3HJKA

2.0 angstrom structure of the ile74val variant of vivid (vvd).
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALVLCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Mechanism-based tuning of a LOV domain photoreceptor.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 38
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3hjkA00
1MZUA 2GJ3A 2Z6DA 2CMNA 4HQAA 1XFQA 1TS6A 3NJAA 1V9ZA 2PYRA 2ZOHA 3LIFA 1NWZA 2PR6A 5G4ZA 4PKYA 2PD7A 4GS9A 4HP4A 4BBVA 3C8CA 1LSVA 2WKQA 1GSVA 1OT9A 1XJ6A 3MJQA 5HDDA 1XFNA 3H7WB 3KX0X 4RQ9A 1S66L 3E4PA 4MN6A 3IBRA 2YKFA 1GSXA 5DJUA 1VB6A 2H28A 1F9IA 3F1PA 2I9VA 3E4OA 1OT6A 3CAXA 3VE3A 4PKYG 4E04A 4EERA 3H82B 4LPZA 3VE4A 2QKPA 5HD3A 3GDIA 5DKLA 4HOIA 4NXGA 1P97A 2D01A 2P7JA 3RH8B 4WL9A 3CLOA 3MFXA 2V0UA 1EW0A 2VV8A 3G6OA 2L1MA 2PR5A 2QHKA 5HWWA 4GHIB 4F3LB 3HJIA 1T18A 1WA9A 2W27A 3NOTC 1UWPX 4EEUA 5HWVA 4H6JA 5F6AA 3IS2B 5HWTA 4DJ2A 3UMEA 3H7WA 4MN5A 2JN7A 5HD5A 5I5LA 4I3AA 2W0NA 1JNUA 3F1OB 3PYPA 4GCZA 3F1NB 2WKPA 3MQQA 2VEAA 5AVEA 5HDSA 3UB9A 4LRXC 1UWNX 2OWJA 1G28A 2PHYA 3P7NA 3E4QA 4HY8A 2INWA 3K3CA 3LYXA 2PD8A 3EEHA 3RTYA 2PYPA 1T1CA 2V0WA 1TS8A 3A0VA 4EESA 5DKKA 4DJ3A 2J80A 4R3AA 1S4SA 3NOPC 2KX6A 4HH2A 2QJ5A 4F3LA 1S4RA 4KUOA 2YKHA 4LLOB 4HJ3A 3PHYA 5G4YA 3HJKA 3D72A 4HIAA 3VOLA 3BWLA 5HZHA 3LIBA 3SW1A 1S1ZA 4K08A 2V1BA 2L0WA 5A8BA 1N9OA 2K7SA 4KUKA 1T1AA 4LRYC 1OJ5A 1Y28A 4XT2B 5KIZA 1OTIA 1V9YA 4L9FA 3UB6A 1TS7A 1DRMA 3F1OA 3LIAA 4JGQA 3F1NA 4B9OA 4GW9A 3MXQA 3NHQA 1UGUA 3UB8A 2A24B 3LI8A 1LT0A 3EWKA 5J7EA 1DP8A 1XJ2A 3FC7A 4WN5A 1OTAA 3F1PB 1N9NA 3LIDA 4KQDA 2OOLA 4WLAA 4NXFA 4M4XA 1BYWA 1OTBA 5J3WA 3UB7A 1OTDA 4HHDA 1DP6A 4R38A 3UE6A 3LICA 5DJTA 5EFWA 1KOUA 5IS1A 4L9GA 1T1BA 4HJ6A 4BBUA 2R78A 3H82A 1D06A 2D02A 2M1CA 4I3IA 2QJ7A 4BBTA 4I5SA 4JGPA 3LUQA 2PDRA 5HDCA 1N9LA 1P0ZA 2V9AA 2JHEA 3ICYA 3H9WA 4I3JA 4XT2A 5F69A 4HI4A 1F98A 3LIEA 1T19A 3OLOA 4GHIA 1D7EA 3BY8A 1GSWA 4WUJA 1X0OA 4H6JB 5TBMB 2QWSA 2A24A 4NXBA 3NOUC 1S67L 4HNBA 4EETB 3GECA 1LSWA 4L9EA 4LRZE 1OTEA 2VV6A 4EEPA 1XJ3A 1S1YA 2EA9A 5HSQA 3IS2A 4HP9A 4NXEA 2B02A 4YWZA 4I39A 3A0RA 5F5YA 1TS0A 4EW7A 2OWHA 4GS9B 1LSXA 4R70A 4HH3A 2L4RA 2ZBBA 5IU1A 4R6LA 2WKRA 2HV1A 3CWFA 3ZQ5A 1XJ4A 3B33A 3FG8A 3MR0A 2V1AA 2ZOIA 2VLGA 3UMDA 5J4EA 4I38A 4EQ1A 2BASA 1OJGA 3ULFA 1DP9A 3LI9A 3A0SA 3K3DA 3T50A 3BY9A 1ODVA 2KDKA 5F68A 5AVFA 4WF0A 4JGRA 2Z6CA 3MQOA 5TBMA 4JGOA 4EXOA 1LL8A 2VV7A 3C2WA 4HJ4A
chains in the Genus database with same CATH superfamily
1MZUA 5EPHA 2Z6DA 3IX8A 2CMNA 4HQAA 3OPLA 3NC8A 3KYZA 2P9VA 3NJAA 5FDSA 3O88A 4KZ6A 5G4ZA 3NI9A 4UA7A 2PD7A 5LBRA 1L3LA 4HP4A 5DF7A 3FKVA 4BBVA 1PRQA 3C8CA 1L2SA 5F82A 4EUZA 5I94A 1XX2A 4O7DA 4WEKA 3KX0X 5FEGA 1S66L 3E4PA 1H3QA 1I2SA 3TSGA 1C3BA 1ONHA 2HGVA 4WZ4A 3VE3A 3T1XA 3HUNA 3M2JA 1BLCA 4LPZA 5A92A 2XQZA 4HOIA 3EOIA 3G2ZA 2ZL1B 4NXGA 4X1LA 2QZ6A 2M7VA 1CEFA 1NZOA 5HAPA 3VOYA 1PW8A 2L1MA 3DBAA 4YNRA 2PR5A 3ZDJA 1TF1A 2XD5A 1Y54A 5FATA 4GHIB 4F3LB 3IT9A 3FV7A 3C5AA 2WAFA 1H5XA 2W27A 3HUMA 3IX3A 3UO9A 2V1ZA 4EEUA 2OAQ1 3LO7A 2XGNA 3IHAA 5A93A 1PNEA 4QHCA 3IF6C 5HWTA 2PT7A 3CG5A 5D3OA 3UMEA 3OPHA 3O86A 4UA9A 3UDIA 1KGEA 4UEYA 2Q0OA 4I3AA 4QU3A 4G3VA 4JXWA 3B42A 3UB9A 1UWNX 1VM1A 2W1TB 3IQAA 1IYPA 1NRJA 4UA6A 4C75A 5FA7A 3JVVA 3BW6A 3BRMA 1M40A 3CI6A 4EBPA 1PW1A 2XA7M 1L0FA 5FQQA 1K56D 4AFIA 5EOOA 2X71A 2PD8A 4OOYA 3BEBA 4KG6A 1G5UA 4IVKA 1JWVA 1K6RA 4HEFA 3A0VA 4DJ3A 2J80A 5FL3A 4R3AA 2O9AA 4KZ9A 2HDQA 2KX6A 3SZTA 4F3LA 3OBFA 1K25A 3G2YA 2JKTI 4BLMA 5G4YA 3ZG7B 3S7OA 3D72A 5E43A 4HIAA 3VOLA 2DRWA 3BWLA 3HLFA 3T1QB 2ZLYA 2V1BA 1W8YA 3EGXC 2L0WA 5A8BA 2K7SA 4KUKA 4LRYC 2DMWA 3NBLA 3ITAA 2W3DA 2PBDP 2ZM2A 1OTIA 4L9FA 5DTTA 4LV0A 3UB6A 3GV9A 5DF9A 3IH9A 1LI9A 1IKGA 3IWQA 1PZOA 3PBTA 1UGUA 1JTGA 5GLBA 1YLZA 2A24B 3LI8A 1LT0A 2P74A 3CUEA 4KZ7A 1DP8A 1XJ2A 3FC7A 3QP4A 2I72A 4NXFA 4HBTA 2J3TD 2P08A 2ZM8A 4Y17A 1S0WA 2AVXA 2HZ5A 4HESA 3HLDA 4YOFA 1OTDA 4HHDA 2J3WA 4Y0TA 2FZ0A 3WS5A 2WGVA 2H0TA 4L9GA 4U0TA 1F5MA 5EOEA 2XD1A 2Y55A 1N9BA 4I3IA 5HX9A 1KDWA 1OPXA 3GR2A 3LUQA 1IYSA 2E8IA 5EV0A 3UE1A 3OPRA 4DDYA 3H9WA 4I3JA 3CPTB 2QYBA 1SCWA 3HCYA 3LIEA 4HBUA 2JKGA 3P98A 5IHVA 1GHMA 2ZMAA 5JYPA 3TG9A 1NY0A 1YKDA 3BY8A 3MS6A 5TR7A 2JKFA 2QWSA 1TEMA 2VA0A 3ZG0A 2A24A 2XK1A 3K2NA 3ZG8B 2E8JA 3R4KA 3BQAA 4E3IA 4L9EA 2J9OA 3OPPA 4EEPA 1FSWA 1CQAA 4Y2FA 3LEZA 1KVMA 2HP6A 1BT5A 1FCMA 2OV5A 4NXEA 1Y4OA 2B95A 3SH7A 2VKSA 3A0RA 5F5YA 3C7VA 4E3LA 4O01A 3LCEA 4EWFA 4JF4A 5HPFA 2OSUA 1NRFA 1XGIA 4GZBA 4O8GA 4R6LA 2WKRA 4KQOA 4MBKA 5HAQA 2OLVA 3KYEA 1W79A 1IOUA 4WMCD 3MR0A 4MCWA 5EVEA 4E6XA 3UMDA 4ZRRA 5FI6A 5EE8A 1PI4A 2EXBA 4GOGA 1OJGA 2Y2JA 3G4PA 1ES3A 3V50A 1YQSA 2Y2OA 2FH5A 3LY4A 4R3JA 5FQKA 5HFOA 1MKMA 3BY9A 1TDLA 1E3UA 5CERA 3S7QA 2ZQ8A 1MWSA 3MXSA 3HLWA 2O9BA 3NCKA 1E25A 4EXOA 1ES2A 3OOVA 3UPNA 1YLWA 5KMWA 4R4SA 1IKIA 3CITA 2ZC5B 1VETB 2VV7A 1U60A 3VP2A 4FOFA 2XFSA 4LV3A 2Z2MB 4F94A 4U0XA 3EGDC 1LI0A 4XUZA 3DAVA 1KVLA 4JKTA 4OP8A 3Q7VB 4S2LA 3BYDA 1V9ZA 3IF5A 2ZOHA 1NWZA 