3HJSA

Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
256
Chain Sequence
b'ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 73
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hjsA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hjsA02
4WHPB 2BUMA 3LXVA 3PCCM 1DMHA 4ILTA 5TD3A 1YKPB 4ILVA 4WHRB 1S9AA 2BUMB 3PCEM 1YKKA 3I4YA 3PCBA 1YKOA 3HJSA 1TMXA 1YKKB 3HHXA 3HGIA 2XSRA 3MV4A 3HJ8A 3PCFA 3PCNA 1EOCA 3T63M 3PCAA 4WHPA 3T67A 2BUVA 2BURA 4WHSD 3PCGA 2BUVB 1EOBA 1YKMA 4WHQA 3LMXM 2BURB 4WHOA 2BUQA 3MFLM 1EOBB 1YKMB 3LKTM 4WHQB 2BV0A 3PCKM 4WHOB 2BUZA 2BUQB 3PCIA 2BUTB 2BV0B 3MI1A 3PCLA 2XSUA 3HHYA 3PCJA 3I51A 2BUZB 1EO2A 1DLMA 3PCHA 3LXVM 2BUYA 3TH1A 2XSVA 2PCDA 2BOYA 1EO2B 1YKLB 1DLQA 1EO9A 3I4VA 2BUYB 1DLTA 4WHRF 3O6JA 3PCCA 3PCBM 3PCDM 3PCMM 3HKPA 1EO9B 3MI5M 2BUWA 3PCEA 2BUTA 2AZQA 3MV4M 2BUWB 3PCNM 1EOAA 3PCFM 1YKNA 3PCAM 2BUXB 3T67M 4WHSA 3MV6M 1EOAB 2BUUA 1YKNB 1YKLA 3O6RA 3PCGM 3T63A 4WHPD 4WHSB 2BUUB 3O5UA 3O32A 3LMXA 3PCMA 3PCDA 4WHOD 3PCIM 3MI5A 3MI1M 3LKTA 3MFLA 3PCLM 2BUXA 3PCKA 3PCJM 3HJQA 1YKOB 3PCHM 2PCDM 3N9TA 3MV6A 1EOCB 1YKPA 4WHRA
chains in the Genus database with same CATH superfamily
3J7BA 3HZJA 4IBEA 4DV6M 1AUAA 2HAKA 1F4IA 1DMHA 2LTUA 4ILTA 4M0WA 2R18A 1C7YA 3QYBA 3KS8A 2KNVA 4X66M 1I4WA 4IBCA 1LV7A 2P5TA 2ZM6M 3PCBA 3HJSA 1VEGA 5EP4A 4JI6M 1W5SA 2EJSA 2ZAOA 3B7NA 3SHFA 1VDDA 4I4LA 1XXHE 1R2ZA 3I04M 1DGHB 2YR0A 3GLHB 1E32A 5DYIA 3AJIB 3MHVC 2Z4SA 1K3XA 4L16A 2BUVA 2APLA 3AOEA 4QNMA 3T67A 4IJEA 2DI0A 5ITTA 4WHSD 1PJTA 4Z6YA 3MI1M 4GEWA 4LJ9A 2EA0A 3W68A 1J5EM 1YKMA 4LJ5A 1C1KA 4IBDA 4BLCA 4WHOA 2F5OA 1IN7A 1IN5A 1L1TA 4OU7A 2JA2A 3L28A 4IJFA 1EOBB 4JYAM 2CRUA 4WURA 4FVMA 2F5NA 4LJ7A 2DNAA 1AIPC 1N75A 5KO3A 3U61A 2C96A 2BV0B 5IZ7D 1HJPA 2XSUA 2DAIA 2WZJA 4D80A 2Z7JA 2BUZB 1GJSA 4PDIA 5EXXA 1T43A 2DZLA 2XEPA 2CE7A 4QOSA 4JI1M 1OIZA 2Z4RA 3VKGA 1OAOC 4CIZA 4LFAM 1R2YA 1EO2B 2C9CA 3IHPA 3FTFA 2CP8A 4PDGA 1QAQA 4GHLA 2K6BA 2QHOB 4F2LA 3UMMA 2MROB 4MGKE 1NHGC 3B7ZA 4A3VB 5ITQA 2C5RA 3PCBM 2WSCF 3PCMM 5EXPA 1UFZA 2LH0A 2QENA 5JI2E 3HU1A 1PJIA 4ITQA 3PCDM 3MI5M 1HT1E 3U60A 4LFCM 3GRYA 2BUTA 1H6UA 1GO5A 2HL7A 4MB7A 2VF7A 2BUWB 1R5LA 3JR4A 3GLFB 2JY6B 1WHCA 1OKSA 4IBKA 4LZZA 3T67M 3GRRA 2C99A 4KO8A 4LRTA 4QOZC 4GC5A 3ZQJA 5BR8M 4WHSA 8CATA 3MV6M 1NJGA 3K92A 2DAEA 2L09A 5KPTA 3GLIA 3SAVA 3O6RA 4NL4H 3TWMA 3U6EA 2UUAM 2R65A 2YFQA 4XGIA 3R8FA 4WHPD 1SXJC 3IG5A 2QSFX 3SMSA 4AG6A 2H1RA 2R62A 2VF8A 2CHQA 4BBAA 2UU9M 1WJ7A 3FE3A 4NC6A 1IFYA 3O32A 2BWBA 3D8LA 1N33M 3VDUA 1TH3A 1Z5CA 1GVNA 4IBBA 2MH8A 3KW6A 2QBYB 4NRWA 4GMQA 3OTOM 4AKHA 2YQZA 5FTKA 3T6PA 2BUXA 2CHVA 4G4OA 2LVQD 2R46A 4KT0F 3UK6A 2KRUA 2LXEA 1Q3BA 1MJGM 1QUTA 3FUUA 3FYCA 4JN6A 4Y28F 3TQSA 2VQEM 3J81S 2KRKA 3I01M 1XB2B 3IECA 3KOXE 1SXJB 1OFIA 5DYGA 3HU3A 3L2AA 1DGBA 3KXEC 4X64M 3VLFB 2FS1A 2HHHM 2K9DA 4LZJA 3SFZA 1Z59A 2FH0A 2DENA 4LRSA 1G4AE 2YNMD 2BUMA 1E9RA 2UXDM 1IM2A 3WHKA 4L15A 3FTEA 2D7HA 2LVNC 1YKPB 4AW4A 1S9AA 1IN6A 4B3RM 4W5WA 4LY6A 3NBIA 5L8RF 4DV5M 3PXGA 2XH9A 3SYKA 2JY5A 5E6JA 1IBKM 2BJVA 4GHAA 1YKOA 2DAMA 4JI0M 2XZUA 2QQ8A 3GLHE 1XMOM 1YKKB 2L4FA 3VDPA 2G3QA 1QDRA 1UM8A 3HJ8A 4Q7JA 5E26A 4KHPM 1TDZA 3MV4A 4MGHA 3DA1A 3W67A 3PCFA 3FKEA 5FTMA 1EOCA 2UUBM 3FUWA 4RF0A 1NNUC 4WW0A 4WHPA 2JNHA 4DUZM 2KZUA 1OTRA 1QANA 5ITYA 4DV4M 5EXTA 3RGSA 4DR2M 2KNAA 4B3MM 3HHZA 4ANRA 4WHQA 1VEJA 3B74A 1ZAEA 2BURB 3H4JA 1IY1A 5ITXE 4QHTA 3GLGA 2UXCM 2MGWA 3RE8A 3U6SA 1LTMA 3KS4A 3U6PA 4GKKM 3V76A 1D0KA 3LCUA 4B7FA 4D81A 1V33A 4I81A 2BUQB 4YY3M 2BUTB 2L7IA 1GLNA 1TDHA 4XBOA 4FD2A 2OOAA 2GNOA 1QVRA 1DLMA 2CFOA 2LWXA 3TWKA 2JP7A 2JXNA 3IG8A 1FJGM 1K3WA 3TH1A 4MGZE 4GITA 4LGMA 2F5PA 2BOYA 1MU5A 2JUJA 4D82A 1EIJA 1IY0A 1VQ1A 4R71A 2L6OA 3HX3A 3I4VA 4JXJA 1DLTA 4NXNM 2BUYB 5JI3E 4PT5A 1XWIA 3MMPA 1JB0F 3HKPA 4LCBA 1EO9B 3DFZA 2EO2A 2ZTDA 3PCEA 1EE8A 1GL7A 3CGWA 3PVSA 1TH4A 1FNNA 2CUZA 3U6MA 2KW0A 3MV4M 3KOYE 5EXSA 1N32M 2DZNB 2KNZA 3PCFM 1EOAA 2AHMA 4M9SA 3B7QA 1YKNA 2BUXB 4JV5M 4GC9A 1D2NA 2DKLA 4XK8F 2F5QA 5EQTA 1I94M 2MJ5B 4FCWA 4S12A 3L27A 1V34A 2R45A 1DGGA 3T63A 4G4QA 4DR5M 4DBGB 4QHSA 5EP1A 4L6V6 2ZANA 3FYDA 3KSXA 3LVWA 2EKFA 2CV1A 2BUUB 4DV1M 3Q8XA 1NHWC 2DAKA 5EP2A 3LCVB 2DWZB 3Q8GA 2KEBA 3LMXA 4CHTB 3T1HM 3PNYA 4MGIE 1DGFA 3SYLA 3D8BA 