3HJPA

The crystal structure of bcp4 from sulfolobus solfataricus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
MVEIGEKAPEIELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVSTKEMSTFRDSMAKFNEVNAVVIGISVDPPFSNKAFKEQNKINFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIVRYKWVSEDPTKEPNYDEIKDVVTKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin, bacterioferritin comigratory protein homolog
publication title Exploring the catalytic mechanism of the first dimeric Bcp: functional, structural and docking analysis
rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 47
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hjpA00
4BL7A 4TN8A 1BYEA 4MMMA 3C1RA 1WIKA 5HR3A 1EGRA 5DVBA 2RM5A 1O73A 4I2TA 1S3AA 5CYYA 4LLRA 1JLVA 4KA0A 1GH2A 3CRUA 1O8WA 3DYRA 2DJ1A 1A2MA 3HD5A 4KDUA 2OBIA 3KCMA 2OADA 2PMTA 2O7KA 2HZEB 4GXZA 2OJLA 2IMEA 1A0FA 4RI6A 2VL3A 4QL7A 1SK1A 1YY7A 2VUPA 4J2FA 3H79A 1A8YA 2I1UA 5CRHA 2KHPA 5DALB 3ZLPA 2MMZA 1K0OA 2VCQA 4OFMA 3ZIJA 4TXOA 2YN1A 5LD0A 3L78A 2KOKA 4WXTA 4ILFA 2AUVA 1GTBA 3ZFBA 4BPYA 4EL1A 1M2DA 1ACVA 1M0UA 4GCIA 1OC9B 1SJ6A 3L9SA 3CTFA 4EVMA 4X43A 1MTCA 1BQ7A 1TP9A 4KDYA 3L9VA 9GSSA 2M80A 4ZL8A 3U5RE 1M2BA 1WMJA 1C72A 4YAPA 4MK3A 2VIMA 3GURA 2C3TA 1XW6A 3FK8A 1OYJA 2CT6A 1NM3A 2JZSA 3DGQA 3GN3A 4FIWA 3KZQA 2VLVA 2AB6A 4V1Ag 4GWRA 1Q98A 3VI7A 2VD0A 4AJ6A 3M0FA 4ZIJA 3GIXA 1V9WA 3EURA 4BVXA 2O8VB 3IAS2 1OVNA 4I2UA 3RHCA 1YKCA 5AIXA 2ON7A 2EIOA 1B4PA 2NDOA 5IOWA 2FWHA 3Q18A 2IIYA 1J9BA 3ME8A 3APQA 1XXUA 8GSSA 4XS6A 5H5QA 3KTLA 3TRXA 4KAEA 2PVQA 2DIZA 1PRXA 1Z6NA 2FGXA 3NOFA 1FVJA 1E2YA 1WWJA 1QXHA 3C8EA 4IBPA 1K3OA 5CRGA 4DSSA 5IIZA 1K0AA 1E6BA 1ERWA 3DIEA 1Q4JA 2C3QA 3FYGA 1ZOFA 4Q5FA 6GSWA 3DVXA 5IMVA 4ZL7A 2KLXA 5G30A 1SL0B 1X5EA 1Z3EA 2LNTA 4V2NA 3TRQA 2RUEA 4NV5A 2N5BA 5AIVA 2H70A 1XWAA 1JFUA 2P5RA 4LMWA 4ML6A 5E59A 3EC3A 3HCZA 1XWKA 2QGVA 2I81A 4L8EA 2PPTA 2GSSA 3AY8A 5KN2A 1OKDA 5B6NA 3BCKA 2H71A 1DE2A 1BEDA 4MH2A 1V40A 4K7OA 2HFDA 2YANA 3M9KA 4GRFA 2MMNA 5IPHA 1XWBA 2LJAA 1YF0A 1ERUA 1AW9A 4L0UA 2K8VA 19GSA 2FD3A 2TRCP 1FHEA 2XPEA 3W8SA 2VO4A 3TKPA 5IQYA 3LWAA 4EE0A 5F0GA 2NTOA 1R5PA 1ZYQB 1ZL9A 2L5LA 2CA8A 3R2QA 2L6CA 4G9HA 1MEKA 5F8BA 3HZ8A 5J9CA 3GRXA 1TRVA 2X64A 4KB3A 2YOIA 3LSZA 2F9SA 2GQLA 1U87A 1FO5A 4POLA 4NHWA 4ZL9A 4IJIA 4J57E 5COHA 5G1KA 1TU7A 3EU4A 3UVHA 3EVIA 3UOMA 2GZYA 2KP1A 1DBYA 3GMFA 1AQVA 1HQOA 1PD21 1I9DA 5D73A 3C71A 4OCFA 4G19A 2FLSA 3QCPA 1EOHA 2IMFA 1ILOA 1M7TA 3PR8A 4KE3A 5DAKA 2F51A 2LRTA 2L4QA 1EV4A 2WCIA 3MWHA 4I97A 4ECJA 1W4VA 3ZFLA 5ID2A 1YJ6A 3TKSE 5E4WA 5ELGA 3TKQA 1HYUA 3VWWA 3VI5A 3UBKA 1A0RP 2IMIA 2LTKA 3IAM2 1KBNA 3HVSA 2GSQA 1GSQA 5CO3A 4FYBA 2REMA 5D8IA 4AJ8A 3C7MA 3K8NA 1O85A 5D96A 2P0GA 4JR4A 4ID0A 2BJXA 3FR6A 3W8JA 1MDJA 4XCSA 2WGRA 3TJKA 1RQMA 3US3A 3E9JB 2LSTA 2YJHA 4PQ1A 5HFGA 1XZOA 2VAFA 3N9JA 1Z7RA 1JLWA 1QQ2A 5ECKB 1ZZYA 1A2JA 1GNWA 2VCVA 5GZZB 5CAXA 4K7NA 3LG6A 2IWTA 3J7Yk 1N2AA 2CAIA 1YF1A 3A2WA 3A2VA 5ECSA 1R7HA 1GUHA 2H74A 3FKFA 3Q74A 2LV3A 4DSQA 4PGTA 2OACA 3TJJA 4AF2A 16GSA 1K3YA 3PH9A 3P2AA 5ECMB 3V1WA 1SL1B 2L57A 4MZWA 3IK7A 5KN0A 5JCGA 3WD6A 4DVCA 3N5OA 4F2IA 3IBHA 3RHBA 2K18A 2QKEA 4ULXA 4EUYA 5LCZA 3IC4A 5DJLA 3LORA 4CDOA 2H0GA 5HR2A 2NBSA 1KTEA 5EPFA 3KIJA 3KXOA 3HHVA 3HVXA 2RUFA 4HQZA 3WT2A 1W89A 1TU8A 1GSEA 1JZRA 1ERTA 2GDRA 2GT6A 5IPGA 4WKWA 4TR0A 2IPAA 3FRCA 5A4WA 2L5OA 2TIRA 3BD2A 4XS4B 4JZQA 2OE0A 3IPZA 3TRPA 2FHEA 4K7IA 4MPFA 2YV7A 4KH7A 4XRAA 1AQXA 3EINA 2LUSA 1WE0A 1SKSB 3L0HA 3HXSA 3FZAA 5J41A 3KGKA 1QGVA 1VRSD 3CSHA 1GWCA 4IVFA 5JWQB 3KH9A 3TJGA 1LJRA 4FYUA 3TOTA 2FWFA 12GSA 3DRNA 5IMDA 4BVYA 1F3AA 3GSTA 3VWVA 3G7JA 1T4YA 3IA1A 4RQXA 4P3YB 3UMAA 3TOUA 4POMA 3E3EA 2V41A 2H6ZA 6GSSA 1M2AA 3PINA 4ECBA 4TR3A 1ZMAA 4GF0A 4YQVA 4H86A 1O8XA 4NPBA 3FR9A 3FHKA 5CNWA 1S3CA 4TW5A 3GV1A 4ZB9A 4IJ3A 1X9SB 5ECOB 4HJMA 4TRXA 3C73A 2FNOA 4HEA2 3VPQA 11GSA 2IN3A 3GYKA 1X0RA 2R4VA 2MZCA 1YKAA 2M46A 2DLXA 3UBLA 1FAAA 1AXDA 4GSSA 4WR5A 4GSTA 2X8HA 2IJYA 4L5OA 1X9MB 3TKRA 4ECIA 2IL3A 2MBSA 3GA4A 2JZTA 2LNSA 1KEBA 3LJRA 1M9AA 3LQ7A 2FY6A 3GH9A 5C04A 4G10A 4MPGA 1U88A 2I9HA 3ZREA 1LU4A 3G9BA 5D9XA 2WFCA 4JR6A 4ZBDA 2OE3A 4HU9A 3ZVJD 2A2SA 4TOPA 4EXJA 5ECRB 1O7UA 2J23A 2ES7A 3ERGA 2OKAA 2HRNA 5INYA 3UL3A 1K0CA 3BOAA 2OA7A 1M99A 4EKZA 5B8BA 3F3RA 1K0NA 2VLUA 4OWYA 2CX3A 4PUAA 1A24A 5GSSA 4FO5A 1XPVA 2H8LA 1PMTA 1EP8A 4V2MA 5KN1A 2YWOA 3TJFA 4O5RA 3A2XA 4WETA 1K0BA 5GAPD 4NWYA 1JZDA 2VL9A 4AJ7A 4ZBBA 4X1UA 1YDKA 5DJMA 6GSVA 3LEFA 3IV4A 2DJ3A 4MF5A 1JZWA 4MZBA 2CVDA 3DWVA 3EU3A 2H75A 2RLIA 1F6MC 3DXBA 5IO2A 3O6TA 4HU7A 5EVOA 2IFQB 2JSZA 5IOXA 1TXXA 2H6YA 2H73A 5ABRA 5ELAA 1UC7A 3VK9A 5D9VA 3RAZA 4PNGA 5F07A 18GSA 1J08A 1TRWA 5IM9A 1ZGNA 4XS4A 1TJDA 5F06A 4IGJA 1XOAA 4AGSA 3CTGA 4OO5A 2XHFA 3CSIA 1PGTA 4N30A 3P7XA 3F3QA 3LYKA 2VCXA 2GTUA 1OAZA 4JRRA 20GSA 1CQHA 5C00A 1G6WA 1GTIA 3CBUA 3QFAC 1TK8B 1X9WB 4MJCA 2OE1A 2PN8A 2DJJA 4ZB6A 1WJKA 5ECLB 2GZZA 2V6OA 4WF4A 2L59A 4L0WA 2DMLA 4K0GA 2H1BA 3D4MA 2YZUA 3M1GA 2HLSA 5B8AA 2CVKA 2MMOA 1B8XA 2R3XA 4QL9A 1TOFA 3HVVA 3APOA 1B48A 4MH3A 2H1AA 1QK8A 2N5FA 2HNLA 1HNCA 5A4VA 1TK5B 1LBKA 5B6MA 4MCUA 1AAZA 1PL1A 5DDLA 2H72A 4V2LA 2NVLA 1THXA 2P5QA 3BJ5A 4ACSA 5J5NA 4KCEA 1A8LA 1URMA 3CYNA 3GNJA 1EEJA 1Z9HA 3Q6OA 4TR1B 1NSWA 2EIRA 2DSAA 2LEGA 1V57A 4MDCA 1SKWB 2JADA 1GUKA 1M9BA 6GSUA 4XIHA 3JCML 3KM6A 1YZXA 4ZB8A 2VL2C 1PN9A 2E7PA 3QD9A 3F6FA 5G5FA 4NAXA 1A23A 3ZZXA 3KJYA 1ZCPA 4EO3A 2HZEA 3GKMA 22GSA 1IYIA 3DEXA 3TGZA 3A5WA 1PX7A 2CQ9A 3IK9A 2GSTA 3FZ5A 4RI7A 4RUVA 2C0DA 3HZ4A 2XBIA 4LMVA 3IOSA 1Z7PA 5DALA 5DQYA 3GKXA 3VLNA 2PGTA 4YQMA 1YQ1A 1SENA 2D2ZA 1R5AA 2LRCA 3QAVA 2B3SA 4TVEA 5ECNB 3MDKA 2X99A 4GQCA 2GS3A 1K0DA 3D21A 4F9ZA 4N10A 2HXKA 1OC9A 3FW2A 3GKKA 1TTZA 1T3BA 3UVTA 5LNKe 2K9FA 3F4RA 1QFNA 2B1LA 4EDZA 2CAQA 3EMPA 2AV4A 1XCCA 5JWOB 1TW9A 1SK0A 1SK2A 4L5LA 6GSTA 4IKHA 3TB2A 4N0ZA 3VFIA 5ECPB 3GKNA 1WRYA 3IDVA 4WR4A 1MD3A 2H01A 4BA7A 3IHQA 1OE7A 2ZUPA 3EWLA 3TDGA 1T1VA 2GSRA 2L4CA 3A3TA 2C0FA 2DJ0A 2I4AA 3GFKA 1T8EB 2IFQA 3KMOA 1JHBA 3F63A 4MJBA 5IO0A 5JCUA 2G2QA 2JL4A 4TKYA 3F0IA 2GZPA 4TXVA 3ZRDA 1PKWA 2WB9A 1GSFA 1EWXA 1VGLA 2FWGA 1MDIA 1GNEA 5IMCA 3BBYA 4NHZA 2V32A 3VPTA 1Z6MA 1G0TA 3LFLA 2O89A 4Z7XA 3WT1A 4IHUA 4F82A 4DSRA 1BG5A 3D5JA 1KNGA 2LJKA 1N8JA 3RDWA 2HE3A 3GTUB 2FA4A 2HZFA 4K8MA 4E8EA 1DSBA 1USBA 1G6YA 4GQFA 4KDXA 3CRTA 3M8NA 4OCEA 3F4SA 1ML6A 2VCZA 3QDNA 3KTBA 4O32A 1BAYA 4MP4A 1MDKA 3H1NA 2L6DA 4OFTA 4DSSB 3I6AA 1F37A 3CXGA 4JE1A 1DUGA 1U6TA 3TCOA 1FVKA 2VM2A 1Y25A 3WGEA 3GSSA 5EL8A 3BCIA 4TR1A 3VWXA 1K0MA 2A2RA 3GL3A 4FYCA 2TRXA 1XW9A 5CREA 1GSUA 3FZ9A 1TKDB 1Y6EA 4NXIA 4BWSA 1PQNA 2C4JA 4IP1A 5A4UA 3VURA 5HQPA 4JEDA 2JU5A 2OBKA 4OD7A 4J56E 4IQAA 2H19A 3MAKA 4GSNA 1XVQA 3M3MA 2NPBA 1VF3A 2DC5A 2YWMA 1SYRA 1EGOA 3I9V2 3UARA 2R6KA 4HUAA 2EIQA 3LYPA 4MJEA 1T4ZA 4ISDA 5CRWA 3WGXA 4PXOA 1DE1A 2QC7A 3TJBA 3GUSA 2KP2A 1GULA 1WOUA 1O6JA 1FB0A 2CZ3A 2YWIA 2HSHA 1Z5YE 1UA5A 1TK0B 3LGCA 4N11A 5HFKA 5HR0A 2XPDA 1UVZA 1FW1A 4DEJA 3UEMA 1ON4A 3HA9A 1RK4A 2DIYA 4PX1A 3S9FA 2R2JA 3ZL5A 1SYXA 2BTOT 1G7EA 3TKSC 1ABAA 2QSIA 3Q19A 3KP8A 3UIWA 4NMUA 4EDYA 7GSSA 2B7KA 1X5DA 3WGDA 2F8FA 2X8GA 3QOUA 2IMKA 2CX4A 2VCTA 2WDUA 1F3BA 3QPMA 5FHIA 5AGYA 3PGTA 4KW6A 1EOGA 2YP6A 4PUFC 2WZ9A 2R5GA 3M9JA 1MD4A 2PWJA 3I69A 1SL2B 3G7YA 5DAKB 4I8BA 3ED3A 2LRNA 4G2EA 5J4UA 3VWUA 4F0CA 2K6VA 5ID2B 3KMNA 4GLTA 1T7PB 1GSYA 4Q5RA 4MA9A 4PNFA 1ERVA 3EE2A 1SD8A 2C8UA 4ZXGA 2LKUA 1AC1A 1O81A 1OKTA 2YCDA 3HJOA 4YQUA 1XIYA 1FOVA 2MYGA 4WEYA 2B6MA 4RQRA 2GLRA 2AYTA 2FWEA 2H1GA 2VLTA 2WRTA 2O85A 4POBA 2C0GA 10GSA 3ME7A 1PA3A 2HYXA 2VL2A 5AISA 3W6GA 4OO4A 5G2ZA 4KCAA 2YV9A 5JCWA 3G7IA 2JACA 2B5XA 3ZTLA 2B5YA 3GTUA 5FWGA 1PKZA 2VCWA 1H75A 2XBQA 2FA8A 4D73B 1RW1A 4WBJA 3ZIVA 4POKA 1JZOA 5EY6A 4WBRD 3RPNA 2PU9C 1F9MA 3C1SA 5KEJA 3SWLA 1I5GA 5D93A 1B4QA 3J7Yb 5ENUA 2LQOA 4JBBA 3LXZA 5L71A 1U3IA 17GSA 5ECQB 2H0HA 2PERA 2FUG2 5ECIB 2DBCA 2C1YA 2RM6A 3L4NA 3ZITA 3MSZA 2V2GA 1XOBA 2O87A 1F2EA 1WP0A 2PUKC 4KSOA 4KSMA 4IS0A 1WPIA 2ALBA 3OR5A 4JU5A 2HRFA 2RIIA 3LXTA 4KX4A 2H6XA 3FEUA 4I6XA 1EP7A 4MLYA 1TI3A 4EF0A 3UAPA 2GQMA 3H4KA 4HZ2A 5IMFA 3H8QA 2H0IA 2E0QA 1ST9A 2GVPA 2HI7A 2LQQA 4K0NA 5CRDA 3U6VA 3L9UA 4WF5A 4K9ZA 6GSXA 3DVWA 4MJAA 3FZ4A 3NIVA 2I3YA 1H4OA 3CSJA 2DMMA 5G31A 1VF1A 3KEBA 4HS1A 3ERFA 3HY2A 2R37A 1CQGA 3GH6A 3WYWA 4O92A 5H5RA 2P31A 1QMVA 1NHOA 4IP6A 2LS5A 1K3LA 3IE3A 3H93A 1EZKA 4EC0A 2H76A 4HZ4A 2Z9SA 3O76A 3QFBC 1HNAA 3TUEA 3HDCA 2A4VA 1V98A 1AIUA 1GSDA 1TDIA 1XWCA 3D4TA 1S3DA 2G0FA 5D9WA 3FR3A 1UN2A 3F6DA 3IR4A 2VD1A 5J3RA 4CHSA 5DQSA 1R4WA 2BMXA 3EMXA 4Q5NA 1GUMA 4X0XA 2WULA 5DCHA 2F8AA 1TRUA 2M72A 3ISOA 1VF4A 5ECHB 1G7OA 2H30A 1GSSA 3ZMKA 3HYPA 1PSQA 2E2MA 3QAGA 1A2LA 1AUCA 3FY7A 2GT5A 1TI1A 3HKRA 4PURA 2VM1A 3GX0A 3QR6A 1YEPA 3F8UA 1OC3A 2B5EA 3P90A 3CMIA 2DJKA 1OE8A 4I5QA 4KUNA 4BWQA 1R26A 3DMLA 2C0EA 3F4TA 1EV9A 3GX8A 4F0BA 1ZYEA 1XFLA 1SKRB 1AQWA 5G1LA 4ECCA 2IMDA 3DD3A 4N0VA 1SD9A 1GRXA 1SJIA 4KGIA 1XBSA 5AN1A 3KH7A 3ZVJA 2KUCA 3ERWA 1NHYA 4XHMA 2PBJA 4PQIA 1PX6A 2HSYA 3EYTA 3MNGA 4E8HA 4ML1A 4HQSA 4TXOB 1GTUA 4PQHA 3SBCA 14GSA 2V6KA 1V2AA 4HJ2A 1B9XC 4MZCA 3ZMLA 4D73A 1FB6A 2AJQB 1BX9A 4MABA 3KP9A 3UJ1A 2LJRA 4Q5QA 2YPMA 2YNXA 1XW5A 5GAND 3DKSA 2E2GA 1X5CA 4ZILA 3KD0A 3RBTA 5J9BA 2ON5A 2X8CA 4ZBAA 2FCHA 2MBTA 5KN3A 1T00A 4MF6A 2GQKA 1B9YC 3O3TA 2N5AA 1GP1A 5HFIA 1TRSA 5F05A 2XC2A 5IMAA 5JWRB 1PL2A 5H5SA 1GTAA 2C3NA 3APSA 2HT9A 1NW2A 4YAVA 4IQ1A 2VOCA 1FG4A 4CW9A 4K6XA 2K8SA 3IRAA 4LL4B 5DBQA 3TKSA 5GSTA 3E0UA 1EEMA 3D6IA 2B1KA 1BJXA 1THOA 2ZNMA 3P8WA 5CP1A 1XWGA 2GGTA 1IYHA 1GL8A 6GSYA 2WS2A 1SU9A 1HD2A 2J9HA 4HDEA 1VF2A 3RPPA 4XTSA 2MMAA 2AHEA 4FH8A 2B7JA 2YJ7A 4F03A 3QAWA 1V58A 5FT3A 1GLQA 3D22A 4O7HA 4MF7A 5HR1A 3GHAA 3HJMA 4GTUA 4V1Ap 2H66A 4XRDA 1OC8A 2CVBA 3I43A 4LL1B 4NV2A 5A5KA 1XVWA 4QQ7A 2CV4A 2C80A 2JZRA 2V1MA 4KNDA 5IMZA 1GLPA 2DJ2A 2AAWA 4K2DA 1HNBA 2YWNA 3F9UA 3IXRA 4HI7A 1SJZA 4LA1A 4IELA 2F3MA 4YH2A 4HOJA 13GSA 2WJUA 2YZHA 5B7CA 4K1FA 4TR4A 2EC4A 3GL5A 2JSYA 2H1DA 2ZCTA 1QUWA 5D9TA 2PVOC 4OMVA 4IW9A 4XS1A 5DCGA 3HJPA 3ZYWA 1J0FA 1U3AA 2CZ2A 5G5EA 4IN0A 4OFNA 3D0ZA 1YEXA 3NZNA 3QMXA
