3HJSA

Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 73
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hjsA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hjsA02
2BUVB 1YKNA 2PCDA 3LKTM 3PCJA 4WHQA 1YKOB 3T63A 3PCCM 3MFLA 3MI1A 1YKMB 2BUYB 3PCBM 1EOBB 1EO2B 2BUMB 2BUVA 2BUQB 3MI5M 1YKOA 3PCKA 2BURB 3T67M 3PCAM 3PCMM 1YKMA 2BUYA 1DLQA 1EOBA 1EO2A 2BUQA 2BV0B 2BUXB 3HHYA 3HJQA 2BURA 1YKLB 4ILVA 2AZQA 3PCDA 4WHOB 2BV0A 2BUXA 2BOYA 3MV4M 2XSVA 3LMXM 1YKLA 4WHOA 3PCHM 3MV6A 4WHRB 3LXVA 3PCEA 3HHXA 2PCDM 3T63M 4WHPD 3MFLM 1S9AA 1TMXA 3PCGM 4WHRA 2BUZB 5TD3A 2BUMA 3PCLA 3HGIA 1EOAB 3I4VA 4WHOD 1EO9B 3PCBA 1YKKB 1EOAA 3O32A 1EO9A 3PCDM 3PCNA 3T67A 2BUWB 2BUTB 3PCFA 3O6JA 3HJ8A 3PCJM 3MV6M 3LXVM 3PCIA 3MI1M 4ILTA 2BUTA 3MV4A 1EOCB 3PCKM 2XSRA 3LKTA 1DLTA 4WHSB 3PCCA 2BUZA 2BUUB 2XSUA 3PCLM 1DLMA 3N9TA 3MI5A 4WHSA 3PCGA 2BUUA 3I4YA 3PCAA 3PCMA 3I51A 1YKKA 4WHPB 3PCNM 3HKPA 1DMHA 3O6RA 3PCEM 3PCFM 3TH1A 2BUWA 1YKPB 4WHPA 4WHRF 3HJSA 3LMXA 1YKNB 3PCIM 3O5UA 4WHQB 4WHSD 3PCHA 1YKPA 1EOCA
chains in the Genus database with same CATH superfamily
3QYEA 4DV5M 1K3WA 3B89A 1YKNA 2BUVB 2PCDA 3PCJA 3GLHA 1YKOB 1R7RA 3T63A 3MFLA 2LVNC 3LQQA 2KA6B 3MI1A 5GKNA 3SAUA 1EO2B 2BNKA 2MGWA 2BUVA 3FUVA 2FS1A 2CWBA 3VDPA 2G8LA 5FLXS 1YKOA 4DR5M 1JR3E 2QHOB 1FJGM 3TE6A 4JI8M 1G3IA 3PCAM 3HU3A 4LG2A 2QENA 1EO2A 2LVOC 2R0IA 2LHCA 1R2YA 4CIZA 2BUXB 3LQRA 3HHYA 1YKLB 5KPTA 1IY0A 1KSFX 3RGPA 3NBIA 2JP7A 3AFHA 4Z8XA 2VDBB 4CISA 2BOYA 2BUXA 1V92A 4DV4M 4Y28F 3U60B 2DENA 1YKLA 1OIZA 5EP4A 2J5YA 3KS4A 4GMQA 4D80A 3T1YM 4LRTA 1OIPA 2KNZA 3GQ3A 1Z5AA 3MV6A 5ITRA 3LXVA 2R44A 3HHXA 2LBCA 3U60A 1AIPC 2X8AA 1E9RA 4R7GA 1WGLA 5C1BA 4DR3M 1OFHA 2CE7A 1E9SA 1OQYA 2XEPA 1L2DA 4L15A 3FE3A 4AKHA 2FOIC 2BUUA 4M9SA 1TMXA 2LWXA 3PCGM 3KP1E 3T15A 3RFWA 2APLA 4KT0F 4PT5A 3U61A 4PD2A 3PCLA 1HR0M 2RKOA 1CUKA 1LTMA 3HGIA 1EOAB 2L7HA 1JB0F 3BBZA 5DYGA 3UZUA 2K47A 2C9CA 3CF0A 4QNMA 2DNAA 1G8PA 5DNYA 4GKJM 2FH0A 2Y20A 3PCBA 3J80S 2KRUA 3R8FA 1YKKB 3V76A 1EOAA 1XXHB 3O32A 2DAGA 2XFSA 3U6OA 1NNJA 1K82A 1G4AE 4OW0A 1W5TA 1IN6A 3PCNA 3H4MA 2FFJA 1TDHA 4DBGB 1PJJA 2ZAMA 2A5YB 2VF7A 2D7GA 2KNAA 4X64M 1N34M 2R45A 3EIHA 3FD9A 1RU3A 1ZQ9A 4GC5A 4PCZA 2VIIA 1PJIA 4IBFA 1EE8A 3PCIA 4WW0A 2MJ5B 2D7EA 1JR3D 1NSFA 3GLHE 4OU7A 3GLGE 3PCKM 3TL4X 5A2QS 1DGGA 1P3QQ 1TH2A 3K9PA 4LFBM 3HX3A 1NY5A 1NJGA 2JWSA 2Z7JA 1IQPA 1QAQA 4FCTA 1HNXM 4R3DA 2CV0A 4II7A 2BWEA 3SASA 2BUZA 1L2CA 3WHKA 3EIEA 2DI0A 3KSXA 1IY1A 1IBMM 2F5PA 1TTEA 5ITXA 1R5LA 5IWAM 3FTFA 4RNAA 3O6RA 5E6JA 2CV2A 3GLIB 3PNYA 1NV8A 1OFIA 3VFDA 4WHPB 1GKIA 3Q8GA 5ITYA 2VQFM 4DV7M 4IJEA 4JI3M 4NC6A 1HQYE 4BBAA 1DMHA 4HL4A 2QNJA 1WIVA 2NQ8C 4LJAA 3RGSA 5KQ8A 4G4RA 1KFVA 2M5ZA 1L8QA 3NBXX 4LF7M 4JI2M 4XGIA 4WHPA 1YE9A 2QZ4A 3IECA 3LW5F 3HU2A 4WHRF 4DUZM 4L8RC 2O25A 1L1ZA 2L09A 4WHQB 5LMUM 4DR2M 2DKLA 3FYCA 4G3OA 5FTNA 4B7FA 1Z5CA 3B9PA 4CGYB 2UXCM 4LRSA 4PDIA 1EOCA 1WXQA 3HU1A 1WGNA 3K8ZA 3HZJA 4A3VB 4WHQA 4IBEA 1IXSB 3KOWE 4L78A 3UGJA 4JI6M 1HNWM 2QQ8A 5EP1A 2EKKA 2I7PA 1YKMB 3QWLA 1TH3A 3BXWA 3CTWB 1HJPA 3KW6A 3HHZA 1VEJA 2RGOA 3U6MA 1EOBB 1OKSA 4FD2A 3ZQJA 1IXSA 5JI3E 2DAKA 3T67M 1OJLA 3JR4A 2F5NA 3GQ4A 3KSJA 2KZSA 2VF8A 1XNQM 1EOBA 2R46A 1PM5A 1YKMA 3UJNA 3MI5A 1YUBA 2Z8YM 5FTKA 3HJQA 4NRWA 4ILVA 4NRVA 3LMMA 1X37A 1TR8A 4WHOB 2UXDM 2FE8A 4MGYE 2XSVA 3C58A 4HLQA 3LMXM 7CATA 1IXRC 2DZLA 5C18A 4GHAA 2DZOB 4MM3B 4AKGA 3JAMS 3GO8A 4WHOA 2JY6B 2WSCF 3SC3A 3VLFB 4L16A 1VG5A 2JXNA 3SFZA 4QHTA 2LTUA 3W0LB 3W67A 3U6LA 2RRUA 3K2LA 2PCDM 2C96A 4LY6A 3T63M 1J7KA 2WSEF 2J7OA 2L4FA 3MFLM 1S9AA 1GJTA 3CF6E 5DFLA 1GLNA 2W82A 2J7NA 4JI5M 3E9SA 4P17A 1QZEA 4LF6M 1NNUC 3I4VA 1QUTA 4DR4M 2ERCA 1KYIA 4AG6A 4DV2M 2QCUA 4M0WA 1R6BX 1VEKA 3AOGA 2Q2EB 2GQFA 3RE8A 1XC8A 4MH0E 4I8OA 2DAEA 2G3QA 2XSZA 3U6DA 4TUWA 3W0FA 3SBJA 1R4GA 2R4EA 2Y21A 3LCUA 2BUWB 1HT2E 3AOEA 4F1IA 2BUTB 3PCFA 3O6JA 3T38A 3K92A 3FTCA 4NSOB 1YLAA 3MV6M 4OX9M 3LXVM 4YY3M 1IN5A 1QZMA 3TQSA 3U6QA 3TPZA 2L7IA 1GABA 2C5RA 4LF5M 3R9XB 2EJSA 4CHTB 4AKIA 2BUTA 4ILTA 1D0KA 1QYRA 4JN6A 3FUTA 3OTOM 2LVQD 2XSRA 2R18A 2XFTA 3I01M 3LKTA 3HWSA 1TF0B 2C99A 2KW0A 4QHSA 3KOZE 3PCCA 3U6EA 2V1CA 2O01F 2YNMD 3PCLM 1BVSA 3SATA 4BB9A 2CUZA 3KS8A 3K1JA 1DLMA 3N9TA 3CF2A 3GLFB 2LXEA 2KRKA 1Z6TA 