3HK0A

Crystal structure of the ra and ph domains of grb10
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
243
structure length
230
Chain Sequence
b'KQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWSQQSLLQNFLNSSSSPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSAAPRHLQLLADLEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTSWMTAFRLLKYGMLLYQNYRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 10
publication title Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 230
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hk0A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3hk0A01
5CLQB 4HVBA 4XZ4A 3VTVA 2LULA 4GU2A 1FB8A 2JUOA 5C79A 3VH3B 3RUIB 3PREA 2Y5BB 2IO1B 4LJOB 3VAWA 2LJ5A 2GJYA 3V62A 2JZ3B 3ZVVA 2KJ6A 1WJUA 2VRWB 3MJWA 2Z0DB 1ZC4B 3PLVA 2LI5A 1SIFA 3PPAA 2LOZA 2KANA 5G55A 5FI0A 2C7MB 1R4MI 2HD5B 2DAJA 2GCJA 3TIXA 3O65B 1TXDA 4Z2NA 2HTHB 4GZUA 2KK8A 3WALA 3ZRFA 3CSFA 2BF8B 4NQKE 1XD4A 2DKQA 1WJMA 2COAA 2K8CA 2KNBA 2B3AA 4CHMA 2GBJA 4A3OA 3KUCB 4EEWA 4LJPB 5KHQA 4GN1A 2ADZA 2FCMA 3V60A 1WRDB 2JP2A 3ZO5B 1YX6B 4TKNA 2KWUB 2Z59B 3RZWC 2CHXA 1RRPB 2HE7A 4W9JA 2HTHA 1WYWB 4MSMB 2W9NA 3ZIMA 1GG3A 2IO2B 1V86A 3QAQA 2L05A 4Z2MB 1V49A 1OTRB 4HAYB 3FM8C 2P8VA 2P0FA 3VTWA 5J2RA 2KFKB 2C9WB 4NSWA 3SNHA 5JHGA 3RCPA 2BKFA 2Q13A 3JYUA 4ANWA 4MGZE 4BFRA 3VUXA 2RLOA 1M94A 1YJ1A 3DXDA 3VTUA 1H4RA 1TZ1A 4M8NA 2CY5A 3TJPA 3MPXA 2CHWA 3ML9A 3KSYA 3H1UA 1OQYA 4IWQA 1U29A 1SE9A 3UZTA 2KXJA 2WWZA 5DHAB 1C1YB 2D9YA 2J0MA 1AARA 3W1SA 3N3KB 4HCNB 1ZC3B 1Z5SB 5C16A 1CMXB 2KDFB 4FJVB 2L0FA 4KHAA 5AEKB 4IWPA 3PTFC 3D8DA 2Y7BA 3ZVRA 5LONB 2L7RA 2KGXB 2GOWA 3DPDA 1OGWA 5L83A 1LXDA 1XODA 3HHMA 1S3SG 3JSVB 1P6SA 2MBQA 2C5LC 1WE6A 4ICUA 4HB2B 4PQ0A 3PVUA 2JWZA 4W9EA 3RCZA 3CMMB 2FJLA 3IHPC 3V61A 1XQQA 2WX1A 3F5RA 2RUKB 5KQ4A 2DN6A 2PPHA 4IC7B 4I6LB 4AJWA 3WIMA 2BPSA 4FBJB 4HPMB 4KV2A 2MBBB 3L13A 3PHWB 4GDLB 3VHTC 4F8CB 1KM7A 2DYMA 3ENEA 1U5DA 4GXBA 3RT3B 2M38A 2JVCA 4M8MA 1YD8U 1WIAA 1WJ4A 3EFUA 4NQLB 5GMVA 1T0YA 1M7EA 3KZ1A 1V2YA 2PE6B 2K6QA 4KZ0A 1YQBA 5KQ1A 2MP2B 4DDID 1J0WA 2O2VB 3U8ZA 2MBHA 2MFQA 3P6AA 2KUPA 1X1MA 1MIZB 4GDLA 2YT1A 2IBIB 2NZ8B 4A6FB 4WQOB 1KI1B 3SU8X 3QX1A 1WGUA 3APDA 1UPQA 3EC8A 2QKMA 3P7ZA 4IAPA 5AZHA 4ANUA 3IFWB 2LGXA 1H10A 5GOWB 3SUZA 1OQNA 2LWPA 3JW0X 2C7HA 4WJNA 1I7AA 1NU2A 2KJHB 2E2XA 3M95A 1XR0B 2NBWB 2YF0A 3R66C 2K8HA 2K00A 1WMHB 1EGXA 2CRFA 3EHVA 4A6KA 4BKGA 2RNRB 2NS5A 2IFSA 2EKEC 5HE1A 5FI1A 1UELA 2CS4A 2UZRA 2I5FA 2J0KA 4K7SA 3QA8A 1FGZA 1K5DB 2YT0A 5LLIA 2KMAA 1PFJA 3BY4B 4BBKA 2R2QA 3OLMD 1WX8A 3ZNGC 2RR9A 2XBBC 3SD5A 2DHZA 2DFKA 1PQSA 2YS5A 2MKRA 3OANA 2MLBA 2GBKA 