3HJKA

2.0 angstrom structure of the ile74val variant of vivid (vvd).
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
b'MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALVLCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Mechanism-based tuning of a LOV domain photoreceptor.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 38
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hjkA00
2OWJA 4HHDA 4PKYA 2JHEA 1GSXA 2L1MA 2QWSA 4HH2A 3F1OB 3B33A 1T19A 2HV1A 4XT2B 1MZUA 3OLOA 3KX0X 4DJ2A 3A0RA 2V1BA 4GHIA 3GDIA 2I9VA 4RQ9A 3MQOA 2V9AA 2PDRA 1D7EA 4NXFA 1KOUA 4JGOA 1XJ3A 3PHYA 1OTIA 1XFQA 1DP8A 5G4YA 5HSQA 4F3LB 2QKPA 2VV6A 3MR0A 4WLAA 4WF0A 4HP9A 4WN5A 1G28A 3F1NA 2J80A 4EERA 1V9YA 2ZOIA 1NWZA 1T1AA 5J4EA 1LSXA 2VV7A 3H9WA 4KUOA 3LUQA 3LIFA 2KX6A 5TBMB 5DKKA 5DJTA 4I5SA 4NXBA 4L9GA 1WA9A 2INWA 3IS2B 2L0WA 4I3AA 4JGRA 1T1BA 3LI9A 3K3DA 1N9OA 1XFNA 2PD7A 2PD8A 1VB6A 3UE6A 3LIBA 1N9NA 4GS9B 3E4PA 4BBTA 4HI4A 1LSWA 4EESA 3NOUC 4HJ3A 4HOIA 3UB7A 1XJ6A 5F68A 5IU1A 5KIZA 4LRYC 4F3LA 4R3AA 5A8BA 5HWTA 4HY8A 4M4XA 2WKQA 3UMEA 2WKRA 2V1AA 3LIDA 2V0UA 2R78A 5HDDA 1DP6A 3K3CA 2QJ5A 1P97A 1P0ZA 4I38A 2PR5A 5HD3A 5I5LA 2D01A 2OOLA 3HJIA 3LI8A 2W27A 2Z6CA 4NXEA 5IS1A 4MN6A 5AVEA 4HQAA 4I3IA 1S4RA 3BWLA 3UB9A 1N9LA 1X0OA 2YKFA 4WUJA 3F1PA 4GW9A 2QHKA 2M1CA 2Z6DA 4BBUA 5F69A 2K7SA 5DJUA 1OT9A 4HIAA 5F6AA 4HNBA 4EXOA 4GS9A 3MFXA 2BASA 5F5YA 3MJQA 4BBVA 3H7WA 2L4RA 1T18A 1BYWA 2V0WA 1TS0A 5HWWA 5DKLA 2PR6A 5HD5A 1DP9A 1S1YA 5HDSA 4H6JA 1JNUA 4E04A 4EW7A 3RH8B 4GHIB 3NJAA 4LLOB 1S66L 5HWVA 1GSVA 3ICYA 3BY9A 3F1OA 4KQDA 4KUKA 4XT2A 3RTYA 3ULFA 1OJGA 1GSWA 4PKYG 2B02A 3LICA 4JGPA 1OT6A 4EEUA 2OWHA 2KDKA 1S1ZA 4HJ4A 1F9IA 1EW0A 3P7NA 4B9OA 3LYXA 3F1NB 3G6OA 4DJ3A 4I3JA 4LRZE 1OTBA 1LL8A 1T1CA 3CLOA 1TS6A 4GCZA 2PYPA 1OTEA 3UMDA 2A24B 2W0NA 3H82B 3A0SA 1OTDA 1OTAA 3CWFA 1UWPX 3E4QA 1UWNX 3IBRA 5TBMA 2D02A 3HJKA 5HDCA 1ODVA 2VLGA 1S67L 4MN5A 3IS2A 3MXQA 3SW1A 3C2WA 3EEHA 4I39A 1TS8A 1S4SA 1F98A 2H28A 1TS7A 5J3WA 3D72A 4LRXC 4EQ1A 3BY8A 4JGQA 5HZHA 3VE4A 1OJ5A 1LSVA 3FG8A 4K08A 3NOPC 4L9FA 2P7JA 4HP4A 3PYPA 2QJ7A 3ZQ5A 3NOTC 2ZBBA 4R70A 1DRMA 5AVFA 3UB6A 5G4ZA 4NXGA 2GJ3A 3MQQA 3VOLA 3T50A 2YKHA 3LIEA 2A24A 1V9ZA 2VEAA 3H82A 3GECA 5J7EA 3F1PB 3NHQA 1XJ4A 2CMNA 1Y28A 5EFWA 3VE3A 2PYRA 3FC7A 4EEPA 4LPZA 2PHYA 3LIAA 2VV8A 4R6LA 1XJ2A 2EA9A 3UB8A 2JN7A 3H7WB 4YWZA 3E4OA 4WL9A 2WKPA 4R38A 4EETB 4L9EA 3CAXA 3A0VA 3C8CA 4HJ6A 1UGUA 3EWKA 1LT0A 4HH3A 2ZOHA 4H6JB 1D06A
chains in the Genus database with same CATH superfamily
3GVBA 5HPFA 2OWJA 1GA9A 4PKYA 1NZOA 1GSXA 3HLWA 1PW1A 2VZWA 1MKIA 2P08A 4MBFA 4XT2B 2JKRM 4S2OA 3OCNA 2ZQ9A 3GDIA 4BJPA 2PBDP 4HESA 1YT4A 3MSHA 4UHUA 1KVMA 5DTTA 4YINA 1QMEA 4JGOA 2O9BA 3S4XA 1IYSA 2RL3A 2ZL1B 1OTIA 1XFQA 3OZHA 4KZAA 1ZHHB 2EX2A 4YFMA 3UE3A 5HSQA 4F3LB 4E3LA 4ETZA 2FZ0A 1CEGA 3MR0A 1ES3A 3KSGA 1PFLA 4WF0A 4Y2FA 2X71A 4MNRA 3IF6C 3F1NA 4EV4A 4S2JA 5J4EA 1LSXA 1PIOA 4L0LA 3IF5A 4M3KA 2GX5A 3NDGA 3WS5A 1JTGA 2VA0A 3FWLA 1HZOA 5AQ9A 2ZQ7A 4BD1A 5DKKA 3IX3A 4I5SA 1IELA 5I94A 2WUQA 1VQQA 3BLSA 3ZGAB 1E3UA 2ZC4B 3T4LA 4JGRA 1T1BA 1FQGA 2XK1A 3S7PA 5EVIA 1KE0A 5EM1A 3ZNYA 2PD7A 2PD8A 4BLMA 1VB6A 3UE6A 3OPHA 2JC7A 1I2SA 3LY3A 1K38A 4MMNA 4EUZA 4LV3A 4BBTA 4MEZA 3AGFA 2GNXA 4KZ5A 3NOUC 3W4OA 5FI2A 3UB7A 5CEDA 1CI8A 5F68A 5KIZA 3OPPA 4F3LA 4MLLA 4R3AA 1GCEA 5CTNA 2WKQA 2V2FF 1W7FA 3ZG8B 5E2GA 2EX9A 2IA2A 3WS0A 2R78A 3VP1A 4MN7A 1K6SA 3K3CA 3SH9A 4IVIA 4Q0HA 5GHXA 3S7NA 4GKUA 1P0ZA 2PR5A 4X1LA 5I5LA 5FQIA 3HJIA 3LI8A 2HF6A 1ES2A 2W27A 2XQZA 3IXGA 4OQIA 1K4FA 5IS1A 3OC2A 5FA7A 1YSQA 5A90A 2ZC6B 1S4RA 3IH9A 3BWLA 3UB9A 3O5YA 3UY6A 4X6TA 5HL1A 3F1PA 3BM6A 5BOHA 2WKIA 3M6BA 3GV9A 3O87A 3VP0A 2Z6DA 3CUEA 3OCLA 3FZCA 4WM9A 1MPLA 4PM8A 5FEGA 3V3RA 1SKFA 4S2MA 4HNBA 4Y15A 3MJQA 2Z2LB 1PWCA 4PM9A 5DVAA 1LHYA 2ZM2A 4R3JA 3GR2A 2Y55A 4QY6A 1TS0A 3R7WB 2PR6A 4DDSA 3VMAA 1DP9A 4Z1WA 5HDSA 2EX8A 1JNUA 1G6AA 1M40A 4OPQA 1IYQA 4Y0OA 4E04A 3Q7VB 1W79A 1I2WA 5FDSA 4GHIB 5TJJA 4A5RA 2B18A 3DTEA 4OQHA 4O01A 4OP5A 1S66L 3DWKA 3OPLA 2QZ6A 4KUKA 3RTYA 4MBKA 4OP8A 4YOFA 2Y2MA 3VFHA 2Z2MB 1G68A 2VJWA 2H0TA 3LICA 4JGPA 4R1GA 3DTKA 3T1XA 3EQUA 1S1ZA 1VEUB 1FILA 1QMFA 2P9VA 4FSFA 1F9IA 3P7NA 4B9OA 5HPIA 5L8MA 2EWVA 4UA7A 2W1RA 4Q0IA 1G5UA 1SDNA 4QB8A 4ZAMA 3UNWA 3UPNA 4WMCA 1OTBA 1EWZA 2K2NA 1T1CA 4R3BA 3BFDA 3CLOA 4DE3A 4BMWA 4DDYA 2Y2GA 3TOIA 5CRFA 1ZC2A 1YLJA 2V8FA 3A0SA 1KDWA 3VP4A 3CWFA 3W2ZA 1UWPX 4DKIA 1W8QA 4CPKA 5L09A 3IBRA 5TBMA 1K0KA 2D02A 2OV5A 5TGFA 5HDCA 2DCFA 5E2HA 4MN5A 3MXQA 2VX8A 3D3OA 3C2WA 3EEHA 5M1AA 1C3BA 5GLBA 4Y17A 2B95A 1W8YA 3ITAA 1F98A 2H28A 3C30A 3HLBA 2M7VA 2G2UA 2JKTI 5CHJA 4IVKA 2JE5A 3LY4A 1VETB 3VE4A 3E2KA 1LSVA 1K25A 2MJ6A 3QNCA 1PRQA 3VSKA 4E6XA 3ZG9B 2X01A 1ONGA 5FI7A 4LV2A 5FL3A 2WGVA 5F1GA 5A93A 3DTIA 3IH8A 5FQJA 5AVFA 5G4ZA 4BL3A 3MQQA 3RXWA 1VHMA 1ZG6A 5DF7A 3ITBA 1NLYA 3G2YA 5CXWA 2VEAA 3MFDA 1FR6A 5J7EA 1CF0A 4EBPA 1YQSA 2XRNA 1Z09A 5HX9A 2XD1A 1PYYA 1JWVA 4ZJ1A 2Y59A 1KGGA 1TVFA 3MZDA 