1IYQA 3BQ8A 3P09A 3ZG5A 4QY5A 4BL2A 4NEED 4BJPA 3O3VA 1Z09A 3IXDA 1GCEA 1LSVA 1ERMA 1RGYA 2B18A 4ZJ2A 1W63M 2WKQA 4Y3IA 4ESPA 5A90A 1XJ6A 3NULA 1FCNA 3PTEA 4RQ9A 3IBRA 3VFHA 5AQ9A 1VB6A 1PWGA 2H28A 5DTSA 3UB5P 3E4OA 2Y8HA 1OT6A 3ZGAB 2XROA 1YM1A 2O0YA 4EQIA 1XPBA 3M6BA 3FZCA 4E04A 2IA2A 5EVID 3L7HA 2Y2KA 3H82B 3ZG9B 5HD3A 2ZD8A 4GKUA 1K55C 5DKLA 2XSSA 4ZTKA 4Q0HA 3VP4A 2QPNA 2V8CA 3W4QA 2BLSA 4WL9A 3T4QA 5EM0A 4G3KA 3DTEA 3MFXA 1EW0A 5AQ7A 4KG2A 1VETA 3G6OA 4DDSA 4LENA 5DFYA 3T4OA 2QHKA 1DY6A 4WM9A 3VFFA 1MBLA 3N8RA 3Q7VA 3RFBA 3N8LA 3ZNTA 1GHIA 2OLUA 3WWXA 3R7WA 4GJ4A 4CLCD 4UHUA 5FEFA 3CJMA 1T18A 2K2NA 4P6BA 1HTZA 3NOTC 3UNWA 3A3IA 3QP1A 1MY8A 5HWVA 4PMAA 1MWRA 1IEMA 2WZZA 2W1RA 2HJEA 3E98A 3CUEC 3IS2B 4DJ2A 5AJGA 2UWXA 5I5LA 2Y79A 2Q9MA 2W0NA 5GLAA 1JNUA 3PYPA 3LEQA 3TRCA 3MQQA 1TDGA 2VEAA 2VGLS 5AVEA 3WS4A 4B93A 5BOHA 2HP9A 4GLQA 3RXWA 3MBZA 4DMZA 3KSHA 2PHYA 3WS0A 3E4QA 4M3KA 2INWA 4N1HA 2ZC6B 4FSFA 4QJGA 4R3BA 2R9WA 1I2WA 2ZC3B 1W8QA 1JTDA 2ZMVA 3KSFA 1A0KA 1TS8A 2WKIA 3N7WA 4EESA 1S4SA 1VEUB 4DXCA 2BTFP 4CJNA 4IBRA 2XH9A 2QJ5A 4OP5A 4K0XA 4GD6A 4EBNA 1M6KA 2YKHA 3V67A 1BLSA 4FTXA 4PHTA 3FPWA 2IWDA 5HW3A 2WGWA 2HDUA 4S2MA 3LIBA 1ZG6A 5CECA 3W8KA 4K08A 3PBOA 5FAOA 4FH2A 4MLLA 3B3XA 4II7A 1Y28A 2RCXA 5KIZA 1D1JA 2GDNA 5FDHA 3C4OA 2H10A 1FCOA 4JGQA 1DJBA 2J8YA 3OCLA 4MBHA 3S7PA 2JKTM 4B9OA 4GW9A 1Q2QA 2PAVP 1XA1A 2WAEA 3UB8A 4D2OA 3Q1FA 1FSYA 1FIKA 4DN0A 1XXMA 4CLCE 3F1PB 4X25A 1N9NA 3V39A 4IBXA 4WLAA 3VP0A 1OTBA 5J3WA 4WZ5A 2G2UA 2PRFA 3O5YA 1KGGA 4N9KA 3T1RA 3IWIA 3P01A 1DP6A 3B47A 4R38A 2VJWA 5EFWA 1MWUA 2JKRI 4R0QA 1G6OA 1BSGA 4MN7A 5E2GA 2WZXA 5F1FA 2J3TC 2QJ7A 3E2LA 1HD8A 4I5SA 2ZL1A 2RL3A 4IJGA 3VV4A 4LV2A 2PDRA 1GA0A 3IXHA 1P0ZA 5CHMA 3TE8A 3ICYA 3JYIA 4GNUA 1F98A 1T19A 3OLOA 3VSLA 2XF3A 3VSKA 1N4OA 1D7EA 4GHIA 5HARA 3BFGA 2ZMFA 4KQQA 4H6JB 5TBMB 3FWLA 1CF0A 1TD5A 2K31A 4NXBA 2FFFB 2GNXA 1S67L 2ZQAA 4HNBA 2WGIA 3GECA 2NUPC 1BTLA 4P85A 2NUTC 4OLGA 3A3FA 2Y2NA 1CJFA 2V2FF 4P0MA 4I39A 1CEGA 1TS0A 4P87A 3BFEA 4EW7A 5M18A 1P9RA 3G35A 4E3NA 2W3HA 4L0LA 2L4RA 3VOZA 2W1TA 3CWFA 3IH8A 1L0EA 1XJ4A 3B33A 4GN2A 1YT4A 1J9MA 3FG8A 4YFMA 5HL6A 1Z6FA 3Q07A 2G7UA 5GHZA 2HPBA 4EQ1A 5GLDA 2BASA 3WS2A 1LL5A 4RX2A 3MF0A 1DP9A 3ZNYA 2C5WB 3A0SA 3K3DA 5CGWA 1VHMA 1OMEA 1MC0A 3BJNA 5CTNA 4X1MA 3C30A 5G18A 5TBMA 4P6ZS 4JGOA 3FPVA 3G31A 4QPRA 2P04A 1XA7A 1QMFA 4HJ4A 4MMNA 5KSHA 3C4PA 4JXSA 2A3UA 4S2KA 2ZM0A 4Q8IA 3SH9A 1QMEA 1PI5A 3IXGA 1XFQA 4S2NA 3AGFA 3HLGA 4OOMA 4X53A 1LHYA 2PYRA 1K56A 1O7EA 3UE0A 1ESIA 1ESUA 2PR6A 3D9YA 1NYMA 4X56A 1CI9A 3GRJA 1EWZA 3BECA 1NYYA 5KZHA 5DF8A 4OPRA 1GSVA 2PBYA 1OT9A 3ITBA 1YAXA 5HDDA 1XFNA 3H7WB 3M6HA 2YKFA 1GSXA 5DJUA 1ALQA 1F9IA 3W4PA 4WBGA 3MMHA 1SZVA 2XLNA 3UPOA 5GHYA 4PKYG 4E3MA 3PBSA 4R1GA 4EERA 3VE4A 2PU2A 3GDIA 5EM1A 3IWOA 2JBFA 4QD4A 2JE5A 4JBFA 2D01A 4Z1WA 3NY4A 4Y13A 3RH8B 1ZKJA 4IUKA 2O99A 3NECA 2WUQA 2V0UA 2VV8A 3ZHHA 4IUHA 5CHJA 2EFUA 5EUAA 5A91A 3QP8A 3NDEA 3IBJA 4P6ZM 4PM6A 5CRFA 4H8RA 3S1YA 3LR0A 4KZ4A 3A3EA 2WADA 5GL9A 4E6WA 3T4LA 3OZHA 3CPTA 1K4EA 2W3EA 1H8ZA 2EX8A 1WA9A 1ZTUA 1YLJA 5FASA 1KGFA 3AGDA 5F6AA 4B88A 1W7FA 1WYBA 3H7WA 1SDEA 4ZBEA 3UN7A 3SS3A 4DRTA 4NK3A 3CMZA 5HD5A 3LR4A 1KE0A 3F1OB 2HDRA 4GCZA 3F1NB 3AGEA 1MKIA 2EWWA 4WZ5C 4K0WA 5F1GA 5HDSA 2VK3A 4LRXC 2DCFA 5CTMA 1YMSA 1K54A 4X68A 2HDSA 2OWJA 4CQHA 3NDGA 1K38A 1VQQA 3PBRA 4ZJ3A 4E3JA 3K3CA 3BFDA 3QP2A 5E2EA 3WRTA 4JXGA 2J9PA 5L10A 5CXWA 1HVBA 2PYPA 1EROA 4X69A 1T1CA 4OPZA 2ZQDA 5DKKA 1F2KA 4GDBA 2O9CA 4S2IA 3NOPC 3UY6A 1STZA 1S4RA 3PHYA 3HJKA 3V3SA 4BWIA 4KENB 5HZHA 4BL3A 1S1ZA 4JF5A 4X6TA 1NZUA 2Y2IA 3C38A 2BG1A 2XR0A 1T1AA 2EX6A 1K57A 1HLUP 5FQMA 4XT2B 3DTKA 4X55A 1FR1A 4Y7PA 2Y2HA 3F1OA 1DRMA 2Y2MA 5FQJA 4ARZB 3F1NA 3L9KA 4BQMA 3MXQA 4MBFA 5CEBA 3SH8A 4WMCA 1NJ4A 4WEJA 3UPPA 3BFFA 1XKZA 1GA9A 3M2KA 3FKWA 4DKIA 3EEAA 1GHPA 4GDNA 1PZPA 5EVLA 3DW0A 3T1SA 3LIDA 3NIAA 4KQDA 5EVIB 1Q2PA 3MFDA 1ZC2A 3W2ZA 3OCNA 4OVDA 4M4XA 1BYWA 1CI8A 1IELA 2MJ6A 4FCFA 3UDFA 3BLSA 3IX4A 3HBRA 5JYOA 5FI7A 3LICA 5J8XA 5IS1A 1MXOA 1K6SA 4HJ6A 3LR3A 4BBUA 2R78A 4KZ8A 3H82A 2D02A 2M1CA 5L2FA 1BLHA 1HZOA 1NLYA 4CLCB 5DTKA 5HDCA 2GZAA 4S2PA 2JHEA 1MPLA 2EX2A 4XT2A 4HI4A 2XRNA 4S2NC 5DFXA 5CX7A 5TFQA 2V20A 4ARZA 3IXBA 2JKRM 1NXYA 4OQ0A 1ERQA 1JWZA 1RCJA 1AXBA 2ZC4B 1X0OA 3BLMA 4D60A 3NOUC 3EQVA 1ES4A 1OTEA 5FQIA 3SS5A 2QMIA 5EVIA 5C5KA 5HAIA 3IS2A 3MQ0A 4N9LA 2XA7S 4K91A 1JVJA 2B02A 1PFLA 1SDNA 3FYZA 4YWZA 1BUEA 4QWOA 4E3KA 3I7JA 3UDXA 4GS9B 4R70A 2B5RA 3HL9A 4HH3A 3VP1A 3QNCA 1G68A 4PAUA 5IU1A 4ZJ1A 2HV1A 4UQIS 2GX5A 5CEDA 2V1AA 2VGLM 2Y91A 2ZOIA 5J4EA 2WKHA 5FAPA 1WYCA 4PM7A 4I38A 4CLCA 2LB5A 1PIOA 4R4RA 3Q82A 3KO6A 2C6WB 3Q81A 4RA7A 3QP5A 3OC2A 1ES5A 2KDKA 5F68A 4WF0A 5KSCA 3G32A 1VEUA 3GQZA 3S7NA 1PWDA 3G34A 1FOFA 2PU4A 4KZBA 1DJAA 2UV0E 4U3TA 4S2OA 3MQOA 4OOLA 3DWKA 3IHBA 3HREA 1LL8A 4ZDXA 4JPMA 4OPYA 2EX9A 4LFUA 2GJ3A 4LGWA 3U2AA 3HUOA 5FSRA 4BD0A 1XP4A 4NKPA 2HJ9C 4DE1A 3MZFA 4O0PA 3UE3A 2H5SA 1KE4A 1TS6A 5AQAA 3LIFA 