2L00B 1WY8A 4GDKA 1UD7A 3TBLD 3ODWA 3KYCD 4WAAA 2FIDA 3AXCA 5DCNA 2O6VD 2K2JA 3T8MA 3OJ4B 4F7GA 1MKEA 2KC2A 3SDLC 2ASQA 3A9JB 1KOTA 4W9FA 1Y8RC 1WXSA 2G3QB 2ZEQA 3GYPA 4IFSA 1W1GA 2XEWA 3V6EB 4KSKC 1L2NA 4HAWB 5HKHA 3NOBA 3ZNID 3X23A 3R3MA 5D2MB 1U5EA 1X05A 3L0WB 2LGDA 3QK0A 5J3QA 4G50A 4HWIB 3RZFA 3CF6E 2Z0OA 1V5OA 1Q0WB 1WM2A 2ZVOA 3BJIA 1NI2A 4PYUA 4PNKA 1WXAA 2DX5B 1HE8A 4DHZE 4MGKE 3A1QB 2KN5A 3DVGY 4E71A 1WR1A 3B1LX 2UZSA 4IWOA 5CTRC 1U4AA 3PG7A 1KLVA 1EAZA 3A9KB 2JY6A 2LVQA 2AWTA 3X0WA 5L95C 3PP2A 2MRPA 1R4NI 2LXAA 2MCNB 4I6PA 1E5WA 3PGEA 2MQJA 4MGYE 1WGDA 2O6VB 2KCJA 4BOZB 2KVRA 5JLJB 3A1QA 2FCSA 2YRYA 3IG3A 2D9XA 2D07B 2NMBA 1XKEA 1NBFC 4WJ7A 2DAFA 3HW2B 2CAYA 2KHWB 2Z0QA 4JIOU 3QIJA 2IY1B 2CKHB 2JF5A 2O6VA 2ZCCA 4CO7A 3OAWA 3EECA 2N0YA 2LOXA 1TJ6A 4DHZB 4DWFA 5C23A 1D3ZA 5DPTA 1EF1A 1X11A 2FUHB 4DBGA 1FHWA 4BKTA 1DDWA 4KAXB 3VH4B 3IVFA 1WR6E 4KDIC 3RULA 3ZUNA 1XX0A 3DOWA 3D8FA 4MT7A 1RAXA 4WJQA 2KDEB 4HAVB 2OTXA 2AEHA 4B95A 1PLSA 1LQBA 1TGZB 2RGNB 5LXIB 2N7DA 4K7UA 3VDZA 3OJ3A 4X57B 5EDSA 4OVUA 1W1HA 3NY5A 3ML4A 1DBHA 1V61A 2H7DA 5HE0A 4LCDE 1MG8A 3A8PA 4W9CA 4LDTD 2GMIC 1Q67A 1X1GA 3HM3A 1MK7B 3TL5A 1ZSQA 5KHOA 3WA0A 5LOPB 3NS8A 4HB4B 4DHJD 1Z87A 2P0DA 4G11A 4FULA 2PEAA 2MW5A 4E74A 3LJUX 2EC1A 2UYZB 4DX8A 2DYOA 2KDIA 2VSZA 4E3CA 4C0AA 3VQIA 3PRMB 2EMSA 5CHFA 4OVVA 5C6RA 3DBHI 4NY0A 4BOSC 2ZPNA 4KIKA 4W9HA 1EUVB 5JHAA 4NAWA 3RYTA 1QC6A 2D3GA 3UQBA 2KD0A 4HDOA 1DDVA 1X86A 3QWMA 2BYEA 2QHOA 3I3TB 2NBVB 2KKCA 2RVBB 2WYQA 4W9KA 3T9LA 2MSED 2LXCA 2IZVB 1P3RA 3U30A 2BWFA 2WDTB 4PS7A 2FIFA 1H8CA 2VKIA 3UIPB 4A20A 4IM2A 2K1FA 2MBOA 5CHWA 4AWJA 4LDTB 4EKUA 4GMVA 2C7NB 4WWOA 4GPTB 4PS3A 4D0NB 2KX0A 1LM8B 4BBNF 2LVPA 4NJ7A 4P7IA 2NCNA 3QQ8B 2K2UA 2BGFA 2RGFA 2ROZB 1X1FA 2REXA 3DDCB 3ZTCA 2CHZA 4XX5A 3DVNU 2KFJA 5D3YA 4TQ1A 3QARA 2VRRB 2G4SA 3WYFB 1ZVRA 3N7CA 3PS6A 2CODA 2W2XC 3H7SA 3N30A 4IOYX 3ONSA 4PYZA 3KUDB 1FAOA 4MY6A 3M62B 3HM6X 4FN2A 2N4FA 5JH5C 1U27A 2JXXA 4K17A 3GOEA 3NSUA 4IUMB 4WJOA 1XD3B 5E6OA 4K2PA 4KSLC 4KHOA 1WGYA 2K39A 4Y94A 1W1DA 2BKRB 4HLEA 1BAKA 4RM9A 1MPHA 2LUEA 4ASWC 5L81A 2GS0A 1AQCA 2KQSA 3H7PB 1DROA 5LXHA 3W1SC 5AZGA 2IO3B 5D3VA 3ULCA 2A5UA 3CSTA 5D3XA 1KJTA 4PS8A 1RJ2A 2ZNVB 4MSQB 1WI1A 2BYFA 2JRHA 4J6IA 2G45B 1F9JA 4EUTA 3M63B 3WAOA 2AL3A 2M17A 1ZW7A 2KTFA 4EJNA 1UPRA 4NPNA 4JQWC 4TQ0A 2JRIB 3H7PA 4GDKB 2I1KA 5HE2A 3SO6A 2YS3A 3UGBB 1E8ZA 5C1ZA 1TBEA 5JZEB 2YVCA 1Q1OA 2KDBA 4G3XB 1K5GB 3ODXA 1V6EA 4EMOA 1A5RA 4IM3A 5EFXA 4N9F4 3UIOB 5DH9B 4FJZA 3APCA 2MA9B 4MM3A 4AUQC 3DXEA 2ZCBA 4GB9A 1N3HA 1WE7A 1UNRA 3KUZA 4HAUB 2YSZA 2I5CA 5D7GA 4FHKA 3VXWA 3AI5A 3IBEA 2DYNA 3GZNI 3Q3JA 