5EUAA 3AGEA 2PHYA 4KZ4A 2VV8A 4CLCB 3PXPA 4OKPA 3QNBA 3UB8A 5A91A 3H7WB 4S2NC 4FUWA 4BWIA 1AWIA 1KDSA 1D1JA 4RYEA 1TDLA 5EVEA 5CTMA 1IFQA 4S2KA 1LT0A 2XSSA 4GJ4A 5D3OA 4H6JB 4Y5FA 4DF6A 3MMHA 5FQKA 3SH8A 4HHDA 4N9KA 4G3KA 2QWSA 1CI9A 5K5BA 4S2PA 4LFUA 3D4FA 2WADA 3B33A 1T19A 5EVLA 4R23A 4KQQA 1MZUA 3OLOA 4OLDA 1JWPA 3G2ZA 2V1BA 4IHQA 2J9OA 4RA7A 3G31A 3E2LA 5EOOA 1Q2PA 2PDRA 1D7EA 4C6YA 1KOUA 1YMXA 2WGIA 1PWDA 3IXHA 3IWOA 3VV4A 4CQHA 4UA9A 2E8JA 2QKPA 1H0MA 2OSUA 2Y4AA 3BJNA 5CGSA 2UV0E 2GZAA 3NECA 3L9KA 1G28A 1V9YA 4PM6A 1NWZA 1T1AA 2ZC7A 4KUOA 3HL9A 4BENA 4XUXA 4P6ZS 2M7UA 5U47A 4II7A 4GDNA 3VSLA 1O7EA 1Q2QA 4QU3A 4IUHA 3N6IA 4FD8A 3C7UA 3PBRA 2INWA 3IS2B 4E3MA 2L0WA 5FASA 2J3TD 5F83A 3LI9A 3S1YA 3JVVA 5E2FA 2CC1A 2B5RA 1LLBA 3VP2A 3PBSA 2PT7A 2H0YA 1ZG4A 2HP6A 3UDIA 4ME4A 1XFNA 2WKHA 4H8RA 3M2JA 1YKDA 3LIBA 4QHCA 1HLUP 3IQAA 1PI5A 5EV0A 4GS9B 3M6HA 2HGVA 4DE1A 2EFXA 2WZZA 2ZQAA 5EE8A 1SCWA 2ZQ8A 2WAFA 1ZKJA 4JXWA 1XX2A 4ARZA 5IU1A 5DFYA 1H8ZA 4LRYC 1U60A 1FIKA 4UQIS 2V20A 3WS1A 3KYEA 2PU4A 1H3QA 2VGLS 1K54C 5DFXA 2DMWA 2WKRA 2Y2OA 4CLCD 2W3GA 1CQAA 4E6WA 2QMIA 1ERQA 4N9LA 4EUVA 2QJ5A 4RVAA 4DN0A 4E3IA 1TDGA 3O88A 1LI0A 5HD3A 4OONA 2D01A 2OOLA 3LR3A 3DTMA 2Z6CA 4DE2A 2Y2HA 4LV0A 4KQRA 1N9LA 1PNEA 1BLSA 4IUKA 4GW9A 3BEBA 2M1CA 4S2NA 1EI5A 4JXVA 2EFUA 2K7SA 2ZM0A 3ZVWA 4HBTA 4X68A 2RCXA 2WGWA 2VKSA 3EGDC 4G3WA 5F6AA 4EXOA 4S2LA 4GS9A 4O7DA 3ZNTA 2BASA 4BBVA 2Y2LA 2DNSA 4B93A 2L4RA 1FCOA 4NG2A 1T18A 2A49A 4PM5A 2V0WA 5FQ9A 3CPTB 5HWWA 5DKLA 4GDBA 5GL9A 3A3JA 3T4QA 1GHPA 3ZHHA 1K4EA 2XA7S 5HW3A 1YLZA 4EW7A 1P9RA 2NUPC 4BL2A 3MXRA 1FSWA 2WAEA 1K6RA 2Y2QA 2XR0A 3G30A 5HWVA 4YNRA 5TR7A 4XT2A 5AQBA 5AJGA 3T4OA 1OJGA 4JXGA 4KZBA 3TSGA 3LO7A 3BECA 4OQGA 3BQAA 3HLEA 2IWDA 2B02A 2UWXA 4GNUA 1OT6A 2Q9NA 3A3EA 3KSIA 4PHTA 2IWCA 2PU2A 2WYXA 2ZL1A 2J7VA 2HDSA 5AQ7A 3V67A 2FFFB 3ZG7B 3G6OA 2KLIA 2XDMA 4DJ3A 4E3KA 1ONHA 2Y2JA 4LRZE 3QP1A 1LL8A 4JF4A 3KYQA 4EBNA 2Y2KA 5F1FA 3EEAA 3D9YA 4G3VA 1OTAA 3NY4A 4PPRA 3LR5A 3TW8A 1NYYA 1ODVA 2VLGA 2ZD8A 1L0DA 3B42A 2O9AA 4CJNA 1ACFA 1SKOB 3SW1A 4FTXA 4I39A 1E4DA 3C4OA 3N8RA 4DXCA 1S4SA 1TS7A 1KVLA 3D72A 1SDEA 3KO6A 2BG1A 3EQVA 4HBUA 2A3UA 2R9XA 4JKTA 5FSRA 1LI9A 2W3DA 5GLCA 3N8LA 4QPRA 1J9MA 4E3NA 1TF1A 5M18A 3W4PA 5E43A 3W4QA 3RJUA 1K54A 3UO9A 3ZVTA 5EM0A 1CK3A 4KG2A 1K57C 4IJGA 1XKZA 3FV7A 2QJ7A 4FH2A 4WEJA 3UPOA 3HLGA 2JKRI 2ZBBA 4NXGA 2GJ3A 2DRWA 1MY8A 3GRJA 3T50A 3PBTA 4BD0A 3FKVA 1V9ZA 4Z9QA 3GECA 4KENB 4ETXA 4P0MA 3IBJA 1XGJA 4X56A 4ZJ3A 2W1TB 3WS4A 4JBFA 1MKMA 2P74A 5HARA 2CMNA 4OLGA 3P01A 2PYRA 2G2WA 4PMAA 5DF8A 3FYZA 4E3JA 2XFSA 4N1HA 4R6LA 3S22A 3E4OA 2WKPA 4L9EA 5HAQA 2WK0A 4HJ6A 5GLDA 3E0YA 3NBLA 3IWQA 3EWKA 2VGKA 4CLCC 1KE4A 1ALQA 4WELA 4K0XA 3R7WA 4QY5A 1LL5A 3QP5A 2ZMFA 4HH2A 3F1OB 1Y4OA 2HV1A 4NKPA 1L2SA 4DXBA 5G18A 3NCKA 5CX7A 3U2AA 5EECA 3Q7VA 3A3FA 4DJ2A 4GHIA 4EWFA 5J8XA 3ZG5A 3LGOA 2I9VA 3K2NA 1BULA 2ZMVA 1MC0A 2HDQA 3PHYA 4C3QA 5GHYA 3VP3A 3QHYA 5G4YA 5L07A 3BFFA 1MWRA 4KG6A 5KZHA 2VV6A 4HEFA 1XPBA 2XROA 4WLAA 1VEUA 4MBHA 2LB5A 4HP9A 4WN5A 3WRZA 3Q1FA 2J80A 3U4LP 1BLCA 2VV7A 3H9WA 5KSCA 4KG5A 1L0GA 3T12B 2KX6A 3UDFA 4Y3IA 5DJTA 4LCMA 4O8GA 4NXBA 1F5MA 3JVUA 1KE3A 4L9GA 1WA9A 1E25A 4ZRRA 2W3HA 4I3AA 3VOZA 2ZQDA 2HP5A 1BZAA 2VGJA 4NK3A 4CLCE 4X53A 3P98A 4JF5A 1N9OA 3AGDA 3N8SA 3TE8A 4XUZA 2Y2PA 3GMWA 3BW6A 3E4PA 1NY0A 1GA0A 4DMZA 2Y8HA 4R4RA 3CZDA 4D2OA 1RP5A 3G32A 3M2KA 1DY6A 4XXRA 5CGXA 1VETA 1K57A 1XA7A 1XJ6A 1IKGA 2O99A 4BQMA 5HWTA 4HY8A 3C5AA 4LCLA 1GHIA 3B3XA 3HUMA 1M6KA 5CHUA 1N4OA 5HDDA 3IWIA 1DP6A 4GN2A 5HFOA 5FATA 5JYOA 4OPZA 4OVDA 1P97A 3FPVA 4KZ6A 1FR1A 5DF9A 4ZDXA 1HTZA 2EX6A 3L7HA 3C38A 4MN6A 5AVEA 3T4SA 4HQAA 5F82A 3QP2A 3RFBA 2YKFA 2W3EA 1PZOA 2OAP1 3V50A 2IWBA 1WYBA 5EPHA 2Y2NA 1MWUA 4WZ4A 2QHKA 1F2KA 1KGFA 4EU0A 4GZBA 4OQ0A 4B88A 3SS4A 1NLZA 1PW8A 4LENA 5IT5A 5CGWA 4Q8IA 4X55A 4KZ7A 2KOIA 3BFGA 4ZBEA 1L0EA 4RX2A 3MFXA 4UA6A 1RCJA 4CLCA 3WWXA 4E3OA 1W5DA 2XF3A 3H7WA 4MCWA 4GD8A 3IX4A 2HDUA 1NJ4A 4DRTA 5FAOA 1YPRA 5FDHA 3HLDA 3DAVA 1S1YA 4H6JA 4OPRA 3MS6A 4K0WA 2Y91A 2GDNA 3RH8B 4GLQA 3GQZA 4ZTKA 2XFTA 3KYZA 4KZ3A 1W63M 3NJAA 4LLOB 3ICYA 3BY9A 4KQDA 5GHZA 3T1SA 2JCHA 4X1MA 1GSWA 3HLCA 3MXSA 4NEED 4X25A 3HBRA 4EEUA 1Z6FA 3G34A 3NC8A 3UB5P 2OWHA 2HZ5A 1I5QA 3WRTA 1K55C 1BT5A 1PZPA 2ZQCA 3F1NB 1K56D 3RXXA 3T4TA 3HLFA 2PAVP 4QD4A 4I3JA 3SS3A 1STZA 1ESIA 3QP8A 3EGXC 4D60A 2J9PA 3S7OA 4PAUA 3ZDJA 4Y0UA 1OTEA 1WYCA 3S7QA 3UMDA 4R0QA 1OTDA 2ZLYA 5EVIB 1FOFA 3HJKA 2ZMAA 3O3VA 2I72A 1XP4A 3C4PA 3MZEA 3T4JA 3JYIA 3NULA 2HJEA 2LB9A 2ZC5B 4EQIA 3UDXA 3IS2A 2FFYA 4IEDA 3HREA 5M19A 1W63Q 4KZ8A 4FCFA 2C6WB 5FAQA 4EQ1A 1BLHA 3BY8A 3W8KA 3A3DA 5CEBA 4K08A 2VK3A 2K31A 3R4KA 4K91A 2EXAA 4L9FA 4LV1A 3MQ0A 3PYPA 1BSGA 2WKEA 5FQMA 3TG9A 3IT9A 1YLYA 1DRMA 1YLTA 3UB6A 4F94A 1RGYA 3FPWA 5HAPA 2R9WA 4OOLA 3LR4A 3MKEA 3OBFA 1XA1A 4R4SA 3BYDA 3PBQA 3MBZA 3DWZA 1FCMA 3UPPA 3BRMA 1ES4A 5JYPA 1G6OA 3F1PB 4P85A 1XJ4A 3LR0A 1Y28A 2Y79A 5EFWA 3B47A 3UE1A 2HJ9C 5A92A 3T4KA 2O0YA 