3CHWP 2HF6A 3KSGA 3HVFA 3MXRA 1P9WA 1YSPA 2EXAA 4JXVA 5HL1A 4R23A 4XUXA 4PKYA 4GS9A 1K54C 4OKPA 2X02A 3MJQA 3MZEA 2Y2QA 3C7UA 1SKFA 3VMAA 4MN6A 1H8YA 3F1PA 2I9VA 3D3OA 4UQIM 1K55A 2WK0A 3CAXA 5FI2A 4KZ5A 4EBLA 3W4OA 4BMWA 1G6AA 2VZWA 2QKPA 1BLPA 4ZAMA 4PPRA 5CHUA 4LV1A 1P97A 2P7JA 4NG2A 3RJUA 2Y2LA 3CLOA 1KDSA 3T4TA 3LGOA 2Y2PA 4PM5A 5L8MA 1ZG4A 1L0DA 4ETXA 4RYEA 5AQBA 5HWWA 1K57C 4EV4A 2ACGA 2H0YA 4RX3A 3LFVA 3HJIA 3TJZC 1K0KA 3QNBA 4A5RA 1YLPA 1UWPX 3ZVTA 4DE3A 1SHVA 3QP6A 3ZCZA 1E3UD 4H6JA 4OQHA 5GLCA 3PAEA 5TGFA 4Y5FA 2JCHA 3LR5A 3PR6A 4MN5A 2JN7A 1L0GA 4ETZA 4Y15A 4CPKA 5HPIA 2WKPA 4IEDA 1YLYA 5L07A 4KG5A 3DTIA 2WKEA 3RXXA 1G28A 2VGJA 2VGKA 3P7NA 4HY8A 1RGZA 3IF6B 3LYXA 1FQGA 2X01A 3KSIA 2ZQ9A 4OPQA 3HLEA 3T4KA 2WYXA 2W3FA 3EEHA 3RTYA 4KQRA 2ZC7A 5E2HA 4OONA 2V0WA 3JPUA 2R9XA 3QHYA 4QY6A 4EUVA 5TJJA 4Z9QA 4OH0A 3V3RA 3GTCA 4HH2A 2EWVA 4KUOA 3WS1A 1AWIA 3DWZA 4LLOB 4HJ3A 4Q0IA 4PM8A 4S2JA 4WELA 1H0MA 2Y59A 4C3QA 3SW1A 1I5QA 1RP5A 2FFYA 1LLBA 3VP3A 4IVIA 2KOIA 4KZAA 1TVFA 3E2KA 2J7VA 1PYYA 5L09A 3WRZA 1N9OA 3T4SA 4KZ3A 1OJ5A 4JF6A 1NLZA 4LCLA 4FH4A 5EVIC 1V9YA 4MNRA 1TS7A 3LIAA 2LB9A 5MC7A 2V8FA 3T12B 2DNSA 1S6RA 1FR6A 3NHQA 3O87A 3BFCA 5F83A 5GHXA 3EQUA 4QB8A 2ZJ9A 3G30A 3EWKA 4PM9A 3T4JA 4WYYA 1ACFA 5U47A 3BM6A 1J3WA 5J7EA 4DE0A 3IF6A 2M7UA 3E0YA 3N4IA 1BZAA 3JVUA 4WN5A 1KE3A 1OTAA 3SS4A 2Y4AA 2OOLA 2ZQCA 2Q9NA 3GMWA 3Q7ZA 4ME4A 4CLCC 5K5BA 4FD8A 4Q0JA 3UB7A 1DJCA 1YPRA 3TW8A 1XGJA 1WE4A 2KLIA 1YMXA 4GB7A 3UE6A 4LCMA 4MDZA 5DJTA 4N92A 1KOUA 4G3WA 3PAGA 1T1BA 4DXBA 4XXRA 4OLDA 3N6IA 3PBNA 4OQGA 1D06A 3DTMA 3ISGA 1LL9A 4BD1A 4BBTA 4BENA 4JGPA 4B4XA 2A2LA 1E4DA 3CZDA 3S22A 3ZYTA 1SKOB 1N9LA 2V9AA 3R7WB 5E2FA 5F69A 4DE2A 1JWPA 3A3DA 3ZVWA 3HLBA 4FUWA 4IHQA 3MKFA 5DVAA 1GSWA 4UAAA 4WUJA 5FAQA 1IYOA 2W3GA 5M19A 3S4XA 4OQIA 3V5MA 4Y0OA 4EETB 4ID4A 1ONGA 2CC1A 3SOIA 1EI5A 1LSWA 4LRZE 3A3JA 2VV6A 1XJ3A 1S1YA 2EA9A 5HSQA 1H8MA 2A49A 4Y0UA 3N8SA 4HP9A 2P9VB 1O07A 3MZDA 2EFXA 4DF6A 1K4FA 3U4LP 2OWHA 3KYQA 1MWTA 2HP5A 1LSXA 2OAP1 2ZQ7A 2ZBBA 1YSQA 1BULA 3ZQ5A 1W5DA 1W63Q 5CGSA 2VX8A 4NETA 2XEPA 4JLFA 2VLGA 4RVAA 4N1XA 3GSGA 1CK3A 3MSHA 5FQ9A 2JC7A 2Y2GA 1SKOA 1YLTA 3TOIA 3ULFA 1PWCA 5M1AA 3LI9A 2G2WA 3HLCA 3T50A 4GD8A 3PXPA 2WGWB 2Z2LB 1ODVA 5AVFA 2XFTA 4C6YA 5EECA 5IT5A 4JGRA 2Z6CA 1FILA 2XDMA 4EU0A 3GVBA 4MEZA 2IWCA 3LY3A 3D4FA 4YINA 3MKEA 4B4ZA 1ZHHB 3PBQA 2IWBA 4E3OA 3C2WA 5CGXA 3ZFZA 1IFQA
chains in the Genus database with same CATH topology
1MZUA 3EGDC 2GJ3A 2Z6DA 3U2AA 2CMNA 4HQAA 1XFQA 4NKPA 2HJ9C 4O0PA 3KYZA 3UE3A 4OOMA 1TS6A 3NJAA 1V9ZA 2PYRA 2ZOHA 3LIFA 2HF6A 1NWZA 3KSGA 2PR6A 3BQ8A 1P9WA 1YSPA 5G4ZA 4PKYA 4NEED 4BJPA 2PD7A 4GS9A 5LBRA 4HP4A 4BBVA 3C8CA 1LSVA 2B18A 1W63M 2WKQA 4Y3IA 1GSVA 1OT9A 1XJ6A 3MJQA 1YAXA 5HDDA 4WEKA 1XFNA 3H7WB 3KX0X 4RQ9A 1S66L 3E4PA 4MN6A 3IBRA 2YKFA 1GSXA 5DJUA 1VB6A 2H28A 1H3QA 1F9IA 3F1PA 2I9VA 3D3OA 3E4OA 4UQIM 2Y8HA 3MMHA 1OT6A 2XROA 2HGVA 3CAXA 3VE3A 2O0YA 4PKYG 3PBSA 4BMWA 4E04A 2IA2A 4EERA 2VZWA 3H82B 4LPZA 3VE4A 2QKPA 5HD3A 3GDIA 5DKLA 4HOIA 2XSSA 3EOIA 4Q0HA 4NXGA 1P97A 2D01A 2P7JA 4Z1WA 3RH8B 4WL9A 3T4QA 4IUKA 2M7VA 3CLOA 2O99A 4G3KA 3T4TA 3MFXA 2V0UA 1EW0A 2VV8A 5L8MA 3G6OA 4IUHA 2L1MA 3DBAA 4YNRA 2PR5A 5DFYA 3T4OA 3IBJA 2QHKA 4P6ZM 1TF1A 4ETXA 5HWWA 3RFBA 3LR0A 4GHIB 3R7WA 4GJ4A 4F3LB 3LFVA 4CLCD 3HJIA 3T4LA 3TJZC 1T18A 2K2NA 2W3EA 1WA9A 2W27A 3NOTC 1UWPX 1ZTUA 4EEUA 2OAQ1 5HWVA 2W1RA 2HJEA 3E98A 4H6JA 3CUEC 5F6AA 3IS2B 4Y5FA 5HWTA 2PT7A 4DJ2A 3LR5A 5AJGA 3UMEA 3H7WA 3PR6A 4MN5A 2JN7A 4UEYA 5HD5A 5I5LA 2Y79A 3LR4A 4I3AA 2W0NA 1JNUA 3F1OB 3PYPA 4G3VA 4ETZA 5HPIA 4GCZA 3F1NB 3B42A 2WKPA 3TRCA 3MQQA 2EWWA 2VEAA 2VGLS 5AVEA 5HDSA 3UB9A 4B93A 4LRXC 1UWNX 2W1TB 4GLQA 1NRJA 2OWJA 4CQHA 4DMZA 1G28A 3KSHA 2PHYA 3PBRA 3P7NA 3E4QA 3JVVA 2INWA 3BW6A 4HY8A 3CI6A 3K3CA 2XA7M 3LYXA 4FSFA 4AFIA 3KSIA 2PD8A 3T4KA 2W3FA 3EEHA 3RTYA 2PYPA 1T1CA 2ZMVA 2V0WA 3KSFA 1TS8A 3A0VA 4EESA 5DKKA 4DJ3A 2J80A 5FL3A 4EUVA 5TJJA 4R3AA 1S4SA 2O9AA 2O9CA 3NOPC 2KX6A 4HH2A 2EWVA 2QJ5A 4F3LA 1STZA 1S4RA 3OBFA 4KUOA 2YKHA 2JKTI 4HJ3A 4LLOB 3V67A 3PHYA 5G4YA 4Q0IA 4WELA 3S7OA 3HJKA 3D72A 4PHTA 3FPWA 4BWIA 4HIAA 3VOLA 3BWLA 5HZHA 3LIBA 3SW1A 1S1ZA 4K08A 2V1BA 2KOIA 3EGXC 2L0WA 3PBOA 3C38A 5A8BA 1N9OA 2K7SA 3T4SA 4KUKA 1T1AA 4II7A 4LRYC 2DMWA 1OJ5A 1Y28A 2W3DA 1NLZA 4XT2B 5KIZA 1OTIA 1V9YA 4L9FA 3UB6A 1TS7A 1DRMA 3F1OA 3LIAA 4JGQA 2LB9A 5DF9A 5MC7A 4ARZB 3F1NA 3OCLA 3S7PA 2JKTM 4B9OA 4GW9A 3MXQA 3NHQA 3PBTA 1UGUA 4WEJA 3UB8A 3EQUA 2A24B 3LI8A 1LT0A 3EWKA 3T4JA 3CUEA 5J7EA 3EEAA 4DN0A 1DP8A 1XJ2A 3FC7A 2M7UA 3E0YA 3JVUA 4WN5A 1OTAA 4CLCE 3F1PB 1N9NA 3LIDA 4KQDA 2OOLA 4WLAA 3W2ZA 4NXFA 3OCNA 4ME4A 2J3TD 4M4XA 2P08A 1BYWA 1OTBA 5J3WA 4CLCC 5K5BA 2MJ6A 4Q0JA 3O5YA 3UB7A 4YOFA 1OTDA 4HHDA 2J3WA 3P01A 1DP6A 3B47A 3TW8A 4R38A 2KLIA 2FZ0A 2VJWA 3UE6A 4MDZA 3LICA 5DJTA 5EFWA 1KOUA 5IS1A 2JKRI 4G3WA 4L9GA 1F5MA 1G6OA 1T1BA 4HJ6A 3LR3A 4MN7A 4BBUA 2R78A 3H82A 3PBNA 2J3TC 1D06A 2D02A 2M1CA 4I3IA 2QJ7A 1OPXA 