2N23A 3L17A 1WGHA 2LVOA 3V6CB 4AP4C 1LB1A 1EVHA 2DHJA 3LDZE 2LRWA 4EZKA 2QKLA 1IRSA 3AU4A 1P1AA 1NTYA 4HXDA 1V89A 4BKSD 3A33B 3M3JA 4II3B 1E90A 2G35A 1WX9A 2KLGA 3PRPB 3K9PB 1V88A 1KZ7A 2DTCA 5FR6A 4KHBB 2V3SA 4CHKA 3PT2B 4WWNA 2KO3A 1YX5B 4GGQA 4FA6A 1VCBA 4H8SA 3QJZA 3F0WA 2KQ7A 2NBUA 3DXCA 3DCGA 4ANXA 4F7UP 4HATB 2LD9A 1P3QU 4K2OA 1V5UA 2KOXA 3JVZX 2BYVE 2DZJA 4BBNC 3MDBC 3HK0A 1V9JA 4G0NB 2N1VA 2GBRA 1WGQA 3D32A 1TTNA 2KMCA 4ZRKA 2KWCA 2NPTB 3Q3FA 1FOEA 3V5WA 5JHBA 3PEGA 4F7HA 4IW0A 4EOYA 4FADA 5BO4B 2DZIA 1WXMA 3L10B 3QHTA 3B0AA 3PHXB 4FLHA 4KZCA 3S2AA 5DPRA 5J3YA 2D9WA 2ZJDA 1RRBA 2DZKA 5DPWA 2PE9A 4DXAB 2CU1A 4ZRJA 4RMAA 2KWVB 2MWNB 1EF5A 1DYNA 4MJSB 2NPTA 4ICVA 4ZRIA 1WZ0A 3KRWA 1U5GA 1WG7A 2WX0A 4M0WB 2W2WA 1Y5OA 5DIFB 2ZVNA 2L76A 3ML8A 1I2HA 4B9KA 2PZ1A 2D10A 5JHHA 2KLCA 3K9OB 1WM3A 2N9EB 2IYBA 4L6EA 4MJSA 4BKSA 2MWSB 2N9XA 2H7EA 4ZYNA 1G6JA 2DHIA 3TFMA 4IG7B 3ZNHB 1XT9B 1XCGA 2ZZPB 3UQAA 4YL8A 1B55A 2COCA 3AJ4A 1FHOA 1P98A 3SV1A 2RSGA 4K7WA 1UNQA 1OEYA 2M1MA 2AYOB 4HCPB 4F7ZA 1Y19B 1L7YA 1BWNA 3A98B 5IA7A 3CXBB 2Y8GA 1WVHA 2P0HA 3VIAA 5D6JB 5J3TA 5AZFA 2COFA 1LFDA 1ISNA 2RSUA 3CIKA 3ZW3A 3KRXA 1ZKHA 5E6NA 2EJ8A 1P9DU 2PJHA 3ODOA 1WJNA 2NR2A 1QZEA 4KIKB 2JT4B 4NAWB 2Y8FA 5E6PA 5J18A 3DVNV 3G9WA 2DYBA 2J7QB 4FHJA 1LW3A 2M0XA 5CX3A 5D27A 2AL6A 4I6NB 2DX1A 2KJRA 2GBMA 2M8SA 4JLCA 2DZMA 1VD2A 1QQGA 3ZLZA 1BTKA 2DENB 3FSSA 2LRUA 1ZM0A 3KW5B 1J19A 2V76A 1GUAB 3VFKA 1V80A 3MHSD 2XK5B 4II2B 4URKA 1UGMA 4W9GA 3DBLI 2R09A 3A4RA 2IO0B 1YIWA 5DHFB 2DYQA 2MBEA 2FAZA 2LASA 2LGYA 2N7EA 2LZ6A 3UINB 2D2QA 1UBQA 3QC8B 3LJ3A 2CR5A 2FCNA 1IYFA 1UH6A 5D3WA 1BT0A 2K8BA 2KFKA 3TW1A 2KZRA 2XK5A 2OOBB 3H9DA 2ZPYA 4EZJA 3O96A 2I1JA 1WZ3A 4WVFB 3PLUA 1UZXB 3ALBA 2RD0A 3SYXA 3TMPB 4A3PA 4DHJB 1E8WA 1TQZA 4GOCA 2XQNM 3ZDTA 4DBBA 2ELBA 4GMXB 4AOFA 2K25A 2IY0B 3UF8A 3QBVB 1U5FA 2CY4A 1OEYJ 5C5BB 3N32A 2LG1A 3TCAA 4ANVA 2BWES 3B08A 1IPGA 2EMTA 4NNJB 1E7UA 3MTNB 4K1RB 2L1CA 2L0TA 3WANA 3HIZA 3TVVA 1GC6A 5DI9B 2FCQA 4TYZA 3L08A 3JSVA 5KCVA 4MEMA 4RM8A 4MGIE 5D94A 2OQBA 1AWEA 4DDGD 4MELA 5JP4A 1E8XA 5IAAC 1V81A 5C5BA 3PSEB 3VVWB 2D9VA 3ULBA 3DVGX 4TV3A 1WJ6A 4MDKE 3PV1A 3W1YA 4EFOA 2HJ8A 3SHQA 4KDLB 4MK0A 3ZNZB 1DDMA 2KX3A 2K6DB 1WX7A 1EO6A 2NVUI 4GIVA 4HAXB 2DKPA 3KVFB 1WXVA 4GSWA 2R0DA 3HQCA 1KZGA 3T06A 2MP2A 3PZDA 2MX2A 1WJ1A 1C3TA 2G4DB 1RLFA 1U2BA 4MH0E 3AU5A 2O2VA 2D11A 2GBNA 2YLMA 2N9PC 4B6HA 1NTVA 4XC2A 3FEHA 4FJYA 4EZLA 1WGRA 4A6FA 3A4SC 2YS1A 3C0RB 2L8JA 2DA0A 5HE3A 4ZDVA 1BTNA 4A6HA 2C60A 1GJZA 1OMWA 2DHKA 3WAPA 2M14A 1Q5WB 1RFAA 5DPSA 2D4QA 4YONA 2Z0EB 5J17A 3QWZB 3PRZA 1J8CA 3QCAA 4K81A 1UNPA 1V5PA 4WSFA 3U7DA 2KTRB 