4EEPA 4U0TA 2XGNA 1MWTA 3N7WA 4DE0A 3PR6A 2EA9A 1ESUA 2JN7A 4YWZA 2JKTM 4Q0JA 4WL9A 2J8YA 1YAXA 5DTKA 3G35A 3C8CA 3OOVA 2EXBA 3CJMA 4HH3A 2ZOHA 4JF6A 5AQAA 3CG5A 3V5MA 1DJBA 1H8YA 2PBYA 3CPTA 4GB7A 4B4XA 3N4IA 4FOFA 2JHEA 3LEZA 2ZM8A 2L1MA 3ISGA 1ERMA 1NXYA 3SH7A 4RX3A 3JPUA 1H8MA 3KX0X 5L2FA 1MBLA 3A0RA 1EROA 1NYMA 3PAGA 4B4ZA 3PTEA 4RQ9A 3MQOA 1E3UD 5HAIA 2V9AA 4NXFA 1K55A 5EVID 3IF6B 1XJ3A 5FAPA 3HVFA 2P9VB 4GOGA 4WZ5A 1DP8A 2FH5A 1ZTUA 3LEQA 4X69A 3QP4A 5MC7A 4EERA 2ZOIA 1XGIA 3GTCA 1IYOA 1CJFA 3LUQA 3P09A 1YSPA 3LIFA 3NDEA 3CHWP 5TBMB 1TD5A 4OOYA 5L10A 2J3TC 3BLMA 1AXBA 2H5SA 3K3DA 4S2IA 1DJAA 4NETA 4ESPA 5KSHA 4KZ9A 5E2EA 1SKOA 4Y0TA 5C5KA 1N9NA 2HP9A 4C75A 1WE4A 1IYPA 1ES5A 1Y54A 1N9BA 4QWOA 3MF0A 4HI4A 1LSWA 1OMEA 4EESA 1NZUA 4HJ3A 1PI4A 3BFCA 3IF6A 3Q07A 4HOIA 1S6RA 3WS2A 1GHMA 1P9WA 4Y13A 3LFVA 5A8BA 1JVJA 1YLPA 4M4XA 1KGEA 3UMEA 2V1AA 3LIDA 2V0UA 3KSHA 4N1XA 3TRCA 3OPRA 2ZC3B 2HDRA 4JXSA 4OPYA 4I38A 5FEFA 4UEYA 1RGZA 1BLPA 4WBGA 3C7VA 2V8CA 4ID4A 3T1QB 2X02A 1PWGA 2XEPA 4NXEA 3IHAA 2QYBA 4LGWA 4I3IA 3FKWA 3QP6A 2QPNA 1X0OA 2W1TA 4Y7PA 4WUJA 3EOIA 3BFEA 4BBUA 2PRFA 4OOMA 1CEFA 2W3FA 3LCEA 5F69A 3SZTA 5CERA 2V1ZA 2H10A 5DJUA 1OT9A 4HIAA 4PM7A 5DTSA 2E8IA 3UE0A 5F5YA 3NI9A 2EWWA 3ZCZA 4UAAA 1BYWA 2Q0OA 2ACGA 4WMCD 5HD5A 5HL6A 2C5WB 3DW0A 4P6BA 1YLWA 2A2LA 5CHMA 1L0FA 5LBRA 3PAEA 3G4PA 3I7JA 1GSVA 1MXOA 3F1OA 2OLUA 1DJCA 1TEMA 2OAQ1 3ULFA 1NRJA 3T1RA 4PKYG 1H5XA 5IHVA 3V3SA 4MDZA 1O07A 1IOUA 3BQ8A 1XXMA 3VOYA 3V39A 2KDKA 2JKGA 2BTFP 4HJ4A 3MZFA 1EW0A 2J3WA 3LYXA 2NUTC 1L3LA 3NIAA 4ZJ2A 4P6ZM 5TFQA 1BTLA 1TS6A 4GCZA 2AVXA 2PYPA 3CMZA 2BLSA 2A24B 2W0NA 3PBOA 3H82B 1LL9A 2ZJ9A 4U0XA 2OLVA 1J3WA 3E4QA 1UWNX 1YM1A 5KMWA 1IEMA 1SZVA 1S67L 5FI6A 4JPMA 3SOIA 3GSGA 5EOEA 3MKFA 3IX8A 4U3TA 1TS8A 4N92A 1FCNA 5J3WA 5EVIC 1OPXA 2Y2IA 4LRXC 3O86A 1K56A 2WZXA 1JWZA 3Q7ZA 2XD5A 4JGQA 4JLFA 3VFFA 3ZG0A 5HZHA 1OJ5A 4P87A 3FG8A 4ARZB 4KQOA 4UQIM 4WYYA 3NOPC 1BUEA 3E98A 2P7JA 2VGLM 4GD6A 3UN7A 4WEKA 2G7UA 4HP4A 4FH4A 4QJGA 5FQQA 3ZQ5A 2JKFA 3NOTC 1MWSA 3HUOA 4R70A 1A0KA 3IXBA 3VOLA 4O0PA 4IBRA 3CI6A 2YKHA 3SS5A 1IKIA 3LIEA 1S0WA 3IXDA 2O9CA 2A24A 3CITA 3H82A 3IHBA 5CECA 1YMSA 3NHQA 1FSYA 4EBLA 3VE3A 4AFIA 2XH9A 3TJZC 1HD8A 1JTDA 3KSFA 3FC7A 1VM1A 3HUNA 2WGWB 4LPZA 3Q82A 4WZ5C 3HCYA 2HPBA 3LIAA 2P04A 3ZFZA 1XJ2A 2Q9MA 1NRFA 2JBFA 3CUEC 2XLNA 3Q81A 4OH0A 3DBAA 4R38A 4EETB 3CAXA 3A0VA 1SHVA 3PBNA 1UGUA 4IBXA 3ZYTA 3A3IA 5GLAA 1HVBA 2XA7M 1D06A
chains in the Genus database with same CATH topology
4WELA 5HPFA 3MMHA 2OWJA 4HHDA 4PKYA 3R7WA 4FOFA 2JHEA 1GSXA 4G3KA 2L1MA 2QWSA 5K5BA 2VZWA 2ZMFA 4HH2A 3F1OB 2P08A 3B33A 1T19A 2HV1A 4NKPA 5CX7A 4XT2B 3U2AA 1MZUA 2JKRM 1H8MA 3OLOA 3KX0X 4DJ2A 3A0RA 3OCNA 2V1BA 4GHIA 3GDIA 4BJPA 2I9VA 3K2NA 4IHQA 4RQ9A 3MQOA 2V9AA 2PDRA 1D7EA 4NXFA 1KOUA 4JGOA 2ZMVA 1XJ3A 2O9BA 1MC0A 3PHYA 1OTIA 1XFQA 3VV4A 1ZHHB 1DP8A 5G4YA 2FH5A 4CQHA 1ZTUA 3UE3A 5HSQA 4F3LB 2QKPA 4ETZA 2FZ0A 2VV6A 3MR0A 2XROA 4WLAA 3BJNA 3KSGA 2GZAA 4WF0A 4Y2FA 2LB5A 4HP9A 4WN5A 1G28A 3F1NA 5MC7A 2J80A 4EERA 1V9YA 2ZOIA 1NWZA 1T1AA 5J4EA 1LSXA 2VV7A 4L0LA 3H9WA 4KUOA 2GX5A 3LUQA 1YSPA 4P6ZS 3LIFA 2M7UA 4II7A 2VA0A 2KX6A 5TBMB 1TD5A 5DKKA 4IUHA 4Y3IA 5DJTA 4O8GA 4I5SA 4NXBA 2J3TC 1F5MA 3JVUA 3PBRA 4L9GA 1WA9A 2INWA 3IS2B 2L0WA 4ZRRA 2W3HA 4I3AA 3T4LA 2J3TD 4JGRA 1T1BA 3S7PA 3LI9A 3JVVA 3K3DA 4CLCE 1N9OA 3PBSA 2PT7A 4ME4A 1XFNA 2PD7A 5KSHA 3TE8A 2PD8A 1YKDA 1VB6A 3UE6A 3LIBA 3BW6A 5C5KA 1N9NA 4MMNA 4GS9B 3E4PA 4BBTA 3MF0A 2HGVA 4DMZA 2Y8HA 1LSWA 4HI4A 4EESA 2GNXA 3NOUC 4HJ3A 4HOIA 3UB7A 1XJ6A 5F68A 4ARZA 5IU1A 5KIZA 1P9WA 5DFYA 4LRYC 2O99A 4F3LA 3LFVA 4R3AA 4UQIS 5A8BA 5HWTA 4HY8A 4M4XA 2WKQA 1H3QA 2VGLS 3UMEA 5DFXA 2IA2A 2WKRA 2DMWA 2V1AA 3LIDA 4CLCD 2V0UA 2R78A 2W3GA 3KSHA 5HDDA 4MN7A 3TRCA 1DP6A 3K3CA 4EUVA 2QJ5A 4Q0HA 3S7NA 4DN0A 1P97A 1P0ZA 3FPVA 4I38A 2PR5A 4UEYA 5HD3A 5I5LA 5DF9A 2D01A 2OOLA 3HJIA 3LI8A 3LR3A 2HF6A 2W27A 2Z6CA 4NXEA 5IS1A 2QYBA 3OC2A 3C38A 4MN6A 5AVEA 3T4SA 1YSQA 4HQAA 4I3IA 1S4RA 3RFBA 3BWLA 3UB9A 1N9LA 3O5YA 1X0OA 2W1TA 2YKFA 2W3EA 4WUJA 3F1PA 2OAP1 4IUKA 3EOIA 4GW9A 2QHKA 2M1CA 2Z6DA 3CUEA 3OCLA 4OOMA 4BBUA 2W3FA 5F69A 2K7SA 4EU0A 1NLZA 2VKSA 3EGDC 5DJUA 5IT5A 1OT9A 2KOIA 4G3WA 4HIAA 5F6AA 4HNBA 4EXOA 4GS9A 3MFXA 4CLCA 2BASA 5F5YA 3MJQA 4BBVA 2EWWA 4MCWA 3H7WA 4B93A 2L4RA 1T18A 1BYWA 2V0WA 1TS0A 5HWWA 5DKLA 3R7WB 2PR6A 3T4QA 5HD5A 1DP9A 1S1YA 5HDSA 4H6JA 5HL6A 4Z1WA 1JNUA 2XA7S 4E04A 4EW7A 1P9RA 2NUPC 2A2LA 3RH8B 4GLQA 4GHIB 5TJJA 2B18A 3KYZA 1W63M 4O01A 3NJAA 5LBRA 4LLOB 1S66L 5HWVA 1GSVA 3ICYA 3BY9A 3F1OA 4KQDA 4YNRA 4KUKA 4XT2A 3RTYA 2OAQ1 4YOFA 1NRJA 3ULFA 5AJGA 3T4OA 1OJGA 3BQAA 2VJWA 1GSWA 4PKYG 2B02A 4MDZA 3LICA 4JGPA 1OT6A 4NEED 1IOUA 3BQ8A 3KSIA 4EEUA 3EQUA 4PHTA 2OWHA 2KDKA 1S1ZA 4HJ4A 4FSFA 1F9IA 1EW0A 3P7NA 4B9OA 5HPIA 2J3WA 2EWVA 5L8MA 3LYXA 2NUTC 2W1RA 4Q0IA 3V67A 3F1NB 3G6OA 2KLIA 3T4TA 4DJ3A 4I3JA 4LRZE 1OTBA 4P6ZM 2K2NA 1LL8A 1STZA 3KYQA 1T1CA 3CLOA 3EGXC 4BMWA 1TS6A 4GCZA 2PYPA 4PAUA 