4G4RA 3FD9A 2DHRA 1HQYE 3KSJA 4AZFA 1G41A 2KXEA 3U6DA 1IN4A 1SXJE 2XFSA 3U5ZB 1IBLM 3PCKA 1YKOB 3ZC7B 4OVZA 1NVMA 3THGA 2M5ZA 2DWMA 2FFJA 2D7GA 1QYRA 4M9ZA 5IREB 1TF0B 2DHYA 2FE8A 1WGNA 2OPFA 2HKJA 4OW0A 1NNJA 4K0KM 3KP1E 4AQYM 2QP9X 1EOCB 3A45A 3SATA 4WHPB 1TGUA 3CF0A 2JZ0A 1L1ZA 3LXVA 3T15A 2CV2A 3UGJA 3B89A 5TD3A 7CATA 3C58A 2R4EA 2Z3XA 2C98A 1QZEA 2E5LM 3NBXX 2HWJA 2RRUA 4LF9M 4WHRB 2V6ZM 5DFLA 2Q2EB 3PCEM 1L2BA 1E94E 2K0BX 3I4YA 2LVOC 1KSFX 3AOEC 4REZA 3GLGB 1ZV1A 3FUTA 5C1BA 1TMXA 1DGHA 1JQJC 1GJTA 1NJFA 3GLHA 4LJ8A 1R4GA 2K47A 3GPPA 1ZMUA 3FTCA 1QZMA 3ZH9B 4DR3M 2R44A 3U6LA 5EP3A 4X62M 3GP1A 2C9OA 3AL0C 3PCNA 3T63M 1TH2A 2RGHA 3PCAA 1Q02A 1DO0A 4GH9A 5FLXS 1TTEA 2MR9A 5EJCA 1IN8A 2Y0QA 4IBFA 3PCGA 1QUSA 3EIEA 2BUVB 1YLAA 4PD2A 3DZDA 1EOBA 3LMXM 3LQQA 1XHBA 3TL4X 1TR8A 2V1CA 5ITXA 1A5TA 3VKHA 1NSFA 1YKMB 1MN3A 5FTNA 2XGNA 2BV0A 2OO9A 3PCKM 4WHOB 3HY5A 4AKGA 1KYIA 2BUZA 2WSEF 2ERCA 2F4VM 3K9PA 3VK7A 3TE6A 3MI1A 1JR3E 1XXHA 2QPAA 3RGPA 3K8ZA 3KVWA 3PCJA 2Z8YM 1SXJD 3I51A 4HL4A 3M7GA 4DV2M 3U61B 1N36M 4F1IA 1L2DA 2JY7A 1EO2A 4RKUF 3ZCBB 3SARA 3LXVM 3BXWA 1YUBA 2PCDA 3E4RA 2LHCA 3AOGA 3E21A 3KOWE 4JI2M 2R4JA 2ZAMA 4LJ4A 1IXSA 3AV0A 1QAMA 4KLNA 1WIVA 4G4NA 3U6CA 3T38A 3SAWA 3PCCA 1XNQM 4I8OA 4WHRF 2BJWA 4AG5A 2VQFM 3U6OA 2J5YA 2BUWA 4RF1A 2UXBM 3FTDA 4R3DA 3E9SA 2EKKA 3R9XB 3UZUA 5H37D 3AFHA 3E46A 4B7HA 4R7GA 4B3TM 4QNRA 2Y0TA 3QYEA 3TPZA 3U60B 1YE9A 3PCNM 2A5YB 1Z5AA 2L2DA 2RKOA 1N78A 3PCAM 3AKZA 2FOIC 1K82A 4NSRA 2I7PA 4JI4M 1G8PA 2I7NA 3GQ3A 3L29A 1PJQA 1WGLA 3SHGB 4DR6M 5FTLA 2R6FA 3L26A 3T1YM 1DV0A 1HNWM 1YKLA 1VDLA 4LF7M 3PCGM 3VK8A 4B08A 4MM3B 4WHSB 2W82A 2XF3A 4M0DA 2OQ4A 1OJLA 3GLIB 3GQ5A 2QBYA 2XLJA 1PM5A 2F5SA 4L78A 2LVPC 4II7A 3LVVA 3FUVA 3HU2A 4TUWA 4Z8XA 3PCMA 4LF6M 4LF5M 2G5GX 3PCDA 3MI5A 4B7GA 3GLFE 1J7KA 4HLQA 4IIWA 2QZ4A 3JAMS 3SASA 3LKTA 3MFLA 3GRUA 2BWEA 4RNAA 1SXJA 4NRVA 4JI5M 3HJQA 3PCJM 2XSZD 1S3SA 1OIPA 3SC3A 1VEKA 3K9OA 1OFHA 5FTJA 3SMPA 4DR7M 1GABA 4FCVA 4FCTA 1JR3D 4LF4M 2JWSA 3C3EA 2PCDM 1V92A 3C3DA 5LMUM 3N9TA 3SAUA 3MV6A 1XMQM 3MJ5A 4GKJM 1YKPA 1MX0A 4FW9A 3UJNA 2CWBA 2KDLA 4I5SA 4YHHM 3J7AS 1J09A 3M6AA 3PCCM 3J80S 3GLGE 4LJAA 4ILVA 1HNXM 4L4UA 4LGYA 2BUMB 1YKKA 2XFTA 4CGYB 4FWDA 1G71A 4HEOA 2O5RA 2QNJA 2DWNA 1QQWA 2LNHC 4AKIA 2DXIA 4BB9A 5DNYA 5C18A 2GQFA 4FWGA 3HHXA 3TWLA 3HGIA 1L2CA 2XSRA 1HNZM 1GL6A 2VDBB 2X4AA 1XC8A 4CJ6A 1Q3CA 1N77A 1XXHB 4DV7M 2O25A 2V1UA 4LFBM 1NY6A 3VFDA 1N34M 1PGYA 4IBGA 3GRVA 2BNKA 5FSWA 3KFUG 2BURA 1HQCA 4X65M 3CF2A 3K1JA 2VIIA 5KPRA 3BBZA 3CF6E 2O01F 2XZFA 4G6ZA 1G59A 2ZTCA 4NOOB 1OAIA 3KOZE 4IBJA 4LF8M 2LBCA 1ZQ9A 1L8QA 2LVAA 1NY5A 3W0LB 2BUQA 1IXSB 3LKTM 3HWSA 5BPVA 2J7OA 3MFLM 4WHQB 1CUKA 2XSZA 4FWHA 2DAGA 4P17A 3K2LA 4GRIA 4NSOB 3GPUA 3U6QA 3L25A 4DV0M 3PCIA 1BVSA 3PCLA 1JR3A 1IXRC 2D7EA 3CTWB 3HHYA 3A46A 1PJSA 5KQ8A 4DR1M 1HR0M 4B3SM 4AI6A 3A42A 3F92A 3PNVA 4L8RC 2H5XA 1XNRM 5KQDA 3GO8A 3PCHA 5LMNM 3FUXA 1IXZA 1ORYB 5KPZA 1Q39A 4P16A 2BUYA 1YSYA 2KHHA 4PCZA 2XSVA 4JI7M 2B3TA 5ITRA 4DV3M 1EFUB 1E9SA 3EIHA 2NQ8C 1YKLB 1ZMVA 1T6OA 4G3OA 1DLQA 1EO9A 2Y21A 3H4MA 3GQ4A 1QDTA 3NWLA 2CV0A 1R7RA 3O6JA 2WSFF 1IQPA 4MH0E 1Z5BA 5A2QS 2AZQA 2FNAA 1G3IA 1Z6TA 2N35A 3QWLA 4IBIA 2L4EA 1SG9A 1VG5A 2DVWB 1QAOA 2X8AA 3DOAA 1PJJA 5GKNA 4CISA 2KZSA 4JI8M 3QAUA 3RFWA 2CHGA 2KA6B 2UUCM 2Y20A 4JI3M 4MGYE 2R0IA 1D0MA 3KDSE 1EOAB 2BUUA 1P3QQ 1YKNB 3GLIE 4EIWA 4M9XA 3W0FA 3M0EA 3ILKA 5F3WA 1D0LA 1NO1A 2EUCA 1IY2A 1HT2E 3J27B 4DUYM 2ZBKB 3J2PB 3GPXA 1RU3A 4OX9M 1X37A 4UN2B 3PFIA 3O5UA 1T3TA 1DO2A 5ITUA 5IWAM 3KP0E 1ZMWA 5IT9S 3U5ZA 2DZOB 2HCBA 3WHLA 4WHOD 1NV9A 4LG2A 3GPYA 2L7HA 2DWLA 3B9PA 3BOSA 3GLFA 3PCIM 3PCLM 3A98B 3FRIA 2CEAA 3FRHA 1NV8A 2X49A 1R6BX 2JY8A 1OQYA 3LMMA 3LW5F 3SBJA 2LHGA 2OOBA 4LJ6A 4WP2A 2RGOA 3MK6A 4ZPXA 3JR5A 1IBMM 3PCHM 3LQRA 1PRBA 2M60A 4KODA 1WR1B 3C9PA 2J7NA 2G8LA 4OVZB 1KFVA 2QCUA 1GKIA 4DR4M 4GIPA 2JZ1A 1Y8GA 3HHWA 4NXMM 4WHRA 1WXQA 1W5TA
chains in the Genus database with same CATH topology