3NZSA 2L2IA 3ZKJC 3PVWA 4W9DA 2IYDB 1WGGA 1WMHA 2J59M 4F1SA 2UWQA 2D9ZA 1WF9A 3NZUA 3A8QA 1MAIA 3GYOA 1WH3A 1GC7A 1SHCA 3PVLA 1M7RA 3D8EA 2BCJA 4AJYB 4HPLB 2OJRA 2R2OA 5TR5A 3DQVA 4WJPA 1J0GA 2X18A 2DLWA 3KY9A 2ELAA 2KTRA 4XWXA 4W9LA 4WWPA 4DK5A 1K8RB 3VUWA 4JL9A 3VUYA 2FNJB 3NHEB 1WI0A 3ZRCA 4BVUC 3M1IB 1E8YA 1FHXA 3ZTDA 4HHVA 3TO1A 5CLLB 3PSCA 4HK2A 2M4NA 3WAMA 2Z0PA 3KYDD 3H6NA 3VOQA 4TUUA 3R7QA 2GCLA 2UVMA 5CHVC 3A9JA 1V5MA 2LKOA 1P5TA 3DBRI 2ZNVC 4CHJA 2A4ZA 1WFYA 2ROVA 3BINA 2J0JA 4HDQA 2RPQA 1I35A 3P2BA 3R7RA 1E7VA 1FGYA 2MDXA 3L54A 2JZZA 1ZGUB 2L3ZA 5G2NA 1UBIA 1JRUA 1FXTB 2KC1A 1UEFA 4DX90 1I42A 1MIXA 2DX5A 4HJKA 1MK9B 3DBSA 4HB3B 1Z2MA 2V1YA 4B6WA 3AULA 3RD2A 2W2XD 3A9KA 4JGHB 4CYEA 3ECIA 4NJ6A 3ZDMC 1S1QB 2JPHA 1OY2A 4KVGB 4A5KA 1IP9A 2V4LA 4W9IA 1PMSA 1P0RA 1SGHA 2N1WA 4HB0B 3APFA 4IM0A 1NDDA 3L16A 3KH0A 1GNUA 1V5TA 2LYDA 4HAZB
chains in the Genus database with same CATH superfamily
5CLQB 4HVBA 4XZ4A 3VTVA 1FMAD 1ESFA 2LULA 4GU2A 1FB8A 3RNFC 3ZYYX 2JUOA 3HUIA 5C79A 3VH3B 3RUIB 3PREA 1J7BA 3Q8EA 2Y5BB 2IO1B 1NYQA 4LJOB 1MHXA 3VAWA 2LJ5A 3AN1A 2GJYA 1R4MB 3V62A 2JZ3B 3ZVVA 5BYRA 3R2IA 2KJ6A 1WJUA 2K0PA 2LGSA 2VRWB 3MJWA 2JXTA 2Z0DB 2KYWA 1ZC4B 2Z13A 3PLVA 4TMAB 2LI5A 1SIFA 2BT6A 2I38A 3PO0A 2BS2B 1UF0A 1FRRA 1WGKA 3PPAA 1KH0A 2LOZA 2KANA 5G55A 5FI0A 3P63A 2C7MB 1R4MI 2HD5B 2DAJA 5TSSA 1BMLC 2GCJA 1I4RA 3TIXA 4C56C 3O65B 1TXDA 1AWDA 3DWGC 4Z2NA 2HTHB 2D3BA 3EUB2 1KTKA 4GZUA 2KK8A 4YT0B 3WALA 3ZRFA 3CSFA 2BF8B 1XXGA 4NQKE 3MC8A 1XD4A 1OQRA 1MG4A 2DKQA 1WJMA 5IN7A 2COAA 2K8CA 3NRZA 2KNBA 2B3AA 4CHMA 1F2RC 2GBJA 3AEFB 4A3OA 2ICIA 3KUCB 4EEWA 1J7AA 2WXJA 2EELA 4LJPB 5KHQA 1F77A 3ABVB 4GN1A 2WLBA 2ADZA 2FCMA 2ACZB 3V60A 1WRDB 2JP2A 3ZO5B 3U52E 1YX6B 4TKNA 4KGSA 4XDCA 2KWUB 2Z59B 3RZWC 2CHXA 3B77A 1RRPB 2HE7A 4W9JA 2HTHA 1WYWB 4MSMB 3DBHB 2W9NA 3ZIMA 1GG3A 4C4VB 3DHGC 2J42A 2IO2B 3IT6B 1V86A 3QAQA 2L05A 4Z2MB 1V49A 1OTRB 1XLNA 4HAYB 4XDDA 3FM8C 4RNAA 2P8VA 2P0FA 3VTWA 5J2RA 2WXKA 2KFKB 3I57A 1KLGD 2C9WB 4RCOA 4NSWA 3SNHA 5JHGA 3RCPA 1PFDA 2Q13A 2BKFA 3JYUA 4ANWA 1IBXA 4MGZE 4BFRA 3VUXA 2RLOA 1M94A 2ZKMX 1YJ1A 3AEDB 3DXDA 3C8YA 1HEZE 2VZKD 3VTUA 1H4RA 1TZ1A 4M8NA 2CY5A 1VLBA 5HG2A 4YTNB 2Z59A 3TJPA 3MPXA 1T3QA 1XLQA 1SXTA 2CHWA 3ML9A 4UDUC 1QOFA 3KSYA 3H1UA 1OQYA 4IWQA 4C4VA 1U29A 2AQ3B 2XNAC 1SE9A 3UZTA 3N9YC 2K5PA 2KXJA 2WWZA 3RNCC 5DHAB 3RMKC 2HTME 1C1YB 2D9YA 2J0MA 1AARA 3W1SA 1I4GA 3N3KB 4HCNB 4ZRQA 1ZC3B 1Z5SB 5C16A 1CMXB 2V3PA 3KWVA 2WXMA 4OT1A 2KDFB 4FJVB 3MHZA 1SJED 2WXRA 2L0FA 1PYWD 4KHAA 3EA6A 1JALA 3GE8C 5AEKB 4IWPA 3PTFC 3D8DA 2Y7BA 3ZVRA 5LONB 2L7RA 5EE1A 2KGXB 2GOWA 4A55A 1TKEA 2L52A 3DPDA 