3C3DA 3FTDA 2CHVA 4QOSA 3T6PA 3ZCBB 5KQDA 2BJVA 4M9ZA 3U6CA 4XK8F 1UM8A 1R2ZA 3PCGA 2Z3XA 4JI1M 2Y0QA 1SXJB 4I81A 4DUYM 3PCMA 1YSYA 3GLFA 4MGIE 1A5TA 4LJ8A 1YKKA 5EXTA 1XHBA 3PCNM 1XXHA 1Z59A 4LF8M 3DOAA 3PFIA 1FNNA 1VQ1A 3HKPA 1L2BA 1NVMA 1SXJA 1DO0A 2QPAA 3PCEM 2OOBA 3FUWA 3NWLA 4DV1M 4GRIA 3GRRA 3A46A 4WURA 4ITQA 4IIWA 2OPFA 2KNVA 4G4OA 1N36M 3PCIM 3VDUA 5EXPA 2YFQA 4F2LA 1I94M 4GH9A 5H37D 2LNHC 3PCHA 2CP8A 2FNAA 3B7NA 5DYIA 2Z4SA 1GJSA 5EXSA 4M0DA 3SMPA 2Z4RA 3H4JA 2KHHA 3IHPA 2ZBKB 4XBOA 5KO3A 4AG5A 3J7AS 1HT1E 3AV0A 1OTRA 1NHGC 5FTLA 3J2PB 2BUYB 3PXGA 3JR5A 2BUMB 3AOEC 1UFZA 2HL7A 1E32A 1N33M 3PCKA 4IBCA 3KDSE 3KXEC 1GL7A 2ZTDA 4IBKA 4QNRA 3TWKA 2DWMA 2BURB 2JZ0A 1DO2A 3M6AA 1DGFA 2Y0TA 4B7HA 2BUYA 3GLIA 5FSWA 4G4NA 3KVWA 3FKEA 1OAIA 2L6OA 2R6FA 3SHGB 2BURA 2XZFA 1TH4A 2P5TA 3UK6A 5IT9S 2DHYA 1PRBA 2AZQA 3PCDA 2K0BX 1QVRA 4FCWA 3MV4M 2R62A 4LJ5A 2XLJA 3GPXA 1F4IA 2L2DA 4GITA 2CFOA 4G6ZA 4JXJA 3J27B 2F5QA 4LJ4A 1LV7A 1OAOC 3ILKA 3FYDA 4WHRB 4L4UA 4W5WA 1ORYB 1V33A 2EKFA 3VKHA 2JA2A 5BR8M 4GC9A 4DV3M 4QOZC 1IN7A 2WZJA 3GP1A 1NO1A 4WHRA 2G5GX 1PGYA 1SXJC 1VEGA 3FUUA 4OVZB 2HAKA 4FW9A 3TWMA 4I4LA 3Q8XA 2UUCM 2HKJA 4GIPA 2LVAA 3GLFE 4WHOD 1EO9B 3M7GA 4B3RM 3SYLA 2DVWB 1IN4A 3IG8A 4UN2B 1DGHB 2BWBA 1ZAEA 1XXHE 1WJ7A 2YQZA 1GL6A 3AJIB 3E46A 2HWJA 1GO5A 4IBBA 2KZUA 1T43A 3GRVA 1EO9A 3T67A 1J09A 1DGHA 4LCBA 3LCVB 4EIWA 1IFYA 1WHCA 3L2AA 3U6SA 1VDDA 2OOAA 3HJ8A 3PCJM 2CV1A 3VKGA 4KODA 3U6PA 2EUCA 1NHWC 4DR1M 4LJ6A 2XGNA 3MI1M 2BJWA 4S12A 4LF9M 3SAVA 4LJ7A 4JYAM 1H6UA 4MGKE 3U5ZB 2XSZD 4GEWA 5ITXE 1TGUA 2JUJA 3GLGB 4LGMA 2QP9X 4KHPM 2HHHM 4HEOA 4WHSB 2AHMA 3GRYA 2DWLA 2E5LM 2DXIA 2XSUA 2D7HA 2LHGA 3THGA 2JNHA 3MK6A 4MGHA 2H1RA 4IJFA 1MX0A 3UMMA 3GLGA 2CHQA 3U5ZA 4JV5M 1D0MA 3GLIE 3E4RA 1IN8A 4JI0M 4WHSA 2ZTCA 3J7BA 2H5XA 1N77A 1Q3CA 3PCAA 1Y8GA 1XMOM 4JI7M 1QAMA 2V6ZM 1Q02A 1NY6A 2JY7A 1NJFA 4LZJA 2CEAA 1S3SA 2WSFF 3SYKA 2F5OA 4NXNM 3PVSA 2CHGA 4B08A 4IBDA 3GQ5A 1K3XA 5E26A 4DV6M 2B3TA 1EIJA 3PCFM 3KOYE 3D8LA 2BUWA 2C98A 4AQYM 1WR1B 2OO9A 2UXBM 2CRUA 2LVPC 2RGHA 3MHVC 1QANA 3A45A 4FVMA 4X66M 4Z6YA 2DWNA 4IBGA 4B3TM 2N35A 1T6OA 2I7NA 1XB2B 2JZ1A 1HQCA 4FWGA 3W68A 3LKTM 5JI2E 3E21A 1QAOA 3MMPA 2QSFX 2C9OA 3KOXE 1JQJC 3KP0E 3PCCM 3FUXA 1SXJD 2K6BA 3SMSA 1TDZA 4G4QA 3QYBA 2V1UA 4LF4M 4NXMM 4GHLA 3DA1A 4MGZE 3PCBM 1MN3A 3U61B 1DGBA 5IZ7D 2ZM6M 2BUQB 1I4WA 3MI5M 5KPRA 1E94E 3D8BA 3IG5A 3GPUA 1C7YA 4IBJA 3M0EA 3PCMM 3L25A 2O5RA 2M60A 1DLQA 3AL0C 2BUQA 2BV0B 4D81A 3DZDA 2KEBA 2KDLA 3HY5A 5EJCA 5EXXA 4P16A 3SHFA 2DAIA 2KXEA 3GPYA 2MROB 1XMQM 4NSRA 1N78A 4D82A 1HNZM 2BV0A 3GPPA 3B74A 2DZNB 2ZAOA 3L29A 1W5SA 4LZZA 2HCBA 3B7QA 3I04M 3DFZA 5ITQA 1AUAA 8CATA 3FRHA 3PCHM 5IREB 3PCEA 3A98B 4LFAM 3LVWA 4NOOB 3A42A 1Q39A 4NL4H 5F3WA 4WHPD 5L8RF 1C1KA 4X65M 1ZMUA 5FTMA 3SAWA 3FRIA 2MH8A 2UUBM 4RKUF 1NV9A 2BUZB 5TD3A 3C3EA 5FTJA 1J5EM 2R4JA 3K9OA 5LMNM 2BUMA 4M9XA 3L28A 1G71A 4JI4M 4FWHA 3AKZA 2ZANA 4AZFA 4DV0M 2JY8A 1IBLM 2K9DA 1N75A 1ZMVA 4RF1A 3L27A 2VQEM 3FTEA 1JR3A 1IM2A 3QAUA 1PJTA 5BPVA 3J81S 3LVVA 5EP3A 4GKKM 5EQTA 4R71A 4FCVA 3PCDM 4B3MM 2MR9A 5KPZA 4B3SM 2XZUA 4RF0A 2XF3A 4I5SA 2OQ4A 2F5SA 4Q7JA 3MJ5A 4IBIA 3VK7A 4CJ6A 1V34A 4ANRA 1MU5A 4KLNA 1D2NA 1GVNA 1IY2A 1XWIA 2GNOA 1QDRA 4AW4A 4MB7A 3MV4A 1T3TA 1EOCB 1SG9A 4FWDA 4BLCA 5EP2A 1Z5BA 1ZV1A 2DAMA 2L4EA 4REZA 5ITUA 1DV0A 1DLTA 4LGYA 1IBKM 3SARA 1PJQA 1N32M 4LFCM 4OVZA 2BUUB 2EO2A 3L26A 2UU9M 3CGWA 1MJGM 2YR0A 3KFUG 3HHWA 1L1TA 4YHHM 1IXZA 1D0LA 1EFUB 1QDTA 1SXJE 1G41A 2XH9A 1QUSA 1QQWA 3I4YA 4DR7M 2DHRA 2R65A 4ZPXA 4B7GA 4DR6M 4AI6A 1VDLA 1ZMWA 2EA0A 2UUAM 3I51A 3WHLA 2QBYB 4K0KM 1XNRM 3GRUA 1PJSA 4LJ9A 3BOSA 4WP2A 3T1HM 4KO8A 2X4AA 3ZC7B 2DWZB 3ZH9B 3C9PA 3TH1A 1YKPB 2QBYA 4X62M 1Q3BA 2JY5A 3HJSA 3LMXA 4L6V6 2X49A 1YKNB 5ITTA 3GLHB 3O5UA 3VK8A 4WHSD 3B7ZA 4PDGA 2LH0A 3F92A 3PNVA 3TWLA 1YKPA 1G59A 2F4VM
chains in the Genus database with same CATH topology