4BBTA 4I5SA 4JGPA 3LUQA 4IJGA 2A2LA 3VV4A 1NLYA 2PDRA 4CLCB 3ZYTA 5HDCA 2GZAA 1N9LA 1P0ZA 2V9AA 3R7WB 2JHEA 3TE8A 3ICYA 3H9WA 4I3JA 4XT2A 5F69A 2QYBA 4HI4A 1F98A 2XRNA 3HCYA 3LIEA 5CX7A 5DFXA 1T19A 3OLOA 4ARZA 4IHQA 2JKRM 4GHIA 1D7EA 1YKDA 3BY8A 1GSWA 4WUJA 2ZMFA 1X0OA 4H6JB 5TBMB 2QWSA 2W3GA 2VA0A 1TD5A 2K31A 2A24A 4NXBA 3NOUC 3EQVA 2GNXA 1S67L 3K2NA 4HNBA 4EETB 3R4KA 3GECA 3BQAA 1LSWA 2NUPC 4L9EA 4LRZE 1OTEA 2VV6A 4EEPA 1XJ3A 2NUTC 1S1YA 2EA9A 5HSQA 4Y2FA 5C5KA 1H8MA 3IS2A 3MQ0A 4HP9A 2XA7S 4NXEA 2B02A 2VKSA 4YWZA 4I39A 3A0RA 5F5YA 1TS0A 4O01A 4EW7A 2OWHA 1P9RA 4GS9B 3KYQA 5HPFA 2W3HA 1LSXA 2OAP1 4L0LA 4R70A 4HH3A 2L4RA 4O8GA 2ZBBA 2W1TA 1YSQA 4PAUA 5IU1A 4R6LA 2WKRA 2HV1A 4KQOA 3CWFA 3ZQ5A 4UQIS 1XJ4A 3B33A 1W63Q 3FG8A 2GX5A 1IOUA 2VX8A 3MR0A 2V1AA 2VGLM 4MCWA 2ZOIA 5HL6A 2VLGA 3UMDA 5J4EA 4ZRRA 2G7UA 4I38A 4CLCA 4EQ1A 2LB5A 2BASA 1OJGA 3ULFA 3MF0A 1DP9A 3LI9A 3KO6A 2FH5A 3A0SA 3K3DA 3T50A 3OC2A 3PXPA 1MKMA 3BY9A 1ODVA 2KDKA 5F68A 5AVFA 4WF0A 3S7QA 5IT5A 4JGRA 3S7NA 2Z6CA 4EU0A 1VHMA 1MC0A 3BJNA 2O9BA 3MQOA 4OOLA 3C30A 5TBMA 4P6ZS 4JGOA 4EXOA 3FPVA 1LL8A 4QPRA 2P04A 3OOVA 1ZHHB 3PBQA 3CITA 2VV7A 3C2WA 1IFQA 4MMNA 4HJ4A 4FOFA 5KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZU A;  2GJ3 A;  2Z6D A;  2CMN A;  4HQA A;  1XFQ A;  1TS6 A;  3NJA A;  1V9Z A;  2PYR A;  2ZOH A;  3LIF A;  1NWZ A;  2PR6 A;  5G4Z A;  4PKY A;  2PD7 A;  4GS9 A;  4HP4 A;  4BBV A;  3C8C A;  1LSV A;  2WKQ A;  1GSV A;  1OT9 A;  1XJ6 A;  3MJQ A;  5HDD A;  1XFN A;  3H7W B;  3KX0 X;  4RQ9 A;  1S66 L;  3E4P A;  4MN6 A;  3IBR A;  2YKF A;  1GSX A;  5DJU A;  1VB6 A;  2H28 A;  1F9I A;  3F1P A;  2I9V A;  3E4O A;  1OT6 A;  3CAX A;  3VE3 A;  4PKY G;  4E04 A;  4EER A;  3H82 B;  4LPZ A;  3VE4 A;  2QKP A;  5HD3 A;  3GDI A;  5DKL A;  4HOI A;  4NXG A;  1P97 A;  2D01 A;  2P7J A;  3RH8 B;  4WL9 A;  3CLO A;  3MFX A;  2V0U A;  1EW0 A;  2VV8 A;  3G6O A;  2L1M A;  2PR5 A;  2QHK A;  5HWW A;  4GHI B;  4F3L B;  3HJI A;  1T18 A;  1WA9 A;  2W27 A;  3NOT C;  1UWP X;  4EEU A;  5HWV A;  4H6J A;  5F6A A;  3IS2 B;  5HWT A;  4DJ2 A;  3UME A;  3H7W A;  4MN5 A;  2JN7 A;  5HD5 A;  5I5L A;  4I3A A;  2W0N A;  1JNU A;  3F1O B;  3PYP A;  4GCZ A;  3F1N B;  2WKP A;  3MQQ A;  2VEA A;  5AVE A;  5HDS A;  3UB9 A;  4LRX C;  1UWN X;  2OWJ A;  1G28 A;  2PHY A;  3P7N A;  3E4Q A;  4HY8 A;  2INW A;  3K3C A;  3LYX A;  2PD8 A;  3EEH A;  3RTY A;  2PYP A;  1T1C A;  2V0W A;  1TS8 A;  3A0V A;  4EES A;  5DKK A;  4DJ3 A;  2J80 A;  4R3A A;  1S4S A;  3NOP C;  2KX6 A;  4HH2 A;  2QJ5 A;  4F3L A;  1S4R A;  4KUO A;  2YKH A;  4LLO B;  4HJ3 A;  3PHY A;  5G4Y A;  3HJK A;  3D72 A;  4HIA A;  3VOL A;  3BWL A;  5HZH A;  3LIB A;  3SW1 A;  1S1Z A;  4K08 A;  2V1B A;  2L0W A;  5A8B A;  1N9O A;  2K7S A;  4KUK A;  1T1A A;  4LRY C;  1OJ5 A;  1Y28 A;  4XT2 B;  5KIZ A;  1OTI A;  1V9Y A;  4L9F A;  3UB6 A;  1TS7 A;  1DRM A;  3F1O A;  3LIA A;  4JGQ A;  3F1N A;  4B9O A;  4GW9 A;  3MXQ A;  3NHQ A;  1UGU A;  3UB8 A;  2A24 B;  3LI8 A;  1LT0 A;  3EWK A;  5J7E A;  1DP8 A;  1XJ2 A;  3FC7 A;  4WN5 A;  1OTA A;  3F1P B;  1N9N A;  3LID A;  4KQD A;  2OOL A;  4WLA A;  4NXF A;  4M4X A;  1BYW A;  1OTB A;  5J3W A;  3UB7 A;  1OTD A;  4HHD A;  1DP6 A;  4R38 A;  3UE6 A;  3LIC A;  5DJT A;  5EFW A;  1KOU A;  5IS1 A;  4L9G A;  1T1B A;  4HJ6 A;  4BBU A;  2R78 A;  3H82 A;  1D06 A;  2D02 A;  2M1C A;  4I3I A;  2QJ7 A;  4BBT A;  4I5S A;  4JGP A;  3LUQ A;  2PDR A;  5HDC A;  1N9L A;  1P0Z A;  2V9A A;  2JHE A;  3ICY A;  3H9W A;  4I3J A;  4XT2 A;  5F69 A;  4HI4 A;  1F98 A;  3LIE A;  1T19 A;  3OLO A;  4GHI A;  1D7E A;  3BY8 A;  1GSW A;  4WUJ A;  1X0O A;  4H6J B;  5TBM B;  2QWS A;  2A24 A;  4NXB A;  3NOU C;  1S67 L;  4HNB A;  4EET B;  3GEC A;  1LSW A;  4L9E A;  4LRZ E;  1OTE A;  2VV6 A;  4EEP A;  1XJ3 A;  1S1Y A;  2EA9 A;  5HSQ A;  3IS2 A;  4HP9 A;  4NXE A;  2B02 A;  4YWZ A;  4I39 A;  3A0R A;  5F5Y A;  1TS0 A;  4EW7 A;  2OWH A;  4GS9 B;  1LSX A;  4R70 A;  4HH3 A;  2L4R A;  2ZBB A;  5IU1 A;  4R6L A;  2WKR A;  2HV1 A;  3CWF A;  3ZQ5 A;  1XJ4 A;  3B33 A;  3FG8 A;  3MR0 A;  2V1A A;  2ZOI A;  2VLG A;  3UMD A;  5J4E A;  4I38 A;  4EQ1 A;  2BAS A;  1OJG A;  3ULF A;  1DP9 A;  3LI9 A;  3A0S A;  3K3D A;  3T50 A;  3BY9 A;  1ODV A;  2KDK A;  5F68 A;  5AVF A;  4WF0 A;  4JGR A;  2Z6C A;  3MQO A;  5TBM A;  4JGO A;  4EXO A;  1LL8 A;  2VV7 A;  3C2W A;  4HJ4 A; 
#chains in the Genus database with same CATH topology