3J7BA 4IBEA 4DV6M 1DMHA 4ILTA 4M0WA 2R18A 3KS8A 4X66M 1I4WA 4IBCA 1LV7A 2P5TA 2ZM6M 3PCBA 3HJSA 5EP4A 4JI6M 1W5SA 2ZAOA 3SHFA 1VDDA 4I4LA 1R2ZA 1DGHB 2YR0A 3GLHB 1E32A 5DYIA 3AJIB 3MHVC 2Z4SA 1K3XA 4L16A 2BUVA 3AOEA 4QNMA 3T67A 4IJEA 5ITTA 4WHSD 4Z6YA 4LJ9A 2EA0A 1J5EM 1YKMA 4LJ5A 1C1KA 4IBDA 4BLCA 4WHOA 2F5OA 1IN7A 1IN5A 1L1TA 4OU7A 2JA2A 3L28A 4IJFA 1EOBB 4JYAM 4WURA 4FVMA 2F5NA 4LJ7A 1N75A 5KO3A 3U61A 2C96A 2BV0B 5IZ7D 2XSUA 4D80A 2Z7JA 2BUZB 4PDIA 5EXXA 2XEPA 2CE7A 4QOSA 4JI1M 2Z4RA 3VKGA 1R2YA 4LFAM 1EO2B 2C9CA 3FTFA 4PDGA 1QAQA 4GHLA 3UMMA 4MGKE 1NHGC 4A3VB 5ITQA 2C5RA 3PCBM 3PCMM 5EXPA 2LH0A 2QENA 5JI2E 1PJIA 3HU1A 4ITQA 3PCDM 3MI5M 1HT1E 3U60A 4LFCM 3GRYA 2BUTA 1H6UA 2HL7A 4MB7A 2BUWB 3JR4A 3GLFB 4IBKA 4LZZA 3T67M 3GRRA 2C99A 4KO8A 4LRTA 4QOZC 4GC5A 5BR8M 4WHSA 8CATA 3MV6M 1NJGA 3K92A 2L09A 5KPTA 3GLIA 3SAVA 3O6RA 4NL4H 3TWMA 3U6EA 2UUAM 2R65A 2YFQA 4XGIA 3R8FA 4WHPD 1SXJC 3IG5A 3SMSA 4AG6A 2H1RA 2R62A 4BBAA 2CHQA 2UU9M 3O32A 3D8LA 1N33M 3VDUA 1TH3A 1Z5CA 1GVNA 4IBBA 3KW6A 2QBYB 4NRWA 4GMQA 3OTOM 4AKHA 2YQZA 5FTKA 2BUXA 2CHVA 4G4OA 2R46A 4AQYM 3UK6A 2KRUA 2LXEA 1Q3BA 3FYCA 4JN6A 3FUUA 3TQSA 2VQEM 3J81S 2KRKA 3KOXE 1SXJB 1OFIA 5DYGA 3HU3A 3L2AA 1DGBA 3KXEC 4X64M 3VLFB 2HHHM 4LZJA 3SFZA 1Z59A 4LRSA 1G4AE 2YNMD 2BUMA 1E9RA 2UXDM 1IM2A 3WHKA 4L15A 3FTEA 2D7HA 1YKPB 4AW4A 1S9AA 1IN6A 4B3RM 4W5WA 4LY6A 3NBIA 4DV5M 3PXGA 2XH9A 3SYKA 5E6JA 1IBKM 1YKOA 2BJVA 4JI0M 2XZUA 1XMOM 1YKKB 3VDPA 1UM8A 3MV4A 3HJ8A 5E26A 4KHPM 1TDZA 4MGHA 3DA1A 3PCFA 3FKEA 5FTMA 1EOCA 2UUBM 3FUWA 4RF0A 1NNUC 4WW0A 4WHPA 4DUZM 2KZUA 1QANA 5ITYA 4DV4M 5EXTA 3RGSA 4DR2M 4B3MM 3HHZA 4WHQA 1ZAEA 2BURB 1IY1A 5ITXE 4QHTA 3GLGA 2UXCM 3RE8A 3U6SA 3KS4A 3U6PA 4GKKM 4B7FA 4D81A 4I81A 2BUQB 4YY3M 2BUTB 2L7IA 1GLNA 1TDHA 4XBOA 4FD2A 1QVRA 1DLMA 2CFOA 2LWXA 3TWKA 3IG8A 1FJGM 1K3WA 3TH1A 4MGZE 4GITA 4LGMA 2F5PA 2BOYA 1MU5A 4D82A 1IY0A 2L6OA 3I4VA 4JXJA 1DLTA 2BUYB 4NXNM 5JI3E 4PT5A 1XWIA 3HKPA 4LCBA 1EO9B 3DFZA 2EO2A 3PCEA 1EE8A 1GL7A 3PVSA 1TH4A 1FNNA 2CUZA 3U6MA 2KW0A 3MV4M 3KOYE 5EXSA 1N32M 2DZNB 3PCFM 1EOAA 2AHMA 4M9SA 1YKNA 2BUXB 4JV5M 4GC9A 1D2NA 2F5QA 5EQTA 1I94M 4FCWA 4S12A 3L27A 2R45A 3T63A 1DGGA 4G4QA 4DR5M 4QHSA 5EP1A 2ZANA 3FYDA 3KSXA 3LVWA 2CV1A 2BUUB 4DV1M 3Q8XA 1NHWC 5EP2A 2DWZB 2KEBA 3LMXA 4CHTB 3T1HM 3PNYA 4MGIE 1DGFA 3SYLA 3D8BA 4G4RA 3FD9A 2DHRA 1HQYE 3KSJA 4AZFA 1G41A 2KXEA 3U6DA 1IN4A 1SXJE 2XFSA 3U5ZB 1IBLM 3PCKA 1YKOB 3ZC7B 4OVZA 1NVMA 3THGA 2M5ZA 2DWMA 2FFJA 2D7GA 1QYRA 4M9ZA 5IREB 2FE8A 2OPFA 2HKJA 4OW0A 1NNJA 4K0KM 3KP1E 2QP9X 1EOCB 3A45A 3SATA 4WHPB 1TGUA 3CF0A 1L1ZA 3LXVA 3T15A 2CV2A 3UGJA 5TD3A 7CATA 3C58A 2R4EA 2Z3XA 2C98A 2E5LM 4LF9M 4GHAA 4WHRB 2V6ZM 2Q2EB 3PCEM 1L2BA 1E94E 3I4YA 1KSFX 3AOEC 4REZA 3GLGB 5C1BA 3FUTA 1TMXA 1DGHA 1JQJC 1NJFA 3GLHA 4LJ8A 2K47A 3GPPA 3FTCA 3ZH9B 1QZMA 4DR3M 3U6LA 5EP3A 4X62M 3GP1A 2C9OA 3AL0C 3PCNA 3T63M 1TH2A 2RGHA 3PCAA 1DO0A 4GH9A 5FLXS 5EJCA 1IN8A 2Y0QA 4IBFA 3PCGA 3EIEA 2BUVB 4PD2A 1EOBA 3DZDA 3LMXM 3LQQA 1XHBA 3TL4X 2V1CA 5ITXA 3VKHA 1NSFA 1YKMB 5FTNA 2BV0A 2XGNA 3PCKM 4WHOB 4AKGA 1KYIA 2BUZA 2ERCA 2F4VM 3VK7A 3TE6A 3MI1A 2QPAA 1XXHA 3RGPA 3K8ZA 3KVWA 3PCJA 1SXJD 3I51A 4HL4A 3M7GA 4DV2M 3U61B 1N36M 1L2DA 1EO2A 3ZCBB 3SARA 3LXVM 1YUBA 2PCDA 3E4RA 3AOGA 3KOWE 4JI2M 2R4JA 2ZAMA 4LJ4A 4G4NA 3AV0A 1QAMA 4KLNA 3U6CA 3SAWA 3T38A 4WHRF 3PCCA 1XNQM 4I8OA 2BJWA 4AG5A 2VQFM 3U6OA 2BUWA 4RF1A 2UXBM 3FTDA 4R3DA 3E9SA 3R9XB 3UZUA 5H37D 3AFHA 4B7HA 4R7GA 4B3TM 4QNRA 2Y0TA 3U60B 3TPZA 3PCNM 1YE9A 2A5YB 1Z5AA 2RKOA 1N78A 3PCAM 3AKZA 2FOIC 1K82A 4NSRA 2I7PA 4JI4M 1G8PA 2I7NA 3GQ3A 3L29A 3SHGB 4DR6M 5FTLA 3L26A 3T1YM 1YKLA 3PCGM 1HNWM 4LF7M 3VK8A 4B08A 4MM3B 4WHSB 2W82A 2XF3A 4M0DA 2OQ4A 1OJLA 3GLIB 3GQ5A 2QBYA 2XLJA 1PM5A 2F5SA 4L78A 4II7A 3LVVA 3FUVA 3HU2A 4TUWA 4Z8XA 3PCMA 4LF6M 4LF5M 2G5GX 3PCDA 3MI5A 4B7GA 1J7KA 4HLQA 4IIWA 2QZ4A 3JAMS 3SASA 3LKTA 3MFLA 3GRUA 4RNAA 3MI1M 1SXJA 4NRVA 4JI5M 3HJQA 3PCJM 2XSZD 1S3SA 3SC3A 1OFHA 5FTJA 3SMPA 4DR7M 4FCVA 4FCTA 1JR3D 4LF4M 2PCDM 3N9TA 5LMUM 3SAUA 3MV6A 1XMQM 3MJ5A 4GKJM 1YKPA 1MX0A 4FW9A 3UJNA 3J7AS 4I5SA 4YHHM 3PCCM 1J09A 3M6AA 3J80S 4LJAA 4ILVA 1HNXM 4L4UA 4LGYA 2BUMB 1YKKA 2XFTA 4CGYB 4FWDA 2O5RA 2DWNA 1QQWA 2LNHC 4AKIA 2DXIA 4BB9A 5DNYA 5C18A 4FWGA 3HHXA 3TWLA 3HGIA 1L2CA 2XSRA 1HNZM 1GL6A 2X4AA 1XC8A 1N77A 1Q3CA 4LFBM 1XXHB 4DV7M 2V1UA 1NY6A 3VFDA 1N34M 4IBGA 3GRVA 2BNKA 5FSWA 3KFUG 2BURA 1HQCA 4X65M 3CF2A 3K1JA 2VIIA 5KPRA 3CF6E 2XZFA 1G59A 4G6ZA 4NOOB 3KOZE 4IBJA 4LF8M 1ZQ9A 1L8QA 1NY5A 3W0LB 2BUQA 1IXSB 3LKTM 