4DV5M 1K3WA 2BUVB 1YKNA 2PCDA 3PCJA 3GLHA 1YKOB 1R7RA 3T63A 3MFLA 3LQQA 2KA6B 3MI1A 5GKNA 3SAUA 1EO2B 2BNKA 2BUVA 3FUVA 3VDPA 2G8LA 5FLXS 1YKOA 4DR5M 1FJGM 3TE6A 4JI8M 1G3IA 3PCAM 3HU3A 4LG2A 2QENA 1EO2A 1R2YA 2BUXB 3LQRA 3HHYA 1YKLB 5KPTA 1IY0A 1KSFX 3RGPA 3NBIA 4Z8XA 3AFHA 4CISA 2BUXA 2BOYA 4DV4M 3U60B 1YKLA 4D80A 5EP4A 3KS4A 4GMQA 3T1YM 4LRTA 3GQ3A 1Z5AA 3MV6A 5ITRA 3LXVA 3HHXA 3U60A 2X8AA 1E9RA 4R7GA 5C1BA 4DR3M 1L2DA 1OFHA 2CE7A 1E9SA 4AKHA 2XEPA 4L15A 2FOIC 4M9SA 1TMXA 2LWXA 3PCGM 3KP1E 3T15A 3RFWA 4PT5A 3U61A 4PD2A 3PCLA 1HR0M 2RKOA 3HGIA 1EOAB 2L7HA 3UZUA 2K47A 2C9CA 3CF0A 4QNMA 5DNYA 1G8PA 4GKJM 2Y20A 3PCBA 3J80S 2KRUA 3R8FA 1YKKB 1EOAA 1XXHB 3O32A 2XFSA 1NNJA 3U6OA 1K82A 3PCNA 1G4AE 4OW0A 1W5TA 1IN6A 3H4MA 2FFJA 1TDHA 1PJJA 2ZAMA 2A5YB 4X64M 2D7GA 1N34M 2R45A 3EIHA 3FD9A 4PCZA 1ZQ9A 4GC5A 1PJIA 2VIIA 4IBFA 1EE8A 3PCIA 4WW0A 2D7EA 1JR3D 1NSFA 4OU7A 3PCKM 3TL4X 5A2QS 1DGGA 1TH2A 4LFBM 1NY5A 1NJGA 2Z7JA 4FCTA 1IQPA 1QAQA 1HNXM 2BUZA 4R3DA 2CV0A 4II7A 3SASA 1L2CA 3WHKA 3EIEA 3KSXA 1IY1A 1IBMM 2F5PA 3FTFA 5ITXA 5IWAM 4RNAA 5E6JA 2CV2A 3GLIB 3PNYA 1OFIA 3VFDA 4WHPB 1GKIA 5ITYA 2VQFM 4DV7M 4IJEA 4JI3M 1HQYE 4BBAA 1DMHA 4HL4A 4LJAA 2NQ8C 3RGSA 5KQ8A 4G4RA 3O6RA 1KFVA 2M5ZA 1L8QA 4LF7M 4JI2M 4XGIA 4WHPA 1YE9A 2QZ4A 4WHRF 3HU2A 4DUZM 4L8RC 1L1ZA 2L09A 4WHQB 5LMUM 4DR2M 3FYCA 5FTNA 4B7FA 1Z5CA 3B9PA 4CGYB 2UXCM 4LRSA 4PDIA 1EOCA 1WXQA 3HU1A 3K8ZA 4A3VB 4WHQA 4IBEA 1IXSB 3KOWE 4L78A 3UGJA 4JI6M 1HNWM 5EP1A 2I7PA 1YKMB 3QWLA 1TH3A 3CTWB 3KW6A 1EOBB 3HHZA 3U6MA 2RGOA 4FD2A 5JI3E 3T67M 1OJLA 3JR4A 2F5NA 3GQ4A 3KSJA 2KZSA 1XNQM 1EOBA 1YKMA 2R46A 1PM5A 3UJNA 1YUBA 5FTKA 3HJQA 4NRWA 4ILVA 4NRVA 3LMMA 1X37A 4WHOB 2UXDM 2FE8A 4MGYE 2XSVA 3C58A 4HLQA 3LMXM 7CATA 1IXRC 5C18A 4GHAA 2DZOB 4MM3B 4AKGA 3JAMS 3GO8A 4WHOA 3SC3A 3VLFB 4L16A 3SFZA 4QHTA 3W0LB 3U6LA 2PCDM 3K2LA 2C96A 4LY6A 3T63M 1J7KA 2J7OA 3MFLM 1S9AA 3CF6E 1GLNA 2W82A 2J7NA 4JI5M 3E9SA 4LF6M 1NNUC 3I4VA 4DR4M 2ERCA 1KYIA 4AG6A 4DV2M 2QCUA 4M0WA 1R6BX 3AOGA 3RE8A 2Q2EB 1XC8A 4MH0E 4I8OA 2XSZA 3U6DA 4TUWA 3W0FA 3SBJA 2R4EA 2Y21A 2BUWB 1HT2E 3AOEA 2BUTB 3PCFA 3O6JA 3T38A 3K92A 3FTCA 4NSOB 3MV6M 4OX9M 3LXVM 4YY3M 1IN5A 1QZMA 3TQSA 3U6QA 3TPZA 2L7IA 2C5RA 4LF5M 3R9XB 4AKIA 4CHTB 2BUTA 4ILTA 1QYRA 4JN6A 3FUTA 3OTOM 2XSRA 2R18A 2XFTA 3LKTA 3HWSA 2KW0A 2C99A 4QHSA 3KOZE 3PCCA 3U6EA 2V1CA 2YNMD 3PCLM 3SATA 4BB9A 2CUZA 3KS8A 3K1JA 1DLMA 3N9TA 3CF2A 3GLFB 2LXEA 2KRKA 1Z6TA 3FTDA 5KQDA 2CHVA 4QOSA 3ZCBB 3U6CA 1R2ZA 2BJVA 4M9ZA 3MI5A 1UM8A 3PCGA 2Z3XA 4JI1M 2Y0QA 1SXJB 4I81A 4DUYM 3PCMA 1YSYA 3GLFA 4MGIE 4LJ8A 1YKKA 5EXTA 1XHBA 3PCNM 1XXHA 1Z59A 4LF8M 3DOAA 3PFIA 1FNNA 1L2BA 3HKPA 1NVMA 1SXJA 1DO0A 2QPAA 3PCEM 3FUWA 3NWLA 4DV1M 4GRIA 3GRRA 3A46A 4WURA 4ITQA 4IIWA 2OPFA 4G4OA 1N36M 3PCIM 3VDUA 5EXPA 2YFQA 1I94M 4GH9A 5H37D 2LNHC 3PCHA 2FNAA 5DYIA 2Z4SA 5EXSA 4M0DA 3SMPA 2Z4RA 2ZBKB 4XBOA 5KO3A 4AG5A 3J7AS 1HT1E 3AV0A 5FTLA 1NHGC 3J2PB 2BUYB 3PXGA 3JR5A 2BUMB 3AOEC 2HL7A 1E32A 1N33M 3PCKA 4IBCA 3KDSE 3KXEC 1GL7A 4IBKA 4QNRA 3TWKA 2DWMA 2BURB 1DO2A 3M6AA 1DGFA 2Y0TA 4B7HA 2BUYA 3GLIA 5FSWA 4G4NA 3KVWA 3FKEA 2L6OA 3SHGB 2BURA 2XZFA 1TH4A 2P5TA 3UK6A 5IT9S 2AZQA 3PCDA 1QVRA 4FCWA 3MV4M 2R62A 4LJ5A 2XLJA 3GPXA 4GITA 2CFOA 4G6ZA 4JXJA 3J27B 2F5QA 4LJ4A 1LV7A 3ILKA 3FYDA 4WHRB 4L4UA 4W5WA 1ORYB 3VKHA 2JA2A 5BR8M 4GC9A 4DV3M 4QOZC 1IN7A 3GP1A 4WHRA 2G5GX 1SXJC 3FUUA 4OVZB 4FW9A 3TWMA 4I4LA 3Q8XA 2UUCM 2HKJA 4GIPA 4WHOD 1EO9B 3M7GA 4B3RM 3SYLA 2DVWB 1IN4A 3IG8A 5DYGA 1DGHB 1ZAEA 2YQZA 3AJIB 1GL6A 4IBBA 2KZUA 3GRVA 1EO9A 3T67A 1J09A 1DGHA 4LCBA 4EIWA 3L2AA 3U6SA 1VDDA 3HJ8A 3PCJM 2CV1A 3VKGA 4KODA 3U6PA 2EUCA 1NHWC 4DR1M 4LJ6A 2XGNA 3MI1M 2BJWA 4S12A 4LF9M 3SAVA 4LJ7A 4JYAM 1H6UA 4MGKE 3U5ZB 2XSZD 5ITXE 1TGUA 3GLGB 4LGMA 2QP9X 4KHPM 2HHHM 4WHSB 2AHMA 3GRYA 2DWLA 2E5LM 2DXIA 2XSUA 2D7HA 3THGA 3MK6A 4MGHA 2H1RA 4IJFA 1MX0A 3UMMA 3GLGA 2CHQA 3U5ZA 4JV5M 3E4RA 1IN8A 4JI0M 4WHSA 3J7BA 1N77A 1Q3CA 3PCAA 4JI7M 1XMOM 1QAMA 2V6ZM 1NY6A 1NJFA 4LZJA 2CEAA 1S3SA 2F5OA 3SYKA 4NXNM 3PVSA 2CHGA 4B08A 4IBDA 3GQ5A 1K3XA 5E26A 4DV6M 3PCFM 3KOYE 3D8LA 2BUWA 2C98A 4AQYM 2UXBM 2RGHA 3MHVC 1QANA 3A45A 4FVMA 4X66M 4Z6YA 2DWNA 4IBGA 4B3TM 2I7NA 1HQCA 4FWGA 3LKTM 5JI2E 1QAOA 2C9OA 3KOXE 1JQJC 3KP0E 3PCCM 3FUXA 1SXJD 3SMSA 1TDZA 2V1UA 4G4QA 4LF4M 4NXMM 4GHLA 3DA1A 4MGZE 3PCBM 3U61B 1DGBA 5IZ7D 2ZM6M 2BUQB 1I4WA 3MI5M 5KPRA 1E94E 3D8BA 3IG5A 3GPUA 4IBJA 3M0EA 3PCMM 3L25A 2O5RA 2M60A 1DLQA 3AL0C 2BUQA 2BV0B 4D81A 3DZDA 2KEBA 5EJCA 5EXXA 4P16A 3SHFA 2KXEA 3GPYA 1XMQM 4NSRA 1N78A 4D82A 1HNZM 2BV0A 3GPPA 2DZNB 2ZAOA 3L29A 