1OGWA 5L83A 1VDVA 1LXDA 3AE4B 1XODA 1FIQA 3HHMA 1S3SG 3JSVB 1P6SA 2MBQA 4ARCA 3AE1B 2C5LC 2DLBA 1WE6A 3P1MA 2G1EA 4ICUA 4HB2B 4PQ0A 4ZRPA 4LLGM 3PVUA 5IRSA 2JWZA 3U7ZA 4K3CA 4W9EA 3RCZA 3CMMB 2FJLA 3IHPC 2NBVA 1XQQA 3V61A 1JWBD 2WX1A 3F5RA 2RUKB 5G5HA 5KQ4A 2DN6A 2PPHA 4IC7B 4I6LB 2GLSA 4AJWA 3AM9A 4DQOC 3WIMA 3C19A 1UWXA 3GS2A 2BPSA 1C77A 4FBJB 4HPMB 4KV2A 2MBBB 1C4AA 4J3OD 1IGDA 3L13A 3PHWB 4GDLB 4ITKA 3ZXVA 3VHTC 4F8CB 1KM7A 2DYMA 3ENEA 1U5DA 4GXBA 3RT3B 3AV8A 2M38A 2JVCA 4M8MA 1YD8U 3O13A 4WIPA 1WIAA 1WJ4A 3EFUA 2VZKB 3AEGB 5BMHA 3A58A 4NQLB 5GMVA 1T0YA 1M7EA 3KZ1A 2KIEA 1V2YA 2NTSA 2PE6B 2I2YA 2K6QA 2WQYB 4KZ0A 1YQBA 5KQ1A 3L4PA 2MP2B 2RRFA 2M0AA 4LNOA 2JSVX 4DDID 1J0WA 4LNFA 4XWTA 1PDXA 1J7CA 2O2VB 3U8ZA 4HJGE 2MBHA 2MFQA 3P6AA 2KUPA 1YQ3B 2LHDA 1X1MA 4BZAA 1XCQL 1MIZB 1JMLA 4GDLA 2Z4DA 2YT1A 4ZHPA 2IBIB 4M02A 2NZ8B 4A6FB 4JE3B 4WQOB 1KI1B 3SU8X 3QX1A 1WGUA 3APDA 1UPQA 3EC8A 1P7FA 2NMQA 3Q14C 2QKMA 4RGOS 3P7ZA 4IAPA 5AZHA 4ANUA 4ARIA 1VRAB 3IFWB 1ET9A 2LGXA 3N1YC 5E6JA 2YEPF 3ZJVA 1H10A 5GOWB 1FXAA 3SUZA 1E10A 3Q3OC 1OQNA 2LWPA 3E9SA 3JW0X 2C7HA 4WJNA 1I7AA 4Q2JA 1NU2A 2KJHB 2E2XA 4YSZB 3M95A 1XR0B 2NBWB 3HRDD 1E0ZA 2YF0A 4IKGA 3R66C 2N7JA 2K8HA 4H2AA 2K00A 1WMHB 1EGXA 1NYRA 2BBCA 2INNE 2CJOA 2CRFA 3EHVA 2KN4A 4A6KA 4BKGA 3NWAA 2RNRB 1D6EC 4CQNA 3Q6BA 1DOIA 2NS5A 2IFSA 2EKEC 5HE1A 5FI1A 1MVKA 2D5GA 1UELA 2CS4A 2UZRA 2I5FA 2J0KA 4K7SA 3QA8A 1FGZA 4LK0M 1K5DB 3NVVA 2YT0A 5LLIA 2GRIA 2KMAA 1GB1A 1PFJA 1OQQA 3BY4B 4BBKA 4HROA 3VR9B 2R2QA 3LB8C 3OLMD 1WX8A 1CZPA 3ZNGC 3AEAB 5GXGB 2RR9A 2XBBC 3SD5A 1MI1A 1TS5A 2DHZA 2DFKA 1PQSA 2YS5A 2MKRA 3OANA 2MLBA 2GBKA 2L00B 3MP9A 2GI9A 3TEZA 1WY8A 4GDKA 1UD7A 3TBLD 3ODWA 3KYCD 4WAAA 2FIDA 3AXCA 5DCNA 2KWDA 2O6VD 2K2JA 1STEA 3RNEC 3T8MA 1YQ4B 3OJ4B 4F7GA 1MKEA 2KC2A 2LGIA 4RGNA 3SDLC 2R2YA 2SAKA 2Z8LA 3NVYA 2LEKA 5T8IA 4XWWA 4CSQA 2ASQA 3P4QB 2WU5B 2QSDA 3A9JB 1KOTA 1D5XC 4W9FA 1TYGB 1Y8RC 1WXSA 3DCXA 2K9XA 4HEA1 3RNGC 2G3QB 2ZEQA 3GYPA 1WSPA 4IFSA 1W1GA 2XEWA 4MACA 3V6EB 4KSKC 1L2NA 4HAWB 1YN3A 1TZOA 5HKHA 3NOBA 3ZNID 2IGGA 5D3IB 4ZOHC 3X23A 3R3MA 5D3DA 5D2MB 2BS4B 1TS2A 5IO9A 1U5EA 1X05A 3L0WB 5G5GA 1AYFA 2LGDA 3Q8FA 3QK0A 5J3QA 4G50A 4HWIB 3GE3C 3RZFA 3CF6E 2Z0OA 1V5OA 1Q0WB 1WM2A 2ZVOA 3B2FA 3BJIA 1NI2A 2BB5A 3Q69A 4PYUA 2N9KA 4PNKA 1WXAA 2DX5B 3DWMA 1HE8A 4DHZE 4P1CC 4MGKE 3A1QB 1GPXA 2KN5A 1R4NB 1MPEA 3DVGY 2BS3B 4E71A 1WR1A 3B1LX 2KVZA 2UZSA 4IWOA 5CTRC 1U4AA 1C78A 3PG7A 1KLVA 4WWMA 1EAZA 3A9KB 2JY6A 2LVQA 1FPYA 2AWTA 3X0WA 5L95C 3PP2A 2PTLA 2MRPA 1FO4A 1KRHA 1CK1A 1R4NI 2LXAA 2FBWB 2MCNB 4I6PA 3WCQA 1N5XA 1E5WA 4KX6B 3PGEA 4MT5A 2MQJA 2L32A 4MGYE 1WGDA 