3S7OA 3EEAA 1OTEA 3S7QA 3UMDA 2A24B 2W0NA 3PBOA 4G3VA 3H82B 3A0SA 1OTDA 1OTAA 3CWFA 3W2ZA 1UWPX 3E4QA 1UWNX 3LR5A 3IBRA 5TBMA 2D02A 3TW8A 3HJKA 5HDCA 1ODVA 2VLGA 1S67L 3T4JA 3B42A 4MN5A 2HJEA 2LB9A 2O9AA 3IS2A 3MXQA 2VX8A 3D3OA 3SW1A 3C2WA 3EEHA 4I39A 1W63Q 1TS8A 1S4SA 1F98A 2H28A 1TS7A 3C30A 5J3WA 1OPXA 3D72A 2M7VA 4LRXC 3KO6A 3EQVA 2JKTI 4EQ1A 3BY8A 4JGQA 5HZHA 3VE4A 1OJ5A 2W3DA 1LSVA 4QPRA 4Y5FA 3FG8A 4ARZB 1TF1A 2MJ6A 4K08A 2K31A 4KQOA 3R4KA 4UQIM 3NOPC 4L9FA 3E98A 2P7JA 2VGLM 3MQ0A 4WEKA 2G7UA 5FL3A 4HP4A 3PYPA 4IJGA 2QJ7A 3ZQ5A 3NOTC 4WEJA 2JKRI 2ZBBA 4R70A 1DRMA 5AVFA 3UB6A 5G4ZA 4NXGA 2GJ3A 3FPWA 3MQQA 3VOLA 4O0PA 4OOLA 1VHMA 3LR4A 3CI6A 3T50A 2YKHA 3LIEA 1NLYA 3OBFA 2O9CA 3PBTA 2A24A 1V9ZA 2VEAA 3CITA 3H82A 3PBQA 3GECA 4ETXA 5J7EA 3IBJA 2W1TB 1MKMA 1G6OA 2XRNA 3F1PB 3NHQA 1XJ4A 2CMNA 3LR0A 1Y28A 2Y79A 3P01A 5EFWA 3VE3A 3B47A 4AFIA 3TJZC 2PYRA 3KSFA 2HJ9C 3FC7A 3T4KA 2O0YA 4EEPA 4LPZA 3HCYA 2PHYA 3LIAA 2P04A 2VV8A 4CLCB 4R6LA 3PXPA 1XJ2A 3PR6A 2EA9A 3UB8A 2JN7A 3H7WB 3CUEC 4YWZA 2JKTM 3E4OA 4Q0JA 4WL9A 2WKPA 4BWIA 3DBAA 4R38A 4EETB 4L9EA 1YAXA 3CAXA 3A0VA 1IFQA 3C8CA 3PBNA 4HJ6A 3OOVA 1UGUA 3E0YA 3ZYTA 3EWKA 1LT0A 2XSSA 4GJ4A 4HH3A 2ZOHA 4CLCC 4H6JB 2XA7M 1D06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWJ A;  4HHD A;  4PKY A;  2JHE A;  1GSX A;  2L1M A;  2QWS A;  4HH2 A;  3F1O B;  3B33 A;  1T19 A;  2HV1 A;  4XT2 B;  1MZU A;  3OLO A;  3KX0 X;  4DJ2 A;  3A0R A;  2V1B A;  4GHI A;  3GDI A;  2I9V A;  4RQ9 A;  3MQO A;  2V9A A;  2PDR A;  1D7E A;  4NXF A;  1KOU A;  4JGO A;  1XJ3 A;  3PHY A;  1OTI A;  1XFQ A;  1DP8 A;  5G4Y A;  5HSQ A;  4F3L B;  2QKP A;  2VV6 A;  3MR0 A;  4WLA A;  4WF0 A;  4HP9 A;  4WN5 A;  1G28 A;  3F1N A;  2J80 A;  4EER A;  1V9Y A;  2ZOI A;  1NWZ A;  1T1A A;  5J4E A;  1LSX A;  2VV7 A;  3H9W A;  4KUO A;  3LUQ A;  3LIF A;  2KX6 A;  5TBM B;  5DKK A;  5DJT A;  4I5S A;  4NXB A;  4L9G A;  1WA9 A;  2INW A;  3IS2 B;  2L0W A;  4I3A A;  4JGR A;  1T1B A;  3LI9 A;  3K3D A;  1N9O A;  1XFN A;  2PD7 A;  2PD8 A;  1VB6 A;  3UE6 A;  3LIB A;  1N9N A;  4GS9 B;  3E4P A;  4BBT A;  4HI4 A;  1LSW A;  4EES A;  3NOU C;  4HJ3 A;  4HOI A;  3UB7 A;  1XJ6 A;  5F68 A;  5IU1 A;  5KIZ A;  4LRY C;  4F3L A;  4R3A A;  5A8B A;  5HWT A;  4HY8 A;  4M4X A;  2WKQ A;  3UME A;  2WKR A;  2V1A A;  3LID A;  2V0U A;  2R78 A;  5HDD A;  1DP6 A;  3K3C A;  2QJ5 A;  1P97 A;  1P0Z A;  4I38 A;  2PR5 A;  5HD3 A;  5I5L A;  2D01 A;  2OOL A;  3HJI A;  3LI8 A;  2W27 A;  2Z6C A;  4NXE A;  5IS1 A;  4MN6 A;  5AVE A;  4HQA A;  4I3I A;  1S4R A;  3BWL A;  3UB9 A;  1N9L A;  1X0O A;  2YKF A;  4WUJ A;  3F1P A;  4GW9 A;  2QHK A;  2M1C A;  2Z6D A;  4BBU A;  5F69 A;  2K7S A;  5DJU A;  1OT9 A;  4HIA A;  5F6A A;  4HNB A;  4EXO A;  4GS9 A;  3MFX A;  2BAS A;  5F5Y A;  3MJQ A;  4BBV A;  3H7W A;  2L4R A;  1T18 A;  1BYW A;  2V0W A;  1TS0 A;  5HWW A;  5DKL A;  2PR6 A;  5HD5 A;  1DP9 A;  1S1Y A;  5HDS A;  4H6J A;  1JNU A;  4E04 A;  4EW7 A;  3RH8 B;  4GHI B;  3NJA A;  4LLO B;  1S66 L;  5HWV A;  1GSV A;  3ICY A;  3BY9 A;  3F1O A;  4KQD A;  4KUK A;  4XT2 A;  3RTY A;  3ULF A;  1OJG A;  1GSW A;  4PKY G;  2B02 A;  3LIC A;  4JGP A;  1OT6 A;  4EEU A;  2OWH A;  2KDK A;  1S1Z A;  4HJ4 A;  1F9I A;  1EW0 A;  3P7N A;  4B9O A;  3LYX A;  3F1N B;  3G6O A;  4DJ3 A;  4I3J A;  4LRZ E;  1OTB A;  1LL8 A;  1T1C A;  3CLO A;  1TS6 A;  4GCZ A;  2PYP A;  1OTE A;  3UMD A;  2A24 B;  2W0N A;  3H82 B;  3A0S A;  1OTD A;  1OTA A;  3CWF A;  1UWP X;  3E4Q A;  1UWN X;  3IBR A;  5TBM A;  2D02 A;  3HJK A;  5HDC A;  1ODV A;  2VLG A;  1S67 L;  4MN5 A;  3IS2 A;  3MXQ A;  3SW1 A;  3C2W A;  3EEH A;  4I39 A;  1TS8 A;  1S4S A;  1F98 A;  2H28 A;  1TS7 A;  5J3W A;  3D72 A;  4LRX C;  4EQ1 A;  3BY8 A;  4JGQ A;  5HZH A;  3VE4 A;  1OJ5 A;  1LSV A;  3FG8 A;  4K08 A;  3NOP C;  4L9F A;  2P7J A;  4HP4 A;  3PYP A;  2QJ7 A;  3ZQ5 A;  3NOT C;  2ZBB A;  4R70 A;  1DRM A;  5AVF A;  3UB6 A;  5G4Z A;  4NXG A;  2GJ3 A;  3MQQ A;  3VOL A;  3T50 A;  2YKH A;  3LIE A;  2A24 A;  1V9Z A;  2VEA A;  3H82 A;  3GEC A;  5J7E A;  3F1P B;  3NHQ A;  1XJ4 A;  2CMN A;  1Y28 A;  5EFW A;  3VE3 A;  2PYR A;  3FC7 A;  4EEP A;  4LPZ A;  2PHY A;  3LIA A;  2VV8 A;  4R6L A;  1XJ2 A;  2EA9 A;  3UB8 A;  2JN7 A;  3H7W B;  4YWZ A;  3E4O A;  4WL9 A;  2WKP A;  4R38 A;  4EET B;  4L9E A;  3CAX A;  3A0V A;  3C8C A;  4HJ6 A;  1UGU A;  3EWK A;  1LT0 A;  4HH3 A;  2ZOH A;  4H6J B;  1D06 A; 
#chains in the Genus database with same CATH topology