1W5SA 4LZZA 2HCBA 3DFZA 5ITQA 8CATA 3PCHM 5IREB 3PCEA 3A98B 4LFAM 3LVWA 4NOOB 3A42A 1Q39A 4NL4H 5F3WA 4WHPD 1C1KA 4X65M 3SAWA 5FTMA 2UUBM 2BUZB 5TD3A 5FTJA 1J5EM 2R4JA 5LMNM 2BUMA 4M9XA 3L28A 4JI4M 4FWHA 3AKZA 2ZANA 4AZFA 4DV0M 1IBLM 1N75A 4RF1A 2VQEM 3L27A 3FTEA 1JR3A 1IM2A 3QAUA 5BPVA 3J81S 3LVVA 5EP3A 4GKKM 5EQTA 4FCVA 3PCDM 4B3MM 5KPZA 4B3SM 2XZUA 4RF0A 2XF3A 4I5SA 2OQ4A 2F5SA 3MJ5A 4IBIA 3VK7A 1MU5A 4KLNA 1D2NA 1GVNA 1IY2A 1XWIA 4AW4A 4MB7A 3MV4A 1T3TA 1EOCB 4FWDA 4BLCA 5EP2A 1Z5BA 4REZA 5ITUA 1DLTA 4LGYA 1IBKM 3SARA 1N32M 4LFCM 4OVZA 2BUUB 2EO2A 3L26A 2UU9M 2YR0A 3KFUG 3HHWA 1L1TA 4YHHM 1IXZA 1SXJE 1G41A 2XH9A 2BUUA 1QQWA 3I4YA 4DR7M 2DHRA 2R65A 4ZPXA 4B7GA 4DR6M 4AI6A 2EA0A 2UUAM 3I51A 3WHLA 2QBYB 4K0KM 1XNRM 3GRUA 4LJ9A 3BOSA 3T1HM 4KO8A 2X4AA 3ZC7B 2DWZB 3ZH9B 3TH1A 1YKPB 2QBYA 4X62M 1Q3BA 3HJSA 3LMXA 1YKNB 2X49A 5ITTA 3GLHB 3O5UA 3VK8A 4WHSD 4PDGA 2LH0A 3TWLA 3PNVA 1YKPA 1G59A 2F4VM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUV B;  1YKN A;  2PCD A;  3LKT M;  3PCJ A;  4WHQ A;  1YKO B;  3T63 A;  3PCC M;  3MFL A;  3MI1 A;  1YKM B;  2BUY B;  3PCB M;  1EOB B;  1EO2 B;  2BUM B;  2BUV A;  2BUQ B;  3MI5 M;  1YKO A;  3PCK A;  2BUR B;  3T67 M;  3PCA M;  3PCM M;  1YKM A;  2BUY A;  1DLQ A;  1EOB A;  1EO2 A;  2BUQ A;  2BV0 B;  2BUX B;  3HHY A;  3HJQ A;  2BUR A;  1YKL B;  4ILV A;  2AZQ A;  3PCD A;  4WHO B;  2BV0 A;  2BUX A;  2BOY A;  3MV4 M;  2XSV A;  3LMX M;  1YKL A;  4WHO A;  3PCH M;  3MV6 A;  4WHR B;  3LXV A;  3PCE A;  3HHX A;  2PCD M;  3T63 M;  4WHP D;  3MFL M;  1S9A A;  1TMX A;  3PCG M;  4WHR A;  2BUZ B;  5TD3 A;  2BUM A;  3PCL A;  3HGI A;  1EOA B;  3I4V A;  4WHO D;  1EO9 B;  3PCB A;  1YKK B;  1EOA A;  3O32 A;  1EO9 A;  3PCD M;  3PCN A;  3T67 A;  2BUW B;  2BUT B;  3PCF A;  3O6J A;  3HJ8 A;  3PCJ M;  3MV6 M;  3LXV M;  3PCI A;  3MI1 M;  4ILT A;  2BUT A;  3MV4 A;  1EOC B;  3PCK M;  2XSR A;  3LKT A;  1DLT A;  4WHS B;  3PCC A;  2BUZ A;  2BUU B;  2XSU A;  3PCL M;  1DLM A;  3N9T A;  3MI5 A;  4WHS A;  3PCG A;  2BUU A;  3I4Y A;  3PCA A;  3PCM A;  3I51 A;  1YKK A;  4WHP B;  3PCN M;  3HKP A;  1DMH A;  3O6R A;  3PCE M;  3PCF M;  3TH1 A;  2BUW A;  1YKP B;  4WHP A;  4WHR F;  3HJS A;  3LMX A;  1YKN B;  3PCI M;  3O5U A;  4WHQ B;  4WHS D;  3PCH A;  1YKP A;  1EOC A; 
#chains in the Genus database with same CATH topology
 3QYE A;  4DV5 M;  1K3W A;  3B89 A;  1YKN A;  2BUV B;  2PCD A;  3PCJ A;  3GLH A;  1YKO B;  1R7R A;  3T63 A;  3MFL A;  2LVN C;  3LQQ A;  2KA6 B;  3MI1 A;  5GKN A;  3SAU A;  1EO2 B;  2BNK A;  2MGW A;  2BUV A;  3FUV A;  2FS1 A;  2CWB A;  3VDP A;  2G8L A;  5FLX S;  1YKO A;  4DR5 M;  1JR3 E;  2QHO B;  1FJG M;  3TE6 A;  4JI8 M;  1G3I A;  3PCA M;  3HU3 A;  4LG2 A;  2QEN A;  1EO2 A;  2LVO C;  2R0I A;  2LHC A;  1R2Y A;  4CIZ A;  2BUX B;  3LQR A;  3HHY A;  1YKL B;  5KPT A;  1IY0 A;  1KSF X;  3RGP A;  3NBI A;  2JP7 A;  3AFH A;  4Z8X A;  2VDB B;  4CIS A;  2BOY A;  2BUX A;  1V92 A;  4DV4 M;  4Y28 F;  3U60 B;  2DEN A;  1YKL A;  1OIZ A;  5EP4 A;  2J5Y A;  3KS4 A;  4GMQ A;  4D80 A;  3T1Y M;  4LRT A;  1OIP A;  2KNZ A;  3GQ3 A;  1Z5A A;  3MV6 A;  5ITR A;  3LXV A;  2R44 A;  3HHX A;  2LBC A;  3U60 A;  1AIP C;  2X8A A;  1E9R A;  4R7G A;  1WGL A;  5C1B A;  4DR3 M;  1OFH A;  2CE7 A;  1E9S A;  1OQY A;  2XEP A;  1L2D A;  4L15 A;  3FE3 A;  4AKH A;  2FOI C;  2BUU A;  4M9S A;  1TMX A;  2LWX A;  3PCG M;  3KP1 E;  3T15 A;  3RFW A;  2APL A;  4KT0 F;  4PT5 A;  3U61 A;  4PD2 A;  3PCL A;  1HR0 M;  2RKO A;  1CUK A;  1LTM A;  3HGI A;  1EOA B;  2L7H A;  1JB0 F;  3BBZ A;  5DYG A;  3UZU A;  2K47 A;  2C9C A;  3CF0 A;  4QNM A;  2DNA A;  1G8P A;  5DNY A;  4GKJ M;  2FH0 A;  2Y20 A;  3PCB A;  3J80 S;  2KRU A;  3R8F A;  1YKK B;  3V76 A;  1EOA A;  1XXH B;  3O32 A;  2DAG A;  2XFS A;  3U6O A;  1NNJ A;  1K82 A;  1G4A E;  4OW0 A;  1W5T A;  1IN6 A;  3PCN A;  3H4M A;  2FFJ A;  1TDH A;  4DBG B;  1PJJ A;  2ZAM A;  2A5Y B;  2VF7 A;  2D7G A;  2KNA A;  4X64 M;  1N34 M;  2R45 A;  3EIH A;  3FD9 A;  1RU3 A;  1ZQ9 A;  4GC5 A;  4PCZ A;  2VII A;  1PJI A;  4IBF A;  1EE8 A;  3PCI A;  4WW0 A;  2MJ5 B;  2D7E A;  1JR3 D;  1NSF A;  3GLH E;  4OU7 A;  3GLG E;  3PCK M;  3TL4 X;  5A2Q S;  1DGG A;  1P3Q Q;  1TH2 A;  3K9P A;  4LFB M;  3HX3 A;  1NY5 A;  1NJG A;  2JWS A;  