 1MZU A;  5EPH A;  2Z6D A;  3IX8 A;  2CMN A;  4HQA A;  3OPL A;  3NC8 A;  3KYZ A;  2P9V A;  3NJA A;  5FDS A;  3O88 A;  4KZ6 A;  5G4Z A;  3NI9 A;  4UA7 A;  2PD7 A;  5LBR A;  1L3L A;  4HP4 A;  5DF7 A;  3FKV A;  4BBV A;  1PRQ A;  3C8C A;  1L2S A;  5F82 A;  4EUZ A;  5I94 A;  1XX2 A;  4O7D A;  4WEK A;  3KX0 X;  5FEG A;  1S66 L;  3E4P A;  1H3Q A;  1I2S A;  3TSG A;  1C3B A;  1ONH A;  2HGV A;  4WZ4 A;  3VE3 A;  3T1X A;  3HUN A;  3M2J A;  1BLC A;  4LPZ A;  5A92 A;  2XQZ A;  4HOI A;  3EOI A;  3G2Z A;  2ZL1 B;  4NXG A;  4X1L A;  2QZ6 A;  2M7V A;  1CEF A;  1NZO A;  5HAP A;  3VOY A;  1PW8 A;  2L1M A;  3DBA A;  4YNR A;  2PR5 A;  3ZDJ A;  1TF1 A;  2XD5 A;  1Y54 A;  5FAT A;  4GHI B;  4F3L B;  3IT9 A;  3FV7 A;  3C5A A;  2WAF A;  1H5X A;  2W27 A;  3HUM A;  3IX3 A;  3UO9 A;  2V1Z A;  4EEU A;  2OAQ 1;  3LO7 A;  2XGN A;  3IHA A;  5A93 A;  1PNE A;  4QHC A;  3IF6 C;  5HWT A;  2PT7 A;  3CG5 A;  5D3O A;  3UME A;  3OPH A;  3O86 A;  4UA9 A;  3UDI A;  1KGE A;  4UEY A;  2Q0O A;  4I3A A;  4QU3 A;  4G3V A;  4JXW A;  3B42 A;  3UB9 A;  1UWN X;  1VM1 A;  2W1T B;  3IQA A;  1IYP A;  1NRJ A;  4UA6 A;  4C75 A;  5FA7 A;  3JVV A;  3BW6 A;  3BRM A;  1M40 A;  3CI6 A;  4EBP A;  1PW1 A;  2XA7 M;  1L0F A;  5FQQ A;  1K56 D;  4AFI A;  5EOO A;  2X71 A;  2PD8 A;  4OOY A;  3BEB A;  4KG6 A;  1G5U A;  4IVK A;  1JWV A;  1K6R A;  4HEF A;  3A0V A;  4DJ3 A;  2J80 A;  5FL3 A;  4R3A A;  2O9A A;  4KZ9 A;  2HDQ A;  2KX6 A;  3SZT A;  4F3L A;  3OBF A;  1K25 A;  3G2Y A;  2JKT I;  4BLM A;  5G4Y A;  3ZG7 B;  3S7O A;  3D72 A;  5E43 A;  4HIA A;  3VOL A;  2DRW A;  3BWL A;  3HLF A;  3T1Q B;  2ZLY A;  2V1B A;  1W8Y A;  3EGX C;  2L0W A;  5A8B A;  2K7S A;  4KUK A;  4LRY C;  2DMW A;  3NBL A;  3ITA A;  2W3D A;  2PBD P;  2ZM2 A;  1OTI A;  4L9F A;  5DTT A;  4LV0 A;  3UB6 A;  3GV9 A;  5DF9 A;  3IH9 A;  1LI9 A;  1IKG A;  3IWQ A;  1PZO A;  3PBT A;  1UGU A;  1JTG A;  5GLB A;  1YLZ A;  2A24 B;  3LI8 A;  1LT0 A;  2P74 A;  3CUE A;  4KZ7 A;  1DP8 A;  1XJ2 A;  3FC7 A;  3QP4 A;  2I72 A;  4NXF A;  4HBT A;  2J3T D;  2P08 A;  2ZM8 A;  4Y17 A;  1S0W A;  2AVX A;  2HZ5 A;  4HES A;  3HLD A;  4YOF A;  1OTD A;  4HHD A;  2J3W A;  4Y0T A;  2FZ0 A;  3WS5 A;  2WGV A;  2H0T A;  4L9G A;  4U0T A;  1F5M A;  5EOE A;  2XD1 A;  2Y55 A;  1N9B A;  4I3I A;  5HX9 A;  1KDW A;  1OPX A;  3GR2 A;  3LUQ A;  1IYS A;  2E8I A;  5EV0 A;  3UE1 A;  3OPR A;  4DDY A;  3H9W A;  4I3J A;  3CPT B;  2QYB A;  1SCW A;  3HCY A;  3LIE A;  4HBU A;  2JKG A;  3P98 A;  5IHV A;  1GHM A;  2ZMA A;  5JYP A;  3TG9 A;  1NY0 A;  1YKD A;  3BY8 A;  3MS6 A;  5TR7 A;  2JKF A;  2QWS A;  1TEM A;  2VA0 A;  3ZG0 A;  2A24 A;  2XK1 A;  3K2N A;  3ZG8 B;  2E8J A;  3R4K A;  3BQA A;  4E3I A;  4L9E A;  2J9O A;  3OPP A;  4EEP A;  1FSW A;  1CQA A;  4Y2F A;  3LEZ A;  1KVM A;  2HP6 A;  1BT5 A;  1FCM A;  2OV5 A;  4NXE A;  1Y4O A;  2B95 A;  3SH7 A;  2VKS A;  3A0R A;  5F5Y A;  3C7V A;  4E3L A;  4O01 A;  3LCE A;  4EWF A;  4JF4 A;  5HPF A;  2OSU A;  1NRF A;  1XGI A;  4GZB A;  4O8G A;  4R6L A;  2WKR A;  4KQO A;  4MBK A;  5HAQ A;  2OLV A;  3KYE A;  1W79 A;  1IOU A;  4WMC D;  3MR0 A;  4MCW A;  5EVE A;  4E6X A;  3UMD A;  4ZRR A;  5FI6 A;  5EE8 A;  1PI4 A;  2EXB A;  4GOG A;  1OJG A;  2Y2J A;  3G4P A;  1ES3 A;  3V50 A;  1YQS A;  2Y2O A;  2FH5 A;  3LY4 A;  4R3J A;  5FQK A;  5HFO A;  1MKM A;  3BY9 A;  1TDL A;  1E3U A;  5CER A;  3S7Q A;  2ZQ8 A;  1MWS A;  3MXS A;  3HLW A;  2O9B A;  3NCK A;  1E25 A;  4EXO A;  1ES2 A;  3OOV A;  3UPN A;  1YLW A;  5KMW A;  4R4S A;  1IKI A;  3CIT A;  2ZC5 B;  1VET B;  2VV7 A;  1U60 A;  3VP2 A;  4FOF A;  2XFS A;  4LV3 A;  2Z2M B;  4F94 A;  4U0X A;  3EGD C;  1LI0 A;  4XUZ A;  3DAV A;  1KVL A;  4JKT A;  4OP8 A;  3Q7V B;  4S2L A;  3BYD A;  1V9Z A;  3IF5 A;  2ZOH A;  1NWZ A;  1IYQ A;  3BQ8 A;  3P09 A;  3ZG5 A;  4QY5 A;  4BL2 A;  4NEE D;  4BJP A;  3O3V A;  1Z09 A;  3IXD A;  1GCE A;  1LSV A;  1ERM A;  1RGY A;  2B18 A;  4ZJ2 A;  1W63 M;  2WKQ A;  4Y3I A;  4ESP A;  5A90 A;  1XJ6 A;  3NUL A;  1FCN A;  3PTE A;  4RQ9 A;  3IBR A;  3VFH A;  5AQ9 A;  1VB6 A;  1PWG A;  2H28 A;  5DTS A;  3UB5 P;  3E4O A;  2Y8H A;  1OT6 A;  3ZGA B;  2XRO A;  1YM1 A;  2O0Y A;  4EQI A;  1XPB A;  3M6B A;  3FZC A;  4E04 A;  2IA2 A;  5EVI D;  3L7H A;  2Y2K A;  3H82 B;  3ZG9 B;  5HD3 A;  2ZD8 A;  4GKU A;  1K55 C;  5DKL A;  2XSS A;  4ZTK A;  4Q0H A;  3VP4 A;  2QPN A;  2V8C A;  3W4Q A;  2BLS A;  4WL9 A;  3T4Q A;  5EM0 A;  4G3K A;  3DTE A;  3MFX A;  1EW0 A;  5AQ7 A;  4KG2 A;  1VET A;  3G6O A;  4DDS A;  4LEN A;  5DFY A;  3T4O A;  2QHK A;  1DY6 A;  4WM9 A;  3VFF A;  1MBL A;  3N8R A;  3Q7V A;  3RFB A;  3N8L A;  3ZNT A;  1GHI A;  2OLU A;  3WWX A;  3R7W A;  4GJ4 A;  4CLC D;  4UHU A;  5FEF A;  3CJM A;  1T18 A;  2K2N A;  4P6B A;  1HTZ A;  3NOT C;  3UNW A;  3A3I A;  3QP1 A;  1MY8 A;  5HWV A;  4PMA A;  1MWR A;  1IEM A;  2WZZ A;  2W1R A;  2HJE A;  3E98 A;  3CUE C;  3IS2 B;  4DJ2 A;  5AJG A;  2UWX A;  5I5L A;  2Y79 A;  2Q9M A;  2W0N A;  5GLA A;  1JNU A;  3PYP A;  3LEQ A;  3TRC A;  3MQQ A;  1TDG A;  2VEA A;  2VGL S;  5AVE A;  3WS4 A;  4B93 A;  5BOH A;  2HP9 A;  4GLQ A;  3RXW A;  3MBZ A;  4DMZ A;  3KSH A;  2PHY A;  3WS0 A;  3E4Q A;  4M3K A;  2INW A;  4N1H A;  2ZC6 B;  4FSF A;  4QJG A;  4R3B A;  2R9W A;  1I2W A;  2ZC3 B;  1W8Q A;  1JTD A;  2ZMV A;  3KSF A;  1A0K A;  1TS8 A;  2WKI A;  3N7W A;  4EES A;  1S4S A;  1VEU B;  4DXC A;  2BTF P;  4CJN A;  4IBR A;  2XH9 A;  2QJ5 A;  4OP5 A;  4K0X A;  4GD6 A;  4EBN A;  1M6K A;  2YKH A;  3V67 A;  1BLS A;  4FTX A;  4PHT A;  3FPW A;  2IWD A;  5HW3 A;  2WGW A;  2HDU A;  4S2M A;  3LIB A;  1ZG6 A;  5CEC A;  3W8K