chains in the Genus database with same CATH superfamily
4BL7A 4TN8A 1BYEA 4MMMA 3C1RA 1WIKA 5HR3A 1EGRA 5DVBA 2RM5A 1O73A 4I2TA 1S3AA 5CYYA 4LLRA 1JLVA 4KA0A 1GH2A 3CRUA 1O8WA 3DYRA 2DJ1A 1A2MA 3HD5A 4KDUA 2OBIA 3KCMA 2OADA 2PMTA 2HSMA 2O7KA 2HZEB 5KOWA 4GXZA 2OJLA 2IMEA 1A0FA 4RI6A 2VL3A 4QL7A 1SK1A 1YY7A 2VUPA 4J2FA 3H79A 1A8YA 2R0CA 2I1UA 5CRHA 2KHPA 5DALB 3ZLPA 2MMZA 1K0OA 2VCQA 4OFMA 3ZIJA 4TXOA 2YN1A 5LD0A 3L78A 2KOKA 4EIPA 4WXTA 4ILFA 2AUVA 1GTBA 3ZFBA 4BPYA 4EL1A 1M2DA 1ACVA 1M0UA 4GCIA 1OC9B 1SJ6A 3L9SA 3CTFA 4EVMA 4X43A 1MTCA 1BQ7A 1TP9A 4KDYA 3L9VA 9GSSA 2M80A 4ZL8A 3U5RE 1M2BA 1WMJA 1C72A 4YAPA 4MK3A 2VIMA 3GURA 2C3TA 1XW6A 3FK8A 1OYJA 2CT6A 1NM3A 2JZSA 3DGQA 3GN3A 4FIWA 3KZQA 2VLVA 2AB6A 4V1Ag 4GWRA 1Q98A 3VI7A 2VD0A 4AJ6A 3M0FA 4ZIJA 3GIXA 1V9WA 3EURA 4BVXA 2O8VB 3IAS2 1OVNA 4I2UA 3RHCA 1YKCA 5AIXA 2ON7A 2EIOA 1B4PA 2NDOA 5IOWA 3A5IA 2FWHA 3Q18A 2IIYA 1J9BA 3ME8A 3MYDA 3APQA 1FOHA 1XXUA 8GSSA 4XS6A 5H5QA 3KTLA 3TRXA 4KAEA 2PVQA 2DIZA 4USSA 1PRXA 1Z6NA 2FGXA 3NOFA 1FVJA 1E2YA 1WWJA 1QXHA 3C8EA 4IBPA 1K3OA 5CRGA 4DSSA 5IIZA 1K0AA 1E6BA 1ERWA 3DIEA 3HVNA 1Q4JA 2C3QA 3FYGA 1ZOFA 4Q5FA 6GSWA 3DVXA 5IMVA 4ZL7A 2KLXA 5G30A 1SL0B 1X5EA 1Z3EA 2LNTA 4V2NA 3TRQA 4Z2UA 2RUEA 4NV5A 2N5BA 5AIVA 2H70A 1XWAA 1JFUA 2P5RA 4LMWA 4ML6A 5E59A 3EC3A 3HCZA 1XWKA 2QGVA 2I81A 4L8EA 2PPTA 2GSSA 3AY8A 5KN2A 1OKDA 5B6NA 3BCKA 3R3EA 2H71A 1DE2A 1BEDA 4MH2A 1V40A 4K7OA 2HFDA 2YANA 3M9KA 4GRFA 2MMNA 5IPHA 1XWBA 2LJAA 1YF0A 1ERUA 1AW9A 4L0UA 2K8VA 19GSA 2FD3A 2TRCP 1FHEA 2XPEA 3W8SA 2VO4A 3TKPA 5IQYA 3LWAA 4EE0A 5F0GA 2NTOA 1R5PA 1ZYQB 1ZL9A 2L5LA 2CA8A 3R2QA 2L6CA 4G9HA 1MEKA 5F8BA 3HZ8A 5J9CA 3GRXA 1TRVA 2X64A 4KB3A 2YOIA 3LSZA 2F9SA 2GQLA 1U87A 3EPTA 1FO5A 4POLA 4NHWA 4ZL9A 4IJIA 4J57E 5COHA 5G1KA 1TU7A 3EU4A 3UVHA 3EVIA 3UOMA 2GZYA 2KP1A 1DBYA 3GMFA 1AQVA 1HQOA 1PD21 1I9DA 5D73A 3C71A 4OCFA 4G19A 2FLSA 3QCPA 1EOHA 2IMFA 1ILOA 1M7TA 3PR8A 4KE3A 5DAKA 2F51A 2LRTA 2L4QA 1EV4A 2WCIA 3MWHA 4I97A 4ECJA 1W4VA 3ZFLA 5ID2A 1YJ6A 3TKSE 5E4WA 5ELGA 3TKQA 2UZ8A 1HYUA 3VWWA 3VI5A 3UBKA 1A0RP 2IMIA 2LTKA 3IAM2 1KBNA 3HVSA 2GSQA 1GSQA 5CO3A 4FYBA 2REMA 5D8IA 4AJ8A 3C7MA 3K8NA 1O85A 5D96A 2P0GA 4JR4A 4ID0A 2BJXA 3FR6A 3W8JA 1MDJA 4XCSA 2WGRA 3TJKA 1RQMA 3US3A 3E9JB 2LSTA 2YJHA 4PQ1A 5HFGA 1XZOA 2VAFA 3N9JA 2HRAA 1Z7RA 1JLWA 1QQ2A 5ECKB 1ZZYA 1A2JA 1GNWA 2VCVA 5GZZB 5CAXA 4K7NA 3LG6A 2IWTA 3J7Yk 1N2AA 2CAIA 1YF1A 3A2WA 3A2VA 5ECSA 1R7HA 1GUHA 2H74A 3FKFA 3Q74A 2LV3A 4DSQA 4PGTA 2OACA 3TJJA 5BMUA 4AF2A 16GSA 1K3YA 3PH9A 3P2AA 4K5SA 5ECMB 3V1WA 1SL1B 1PN0A 2L57A 4MZWA 4X4JA 3IK7A 5KN0A 5JCGA 3WD6A 4DVCA 3N5OA 4F2IA 3IBHA 3RHBA 2K18A 2QKEA 4ULXA 4EUYA 5LCZA 3IC4A 5DJLA 3LORA 4CDOA 2H0GA 5HR2A 2NBSA 1KTEA 5EPFA 3KIJA 3KXOA 3HHVA 3HVXA 2RUFA 4HQZA 3WT2A 1W89A 1TU8A 1GSEA 1JZRA 1ERTA 2GDRA 2GT6A 5IPGA 4WKWA 4TR0A 2IPAA 3FRCA 5A4WA 2L5OA 2TIRA 3BD2A 4XS4B 4JZQA 2OE0A 3IPZA 3TRPA 2FHEA 4K7IA 4MPFA 2YV7A 4KH7A 4XRAA 1AQXA 3EINA 2LUSA 1WE0A 1SKSB 3L0HA 3HXSA 3FZAA 5J41A 3KGKA 1QGVA 1VRSD 3CSHA 1GWCA 4IVFA 5JWQB 3KH9A 3TJGA 1LJRA 4FYUA 3TOTA 2FWFA 12GSA 3DRNA 5IMDA 4BVYA 1F3AA 3GSTA 3VWVA 3G7JA 1T4YA 3IA1A 4RQXA 4P3YB 3UMAA 3TOUA 4POMA 3E3EA 2V41A 2H6ZA 6GSSA 1M2AA 3PINA 4ECBA 4TR3A 1ZMAA 4GF0A 4YQVA 4H86A 1O8XA 4NPBA 3FR9A 3FHKA 5CNWA 1S3CA 4TW5A 3FMWA 3GV1A 4ZB9A 4IJ3A 1X9SB 5ECOB 4HJMA 4TRXA 3C73A 2FNOA 3IHGA 4HEA2 3VPQA 11GSA 2IN3A 3GYKA 1X0RA 2R4VA 2MZCA 1YKAA 2M46A 2DLXA 3UBLA 1FAAA 1AXDA 4GSSA 4WR5A 4GSTA 2X8HA 2IJYA 4L5OA 1X9MB 3TKRA 4ECIA 2IL3A 2MBSA 3GA4A 2JZTA 2LNSA 1KEBA 3LJRA 1M9AA 3LQ7A 2FY6A 3GH9A 5C04A 4G10A 4MPGA 1U88A 4FQUA 2I9HA 3ZREA 1LU4A 3G9BA 5D9XA 2WFCA 4JR6A 4ZBDA 2OE3A 4HU9A 3ZVJD 2A2SA 4TOPA 4EXJA 5ECRB 1O7UA 2J23A 2ES7A 3ERGA 2A2PA 2OKAA 2HRNA 5INYA 3UL3A 1K0CA 3BOAA 2OA7A 1M99A 4EKZA 5B8BA 3F3RA 1K0NA 2VLUA 4OWYA 2CX3A 4PUAA 1A24A 5GSSA 4FO5A 1XPVA 2H8LA 1PMTA 1EP8A 4V2MA 5KN1A 4K5RA 2YWOA 3TJFA 4O5RA 3A2XA 4WETA 1K0BA 5GAPD 4NWYA 1JZDA 2VL9A 4AJ7A 4ZBBA 4X1UA 1YDKA 5DJMA 6GSVA 3LEFA 3IV4A 2DJ3A 4MF5A 1JZWA 4MZBA 2CVDA 3DWVA 3EU3A 2H75A 2RLIA 1F6MC 3DXBA 5IO2A 3O6TA 4HU7A 5EVOA 2IFQB 2JSZA 5IOXA 1TXXA 2H6YA 2H73A 5ABRA 5ELAA 1UC7A 3VK9A 5D9VA 3RAZA 4PNGA 5F07A 18GSA 1J08A 1TRWA 5IM9A 1ZGNA 4XS4A 1TJDA 5F06A 4IGJA 1XOAA 4AGSA 3CTGA 4OO5A 2XHFA 3CSIA 1PGTA 4N30A 3P7XA 2R0PA 3F3QA 3LYKA 2VCXA 2GTUA 2QA2A 1OAZA 4JRRA 3LW9A 20GSA 1CQHA 5C00A 1G6WA 1GTIA 3CBUA 3QFAC 1TK8B 1X9WB 4MJCA 2OE1A 2PN8A 2DJJA 4ZB6A 1WJKA 5ECLB 2GZZA 4MNNA 2V6OA 4WF4A 2L59A 4L0WA 2DMLA 4K0GA 2H1BA 3D4MA 2YZUA 3M1GA 2HLSA 5B8AA 2CVKA 2MMOA 1B8XA 4O5QA 2R3XA 4QL9A 1TOFA 3HVVA 3APOA 1B48A 4MH3A 2H1AA 1QK8A 2N5FA 2HNLA 1HNCA 5A4VA 1TK5B 1LBKA 5B6MA 4MCUA 1AAZA 1PL1A 5DDLA 2H72A 4V2LA 2NVLA 1THXA 3PPUA 2P5QA 3BJ5A 4ACSA 5J5NA 4KCEA 1A8LA 1URMA 3CYNA 3GNJA 1EEJA 5BRTA 1Z9HA 3Q6OA 4TR1B 1NSWA 2EIRA 2DSAA 2LEGA 1V57A 4MDCA 1SKWB 2JADA 1GUKA 1M9BA 6GSUA 4XIHA 3JCML 3KM6A 1YZXA 4ZB8A 2VL2C 1PN9A 2E7PA 3QD9A 3F6FA 5G5FA 4NAXA 1A23A 3ZZXA 3KJYA 1ZCPA 4EO3A 2HZEA 3GKMA 22GSA 1IYIA 3DEXA 3TGZA 3A5WA 1PX7A 2CQ9A 3IK9A 4EIQA 2GSTA 3FZ5A 4RI7A 4RUVA 2C0DA 3HZ4A 2XBIA 4LMVA 3IOSA 1Z7PA 5DALA 5DQYA 3GKXA 3VLNA 2PGTA 4YQMA 1YQ1A 4K2XA 1SENA 2D2ZA 1R5AA 2LRCA 3QAVA 2B3SA 4TVEA 5ECNB 3MDKA 4BL7B 2X99A 4GQCA 2GS3A 1K0DA 3D21A 4F9ZA 4N10A 2HXKA 1OC9A 1PFOA 4BIKA 3FW2A 3GKKA 1TTZA 1T3BA 3UVTA 5LNKe 2K9FA 3F4RA 1QFNA 2X4AA 2B1LA 4EDZA 2CAQA 4O5UA 3EMPA 2AV4A 1XCCA 5JWOB 1TW9A 1SK0A 1SK2A 4L5LA 6GSTA 4IKHA 3TB2A 4N0ZA 3VFIA 5ECPB 3GKNA 1WRYA 3IDVA 4WR4A 1MD3A 2H01A 1ZYPA 4KF9A 4BA7A 3IHQA 1OE7A 2ZUPA 3EWLA 3TDGA 1T1VA 2GSRA 2L4CA 3A3TA 2C0FA 2DJ0A 2I4AA 3GFKA 1T8EB 2IFQA 3KMOA 1JHBA 3F63A 4MJBA 5IO0A 5JCUA 2G2QA 2JL4A 4TKYA 3F0IA 2GZPA 4TXVA 3ZRDA 1PKWA 2WB9A 1GSFA 4A5PA 1EWXA 1VGLA 2FWGA 1MDIA 1GNEA 5IMCA 3BBYA 4NHZA 2V32A 3VPTA 1Z6MA 1G0TA 3LFLA 2O89A 4Z7XA 3WT1A 4IHUA 4F82A 4DSRA 1BG5A 3D5JA 1KNGA 2LJKA 1N8JA 3RDWA 2HE3A 2HRKA 3GTUB 2DKHA 2FA4A 2HZFA 4K8MA 4E8EA 1DSBA 1USBA 1G6YA 4GQFA 4KDXA 4G0LA 3CRTA 3M8NA 4OCEA 3F4SA 1ML6A 2VCZA 3QDNA 3KTBA 4O32A 1BAYA 4MP4A 1MDKA 3H1NA 2L6DA 4OFTA 4DSSB 3I6AA 1F37A 3CXGA 4JE1A 1DUGA 1U6TA 3TCOA 1FVKA 2VM2A 1Y25A 3WGEA 3GSSA 5EL8A 3BCIA 4TR1A 3VWXA 1K0MA 3IC8A 2A2RA 3GL3A 4FYCA 2TRXA 1XW9A 5CREA 1GSUA 3FZ9A 1TKDB 1Y6EA 4NXIA 4BWSA 1PQNA 2C4JA 4IP1A 5A4UA 3VURA 5HQPA 4JEDA 4ICYA 2JU5A 2OBKA 4OD7A 4J56E 4IQAA 4YKFA 2H19A 3MAKA 4GSNA 1XVQA 3M3MA 2NPBA 1VF3A 2DC5A 2YWMA 1SYRA 1EGOA 3I9V2 3UARA 2R6KA 4HUAA 2EIQA 3LYPA 4MJEA 1T4ZA 4ISDA 5CRWA 4PTSA 3WGXA 4PXOA 1DE1A 2QC7A 3TJBA 3GUSA 2KP2A 1GULA 1WOUA 1O6JA 1FB0A 2CZ3A 2YWIA 2HSHA 1Z5YE 1UA5A 1TK0B 3LGCA 4N11A 5HFKA 5HR0A 2XPDA 1UVZA 1FW1A 4DEJA 3UEMA 1ON4A 3HA9A 1RK4A 2DIYA 4PX1A 3S9FA 2R2JA 3ZL5A 2X49A 1SYXA 2BTOT 1G7EA 3TKSC 1ABAA 2QSIA 3Q19A 3KP8A 3UIWA 4NMUA 4EDYA 7GSSA 2B7KA 1X5DA 3WGDA 2A4HA 2F8FA 2X8GA 3QOUA 2IMKA 2CX4A 2VCTA 2WDUA 1F3BA 3QPMA 5FHIA 5AGYA 3PGTA 4KW6A 1EOGA 2YP6A 4PUFC 2WZ9A 2R5GA 3M9JA 1MD4A 2PWJA 3I69A 1SL2B 3G7YA 5DAKB 4I8BA 3ED3A 2LRNA 4G2EA 5J4UA 3VWUA 4F0CA 2K6VA 5ID2B 3KMNA 4GLTA 1T7PB 1GSYA 4Q5RA 4MA9A 4PNFA 1ERVA 3EE2A 1SD8A 2C8UA 4ZXGA 2LKUA 1AC1A 1O81A 1OKTA 2YCDA 3HJOA 4YQUA 1XIYA 1FOVA 2MYGA 4WEYA 2B6MA 4RQRA 2GLRA 2AYTA 2FWEA 2H1GA 2VLTA 2WRTA 4CY6A 2O85A 4POBA 2C0GA 10GSA 3ME7A 1PA3A 1M3JA 1XG8A 2HYXA 2VL2A 5AISA 3W6GA 4OO4A 5G2ZA 4KCAA 2YV9A 5JCWA 3G7IA 2JACA 2B5XA 3ZTLA 2B5YA 3GTUA 5FWGA 1PKZA 2VCWA 1H75A 2XBQA 2FA8A 4D73B 1RW1A 4WBJA 1S3RA 3ZIVA 4POKA 1JZOA 5EY6A 4WBRD 3RPNA 2PU9C 1F9MA 3C1SA 5KEJA 3SWLA 1I5GA 5D93A 1B4QA 3J7Yb 5ENUA 2LQOA 4JBBA 3LXZA 5L71A 1U3IA 17GSA 5ECQB 2H0HA 2PERA 2FUG2 1M3IA 5ECIB 2DBCA 2C1YA 2RM6A 3L4NA 3ZITA 3MSZA 2V2GA 1XOBA 2O87A 1F2EA 4YKGA 1WP0A 2PUKC 4KSOA 4KSMA 4IS0A 1WPIA 2ALBA 3OR5A 4JU5A 2HRFA 2RIIA 3LXTA 4KX4A 2H6XA 2R0GA 3FEUA 4I6XA 1EP7A 3MIXA 4MLYA 1TI3A 4EF0A 3UAPA 2GQMA 3H4KA 4HZ2A 5IMFA 3H8QA 2H0IA 2E0QA 1ST9A 2GVPA 2HI7A 2LQQA 4K0NA 5CRDA 3U6VA 3L9UA 4WF5A 4K9ZA 6GSXA 3DVWA 4MJAA 3FZ4A 4Z2RA 3NIVA 2I3YA 1H4OA 3CSJA 2DMMA 5G31A 1VF1A 3KEBA 4HS1A 3ERFA 3HY2A 2R37A 1CQGA 3GH6A 3WYWA 4O92A 5H5RA 2P31A 1QMVA 1NHOA 4IP6A 2LS5A 1K3LA 3IE3A 3H93A 1EZKA 4EC0A 2H76A 4HZ4A 2Z9SA 3O76A 3QFBC 1HNAA 3TUEA 3HDCA 2A4VA 1V98A 1AIUA 1GSDA 1TDIA 1XWCA 3D4TA 1S3DA 2G0FA 5D9WA 3FR3A 1UN2A 3F6DA 3IR4A 2VD1A 4BVYB 5J3RA 4CHSA 4Z2TA 5DQSA 1R4WA 2BMXA 3EMXA 4Q5NA 1GUMA 4X0XA 