2Z7J A;  1IQP A;  1QAQ A;  4FCT A;  1HNX M;  4R3D A;  2CV0 A;  4II7 A;  2BWE A;  3SAS A;  2BUZ A;  1L2C A;  3WHK A;  3EIE A;  2DI0 A;  3KSX A;  1IY1 A;  1IBM M;  2F5P A;  1TTE A;  5ITX A;  1R5L A;  5IWA M;  3FTF A;  4RNA A;  3O6R A;  5E6J A;  2CV2 A;  3GLI B;  3PNY A;  1NV8 A;  1OFI A;  3VFD A;  4WHP B;  1GKI A;  3Q8G A;  5ITY A;  2VQF M;  4DV7 M;  4IJE A;  4JI3 M;  4NC6 A;  1HQY E;  4BBA A;  1DMH A;  4HL4 A;  2QNJ A;  1WIV A;  2NQ8 C;  4LJA A;  3RGS A;  5KQ8 A;  4G4R A;  1KFV A;  2M5Z A;  1L8Q A;  3NBX X;  4LF7 M;  4JI2 M;  4XGI A;  4WHP A;  1YE9 A;  2QZ4 A;  3IEC A;  3LW5 F;  3HU2 A;  4WHR F;  4DUZ M;  4L8R C;  2O25 A;  1L1Z A;  2L09 A;  4WHQ B;  5LMU M;  4DR2 M;  2DKL A;  3FYC A;  4G3O A;  5FTN A;  4B7F A;  1Z5C A;  3B9P A;  4CGY B;  2UXC M;  4LRS A;  4PDI A;  1EOC A;  1WXQ A;  3HU1 A;  1WGN A;  3K8Z A;  3HZJ A;  4A3V B;  4WHQ A;  4IBE A;  1IXS B;  3KOW E;  4L78 A;  3UGJ A;  4JI6 M;  1HNW M;  2QQ8 A;  5EP1 A;  2EKK A;  2I7P A;  1YKM B;  3QWL A;  1TH3 A;  3BXW A;  3CTW B;  1HJP A;  3KW6 A;  3HHZ A;  1VEJ A;  2RGO A;  3U6M A;  1EOB B;  1OKS A;  4FD2 A;  3ZQJ A;  1IXS A;  5JI3 E;  2DAK A;  3T67 M;  1OJL A;  3JR4 A;  2F5N A;  3GQ4 A;  3KSJ A;  2KZS A;  2VF8 A;  1XNQ M;  1EOB A;  2R46 A;  1PM5 A;  1YKM A;  3UJN A;  3MI5 A;  1YUB A;  2Z8Y M;  5FTK A;  3HJQ A;  4NRW A;  4ILV A;  4NRV A;  3LMM A;  1X37 A;  1TR8 A;  4WHO B;  2UXD M;  2FE8 A;  4MGY E;  2XSV A;  3C58 A;  4HLQ A;  3LMX M;  7CAT A;  1IXR C;  2DZL A;  5C18 A;  4GHA A;  2DZO B;  4MM3 B;  4AKG A;  3JAM S;  3GO8 A;  4WHO A;  2JY6 B;  2WSC F;  3SC3 A;  3VLF B;  4L16 A;  1VG5 A;  2JXN A;  3SFZ A;  4QHT A;  2LTU A;  3W0L B;  3W67 A;  3U6L A;  2RRU A;  3K2L A;  2PCD M;  2C96 A;  4LY6 A;  3T63 M;  1J7K A;  2WSE F;  2J7O A;  2L4F A;  3MFL M;  1S9A A;  1GJT A;  3CF6 E;  5DFL A;  1GLN A;  2W82 A;  2J7N A;  4JI5 M;  3E9S A;  4P17 A;  1QZE A;  4LF6 M;  1NNU C;  3I4V A;  1QUT A;  4DR4 M;  2ERC A;  1KYI A;  4AG6 A;  4DV2 M;  2QCU A;  4M0W A;  1R6B X;  1VEK A;  3AOG A;  2Q2E B;  2GQF A;  3RE8 A;  1XC8 A;  4MH0 E;  4I8O A;  2DAE A;  2G3Q A;  2XSZ A;  3U6D A;  4TUW A;  3W0F A;  3SBJ A;  1R4G A;  2R4E A;  2Y21 A;  3LCU A;  2BUW B;  1HT2 E;  3AOE A;  4F1I A;  2BUT B;  3PCF A;  3O6J A;  3T38 A;  3K92 A;  3FTC A;  4NSO B;  1YLA A;  3MV6 M;  4OX9 M;  3LXV M;  4YY3 M;  1IN5 A;  1QZM A;  3TQS A;  3U6Q A;  3TPZ A;  2L7I A;  1GAB A;  2C5R A;  4LF5 M;  3R9X B;  2EJS A;  4CHT B;  4AKI A;  2BUT A;  4ILT A;  1D0K A;  1QYR A;  4JN6 A;  3FUT A;  3OTO M;  2LVQ D;  2XSR A;  2R18 A;  2XFT A;  3I01 M;  3LKT A;  3HWS A;  1TF0 B;  2C99 A;  2KW0 A;  4QHS A;  3KOZ E;  3PCC A;  3U6E A;  2V1C A;  2O01 F;  2YNM D;  3PCL M;  1BVS A;  3SAT A;  4BB9 A;  2CUZ A;  3KS8 A;  3K1J A;  1DLM A;  3N9T A;  3CF2 A;  3GLF B;  2LXE A;  2KRK A;  1Z6T A;  3C3D A;  3FTD A;  2CHV A;  4QOS A;  3T6P A;  3ZCB B;  5KQD A;  2BJV A;  4M9Z A;  3U6C A;  4XK8 F;  1UM8 A;  1R2Z A;  3PCG A;  2Z3X A;  4JI1 M;  2Y0Q A;  1SXJ B;  4I81 A;  4DUY M;  3PCM A;  1YSY A;  3GLF A;  4MGI E;  1A5T A;  4LJ8 A;  1YKK A;  5EXT A;  1XHB A;  3PCN M;  1XXH A;  1Z59 A;  4LF8 M;  3DOA A;  3PFI A;  1FNN A;  1VQ1 A;  3HKP A;  1L2B A;  1NVM A;  1SXJ A;  1DO0 A;  2QPA A;  3PCE M;  2OOB A;  3FUW A;  3NWL A;  4DV1 M;  4GRI A;  3GRR A;  3A46 A;  4WUR A;  4ITQ A;  4IIW A;  2OPF A;  2KNV A;  4G4O A;  1N36 M;  3PCI M;  3VDU A;  5EXP A;  2YFQ A;  4F2L A;  1I94 M;  4GH9 A;  5H37 D;  2LNH C;  3PCH A;  2CP8 A;  2FNA A;  3B7N A;  5DYI A;  2Z4S A;  1GJS A;  5EXS A;  4M0D A;  3SMP A;  2Z4R A;  3H4J A;  2KHH A;  3IHP A;  2ZBK B;  4XBO A;  5KO3 A;  4AG5 A;  3J7A S;  1HT1 E;  3AV0 A;  1OTR A;  1NHG C;  5FTL A;  3J2P B;  2BUY B;  3PXG A;  3JR5 A;  2BUM B;  3AOE C;  1UFZ A;  2HL7 A;  1E32 A;  1N33 M;  3PCK A;  4IBC A;  3KDS E;  3KXE C;  1GL7 A;  2ZTD A;  4IBK A;  4QNR A;  3TWK A;  2DWM A;  2BUR B;  2JZ0 A;  1DO2 A;  3M6A A;  1DGF A;  2Y0T A;  4B7H A;  2BUY A;  3GLI A;  5FSW A;  4G4N A;  3KVW A;  3FKE A;  1OAI A;  2L6O A;  2R6F A;  3SHG B;  2BUR A;  2XZF A;  1TH4 A;  2P5T A;  3UK6 A;  5IT9 S;  2DHY A;  1PRB A;  2AZQ A;  3PCD A;  2K0B X;  1QVR A;  4FCW A;  3MV4 M;  2R62 A;  4LJ5 A;  2XLJ A;  3GPX A;  1F4I A;  2L2D A;  4GIT A;  2CFO A;  4G6Z A;  4JXJ A;  3J27 B;  2F5Q