3HWSA 5BPVA 2J7OA 3MFLM 4WHQB 2XSZA 4FWHA 3K2LA 4GRIA 4NSOB 3GPUA 3U6QA 3L25A 4DV0M 3PCIA 3PCLA 1JR3A 1IXRC 2D7EA 3CTWB 3HHYA 3A46A 4DR1M 5KQ8A 1HR0M 4B3SM 4AI6A 3A42A 3PNVA 4L8RC 1XNRM 5KQDA 3GO8A 3PCHA 5LMNM 3FUXA 1IXZA 1ORYB 5KPZA 1Q39A 4P16A 2BUYA 1YSYA 4PCZA 2XSVA 4JI7M 5ITRA 4DV3M 3EIHA 1E9SA 2NQ8C 1YKLB 1DLQA 1EO9A 2Y21A 3H4MA 3GQ4A 3NWLA 2CV0A 1R7RA 3O6JA 1IQPA 4MH0E 1Z5BA 5A2QS 2AZQA 2FNAA 1G3IA 1Z6TA 3QWLA 4IBIA 2DVWB 1QAOA 2X8AA 3DOAA 1PJJA 5GKNA 4CISA 2KZSA 4JI8M 3QAUA 3RFWA 2CHGA 2KA6B 2UUCM 2Y20A 4JI3M 4MGYE 3KDSE 1EOAB 2BUUA 1YKNB 4EIWA 4M9XA 3W0FA 3M0EA 3ILKA 2EUCA 1IY2A 1HT2E 3J27B 4DUYM 2ZBKB 3J2PB 3GPXA 4OX9M 1X37A 3O5UA 3PFIA 1T3TA 1DO2A 5ITUA 5IWAM 3KP0E 5IT9S 3U5ZA 2DZOB 2HCBA 3WHLA 4WHOD 4LG2A 3GPYA 2L7HA 2DWLA 3B9PA 3BOSA 3GLFA 3PCIM 3PCLM 3A98B 2CEAA 3LMMA 3SBJA 2X49A 1R6BX 5F3WA 4LJ6A 2RGOA 3MK6A 4ZPXA 3JR5A 1IBMM 3PCHM 3LQRA 2M60A 4KODA 2J7NA 2G8LA 4OVZB 1KFVA 2QCUA 1GKIA 4DR4M 4GIPA 3HHWA 4NXMM 4WHRA 1WXQA 1W5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHP B;  2BUM A;  3LXV A;  3PCC M;  1DMH A;  4ILT A;  5TD3 A;  1YKP B;  4ILV A;  4WHR B;  1S9A A;  2BUM B;  3PCE M;  1YKK A;  3I4Y A;  3PCB A;  1YKO A;  3HJS A;  1TMX A;  1YKK B;  3HHX A;  3HGI A;  2XSR A;  3MV4 A;  3HJ8 A;  3PCF A;  3PCN A;  1EOC A;  3T63 M;  3PCA A;  4WHP A;  3T67 A;  2BUV A;  2BUR A;  4WHS D;  3PCG A;  2BUV B;  1EOB A;  1YKM A;  4WHQ A;  3LMX M;  2BUR B;  4WHO A;  2BUQ A;  3MFL M;  1EOB B;  1YKM B;  3LKT M;  4WHQ B;  2BV0 A;  3PCK M;  4WHO B;  2BUZ A;  2BUQ B;  3PCI A;  2BUT B;  2BV0 B;  3MI1 A;  3PCL A;  2XSU A;  3HHY A;  3PCJ A;  3I51 A;  2BUZ B;  1EO2 A;  1DLM A;  3PCH A;  3LXV M;  2BUY A;  3TH1 A;  2XSV A;  2PCD A;  2BOY A;  1EO2 B;  1YKL B;  1DLQ A;  1EO9 A;  3I4V A;  2BUY B;  1DLT A;  4WHR F;  3O6J A;  3PCC A;  3PCB M;  3PCD M;  3PCM M;  3HKP A;  1EO9 B;  3MI5 M;  2BUW A;  3PCE A;  2BUT A;  2AZQ A;  3MV4 M;  2BUW B;  3PCN M;  1EOA A;  3PCF M;  1YKN A;  3PCA M;  2BUX B;  3T67 M;  4WHS A;  3MV6 M;  1EOA B;  2BUU A;  1YKN B;  1YKL A;  3O6R A;  3PCG M;  3T63 A;  4WHP D;  4WHS B;  2BUU B;  3O5U A;  3O32 A;  3LMX A;  3PCM A;  3PCD A;  4WHO D;  3PCI M;  3MI5 A;  3MI1 M;  3LKT A;  3MFL A;  3PCL M;  2BUX A;  3PCK A;  3PCJ M;  3HJQ A;  1YKO B;  3PCH M;  2PCD M;  3N9T A;  3MV6 A;  1EOC B;  1YKP A;  4WHR A; 
#chains in the Genus database with same CATH topology
 3J7B A;  3HZJ A;  4IBE A;  4DV6 M;  1AUA A;  2HAK A;  1F4I A;  1DMH A;  2LTU A;  4ILT A;  4M0W A;  2R18 A;  1C7Y A;  3QYB A;  3KS8 A;  2KNV A;  4X66 M;  1I4W A;  4IBC A;  1LV7 A;  2P5T A;  2ZM6 M;  3PCB A;  3HJS A;  1VEG A;  5EP4 A;  4JI6 M;  1W5S A;  2EJS A;  2ZAO A;  3B7N A;  3SHF A;  1VDD A;  4I4L A;  1XXH E;  1R2Z A;  3I04 M;  1DGH B;  2YR0 A;  3GLH B;  1E32 A;  5DYI A;  3AJI B;  3MHV C;  2Z4S A;  1K3X A;  4L16 A;  2BUV A;  2APL A;  3AOE A;  4QNM A;  3T67 A;  4IJE A;  2DI0 A;  5ITT A;  4WHS D;  1PJT A;  4Z6Y A;  3MI1 M;  4GEW A;  4LJ9 A;  2EA0 A;  3W68 A;  1J5E M;  1YKM A;  4LJ5 A;  1C1K A;  4IBD A;  4BLC A;  4WHO A;  2F5O A;  1IN7 A;  1IN5 A;  1L1T A;  4OU7 A;  2JA2 A;  3L28 A;  4IJF A;  1EOB B;  4JYA M;  2CRU A;  4WUR A;  4FVM A;  2F5N A;  4LJ7 A;  2DNA A;  1AIP C;  1N75 A;  5KO3 A;  3U61 A;  2C96 A;  2BV0 B;  5IZ7 D;  1HJP A;  2XSU A;  2DAI A;  2WZJ A;  4D80 A;  2Z7J A;  2BUZ B;  1GJS A;  4PDI A;  5EXX A;  1T43 A;  2DZL A;  2XEP A;  2CE7 A;  4QOS A;  4JI1 M;  1OIZ A;  2Z4R A;  3VKG A;  1OAO C;  4CIZ A;  4LFA M;  1R2Y A;  1EO2 B;  2C9C A;  3IHP A;  3FTF A;  2CP8 A;  4PDG A;  1QAQ A;  4GHL A;  2K6B A;  2QHO B;  4F2L A;  3UMM A;  2MRO B;  4MGK E;  1NHG C;  3B7Z A;  4A3V B;  5ITQ A;  2C5R A;  3PCB M;  2WSC F;  3PCM M;  5EXP A;  1UFZ A;  2LH0 A;  2QEN A;  5JI2 E;  3HU1 A;  1PJI A;  4ITQ A;  3PCD M;  3MI5 M;  1HT1 E;  3U60 A;  4LFC M;  3GRY A;  2BUT A;  1H6U A;  1GO5 A;  2HL7 A;  4MB7 A;  2VF7 A;  2BUW B;  1R5L A;  3JR4 A;  3GLF B;  2JY6 B;  1WHC A;  1OKS A;  4IBK A;  4LZZ A;  3T67 M;  3GRR A;  2C99 A;  4KO8 A;  4LRT A;  4QOZ C;  4GC5 A;  3ZQJ A;  5BR8 M;  4WHS A;  8CAT A;  3MV6 M;  1NJG A;  3K92 A;  2DAE A;  2L09 A;  5KPT A;  3GLI A;  3SAV A;  3O6R A;  4NL4 H;  3TWM A;  3U6E A;  2UUA M;  2R65 A;  2YFQ A;  4XGI A;  3R8F A;  4WHP D;  1SXJ C;  3IG5 A;  2QSF X;  