2O6VB 2KCJA 4BOZB 4DXFA 2DNFA 2KVRA 5JLJB 2JYEA 4LNNA 3URYA 3A1QA 2FCSA 2YRYA 3IG3A 2D9XA 2D07B 4M01A 2NMBA 2WDVB 1XKEA 3HVZA 1NBFC 2J53A 2WXNA 2K22A 1CJEA 4WJ7A 2DAFA 3HW2B 2CAYA 1FNWA 2KHWB 2FUG1 1WXQA 3Q2AC 1EWYC 2Z0QA 4DIXA 2MHJA 4JIOU 3QIJA 1ZE3D 2IY1B 2CKHB 2UU7A 2JF5A 2O6VA 2ZCCA 3HVDA 4CO7A 3OAWA 1EU3A 1QOBA 3EECA 4RH6A 2N0YA 2LOXA 1TJ6A 1ZP0B 2WXGA 2J52A 4DHZB 4DWFA 1ZOYB 2IJ0A 1V1PA 5C23A 5EE3A 2ONQA 1L4DB 1D3ZA 5DPTA 1EF1A 1X11A 1PGBA 3AE8B 2FUHB 4DBGA 1FRDA 1FHWA 4BKTA 4S0RA 4O1NA 1DDWA 4KAXB 3VH4B 3IVFA 1WR6E 4OZCA 2ON8A 4KDIC 3RULA 2D3AA 3ZUNA 2LFIA 3AH7A 1XX0A 3P4PB 3DOWA 3D8FA 4MT7A 1RAXA 3CWIA 4WJQA 2KDEB 4HAVB 2OTXA 2AEHA 4B95A 4A9AA 1ZYIA 1PLSA 1LQBA 1TGZB 2RGNB 1P7EA 5LXIB 2N7DA 4K7UA 2KAJA 3VDZA 3OJ3A 2N9LA 1N63A 2PVOD 1N60A 3TUOA 4X57B 5EDSA 4OVUA 1W1HA 1TS4A 1N62A 3TEXA 3NY5A 2H88B 3ML4A 1DBHA 1V61A 2H7DA 5HE0A 4LCDE 1MG8A 3A8PA 4W9CA 4LDTD 4WH4A 2GMIC 1Q67A 1IBXB 1X1GA 1SEBD 3HM3A 4P6VF 3SEBA 1MK7B 3TL5A 4QXAB 1ZSQA 5KHOA 3WA0A 3RNAC 5LOPB 3NS8A 4HB4B 4DHJD 1Z87A 1HXYD 2P0DA 4G11A 3IAM1 4FULA 4N58A 2PEAA 2MW5A 4E74A 3LJUX 3ETRA 1Y56A 2EC1A 1YJIA 2UYZB 3NW8A 4LNIA 1C9FA 4YXDB 2Q5WD 4QAYA 4DX8A 2DYOA 2KDIA 2VSZA 3NG0A 2PMVA 4E3CA 4C0AA 3VQIA 3PRMB 2EMSA 2K49A 5CHFA 4OVVA 5C6RA 2KDMA 2MJDA 2BQQA 3DBHI 4NY0A 4BOSC 2JQRB 2ZPNA 4KIKA 1MFWA 1EUVB 4W9HA 5JHAA 2LJIA 4NAWA 3RYTA 1QC6A 2D3GA 3UQBA 2KD0A 3IT4B 2QIEB 4HDOA 4L23A 1ACCA 1DDVA 4YSXB 1EU4A 2E3TA 4RF0A 1X86A 4HSIA 5IOIA 3QWMA 1RFKA 2BYEA 2IDYA 1QOGA 2QHOA 3PZ8A 1I4QA 3I3TB 1VZ7A 4GLSC 2W55A 1D5MC 1JCKB 2WP9B 2WXOA 2W82A 2NBVB 2KKCA 5H92C 2RVBB 2WYQA 4W9KA 3T9LA 2MSED 2LXCA 1JWMD 2IZVB 3J9CA 1T0SC 1P3RA 3U30A 2BWFA 1VR9A 2WDTB 4PS7A 3R8BA 2FIFA 1H8CA 2VKIA 3UIPB 4A20A 1VJKA 4IM2A 2K1FA 1E9MA 2MBOA 5CHWA 3BVGA 3HSAA 4AWJA 1KLUD 4LDTB 1N6ZA 4QJ4B 2MJEA 3ZXRA 2AX5A 4EKUA 4GMVA 2C7NB 4WWOA 4GPTB 4PS3A 4D0NB 2KX0A 2N0SB 1LM8B 1KFYB 3AE5B 3E56A 4BBNF 2LVPA 4JWUC 4NJ7A 4P7IA 2NCNA 3QQ8B 2K2UA 2H89B 2BGFA 2RGFA 2QDFA 2ROZB 2BTEA 1X1FA 2REXA 4EE2A 3DDCB 3ZTCA 2CHZA 2WXPA 3VRBB 4XX5A 1EWCA 3DVNU 1UNSA 2KFJA 1YMHE 3LYYA 5D3YA 2QC8A 4TQ1A 3QARA 2VRRB 3VRAB 2FE8A 2G4SA 3WYFB 1ZVRA 3N7CA 1GAQB 3PS6A 2CODA 1TY2A 2W2XC 3H7SA 1HTQA 3N30A 4IOYX 3ONSA 4PYZA 3KUDB 1FAOA 1ET6A 4FXCA 4MY6A 3M62B 3HM6X 2N4FA 4FN2A 5JH5C 2Z14A 3HIEA 1U27A 5LNK1 4US9A 2JXXA 3PZ7A 4K17A 3GOEA 3NSUA 1L6VA 3MFGA 1C4PA 4IUMB 4WJOA 1XD3B 3CIRB 5E6OA 4K2PA 1SJHD 4KSLC 4KHOA 1WGYA 2K39A 3MJ5A 1TKYA 4Y94A 1W1DA 2E6XA 2BKRB 1TJEA 3IXSA 1UUPA 4HLEA 4D2KA 1WYGA 1BAKA 4RM9A 1MPHA 3LXFA 2LUEA 4ASWC 5L81A 2GS0A 1AQCA 5EE9A 2KQSA 3BWUD 3KLSX 3H7PB 5HFYA 1DROA 5LXHA 3W1SC 5AZGA 2IO3B 3W5VB 