A;  4LJ4 A;  1LV7 A;  1OAO C;  3ILK A;  3FYD A;  4WHR B;  4L4U A;  4W5W A;  1ORY B;  1V33 A;  2EKF A;  3VKH A;  2JA2 A;  5BR8 M;  4GC9 A;  4DV3 M;  4QOZ C;  1IN7 A;  2WZJ A;  3GP1 A;  1NO1 A;  4WHR A;  2G5G X;  1PGY A;  1SXJ C;  1VEG A;  3FUU A;  4OVZ B;  2HAK A;  4FW9 A;  3TWM A;  4I4L A;  3Q8X A;  2UUC M;  2HKJ A;  4GIP A;  2LVA A;  3GLF E;  4WHO D;  1EO9 B;  3M7G A;  4B3R M;  3SYL A;  2DVW B;  1IN4 A;  3IG8 A;  4UN2 B;  1DGH B;  2BWB A;  1ZAE A;  1XXH E;  1WJ7 A;  2YQZ A;  1GL6 A;  3AJI B;  3E46 A;  2HWJ A;  1GO5 A;  4IBB A;  2KZU A;  1T43 A;  3GRV A;  1EO9 A;  3T67 A;  1J09 A;  1DGH A;  4LCB A;  3LCV B;  4EIW A;  1IFY A;  1WHC A;  3L2A A;  3U6S A;  1VDD A;  2OOA A;  3HJ8 A;  3PCJ M;  2CV1 A;  3VKG A;  4KOD A;  3U6P A;  2EUC A;  1NHW C;  4DR1 M;  4LJ6 A;  2XGN A;  3MI1 M;  2BJW A;  4S12 A;  4LF9 M;  3SAV A;  4LJ7 A;  4JYA M;  1H6U A;  4MGK E;  3U5Z B;  2XSZ D;  4GEW A;  5ITX E;  1TGU A;  2JUJ A;  3GLG B;  4LGM A;  2QP9 X;  4KHP M;  2HHH M;  4HEO A;  4WHS B;  2AHM A;  3GRY A;  2DWL A;  2E5L M;  2DXI A;  2XSU A;  2D7H A;  2LHG A;  3THG A;  2JNH A;  3MK6 A;  4MGH A;  2H1R A;  4IJF A;  1MX0 A;  3UMM A;  3GLG A;  2CHQ A;  3U5Z A;  4JV5 M;  1D0M A;  3GLI E;  3E4R A;  1IN8 A;  4JI0 M;  4WHS A;  2ZTC A;  3J7B A;  2H5X A;  1N77 A;  1Q3C A;  3PCA A;  1Y8G A;  1XMO M;  4JI7 M;  1QAM A;  2V6Z M;  1Q02 A;  1NY6 A;  2JY7 A;  1NJF A;  4LZJ A;  2CEA A;  1S3S A;  2WSF F;  3SYK A;  2F5O A;  4NXN M;  3PVS A;  2CHG A;  4B08 A;  4IBD A;  3GQ5 A;  1K3X A;  5E26 A;  4DV6 M;  2B3T A;  1EIJ A;  3PCF M;  3KOY E;  3D8L A;  2BUW A;  2C98 A;  4AQY M;  1WR1 B;  2OO9 A;  2UXB M;  2CRU A;  2LVP C;  2RGH A;  3MHV C;  1QAN A;  3A45 A;  4FVM A;  4X66 M;  4Z6Y A;  2DWN A;  4IBG A;  4B3T M;  2N35 A;  1T6O A;  2I7N A;  1XB2 B;  2JZ1 A;  1HQC A;  4FWG A;  3W68 A;  3LKT M;  5JI2 E;  3E21 A;  1QAO A;  3MMP A;  2QSF X;  2C9O A;  3KOX E;  1JQJ C;  3KP0 E;  3PCC M;  3FUX A;  1SXJ D;  2K6B A;  3SMS A;  1TDZ A;  4G4Q A;  3QYB A;  2V1U A;  4LF4 M;  4NXM M;  4GHL A;  3DA1 A;  4MGZ E;  3PCB M;  1MN3 A;  3U61 B;  1DGB A;  5IZ7 D;  2ZM6 M;  2BUQ B;  1I4W A;  3MI5 M;  5KPR A;  1E94 E;  3D8B A;  3IG5 A;  3GPU A;  1C7Y A;  4IBJ A;  3M0E A;  3PCM M;  3L25 A;  2O5R A;  2M60 A;  1DLQ A;  3AL0 C;  2BUQ A;  2BV0 B;  4D81 A;  3DZD A;  2KEB A;  2KDL A;  3HY5 A;  5EJC A;  5EXX A;  4P16 A;  3SHF A;  2DAI A;  2KXE A;  3GPY A;  2MRO B;  1XMQ M;  4NSR A;  1N78 A;  4D82 A;  1HNZ M;  2BV0 A;  3GPP A;  3B74 A;  2DZN B;  2ZAO A;  3L29 A;  1W5S A;  4LZZ A;  2HCB A;  3B7Q A;  3I04 M;  3DFZ A;  5ITQ A;  1AUA A;  8CAT A;  3FRH A;  3PCH M;  5IRE B;  3PCE A;  3A98 B;  4LFA M;  3LVW A;  4NOO B;  3A42 A;  1Q39 A;  4NL4 H;  5F3W A;  4WHP D;  5L8R F;  1C1K A;  4X65 M;  1ZMU A;  5FTM A;  3SAW A;  3FRI A;  2MH8 A;  2UUB M;  4RKU F;  1NV9 A;  2BUZ B;  5TD3 A;  3C3E A;  5FTJ A;  1J5E M;  2R4J A;  3K9O A;  5LMN M;  2BUM A;  4M9X A;  3L28 A;  1G71 A;  4JI4 M;  4FWH A;  3AKZ A;  2ZAN A;  4AZF A;  4DV0 M;  2JY8 A;  1IBL M;  2K9D A;  1N75 A;  1ZMV A;  4RF1 A;  3L27 A;  2VQE M;  3FTE A;  1JR3 A;  1IM2 A;  3QAU A;  1PJT A;  5BPV A;  3J81 S;  3LVV A;  5EP3 A;  4GKK M;  5EQT A;  4R71 A;  4FCV A;  3PCD M;  4B3M M;  2MR9 A;  5KPZ A;  4B3S M;  2XZU A;  4RF0 A;  2XF3 A;  4I5S A;  2OQ4 A;  2F5S A;  4Q7J A;  3MJ5 A;  4IBI A;  3VK7 A;  4CJ6 A;  1V34 A;  4ANR A;  1MU5 A;  4KLN A;  1D2N A;  1GVN A;  1IY2 A;  1XWI A;  2GNO A;  1QDR A;  4AW4 A;  4MB7 A;  3MV4 A;  1T3T A;  1EOC B;  1SG9 A;  4FWD A;  4BLC A;  5EP2 A;  1Z5B A;  1ZV1 A;  2DAM A;  2L4E A;  4REZ A;  5ITU A;  1DV0 A;  1DLT A;  4LGY A;  1IBK M;  3SAR A;  1PJQ A;  1N32 M;  4LFC M;  4OVZ A;  2BUU B;  2EO2 A;  3L26 A;  2UU9 M;  3CGW A;  1MJG M;  2YR0 A;  3KFU G;  3HHW A;  1L1T A;  4YHH M;  1IXZ A;  1D0L A;  1EFU B;  1QDT A;  1SXJ E;  1G41 A;  2XH9 A;  1QUS A;  1QQW A;  3I4Y A;  4DR7 M;  2DHR A;  2R65 A;  4ZPX A;  4B7G A;  4DR6 M;  4AI6 A;  1VDL A;  1ZMW A;  2EA0 A;  2UUA M;  3I51 A;  3WHL A;  2QBY B;  4K0K M;  1XNR M;  3GRU A;  1PJS A;  4LJ9 A;  3BOS A;  4WP2 A;  3T1H M;  4KO8 A;  2X4A A;  3ZC7 B;  2DWZ B;  3ZH9 B;  3C9P A;  3TH1 A;  1YKP B;  2QBY A;  4X62 M;  1Q3B A;  2JY5 A;  3HJS A;  3LMX A;  4L6V 6;  2X49 A;  1YKN B;  5ITT A;  3GLH B;  3O5U A;  3VK8 A;  4WHS D;  3B7Z A;  4PDG A;  2LH0 A;  3F92 A;  3PNV A;  3TWL A;  1YKP A;  1G59 A;  2F4V M; 