 3GVB A;  5HPF A;  2OWJ A;  1GA9 A;  4PKY A;  1NZO A;  1GSX A;  3HLW A;  1PW1 A;  2VZW A;  1MKI A;  2P08 A;  4MBF A;  4XT2 B;  2JKR M;  4S2O A;  3OCN A;  2ZQ9 A;  3GDI A;  4BJP A;  2PBD P;  4HES A;  1YT4 A;  3MSH A;  4UHU A;  1KVM A;  5DTT A;  4YIN A;  1QME A;  4JGO A;  2O9B A;  3S4X A;  1IYS A;  2RL3 A;  2ZL1 B;  1OTI A;  1XFQ A;  3OZH A;  4KZA A;  1ZHH B;  2EX2 A;  4YFM A;  3UE3 A;  5HSQ A;  4F3L B;  4E3L A;  4ETZ A;  2FZ0 A;  1CEG A;  3MR0 A;  1ES3 A;  3KSG A;  1PFL A;  4WF0 A;  4Y2F A;  2X71 A;  4MNR A;  3IF6 C;  3F1N A;  4EV4 A;  4S2J A;  5J4E A;  1LSX A;  1PIO A;  4L0L A;  3IF5 A;  4M3K A;  2GX5 A;  3NDG A;  3WS5 A;  1JTG A;  2VA0 A;  3FWL A;  1HZO A;  5AQ9 A;  2ZQ7 A;  4BD1 A;  5DKK A;  3IX3 A;  4I5S A;  1IEL A;  5I94 A;  2WUQ A;  1VQQ A;  3BLS A;  3ZGA B;  1E3U A;  2ZC4 B;  3T4L A;  4JGR A;  1T1B A;  1FQG A;  2XK1 A;  3S7P A;  5EVI A;  1KE0 A;  5EM1 A;  3ZNY A;  2PD7 A;  2PD8 A;  4BLM A;  1VB6 A;  3UE6 A;  3OPH A;  2JC7 A;  1I2S A;  3LY3 A;  1K38 A;  4MMN A;  4EUZ A;  4LV3 A;  4BBT A;  4MEZ A;  3AGF A;  2GNX A;  4KZ5 A;  3NOU C;  3W4O A;  5FI2 A;  3UB7 A;  5CED A;  1CI8 A;  5F68 A;  5KIZ A;  3OPP A;  4F3L A;  4MLL A;  4R3A A;  1GCE A;  5CTN A;  2WKQ A;  2V2F F;  1W7F A;  3ZG8 B;  5E2G A;  2EX9 A;  2IA2 A;  3WS0 A;  2R78 A;  3VP1 A;  4MN7 A;  1K6S A;  3K3C A;  3SH9 A;  4IVI A;  4Q0H A;  5GHX A;  3S7N A;  4GKU A;  1P0Z A;  2PR5 A;  4X1L A;  5I5L A;  5FQI A;  3HJI A;  3LI8 A;  2HF6 A;  1ES2 A;  2W27 A;  2XQZ A;  3IXG A;  4OQI A;  1K4F A;  5IS1 A;  3OC2 A;  5FA7 A;  1YSQ A;  5A90 A;  2ZC6 B;  1S4R A;  3IH9 A;  3BWL A;  3UB9 A;  3O5Y A;  3UY6 A;  4X6T A;  5HL1 A;  3F1P A;  3BM6 A;  5BOH A;  2WKI A;  3M6B A;  3GV9 A;  3O87 A;  3VP0 A;  2Z6D A;  3CUE A;  3OCL A;  3FZC A;  4WM9 A;  1MPL A;  4PM8 A;  5FEG A;  3V3R A;  1SKF A;  4S2M A;  4HNB A;  4Y15 A;  3MJQ A;  2Z2L B;  1PWC A;  4PM9 A;  5DVA A;  1LHY A;  2ZM2 A;  4R3J A;  3GR2 A;  2Y55 A;  4QY6 A;  1TS0 A;  3R7W B;  2PR6 A;  4DDS A;  3VMA A;  1DP9 A;  4Z1W A;  5HDS A;  2EX8 A;  1JNU A;  1G6A A;  1M40 A;  4OPQ A;  1IYQ A;  4Y0O A;  4E04 A;  3Q7V B;  1W79 A;  1I2W A;  5FDS A;  4GHI B;  5TJJ A;  4A5R A;  2B18 A;  3DTE A;  4OQH A;  4O01 A;  4OP5 A;  1S66 L;  3DWK A;  3OPL A;  2QZ6 A;  4KUK A;  3RTY A;  4MBK A;  4OP8 A;  4YOF A;  2Y2M A;  3VFH A;  2Z2M B;  1G68 A;  2VJW A;  2H0T A;  3LIC A;  4JGP A;  4R1G A;  3DTK A;  3T1X A;  3EQU A;  1S1Z A;  1VEU B;  1FIL A;  1QMF A;  2P9V A;  4FSF A;  1F9I A;  3P7N A;  4B9O A;  5HPI A;  5L8M A;  2EWV A;  4UA7 A;  2W1R A;  4Q0I A;  1G5U A;  1SDN A;  4QB8 A;  4ZAM A;  3UNW A;  3UPN A;  4WMC A;  1OTB A;  1EWZ A;  2K2N A;  1T1C A;  4R3B A;  3BFD A;  3CLO A;  4DE3 A;  4BMW A;  4DDY A;  2Y2G A;  3TOI A;  5CRF A;  1ZC2 A;  1YLJ A;  2V8F A;  3A0S A;  1KDW A;  3VP4 A;  3CWF A;  3W2Z A;  1UWP X;  4DKI A;  1W8Q A;  4CPK A;  5L09 A;  3IBR A;  5TBM A;  1K0K A;  2D02 A;  2OV5 A;  5TGF A;  5HDC A;  2DCF A;  5E2H A;  4MN5 A;  3MXQ A;  2VX8 A;  3D3O A;  3C2W A;  3EEH A;  5M1A A;  1C3B A;  5GLB A;  4Y17 A;  2B95 A;  1W8Y A;  3ITA A;  1F98 A;  2H28 A;  3C30 A;  3HLB A;  2M7V A;  2G2U A;  2JKT I;  5CHJ A;  4IVK A;  2JE5 A;  3LY4 A;  1VET B;  3VE4 A;  3E2K A;  1LSV A;  1K25 A;  2MJ6 A;  3QNC A;  1PRQ A;  3VSK A;  4E6X A;  3ZG9 B;  2X01 A;  1ONG A;  5FI7 A;  4LV2 A;  5FL3 A;  2WGV A;  5F1G A;  5A93 A;  3DTI A;  3IH8 A;  5FQJ A;  5AVF A;  5G4Z A;  4BL3 A;  3MQQ A;  3RXW A;  1VHM A;  1ZG6 A;  5DF7 A;  3ITB A;  1NLY A;  3G2Y A;  5CXW A;  2VEA A;  3MFD A;  1FR6 A;  5J7E A;  1CF0 A;  4EBP A;  1YQS A;  2XRN A;  1Z09 A;  5HX9 A;  2XD1 A;  1PYY A;  1JWV A;  4ZJ1 A;  2Y59 A;  1KGG A;  1TVF A;  3MZD A;  5EUA A;  3AGE A;  2PHY A;  4KZ4 A;  2VV8 A;  4CLC B;  3PXP A;  4OKP A;  3QNB A;  3UB8 A;  5A91 A;  3H7W B;  4S2N C;  4FUW A;  4BWI A;  1AWI A;  1KDS A;  1D1J A;  4RYE A;  1TDL A;  5EVE A;  5CTM A;  1IFQ A;  4S2K A;  1LT0 A;  2XSS A;  4GJ4 A;  5D3O A;  4H6J B;  4Y5F A;  4DF6 A;  3MMH A;  5FQK A;  3SH8 A;  4HHD A;  4N9K A;  4G3K A;  2QWS A;  1CI9 A;  5K5B A;  4S2P A;  4LFU A;  3D4F A;  2WAD A;  3B33 A;  1T19 A;  5EVL A;  4R23 A;  4KQQ A;  1MZU A;  3OLO A;  4OLD A;  1JWP A;  3G2Z A;  2V1B A;  4IHQ A;  2J9O A;  4RA7 A;  3G31 A;  3E2L A;  5EOO A;  1Q2P A;  2PDR A;  1D7E A;  4C6Y A;  1KOU A;  1YMX A;  2WGI A;  1PWD A;  3IXH A;  3IWO A;  3VV4 A;  4CQH A;  4UA9 A;  2E8J A;  2QKP A;  1H0M A;  2OSU A;  2Y4A A;  3BJN A;  5CGS A;  2UV0 E;  2GZA A;  3NEC A;  3L9K A;  1G28 A;  1V9Y A;  4PM6 A;  1NWZ A;  1T1A A;  2ZC7 A;  4KUO A;  3HL9 A;  4BEN A;  4XUX A;  4P6Z S;  2M7U A;  5U47 A;  4II7 A;  4GDN A;  3VSL A;  1O7E A;  1Q2Q A;  4QU3 A;  4IUH A;  3N6I A;  4FD8 A;  3C7U A;  3PBR A;  2INW A;  3IS2 B;  4E3M A;  2L0W A;  5FAS A;  2J3T D;  5F83 A;  3LI9 A;  3S1Y A;  3JVV A;  5E2F A;  2CC1 A;  2B5R A;  1LLB A;  3VP2 A;  3PBS A;  2PT7 A;  2H0Y A;  1ZG4 A;  2HP6 A;  3UDI A;  4ME4 A;  1XFN A;  2WKH A;  4H8R A;  3M2J A;  1YKD A;  3LIB A;  4QHC A;  1HLU P;  3IQA A;  1PI5 A;  5EV0 A;  4GS9 B;  3M6H A;  2HGV A;  4DE1 A;  2EFX A;  2WZZ A;  2ZQA A;  5EE8 A;  1SCW A;  2ZQ8 A;  2WAF A;  1ZKJ A;  4JXW A;  1XX2 A;  4ARZ A;  5IU1 A;  5DFY A;  1H8Z A;  4LRY C;  1U60 A;  1FIK A;  4UQI S;  2V20 A;  3WS1 A;  3KYE A;  2PU4 A;  1H3Q A;  2VGL S;  1K54 C;  5DFX A;  2DMW A;  2WKR A;  2Y2O A;  4CLC D;  2W3G A;  1CQA A;  4E6W A;  2QMI A;  1ERQ A;  4N9L A;  4EUV A;  2QJ5 A;  4RVA A;  4DN0 A;  4E3I A;  1TDG A;  3O88 A;  1LI0 A;  5HD3 A;  4OON A;  2D01 A;  2OOL A;  3LR3 A;  3DTM A;  2Z6C A;  4DE2 A;  2Y2H A;  4LV0 A;  4KQR A;  1N9L A;  1PNE A;  1BLS A;  4IUK A;  4GW9 A;  3BEB A;  2M1C A;  4S2N A;  1EI5 A;  4JXV A;  2EFU A;  2K7S A;  2ZM0 A;  3ZVW A;  4HBT A;  4X68 A;  2RCX A;  2WGW A;  2VKS A;  3EGD C;  4G3W A;  5F6A A;  4EXO A;  4S2L A;  4GS9 A;  4O7D A;  3ZNT A;  2BAS A;  4BBV A;  2Y2L A;  2DNS A;  4B93 A;  2L4R A;  1FCO A;  4NG2 A;  1T18 A;  2A49 A;  4PM5 A;  2V0W A;  5FQ9 A;  3CPT B;  5HWW A;  5DKL A;  4GDB A;  5GL9 A;  3A3J A;  3T4Q A;  1GHP A;  3ZHH A;  1K4E A;  2XA7 S;  5HW3 A;  1YLZ A;  4EW7 A;  1P9R A;  2NUP C;  4BL2 A;  3MXR A;  1FSW A;  2WAE A;  1K6R A;  2Y2Q A;  2XR0 A;  3G30 A;  5HWV A;  4YNR A;  5TR7 A;  4XT2 A;  5AQB A;  5AJG A;  3T4O A;  1OJG A;  4JXG A;  4KZB A;  3TSG A;  3LO7 A;  3BEC A;  4OQG A;  3BQA A;  3HLE A;  2IWD A;  2B02 A;  2UWX A;  4GNU A;  1OT6 A;  2Q9N A;  3A3E A;  3KSI A;  4PHT A;  2IWC A;  2PU2 A;  2WYX A;  2ZL1 A;  2J7V A;  2HDS A;  5AQ7 A;  3V67 A;  2FFF B;  3ZG7 B;  3G6O A;  2KLI A;  2XDM A;  4DJ3 A;  4E3K A;  1ONH A;  2Y2J A;  4LRZ E;  3QP1 A;  1LL8 A;  4JF4 A;  3KYQ A;  4EBN A;  2Y2K A;  5F1F A;  3EEA A;  3D9Y A;  4G3V A;  1OTA A;  3NY4 A;  4PPR A;  3LR5 A;  3TW8 A;  1NYY A;  1ODV A;  2VLG A;  2ZD8 A;  1L0D A;  3B42 A;  2O9A A;  4CJN A;  1ACF A;  1SKO B;  3SW1 A;  4FTX A;  4I39 A;  1E4D A;  3C4O A;  3N8R A;  4DXC A;  1S4S A;  1TS7 A;  1KVL A;  3D72 A;  1SDE A;  3KO6 A;  2BG1 A;  3EQV A;  4HBU A;  2A3U A;  2R9X A;  4JKT A;  5FSR A;  1LI9 A;  2W3D A;  5GLC A;  3N8L A;  4QPR A;  1J9M A;  4E3N A;  1TF1 A;  5M18 A;  3W4P A;  5E43 A;  3W4Q A;  3RJU A;  1K54 A;  3UO9 A;  3ZVT A;  5EM0 A;  1CK3 A;  4KG2 A;  1K57 C;  4IJG A;  1XKZ A;  3FV7 A;  2QJ7 A;  4FH2 A;  4WEJ A;  3UPO A;  3HLG A;  2JKR I;  2ZBB A;  4NXG A;  2GJ3 A;  2DRW A;  1MY8 A;  3GRJ A;  3T50 A;  3PBT A;  4BD0 A;  3FKV A;  1V9Z A;  4Z9Q A;  3GEC A;  4KEN B;  4ETX A;  4P0M A;  3IBJ A;  1XGJ A;  4X56 A;  4ZJ3 A;  2W1T B;  3WS4 A;  4JBF A;  1MKM A;  2P74 A;  5HAR A;  2CMN A;  4OLG A;  3P01 A;  2PYR A;  2G2W A;  4PMA A;  5DF8 A;  3FYZ A;  4E3J A;  2XFS A;  4N1H A;  4R6L A;  3S22 A;  3E4O A;  2WKP A;  4L9E A;  5HAQ A;  2WK0 A;  4HJ6 A;  5GLD A;  3E0Y A;  3NBL A;  3IWQ A;  3EWK A;  2VGK A;  4CLC C;  1KE4 A;  1ALQ A;  4WEL A;  4K0X A;  3R7W A;  4QY5 A;  1LL5 A;  3QP5 A;  2ZMF A;  4HH2 A;  3F1O B;  1Y4O A;  2HV1 A;  4NKP A;  1L2S A;  4DXB A;  5G18 A;  3NCK A;  5CX7 A;  3U2A A;  5EEC A;  3Q7V A;  3A3F A;  4DJ2 A;  4GHI A;  4EWF A;  5J8X A;  3ZG5 A;  3LGO A;  2I9V A;  3K2N A;  1BUL A;  2ZMV A;  1MC0 A;  2HDQ A;  3PHY A;  4C3Q A;  5GHY A;  3VP3 A;  3QHY A;  5G4Y A;  5L07 A;  3BFF A;  1MWR A;  4KG6 A;  5KZH A;  2VV6 A;  4HEF A;  1XPB A;  2XRO A;  4WLA A;  1VEU A;  4MBH A;  2LB5 A;  4HP9 A;  4WN5 A;  3WRZ A;  3Q1F A;  2J80 A;  3U4L P;  1BLC A;  2VV7 A;  3H9W A;  5KSC A;  4KG5 A;  1L0G A;  3T12 B;  2KX6 A;  3UDF A;  4Y3I A;  5DJT A;  4LCM A;  4O8G A;  4NXB A;  1F5M A;  3JVU A;  1KE3 A;  4L9G A;  1WA9 A;  1E25 A;  4ZRR A;  2W3H A;  4I3A A;  3VOZ A;  2ZQD A;  2HP5 A;  1BZA A;  2VGJ A;  4NK3 A;  4CLC E;  4X53 A;  3P98 A;  4JF5 A;  1N9O A;  3AGD A;  3N8S A;  3TE8 A;  4XUZ A;  2Y2P A;  3GMW A;  3BW6 A;  3E4P A;  1NY0 A;  1GA0 A;  4DMZ A;  2Y8H A;  4R4R A;  3CZD A;  4D2O A;  1RP5 A;  3G32 A;  3M2K A;  1DY6 A;  4XXR A;  5CGX A;  1VET A;  1K57 A;  1XA7 A;  1XJ6 A;  1IKG A;  2O99 A;  4BQM A;  5HWT A;  4HY8 A;  3C5A A;  4LCL A;  1GHI A;  3B3X A;  3HUM A;  1M6K A;  5CHU A;  1N4O A;  5HDD A;  3IWI A;  1DP6 A;  4GN2 A;  5HFO A;  5FAT A;  5JYO A;  4OPZ A;  4OVD A;  1P97 A;  3FPV A;  4KZ6 A;  1FR1 A;  5DF9 A;  4ZDX A;  1HTZ A;  2EX6 A;  3L7H A;  3C38 A;  4MN6 A;  5AVE A;  3T4S A;  4HQA A;  5F82 A;  3QP2 A;  3RFB A;  2YKF A;  2W3E A;  1PZO A;  2OAP 1;  3V50 A;  2IWB A;  1WYB A;  5EPH A;  2Y2N A;  1MWU A;  4WZ4 A;  2QHK A;  1F2K A;  1KGF A;  4EU0 A;  4GZB A;  4OQ0 A;  4B88 A;  3SS4 A;  1NLZ A;  1PW8 A;  4LEN A;  5IT5 A;  5CGW A;  4Q8I A;  4X55 A;  4KZ7 A;  2KOI A;  3BFG A;  4ZBE A;  1L0E A;  4RX2 A;  3MFX A;  4UA6 A;  1RCJ A;  4CLC A;  3WWX A;  4E3O A;  1W5D A;  2XF3 A;  3H7W A;  4MCW A;  4GD8 A;  3IX4 A;  2HDU A;  1NJ4 A;  4DRT A;  5FAO A;  1YPR A;  5FDH A;  3HLD A;  3DAV A;  1S1Y A;  4H6J A;  4OPR A;  3MS6 A;  4K0W A;  2Y91 A;  2GDN A;  3RH8 B;  4GLQ A;  3GQZ A;  4ZTK A;  2XFT A;  3KYZ A;  4KZ3 A;  1W63 M;  3NJA A;  4LLO B;  3ICY A;  3BY9 A;  4KQD A;  5GHZ A;  3T1S A;  2JCH A;  4X1M A;  1GSW A;  3HLC A;  3MXS A;  4NEE D;  4X25 A;  3HBR A;  4EEU A;  1Z6F A;  3G34 A;  3NC8 A;  3UB5 P;  2OWH A;  2HZ5 A;  1I5Q A;  3WRT A;  1K55 C;  1BT5 A;  1PZP A;  2ZQC A;  3F1N B;  1K56 D;  3RXX A;  3T4T A;  3HLF A;  2PAV P;  4QD4 A;  4I3J A;  3SS3 A;  1STZ A;  1ESI A;  3QP8 A;  3EGX C;  4D60 A;  2J9P A;  3S7O A;  4PAU A;  3ZDJ A;  4Y0U A;  1OTE A;  1WYC A;  3S7Q A;  3UMD A;  4R0Q A;  1OTD A;  2ZLY A;  5EVI B;  1FOF A;  3HJK A;  2ZMA A;  3O3V A;  2I72 A;  1XP4 A;  3C4P A;  3MZE A;  3T4J A;  3JYI A;  3NUL A;  2HJE A;  2LB9 A;  2ZC5 B;  4EQI A;  3UDX A;  3IS2 A;  2FFY A;  4IED A;  