A;  4K08 A;  3PBO A;  5FAO A;  4FH2 A;  4MLL A;  3B3X A;  4II7 A;  1Y28 A;  2RCX A;  5KIZ A;  1D1J A;  2GDN A;  5FDH A;  3C4O A;  2H10 A;  1FCO A;  4JGQ A;  1DJB A;  2J8Y A;  3OCL A;  4MBH A;  3S7P A;  2JKT M;  4B9O A;  4GW9 A;  1Q2Q A;  2PAV P;  1XA1 A;  2WAE A;  3UB8 A;  4D2O A;  3Q1F A;  1FSY A;  1FIK A;  4DN0 A;  1XXM A;  4CLC E;  3F1P B;  4X25 A;  1N9N A;  3V39 A;  4IBX A;  4WLA A;  3VP0 A;  1OTB A;  5J3W A;  4WZ5 A;  2G2U A;  2PRF A;  3O5Y A;  1KGG A;  4N9K A;  3T1R A;  3IWI A;  3P01 A;  1DP6 A;  3B47 A;  4R38 A;  2VJW A;  5EFW A;  1MWU A;  2JKR I;  4R0Q A;  1G6O A;  1BSG A;  4MN7 A;  5E2G A;  2WZX A;  5F1F A;  2J3T C;  2QJ7 A;  3E2L A;  1HD8 A;  4I5S A;  2ZL1 A;  2RL3 A;  4IJG A;  3VV4 A;  4LV2 A;  2PDR A;  1GA0 A;  3IXH A;  1P0Z A;  5CHM A;  3TE8 A;  3ICY A;  3JYI A;  4GNU A;  1F98 A;  1T19 A;  3OLO A;  3VSL A;  2XF3 A;  3VSK A;  1N4O A;  1D7E A;  4GHI A;  5HAR A;  3BFG A;  2ZMF A;  4KQQ A;  4H6J B;  5TBM B;  3FWL A;  1CF0 A;  1TD5 A;  2K31 A;  4NXB A;  2FFF B;  2GNX A;  1S67 L;  2ZQA A;  4HNB A;  2WGI A;  3GEC A;  2NUP C;  1BTL A;  4P85 A;  2NUT C;  4OLG A;  3A3F A;  2Y2N A;  1CJF A;  2V2F F;  4P0M A;  4I39 A;  1CEG A;  1TS0 A;  4P87 A;  3BFE A;  4EW7 A;  5M18 A;  1P9R A;  3G35 A;  4E3N A;  2W3H A;  4L0L A;  2L4R A;  3VOZ A;  2W1T A;  3CWF A;  3IH8 A;  1L0E A;  1XJ4 A;  3B33 A;  4GN2 A;  1YT4 A;  1J9M A;  3FG8 A;  4YFM A;  5HL6 A;  1Z6F A;  3Q07 A;  2G7U A;  5GHZ A;  2HPB A;  4EQ1 A;  5GLD A;  2BAS A;  3WS2 A;  1LL5 A;  4RX2 A;  3MF0 A;  1DP9 A;  3ZNY A;  2C5W B;  3A0S A;  3K3D A;  5CGW A;  1VHM A;  1OME A;  1MC0 A;  3BJN A;  5CTN A;  4X1M A;  3C30 A;  5G18 A;  5TBM A;  4P6Z S;  4JGO A;  3FPV A;  3G31 A;  4QPR A;  2P04 A;  1XA7 A;  1QMF A;  4HJ4 A;  4MMN A;  5KSH A;  3C4P A;  4JXS A;  2A3U A;  4S2K A;  2ZM0 A;  4Q8I A;  3SH9 A;  1QME A;  1PI5 A;  3IXG A;  1XFQ A;  4S2N A;  3AGF A;  3HLG A;  4OOM A;  4X53 A;  1LHY A;  2PYR A;  1K56 A;  1O7E A;  3UE0 A;  1ESI A;  1ESU A;  2PR6 A;  3D9Y A;  1NYM A;  4X56 A;  1CI9 A;  3GRJ A;  1EWZ A;  3BEC A;  1NYY A;  5KZH A;  5DF8 A;  4OPR A;  1GSV A;  2PBY A;  1OT9 A;  3ITB A;  1YAX A;  5HDD A;  1XFN A;  3H7W B;  3M6H A;  2YKF A;  1GSX A;  5DJU A;  1ALQ A;  1F9I A;  3W4P A;  4WBG A;  3MMH A;  1SZV A;  2XLN A;  3UPO A;  5GHY A;  4PKY G;  4E3M A;  3PBS A;  4R1G A;  4EER A;  3VE4 A;  2PU2 A;  3GDI A;  5EM1 A;  3IWO A;  2JBF A;  4QD4 A;  2JE5 A;  4JBF A;  2D01 A;  4Z1W A;  3NY4 A;  4Y13 A;  3RH8 B;  1ZKJ A;  4IUK A;  2O99 A;  3NEC A;  2WUQ A;  2V0U A;  2VV8 A;  3ZHH A;  4IUH A;  5CHJ A;  2EFU A;  5EUA A;  5A91 A;  3QP8 A;  3NDE A;  3IBJ A;  4P6Z M;  4PM6 A;  5CRF A;  4H8R A;  3S1Y A;  3LR0 A;  4KZ4 A;  3A3E A;  2WAD A;  5GL9 A;  4E6W A;  3T4L A;  3OZH A;  3CPT A;  1K4E A;  2W3E A;  1H8Z A;  2EX8 A;  1WA9 A;  1ZTU A;  1YLJ A;  5FAS A;  1KGF A;  3AGD A;  5F6A A;  4B88 A;  1W7F A;  1WYB A;  3H7W A;  1SDE A;  4ZBE A;  3UN7 A;  3SS3 A;  4DRT A;  4NK3 A;  3CMZ A;  5HD5 A;  3LR4 A;  1KE0 A;  3F1O B;  2HDR A;  4GCZ A;  3F1N B;  3AGE A;  1MKI A;  2EWW A;  4WZ5 C;  4K0W A;  5F1G A;  5HDS A;  2VK3 A;  4LRX C;  2DCF A;  5CTM A;  1YMS A;  1K54 A;  4X68 A;  2HDS A;  2OWJ A;  4CQH A;  3NDG A;  1K38 A;  1VQQ A;  3PBR A;  4ZJ3 A;  4E3J A;  3K3C A;  3BFD A;  3QP2 A;  5E2E A;  3WRT A;  4JXG A;  2J9P A;  5L10 A;  5CXW A;  1HVB A;  2PYP A;  1ERO A;  4X69 A;  1T1C A;  4OPZ A;  2ZQD A;  5DKK A;  1F2K A;  4GDB A;  2O9C A;  4S2I A;  3NOP C;  3UY6 A;  1STZ A;  1S4R A;  3PHY A;  3HJK A;  3V3S A;  4BWI A;  4KEN B;  5HZH A;  4BL3 A;  1S1Z A;  4JF5 A;  4X6T A;  1NZU A;  2Y2I A;  3C38 A;  2BG1 A;  2XR0 A;  1T1A A;  2EX6 A;  1K57 A;  1HLU P;  5FQM A;  4XT2 B;  3DTK A;  4X55 A;  1FR1 A;  4Y7P A;  2Y2H A;  3F1O A;  1DRM A;  2Y2M A;  5FQJ A;  4ARZ B;  3F1N A;  3L9K A;  4BQM A;  3MXQ A;  4MBF A;  5CEB A;  3SH8 A;  4WMC A;  1NJ4 A;  4WEJ A;  3UPP A;  3BFF A;  1XKZ A;  1GA9 A;  3M2K A;  3FKW A;  4DKI A;  3EEA A;  1GHP A;  4GDN A;  1PZP A;  5EVL A;  3DW0 A;  3T1S A;  3LID A;  3NIA A;  4KQD A;  5EVI B;  1Q2P A;  3MFD A;  1ZC2 A;  3W2Z A;  3OCN A;  4OVD A;  4M4X A;  1BYW A;  1CI8 A;  1IEL A;  2MJ6 A;  4FCF A;  3UDF A;  3BLS A;  3IX4 A;  3HBR A;  5JYO A;  5FI7 A;  3LIC A;  5J8X A;  5IS1 A;  1MXO A;  1K6S A;  4HJ6 A;  3LR3 A;  4BBU A;  2R78 A;  4KZ8 A;  3H82 A;  2D02 A;  2M1C A;  5L2F A;  1BLH A;  1HZO A;  1NLY A;  4CLC B;  5DTK A;  5HDC A;  2GZA A;  4S2P A;  2JHE A;  1MPL A;  2EX2 A;  4XT2 A;  4HI4 A;  2XRN A;  4S2N C;  5DFX A;  5CX7 A;  5TFQ A;  2V20 A;  4ARZ A;  3IXB A;  2JKR M;  1NXY A;  4OQ0 A;  1ERQ A;  1JWZ A;  1RCJ A;  1AXB A;  2ZC4 B;  1X0O A;  3BLM A;  4D60 A;  3NOU C;  3EQV A;  1ES4 A;  1OTE A;  5FQI A;  3SS5 A;  2QMI A;  5EVI A;  5C5K A;  5HAI A;  3IS2 A;  3MQ0 A;  4N9L A;  2XA7 S;  4K91 A;  1JVJ A;  2B02 A;  1PFL A;  1SDN A;  3FYZ A;  4YWZ A;  1BUE A;  4QWO A;  4E3K A;  3I7J A;  3UDX A;  4GS9 B;  4R70 A;  2B5R A;  3HL9 A;  4HH3 A;  3VP1 A;  3QNC A;  1G68 A;  4PAU A;  5IU1 A;  4ZJ1 A;  2HV1 