3SMS A;  4AG6 A;  2H1R A;  2R62 A;  2VF8 A;  2CHQ A;  4BBA A;  2UU9 M;  1WJ7 A;  3FE3 A;  4NC6 A;  1IFY A;  3O32 A;  2BWB A;  3D8L A;  1N33 M;  3VDU A;  1TH3 A;  1Z5C A;  1GVN A;  4IBB A;  2MH8 A;  3KW6 A;  2QBY B;  4NRW A;  4GMQ A;  3OTO M;  4AKH A;  2YQZ A;  5FTK A;  3T6P A;  2BUX A;  2CHV A;  4G4O A;  2LVQ D;  2R46 A;  4KT0 F;  3UK6 A;  2KRU A;  2LXE A;  1Q3B A;  1MJG M;  1QUT A;  3FUU A;  3FYC A;  4JN6 A;  4Y28 F;  3TQS A;  2VQE M;  3J81 S;  2KRK A;  3I01 M;  1XB2 B;  3IEC A;  3KOX E;  1SXJ B;  1OFI A;  5DYG A;  3HU3 A;  3L2A A;  1DGB A;  3KXE C;  4X64 M;  3VLF B;  2FS1 A;  2HHH M;  2K9D A;  4LZJ A;  3SFZ A;  1Z59 A;  2FH0 A;  2DEN A;  4LRS A;  1G4A E;  2YNM D;  2BUM A;  1E9R A;  2UXD M;  1IM2 A;  3WHK A;  4L15 A;  3FTE A;  2D7H A;  2LVN C;  1YKP B;  4AW4 A;  1S9A A;  1IN6 A;  4B3R M;  4W5W A;  4LY6 A;  3NBI A;  5L8R F;  4DV5 M;  3PXG A;  2XH9 A;  3SYK A;  2JY5 A;  5E6J A;  1IBK M;  2BJV A;  4GHA A;  1YKO A;  2DAM A;  4JI0 M;  2XZU A;  2QQ8 A;  3GLH E;  1XMO M;  1YKK B;  2L4F A;  3VDP A;  2G3Q A;  1QDR A;  1UM8 A;  3HJ8 A;  4Q7J A;  5E26 A;  4KHP M;  1TDZ A;  3MV4 A;  4MGH A;  3DA1 A;  3W67 A;  3PCF A;  3FKE A;  5FTM A;  1EOC A;  2UUB M;  3FUW A;  4RF0 A;  1NNU C;  4WW0 A;  4WHP A;  2JNH A;  4DUZ M;  2KZU A;  1OTR A;  1QAN A;  5ITY A;  4DV4 M;  5EXT A;  3RGS A;  4DR2 M;  2KNA A;  4B3M M;  3HHZ A;  4ANR A;  4WHQ A;  1VEJ A;  3B74 A;  1ZAE A;  2BUR B;  3H4J A;  1IY1 A;  5ITX E;  4QHT A;  3GLG A;  2UXC M;  2MGW A;  3RE8 A;  3U6S A;  1LTM A;  3KS4 A;  3U6P A;  4GKK M;  3V76 A;  1D0K A;  3LCU A;  4B7F A;  4D81 A;  1V33 A;  4I81 A;  2BUQ B;  4YY3 M;  2BUT B;  2L7I A;  1GLN A;  1TDH A;  4XBO A;  4FD2 A;  2OOA A;  2GNO A;  1QVR A;  1DLM A;  2CFO A;  2LWX A;  3TWK A;  2JP7 A;  2JXN A;  3IG8 A;  1FJG M;  1K3W A;  3TH1 A;  4MGZ E;  4GIT A;  4LGM A;  2F5P A;  2BOY A;  1MU5 A;  2JUJ A;  4D82 A;  1EIJ A;  1IY0 A;  1VQ1 A;  4R71 A;  2L6O A;  3HX3 A;  3I4V A;  4JXJ A;  1DLT A;  4NXN M;  2BUY B;  5JI3 E;  4PT5 A;  1XWI A;  3MMP A;  1JB0 F;  3HKP A;  4LCB A;  1EO9 B;  3DFZ A;  2EO2 A;  2ZTD A;  3PCE A;  1EE8 A;  1GL7 A;  3CGW A;  3PVS A;  1TH4 A;  1FNN A;  2CUZ A;  3U6M A;  2KW0 A;  3MV4 M;  3KOY E;  5EXS A;  1N32 M;  2DZN B;  2KNZ A;  3PCF M;  1EOA A;  2AHM A;  4M9S A;  3B7Q A;  1YKN A;  2BUX B;  4JV5 M;  4GC9 A;  1D2N A;  2DKL A;  4XK8 F;  2F5Q A;  5EQT A;  1I94 M;  2MJ5 B;  4FCW A;  4S12 A;  3L27 A;  1V34 A;  2R45 A;  1DGG A;  3T63 A;  4G4Q A;  4DR5 M;  4DBG B;  4QHS A;  5EP1 A;  4L6V 6;  2ZAN A;  3FYD A;  3KSX A;  3LVW A;  2EKF A;  2CV1 A;  2BUU B;  4DV1 M;  3Q8X A;  1NHW C;  2DAK A;  5EP2 A;  3LCV B;  2DWZ B;  3Q8G A;  2KEB A;  3LMX A;  4CHT B;  3T1H M;  3PNY A;  4MGI E;  1DGF A;  3SYL A;  3D8B A;  4G4R A;  3FD9 A;  2DHR A;  1HQY E;  3KSJ A;  4AZF A;  1G41 A;  2KXE A;  3U6D A;  1IN4 A;  1SXJ E;  2XFS A;  3U5Z B;  1IBL M;  3PCK A;  1YKO B;  3ZC7 B;  4OVZ A;  1NVM A;  3THG A;  2M5Z A;  2DWM A;  2FFJ A;  2D7G A;  1QYR A;  4M9Z A;  5IRE B;  1TF0 B;  2DHY A;  2FE8 A;  1WGN A;  2OPF A;  2HKJ A;  4OW0 A;  1NNJ A;  4K0K M;  3KP1 E;  4AQY M;  2QP9 X;  1EOC B;  3A45 A;  3SAT A;  4WHP B;  1TGU A;  3CF0 A;  2JZ0 A;  1L1Z A;  3LXV A;  3T15 A;  2CV2 A;  3UGJ A;  3B89 A;  5TD3 A;  7CAT A;  3C58 A;  2R4E A;  2Z3X A;  2C98 A;  1QZE A;  2E5L M;  3NBX X;  2HWJ A;  2RRU A;  4LF9 M;  4WHR B;  2V6Z M;  5DFL A;  2Q2E B;  3PCE M;  1L2B A;  1E94 E;  2K0B X;  3I4Y A;  2LVO C;  1KSF X;  3AOE C;  4REZ A;  3GLG B;  1ZV1 A;  3FUT A;  5C1B A;  1TMX A;  1DGH A;  1JQJ C;  1GJT A;  1NJF A;  3GLH A;  4LJ8 A;  1R4G A;  2K47 A;  3GPP A;  1ZMU A;  3FTC A;  1QZM A;  3ZH9 B;  4DR3 M;  2R44 A;  3U6L A;  5EP3 A;  4X62 M;  3GP1 A;  2C9O A;  3AL0 C;  3PCN A;  3T63 M;  1TH2 A;  2RGH A;  3PCA A;  1Q02 A;  1DO0 A;  4GH9 A;  5FLX S;  1TTE A;  2MR9 A;  5EJC A;  1IN8 A;  2Y0Q A;  4IBF A;  3PCG A;  1QUS A;  3EIE A;  2BUV B;  1YLA A;  4PD2 A;  3DZD A;  1EOB A;  3LMX M;  3LQQ A;  1XHB A;  3TL4 X;  1TR8 A;  2V1C A;  5ITX A;  1A5T A;  3VKH A;  1NSF A;  1YKM B;  1MN3 A;  5FTN A;  2XGN A;  2BV0 A;  2OO9 A;  3PCK M;  4WHO B;  3HY5 A;  4AKG A;  1KYI A;  2BUZ A;  2WSE F;  2ERC A;  2F4V M;  3K9P A;  3VK7 A;  3TE6 A;  3MI1 A;  1JR3 E;  1XXH A;  2QPA A;  3RGP A;  3K8Z A;  3KVW A;  3PCJ A;  2Z8Y M;  1SXJ D;  3I51 A;  4HL4 A;  3M7G A;  4DV2 M;  3U61 B;  1N36 M;  4F1I A;  1L2D A;  2JY7 A;  1EO2 A;  4RKU F;  3ZCB B;  3SAR A;  3LXV M;  3BXW A;  1YUB A;  2PCD A;  3E4R A;  2LHC A;  3AOG A;  3E21 A;  3KOW E;  4JI2 M;  2R4J A;  2ZAM A;  4LJ4 A;  1IXS A;  3AV0 A;  1QAM A;  4KLN A;  1WIV A;  4G4N A;  3U6C A;  3T38 A;  3SAW A;  3PCC A;  1XNQ M;  4I8O A;  4WHR F;  2BJW A;  4AG5 A;  2VQF M;  3U6O A;  2J5Y A;  2BUW A;  4RF1 A;  2UXB M;  3FTD A;  4R3D A;  3E9S A;  2EKK A;  3R9X B;  3UZU A;  5H37 D;  3AFH A;  3E46 A;  4B7H A;  4R7G A;  4B3T M;  4QNR A;  2Y0T A;  3QYE A;  3TPZ A;  3U60 B;  1YE9 A;  3PCN M;  2A5Y B;  1Z5A A;  2L2D A;  2RKO A;  1N78 A;  3PCA M;  3AKZ A;  2FOI C;  1K82 A;  4NSR A;  2I7P A;  4JI4 M;  1G8P A;  2I7N A;  3GQ3 A;  3L29 A;  1PJQ A;  1WGL A;  3SHG B;  4DR6 M;  5FTL A;  2R6F A;  3L26 A;  3T1Y M;  1DV0 A;  1HNW M;  1YKL A;  1VDL A;  4LF7 M;  3PCG M;  3VK8 A;  4B08 A;  4MM3 B;  4WHS B;  2W82 A;  2XF3 A;  4M0D A;  2OQ4 A;  1OJL A;  3GLI B;  3GQ5 A;  2QBY A;  2XLJ A;  1PM5 A;  2F5S A;  4L78 A;  2LVP C;  4II7 A;  3LVV A;  3FUV A;  3HU2 A;  4TUW A;  4Z8X A;  3PCM A;  4LF6 M;  4LF5 M;  2G5G X;  3PCD A;  3MI5 A;  4B7G A;  3GLF E;  1J7K A;  4HLQ A;  4IIW A;  2QZ4 A;  3JAM S;  3SAS A;  3LKT A;  3MFL A;  3GRU A;  2BWE A;  4RNA A;  1SXJ A;  4NRV A;  4JI5 M;  3HJQ A;  3PCJ M;  2XSZ D;  1S3S A;  1OIP A;  3SC3 A;  1VEK A;  3K9O A;  1OFH A;  5FTJ A;  3SMP A;  4DR7 M;  1GAB A;  4FCV A;  4FCT A;  1JR3 D;  4LF4 M;  2JWS A;  3C3E A;  2PCD M;  1V92 A;  3C3D A;  5LMU M;  3N9T A;  3SAU A;  3MV6 A;  1XMQ M;  3MJ5 A;  4GKJ M;  1YKP A;  1MX0 A;  4FW9 A;  3UJN A;  2CWB A;  2KDL A;  4I5S A;  4YHH M;  3J7A S;  1J09 A;  3M6A A;  3PCC M;  3J80 S;  3GLG E;  4LJA A;  4ILV A;  1HNX M;  4L4U A;  4LGY A;  2BUM B;  1YKK A;  2XFT A;  4CGY B;  4FWD A;  1G71 A;  4HEO A;  2O5R A;  2QNJ A;  2DWN A;  1QQW A;  2LNH C;  4AKI A;  2DXI A;  4BB9 A;  5DNY A;  5C18 A;  2GQF A;  4FWG A;  3HHX A;  3TWL A;  3HGI A;  1L2C A;  2XSR A;  1HNZ M;  1GL6 A;  2VDB B;  2X4A A;  1XC8 A;  4CJ6 A;  1Q3C A;  1N77 A;  1XXH B;  4DV7 M;  2O25 A;  2V1U A;  4LFB M;  1NY6 A;  3VFD A;  1N34 M;  1PGY A;  4IBG A;  3GRV A;  2BNK A;  5FSW A;  3KFU G;  2BUR A;  1HQC A;  4X65 M;  3CF2 A;  3K1J A;  2VII A;  5KPR A;  3BBZ A;  3CF6 E;  2O01 F;  2XZF A;  4G6Z A;  1G59 A;  2ZTC A;  4NOO B;  1OAI A;  3KOZ E;  4IBJ A;  4LF8 M;  2LBC A;  1ZQ9 A;  1L8Q A;  2LVA A;  1NY5 A;  3W0L B;  2BUQ A;  1IXS B;  3LKT M;  3HWS A;  5BPV A;  2J7O A;  3MFL M;  4WHQ B;  1CUK A;  2XSZ A;  4FWH A;  2DAG A;  4P17 A;  3K2L A;  4GRI A;  4NSO B;  3GPU A;  3U6Q A;  3L25 A;  4DV0 M;  3PCI A;  1BVS A;  3PCL A;  1JR3 A;  1IXR C;  2D7E A;  3CTW B;  3HHY A;  3A46 A;  1PJS A;  5KQ8 A;  4DR1 M;  1HR0 M;  4B3S M;  4AI6 A;  3A42 A;  3F92 A;  3PNV A;  4L8R C;  2H5X A;  1XNR M;  5KQD A;  3GO8 A;  3PCH A;  5LMN M;  3FUX A;  1IXZ A;  1ORY B;  5KPZ A;  1Q39 A;  4P16 A;  2BUY A;  1YSY A;  2KHH A;  4PCZ A;  2XSV A;  4JI7 M;  2B3T A;  5ITR A;  4DV3 M;  1EFU B;  1E9S A;  3EIH A;  2NQ8 C;  1YKL B;  1ZMV A;  1T6O A;  4G3O A;  1DLQ A;  1EO9 A;  2Y21 A;  3H4M A;  3GQ4 A;  1QDT A;  3NWL A;  2CV0 A;  1R7R A;  3O6J A;  2WSF F;  1IQP A;  4MH0 E;  1Z5B A;  5A2Q S;  2AZQ A;  2FNA A;  1G3I A;  1Z6T A;  2N35 A;  3QWL A;  4IBI A;  2L4E A;  1SG9 A;  1VG5 A;  2DVW B;  1QAO A;  2X8A A;  3DOA A;  1PJJ A;  5GKN A;  4CIS A;  2KZS A;  4JI8 M;  3QAU A;  3RFW A;  2CHG A;  2KA6 B;  2UUC M;  2Y20 A;  4JI3 M;  4MGY E;  2R0I A;  1D0M A;  3KDS E;  1EOA B;  2BUU A;  1P3Q Q;  1YKN B;  3GLI E;  4EIW A;  4M9X A;  3W0F A;  3M0E A;  3ILK A;  5F3W A;  1D0L A;  1NO1 A;  2EUC A;  1IY2 A;  1HT2 E;  3J27 B;  4DUY M;  2ZBK B;  3J2P B;  3GPX A;  1RU3 A;  4OX9 M;  1X37 A;  4UN2 B;  3PFI A;  3O5U A;  1T3T A;  1DO2 A;  5ITU A;  5IWA M;  3KP0 E;  1ZMW A;  5IT9 S;  3U5Z A;  2DZO B;  2HCB A;  3WHL A;  4WHO D;  1NV9 A;  4LG2 A;  3GPY A;  2L7H A;  2DWL A;  3B9P A;  3BOS A;  3GLF A;  3PCI M;  3PCL M;  3A98 B;  3FRI A;  2CEA A;  3FRH A;  1NV8 A;  2X49 A;  1R6B X;  2JY8 A;  1OQY A;  3LMM A;  3LW5 F;  3SBJ A;  2LHG A;  2OOB A;  4LJ6 A;  4WP2 A;  2RGO A;  3MK6 A;  4ZPX A;  3JR5 A;  1IBM M;  3PCH M;  3LQR A;  1PRB A;  2M60 A;  4KOD A;  1WR1 B;  3C9P A;  2J7N A;  2G8L A;  4OVZ B;  1KFV A;  2QCU A;  1GKI A;  4DR4 M;  4GIP A;  2JZ1 A;  1Y8G A;  3HHW A;  4NXM M;  4WHR A;  1WXQ A;  1W5T A; 