#chains in the Genus database with same CATH homology
 4DV5 M;  1K3W A;  2BUV B;  1YKN A;  2PCD A;  3PCJ A;  3GLH A;  1YKO B;  1R7R A;  3T63 A;  3MFL A;  3LQQ A;  2KA6 B;  3MI1 A;  5GKN A;  3SAU A;  1EO2 B;  2BNK A;  2BUV A;  3FUV A;  3VDP A;  2G8L A;  5FLX S;  1YKO A;  4DR5 M;  1FJG M;  3TE6 A;  4JI8 M;  1G3I A;  3PCA M;  3HU3 A;  4LG2 A;  2QEN A;  1EO2 A;  1R2Y A;  2BUX B;  3LQR A;  3HHY A;  1YKL B;  5KPT A;  1IY0 A;  1KSF X;  3RGP A;  3NBI A;  4Z8X A;  3AFH A;  4CIS A;  2BUX A;  2BOY A;  4DV4 M;  3U60 B;  1YKL A;  4D80 A;  5EP4 A;  3KS4 A;  4GMQ A;  3T1Y M;  4LRT A;  3GQ3 A;  1Z5A A;  3MV6 A;  5ITR A;  3LXV A;  3HHX A;  3U60 A;  2X8A A;  1E9R A;  4R7G A;  5C1B A;  4DR3 M;  1L2D A;  1OFH A;  2CE7 A;  1E9S A;  4AKH A;  2XEP A;  4L15 A;  2FOI C;  4M9S A;  1TMX A;  2LWX A;  3PCG M;  3KP1 E;  3T15 A;  3RFW A;  4PT5 A;  3U61 A;  4PD2 A;  3PCL A;  1HR0 M;  2RKO A;  3HGI A;  1EOA B;  2L7H A;  3UZU A;  2K47 A;  2C9C A;  3CF0 A;  4QNM A;  5DNY A;  1G8P A;  4GKJ M;  2Y20 A;  3PCB A;  3J80 S;  2KRU A;  3R8F A;  1YKK B;  1EOA A;  1XXH B;  3O32 A;  2XFS A;  1NNJ A;  3U6O A;  1K82 A;  3PCN A;  1G4A E;  4OW0 A;  1W5T A;  1IN6 A;  3H4M A;  2FFJ A;  1TDH A;  1PJJ A;  2ZAM A;  2A5Y B;  4X64 M;  2D7G A;  1N34 M;  2R45 A;  3EIH A;  3FD9 A;  4PCZ A;  1ZQ9 A;  4GC5 A;  1PJI A;  2VII A;  4IBF A;  1EE8 A;  3PCI A;  4WW0 A;  2D7E A;  1JR3 D;  1NSF A;  4OU7 A;  3PCK M;  3TL4 X;  5A2Q S;  1DGG A;  1TH2 A;  4LFB M;  1NY5 A;  1NJG A;  2Z7J A;  4FCT A;  1IQP A;  1QAQ A;  1HNX M;  2BUZ A;  4R3D A;  2CV0 A;  4II7 A;  3SAS A;  1L2C A;  3WHK A;  3EIE A;  3KSX A;  1IY1 A;  1IBM M;  2F5P A;  3FTF A;  5ITX A;  5IWA M;  4RNA A;  5E6J A;  2CV2 A;  3GLI B;  3PNY A;  1OFI A;  3VFD A;  4WHP B;  1GKI A;  5ITY A;  2VQF M;  4DV7 M;  4IJE A;  4JI3 M;  1HQY E;  4BBA A;  1DMH A;  4HL4 A;  4LJA A;  2NQ8 C;  3RGS A;  5KQ8 A;  4G4R A;  3O6R A;  1KFV A;  2M5Z A;  1L8Q A;  4LF7 M;  4JI2 M;  4XGI A;  4WHP A;  1YE9 A;  2QZ4 A;  4WHR F;  3HU2 A;  4DUZ M;  4L8R C;  1L1Z A;  2L09 A;  4WHQ B;  5LMU M;  4DR2 M;  3FYC A;  5FTN A;  4B7F A;  1Z5C A;  3B9P A;  4CGY B;  2UXC M;  4LRS A;  4PDI A;  1EOC A;  1WXQ A;  3HU1 A;  3K8Z A;  4A3V B;  4WHQ A;  4IBE A;  1IXS B;  3KOW E;  4L78 A;  3UGJ A;  4JI6 M;  1HNW M;  5EP1 A;  2I7P A;  1YKM B;  3QWL A;  1TH3 A;  3CTW B;  3KW6 A;  1EOB B;  3HHZ A;  3U6M A;  2RGO A;  4FD2 A;  5JI3 E;  3T67 M;  1OJL A;  3JR4 A;  2F5N A;  3GQ4 A;  3KSJ A;  2KZS A;  1XNQ M;  1EOB A;  1YKM A;  2R46 A;  1PM5 A;  3UJN A;  1YUB A;  5FTK A;  3HJQ A;  4NRW A;  4ILV A;  4NRV A;  3LMM A;  1X37 A;  4WHO B;  2UXD M;  2FE8 A;  4MGY E;  2XSV A;  3C58 A;  4HLQ A;  3LMX M;  7CAT A;  1IXR C;  5C18 A;  4GHA A;  2DZO B;  4MM3 B;  4AKG A;  3JAM S;  3GO8 A;  4WHO A;  3SC3 A;  3VLF B;  4L16 A;  3SFZ A;  4QHT A;  3W0L B;  3U6L A;  2PCD M;  3K2L A;  2C96 A;  4LY6 A;  3T63 M;  1J7K A;  2J7O A;  3MFL M;  1S9A A;  3CF6 E;  1GLN A;  2W82 A;  2J7N A;  4JI5 M;  3E9S A;  4LF6 M;  1NNU C;  3I4V A;  4DR4 M;  2ERC A;  1KYI A;  4AG6 A;  4DV2 M;  2QCU A;  4M0W A;  1R6B X;  3AOG A;  3RE8 A;  2Q2E B;  1XC8 A;  4MH0 E;  4I8O A;  2XSZ A;  3U6D A;  4TUW A;  3W0F A;  3SBJ A;  2R4E A;  2Y21 A;  2BUW B;  1HT2 E;  3AOE A;  2BUT B;  3PCF A;  3O6J A;  3T38 A;  3K92 A;  3FTC A;  4NSO B;  3MV6 M;  4OX9 M;  3LXV M;  4YY3 M;  1IN5 A;  1QZM A;  3TQS A;  3U6Q A;  3TPZ A;  2L7I A;  2C5R A;  4LF5 M;  3R9X B;  4AKI A;  4CHT B;  2BUT A;  4ILT A;  1QYR A;  4JN6 A;  3FUT A;  3OTO M;  2XSR A;  2R18 A;  2XFT A;  3LKT A;  3HWS A;  2KW0 A;  2C99 A;  4QHS A;  3KOZ E;  3PCC A;  3U6E A;  2V1C A;  2YNM D;  3PCL M;  3SAT A;  4BB9 A;  2CUZ A;  3KS8 A;  3K1J A;  1DLM A;  3N9T A;  3CF2 A;  3GLF B;  2LXE A;  2KRK A;  1Z6T A;  3FTD A;  5KQD A;  2CHV A;  4QOS A;  3ZCB B;  3U6C A;  1R2Z A;  2BJV A;  4M9Z A;  3MI5 A;  1UM8 A;  3PCG A;  2Z3X A;  4JI1 M;  2Y0Q A;  1SXJ B;  4I81 A;  4DUY M;  3PCM A;  1YSY A;  3GLF A;  4MGI E;  4LJ8 A;  1YKK A;  5EXT A;  1XHB A;  3PCN M;  1XXH A;  1Z59 A;  4LF8 M;  3DOA A;  3PFI A;  1FNN A;  1L2B A;  3HKP A;  1NVM A;  1SXJ A;  1DO0 A;  2QPA A;  3PCE M;  3FUW A;  3NWL A;  4DV1 M;  4GRI A;  3GRR