A;  4UQI S;  2GX5 A;  5CED A;  2V1A A;  2VGL M;  2Y91 A;  2ZOI A;  5J4E A;  2WKH A;  5FAP A;  1WYC A;  4PM7 A;  4I38 A;  4CLC A;  2LB5 A;  1PIO A;  4R4R A;  3Q82 A;  3KO6 A;  2C6W B;  3Q81 A;  4RA7 A;  3QP5 A;  3OC2 A;  1ES5 A;  2KDK A;  5F68 A;  4WF0 A;  5KSC A;  3G32 A;  1VEU A;  3GQZ A;  3S7N A;  1PWD A;  3G34 A;  1FOF A;  2PU4 A;  4KZB A;  1DJA A;  2UV0 E;  4U3T A;  4S2O A;  3MQO A;  4OOL A;  3DWK A;  3IHB A;  3HRE A;  1LL8 A;  4ZDX A;  4JPM A;  4OPY A;  2EX9 A;  4LFU A;  2GJ3 A;  4LGW A;  3U2A A;  3HUO A;  5FSR A;  4BD0 A;  1XP4 A;  4NKP A;  2HJ9 C;  4DE1 A;  3MZF A;  4O0P A;  3UE3 A;  2H5S A;  1KE4 A;  1TS6 A;  5AQA A;  3LIF A;  3CHW P;  2HF6 A;  3KSG A;  3HVF A;  3MXR A;  1P9W A;  1YSP A;  2EXA A;  4JXV A;  5HL1 A;  4R23 A;  4XUX A;  4PKY A;  4GS9 A;  1K54 C;  4OKP A;  2X02 A;  3MJQ A;  3MZE A;  2Y2Q A;  3C7U A;  1SKF A;  3VMA A;  4MN6 A;  1H8Y A;  3F1P A;  2I9V A;  3D3O A;  4UQI M;  1K55 A;  2WK0 A;  3CAX A;  5FI2 A;  4KZ5 A;  4EBL A;  3W4O A;  4BMW A;  1G6A A;  2VZW A;  2QKP A;  1BLP A;  4ZAM A;  4PPR A;  5CHU A;  4LV1 A;  1P97 A;  2P7J A;  4NG2 A;  3RJU A;  2Y2L A;  3CLO A;  1KDS A;  3T4T A;  3LGO A;  2Y2P A;  4PM5 A;  5L8M A;  1ZG4 A;  1L0D A;  4ETX A;  4RYE A;  5AQB A;  5HWW A;  1K57 C;  4EV4 A;  2ACG A;  2H0Y A;  4RX3 A;  3LFV A;  3HJI A;  3TJZ C;  1K0K A;  3QNB A;  4A5R A;  1YLP A;  1UWP X;  3ZVT A;  4DE3 A;  1SHV A;  3QP6 A;  3ZCZ A;  1E3U D;  4H6J A;  4OQH A;  5GLC A;  3PAE A;  5TGF A;  4Y5F A;  2JCH A;  3LR5 A;  3PR6 A;  4MN5 A;  2JN7 A;  1L0G A;  4ETZ A;  4Y15 A;  4CPK A;  5HPI A;  2WKP A;  4IED A;  1YLY A;  5L07 A;  4KG5 A;  3DTI A;  2WKE A;  3RXX A;  1G28 A;  2VGJ A;  2VGK A;  3P7N A;  4HY8 A;  1RGZ A;  3IF6 B;  3LYX A;  1FQG A;  2X01 A;  3KSI A;  2ZQ9 A;  4OPQ A;  3HLE A;  3T4K A;  2WYX A;  2W3F A;  3EEH A;  3RTY A;  4KQR A;  2ZC7 A;  5E2H A;  4OON A;  2V0W A;  3JPU A;  2R9X A;  3QHY A;  4QY6 A;  4EUV A;  5TJJ A;  4Z9Q A;  4OH0 A;  3V3R A;  3GTC A;  4HH2 A;  2EWV A;  4KUO A;  3WS1 A;  1AWI A;  3DWZ A;  4LLO B;  4HJ3 A;  4Q0I A;  4PM8 A;  4S2J A;  4WEL A;  1H0M A;  2Y59 A;  4C3Q A;  3SW1 A;  1I5Q A;  1RP5 A;  2FFY A;  1LLB A;  3VP3 A;  4IVI A;  2KOI A;  4KZA A;  1TVF A;  3E2K A;  2J7V A;  1PYY A;  5L09 A;  3WRZ A;  1N9O A;  3T4S A;  4KZ3 A;  1OJ5 A;  4JF6 A;  1NLZ A;  4LCL A;  4FH4 A;  5EVI C;  1V9Y A;  4MNR A;  1TS7 A;  3LIA A;  2LB9 A;  5MC7 A;  2V8F A;  3T12 B;  2DNS A;  1S6R A;  1FR6 A;  3NHQ A;  3O87 A;  3BFC A;  5F83 A;  5GHX A;  3EQU A;  4QB8 A;  2ZJ9 A;  3G30 A;  3EWK A;  4PM9 A;  3T4J A;  4WYY A;  1ACF A;  5U47 A;  3BM6 A;  1J3W A;  5J7E A;  4DE0 A;  3IF6 A;  2M7U A;  3E0Y A;  3N4I A;  1BZA A;  3JVU A;  4WN5 A;  1KE3 A;  1OTA A;  3SS4 A;  2Y4A A;  2OOL A;  2ZQC A;  2Q9N A;  3GMW A;  3Q7Z A;  4ME4 A;  4CLC C;  5K5B A;  4FD8 A;  4Q0J A;  3UB7 A;  1DJC A;  1YPR A;  3TW8 A;  1XGJ A;  1WE4 A;  2KLI A;  1YMX A;  4GB7 A;  3UE6 A;  4LCM A;  4MDZ A;  5DJT A;  4N92 A;  1KOU A;  4G3W A;  3PAG A;  1T1B A;  4DXB A;  4XXR A;  4OLD A;  3N6I A;  3PBN A;  4OQG A;  1D06 A;  3DTM A;  3ISG A;  1LL9 A;  4BD1 A;  4BBT A;  4BEN A;  4JGP A;  4B4X A;  2A2L A;  1E4D A;  3CZD A;  3S22 A;  3ZYT A;  1SKO B;  1N9L A;  2V9A A;  3R7W B;  5E2F A;  5F69 A;  4DE2 A;  1JWP A;  3A3D A;  3ZVW A;  3HLB A;  4FUW A;  4IHQ A;  3MKF A;  5DVA A;  1GSW A;  4UAA A;  4WUJ A;  5FAQ A;  1IYO A;  2W3G A;  5M19 A;  3S4X A;  4OQI A;  3V5M A;  4Y0O A;  4EET B;  4ID4 A;  1ONG A;  2CC1 A;  3SOI A;  1EI5 A;  1LSW A;  4LRZ E;  3A3J A;  2VV6 A;  1XJ3 A;  1S1Y A;  2EA9 A;  5HSQ A;  1H8M A;  2A49 A;  4Y0U A;  3N8S A;  4HP9 A;  2P9V B;  1O07 A;  3MZD A;  2EFX A;  4DF6 A;  1K4F A;  3U4L P;  2OWH A;  3KYQ A;  1MWT A;  2HP5 A;  1LSX A;  2OAP 1;  2ZQ7 A;  2ZBB A;  1YSQ A;  1BUL A;  3ZQ5 A;  1W5D A;  1W63 Q;  5CGS A;  2VX8 A;  4NET A;  2XEP A;  4JLF A;  2VLG A;  4RVA A;  4N1X A;  3GSG A;  1CK3 A;  3MSH A;  5FQ9 A;  2JC7 A;  2Y2G A;  1SKO A;  1YLT A;  3TOI A;  3ULF A;  1PWC A;  5M1A A;  3LI9 A;  2G2W A;  3HLC A;  3T50 A;  4GD8 A;  3PXP A;  2WGW B;  2Z2L B;  1ODV A;  5AVF A;  2XFT A;  4C6Y A;  5EEC A;  5IT5 A;  4JGR A;  2Z6C A;  1FIL A;  2XDM A;  4EU0 A;  3GVB A;  4MEZ A;  2IWC A;  3LY3 A;  3D4F A;  4YIN A;  3MKE A;  4B4Z A;  1ZHH B;  3PBQ A;  2IWB A;  4E3O A;  3C2W A;  5CGX A;  3ZFZ A;  1IFQ A; 
#chains in the Genus database with same CATH homology