#chains in the Genus database with same CATH homology
 3J7B A;  4IBE A;  4DV6 M;  1DMH A;  4ILT A;  4M0W A;  2R18 A;  3KS8 A;  4X66 M;  1I4W A;  4IBC A;  1LV7 A;  2P5T A;  2ZM6 M;  3PCB A;  3HJS A;  5EP4 A;  4JI6 M;  1W5S A;  2ZAO A;  3SHF A;  1VDD A;  4I4L A;  1R2Z A;  1DGH B;  2YR0 A;  3GLH B;  1E32 A;  5DYI A;  3AJI B;  3MHV C;  2Z4S A;  1K3X A;  4L16 A;  2BUV A;  3AOE A;  4QNM A;  3T67 A;  4IJE A;  5ITT A;  4WHS D;  4Z6Y A;  4LJ9 A;  2EA0 A;  1J5E M;  1YKM A;  4LJ5 A;  1C1K A;  4IBD A;  4BLC A;  4WHO A;  2F5O A;  1IN7 A;  1IN5 A;  1L1T A;  4OU7 A;  2JA2 A;  3L28 A;  4IJF A;  1EOB B;  4JYA M;  4WUR A;  4FVM A;  2F5N A;  4LJ7 A;  1N75 A;  5KO3 A;  3U61 A;  2C96 A;  2BV0 B;  5IZ7 D;  2XSU A;  4D80 A;  2Z7J A;  2BUZ B;  4PDI A;  5EXX A;  2XEP A;  2CE7 A;  4QOS A;  4JI1 M;  2Z4R A;  3VKG A;  1R2Y A;  4LFA M;  1EO2 B;  2C9C A;  3FTF A;  4PDG A;  1QAQ A;  4GHL A;  3UMM A;  4MGK E;  1NHG C;  4A3V B;  5ITQ A;  2C5R A;  3PCB M;  3PCM M;  5EXP A;  2LH0 A;  2QEN A;  5JI2 E;  1PJI A;  3HU1 A;  4ITQ A;  3PCD M;  3MI5 M;  1HT1 E;  3U60 A;  4LFC M;  3GRY A;  2BUT A;  1H6U A;  2HL7 A;  4MB7 A;  2BUW B;  3JR4 A;  3GLF B;  4IBK A;  4LZZ A;  3T67 M;  3GRR A;  2C99 A;  4KO8 A;  4LRT A;  4QOZ C;  4GC5 A;  5BR8 M;  4WHS A;  8CAT A;  3MV6 M;  1NJG A;  3K92 A;  2L09 A;  5KPT A;  3GLI A;  3SAV A;  3O6R A;  4NL4 H;  3TWM A;  3U6E A;  2UUA M;  2R65 A;  2YFQ A;  4XGI A;  3R8F A;  4WHP D;  1SXJ C;  3IG5 A;  3SMS A;  4AG6 A;  2H1R A;  2R62 A;  4BBA A;  2CHQ A;  2UU9 M;  3O32 A;  3D8L A;  1N33 M;  3VDU A;  1TH3 A;  1Z5C A;  1GVN A;  4IBB A;  3KW6 A;  2QBY B;  4NRW A;  4GMQ A;  3OTO M;  4AKH A;  2YQZ A;  5FTK A;  2BUX A;  2CHV A;  4G4O A;  2R46 A;  4AQY M;  3UK6 A;  2KRU A;  2LXE A;  1Q3B A;  3FYC A;  4JN6 A;  3FUU A;  3TQS A;  2VQE M;  3J81 S;  2KRK A;  3KOX E;  1SXJ B;  1OFI A;  5DYG A;  3HU3 A;  3L2A A;  1DGB A;  3KXE C;  4X64 M;  3VLF B;  2HHH M;  4LZJ A;  3SFZ A;  1Z59 A;  4LRS A;  1G4A E;  2YNM D;  2BUM A;  1E9R A;  2UXD M;  1IM2 A;  3WHK A;  4L15 A;  3FTE A;  2D7H A;  1YKP B;  4AW4 A;  1S9A A;  1IN6 A;  4B3R M;  4W5W A;  4LY6 A;  3NBI A;  4DV5 M;  3PXG A;  2XH9 A;  3SYK A;  5E6J A;  1IBK M;  1YKO A;  2BJV A;  4JI0 M;  2XZU A;  1XMO M;  1YKK B;  3VDP A;  1UM8 A;  3MV4 A;  3HJ8 A;  5E26 A;  4KHP M;  1TDZ A;  4MGH A;  3DA1 A;  3PCF A;  3FKE A;  5FTM A;  1EOC A;  2UUB M;  3FUW A;  4RF0 A;  1NNU C;  4WW0 A;  4WHP A;  4DUZ M;  2KZU A;  1QAN A;  5ITY A;  4DV4 M;  5EXT A;  3RGS A;  4DR2 M;  4B3M M;  3HHZ A;  4WHQ A;  1ZAE A;  2BUR B;  1IY1 A;  5ITX E;  4QHT A;  3GLG A;  2UXC M;  3RE8 A;  3U6S A;  3KS4 A;  3U6P A;  4GKK M;  4B7F A;  4D81 A;  4I81 A;  2BUQ B;  4YY3 M;  2BUT B;  2L7I A;  1GLN A;  1TDH A;  4XBO A;  4FD2 A;  1QVR A;  1DLM A;  2CFO A;  2LWX A;  3TWK A;  3IG8 A;  1FJG M;  1K3W A;  3TH1 A;  4MGZ E;  4GIT A;  4LGM A;  2F5P A;  2BOY A;  1MU5 A;  4D82 A;  1IY0 A;  2L6O A;  3I4V A;  4JXJ A;  1DLT A;  2BUY B;  4NXN M;  5JI3 E;  4PT5 A;  1XWI A;  3HKP A;  4LCB A;  1EO9 B;  3DFZ A;  2EO2 A;  3PCE A;  1EE8 A;  1GL7 A;  3PVS A;  1TH4 A;  1FNN A;  2CUZ A;  3U6M A;  2KW0 A;  3MV4 M;  3KOY E;  5EXS A;  1N32 M;  2DZN B;  3PCF M;  1EOA A;  2AHM A;  4M9S A;  1YKN A;  2BUX B;  4JV5 M;  4GC9 A;  1D2N A;  2F5Q A;  5EQT A;  1I94 M;  4FCW A;  4S12 A;  3L27 A;  2R45 A;  3T63 A;  1DGG A;  4G4Q A;  4DR5 M;  4QHS A;  5EP1 A;  2ZAN A;  3FYD A;  3KSX A;  3LVW A;  2CV1 A;  2BUU B;  4DV1 M;  3Q8X A;  1NHW C;  5EP2 A;  2DWZ B;  2KEB A;  3LMX A;  4CHT B;  3T1H M;  3PNY A;  4MGI E;  1DGF A;  3SYL A;  3D8B A;  4G4R A;  3FD9 A;  2DHR A;  1HQY E;  3KSJ A;  4AZF A;  1G41 A;  2KXE A;  3U6D A;  1IN4 A;  1SXJ E;  2XFS A;  3U5Z B;  1IBL M;  3PCK A;  1YKO B;  3ZC7 B;  4OVZ A;  1NVM A;  3THG A;  2M5Z A;  2DWM A;  2FFJ A;  2D7G A;  1QYR A;  4M9Z A;  5IRE B;  2FE8 A;  2OPF A;  2HKJ A;  4OW0 A;  1NNJ A;  4K0K M;  3KP1 E;  2QP9 X;  1EOC B;  3A45 A;  3SAT A;  4WHP B;  1TGU A;  3CF0 A;  1L1Z A;  3LXV A;  3T15 A;  2CV2 A;  3UGJ A;  5TD3 A;  7CAT A;  3C58 A;  2R4E A;  2Z3X A;  2C98 A;  2E5L M;  4LF9 M;  4GHA A;  4WHR B;  2V6Z M;  2Q2E B;  3PCE M;  1L2B A;  1E94 E;  