2WULA 5DCHA 2F8AA 1TRUA 2M72A 3ISOA 1VF4A 1ZYNA 5ECHB 1G7OA 2H30A 1GSSA 3ZMKA 3HYPA 1PSQA 2E2MA 3QAGA 1A2LA 1AUCA 3FY7A 2GT5A 4CY8A 1TI1A 3HKRA 4PURA 2VM1A 3GX0A 3QR6A 1YEPA 3F8UA 1OC3A 2B5EA 3P90A 3CMIA 3CQFA 2DJKA 1OE8A 4I5QA 4KUNA 4BWQA 1R26A 3DMLA 2C0EA 3F4TA 1EV9A 3GX8A 4F0BA 1ZYEA 1XFLA 1SKRB 1AQWA 5G1LA 4ECCA 2IMDA 3DD3A 4N0VA 1SD9A 1GRXA 1SJIA 4KGIA 1XBSA 5AN1A 2DKIA 3KH7A 3ZVJA 2KUCA 3ERWA 1NHYA 4XHMA 2PBJA 4PQIA 1PX6A 2HSYA 3EYTA 3MNGA 4E8HA 4ML1A 4HQSA 4TXOB 1GTUA 4PQHA 3SBCA 4HSCX 14GSA 2V6KA 1V2AA 4HJ2A 1B9XC 4MZCA 3ZMLA 4D73A 1FB6A 2AJQB 4G0KA 1BX9A 4MABA 3KP9A 3UJ1A 2LJRA 4Q5QA 2YPMA 2YNXA 1XW5A 5GAND 3DKSA 2E2GA 1X5CA 4ZILA 3KD0A 3RBTA 5J9BA 2ON5A 2X8CA 4ZBAA 2FCHA 2MBTA 5KN3A 1T00A 4MF6A 2GQKA 1B9YC 3O3TA 2N5AA 1GP1A 5HFIA 1TRSA 5F05A 2XC2A 4BVXB 5IMAA 2QA1A 5JWRB 1PL2A 5H5SA 1GTAA 2C3NA 3APSA 2HT9A 1NW2A 4YAVA 4IQ1A 2VOCA 1FG4A 4CW9A 4K6XA 2K8SA 3IRAA 4LL4B 5DBQA 3TKSA 5GSTA 3E0UA 1EEMA 3D6IA 4G0IA 2B1KA 1BJXA 1THOA 2ZNMA 3P8WA 5CP1A 1XWGA 2GGTA 1IYHA 1GL8A 6GSYA 2WS2A 1SU9A 1HD2A 2J9HA 4HDEA 1VF2A 3RPPA 4XTSA 2MMAA 2AHEA 4FH8A 2B7JA 2YJ7A 4F03A 3QAWA 1V58A 5FT3A 1GLQA 3D22A 4O7HA 4MF7A 5HR1A 3GHAA 3HJMA 4GTUA 4V1Ap 2H66A 4XRDA 1OC8A 2CVBA 3I43A 4LL1B 4NV2A 5A5KA 1XVWA 4QQ7A 2CV4A 2C80A 2JZRA 2V1MA 4KNDA 5IMZA 1GLPA 2DJ2A 2AAWA 4K2DA 5KOXA 1HNBA 2YWNA 3F9UA 3IXRA 4HI7A 1SJZA 4LA1A 4IELA 2F3MA 4YH2A 4HOJA 13GSA 2WJUA 2YZHA 5B7CA 4K1FA 4TR4A 2EC4A 3GL5A 2JSYA 2H1DA 2ZCTA 1QUWA 5D9TA 2PVOC 4OMVA 4IW9A 4XS1A 5DCGA 3HJPA 3ZYWA 1J0FA 1U3AA 2CZ2A 5G5EA 4IN0A 4OFNA 3D0ZA 1YEXA 3NZNA 3QMXA
chains in the Genus database with same CATH topology
4BL7A 4TN8A 1BYEA 4MMMA 3C1RA 1WIKA 5HR3A 1EGRA 5DVBA 2RM5A 1O73A 4I2TA 1S3AA 5CYYA 4LLRA 1JLVA 4KA0A 1GH2A 3CRUA 1O8WA 3DYRA 2DJ1A 1A2MA 3HD5A 4KDUA 2OBIA 3KCMA 2OADA 2PMTA 2HSMA 2O7KA 2HZEB 5KOWA 4GXZA 2OJLA 2IMEA 1A0FA 4RI6A 2VL3A 4QL7A 1SK1A 1YY7A 2VUPA 4J2FA 3H79A 1A8YA 2R0CA 2I1UA 5CRHA 2KHPA 5DALB 3ZLPA 2MMZA 1K0OA 2VCQA 4OFMA 3ZIJA 4TXOA 2YN1A 5LD0A 3L78A 2KOKA 4EIPA 4WXTA 4ILFA 2AUVA 1GTBA 3ZFBA 4BPYA 4EL1A 1M2DA 1ACVA 1M0UA 4GCIA 1OC9B 1SJ6A 3L9SA 3CTFA 4EVMA 4X43A 1MTCA 1BQ7A 1TP9A 4KDYA 3L9VA 9GSSA 2M80A 4ZL8A 3U5RE 1M2BA 1WMJA 1C72A 4YAPA 4MK3A 2VIMA 3GURA 2C3TA 1XW6A 3FK8A 1OYJA 2CT6A 1NM3A 2JZSA 3DGQA 3GN3A 4FIWA 3KZQA 2VLVA 2AB6A 4V1Ag 4GWRA 1Q98A 3VI7A 2VD0A 4AJ6A 3M0FA 4ZIJA 3GIXA 1V9WA 3EURA 4BVXA 2O8VB 3IAS2 1OVNA 4I2UA 3RHCA 1YKCA 5AIXA 2ON7A 2EIOA 1B4PA 2NDOA 5IOWA 3A5IA 2FWHA 3Q18A 2IIYA 1J9BA 3ME8A 3MYDA 3APQA 1FOHA 1XXUA 8GSSA 4XS6A 5H5QA 3KTLA 3TRXA 4KAEA 2PVQA 2DIZA 4USSA 1PRXA 1Z6NA 2FGXA 3NOFA 1FVJA 1E2YA 1WWJA 1QXHA 3C8EA 4IBPA 1K3OA 5CRGA 4DSSA 5IIZA 1K0AA 1E6BA 1ERWA 3DIEA 1Q4JA 2C3QA 3FYGA 1ZOFA 4Q5FA 6GSWA 3DVXA 5IMVA 4ZL7A 2KLXA 5G30A 1SL0B 1X5EA 1Z3EA 2LNTA 4V2NA 3TRQA 4Z2UA 2RUEA 4NV5A 2N5BA 5AIVA 2H70A 1XWAA 1JFUA 2P5RA 4LMWA 4ML6A 5E59A 3EC3A 3HCZA 1XWKA 2QGVA 2I81A 4L8EA 2PPTA 2GSSA 3AY8A 5KN2A 1OKDA 5B6NA 3BCKA 3R3EA 2H71A 1DE2A 1BEDA 4MH2A 1V40A 4K7OA 2HFDA 2YANA 3M9KA 4GRFA 2MMNA 5IPHA 1XWBA 2LJAA 1YF0A 1ERUA 1AW9A 4L0UA 2K8VA 19GSA 2FD3A 2TRCP 1FHEA 2XPEA 3W8SA 2VO4A 3TKPA 5IQYA 3LWAA 4EE0A 5F0GA 2NTOA 1R5PA 1ZYQB 1ZL9A 2L5LA 2CA8A 3R2QA 2L6CA 4G9HA 1MEKA 5F8BA 3HZ8A 5J9CA 3GRXA 1TRVA 2X64A 4KB3A 2YOIA 3LSZA 2F9SA 2GQLA 1U87A 3EPTA 1FO5A 4POLA 4NHWA 4ZL9A 4IJIA 4J57E 5COHA 5G1KA 1TU7A 3EU4A 3UVHA 3EVIA 3UOMA 2GZYA 2KP1A 1DBYA 3GMFA 1AQVA 1HQOA 1PD21 1I9DA 5D73A 3C71A 4OCFA 4G19A 2FLSA 3QCPA 1EOHA 2IMFA 1ILOA 1M7TA 3PR8A 4KE3A 5DAKA 2F51A 2LRTA 2L4QA 1EV4A 2WCIA 3MWHA 4I97A 4ECJA 1W4VA 3ZFLA 5ID2A 1YJ6A 3TKSE 5E4WA 5ELGA 3TKQA 2UZ8A 1HYUA 3VWWA 3VI5A 3UBKA 1A0RP 2IMIA 2LTKA 3IAM2 1KBNA 3HVSA 2GSQA 1GSQA 5CO3A 4FYBA 2REMA 5D8IA 4AJ8A 3C7MA 3K8NA 1O85A 5D96A 2P0GA 4JR4A 4ID0A 2BJXA 3FR6A 3W8JA 1MDJA 4XCSA 2WGRA 3TJKA 1RQMA 3US3A 3E9JB 2LSTA 2YJHA 4PQ1A 5HFGA 1XZOA 2VAFA 3N9JA 2HRAA 1Z7RA 1JLWA 1QQ2A 5ECKB 1ZZYA 1A2JA 1GNWA 2VCVA 5GZZB 5CAXA 4K7NA 3LG6A 2IWTA 3J7Yk 1N2AA 2CAIA 1YF1A 3A2WA 3A2VA 5ECSA 1R7HA 1GUHA 2H74A 3FKFA 3Q74A 2LV3A 4DSQA 4PGTA 2OACA 3TJJA 5BMUA 4AF2A 16GSA 1K3YA 3PH9A 3P2AA 4K5SA 5ECMB 3V1WA 1SL1B 1PN0A 2L57A 4MZWA 4X4JA 3IK7A 5KN0A 5JCGA 3WD6A 4DVCA 3N5OA 4F2IA 3IBHA 3RHBA 2K18A 2QKEA 4ULXA 4EUYA 5LCZA 3IC4A 5DJLA 3LORA 4CDOA 2H0GA 5HR2A 2NBSA 1KTEA 5EPFA 3KIJA 3KXOA 3HHVA 3HVXA 2RUFA 4HQZA 3WT2A 1W89A 1TU8A 1GSEA 1JZRA 1ERTA 2GDRA 2GT6A 5IPGA 4WKWA 4TR0A 2IPAA 3FRCA 5A4WA 2L5OA 2TIRA 3BD2A 4XS4B 4JZQA 2OE0A 3IPZA 3TRPA 2FHEA 4K7IA 4MPFA 2YV7A 4KH7A 4XRAA 1AQXA 3EINA 2LUSA 1WE0A 1SKSB 3L0HA 3HXSA 3FZAA 5J41A 3KGKA 1QGVA 1VRSD 3CSHA 1GWCA 4IVFA 5JWQB 3KH9A 3TJGA 1LJRA 4FYUA 3TOTA 2FWFA 12GSA 3DRNA 5IMDA 4BVYA 1F3AA 3GSTA 3VWVA 3G7JA 1T4YA 3IA1A 4RQXA 4P3YB 3UMAA 3TOUA 4POMA 3E3EA 2V41A 2H6ZA 6GSSA 1M2AA 3PINA 4ECBA 4TR3A 1ZMAA 4GF0A 4YQVA 4H86A 1O8XA 4NPBA 3FR9A 3FHKA 5CNWA 1S3CA 4TW5A 3FMWA 3GV1A 4ZB9A 4IJ3A 1X9SB 5ECOB 4HJMA 4TRXA 3C73A 2FNOA 3IHGA 4HEA2 3VPQA 11GSA 2IN3A 3GYKA 1X0RA 2R4VA 2MZCA 1YKAA 2M46A 2DLXA 3UBLA 1FAAA 1AXDA 4GSSA 4WR5A 4GSTA 2X8HA 2IJYA 4L5OA 1X9MB 3TKRA 4ECIA 2IL3A 2MBSA 3GA4A 2JZTA 2LNSA 1KEBA 3LJRA 1M9AA 3LQ7A 2FY6A 3GH9A 5C04A 4G10A 4MPGA 1U88A 4FQUA 2I9HA 3ZREA 1LU4A 3G9BA 5D9XA 2WFCA 4JR6A 4ZBDA 2OE3A 4HU9A 3ZVJD 2A2SA 4TOPA 4EXJA 5ECRB 1O7UA 2J23A 2ES7A 3ERGA 2A2PA 2OKAA 2HRNA 5INYA 3UL3A 1K0CA 3BOAA 2OA7A 1M99A 4EKZA 5B8BA 3F3RA 1K0NA 2VLUA 4OWYA 2CX3A 4PUAA 1A24A 5GSSA 4FO5A 1XPVA 2H8LA 1PMTA 1EP8A 4V2MA 5KN1A 4K5RA 2YWOA 3TJFA 4O5RA 3A2XA 4WETA 1K0BA 5GAPD 4NWYA 1JZDA 2VL9A 4AJ7A 4ZBBA 4X1UA 1YDKA 5DJMA 6GSVA 3LEFA 3IV4A 2DJ3A 4MF5A 1JZWA 4MZBA 2CVDA 3DWVA 3EU3A 2H75A 2RLIA 1F6MC 3DXBA 5IO2A 3O6TA 4HU7A 5EVOA 2IFQB 2JSZA 5IOXA 1TXXA 2H6YA 2H73A 5ABRA 5ELAA 1UC7A 3VK9A 5D9VA 3RAZA 4PNGA 5F07A 18GSA 1J08A 1TRWA 5IM9A 1ZGNA 4XS4A 1TJDA 5F06A 4IGJA 1XOAA 4AGSA 3CTGA 4OO5A 2XHFA 3CSIA 1PGTA 4N30A 3P7XA 2R0PA 3F3QA 3LYKA 2VCXA 2GTUA 2QA2A 1OAZA 4JRRA 3LW9A 20GSA 1CQHA 5C00A 1G6WA 1GTIA 3CBUA 3QFAC 1TK8B 1X9WB 4MJCA 2OE1A 2PN8A 2DJJA 4ZB6A 1WJKA 5ECLB 2GZZA 4MNNA 2V6OA 4WF4A 2L59A 4L0WA 2DMLA 4K0GA 2H1BA 3D4MA 2YZUA 3M1GA 2HLSA 5B8AA 2CVKA 2MMOA 1B8XA 4O5QA 2R3XA 4QL9A 1TOFA 3HVVA 3APOA 1B48A 4MH3A 2H1AA 1QK8A 2N5FA 2HNLA 1HNCA 5A4VA 1TK5B 1LBKA 5B6MA 4MCUA 1AAZA 1PL1A 5DDLA 2H72A 4V2LA 2NVLA 1THXA 3PPUA 2P5QA 3BJ5A 4ACSA 5J5NA 4KCEA 1A8LA 1URMA 3CYNA 3GNJA 1EEJA 5BRTA 1Z9HA 3Q6OA 4TR1B 1NSWA 2EIRA 2DSAA 2LEGA 1V57A 4MDCA 1SKWB 2JADA 1GUKA 1M9BA 6GSUA 4XIHA 3JCML 3KM6A 1YZXA 4ZB8A 2VL2C 1PN9A 2E7PA 3QD9A 3F6FA 5G5FA 4NAXA 1A23A 3ZZXA 3KJYA 1ZCPA 4EO3A 2HZEA 3GKMA 22GSA 1IYIA 3DEXA 3TGZA 3A5WA 1PX7A 2CQ9A 3IK9A 4EIQA 2GSTA 3FZ5A 4RI7A 4RUVA 2C0DA 3HZ4A 2XBIA 4LMVA 3IOSA 1Z7PA 5DALA 5DQYA 3GKXA 3VLNA 2PGTA 4YQMA 1YQ1A 4K2XA 1SENA 2D2ZA 1R5AA 2LRCA 3QAVA 2B3SA 4TVEA 5ECNB 3MDKA 4BL7B 2X99A 4GQCA 2GS3A 1K0DA 3D21A 4F9ZA 4N10A 2HXKA 1OC9A 3FW2A 3GKKA 1TTZA 1T3BA 3UVTA 5LNKe 2K9FA 3F4RA 1QFNA 2X4AA 2B1LA 4EDZA 2CAQA 4O5UA 3EMPA 2AV4A 1XCCA 5JWOB 1TW9A 1SK0A 1SK2A 4L5LA 6GSTA 4IKHA 3TB2A 4N0ZA 3VFIA 5ECPB 3GKNA 1WRYA 3IDVA 4WR4A 1MD3A 2H01A 1ZYPA 4KF9A 4BA7A 3IHQA 1OE7A 2ZUPA 3EWLA 3TDGA 1T1VA 2GSRA 2L4CA 3A3TA 2C0FA 2DJ0A 2I4AA 3GFKA 1T8EB 2IFQA 3KMOA 1JHBA 3F63A 4MJBA 5IO0A 5JCUA 2G2QA 2JL4A 4TKYA 3F0IA 2GZPA 4TXVA 3ZRDA 1PKWA 2WB9A 1GSFA 4A5PA 1EWXA 1VGLA 2FWGA 1MDIA 1GNEA 5IMCA 3BBYA 4NHZA 2V32A 3VPTA 1Z6MA 1G0TA 3LFLA 2O89A 4Z7XA 3WT1A 4IHUA 4F82A 4DSRA 1BG5A 3D5JA 1KNGA 2LJKA 1N8JA 3RDWA 2HE3A 2HRKA 3GTUB 2DKHA 2FA4A 2HZFA 4K8MA 4E8EA 1DSBA 1USBA 1G6YA 4GQFA 4KDXA 4G0LA 3CRTA 3M8NA 4OCEA 3F4SA 1ML6A 2VCZA 3QDNA 3KTBA 4O32A 1BAYA 4MP4A 1MDKA 3H1NA 2L6DA 4OFTA 4DSSB 3I6AA 1F37A 3CXGA 4JE1A 1DUGA 1U6TA 3TCOA 1FVKA 2VM2A 1Y25A 3WGEA 3GSSA 5EL8A 3BCIA 4TR1A 3VWXA 1K0MA 3IC8A 2A2RA 3GL3A 4FYCA 2TRXA 1XW9A 5CREA 1GSUA 3FZ9A 1TKDB 1Y6EA 4NXIA 4BWSA 1PQNA 2C4JA 4IP1A 5A4UA 3VURA 5HQPA 4JEDA 4ICYA 2JU5A 2OBKA 4OD7A 4J56E 4IQAA 4YKFA 2H19A 3MAKA 4GSNA 1XVQA 3M3MA 2NPBA 1VF3A 2DC5A 2YWMA 1SYRA 1EGOA 3I9V2 3UARA 2R6KA 4HUAA 2EIQA 3LYPA 4MJEA 1T4ZA 4ISDA 5CRWA 4PTSA 3WGXA 4PXOA 1DE1A 2QC7A 3TJBA 3GUSA 2KP2A 1GULA 1WOUA 1O6JA 1FB0A 2CZ3A 2YWIA 2HSHA 1Z5YE 1UA5A 1TK0B 3LGCA 4N11A 5HFKA 5HR0A 2XPDA 1UVZA 1FW1A 4DEJA 3UEMA 1ON4A 3HA9A 1RK4A 2DIYA 4PX1A 3S9FA 2R2JA 3ZL5A 2X49A 1SYXA 2BTOT 1G7EA 3TKSC 1ABAA 2QSIA 3Q19A 3KP8A 3UIWA 4NMUA 4EDYA 7GSSA 2B7KA 1X5DA 3WGDA 2A4HA 2F8FA 2X8GA 3QOUA 2IMKA 2CX4A 2VCTA 2WDUA 1F3BA 3QPMA 5FHIA 5AGYA 3PGTA 4KW6A 1EOGA 2YP6A 4PUFC 2WZ9A 2R5GA 3M9JA 1MD4A 2PWJA 3I69A 1SL2B 3G7YA 5DAKB 4I8BA 3ED3A 2LRNA 4G2EA 5J4UA 3VWUA 4F0CA 2K6VA 5ID2B 3KMNA 4GLTA 1T7PB 1GSYA 4Q5RA 4MA9A 4PNFA 1ERVA 3EE2A 1SD8A 2C8UA 4ZXGA 2LKUA 1AC1A 1O81A 1OKTA 2YCDA 3HJOA 4YQUA 1XIYA 1FOVA 2MYGA 4WEYA 2B6MA 4RQRA 2GLRA 2AYTA 2FWEA 2H1GA 2VLTA 2WRTA 4CY6A 2O85A 4POBA 2C0GA 10GSA 3ME7A 1PA3A 2HYXA 2VL2A 5AISA 3W6GA 4OO4A 5G2ZA 4KCAA 2YV9A 5JCWA 3G7IA 2JACA 2B5XA 3ZTLA 2B5YA 3GTUA 5FWGA 1PKZA 2VCWA 1H75A 2XBQA 2FA8A 4D73B 1RW1A 4WBJA 3ZIVA 4POKA 1JZOA 5EY6A 4WBRD 3RPNA 2PU9C 1F9MA 3C1SA 5KEJA 3SWLA 1I5GA 5D93A 1B4QA 3J7Yb 5ENUA 2LQOA 4JBBA 3LXZA 5L71A 1U3IA 17GSA 5ECQB 2H0HA 2PERA 2FUG2 5ECIB 2DBCA 2C1YA 2RM6A 3L4NA 3ZITA 3MSZA 2V2GA 1XOBA 2O87A 1F2EA 4YKGA 1WP0A 