3HRE A;  5M19 A;  1W63 Q;  4KZ8 A;  4FCF A;  2C6W B;  5FAQ A;  4EQ1 A;  1BLH A;  3BY8 A;  3W8K A;  3A3D A;  5CEB A;  4K08 A;  2VK3 A;  2K31 A;  3R4K A;  4K91 A;  2EXA A;  4L9F A;  4LV1 A;  3MQ0 A;  3PYP A;  1BSG A;  2WKE A;  5FQM A;  3TG9 A;  3IT9 A;  1YLY A;  1DRM A;  1YLT A;  3UB6 A;  4F94 A;  1RGY A;  3FPW A;  5HAP A;  2R9W A;  4OOL A;  3LR4 A;  3MKE A;  3OBF A;  1XA1 A;  4R4S A;  3BYD A;  3PBQ A;  3MBZ A;  3DWZ A;  1FCM A;  3UPP A;  3BRM A;  1ES4 A;  5JYP A;  1G6O A;  3F1P B;  4P85 A;  1XJ4 A;  3LR0 A;  1Y28 A;  2Y79 A;  5EFW A;  3B47 A;  3UE1 A;  2HJ9 C;  5A92 A;  3T4K A;  2O0Y A;  4EEP A;  4U0T A;  2XGN A;  1MWT A;  3N7W A;  4DE0 A;  3PR6 A;  2EA9 A;  1ESU A;  2JN7 A;  4YWZ A;  2JKT M;  4Q0J A;  4WL9 A;  2J8Y A;  1YAX A;  5DTK A;  3G35 A;  3C8C A;  3OOV A;  2EXB A;  3CJM A;  4HH3 A;  2ZOH A;  4JF6 A;  5AQA A;  3CG5 A;  3V5M A;  1DJB A;  1H8Y A;  2PBY A;  3CPT A;  4GB7 A;  4B4X A;  3N4I A;  4FOF A;  2JHE A;  3LEZ A;  2ZM8 A;  2L1M A;  3ISG A;  1ERM A;  1NXY A;  3SH7 A;  4RX3 A;  3JPU A;  1H8M A;  3KX0 X;  5L2F A;  1MBL A;  3A0R A;  1ERO A;  1NYM A;  3PAG A;  4B4Z A;  3PTE A;  4RQ9 A;  3MQO A;  1E3U D;  5HAI A;  2V9A A;  4NXF A;  1K55 A;  5EVI D;  3IF6 B;  1XJ3 A;  5FAP A;  3HVF A;  2P9V B;  4GOG A;  4WZ5 A;  1DP8 A;  2FH5 A;  1ZTU A;  3LEQ A;  4X69 A;  3QP4 A;  5MC7 A;  4EER A;  2ZOI A;  1XGI A;  3GTC A;  1IYO A;  1CJF A;  3LUQ A;  3P09 A;  1YSP A;  3LIF A;  3NDE A;  3CHW P;  5TBM B;  1TD5 A;  4OOY A;  5L10 A;  2J3T C;  3BLM A;  1AXB A;  2H5S A;  3K3D A;  4S2I A;  1DJA A;  4NET A;  4ESP A;  5KSH A;  4KZ9 A;  5E2E A;  1SKO A;  4Y0T A;  5C5K A;  1N9N A;  2HP9 A;  4C75 A;  1WE4 A;  1IYP A;  1ES5 A;  1Y54 A;  1N9B A;  4QWO A;  3MF0 A;  4HI4 A;  1LSW A;  1OME A;  4EES A;  1NZU A;  4HJ3 A;  1PI4 A;  3BFC A;  3IF6 A;  3Q07 A;  4HOI A;  1S6R A;  3WS2 A;  1GHM A;  1P9W A;  4Y13 A;  3LFV A;  5A8B A;  1JVJ A;  1YLP A;  4M4X A;  1KGE A;  3UME A;  2V1A A;  3LID A;  2V0U A;  3KSH A;  4N1X A;  3TRC A;  3OPR A;  2ZC3 B;  2HDR A;  4JXS A;  4OPY A;  4I38 A;  5FEF A;  4UEY A;  1RGZ A;  1BLP A;  4WBG A;  3C7V A;  2V8C A;  4ID4 A;  3T1Q B;  2X02 A;  1PWG A;  2XEP A;  4NXE A;  3IHA A;  2QYB A;  4LGW A;  4I3I A;  3FKW A;  3QP6 A;  2QPN A;  1X0O A;  2W1T A;  4Y7P A;  4WUJ A;  3EOI A;  3BFE A;  4BBU A;  2PRF A;  4OOM A;  1CEF A;  2W3F A;  3LCE A;  5F69 A;  3SZT A;  5CER A;  2V1Z A;  2H10 A;  5DJU A;  1OT9 A;  4HIA A;  4PM7 A;  5DTS A;  2E8I A;  3UE0 A;  5F5Y A;  3NI9 A;  2EWW A;  3ZCZ A;  4UAA A;  1BYW A;  2Q0O A;  2ACG A;  4WMC D;  5HD5 A;  5HL6 A;  2C5W B;  3DW0 A;  4P6B A;  1YLW A;  2A2L A;  5CHM A;  1L0F A;  5LBR A;  3PAE A;  3G4P A;  3I7J A;  1GSV A;  1MXO A;  3F1O A;  2OLU A;  1DJC A;  1TEM A;  2OAQ 1;  3ULF A;  1NRJ A;  3T1R A;  4PKY G;  1H5X A;  5IHV A;  3V3S A;  4MDZ A;  1O07 A;  1IOU A;  3BQ8 A;  1XXM A;  3VOY A;  3V39 A;  2KDK A;  2JKG A;  2BTF P;  4HJ4 A;  3MZF A;  1EW0 A;  2J3W A;  3LYX A;  2NUT C;  1L3L A;  3NIA A;  4ZJ2 A;  4P6Z M;  5TFQ A;  1BTL A;  1TS6 A;  4GCZ A;  2AVX A;  2PYP A;  3CMZ A;  2BLS A;  2A24 B;  2W0N A;  3PBO A;  3H82 B;  1LL9 A;  2ZJ9 A;  4U0X A;  2OLV A;  1J3W A;  3E4Q A;  1UWN X;  1YM1 A;  5KMW A;  1IEM A;  1SZV A;  1S67 L;  5FI6 A;  4JPM A;  3SOI A;  3GSG A;  5EOE A;  3MKF A;  3IX8 A;  4U3T A;  1TS8 A;  4N92 A;  1FCN A;  5J3W A;  5EVI C;  1OPX A;  2Y2I A;  4LRX C;  3O86 A;  1K56 A;  2WZX A;  1JWZ A;  3Q7Z A;  2XD5 A;  4JGQ A;  4JLF A;  3VFF A;  3ZG0 A;  5HZH A;  1OJ5 A;  4P87 A;  3FG8 A;  4ARZ B;  4KQO A;  4UQI M;  4WYY A;  3NOP C;  1BUE A;  3E98 A;  2P7J A;  2VGL M;  4GD6 A;  3UN7 A;  4WEK A;  2G7U A;  4HP4 A;  4FH4 A;  4QJG A;  5FQQ A;  3ZQ5 A;  2JKF A;  3NOT C;  1MWS A;  3HUO A;  4R70 A;  1A0K A;  3IXB A;  3VOL A;  4O0P A;  4IBR A;  3CI6 A;  2YKH A;  3SS5 A;  1IKI A;  3LIE A;  1S0W A;  3IXD A;  2O9C A;  2A24 A;  3CIT A;  3H82 A;  3IHB A;  5CEC A;  1YMS A;  3NHQ A;  1FSY A;  4EBL A;  3VE3 A;  4AFI A;  2XH9 A;  3TJZ C;  1HD8 A;  1JTD A;  3KSF A;  3FC7 A;  1VM1 A;  3HUN A;  2WGW B;  4LPZ A;  3Q82 A;  4WZ5 C;  3HCY A;  2HPB A;  3LIA A;  2P04 A;  3ZFZ A;  1XJ2 A;  2Q9M A;  1NRF A;  2JBF A;  3CUE C;  2XLN A;  3Q81 A;  4OH0 A;  3DBA A;  4R38 A;  4EET B;  3CAX A;  3A0V A;  1SHV A;  3PBN A;  1UGU A;  4IBX A;  3ZYT A;  3A3I A;  5GLA A;  1HVB A;  2XA7 M;  1D06 A; 
#chains in the Genus database with same CATH homology