5D3VA 3ULCA 2A5UA 2KT7A 3CSTA 5D3XA 1KJTA 2SEBD 4PS8A 1RJ2A 2ZNVB 1L0YB 4YTMB 1UWMA 2GUMA 4MSQB 3OG5A 1WI1A 2BYFA 2JRHA 3AE9B 2Y5CA 3NVZA 3I5JC 2G45B 1F9JA 4J6IA 3T3NA 4EUTA 3Q3MC 3M63B 1C76A 3WAOA 2AL3A 2B76B 2M17A 4GOUA 1ZW7A 2QEJC 2KTFA 4EJNA 1UPRA 4NPNA 4JQWC 1JWAD 4TQ0A 2JRIB 2PKOA 3H7PA 4GDKB 2I1KA 5HE2A 3SO6A 2YS3A 3UGBB 2LMCA 1E8ZA 5C1ZA 1TBEA 3B9JA 1XLOA 5JZEB 2YVCA 4L1RA 1Q1OA 2KDBA 4G3XB 1K5GB 1QT9A 2KQ4X 1N5WA 4M00A 4HKZE 3ODXA 2PLPA 1I4PA 1V6EA 1YN4A 4EMOA 1A5RA 4IM3A 4PK1A 5EFXA 1F1HA 5FKAC 4N9F4 3UIOB 1LGRA 2W3RA 1PGXA 3AEEB 1T77A 5DH9B 4FJZA 1FD6A 1FNUA 1SIJA 3APCA 3U12A 3GZNB 2MA9B 4MM3A 4AUQC 3DXEA 4L1BA 2ZCBA 3TSSA 4GB9A 2YEPB 1N3HA 1WE7A 1UNRA 3KUZA 4HAUB 2YSZA 2I5CA 4KGTA 1XLPA 5D7GA 1I4XA 4FHKA 3VXWA 1TKGA 3AI5A 3RI7C 3IBEA 2DYNA 3GZNI 1RM6C 3Q3JA 2N23A 3L17A 1WGHA 1ZXHA 2LVOA 3V6CB 4AP4C 1LB1A 1AW7A 2WDQB 1EVHA 2DHJA 1TIFA 3LDZE 2LRWA 4EZKA 2QKLA 1IRSA 3AU4A 1L6UA 1P1AA 1NTYA 1IGCA 2QMTA 4HXDA 1V89A 4BKSD 3A33B 3M3JA 4II3B 1E90A 4JPSA 2G35A 1WX9A 2KLGA 3PRPB 3K9PB 1V88A 4XYCA 1KZ7A 2DTCA 5FR6A 4KHBB 1FEHA 2V3SA 4CHKA 3PT2B 4WWNA 2KO3A 1YX5B 4GGQA 2OHFA 2J4XA 4FA6A 1VCBA 1XEEA 1FFVA 4H8SA 3QJZA 1QOAA 3U4EG 3F0WA 2KQ7A 3BK2A 3NJTA 1NEKB 2NBUA 3V3XA 5C3JB 3DXCA 3DCGA 4NAMA 4ANXA 1OFFA 4F7UP 4HATB 2LD9A 4IDIA 4B0EA 3VR8B 1P3QU 4K2OA 5FR3A 1V5UA 2KOXA 3JVZX 4ACFA 2BYVE 2DZJA 4BBNC 3MDBC 3HK0A 2RDGA 3FAHA 1V9JA 4G0NB 2BYTA 2N1VA 2GBRA 1WGQA 4KHBA 4L2YA 3D32A 1TTNA 2KMCA 4ZRKA 2KWCA 2NPTB 3Q3FA 2KIGA 1JWSD 1FOEA 3V5WA 5JHBA 3PEGA 4GNKB 4KGRA 1FXIA 4F7HA 4IW0A 4EOYA 1K51A 4WQMA 5EE0A 4FADA 5BO4B 2DZIA 1WXMA 3L10B 3QHTA 3TEYA 3B0AA 3PHXB 4FLHA 4KZCA 3S2AA 5DPRA 1D4BA 5J3YA 2D9WA 1LO5D 1V1PB 5BMGA 2ZJDA 2DWQA 1RRBA 5BYSA 4N6EB 2DZKA 1JROA 5DPWA 4NZLB 2PE9A 1YOVB 4USAA 4DXAB 2CU1A 1SE2A 1F52A 4ZRJA 4RMAA 1FFUA 2KWVB 2MWNB 1EF5A 1DYNA 4MJSB 2LUMA 1I7HA 2NPTA 4ICVA 4ZRIA 2V4IB 1WZ0A 3KRWA 2PVGC 1U5GA 1RWSA 1UGJA 1WG7A 2W54A 4RFBA 2WX0A 1HZ6A 4M0WB 3W2DA 2W2WA 1Y5OA 5DIFB 3BIID 2ZVNA 2L76A 3AB5A 1V8CA 1DGJA 1XCTL 3BYYB 3ML8A 3N1ZC 1I2HA 4B9KA 2PZ1A 2D10A 4LTUA 5JHHA 2KLCA 3K9OB 1VZ8A 1R7SA 1WM3A 3FKYA 3T3OA 3BYTB 3N1XC 2INPE 2N9EB 2IYBA 3N20C 2TSSA 4L6EA 4MJSA 4BKSA 3FILA 2MWSB 2N9XA 1DOYA 2H7EA 4ZYNA 3BK1A 1G6JA 2DHIA 3I63C 3TFMA 3RN9C 4IG7B 1V97A 5JXVA 3ZNHB 1IUEA 3V05A 1XT9B 2IPKD 1ENFA 2WDRB 3W9CB 2WU2B 4M0WA 1E7PB 2QJLA 1EM7A 1TY0A 1XCGA 2ZZPB 3UQAA 1WRIA 4YL8A 1B55A 1RYJA 1MHHE 1FCCC 2COCA 3AJ4A 2D3CA 2W3SA 1FHOA 1P98A 2KR0A 3SV1A 1YN5A 2RSGA 4K7WA 1UNQA 1OEYA 2M1MA 2AYOB 4HCPB 2WS3B 2OJWA 4F7ZA 3AMZA 3EFCA 1Y19B 2BB6A 1NI3A 1L7YA 1BWNA 3A98B 2RMMA 2WXHA 5IA7A 3CXBB 4JWSC 1GOZA 2Y8GA 1WVHA 