2PUKC 4KSOA 4KSMA 4IS0A 1WPIA 2ALBA 3OR5A 4JU5A 2HRFA 2RIIA 3LXTA 4KX4A 2H6XA 2R0GA 3FEUA 4I6XA 1EP7A 3MIXA 4MLYA 1TI3A 4EF0A 3UAPA 2GQMA 3H4KA 4HZ2A 5IMFA 3H8QA 2H0IA 2E0QA 1ST9A 2GVPA 2HI7A 2LQQA 4K0NA 5CRDA 3U6VA 3L9UA 4WF5A 4K9ZA 6GSXA 3DVWA 4MJAA 3FZ4A 4Z2RA 3NIVA 2I3YA 1H4OA 3CSJA 2DMMA 5G31A 1VF1A 3KEBA 4HS1A 3ERFA 3HY2A 2R37A 1CQGA 3GH6A 3WYWA 4O92A 5H5RA 2P31A 1QMVA 1NHOA 4IP6A 2LS5A 1K3LA 3IE3A 3H93A 1EZKA 4EC0A 2H76A 4HZ4A 2Z9SA 3O76A 3QFBC 1HNAA 3TUEA 3HDCA 2A4VA 1V98A 1AIUA 1GSDA 1TDIA 1XWCA 3D4TA 1S3DA 2G0FA 5D9WA 3FR3A 1UN2A 3F6DA 3IR4A 2VD1A 4BVYB 5J3RA 4CHSA 4Z2TA 5DQSA 1R4WA 2BMXA 3EMXA 4Q5NA 1GUMA 4X0XA 2WULA 5DCHA 2F8AA 1TRUA 2M72A 3ISOA 1VF4A 1ZYNA 5ECHB 1G7OA 2H30A 1GSSA 3ZMKA 3HYPA 1PSQA 2E2MA 3QAGA 1A2LA 1AUCA 3FY7A 2GT5A 4CY8A 1TI1A 3HKRA 4PURA 2VM1A 3GX0A 3QR6A 1YEPA 3F8UA 1OC3A 2B5EA 3P90A 3CMIA 2DJKA 1OE8A 4I5QA 4KUNA 4BWQA 1R26A 3DMLA 2C0EA 3F4TA 1EV9A 3GX8A 4F0BA 1ZYEA 1XFLA 1SKRB 1AQWA 5G1LA 4ECCA 2IMDA 3DD3A 4N0VA 1SD9A 1GRXA 1SJIA 4KGIA 1XBSA 5AN1A 2DKIA 3KH7A 3ZVJA 2KUCA 3ERWA 1NHYA 4XHMA 2PBJA 4PQIA 1PX6A 2HSYA 3EYTA 3MNGA 4E8HA 4ML1A 4HQSA 4TXOB 1GTUA 4PQHA 3SBCA 14GSA 2V6KA 1V2AA 4HJ2A 1B9XC 4MZCA 3ZMLA 4D73A 1FB6A 2AJQB 4G0KA 1BX9A 4MABA 3KP9A 3UJ1A 2LJRA 4Q5QA 2YPMA 2YNXA 1XW5A 5GAND 3DKSA 2E2GA 1X5CA 4ZILA 3KD0A 3RBTA 5J9BA 2ON5A 2X8CA 4ZBAA 2FCHA 2MBTA 5KN3A 1T00A 4MF6A 2GQKA 1B9YC 3O3TA 2N5AA 1GP1A 5HFIA 1TRSA 5F05A 2XC2A 4BVXB 5IMAA 2QA1A 5JWRB 1PL2A 5H5SA 1GTAA 2C3NA 3APSA 2HT9A 1NW2A 4YAVA 4IQ1A 2VOCA 1FG4A 4CW9A 4K6XA 2K8SA 3IRAA 4LL4B 5DBQA 3TKSA 5GSTA 3E0UA 1EEMA 3D6IA 4G0IA 2B1KA 1BJXA 1THOA 2ZNMA 3P8WA 5CP1A 1XWGA 2GGTA 1IYHA 1GL8A 6GSYA 2WS2A 1SU9A 1HD2A 2J9HA 4HDEA 1VF2A 3RPPA 4XTSA 2MMAA 2AHEA 4FH8A 2B7JA 2YJ7A 4F03A 3QAWA 1V58A 5FT3A 1GLQA 3D22A 4O7HA 4MF7A 5HR1A 3GHAA 3HJMA 4GTUA 4V1Ap 2H66A 4XRDA 1OC8A 2CVBA 3I43A 4LL1B 4NV2A 5A5KA 1XVWA 4QQ7A 2CV4A 2C80A 2JZRA 2V1MA 4KNDA 5IMZA 1GLPA 2DJ2A 2AAWA 4K2DA 5KOXA 1HNBA 2YWNA 3F9UA 3IXRA 4HI7A 1SJZA 4LA1A 4IELA 2F3MA 4YH2A 4HOJA 13GSA 2WJUA 2YZHA 5B7CA 4K1FA 4TR4A 2EC4A 3GL5A 2JSYA 2H1DA 2ZCTA 1QUWA 5D9TA 2PVOC 4OMVA 4IW9A 4XS1A 5DCGA 3HJPA 3ZYWA 1J0FA 1U3AA 2CZ2A 5G5EA 4IN0A 4OFNA 3D0ZA 1YEXA 3NZNA 3QMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL7 A;  4TN8 A;  1BYE A;  4MMM A;  3C1R A;  1WIK A;  5HR3 A;  1EGR A;  5DVB A;  2RM5 A;  1O73 A;  4I2T A;  1S3A A;  5CYY A;  4LLR A;  1JLV A;  4KA0 A;  1GH2 A;  3CRU A;  1O8W A;  3DYR A;  2DJ1 A;  1A2M A;  3HD5 A;  4KDU A;  2OBI A;  3KCM A;  2OAD A;  2PMT A;  2O7K A;  2HZE B;  4GXZ A;  2OJL A;  2IME A;  1A0F A;  4RI6 A;  2VL3 A;  4QL7 A;  1SK1 A;  1YY7 A;  2VUP A;  4J2F A;  3H79 A;  1A8Y A;  2I1U A;  5CRH A;  2KHP A;  5DAL B;  3ZLP A;  2MMZ A;  1K0O A;  2VCQ A;  4OFM A;  3ZIJ A;  4TXO A;  2YN1 A;  5LD0 A;  3L78 A;  2KOK A;  4WXT A;  4ILF A;  2AUV A;  1GTB A;  3ZFB A;  4BPY A;  4EL1 A;  1M2D A;  1ACV A;  1M0U A;  4GCI A;  1OC9 B;  1SJ6 A;  3L9S A;  3CTF A;  4EVM A;  4X43 A;  1MTC A;  1BQ7 A;  1TP9 A;  4KDY A;  3L9V A;  9GSS A;  2M80 A;  4ZL8 A;  3U5R E;  1M2B A;  1WMJ A;  1C72 A;  4YAP A;  4MK3 A;  2VIM A;  3GUR A;  2C3T A;  1XW6 A;  3FK8 A;  1OYJ A;  2CT6 A;  1NM3 A;  2JZS A;  3DGQ A;  3GN3 A;  4FIW A;  3KZQ A;  2VLV A;  2AB6 A;  4V1A g;  4GWR A;  1Q98 A;  3VI7 A;  2VD0 A;  4AJ6 A;  3M0F A;  4ZIJ A;  3GIX A;  1V9W A;  3EUR A;  4BVX A;  2O8V B;  3IAS 2;  1OVN A;  4I2U A;  3RHC A;  1YKC A;  5AIX A;  2ON7 A;  2EIO A;  1B4P A;  2NDO A;  5IOW A;  2FWH A;  3Q18 A;  2IIY A;  1J9B A;  3ME8 A;  3APQ A;  1XXU A;  8GSS A;  4XS6 A;  5H5Q A;  3KTL A;  3TRX A;  4KAE A;  2PVQ A;  2DIZ A;  1PRX A;  1Z6N A;  2FGX A;  3NOF A;  1FVJ A;  1E2Y A;  1WWJ A;  1QXH A;  3C8E A;  4IBP A;  1K3O A;  5CRG A;  4DSS A;  5IIZ A;  1K0A A;  1E6B A;  1ERW A;  3DIE A;  1Q4J A;  2C3Q A;  3FYG A;  1ZOF A;  4Q5F A;  6GSW A;  3DVX A;  5IMV A;  4ZL7 A;  2KLX A;  5G30 A;  1SL0 B;  1X5E A;  1Z3E A;  2LNT A;  4V2N A;  3TRQ A;  2RUE A;  4NV5 A;  2N5B A;  5AIV A;  2H70 A;  1XWA A;  1JFU A;  2P5R A;  4LMW A;  4ML6 A;  5E59 A;  3EC3 A;  3HCZ A;  1XWK A;  2QGV A;  2I81 A;  4L8E A;  2PPT A;  2GSS A;  3AY8 A;  5KN2 A;  1OKD A;  5B6N A;  3BCK A;  2H71 A;  1DE2 A;  1BED A;  4MH2 A;  1V40 A;  4K7O A;  2HFD A;  2YAN A;  3M9K A;  4GRF A;  2MMN A;  5IPH A;  1XWB A;  2LJA A;  1YF0 A;  1ERU A;  1AW9 A;  4L0U A;  2K8V A;  19GS A;  2FD3 A;  2TRC P;  1FHE A;  2XPE A;  3W8S A;  2VO4 A;  3TKP A;  5IQY A;  3LWA A;  4EE0 A;  5F0G A;  2NTO A;  1R5P A;  1ZYQ B;  1ZL9 A;  2L5L A;  2CA8 A;  3R2Q A;  2L6C A;  4G9H A;  1MEK A;  5F8B A;  3HZ8 A;  5J9C A;  3GRX A;  1TRV A;  2X64 A;  4KB3 A;  2YOI A;  3LSZ A;  2F9S A;  2GQL A;  1U87 A;  1FO5 A;  4POL A;  4NHW A;  4ZL9 A;  4IJI A;  4J57 E;  5COH A;  5G1K A;  1TU7 A;  3EU4 A;  3UVH A;  3EVI A;  3UOM A;  2GZY A;  2KP1 A;  1DBY A;  3GMF A;  1AQV A;  1HQO A;  1PD2 1;  1I9D A;  5D73 A;  3C71 A;  4OCF A;  4G19 A;  2FLS A;  3QCP A;  1EOH A;  2IMF A;  1ILO A;  1M7T A;  3PR8 A;  4KE3 A;  5DAK A;  2F51 A;  2LRT A;  2L4Q A;  1EV4 A;  2WCI A;  3MWH A;  4I97 A;  4ECJ A;  1W4V A;  3ZFL A;  5ID2 A;  1YJ6 A;  3TKS E;  5E4W A;  5ELG A;  3TKQ A;  1HYU A;  3VWW A;  3VI5 A;  3UBK A;  1A0R P;  2IMI A;  2LTK A;  3IAM 2;  1KBN A;  3HVS A;  2GSQ A;  1GSQ A;  5CO3 A;  4FYB A;  2REM A;  5D8I A;  4AJ8 A;  3C7M A;  3K8N A;  1O85 A;  5D96 A;  2P0G A;  4JR4 A;  4ID0 A;  2BJX A;  3FR6 A;  3W8J A;  1MDJ A;  4XCS A;  2WGR A;  3TJK A;  1RQM A;  3US3 A;  3E9J B;  2LST A;  2YJH A;  4PQ1 A;  5HFG A;  1XZO A;  2VAF A;  3N9J A;  1Z7R A;  1JLW A;  1QQ2 A;  5ECK B;  1ZZY A;  1A2J A;  1GNW A;  2VCV A;  5GZZ B;  5CAX A;  4K7N A;  3LG6 A;  2IWT A;  3J7Y k;  1N2A A;  2CAI A;  1YF1 A;  3A2W A;  3A2V A;  5ECS A;  1R7H A;  1GUH A;  2H74 A;  3FKF A;  3Q74 A;  2LV3 A;  4DSQ A;  4PGT A;  2OAC A;  3TJJ A;  4AF2 A;  16GS A;  1K3Y A;  3PH9 A;  3P2A A;  5ECM B;  3V1W A;  1SL1 B;  2L57 A;  4MZW A;  3IK7 A;  5KN0 A;  5JCG A;  3WD6 A;  4DVC A;  3N5O A;  4F2I A;  3IBH A;  3RHB A;  2K18 A;  2QKE A;  4ULX A;  4EUY A;  5LCZ A;  3IC4 A;  5DJL A;  3LOR A;  4CDO A;  2H0G A;  5HR2 A;  2NBS A;  1KTE A;  5EPF A;  3KIJ A;  3KXO A;  3HHV A;  3HVX A;  2RUF A;  4HQZ A;  3WT2 A;  1W89 A;  1TU8 A;  1GSE A;  1JZR A;  1ERT A;  2GDR A;  2GT6 A;  5IPG A;  4WKW A;  4TR0 A;  2IPA A;  3FRC A;  5A4W A;  2L5O A;  2TIR A;  3BD2 A;  4XS4 B;  4JZQ A;  2OE0 A;  3IPZ A;  3TRP A;  2FHE A;  4K7I A;  4MPF A;  2YV7 A;  4KH7 A;  4XRA A;  1AQX A;  3EIN A;  2LUS A;  1WE0 A;  1SKS B;  3L0H A;  3HXS A;  3FZA A;  5J41 A;  3KGK A;  1QGV A;  1VRS D;  3CSH A;  1GWC A;  4IVF A;  5JWQ B;  3KH9 A;  3TJG A;  1LJR A;  4FYU A;  3TOT A;  2FWF A;  12GS A;  3DRN A;  5IMD A;  4BVY A;  1F3A A;  3GST A;  3VWV A;  3G7J A;  1T4Y A;  3IA1 A;  4RQX A;  4P3Y B;  3UMA A;  3TOU A;  4POM A;  3E3E A;  2V41 A;  2H6Z A;  6GSS A;  1M2A A;  3PIN A;  4ECB A;  4TR3 A;  1ZMA A;  4GF0 A;  4YQV A;  4H86 A;  1O8X A;  4NPB A;  3FR9 A;  3FHK A;  5CNW A;  1S3C A;  4TW5 A;  3GV1 A;  4ZB9 A;  4IJ3 A;  1X9S B;  5ECO B;  4HJM A;  4TRX A;  3C73 A;  2FNO A;  4HEA 2;  3VPQ A;  11GS A;  2IN3 A;  3GYK A;  1X0R A;  2R4V A;  2MZC A;  1YKA A;  2M46 A;  2DLX A;  3UBL A;  1FAA A;  1AXD A;  4GSS A;  4WR5 A;  4GST A;  2X8H A;  2IJY A;  4L5O A;  1X9M B;  3TKR A;  4ECI A;  2IL3 A;  2MBS A;  3GA4 A;  2JZT A;  2LNS A;  1KEB A;  3LJR A;  1M9A A;  3LQ7 A;  2FY6 A;  3GH9 A;  5C04 A;  4G10 A;  4MPG A;  1U88 A;  2I9H A;  3ZRE A;  1LU4 A;  3G9B A;  5D9X A;  2WFC A;  4JR6 A;  4ZBD A;  2OE3 A;  4HU9 A;  3ZVJ D;  2A2S A;  4TOP A;  4EXJ A;  5ECR B;  1O7U A;  2J23 A;  2ES7 A;  3ERG A;  2OKA A;  2HRN A;  5INY A;  3UL3 A;  1K0C A;  3BOA A;  2OA7 A;  1M99 A;  4EKZ A;  5B8B A;  3F3R A;  1K0N A;  2VLU A;  4OWY A;  2CX3 A;  4PUA A;  1A24 A;  5GSS A;  4FO5 A;  1XPV A;  2H8L A;  1PMT A;  1EP8 A;  4V2M A;  5KN1 A;  2YWO A;  3TJF A;  4O5R A;  3A2X A;  4WET A;  1K0B A;  5GAP D;  4NWY A;  1JZD A;  2VL9 A;  4AJ7 A;  4ZBB A;  4X1U A;  1YDK A;  5DJM A;  6GSV A;  3LEF A;  3IV4 A;  2DJ3 A;  4MF5 A;  1JZW A;  4MZB A;  2CVD A;  3DWV A;  3EU3 A;  2H75 A;  2RLI A;  1F6M C;  3DXB A;  5IO2 A;  3O6T A;  4HU7 A;  5EVO A;  2IFQ B;  2JSZ A;  5IOX A;  1TXX A;  2H6Y A;  2H73 A;  5ABR A;  5ELA A;  1UC7 A;  3VK9 A;  5D9V A;  3RAZ A;  4PNG A;  5F07 A;  18GS A;  1J08 A;  1TRW A;  5IM9 A;  1ZGN A;  4XS4 A;  1TJD A;  5F06 A;  4IGJ A;  1XOA A;  4AGS A;  3CTG A;  4OO5 A;  2XHF A;  3CSI A;  1PGT A;  4N30 A;  3P7X A;  3F3Q A;  3LYK A;  2VCX A;  2GTU A;  1OAZ A;  4JRR A;  20GS A;  1CQH A;  5C00 A;  1G6W A;  1GTI A;  3CBU A;  3QFA C;  1TK8 B;  1X9W B;  4MJC A;  2OE1 A;  2PN8 A;  2DJJ A;  4ZB6 A;  1WJK A;  5ECL B;  2GZZ A;  2V6O A;  4WF4 A;  2L59 A;  4L0W A;  2DML A;  4K0G A;  2H1B A;  3D4M A;  2YZU A;  3M1G A;  2HLS A;  5B8A A;  2CVK A;  2MMO A;  1B8X A;  2R3X A;  4QL9 A;  1TOF A;  3HVV A;  3APO A;  1B48 A;  4MH3 A;  2H1A A;  1QK8 A;  2N5F A;  2HNL A;  1HNC A;  5A4V A;  1TK5 B;  1LBK A;  5B6M A;  4MCU A;  1AAZ A;  1PL1 A;  5DDL A;  2H72 A;  4V2L A;  2NVL A;  1THX A;  2P5Q A;  3BJ5 A;  4ACS A;  5J5N A;  4KCE A;  1A8L A;  1URM A;  3CYN A;  3GNJ A;  1EEJ A;  1Z9H A;  3Q6O A;  4TR1 B;  1NSW A;  2EIR A;  2DSA A;  2LEG A;  1V57 A;  4MDC A;  1SKW B;  2JAD A;  1GUK A;  