3I4Y A;  1KSF X;  3AOE C;  4REZ A;  3GLG B;  5C1B A;  3FUT A;  1TMX A;  1DGH A;  1JQJ C;  1NJF A;  3GLH A;  4LJ8 A;  2K47 A;  3GPP A;  3FTC A;  3ZH9 B;  1QZM A;  4DR3 M;  3U6L A;  5EP3 A;  4X62 M;  3GP1 A;  2C9O A;  3AL0 C;  3PCN A;  3T63 M;  1TH2 A;  2RGH A;  3PCA A;  1DO0 A;  4GH9 A;  5FLX S;  5EJC A;  1IN8 A;  2Y0Q A;  4IBF A;  3PCG A;  3EIE A;  2BUV B;  4PD2 A;  1EOB A;  3DZD A;  3LMX M;  3LQQ A;  1XHB A;  3TL4 X;  2V1C A;  5ITX A;  3VKH A;  1NSF A;  1YKM B;  5FTN A;  2BV0 A;  2XGN A;  3PCK M;  4WHO B;  4AKG A;  1KYI A;  2BUZ A;  2ERC A;  2F4V M;  3VK7 A;  3TE6 A;  3MI1 A;  2QPA A;  1XXH A;  3RGP A;  3K8Z A;  3KVW A;  3PCJ A;  1SXJ D;  3I51 A;  4HL4 A;  3M7G A;  4DV2 M;  3U61 B;  1N36 M;  1L2D A;  1EO2 A;  3ZCB B;  3SAR A;  3LXV M;  1YUB A;  2PCD A;  3E4R A;  3AOG A;  3KOW E;  4JI2 M;  2R4J A;  2ZAM A;  4LJ4 A;  4G4N A;  3AV0 A;  1QAM A;  4KLN A;  3U6C A;  3SAW A;  3T38 A;  4WHR F;  3PCC A;  1XNQ M;  4I8O A;  2BJW A;  4AG5 A;  2VQF M;  3U6O A;  2BUW A;  4RF1 A;  2UXB M;  3FTD A;  4R3D A;  3E9S A;  3R9X B;  3UZU A;  5H37 D;  3AFH A;  4B7H A;  4R7G A;  4B3T M;  4QNR A;  2Y0T A;  3U60 B;  3TPZ A;  3PCN M;  1YE9 A;  2A5Y B;  1Z5A A;  2RKO A;  1N78 A;  3PCA M;  3AKZ A;  2FOI C;  1K82 A;  4NSR A;  2I7P A;  4JI4 M;  1G8P A;  2I7N A;  3GQ3 A;  3L29 A;  3SHG B;  4DR6 M;  5FTL A;  3L26 A;  3T1Y M;  1YKL A;  3PCG M;  1HNW M;  4LF7 M;  3VK8 A;  4B08 A;  4MM3 B;  4WHS B;  2W82 A;  2XF3 A;  4M0D A;  2OQ4 A;  1OJL A;  3GLI B;  3GQ5 A;  2QBY A;  2XLJ A;  1PM5 A;  2F5S A;  4L78 A;  4II7 A;  3LVV A;  3FUV A;  3HU2 A;  4TUW A;  4Z8X A;  3PCM A;  4LF6 M;  4LF5 M;  2G5G X;  3PCD A;  3MI5 A;  4B7G A;  1J7K A;  4HLQ A;  4IIW A;  2QZ4 A;  3JAM S;  3SAS A;  3LKT A;  3MFL A;  3GRU A;  4RNA A;  3MI1 M;  1SXJ A;  4NRV A;  4JI5 M;  3HJQ A;  3PCJ M;  2XSZ D;  1S3S A;  3SC3 A;  1OFH A;  5FTJ A;  3SMP A;  4DR7 M;  4FCV A;  4FCT A;  1JR3 D;  4LF4 M;  2PCD M;  3N9T A;  5LMU M;  3SAU A;  3MV6 A;  1XMQ M;  3MJ5 A;  4GKJ M;  1YKP A;  1MX0 A;  4FW9 A;  3UJN A;  3J7A S;  4I5S A;  4YHH M;  3PCC M;  1J09 A;  3M6A A;  3J80 S;  4LJA A;  4ILV A;  1HNX M;  4L4U A;  4LGY A;  2BUM B;  1YKK A;  2XFT A;  4CGY B;  4FWD A;  2O5R A;  2DWN A;  1QQW A;  2LNH C;  4AKI A;  2DXI A;  4BB9 A;  5DNY A;  5C18 A;  4FWG A;  3HHX A;  3TWL A;  3HGI A;  1L2C A;  2XSR A;  1HNZ M;  1GL6 A;  2X4A A;  1XC8 A;  1N77 A;  1Q3C A;  4LFB M;  1XXH B;  4DV7 M;  2V1U A;  1NY6 A;  3VFD A;  1N34 M;  4IBG A;  3GRV A;  2BNK A;  5FSW A;  3KFU G;  2BUR A;  1HQC A;  4X65 M;  3CF2 A;  3K1J A;  2VII A;  5KPR A;  3CF6 E;  2XZF A;  1G59 A;  4G6Z A;  4NOO B;  3KOZ E;  4IBJ A;  4LF8 M;  1ZQ9 A;  1L8Q A;  1NY5 A;  3W0L B;  2BUQ A;  1IXS B;  3LKT M;  3HWS A;  5BPV A;  2J7O A;  3MFL M;  4WHQ B;  2XSZ A;  4FWH A;  3K2L A;  4GRI A;  4NSO B;  3GPU A;  3U6Q A;  3L25 A;  4DV0 M;  3PCI A;  3PCL A;  1JR3 A;  1IXR C;  2D7E A;  3CTW B;  3HHY A;  3A46 A;  4DR1 M;  5KQ8 A;  1HR0 M;  4B3S M;  4AI6 A;  3A42 A;  3PNV A;  4L8R C;  1XNR M;  5KQD A;  3GO8 A;  3PCH A;  5LMN M;  3FUX A;  1IXZ A;  1ORY B;  5KPZ A;  1Q39 A;  4P16 A;  2BUY A;  1YSY A;  4PCZ A;  2XSV A;  4JI7 M;  5ITR A;  4DV3 M;  3EIH A;  1E9S A;  2NQ8 C;  1YKL B;  1DLQ A;  1EO9 A;  2Y21 A;  3H4M A;  3GQ4 A;  3NWL A;  2CV0 A;  1R7R A;  3O6J A;  1IQP A;  4MH0 E;  1Z5B A;  5A2Q S;  2AZQ A;  2FNA A;  1G3I A;  1Z6T A;  3QWL A;  4IBI A;  2DVW B;  1QAO A;  2X8A A;  3DOA A;  1PJJ A;  5GKN A;  4CIS A;  2KZS A;  4JI8 M;  3QAU A;  3RFW A;  2CHG A;  2KA6 B;  2UUC M;  2Y20 A;  4JI3 M;  4MGY E;  3KDS E;  1EOA B;  2BUU A;  1YKN B;  4EIW A;  4M9X A;  3W0F A;  3M0E A;  3ILK A;  2EUC A;  1IY2 A;  1HT2 E;  3J27 B;  4DUY M;  2ZBK B;  3J2P B;  3GPX A;  4OX9 M;  1X37 A;  3O5U A;  3PFI A;  1T3T A;  1DO2 A;  5ITU A;  5IWA M;  3KP0 E;  5IT9 S;  3U5Z A;  2DZO B;  2HCB A;  3WHL A;  4WHO D;  4LG2 A;  3GPY A;  2L7H A;  2DWL A;  3B9P A;  3BOS A;  3GLF A;  3PCI M;  3PCL M;  3A98 B;  2CEA A;  3LMM A;  3SBJ A;  2X49 A;  1R6B X;  5F3W A;  4LJ6 A;  2RGO A;  3MK6 A;  4ZPX A;  3JR5 A;  1IBM M;  3PCH M;  3LQR A;  2M60 A;  4KOD A;  2J7N A;  2G8L A;  4OVZ B;  1KFV A;  2QCU A;  1GKI A;  4DR4 M;  4GIP A;  3HHW A;  4NXM M;  4WHR A;  1WXQ A;  1W5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...