 1MZU A;  3EGD C;  2GJ3 A;  2Z6D A;  3U2A A;  2CMN A;  4HQA A;  1XFQ A;  4NKP A;  2HJ9 C;  4O0P A;  3KYZ A;  3UE3 A;  4OOM A;  1TS6 A;  3NJA A;  1V9Z A;  2PYR A;  2ZOH A;  3LIF A;  2HF6 A;  1NWZ A;  3KSG A;  2PR6 A;  3BQ8 A;  1P9W A;  1YSP A;  5G4Z A;  4PKY A;  4NEE D;  4BJP A;  2PD7 A;  4GS9 A;  5LBR A;  4HP4 A;  4BBV A;  3C8C A;  1LSV A;  2B18 A;  1W63 M;  2WKQ A;  4Y3I A;  1GSV A;  1OT9 A;  1XJ6 A;  3MJQ A;  1YAX A;  5HDD A;  4WEK A;  1XFN A;  3H7W B;  3KX0 X;  4RQ9 A;  1S66 L;  3E4P A;  4MN6 A;  3IBR A;  2YKF A;  1GSX A;  5DJU A;  1VB6 A;  2H28 A;  1H3Q A;  1F9I A;  3F1P A;  2I9V A;  3D3O A;  3E4O A;  4UQI M;  2Y8H A;  3MMH A;  1OT6 A;  2XRO A;  2HGV A;  3CAX A;  3VE3 A;  2O0Y A;  4PKY G;  3PBS A;  4BMW A;  4E04 A;  2IA2 A;  4EER A;  2VZW A;  3H82 B;  4LPZ A;  3VE4 A;  2QKP A;  5HD3 A;  3GDI A;  5DKL A;  4HOI A;  2XSS A;  3EOI A;  4Q0H A;  4NXG A;  1P97 A;  2D01 A;  2P7J A;  4Z1W A;  3RH8 B;  4WL9 A;  3T4Q A;  4IUK A;  2M7V A;  3CLO A;  2O99 A;  4G3K A;  3T4T A;  3MFX A;  2V0U A;  1EW0 A;  2VV8 A;  5L8M A;  3G6O A;  4IUH A;  2L1M A;  3DBA A;  4YNR A;  2PR5 A;  5DFY A;  3T4O A;  3IBJ A;  2QHK A;  4P6Z M;  1TF1 A;  4ETX A;  5HWW A;  3RFB A;  3LR0 A;  4GHI B;  3R7W A;  4GJ4 A;  4F3L B;  3LFV A;  4CLC D;  3HJI A;  3T4L A;  3TJZ C;  1T18 A;  2K2N A;  2W3E A;  1WA9 A;  2W27 A;  3NOT C;  1UWP X;  1ZTU A;  4EEU A;  2OAQ 1;  5HWV A;  2W1R A;  2HJE A;  3E98 A;  4H6J A;  3CUE C;  5F6A A;  3IS2 B;  4Y5F A;  5HWT A;  2PT7 A;  4DJ2 A;  3LR5 A;  5AJG A;  3UME A;  3H7W A;  3PR6 A;  4MN5 A;  2JN7 A;  4UEY A;  5HD5 A;  5I5L A;  2Y79 A;  3LR4 A;  4I3A A;  2W0N A;  1JNU A;  3F1O B;  3PYP A;  4G3V A;  4ETZ A;  5HPI A;  4GCZ A;  3F1N B;  3B42 A;  2WKP A;  3TRC A;  3MQQ A;  2EWW A;  2VEA A;  2VGL S;  5AVE A;  5HDS A;  3UB9 A;  4B93 A;  4LRX C;  1UWN X;  2W1T B;  4GLQ A;  1NRJ A;  2OWJ A;  4CQH A;  4DMZ A;  1G28 A;  3KSH A;  2PHY A;  3PBR A;  3P7N A;  3E4Q A;  3JVV A;  2INW A;  3BW6 A;  4HY8 A;  3CI6 A;  3K3C A;  2XA7 M;  3LYX A;  4FSF A;  4AFI A;  3KSI A;  2PD8 A;  3T4K A;  2W3F A;  3EEH A;  3RTY A;  2PYP A;  1T1C A;  2ZMV A;  2V0W A;  3KSF A;  1TS8 A;  3A0V A;  4EES A;  5DKK A;  4DJ3 A;  2J80 A;  5FL3 A;  4EUV A;  5TJJ A;  4R3A A;  1S4S A;  2O9A A;  2O9C A;  3NOP C;  2KX6 A;  4HH2 A;  2EWV A;  2QJ5 A;  4F3L A;  1STZ A;  1S4R A;  3OBF A;  4KUO A;  2YKH A;  2JKT I;  4HJ3 A;  4LLO B;  3V67 A;  3PHY A;  5G4Y A;  4Q0I A;  4WEL A;  3S7O A;  3HJK A;  3D72 A;  4PHT A;  3FPW A;  4BWI A;  4HIA A;  3VOL A;  3BWL A;  5HZH A;  3LIB A;  3SW1 A;  1S1Z A;  4K08 A;  2V1B A;  2KOI A;  3EGX C;  2L0W A;  3PBO A;  3C38 A;  5A8B A;  1N9O A;  2K7S A;  3T4S A;  4KUK A;  1T1A A;  4II7 A;  4LRY C;  2DMW A;  1OJ5 A;  1Y28 A;  2W3D A;  1NLZ A;  4XT2 B;  5KIZ A;  1OTI A;  1V9Y A;  4L9F A;  3UB6 A;  1TS7 A;  1DRM A;  3F1O A;  3LIA A;  4JGQ A;  2LB9 A;  5DF9 A;  5MC7 A;  4ARZ B;  3F1N A;  3OCL A;  3S7P A;  2JKT M;  4B9O A;  4GW9 A;  3MXQ A;  3NHQ A;  3PBT A;  1UGU A;  4WEJ A;  3UB8 A;  3EQU A;  2A24 B;  3LI8 A;  1LT0 A;  3EWK A;  3T4J A;  3CUE A;  5J7E A;  3EEA A;  4DN0 A;  1DP8 A;  1XJ2 A;  3FC7 A;  2M7U A;  3E0Y A;  3JVU A;  4WN5 A;  1OTA A;  4CLC E;  3F1P B;  1N9N A;  3LID A;  4KQD A;  2OOL A;  4WLA A;  3W2Z A;  4NXF A;  3OCN A;  4ME4 A;  2J3T D;  4M4X A;  2P08 A;  1BYW A;  1OTB A;  5J3W A;  4CLC C;  5K5B A;  2MJ6 A;  4Q0J A;  3O5Y A;  3UB7 A;  4YOF A;  1OTD A;  4HHD A;  2J3W A;  3P01 A;  1DP6 A;  3B47 A;  3TW8 A;  4R38 A;  2KLI A;  2FZ0 A;  2VJW A;  3UE6 A;  4MDZ A;  3LIC A;  5DJT A;  5EFW A;  1KOU A;  5IS1 A;  2JKR I;  4G3W A;  4L9G A;  1F5M A;  1G6O A;  1T1B A;  4HJ6 A;  3LR3 A;  4MN7 A;  4BBU A;  2R78 A;  3H82 A;  3PBN A;  2J3T C;  1D06 A;  2D02 A;  2M1C A;  4I3I A;  2QJ7 A;  1OPX A;  4BBT A;  4I5S A;  4JGP A;  3LUQ A;  4IJG A;  2A2L A;  3VV4 A;  1NLY A;  2PDR A;  4CLC B;  3ZYT A;  5HDC A;  2GZA A;  1N9L A;  1P0Z A;  2V9A A;  3R7W B;  2JHE A;  3TE8 A;  3ICY A;  3H9W A;  4I3J A;  4XT2 A;  5F69 A;  2QYB A;  4HI4 A;  1F98 A;  2XRN A;  3HCY A;  3LIE A;  5CX7 A;  5DFX A;  1T19 A;  3OLO A;  4ARZ A;  4IHQ A;  2JKR M;  4GHI A;  1D7E A;  1YKD A;  3BY8 A;  1GSW A;  4WUJ A;  2ZMF A;  1X0O A;  4H6J B;  5TBM B;  2QWS A;  2W3G A;  2VA0 A;  1TD5 A;  2K31 A;  2A24 A;  4NXB A;  3NOU C;  3EQV A;  2GNX A;  1S67 L;  3K2N A;  4HNB A;  4EET B;  3R4K A;  3GEC A;  3BQA A;  1LSW A;  2NUP C;  4L9E A;  4LRZ E;  1OTE A;  2VV6 A;  4EEP A;  1XJ3 A;  2NUT C;  1S1Y A;  2EA9 A;  5HSQ A;  4Y2F A;  5C5K A;  1H8M A;  3IS2 A;  3MQ0 A;  4HP9 A;  2XA7 S;  4NXE A;  2B02 A;  2VKS A;  4YWZ A;  4I39 A;  3A0R A;  5F5Y A;  1TS0 A;  4O01 A;  4EW7 A;  2OWH A;  1P9R A;  4GS9 B;  3KYQ A;  5HPF A;  2W3H A;  1LSX A;  2OAP 1;  4L0L A;  4R70 A;  4HH3 A;  2L4R A;  4O8G A;  2ZBB A;  2W1T A;  1YSQ A;  4PAU A;  5IU1 A;  4R6L A;  2WKR A;  2HV1 A;  4KQO A;  3CWF A;  3ZQ5 A;  4UQI S;  1XJ4 A;  3B33 A;  1W63 Q;  3FG8 A;  2GX5 A;  1IOU A;  2VX8 A;  3MR0 A;  2V1A A;  2VGL M;  4MCW A;  2ZOI A;  5HL6 A;  2VLG A;  3UMD A;  5J4E A;  4ZRR A;  2G7U A;  4I38 A;  4CLC A;  4EQ1 A;  2LB5 A;  2BAS A;  1OJG A;  3ULF A;  3MF0 A;  1DP9 A;  3LI9 A;  3KO6 A;  2FH5 A;  3A0S A;  3K3D A;  3T50 A;  3OC2 A;  3PXP A;  1MKM A;  3BY9 A;  1ODV A;  2KDK A;  5F68 A;  5AVF A;  4WF0 A;  3S7Q A;  5IT5 A;  4JGR A;  3S7N A;  2Z6C A;  4EU0 A;  1VHM A;  1MC0 A;  3BJN A;  2O9B A;  3MQO A;  4OOL A;  3C30 A;  5TBM A;  4P6Z S;  4JGO A;  4EXO A;  3FPV A;  1LL8 A;  4QPR A;  2P04 A;  3OOV A;  1ZHH B;  3PBQ A;  3CIT A;  2VV7 A;  3C2W A;  1IFQ A;  4MMN A;  4HJ4 A;  4FOF A;  5KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...