1M9B A;  6GSU A;  4XIH A;  3JCM L;  3KM6 A;  1YZX A;  4ZB8 A;  2VL2 C;  1PN9 A;  2E7P A;  3QD9 A;  3F6F A;  5G5F A;  4NAX A;  1A23 A;  3ZZX A;  3KJY A;  1ZCP A;  4EO3 A;  2HZE A;  3GKM A;  22GS A;  1IYI A;  3DEX A;  3TGZ A;  3A5W A;  1PX7 A;  2CQ9 A;  3IK9 A;  2GST A;  3FZ5 A;  4RI7 A;  4RUV A;  2C0D A;  3HZ4 A;  2XBI A;  4LMV A;  3IOS A;  1Z7P A;  5DAL A;  5DQY A;  3GKX A;  3VLN A;  2PGT A;  4YQM A;  1YQ1 A;  1SEN A;  2D2Z A;  1R5A A;  2LRC A;  3QAV A;  2B3S A;  4TVE A;  5ECN B;  3MDK A;  2X99 A;  4GQC A;  2GS3 A;  1K0D A;  3D21 A;  4F9Z A;  4N10 A;  2HXK A;  1OC9 A;  3FW2 A;  3GKK A;  1TTZ A;  1T3B A;  3UVT A;  5LNK e;  2K9F A;  3F4R A;  1QFN A;  2B1L A;  4EDZ A;  2CAQ A;  3EMP A;  2AV4 A;  1XCC A;  5JWO B;  1TW9 A;  1SK0 A;  1SK2 A;  4L5L A;  6GST A;  4IKH A;  3TB2 A;  4N0Z A;  3VFI A;  5ECP B;  3GKN A;  1WRY A;  3IDV A;  4WR4 A;  1MD3 A;  2H01 A;  4BA7 A;  3IHQ A;  1OE7 A;  2ZUP A;  3EWL A;  3TDG A;  1T1V A;  2GSR A;  2L4C A;  3A3T A;  2C0F A;  2DJ0 A;  2I4A A;  3GFK A;  1T8E B;  2IFQ A;  3KMO A;  1JHB A;  3F63 A;  4MJB A;  5IO0 A;  5JCU A;  2G2Q A;  2JL4 A;  4TKY A;  3F0I A;  2GZP A;  4TXV A;  3ZRD A;  1PKW A;  2WB9 A;  1GSF A;  1EWX A;  1VGL A;  2FWG A;  1MDI A;  1GNE A;  5IMC A;  3BBY A;  4NHZ A;  2V32 A;  3VPT A;  1Z6M A;  1G0T A;  3LFL A;  2O89 A;  4Z7X A;  3WT1 A;  4IHU A;  4F82 A;  4DSR A;  1BG5 A;  3D5J A;  1KNG A;  2LJK A;  1N8J A;  3RDW A;  2HE3 A;  3GTU B;  2FA4 A;  2HZF A;  4K8M A;  4E8E A;  1DSB A;  1USB A;  1G6Y A;  4GQF A;  4KDX A;  3CRT A;  3M8N A;  4OCE A;  3F4S A;  1ML6 A;  2VCZ A;  3QDN A;  3KTB A;  4O32 A;  1BAY A;  4MP4 A;  1MDK A;  3H1N A;  2L6D A;  4OFT A;  4DSS B;  3I6A A;  1F37 A;  3CXG A;  4JE1 A;  1DUG A;  1U6T A;  3TCO A;  1FVK A;  2VM2 A;  1Y25 A;  3WGE A;  3GSS A;  5EL8 A;  3BCI A;  4TR1 A;  3VWX A;  1K0M A;  2A2R A;  3GL3 A;  4FYC A;  2TRX A;  1XW9 A;  5CRE A;  1GSU A;  3FZ9 A;  1TKD B;  1Y6E A;  4NXI A;  4BWS A;  1PQN A;  2C4J A;  4IP1 A;  5A4U A;  3VUR A;  5HQP A;  4JED A;  2JU5 A;  2OBK A;  4OD7 A;  4J56 E;  4IQA A;  2H19 A;  3MAK A;  4GSN A;  1XVQ A;  3M3M A;  2NPB A;  1VF3 A;  2DC5 A;  2YWM A;  1SYR A;  1EGO A;  3I9V 2;  3UAR A;  2R6K A;  4HUA A;  2EIQ A;  3LYP A;  4MJE A;  1T4Z A;  4ISD A;  5CRW A;  3WGX A;  4PXO A;  1DE1 A;  2QC7 A;  3TJB A;  3GUS A;  2KP2 A;  1GUL A;  1WOU A;  1O6J A;  1FB0 A;  2CZ3 A;  2YWI A;  2HSH A;  1Z5Y E;  1UA5 A;  1TK0 B;  3LGC A;  4N11 A;  5HFK A;  5HR0 A;  2XPD A;  1UVZ A;  1FW1 A;  4DEJ A;  3UEM A;  1ON4 A;  3HA9 A;  1RK4 A;  2DIY A;  4PX1 A;  3S9F A;  2R2J A;  3ZL5 A;  1SYX A;  2BTO T;  1G7E A;  3TKS C;  1ABA A;  2QSI A;  3Q19 A;  3KP8 A;  3UIW A;  4NMU A;  4EDY A;  7GSS A;  2B7K A;  1X5D A;  3WGD A;  2F8F A;  2X8G A;  3QOU A;  2IMK A;  2CX4 A;  2VCT A;  2WDU A;  1F3B A;  3QPM A;  5FHI A;  5AGY A;  3PGT A;  4KW6 A;  1EOG A;  2YP6 A;  4PUF C;  2WZ9 A;  2R5G A;  3M9J A;  1MD4 A;  2PWJ A;  3I69 A;  1SL2 B;  3G7Y A;  5DAK B;  4I8B A;  3ED3 A;  2LRN A;  4G2E A;  5J4U A;  3VWU A;  4F0C A;  2K6V A;  5ID2 B;  3KMN A;  4GLT A;  1T7P B;  1GSY A;  4Q5R A;  4MA9 A;  4PNF A;  1ERV A;  3EE2 A;  1SD8 A;  2C8U A;  4ZXG A;  2LKU A;  1AC1 A;  1O81 A;  1OKT A;  2YCD A;  3HJO A;  4YQU A;  1XIY A;  1FOV A;  2MYG A;  4WEY A;  2B6M A;  4RQR A;  2GLR A;  2AYT A;  2FWE A;  2H1G A;  2VLT A;  2WRT A;  2O85 A;  4POB A;  2C0G A;  10GS A;  3ME7 A;  1PA3 A;  2HYX A;  2VL2 A;  5AIS A;  3W6G A;  4OO4 A;  5G2Z A;  4KCA A;  2YV9 A;  5JCW A;  3G7I A;  2JAC A;  2B5X A;  3ZTL A;  2B5Y A;  3GTU A;  5FWG A;  1PKZ A;  2VCW A;  1H75 A;  2XBQ A;  2FA8 A;  4D73 B;  1RW1 A;  4WBJ A;  3ZIV A;  4POK A;  1JZO A;  5EY6 A;  4WBR D;  3RPN A;  2PU9 C;  1F9M A;  3C1S A;  5KEJ A;  3SWL A;  1I5G A;  5D93 A;  1B4Q A;  3J7Y b;  5ENU A;  2LQO A;  4JBB A;  3LXZ A;  5L71 A;  1U3I A;  17GS A;  5ECQ B;  2H0H A;  2PER A;  2FUG 2;  5ECI B;  2DBC A;  2C1Y A;  2RM6 A;  3L4N A;  3ZIT A;  3MSZ A;  2V2G A;  1XOB A;  2O87 A;  1F2E A;  1WP0 A;  2PUK C;  4KSO A;  4KSM A;  4IS0 A;  1WPI A;  2ALB A;  3OR5 A;  4JU5 A;  2HRF A;  2RII A;  3LXT A;  4KX4 A;  2H6X A;  3FEU A;  4I6X A;  1EP7 A;  4MLY A;  1TI3 A;  4EF0 A;  3UAP A;  2GQM A;  3H4K A;  4HZ2 A;  5IMF A;  3H8Q A;  2H0I A;  2E0Q A;  1ST9 A;  2GVP A;  2HI7 A;  2LQQ A;  4K0N A;  5CRD A;  3U6V A;  3L9U A;  4WF5 A;  4K9Z A;  6GSX A;  3DVW A;  4MJA A;  3FZ4 A;  3NIV A;  2I3Y A;  1H4O A;  3CSJ A;  2DMM A;  5G31 A;  1VF1 A;  3KEB A;  4HS1 A;  3ERF A;  3HY2 A;  2R37 A;  1CQG A;  3GH6 A;  3WYW A;  4O92 A;  5H5R A;  2P31 A;  1QMV A;  1NHO A;  4IP6 A;  2LS5 A;  1K3L A;  3IE3 A;  3H93 A;  1EZK A;  4EC0 A;  2H76 A;  4HZ4 A;  2Z9S A;  3O76 A;  3QFB C;  1HNA A;  3TUE A;  3HDC A;  2A4V A;  1V98 A;  1AIU A;  1GSD A;  1TDI A;  1XWC A;  3D4T A;  1S3D A;  2G0F A;  5D9W A;  3FR3 A;  1UN2 A;  3F6D A;  3IR4 A;  2VD1 A;  5J3R A;  4CHS A;  5DQS A;  1R4W A;  2BMX A;  3EMX A;  4Q5N A;  1GUM A;  4X0X A;  2WUL A;  5DCH A;  2F8A A;  1TRU A;  2M72 A;  3ISO A;  1VF4 A;  5ECH B;  1G7O A;  2H30 A;  1GSS A;  3ZMK A;  3HYP A;  1PSQ A;  2E2M A;  3QAG A;  1A2L A;  1AUC A;  3FY7 A;  2GT5 A;  1TI1 A;  3HKR A;  4PUR A;  2VM1 A;  3GX0 A;  3QR6 A;  1YEP A;  3F8U A;  1OC3 A;  2B5E A;  3P90 A;  3CMI A;  2DJK A;  1OE8 A;  4I5Q A;  4KUN A;  4BWQ A;  1R26 A;  3DML A;  2C0E A;  3F4T A;  1EV9 A;  3GX8 A;  4F0B A;  1ZYE A;  1XFL A;  1SKR B;  1AQW A;  5G1L A;  4ECC A;  2IMD A;  3DD3 A;  4N0V A;  1SD9 A;  1GRX A;  1SJI A;  4KGI A;  1XBS A;  5AN1 A;  3KH7 A;  3ZVJ A;  2KUC A;  3ERW A;  1NHY A;  4XHM A;  2PBJ A;  4PQI A;  1PX6 A;  2HSY A;  3EYT A;  3MNG A;  4E8H A;  4ML1 A;  4HQS A;  4TXO B;  1GTU A;  4PQH A;  3SBC A;  14GS A;  2V6K A;  1V2A A;  4HJ2 A;  1B9X C;  4MZC A;  3ZML A;  4D73 A;  1FB6 A;  2AJQ B;  1BX9 A;  4MAB A;  3KP9 A;  3UJ1 A;  2LJR A;  4Q5Q A;  2YPM A;  2YNX A;  1XW5 A;  5GAN D;  3DKS A;  2E2G A;  1X5C A;  4ZIL A;  3KD0 A;  3RBT A;  5J9B A;  2ON5 A;  2X8C A;  4ZBA A;  2FCH A;  2MBT A;  5KN3 A;  1T00 A;  4MF6 A;  2GQK A;  1B9Y C;  3O3T A;  2N5A A;  1GP1 A;  5HFI A;  1TRS A;  5F05 A;  2XC2 A;  5IMA A;  5JWR B;  1PL2 A;  5H5S A;  1GTA A;  2C3N A;  3APS A;  2HT9 A;  1NW2 A;  4YAV A;  4IQ1 A;  2VOC A;  1FG4 A;  4CW9 A;  4K6X A;  2K8S A;  3IRA A;  4LL4 B;  5DBQ A;  3TKS A;  5GST A;  3E0U A;  1EEM A;  3D6I A;  2B1K A;  1BJX A;  1THO A;  2ZNM A;  3P8W A;  5CP1 A;  1XWG A;  2GGT A;  1IYH A;  1GL8 A;  6GSY A;  2WS2 A;  1SU9 A;  1HD2 A;  2J9H A;  4HDE A;  1VF2 A;  3RPP A;  4XTS A;  2MMA A;  2AHE A;  4FH8 A;  2B7J A;  2YJ7 A;  4F03 A;  3QAW A;  1V58 A;  5FT3 A;  1GLQ A;  3D22 A;  4O7H A;  4MF7 A;  5HR1 A;  3GHA A;  3HJM A;  4GTU A;  4V1A p;  2H66 A;  4XRD A;  1OC8 A;  2CVB A;  3I43 A;  4LL1 B;  4NV2 A;  5A5K A;  1XVW A;  4QQ7 A;  2CV4 A;  2C80 A;  2JZR A;  2V1M A;  4KND A;  5IMZ A;  1GLP A;  2DJ2 A;  2AAW A;  4K2D A;  1HNB A;  2YWN A;  3F9U A;  3IXR A;  4HI7 A;  1SJZ A;  4LA1 A;  4IEL A;  2F3M A;  4YH2 A;  4HOJ A;  13GS A;  2WJU A;  2YZH A;  5B7C A;  4K1F A;  4TR4 A;  2EC4 A;  3GL5 A;  2JSY A;  2H1D A;  2ZCT A;  1QUW A;  5D9T A;  2PVO C;  4OMV A;  4IW9 A;  4XS1 A;  5DCG A;  3HJP A;  3ZYW A;  1J0F A;  1U3A A;  2CZ2 A;  5G5E A;  4IN0 A;  4OFN A;  3D0Z A;  1YEX A;  3NZN A;  3QMX A; 
#chains in the Genus database with same CATH topology
 4BL7 A;  4TN8 A;  1BYE A;  4MMM A;  3C1R A;  1WIK A;  5HR3 A;  1EGR A;  5DVB A;  2RM5 A;  1O73 A;  4I2T A;  1S3A A;  5CYY A;  4LLR A;  1JLV A;  4KA0 A;  1GH2 A;  3CRU A;  1O8W A;  3DYR A;  2DJ1 A;  1A2M A;  3HD5 A;  4KDU A;  2OBI A;  3KCM A;  2OAD A;  2PMT A;  2HSM A;  2O7K A;  2HZE B;  5KOW A;  4GXZ A;  2OJL A;  2IME A;  1A0F A;  4RI6 A;  2VL3 A;  4QL7 A;  1SK1 A;  1YY7 A;  2VUP A;  4J2F A;  3H79 A;  1A8Y A;  2R0C A;  2I1U A;  5CRH A;  2KHP A;  5DAL B;  3ZLP A;  2MMZ A;  1K0O A;  2VCQ A;  4OFM A;  3ZIJ A;  4TXO A;  2YN1 A;  5LD0 A;  3L78 A;  2KOK A;  4EIP A;  4WXT A;  4ILF A;  2AUV A;  1GTB A;  3ZFB A;  4BPY A;  4EL1 A;  1M2D A;  1ACV A;  1M0U A;  4GCI A;  1OC9 B;  1SJ6 A;  3L9S A;  3CTF A;  4EVM A;  4X43 A;  1MTC A;  1BQ7 A;  1TP9 A;  4KDY A;  3L9V A;  9GSS A;  2M80 A;  4ZL8 A;  3U5R E;  1M2B A;  1WMJ A;  1C72 A;  4YAP A;  4MK3 A;  2VIM A;  3GUR A;  2C3T A;  1XW6 A;  3FK8 A;  1OYJ A;  2CT6 A;  1NM3 A;  2JZS A;  3DGQ A;  3GN3 A;  4FIW A;  3KZQ A;  2VLV A;  2AB6 A;  4V1A g;  4GWR A;  1Q98 A;  3VI7 A;  2VD0 A;  4AJ6 A;  3M0F A;  4ZIJ A;  3GIX A;  1V9W A;  3EUR A;  4BVX A;  2O8V B;  3IAS 2;  1OVN A;  4I2U A;  3RHC A;  1YKC A;  5AIX A;  2ON7 A;  2EIO A;  1B4P A;  2NDO A;  5IOW A;  3A5I A;  2FWH A;  3Q18 A;  2IIY A;  1J9B A;  3ME8 A;  3MYD A;  3APQ A;  1FOH A;  1XXU A;  8GSS A;  4XS6 A;  5H5Q A;  3KTL A;  3TRX A;  4KAE A;  2PVQ A;  2DIZ A;  4USS A;  1PRX A;  1Z6N A;  2FGX A;  3NOF A;  1FVJ A;  1E2Y A;  1WWJ A;  1QXH A;  3C8E A;  4IBP A;  1K3O A;  5CRG A;  4DSS A;  5IIZ A;  1K0A A;  1E6B A;  1ERW A;  3DIE A;  3HVN A;  1Q4J A;  2C3Q A;  3FYG A;  1ZOF A;  4Q5F A;  6GSW A;  3DVX A;  5IMV A;  4ZL7 A;  2KLX A;  5G30 A;  1SL0 B;  1X5E A;  1Z3E A;  2LNT A;  4V2N A;  3TRQ A;  4Z2U A;  2RUE A;  4NV5 A;  2N5B A;  5AIV A;  2H70 A;  1XWA A;  1JFU A;  2P5R A;  4LMW A;  4ML6 A;  5E59 A;  3EC3 A;  3HCZ A;  1XWK A;  2QGV A;  2I81 A;  4L8E A;  2PPT A;  2GSS A;  3AY8 A;  