A;  3A46 A;  4WUR A;  4ITQ A;  4IIW A;  2OPF A;  4G4O A;  1N36 M;  3PCI M;  3VDU A;  5EXP A;  2YFQ A;  1I94 M;  4GH9 A;  5H37 D;  2LNH C;  3PCH A;  2FNA A;  5DYI A;  2Z4S A;  5EXS A;  4M0D A;  3SMP A;  2Z4R A;  2ZBK B;  4XBO A;  5KO3 A;  4AG5 A;  3J7A S;  1HT1 E;  3AV0 A;  5FTL A;  1NHG C;  3J2P B;  2BUY B;  3PXG A;  3JR5 A;  2BUM B;  3AOE C;  2HL7 A;  1E32 A;  1N33 M;  3PCK A;  4IBC A;  3KDS E;  3KXE C;  1GL7 A;  4IBK A;  4QNR A;  3TWK A;  2DWM A;  2BUR B;  1DO2 A;  3M6A A;  1DGF A;  2Y0T A;  4B7H A;  2BUY A;  3GLI A;  5FSW A;  4G4N A;  3KVW A;  3FKE A;  2L6O A;  3SHG B;  2BUR A;  2XZF A;  1TH4 A;  2P5T A;  3UK6 A;  5IT9 S;  2AZQ A;  3PCD A;  1QVR A;  4FCW A;  3MV4 M;  2R62 A;  4LJ5 A;  2XLJ A;  3GPX A;  4GIT A;  2CFO A;  4G6Z A;  4JXJ A;  3J27 B;  2F5Q A;  4LJ4 A;  1LV7 A;  3ILK A;  3FYD A;  4WHR B;  4L4U A;  4W5W A;  1ORY B;  3VKH A;  2JA2 A;  5BR8 M;  4GC9 A;  4DV3 M;  4QOZ C;  1IN7 A;  3GP1 A;  4WHR A;  2G5G X;  1SXJ C;  3FUU A;  4OVZ B;  4FW9 A;  3TWM A;  4I4L A;  3Q8X A;  2UUC M;  2HKJ A;  4GIP A;  4WHO D;  1EO9 B;  3M7G A;  4B3R M;  3SYL A;  2DVW B;  1IN4 A;  3IG8 A;  5DYG A;  1DGH B;  1ZAE A;  2YQZ A;  3AJI B;  1GL6 A;  4IBB A;  2KZU A;  3GRV A;  1EO9 A;  3T67 A;  1J09 A;  1DGH A;  4LCB A;  4EIW A;  3L2A A;  3U6S A;  1VDD A;  3HJ8 A;  3PCJ M;  2CV1 A;  3VKG A;  4KOD A;  3U6P A;  2EUC A;  1NHW C;  4DR1 M;  4LJ6 A;  2XGN A;  3MI1 M;  2BJW A;  4S12 A;  4LF9 M;  3SAV A;  4LJ7 A;  4JYA M;  1H6U A;  4MGK E;  3U5Z B;  2XSZ D;  5ITX E;  1TGU A;  3GLG B;  4LGM A;  2QP9 X;  4KHP M;  2HHH M;  4WHS B;  2AHM A;  3GRY A;  2DWL A;  2E5L M;  2DXI A;  2XSU A;  2D7H A;  3THG A;  3MK6 A;  4MGH A;  2H1R A;  4IJF A;  1MX0 A;  3UMM A;  3GLG A;  2CHQ A;  3U5Z A;  4JV5 M;  3E4R A;  1IN8 A;  4JI0 M;  4WHS A;  3J7B A;  1N77 A;  1Q3C A;  3PCA A;  4JI7 M;  1XMO M;  1QAM A;  2V6Z M;  1NY6 A;  1NJF A;  4LZJ A;  2CEA A;  1S3S A;  2F5O A;  3SYK A;  4NXN M;  3PVS A;  2CHG A;  4B08 A;  4IBD A;  3GQ5 A;  1K3X A;  5E26 A;  4DV6 M;  3PCF M;  3KOY E;  3D8L A;  2BUW A;  2C98 A;  4AQY M;  2UXB M;  2RGH A;  3MHV C;  1QAN A;  3A45 A;  4FVM A;  4X66 M;  4Z6Y A;  2DWN A;  4IBG A;  4B3T M;  2I7N A;  1HQC A;  4FWG A;  3LKT M;  5JI2 E;  1QAO A;  2C9O A;  3KOX E;  1JQJ C;  3KP0 E;  3PCC M;  3FUX A;  1SXJ D;  3SMS A;  1TDZ A;  2V1U A;  4G4Q A;  4LF4 M;  4NXM M;  4GHL A;  3DA1 A;  4MGZ E;  3PCB M;  3U61 B;  1DGB A;  5IZ7 D;  2ZM6 M;  2BUQ B;  1I4W A;  3MI5 M;  5KPR A;  1E94 E;  3D8B A;  3IG5 A;  3GPU A;  4IBJ A;  3M0E A;  3PCM M;  3L25 A;  2O5R A;  2M60 A;  1DLQ A;  3AL0 C;  2BUQ A;  2BV0 B;  4D81 A;  3DZD A;  2KEB A;  5EJC A;  5EXX A;  4P16 A;  3SHF A;  2KXE A;  3GPY A;  1XMQ M;  4NSR A;  1N78 A;  4D82 A;  1HNZ M;  2BV0 A;  3GPP A;  2DZN B;  2ZAO A;  3L29 A;  1W5S A;  4LZZ A;  2HCB A;  3DFZ A;  5ITQ A;  8CAT A;  3PCH M;  5IRE B;  3PCE A;  3A98 B;  4LFA M;  3LVW A;  4NOO B;  3A42 A;  1Q39 A;  4NL4 H;  5F3W A;  4WHP D;  1C1K A;  4X65 M;  3SAW A;  5FTM A;  2UUB M;  2BUZ B;  5TD3 A;  5FTJ A;  1J5E M;  2R4J A;  5LMN M;  2BUM A;  4M9X A;  3L28 A;  4JI4 M;  4FWH A;  3AKZ A;  2ZAN A;  4AZF A;  4DV0 M;  1IBL M;  1N75 A;  4RF1 A;  2VQE M;  3L27 A;  3FTE A;  1JR3 A;  1IM2 A;  3QAU A;  5BPV A;  3J81 S;  3LVV A;  5EP3 A;  4GKK M;  5EQT A;  4FCV A;  3PCD M;  4B3M M;  5KPZ A;  4B3S M;  2XZU A;  4RF0 A;  2XF3 A;  4I5S A;  2OQ4 A;  2F5S A;  3MJ5 A;  4IBI A;  3VK7 A;  1MU5 A;  4KLN A;  1D2N A;  1GVN A;  1IY2 A;  1XWI A;  4AW4 A;  4MB7 A;  3MV4 A;  1T3T A;  1EOC B;  4FWD A;  4BLC A;  5EP2 A;  1Z5B A;  4REZ A;  5ITU A;  1DLT A;  4LGY A;  1IBK M;  3SAR A;  1N32 M;  4LFC M;  4OVZ A;  2BUU B;  2EO2 A;  3L26 A;  2UU9 M;  2YR0 A;  3KFU G;  3HHW A;  1L1T A;  4YHH M;  1IXZ A;  1SXJ E;  1G41 A;  2XH9 A;  2BUU A;  1QQW A;  3I4Y A;  4DR7 M;  2DHR A;  2R65 A;  4ZPX A;  4B7G A;  4DR6 M;  4AI6 A;  2EA0 A;  2UUA M;  3I51 A;  3WHL A;  2QBY B;  4K0K M;  1XNR M;  3GRU A;  4LJ9 A;  3BOS A;  3T1H M;  4KO8 A;  2X4A A;  3ZC7 B;  2DWZ B;  3ZH9 B;  3TH1 A;  1YKP B;  2QBY A;  4X62 M;  1Q3B A;  3HJS A;  3LMX A;  1YKN B;  2X49 A;  5ITT A;  3GLH B;  3O5U A;  3VK8 A;  4WHS D;  4PDG A;  2LH0 A;  3TWL A;  3PNV A;  1YKP A;  1G59 A;  2F4V M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...