 4WEL A;  5HPF A;  3MMH A;  2OWJ A;  4HHD A;  4PKY A;  3R7W A;  4FOF A;  2JHE A;  1GSX A;  4G3K A;  2L1M A;  2QWS A;  5K5B A;  2VZW A;  2ZMF A;  4HH2 A;  3F1O B;  2P08 A;  3B33 A;  1T19 A;  2HV1 A;  4NKP A;  5CX7 A;  4XT2 B;  3U2A A;  1MZU A;  2JKR M;  1H8M A;  3OLO A;  3KX0 X;  4DJ2 A;  3A0R A;  3OCN A;  2V1B A;  4GHI A;  3GDI A;  4BJP A;  2I9V A;  3K2N A;  4IHQ A;  4RQ9 A;  3MQO A;  2V9A A;  2PDR A;  1D7E A;  4NXF A;  1KOU A;  4JGO A;  2ZMV A;  1XJ3 A;  2O9B A;  1MC0 A;  3PHY A;  1OTI A;  1XFQ A;  3VV4 A;  1ZHH B;  1DP8 A;  5G4Y A;  2FH5 A;  4CQH A;  1ZTU A;  3UE3 A;  5HSQ A;  4F3L B;  2QKP A;  4ETZ A;  2FZ0 A;  2VV6 A;  3MR0 A;  2XRO A;  4WLA A;  3BJN A;  3KSG A;  2GZA A;  4WF0 A;  4Y2F A;  2LB5 A;  4HP9 A;  4WN5 A;  1G28 A;  3F1N A;  5MC7 A;  2J80 A;  4EER A;  1V9Y A;  2ZOI A;  1NWZ A;  1T1A A;  5J4E A;  1LSX A;  2VV7 A;  4L0L A;  3H9W A;  4KUO A;  2GX5 A;  3LUQ A;  1YSP A;  4P6Z S;  3LIF A;  2M7U A;  4II7 A;  2VA0 A;  2KX6 A;  5TBM B;  1TD5 A;  5DKK A;  4IUH A;  4Y3I A;  5DJT A;  4O8G A;  4I5S A;  4NXB A;  2J3T C;  1F5M A;  3JVU A;  3PBR A;  4L9G A;  1WA9 A;  2INW A;  3IS2 B;  2L0W A;  4ZRR A;  2W3H A;  4I3A A;  3T4L A;  2J3T D;  4JGR A;  1T1B A;  3S7P A;  3LI9 A;  3JVV A;  3K3D A;  4CLC E;  1N9O A;  3PBS A;  2PT7 A;  4ME4 A;  1XFN A;  2PD7 A;  5KSH A;  3TE8 A;  2PD8 A;  1YKD A;  1VB6 A;  3UE6 A;  3LIB A;  3BW6 A;  5C5K A;  1N9N A;  4MMN A;  4GS9 B;  3E4P A;  4BBT A;  3MF0 A;  2HGV A;  4DMZ A;  2Y8H A;  1LSW A;  4HI4 A;  4EES A;  2GNX A;  3NOU C;  4HJ3 A;  4HOI A;  3UB7 A;  1XJ6 A;  5F68 A;  4ARZ A;  5IU1 A;  5KIZ A;  1P9W A;  5DFY A;  4LRY C;  2O99 A;  4F3L A;  3LFV A;  4R3A A;  4UQI S;  5A8B A;  5HWT A;  4HY8 A;  4M4X A;  2WKQ A;  1H3Q A;  2VGL S;  3UME A;  5DFX A;  2IA2 A;  2WKR A;  2DMW A;  2V1A A;  3LID A;  4CLC D;  2V0U A;  2R78 A;  2W3G A;  3KSH A;  5HDD A;  4MN7 A;  3TRC A;  1DP6 A;  3K3C A;  4EUV A;  2QJ5 A;  4Q0H A;  3S7N A;  4DN0 A;  1P97 A;  1P0Z A;  3FPV A;  4I38 A;  2PR5 A;  4UEY A;  5HD3 A;  5I5L A;  5DF9 A;  2D01 A;  2OOL A;  3HJI A;  3LI8 A;  3LR3 A;  2HF6 A;  2W27 A;  2Z6C A;  4NXE A;  5IS1 A;  2QYB A;  3OC2 A;  3C38 A;  4MN6 A;  5AVE A;  3T4S A;  1YSQ A;  4HQA A;  4I3I A;  1S4R A;  3RFB A;  3BWL A;  3UB9 A;  1N9L A;  3O5Y A;  1X0O A;  2W1T A;  2YKF A;  2W3E A;  4WUJ A;  3F1P A;  2OAP 1;  4IUK A;  3EOI A;  4GW9 A;  2QHK A;  2M1C A;  2Z6D A;  3CUE A;  3OCL A;  4OOM A;  4BBU A;  2W3F A;  5F69 A;  2K7S A;  4EU0 A;  1NLZ A;  2VKS A;  3EGD C;  5DJU A;  5IT5 A;  1OT9 A;  2KOI A;  4G3W A;  4HIA A;  5F6A A;  4HNB A;  4EXO A;  4GS9 A;  3MFX A;  4CLC A;  2BAS A;  5F5Y A;  3MJQ A;  4BBV A;  2EWW A;  4MCW A;  3H7W A;  4B93 A;  2L4R A;  1T18 A;  1BYW A;  2V0W A;  1TS0 A;  5HWW A;  5DKL A;  3R7W B;  2PR6 A;  3T4Q A;  5HD5 A;  1DP9 A;  1S1Y A;  5HDS A;  4H6J A;  5HL6 A;  4Z1W A;  1JNU A;  2XA7 S;  4E04 A;  4EW7 A;  1P9R A;  2NUP C;  2A2L A;  3RH8 B;  4GLQ A;  4GHI B;  5TJJ A;  2B18 A;  3KYZ A;  1W63 M;  4O01 A;  3NJA A;  5LBR A;  4LLO B;  1S66 L;  5HWV A;  1GSV A;  3ICY A;  3BY9 A;  3F1O A;  4KQD A;  4YNR A;  4KUK A;  4XT2 A;  3RTY A;  2OAQ 1;  4YOF A;  1NRJ A;  3ULF A;  5AJG A;  3T4O A;  1OJG A;  3BQA A;  2VJW A;  1GSW A;  4PKY G;  2B02 A;  4MDZ A;  3LIC A;  4JGP A;  1OT6 A;  4NEE D;  1IOU A;  3BQ8 A;  3KSI A;  4EEU A;  3EQU A;  4PHT A;  2OWH A;  2KDK A;  1S1Z A;  4HJ4 A;  4FSF A;  1F9I A;  1EW0 A;  3P7N A;  4B9O A;  5HPI A;  2J3W A;  2EWV A;  5L8M A;  3LYX A;  2NUT C;  2W1R A;  4Q0I A;  3V67 A;  3F1N B;  3G6O A;  2KLI A;  3T4T A;  4DJ3 A;  4I3J A;  4LRZ E;  1OTB A;  4P6Z M;  2K2N A;  1LL8 A;  1STZ A;  3KYQ A;  1T1C A;  3CLO A;  3EGX C;  4BMW A;  1TS6 A;  4GCZ A;  2PYP A;  4PAU A;  3S7O A;  3EEA A;  1OTE A;  3S7Q A;  3UMD A;  2A24 B;  2W0N A;  3PBO A;  4G3V A;  3H82 B;  3A0S A;  1OTD A;  1OTA A;  3CWF A;  3W2Z A;  1UWP X;  3E4Q A;  1UWN X;  3LR5 A;  3IBR A;  5TBM A;  2D02 A;  3TW8 A;  3HJK A;  5HDC A;  1ODV A;  2VLG A;  1S67 L;  3T4J A;  3B42 A;  4MN5 A;  2HJE A;  2LB9 A;  2O9A A;  3IS2 A;  3MXQ A;  2VX8 A;  3D3O A;  3SW1 A;  3C2W A;  3EEH A;  4I39 A;  1W63 Q;  1TS8 A;  1S4S A;  1F98 A;  2H28 A;  1TS7 A;  3C30 A;  5J3W A;  1OPX A;  3D72 A;  2M7V A;  4LRX C;  3KO6 A;  3EQV A;  2JKT I;  4EQ1 A;  3BY8 A;  4JGQ A;  5HZH A;  3VE4 A;  1OJ5 A;  2W3D A;  1LSV A;  4QPR A;  4Y5F A;  3FG8 A;  4ARZ B;  1TF1 A;  2MJ6 A;  4K08 A;  2K31 A;  4KQO A;  3R4K A;  4UQI M;  3NOP C;  4L9F A;  3E98 A;  2P7J A;  2VGL M;  3MQ0 A;  4WEK A;  2G7U A;  5FL3 A;  4HP4 A;  3PYP A;  4IJG A;  2QJ7 A;  3ZQ5 A;  3NOT C;  4WEJ A;  2JKR I;  2ZBB A;  4R70 A;  1DRM A;  5AVF A;  3UB6 A;  5G4Z A;  4NXG A;  2GJ3 A;  3FPW A;  3MQQ A;  3VOL A;  4O0P A;  4OOL A;  1VHM A;  3LR4 A;  3CI6 A;  3T50 A;  2YKH A;  3LIE A;  1NLY A;  3OBF A;  2O9C A;  3PBT A;  2A24 A;  1V9Z A;  2VEA A;  3CIT A;  3H82 A;  3PBQ A;  3GEC A;  4ETX A;  5J7E A;  3IBJ A;  2W1T B;  1MKM A;  1G6O A;  2XRN A;  3F1P B;  3NHQ A;  1XJ4 A;  2CMN A;  3LR0 A;  1Y28 A;  2Y79 A;  3P01 A;  5EFW A;  3VE3 A;  3B47 A;  4AFI A;  3TJZ C;  2PYR A;  3KSF A;  2HJ9 C;  3FC7 A;  3T4K A;  2O0Y A;  4EEP A;  4LPZ A;  3HCY A;  2PHY A;  3LIA A;  2P04 A;  2VV8 A;  4CLC B;  4R6L A;  3PXP A;  1XJ2 A;  3PR6 A;  2EA9 A;  3UB8 A;  2JN7 A;  3H7W B;  3CUE C;  4YWZ A;  2JKT M;  3E4O A;  4Q0J A;  4WL9 A;  2WKP A;  4BWI A;  3DBA A;  4R38 A;  4EET B;  4L9E A;  1YAX A;  3CAX A;  3A0V A;  1IFQ A;  3C8C A;  3PBN A;  4HJ6 A;  3OOV A;  1UGU A;  3E0Y A;  3ZYT A;  3EWK A;  1LT0 A;  2XSS A;  4GJ4 A;  4HH3 A;  2ZOH A;  4CLC C;  4H6J B;  2XA7 M;  1D06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...