5KN2 A;  1OKD A;  5B6N A;  3BCK A;  3R3E A;  2H71 A;  1DE2 A;  1BED A;  4MH2 A;  1V40 A;  4K7O A;  2HFD A;  2YAN A;  3M9K A;  4GRF A;  2MMN A;  5IPH A;  1XWB A;  2LJA A;  1YF0 A;  1ERU A;  1AW9 A;  4L0U A;  2K8V A;  19GS A;  2FD3 A;  2TRC P;  1FHE A;  2XPE A;  3W8S A;  2VO4 A;  3TKP A;  5IQY A;  3LWA A;  4EE0 A;  5F0G A;  2NTO A;  1R5P A;  1ZYQ B;  1ZL9 A;  2L5L A;  2CA8 A;  3R2Q A;  2L6C A;  4G9H A;  1MEK A;  5F8B A;  3HZ8 A;  5J9C A;  3GRX A;  1TRV A;  2X64 A;  4KB3 A;  2YOI A;  3LSZ A;  2F9S A;  2GQL A;  1U87 A;  3EPT A;  1FO5 A;  4POL A;  4NHW A;  4ZL9 A;  4IJI A;  4J57 E;  5COH A;  5G1K A;  1TU7 A;  3EU4 A;  3UVH A;  3EVI A;  3UOM A;  2GZY A;  2KP1 A;  1DBY A;  3GMF A;  1AQV A;  1HQO A;  1PD2 1;  1I9D A;  5D73 A;  3C71 A;  4OCF A;  4G19 A;  2FLS A;  3QCP A;  1EOH A;  2IMF A;  1ILO A;  1M7T A;  3PR8 A;  4KE3 A;  5DAK A;  2F51 A;  2LRT A;  2L4Q A;  1EV4 A;  2WCI A;  3MWH A;  4I97 A;  4ECJ A;  1W4V A;  3ZFL A;  5ID2 A;  1YJ6 A;  3TKS E;  5E4W A;  5ELG A;  3TKQ A;  2UZ8 A;  1HYU A;  3VWW A;  3VI5 A;  3UBK A;  1A0R P;  2IMI A;  2LTK A;  3IAM 2;  1KBN A;  3HVS A;  2GSQ A;  1GSQ A;  5CO3 A;  4FYB A;  2REM A;  5D8I A;  4AJ8 A;  3C7M A;  3K8N A;  1O85 A;  5D96 A;  2P0G A;  4JR4 A;  4ID0 A;  2BJX A;  3FR6 A;  3W8J A;  1MDJ A;  4XCS A;  2WGR A;  3TJK A;  1RQM A;  3US3 A;  3E9J B;  2LST A;  2YJH A;  4PQ1 A;  5HFG A;  1XZO A;  2VAF A;  3N9J A;  2HRA A;  1Z7R A;  1JLW A;  1QQ2 A;  5ECK B;  1ZZY A;  1A2J A;  1GNW A;  2VCV A;  5GZZ B;  5CAX A;  4K7N A;  3LG6 A;  2IWT A;  3J7Y k;  1N2A A;  2CAI A;  1YF1 A;  3A2W A;  3A2V A;  5ECS A;  1R7H A;  1GUH A;  2H74 A;  3FKF A;  3Q74 A;  2LV3 A;  4DSQ A;  4PGT A;  2OAC A;  3TJJ A;  5BMU A;  4AF2 A;  16GS A;  1K3Y A;  3PH9 A;  3P2A A;  4K5S A;  5ECM B;  3V1W A;  1SL1 B;  1PN0 A;  2L57 A;  4MZW A;  4X4J A;  3IK7 A;  5KN0 A;  5JCG A;  3WD6 A;  4DVC A;  3N5O A;  4F2I A;  3IBH A;  3RHB A;  2K18 A;  2QKE A;  4ULX A;  4EUY A;  5LCZ A;  3IC4 A;  5DJL A;  3LOR A;  4CDO A;  2H0G A;  5HR2 A;  2NBS A;  1KTE A;  5EPF A;  3KIJ A;  3KXO A;  3HHV A;  3HVX A;  2RUF A;  4HQZ A;  3WT2 A;  1W89 A;  1TU8 A;  1GSE A;  1JZR A;  1ERT A;  2GDR A;  2GT6 A;  5IPG A;  4WKW A;  4TR0 A;  2IPA A;  3FRC A;  5A4W A;  2L5O A;  2TIR A;  3BD2 A;  4XS4 B;  4JZQ A;  2OE0 A;  3IPZ A;  3TRP A;  2FHE A;  4K7I A;  4MPF A;  2YV7 A;  4KH7 A;  4XRA A;  1AQX A;  3EIN A;  2LUS A;  1WE0 A;  1SKS B;  3L0H A;  3HXS A;  3FZA A;  5J41 A;  3KGK A;  1QGV A;  1VRS D;  3CSH A;  1GWC A;  4IVF A;  5JWQ B;  3KH9 A;  3TJG A;  1LJR A;  4FYU A;  3TOT A;  2FWF A;  12GS A;  3DRN A;  5IMD A;  4BVY A;  1F3A A;  3GST A;  3VWV A;  3G7J A;  1T4Y A;  3IA1 A;  4RQX A;  4P3Y B;  3UMA A;  3TOU A;  4POM A;  3E3E A;  2V41 A;  2H6Z A;  6GSS A;  1M2A A;  3PIN A;  4ECB A;  4TR3 A;  1ZMA A;  4GF0 A;  4YQV A;  4H86 A;  1O8X A;  4NPB A;  3FR9 A;  3FHK A;  5CNW A;  1S3C A;  4TW5 A;  3FMW A;  3GV1 A;  4ZB9 A;  4IJ3 A;  1X9S B;  5ECO B;  4HJM A;  4TRX A;  3C73 A;  2FNO A;  3IHG A;  4HEA 2;  3VPQ A;  11GS A;  2IN3 A;  3GYK A;  1X0R A;  2R4V A;  2MZC A;  1YKA A;  2M46 A;  2DLX A;  3UBL A;  1FAA A;  1AXD A;  4GSS A;  4WR5 A;  4GST A;  2X8H A;  2IJY A;  4L5O A;  1X9M B;  3TKR A;  4ECI A;  2IL3 A;  2MBS A;  3GA4 A;  2JZT A;  2LNS A;  1KEB A;  3LJR A;  1M9A A;  3LQ7 A;  2FY6 A;  3GH9 A;  5C04 A;  4G10 A;  4MPG A;  1U88 A;  4FQU A;  2I9H A;  3ZRE A;  1LU4 A;  3G9B A;  5D9X A;  2WFC A;  4JR6 A;  4ZBD A;  2OE3 A;  4HU9 A;  3ZVJ D;  2A2S A;  4TOP A;  4EXJ A;  5ECR B;  1O7U A;  2J23 A;  2ES7 A;  3ERG A;  2A2P A;  2OKA A;  2HRN A;  5INY A;  3UL3 A;  1K0C A;  3BOA A;  2OA7 A;  1M99 A;  4EKZ A;  5B8B A;  3F3R A;  1K0N A;  2VLU A;  4OWY A;  2CX3 A;  4PUA A;  1A24 A;  5GSS A;  4FO5 A;  1XPV A;  2H8L A;  1PMT A;  1EP8 A;  4V2M A;  5KN1 A;  4K5R A;  2YWO A;  3TJF A;  4O5R A;  3A2X A;  4WET A;  1K0B A;  5GAP D;  4NWY A;  1JZD A;  2VL9 A;  4AJ7 A;  4ZBB A;  4X1U A;  1YDK A;  5DJM A;  6GSV A;  3LEF A;  3IV4 A;  2DJ3 A;  4MF5 A;  1JZW A;  4MZB A;  2CVD A;  3DWV A;  3EU3 A;  2H75 A;  2RLI A;  1F6M C;  3DXB A;  5IO2 A;  3O6T A;  4HU7 A;  5EVO A;  2IFQ B;  2JSZ A;  5IOX A;  1TXX A;  2H6Y A;  2H73 A;  5ABR A;  5ELA A;  1UC7 A;  3VK9 A;  5D9V A;  3RAZ A;  4PNG A;  5F07 A;  18GS A;  1J08 A;  1TRW A;  5IM9 A;  1ZGN A;  4XS4 A;  1TJD A;  5F06 A;  4IGJ A;  1XOA A;  4AGS A;  3CTG A;  4OO5 A;  2XHF A;  3CSI A;  1PGT A;  4N30 A;  3P7X A;  2R0P A;  3F3Q A;  3LYK A;  2VCX A;  2GTU A;  2QA2 A;  1OAZ A;  4JRR A;  3LW9 A;  20GS A;  1CQH A;  5C00 A;  1G6W A;  1GTI A;  3CBU A;  3QFA C;  1TK8 B;  1X9W B;  4MJC A;  2OE1 A;  2PN8 A;  2DJJ A;  4ZB6 A;  1WJK A;  5ECL B;  2GZZ A;  4MNN A;  2V6O A;  4WF4 A;  2L59 A;  4L0W A;  2DML A;  4K0G A;  2H1B A;  3D4M A;  2YZU A;  3M1G A;  2HLS A;  5B8A A;  2CVK A;  2MMO A;  1B8X A;  4O5Q A;  2R3X A;  4QL9 A;  1TOF A;  3HVV A;  3APO A;  1B48 A;  4MH3 A;  2H1A A;  1QK8 A;  2N5F A;  2HNL A;  1HNC A;  5A4V A;  1TK5 B;  1LBK A;  5B6M A;  4MCU A;  1AAZ A;  1PL1 A;  5DDL A;  2H72 A;  4V2L A;  2NVL A;  1THX A;  3PPU A;  2P5Q A;  3BJ5 A;  4ACS A;  5J5N A;  4KCE A;  1A8L A;  1URM A;  3CYN A;  3GNJ A;  1EEJ A;  5BRT A;  1Z9H A;  3Q6O A;  4TR1 B;  1NSW A;  2EIR A;  2DSA A;  2LEG A;  1V57 A;  4MDC A;  1SKW B;  2JAD A;  1GUK A;  1M9B A;  6GSU A;  4XIH A;  3JCM L;  3KM6 A;  1YZX A;  4ZB8 A;  2VL2 C;  1PN9 A;  2E7P A;  3QD9 A;  3F6F A;  5G5F A;  4NAX A;  1A23 A;  3ZZX A;  3KJY A;  1ZCP A;  4EO3 A;  2HZE A;  3GKM A;  22GS A;  1IYI A;  3DEX A;  3TGZ A;  3A5W A;  1PX7 A;  2CQ9 A;  3IK9 A;  4EIQ A;  2GST A;  3FZ5 A;  4RI7 A;  4RUV A;  2C0D A;  3HZ4 A;  2XBI A;  4LMV A;  3IOS A;  1Z7P A;  5DAL A;  5DQY A;  3GKX A;  3VLN A;  2PGT A;  4YQM A;  1YQ1 A;  4K2X A;  1SEN A;  2D2Z A;  1R5A A;  2LRC A;  3QAV A;  2B3S A;  4TVE A;  5ECN B;  3MDK A;  4BL7 B;  2X99 A;  4GQC A;  2GS3 A;  1K0D A;  3D21 A;  4F9Z A;  4N10 A;  2HXK A;  1OC9 A;  1PFO A;  4BIK A;  3FW2 A;  3GKK A;  1TTZ A;  1T3B A;  3UVT A;  5LNK e;  2K9F A;  3F4R A;  1QFN A;  2X4A A;  2B1L A;  4EDZ A;  2CAQ A;  4O5U A;  3EMP A;  2AV4 A;  1XCC A;  5JWO B;  1TW9 A;  1SK0 A;  1SK2 A;  4L5L A;  6GST A;  4IKH A;  3TB2 A;  4N0Z A;  3VFI A;  5ECP B;  3GKN A;  1WRY A;  3IDV A;  4WR4 A;  1MD3 A;  2H01 A;  1ZYP A;  4KF9 A;  4BA7 A;  3IHQ A;  1OE7 A;  2ZUP A;  3EWL A;  3TDG A;  1T1V A;  2GSR A;  2L4C A;  3A3T A;  2C0F A;  2DJ0 A;  2I4A A;  3GFK A;  1T8E B;  2IFQ A;  3KMO A;  1JHB A;  3F63 A;  4MJB A;  5IO0 A;  5JCU A;  2G2Q A;  2JL4 A;  4TKY A;  3F0I A;  2GZP A;  4TXV A;  3ZRD A;  1PKW A;  2WB9 A;  1GSF A;  4A5P A;  1EWX A;  1VGL A;  2FWG A;  1MDI A;  1GNE A;  5IMC A;  3BBY A;  4NHZ A;  2V32 A;  3VPT A;  1Z6M A;  1G0T A;  3LFL A;  2O89 A;  4Z7X A;  3WT1 A;  4IHU A;  4F82 A;  4DSR A;  1BG5 A;  3D5J A;  1KNG A;  2LJK A;  1N8J A;  3RDW A;  2HE3 A;  2HRK A;  3GTU B;  2DKH A;  2FA4 A;  2HZF A;  4K8M A;  4E8E A;  1DSB A;  1USB A;  1G6Y A;  4GQF A;  4KDX A;  4G0L A;  3CRT A;  3M8N A;  4OCE A;  3F4S A;  1ML6 A;  2VCZ A;  3QDN A;  3KTB A;  4O32 A;  1BAY A;  4MP4 A;  1MDK A;  3H1N A;  2L6D A;  4OFT A;  4DSS B;  3I6A A;  1F37 A;  3CXG A;  4JE1 A;  1DUG A;  1U6T A;  3TCO A;  1FVK A;  2VM2 A;  1Y25 A;  3WGE A;  3GSS A;  5EL8 A;  3BCI A;  4TR1 A;  3VWX A;  1K0M A;  3IC8 A;  2A2R A;  3GL3 A;  4FYC A;  2TRX A;  1XW9 A;  5CRE A;  1GSU A;  3FZ9 A;  1TKD B;  1Y6E A;  4NXI A;  4BWS A;  1PQN A;  2C4J A;  4IP1 A;  5A4U A;  3VUR A;  5HQP A;  4JED A;  4ICY A;  2JU5 A;  2OBK A;  4OD7 A;  4J56 E;  4IQA A;  4YKF A;  2H19 A;  3MAK A;  4GSN A;  1XVQ A;  3M3M A;  2NPB A;  1VF3 A;  2DC5 A;  2YWM A;  1SYR A;  1EGO A;  3I9V 2;  3UAR A;  2R6K A;  4HUA A;  2EIQ A;  3LYP A;  4MJE A;  1T4Z A;  4ISD A;  5CRW A;  4PTS A;  3WGX A;  4PXO A;  1DE1 A;  2QC7 A;  3TJB A;  3GUS A;  2KP2 A;  1GUL A;  1WOU A;  1O6J A;  1FB0 A;  2CZ3 A;  2YWI A;  2HSH A;  1Z5Y E;  1UA5 A;  1TK0 B;  3LGC A;  4N11 A;  5HFK A;  5HR0 A;  2XPD A;  1UVZ A;  1FW1 A;  4DEJ A;  3UEM A;  1ON4 A;  3HA9 A;  1RK4 A;  2DIY A;  4PX1 A;  3S9F A;  2R2J A;  3ZL5 A;  2X49 A;  1SYX A;  2BTO T;  1G7E A;  3TKS C;  1ABA A;  2QSI A;  3Q19 A;  3KP8 A;  3UIW A;  4NMU A;  4EDY A;  7GSS A;  2B7K A;  1X5D A;  3WGD A;  2A4H A;  2F8F A;  2X8G A;  3QOU A;  2IMK A;  2CX4 A;  2VCT A;  2WDU A;  1F3B A;  3QPM A;  5FHI A;  5AGY A;  3PGT A;  4KW6 A;  1EOG A;  2YP6 A;  4PUF C;  2WZ9 A;  2R5G A;  3M9J A;  1MD4 A;  2PWJ A;  3I69 A;  1SL2 B;  3G7Y A;  5DAK B;  4I8B A;  3ED3 A;  2LRN A;  4G2E A;  5J4U A;  3VWU A;  4F0C A;  2K6V A;  5ID2 B;  3KMN A;  4GLT A;  1T7P B;  1GSY A;  4Q5R A;  4MA9 A;  4PNF A;  1ERV A;  3EE2 A;  1SD8 A;  2C8U A;  4ZXG A;  2LKU A;  1AC1 A;  1O81 A;  1OKT A;  2YCD A;  3HJO A;  4YQU A;  1XIY A;  1FOV A;  2MYG A;  4WEY A;  2B6M A;  4RQR A;  2GLR A;  2AYT A;  2FWE A;  2H1G A;  2VLT A;  2WRT A;  4CY6 A;  2O85 A;  4POB A;  2C0G A;  10GS A;  3ME7 A;  1PA3 A;  1M3J A;  1XG8 A;  2HYX A;  2VL2 A;  5AIS A;  3W6G A;  4OO4 A;  5G2Z A;  4KCA A;  2YV9 A;  5JCW A;  3G7I A;  2JAC A;  2B5X A;  3ZTL A;  2B5Y A;  3GTU A;  5FWG A;  1PKZ A;  2VCW A;  1H75 A;  2XBQ A;  2FA8 A;  4D73 B;  1RW1 A;  4WBJ A;  1S3R A;  3ZIV A;  4POK A;  1JZO A;  5EY6 A;  4WBR D;  3RPN A;  2PU9 C;  1F9M A;  3C1S A;  5KEJ A;  3SWL A;  1I5G A;  5D93 A;  1B4Q A;  3J7Y b;  5ENU A;  2LQO A;  4JBB A;  3LXZ A;  5L71 A;  1U3I A;  17GS A;  5ECQ B;  2H0H A;  2PER A;  2FUG 2;  1M3I A;  5ECI B;  2DBC A;  2C1Y A;  2RM6 A;  3L4N A;  3ZIT A;  3MSZ A;  2V2G A;  1XOB A;  2O87 A;  1F2E A;  4YKG A;  1WP0 A;  2PUK C;  4KSO A;  4KSM A;  4IS0 A;  1WPI A;  2ALB A;  3OR5 A;  4JU5 A;  2HRF A;  2RII A;  3LXT A;  4KX4 A;  2H6X A;  2R0G A;  3FEU A;  4I6X A;  1EP7 A;  3MIX A;  4MLY A;  1TI3 A;  4EF0 A;  3UAP A;  2GQM A;  3H4K A;  4HZ2 A;  5IMF A;  3H8Q A;  2H0I A;  2E0Q A;  1ST9 A;  2GVP A;  2HI7 A;  2LQQ A;  4K0N A;  5CRD A;  3U6V A;  3L9U A;  4WF5 A;  4K9Z A;  6GSX A;  3DVW A;  4MJA A;  3FZ4 A;  4Z2R A;  3NIV A;  2I3Y A;  1H4O A;  3CSJ A;  2DMM A;  5G31 A;  1VF1 A;  3KEB A;  4HS1 A;  3ERF A;  3HY2 A;  2R37 A;  1CQG A;  3GH6 A;  3WYW A;  4O92 A;  5H5R A;  2P31 A;  1QMV A;  1NHO A;  4IP6 A;  2LS5 A;  1K3L A;  3IE3 A;  3H93 A;  1EZK A;  4EC0 A;  2H76 A;  4HZ4 A;  2Z9S A;  3O76 A;  3QFB C;  1HNA A;  3TUE A;  3HDC A;  2A4V A;  1V98 A;  1AIU A;  1GSD A;  1TDI A;  1XWC A;  3D4T A;  1S3D A;  2G0F A;  5D9W A;  3FR3 A;  1UN2 A;  3F6D A;  3IR4 A;  2VD1 A;  4BVY B;  5J3R A;  4CHS A;  4Z2T A;  5DQS A;  1R4W A;  2BMX A;  3EMX A;  4Q5N A;  1GUM A;  4X0X A;  2WUL A;  5DCH A;  2F8A A;  1TRU A;  2M72 A;  3ISO A;  1VF4 A;  1ZYN A;  5ECH B;  1G7O A;  2H30 A;  1GSS A;  3ZMK A;  3HYP A;  1PSQ A;  2E2M A;  3QAG A;  1A2L A;  1AUC A;  3FY7 A;  2GT5 A;  4CY8 A;  1TI1 A;  3HKR A;  4PUR A;  2VM1 A;  3GX0 A;  3QR6 A;  1YEP A;  3F8U A;  1OC3 A;  2B5E A;  3P90 A;  3CMI A;  3CQF A;  2DJK A;  1OE8 A;  4I5Q A;  4KUN A;  4BWQ A;  1R26 A;  3DML A;  2C0E A;  3F4T A;  1EV9 A;  3GX8 A;  4F0B A;  1ZYE A;  1XFL A;  1SKR B;  1AQW A;  5G1L A;  4ECC A;  2IMD A;  3DD3 A;  4N0V A;  1SD9 A;  1GRX A;  1SJI A;  4KGI A;  1XBS A;  5AN1 A;  2DKI A;  3KH7 A;  3ZVJ A;  2KUC A;  3ERW A;  1NHY A;  4XHM A;  2PBJ A;  4PQI A;  1PX6 A;  2HSY A;  3EYT A;  3MNG A;  4E8H A;  4ML1 A;  4HQS A;  4TXO B;  1GTU A;  4PQH A;  3SBC A;  4HSC X;  14GS A;  2V6K A;  1V2A A;  4HJ2 A;  1B9X C;  4MZC A;  3ZML A;  4D73 A;  1FB6 A;  2AJQ B;  4G0K A;  1BX9 A;  4MAB A;  3KP9 A;  3UJ1 A;  2LJR A;  4Q5Q A;  2YPM A;  2YNX A;  1XW5 A;  5GAN D;  3DKS A;  2E2G A;  1X5C A;  4ZIL A;  3KD0 A;  3RBT A;  5J9B A;  2ON5 A;  2X8C A;  4ZBA A;  2FCH A;  2MBT A;  5KN3 A;  1T00 A;  4MF6 A;  2GQK A;  1B9Y C;  3O3T A;  2N5A A;  1GP1 A;  5HFI A;  1TRS A;  5F05 A;  2XC2 A;  4BVX B;  5IMA A;  2QA1 A;  5JWR B;  1PL2 A;  5H5S A;  1GTA A;  2C3N A;  3APS A;  2HT9 A;  1NW2 A;  4YAV A;  4IQ1 A;  2VOC A;  1FG4 A;  4CW9 A;  4K6X A;  2K8S A;  3IRA A;  4LL4 B;  5DBQ A;  3TKS A;  5GST A;  3E0U A;  1EEM A;  3D6I A;  4G0I A;  2B1K A;  1BJX A;  1THO A;  2ZNM A;  3P8W A;  5CP1 A;  1XWG A;  2GGT A;  1IYH A;  1GL8 A;  6GSY A;  2WS2 A;  1SU9 A;  1HD2 A;  2J9H A;  4HDE A;  1VF2 A;  3RPP A;  4XTS A;  2MMA A;  2AHE A;  4FH8 A;  2B7J A;  2YJ7 A;  4F03 A;  3QAW A;  1V58 A;  5FT3 A;  1GLQ A;  3D22 A;  4O7H A;  4MF7 A;  5HR1 A;  3GHA A;  3HJM A;  4GTU A;  4V1A p;  2H66 A;  4XRD A;  1OC8 A;  2CVB A;  3I43 A;  4LL1 B;  4NV2 A;  5A5K A;  1XVW A;  4QQ7 A;  2CV4 A;  2C80 A;  2JZR A;  2V1M A;  4KND A;  5IMZ A;  1GLP A;  2DJ2 A;  2AAW A;  4K2D A;  5KOX A;  1HNB A;  2YWN A;  3F9U A;  3IXR A;  4HI7 A;  1SJZ A;  4LA1 A;  4IEL A;  2F3M A;  4YH2 A;  4HOJ A;  13GS A;  2WJU A;  2YZH A;  5B7C A;  4K1F A;  4TR4 A;  2EC4 A;  3GL5 A;  2JSY A;  2H1D A;  2ZCT A;  1QUW A;  5D9T A;  2PVO C;  4OMV A;  4IW9 A;  4XS1 A;  5DCG A;  3HJP A;  3ZYW A;  1J0F A;  1U3A A;  2CZ2 A;  5G5E A;  4IN0 A;  4OFN A;  3D0Z A;  1YEX A;  3NZN A;  3QMX A; 
#chains in the Genus database with same CATH homology
 4BL7 A;  4TN8 A;  1BYE A;  4MMM A;  3C1R A;  1WIK A;  5HR3 A;  1EGR A;  5DVB A;  2RM5 A;  1O73 A;  4I2T A;  1S3A A;  5CYY A;  4LLR A;  1JLV A;  4KA0 A;  1GH2 A;  3CRU A;  1O8W A;  3DYR A;  2DJ1 A;  1A2M A;  3HD5 A;  4KDU A;  2OBI A;  3KCM A;  2OAD A;  2PMT A;  2HSM A;  2O7K A;  2HZE B;  5KOW A;  4GXZ A;  2OJL A;  2IME A;  1A0F A;  4RI6 A;  2VL3 A;  4QL7 A;  1SK1 A;  1YY7 A;  2VUP A;  4J2F A;  3H79 A;  1A8Y A;  2R0C A;  2I1U A;  5CRH A;  2KHP A;  5DAL B;  3ZLP A;  2MMZ A;  1K0O A;  2VCQ A;  4OFM A;  3ZIJ A;  4TXO A;  2YN1 A;  5LD0 A;  3L78 A;  2KOK A;  4EIP A;  4WXT A;  4ILF A;  2AUV A;  1GTB A;  3ZFB A;  4BPY A;  4EL1 A;  1M2D A;  1ACV A;  1M0U A;  4GCI A;  1OC9 B;  1SJ6 A;  3L9S A;  3CTF A;  4EVM A;  4X43 A;  1MTC A;  1BQ7 A;  1TP9 A;  4KDY A;  3L9V A;  9GSS A;  2M80 A;  4ZL8 A;  3U5R E;  1M2B A;  1WMJ A;  1C72 A;  4YAP A;  4MK3 A;  2VIM A;  3GUR A;  2C3T A;  1XW6 A;  3FK8 A;  1OYJ A;  2CT6 A;  1NM3 A;  2JZS A;  3DGQ A;  3GN3 A;  4FIW A;  3KZQ A;  2VLV A;  2AB6 A;  4V1A g;  4GWR A;  1Q98 A;  3VI7 A;  2VD0 A;  4AJ6 A;  3M0F A;  4ZIJ A;  3GIX A;  1V9W A;  3EUR A;  4BVX A;  2O8V B;  3IAS 2;  1OVN A;  4I2U A;  3RHC A;  1YKC A;  5AIX A;  2ON7 A;  2EIO A;  1B4P A;  2NDO A;  5IOW A;  3A5I A;  2FWH A;  3Q18 A;  2IIY A;  1J9B A;  3ME8 A;  3MYD A;  3APQ A;  1FOH A;  1XXU A;  8GSS A;  4XS6 A;  5H5Q A;  3KTL A;  3TRX A;  4KAE A;  2PVQ A;  2DIZ A;  4USS A;  1PRX A;  1Z6N A;  2FGX A;  3NOF A;  1FVJ A;  1E2Y A;  1WWJ A;  1QXH A;  3C8E A;  4IBP A;  1K3O A;  5CRG A;  4DSS A;  5IIZ A;  1K0A A;  1E6B A;  1ERW A;  3DIE A;  1Q4J A;  2C3Q A;  3FYG A;  1ZOF A;  4Q5F A;  6GSW A;  3DVX A;  5IMV A;  4ZL7 A;  2KLX A;  5G30 A;  1SL0 B;  1X5E A;  1Z3E A;  2LNT A;  4V2N A;  3TRQ A;  4Z2U A;  2RUE A;  4NV5 A;  2N5B A;  5AIV A;  2H70 A;  1XWA A;  1JFU A;  2P5R A;  4LMW A;  4ML6 A;  5E59 A;  3EC3 A;  3HCZ A;  1XWK A;  2QGV A;  2I81 A;  4L8E A;  2PPT A;  2GSS A;  3AY8 A;  5KN2 A;  1OKD A;  5B6N A;  3BCK A;  3R3E A;  2H71 A;  1DE2 A;  1BED A;  4MH2 A;  1V40 A;  4K7O A;  2HFD A;  2YAN A;  3M9K A;  4GRF A;  2MMN A;  5IPH A;  1XWB A;  2LJA A;  1YF0 A;  1ERU A;  1AW9 A;  4L0U A;  2K8V A;  19GS A;  2FD3 A;  2TRC P;  1FHE A;  2XPE A;  3W8S A;  2VO4 A;  3TKP A;  5IQY A;  3LWA A;  4EE0 A;  5F0G A;  2NTO A;  1R5P A;  1ZYQ B;  1ZL9 A;  2L5L A;  2CA8 A;  3R2Q A;  2L6C A;  4G9H A;  1MEK A;  5F8B A;  3HZ8 A;  5J9C A;  3GRX A;  1TRV A;  2X64 A;  4KB3 A;  2YOI A;  3LSZ A;  2F9S A;  2GQL A;  1U87 A;  3EPT A;  1FO5 A;  4POL A;  4NHW A;  4ZL9 A;  4IJI A;  4J57 E;  5COH A;  5G1K A;  1TU7 A;  3EU4 A;  3UVH A;  3EVI A;  3UOM A;  2GZY A;  2KP1 A;  1DBY A;  3GMF A;  1AQV A;  1HQO A;  1PD2 1;  1I9D A;  5D73 A;  3C71 A;  4OCF A;  4G19 A;  2FLS A;  3QCP A;  1EOH A;  2IMF A;  1ILO A;  1M7T A;  3PR8 A;  4KE3 A;  5DAK A;  2F51 A;  2LRT A;  2L4Q A;  1EV4 A;  2WCI A;  3MWH A;  4I97 A;  4ECJ A;  1W4V A;  3ZFL A;  5ID2 A;  1YJ6 A;  3TKS E;  5E4W A;  5ELG A;  3TKQ A;  2UZ8 A;  1HYU A;  3VWW A;  3VI5 A;  3UBK A;  1A0R P;  2IMI A;  2LTK A;  3IAM 2;  1KBN A;  3HVS A;  2GSQ A;  1GSQ A;  5CO3 A;  4FYB A;  2REM A;  5D8I A;  4AJ8 A;  3C7M A;  3K8N A;  1O85 A;  5D96 A;  2P0G A;  4JR4 A;  4ID0 A;  2BJX A;  3FR6 A;  3W8J A;  1MDJ A;  4XCS A;  2WGR A;  3TJK A;  1RQM A;  3US3 A;  3E9J B;  2LST A;  2YJH A;  4PQ1 A;  5HFG A;  1XZO A;  2VAF A;  3N9J A;  2HRA A;  1Z7R A;  1JLW A;  1QQ2 A;  5ECK B;  1ZZY A;  1A2J A;  1GNW A;  2VCV A;  5GZZ B;  5CAX A;  4K7N A;  3LG6 A;  2IWT A;  3J7Y k;  1N2A A;  2CAI A;  1YF1 A;  3A2W A;  3A2V A;  5ECS A;  1R7H A;  1GUH A;  2H74 A;  3FKF A;  3Q74 A;  2LV3 A;  4DSQ A;  4PGT A;  2OAC A;  3TJJ A;  5BMU A;  4AF2 A;  16GS A;  1K3Y A;  3PH9 A;  3P2A A;  4K5S A;  5ECM B;  3V1W A;  1SL1 B;  1PN0 A;  2L57 A;  4MZW A;  4X4J A;  3IK7 A;  5KN0 A;  5JCG A;  3WD6 A;  4DVC A;  3N5O A;  4F2I A;  3IBH A;  3RHB A;  2K18 A;  2QKE A;  4ULX A;  4EUY A;  5LCZ A;  3IC4 A;  5DJL A;  3LOR A;  4CDO A;  2H0G A;  5HR2 A;  2NBS A;  1KTE A;  5EPF A;  3KIJ A;  3KXO A;  3HHV A;  3HVX A;  2RUF A;  4HQZ A;  3WT2 A;  1W89 A;  1TU8 A;  1GSE A;  1JZR A;  1ERT A;  2GDR A;  2GT6 A;  5IPG A;  4WKW A;  4TR0 A;  2IPA A;  3FRC A;  5A4W A;  2L5O A;  2TIR A;  3BD2 A;  4XS4 B;  4JZQ A;  2OE0 A;  3IPZ A;  3TRP A;  2FHE A;  4K7I A;  4MPF A;  2YV7 A;  4KH7 A;  4XRA A;  1AQX A;  3EIN A;  2LUS A;  1WE0 A;  1SKS B;  3L0H A;  3HXS A;  3FZA A;  5J41 A;  3KGK A;  1QGV A;  1VRS D;  3CSH A;  1GWC A;  4IVF A;  5JWQ B;  3KH9 A;  3TJG A;  1LJR A;  4FYU A;  3TOT A;  2FWF A;  12GS A;  3DRN A;  5IMD A;  4BVY A;  1F3A A;  3GST A;  3VWV A;  3G7J A;  1T4Y A;  3IA1 A;  4RQX A;  4P3Y B;  3UMA A;  3TOU A;  4POM A;  3E3E A;  2V41 A;  2H6Z A;  6GSS A;  1M2A A;  3PIN A;  4ECB A;  4TR3 A;  1ZMA A;  4GF0 A;  4YQV A;  4H86 A;  1O8X A;  4NPB A;  3FR9 A;  3FHK A;  5CNW A;  1S3C A;  4TW5 A;  3FMW A;  3GV1 A;  4ZB9 A;  4IJ3 A;  1X9S B;  5ECO B;  4HJM A;  4TRX A;  3C73 A;  2FNO A;  3IHG A;  4HEA 2;  3VPQ A;  11GS A;  2IN3 A;  3GYK A;  1X0R A;  2R4V A;  2MZC A;  1YKA A;  2M46 A;  2DLX A;  3UBL A;  1FAA A;  1AXD A;  4GSS A;  4WR5 A;  4GST A;  2X8H A;  2IJY A;  4L5O A;  1X9M B;  3TKR A;  4ECI A;  2IL3 A;  2MBS A;  3GA4 A;  2JZT A;  2LNS A;  1KEB A;  3LJR A;  1M9A A;  3LQ7 A;  2FY6 A;  3GH9 A;  5C04 A;  4G10 A;  4MPG A;  1U88 A;  4FQU A;  2I9H A;  3ZRE A;  1LU4 A;  3G9B A;  5D9X A;  2WFC A;  4JR6 A;  4ZBD A;  2OE3 A;  4HU9 A;  3ZVJ D;  2A2S A;  4TOP A;  4EXJ A;  5ECR B;  1O7U A;  2J23 A;  2ES7 A;  3ERG A;  2A2P A;  2OKA A;  2HRN A;  5INY A;  3UL3 A;  1K0C A;  3BOA A;  2OA7 A;  1M99 A;  4EKZ A;  5B8B A;  3F3R A;  1K0N A;  2VLU A;  4OWY A;  2CX3 A;  4PUA A;  1A24 A;  5GSS A;  4FO5 A;  1XPV A;  2H8L A;  1PMT A;  1EP8 A;  4V2M A;  5KN1 A;  4K5R A;  2YWO A;  3TJF A;  4O5R A;  3A2X A;  4WET A;  1K0B A;  5GAP D;  4NWY A;  1JZD A;  2VL9 A;  4AJ7 A;  4ZBB A;  4X1U A;  1YDK A;  5DJM A;  6GSV A;  3LEF A;  3IV4 A;  2DJ3 A;  4MF5 A;  1JZW A;  4MZB A;  2CVD A;  3DWV A;  3EU3 A;  2H75 A;  2RLI A;  1F6M C;  3DXB A;  5IO2 A;  3O6T A;  4HU7 A;  5EVO A;  2IFQ B;  2JSZ A;  5IOX A;  1TXX A;  2H6Y A;  2H73 A;  5ABR A;  5ELA A;  1UC7 A;  3VK9 A;  5D9V A;  3RAZ A;  4PNG A;  5F07 A;  18GS A;  1J08 A;  1TRW A;  5IM9 A;  1ZGN A;  4XS4 A;  1TJD A;  5F06 A;  4IGJ A;  1XOA A;  4AGS A;  3CTG A;  4OO5 A;  2XHF A;  3CSI A;  1PGT A;  4N30 A;  3P7X A;  2R0P A;  3F3Q A;  3LYK A;  2VCX A;  2GTU A;  2QA2 A;  1OAZ A;  4JRR A;  3LW9 A;  20GS A;  1CQH A;  5C00 A;  1G6W A;  1GTI A;  3CBU A;  3QFA C;  1TK8 B;  1X9W B;  4MJC A;  2OE1 A;  2PN8 A;  2DJJ A;  4ZB6 A;  1WJK A;  5ECL B;  2GZZ A;  4MNN A;  2V6O A;  4WF4 A;  2L59 A;  4L0W A;  2DML A;  4K0G A;  2H1B A;  3D4M A;  2YZU A;  3M1G A;  2HLS A;  5B8A A;  2CVK A;  2MMO A;  1B8X A;  4O5Q A;  2R3X A;  4QL9 A;  1TOF A;  3HVV A;  3APO A;  1B48 A;  4MH3 A;  2H1A A;  1QK8 A;  2N5F A;  2HNL A;  1HNC A;  5A4V A;  1TK5 B;  1LBK A;  5B6M A;  4MCU A;  1AAZ A;  1PL1 A;  5DDL A;  2H72 A;  4V2L A;  2NVL A;  1THX A;  3PPU A;  2P5Q A;  3BJ5 A;  4ACS A;  5J5N A;  4KCE A;  1A8L A;  1URM A;  3CYN A;  3GNJ A;  1EEJ A;  5BRT A;  1Z9H A;  3Q6O A;  4TR1 B;  1NSW A;  2EIR A;  2DSA A;  2LEG A;  1V57 A;  4MDC A;  1SKW B;  2JAD A;  1GUK A;  1M9B A;  6GSU A;  4XIH A;  3JCM L;  3KM6 A;  1YZX A;  4ZB8 A;  2VL2 C;  1PN9 A;  2E7P A;  3QD9 A;  3F6F A;  5G5F A;  4NAX A;  1A23 A;  3ZZX A;  3KJY A;  1ZCP A;  4EO3 A;  2HZE A;  3GKM A;  22GS A;  1IYI A;  3DEX A;  3TGZ A;  3A5W A;  1PX7 A;  2CQ9 A;  3IK9 A;  4EIQ A;  2GST A;  3FZ5 A;  4RI7 A;  4RUV A;  2C0D A;  3HZ4 A;  2XBI A;  4LMV A;  3IOS A;  1Z7P A;  5DAL A;  5DQY A;  3GKX A;  3VLN A;  2PGT A;  4YQM A;  1YQ1 A;  4K2X A;  1SEN A;  2D2Z A;  1R5A A;  2LRC A;  3QAV A;  2B3S A;  4TVE A;  5ECN B;  3MDK A;  4BL7 B;  2X99 A;  4GQC A;  2GS3 A;  1K0D A;  3D21 A;  4F9Z A;  4N10 A;  2HXK A;  1OC9 A;  3FW2 A;  3GKK A;  1TTZ A;  1T3B A;  3UVT A;  5LNK e;  2K9F A;  3F4R A;  1QFN A;  2X4A A;  2B1L A;  4EDZ A;  2CAQ A;  4O5U A;  3EMP A;  2AV4 A;  1XCC A;  5JWO B;  1TW9 A;  1SK0 A;  1SK2 A;  4L5L A;  6GST A;  4IKH A;  3TB2 A;  4N0Z A;  3VFI A;  5ECP B;  3GKN A;  1WRY A;  3IDV A;  4WR4 A;  1MD3 A;  2H01 A;  1ZYP A;  4KF9 A;  4BA7 A;  3IHQ A;  1OE7 A;  2ZUP A;  3EWL A;  3TDG A;  1T1V A;  2GSR A;  2L4C A;  3A3T A;  2C0F A;  2DJ0 A;  2I4A A;  3GFK A;  1T8E B;  2IFQ A;  3KMO A;  1JHB A;  3F63 A;  4MJB A;  5IO0 A;  5JCU A;  2G2Q A;  2JL4 A;  4TKY A;  3F0I A;  2GZP A;  4TXV A;  3ZRD A;  1PKW A;  2WB9 A;  1GSF A;  4A5P A;  1EWX A;  1VGL A;  2FWG A;  1MDI A;  1GNE A;  5IMC A;  3BBY A;  4NHZ A;  2V32 A;  3VPT A;  1Z6M A;  1G0T A;  3LFL A;  2O89 A;  4Z7X A;  3WT1 A;  4IHU A;  4F82 A;  4DSR A;  1BG5 A;  3D5J A;  1KNG A;  2LJK A;  1N8J A;  3RDW A;  2HE3 A;  2HRK A;  3GTU B;  2DKH A;  2FA4 A;  2HZF A;  4K8M A;  4E8E A;  1DSB A;  1USB A;  1G6Y A;  4GQF A;  4KDX A;  4G0L A;  3CRT A;  3M8N A;  4OCE A;  3F4S A;  1ML6 A;  2VCZ A;  3QDN A;  3KTB A;  4O32 A;  1BAY A;  4MP4 A;  1MDK A;  3H1N A;  2L6D A;  4OFT A;  4DSS B;  3I6A A;  1F37 A;  3CXG A;  4JE1 A;  1DUG A;  1U6T A;  3TCO A;  1FVK A;  2VM2 A;  1Y25 A;  3WGE A;  3GSS A;  5EL8 A;  3BCI A;  4TR1 A;  3VWX A;  1K0M A;  3IC8 A;  2A2R A;  3GL3 A;  4FYC A;  2TRX A;  1XW9 A;  5CRE A;  1GSU A;  3FZ9 A;  1TKD B;  1Y6E A;  4NXI A;  4BWS A;  1PQN A;  2C4J A;  4IP1 A;  5A4U A;  3VUR A;  5HQP A;  4JED A;  4ICY A;  2JU5 A;  2OBK A;  4OD7 A;  4J56 E;  4IQA A;  4YKF A;  2H19 A;  3MAK A;  4GSN A;  1XVQ A;  3M3M A;  2NPB A;  1VF3 A;  2DC5 A;  2YWM A;  1SYR A;  1EGO A;  3I9V 2;  3UAR A;  2R6K A;  4HUA A;  2EIQ A;  3LYP A;  4MJE A;  1T4Z A;  4ISD A;  5CRW A;  4PTS A;  3WGX A;  4PXO A;  1DE1 A;  2QC7 A;  3TJB A;  3GUS A;  2KP2 A;  1GUL A;  1WOU A;  1O6J A;  1FB0 A;  2CZ3 A;  2YWI A;  2HSH A;  1Z5Y E;  1UA5 A;  1TK0 B;  3LGC A;  4N11 A;  5HFK A;  5HR0 A;  2XPD A;  1UVZ A;  1FW1 A;  4DEJ A;  3UEM A;  1ON4 A;  3HA9 A;  1RK4 A;  2DIY A;  4PX1 A;  3S9F A;  2R2J A;  3ZL5 A;  2X49 A;  1SYX A;  2BTO T;  1G7E A;  3TKS C;  1ABA A;  2QSI A;  3Q19 A;  3KP8 A;  3UIW A;  4NMU A;  4EDY A;  7GSS A;  2B7K A;  1X5D A;  3WGD A;  2A4H A;  2F8F A;  2X8G A;  3QOU A;  2IMK A;  2CX4 A;  2VCT A;  2WDU A;  1F3B A;  3QPM A;  5FHI A;  5AGY A;  3PGT A;  4KW6 A;  1EOG A;  2YP6 A;  4PUF C;  2WZ9 A;  2R5G A;  3M9J A;  1MD4 A;  2PWJ A;  3I69 A;  1SL2 B;  3G7Y A;  5DAK B;  4I8B A;  3ED3 A;  2LRN A;  4G2E A;  5J4U A;  3VWU A;  4F0C A;  2K6V A;  5ID2 B;  3KMN A;  4GLT A;  1T7P B;  1GSY A;  4Q5R A;  4MA9 A;  4PNF A;  1ERV A;  3EE2 A;  1SD8 A;  2C8U A;  4ZXG A;  2LKU A;  1AC1 A;  1O81 A;  1OKT A;  2YCD A;  3HJO A;  4YQU A;  1XIY A;  1FOV A;  2MYG A;  4WEY A;  2B6M A;  4RQR A;  2GLR A;  2AYT A;  2FWE A;  2H1G A;  2VLT A;  2WRT A;  4CY6 A;  2O85 A;  4POB A;  2C0G A;  10GS A;  3ME7 A;  1PA3 A;  2HYX A;  2VL2 A;  5AIS A;  3W6G A;  4OO4 A;  5G2Z A;  4KCA A;  2YV9 A;  5JCW A;  3G7I A;  2JAC A;  2B5X A;  3ZTL A;  2B5Y A;  3GTU A;  5FWG A;  1PKZ A;  2VCW A;  1H75 A;  2XBQ A;  2FA8 A;  4D73 B;  1RW1 A;  4WBJ A;  3ZIV A;  4POK A;  1JZO A;  5EY6 A;  4WBR D;  3RPN A;  2PU9 C;  1F9M A;  3C1S A;  5KEJ A;  3SWL A;  1I5G A;  5D93 A;  1B4Q A;  3J7Y b;  5ENU A;  2LQO A;  4JBB A;  3LXZ A;  5L71 A;  1U3I A;  17GS A;  5ECQ B;  2H0H A;  2PER A;  2FUG 2;  5ECI B;  2DBC A;  2C1Y A;  2RM6 A;  3L4N A;  3ZIT A;  3MSZ A;  2V2G A;  1XOB A;  2O87 A;  1F2E A;  4YKG A;  1WP0 A;  2PUK C;  4KSO A;  4KSM A;  4IS0 A;  1WPI A;  2ALB A;  3OR5 A;  4JU5 A;  2HRF A;  2RII A;  3LXT A;  4KX4 A;  2H6X A;  2R0G A;  3FEU A;  4I6X A;  1EP7 A;  3MIX A;  4MLY A;  1TI3 A;  4EF0 A;  3UAP A;  2GQM A;  3H4K A;  4HZ2 A;  5IMF A;  3H8Q A;  2H0I A;  2E0Q A;  1ST9 A;  2GVP A;  2HI7 A;  2LQQ A;  4K0N A;  5CRD A;  3U6V A;  3L9U A;  4WF5 A;  4K9Z A;  6GSX A;  3DVW A;  4MJA A;  3FZ4 A;  4Z2R A;  3NIV A;  2I3Y A;  1H4O A;  3CSJ A;  2DMM A;  5G31 A;  1VF1 A;  3KEB A;  4HS1 A;  3ERF A;  3HY2 A;  2R37 A;  1CQG A;  3GH6 A;  3WYW A;  4O92 A;  5H5R A;  2P31 A;  1QMV A;  1NHO A;  4IP6 A;  2LS5 A;  1K3L A;  3IE3 A;  3H93 A;  1EZK A;  4EC0 A;  2H76 A;  4HZ4 A;  2Z9S A;  3O76 A;  3QFB C;  1HNA A;  3TUE A;  3HDC A;  2A4V A;  1V98 A;  1AIU A;  1GSD A;  1TDI A;  1XWC A;  3D4T A;  1S3D A;  2G0F A;  5D9W A;  3FR3 A;  1UN2 A;  3F6D A;  3IR4 A;  2VD1 A;  4BVY B;  5J3R A;  4CHS A;  4Z2T A;  5DQS A;  1R4W A;  2BMX A;  3EMX A;  4Q5N A;  1GUM A;  4X0X A;  2WUL A;  5DCH A;  2F8A A;  1TRU A;  2M72 A;  3ISO A;  1VF4 A;  1ZYN A;  5ECH B;  1G7O A;  2H30 A;  1GSS A;  3ZMK A;  3HYP A;  1PSQ A;  2E2M A;  3QAG A;  1A2L A;  1AUC A;  3FY7 A;  2GT5 A;  4CY8 A;  1TI1 A;  3HKR A;  4PUR A;  2VM1 A;  3GX0 A;  3QR6 A;  1YEP A;  3F8U A;  1OC3 A;  2B5E A;  3P90 A;  3CMI A;  2DJK A;  1OE8 A;  4I5Q A;  4KUN A;  4BWQ A;  1R26 A;  3DML A;  2C0E A;  3F4T A;  1EV9 A;  3GX8 A;  4F0B A;  1ZYE A;  1XFL A;  1SKR B;  1AQW A;  5G1L A;  4ECC A;  2IMD A;  3DD3 A;  4N0V A;  1SD9 A;  1GRX A;  1SJI A;  4KGI A;  1XBS A;  5AN1 A;  2DKI A;  3KH7 A;  3ZVJ A;  2KUC A;  3ERW A;  1NHY A;  4XHM A;  2PBJ A;  4PQI A;  1PX6 A;  2HSY A;  3EYT A;  3MNG A;  4E8H A;  4ML1 A;  4HQS A;  4TXO B;  1GTU A;  4PQH A;  3SBC A;  14GS A;  2V6K A;  1V2A A;  4HJ2 A;  1B9X C;  4MZC A;  3ZML A;  4D73 A;  1FB6 A;  2AJQ B;  4G0K A;  1BX9 A;  4MAB A;  3KP9 A;  3UJ1 A;  2LJR A;  4Q5Q A;  2YPM A;  2YNX A;  1XW5 A;  5GAN D;  3DKS A;  2E2G A;  1X5C A;  4ZIL A;  3KD0 A;  3RBT A;  5J9B A;  2ON5 A;  2X8C A;  4ZBA A;  2FCH A;  2MBT A;  5KN3 A;  1T00 A;  4MF6 A;  2GQK A;  1B9Y C;  3O3T A;  2N5A A;  1GP1 A;  5HFI A;  1TRS A;  5F05 A;  2XC2 A;  4BVX B;  5IMA A;  2QA1 A;  5JWR B;  1PL2 A;  5H5S A;  1GTA A;  2C3N A;  3APS A;  2HT9 A;  1NW2 A;  4YAV A;  4IQ1 A;  2VOC A;  1FG4 A;  4CW9 A;  4K6X A;  2K8S A;  3IRA A;  4LL4 B;  5DBQ A;  3TKS A;  5GST A;  3E0U A;  1EEM A;  3D6I A;  4G0I A;  2B1K A;  1BJX A;  1THO A;  2ZNM A;  3P8W A;  5CP1 A;  1XWG A;  2GGT A;  1IYH A;  1GL8 A;  6GSY A;  2WS2 A;  1SU9 A;  1HD2 A;  2J9H A;  4HDE A;  1VF2 A;  3RPP A;  4XTS A;  2MMA A;  2AHE A;  4FH8 A;  2B7J A;  2YJ7 A;  4F03 A;  3QAW A;  1V58 A;  5FT3 A;  1GLQ A;  3D22 A;  4O7H A;  4MF7 A;  5HR1 A;  3GHA A;  3HJM A;  4GTU A;  4V1A p;  2H66 A;  4XRD A;  1OC8 A;  2CVB A;  3I43 A;  4LL1 B;  4NV2 A;  5A5K A;  1XVW A;  4QQ7 A;  2CV4 A;  2C80 A;  2JZR A;  2V1M A;  4KND A;  5IMZ A;  1GLP A;  2DJ2 A;  2AAW A;  4K2D A;  5KOX A;  1HNB A;  2YWN A;  3F9U A;  3IXR A;  4HI7 A;  1SJZ A;  4LA1 A;  4IEL A;  2F3M A;  4YH2 A;  4HOJ A;  13GS A;  2WJU A;  2YZH A;  5B7C A;  4K1F A;  4TR4 A;  2EC4 A;  3GL5 A;  2JSY A;  2H1D A;  2ZCT A;  1QUW A;  5D9T A;  2PVO C;  4OMV A;  4IW9 A;  4XS1 A;  5DCG A;  3HJP A;  3ZYW A;  1J0F A;  1U3A A;  2CZ2 A;  5G5E A;  4IN0 A;  4OFN A;  3D0Z A;  1YEX A;  3NZN A;  3QMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...