4XGAB 2P0HA 3VIAA 5D6JB 5J3TA 2G9HD 1M4VA 3BVMA 5AZFA 2COFA 3DHHC 3SFEB 2M19A 1LFDA 2Y5PA 1ISNA 5I2MA 2RSUA 3CIKA 1ZDVA 3EGRA 3ZW3A 3KRXA 1ZKHA 5E6NA 4KKJA 4KKIA 4A8XC 2EJ8A 1P9DU 2PJHA 2L83A 3ODOA 1B1ZA 4P1BC 1SF0A 3BVZA 3B2GA 1WJNA 2V3NA 2NR2A 1QZEA 4KIKB 2JT4B 3AE2B 4NAWB 1NVID 2Y8FA 4HPPA 5E6PA 5J18A 3DVNV 4R3DA 3KQ4A 3G9WA 1B9RA 1JWUD 4S17A 2DYBA 2J7QB 4FHJA 2BVCA 1LW3A 2M0XA 5CX3A 5D27A 2AL6A 2GB1A 4I6NB 1JQ4A 3DHIC 2DX1A 2EKIA 1HA5A 2X38A 2KJRA 1QLBB 2GBMA 2M8SA 4JLCA 2DZMA 1VD2A 1QQGA 3AECB 3ZLZA 1BTKA 3NVWA 2CU3A 4C7ZA 2DENB 3DBLB 1FCLA 3FSSA 2LRUA 4ZHOA 1ZM0A 3KW5B 1J19A 2V76A 1GUAB 1ZXIA 3Q8BA 3VFKA 1V80A 1K53A 3MHSD 3KWLA 2XK5B 2RDHA 4II2B 4URKA 1HZ5A 1UGMA 3OWEB 1T5XD 2JZPA 1MJDA 4W9GA 3DBLI 2R09A 3A4RA 2IO0B 1YIWA 1A70A 5DHFB 2DYQA 2MBEA 2DBYA 2FAZA 2LASA 2LGYA 2N7EA 2LZ6A 4PT5A 3UINB 2L1AA 2D2QA 1UBQA 3QC8B 3LJ3A 2CR5A 2FCNA 1IYFA 2XN9C 1FM0D 4NJCA 1UH6A 5D3WA 1L5PA 2NTTA 1BT0A 1PGAA 4YWGG 2K8BA 2KFKA 3TW1A 1JRPA 1L0XB 2KZRA 1SSNA 2XK5A 2OOBB 3H9DA 2ZPYA 4EZJA 3O96A 2I1JA 5C2TB 1WZ3A 4WVFB 3AE7B 1UZXB 1KF6B 3PLUA 3IAS1 3ALBA 2RD0A 3SYXA 3AEBB 4TSSA 1MI0A 3FC4A 3TMPB 4A3PA 4DHJB 1E8WA 1TQZA 2ZW1A 3AE6B 4GOCA 1QF6A 2XQNM 3ZDTA 4DBBA 2ELBA 4GMXB 4AOFA 4OVZA 4YSYB 2K25A 1DYQA 2IY0B 1ROEA 4B0MA 3UF8A 2V9HA 3MC9A 3QBVB 1C4CA 1U5FA 2CY4A 1OEYJ 5C5BB 3N32A 1K52A 1QKZA 2LG1A 3R2TA 2KMMA 3TCAA 4ANVA 2BWES 4HKQA 3B08A 1IPGA 4N59A 1L0VB 2K3UA 2EMTA 4NNJB 1E7UA 3MTNB 4K1RB 2L1CA 2L0TA 3WANA 3HIZA 3TVVA 1GC6A 3P4SB 4QJ3B 4US8A 5DI9B 2FCQA 4TYZA 5MPOA 3L08A 3JSVA 1BXTA 5KCVA 3BZDB 4MEMA 4RM8A 3RFZB 4MGIE 5D94A 2OQBA 1AWEA 4K3BA 4DDGD 1QILA 3SFDB 1HQRD 4MELA 5JP4A 2INDC 1E8XA 2VH2A 5IAAC 3UI3A 1DOXA 1V81A 1T6BX 2QILA 5C5BA 1N61A 3PSEB 3VVWB 2D9VA 3ULBA 3DVGX 4TV3A 1WJ6A 4MDKE 3PV1A 3W1YA 4EFOA 2HJ8A 2MH7A 3SHQA 4KDLB 1I4HA 4MK0A 3ZNZB 1DDMA 2KX3A 3SR6A 2K6DB 1WX7A 1EO6A 2FJUB 2NVUI 4GIVA 4OZBA 1BUIC 4HAXB 2DKPA 1TT5B 3KVFB 1WXVA 4GSWA 2ZW0A 2R0DA 3HQCA 1KZGA 3T06A 2MP2A 3PZDA 2QCZA 2MX2A 1WJ1A 5M4YB 1C3TA 2G4DB 1RLFA 2X8XX 1U2BA 4MH0E 3AU5A 2O2VA 2D11A 1D5ZC 1YJJA 2GBNA 2YLMA 2N9PC 2LHEA 4B6HA 1K50A 3GB1A 2MEKA 1NTVA 4XC2A 3FEHA 4FJYA 4EZLA 1WGRA 4A6FA 4MM3B 1SB3C 3A4SC 2YS1A 3C0RB 1QQRA 2L8JA 2DA0A 5HE3A 1GB4A 4ZDVA 1BTNA 4OHJA 1T0QC 4A6HA 2WXIA 2VH1A 4HRSA 2C60A 2JWUA 1GJZA 1OMWA 2DHKA 3WAPA 3I9V1 2M14A 4RF1A 1Q5WB 1RFAA 5DPSA 4BAXA 2D4QA 4YONA 1TS3A 2Z0EB 3NS1A 5J17A 5AUIA 1Q10A 3Q8CA 3GP7A 3ZGZA 3QWZB 3PRZA 2RPVA 1J8CA 3QCAA 4K81A 1UNPA 1V5PA 4WSFA 3U7DA 2KTRB 1T0RC 3NZSA 2L2IA 3ZKJC 3PVWA 2MJ3A 1ZUD2 4W9DA 2IYDB 1WGGA 1WMHA 1WWTA 2J59M 2V0GA 1L4ZB 1SBBB 2RDBC 4F1SA 3AE3B 2UWQA 2D9ZA 2KUQA 1WF9A 3NZUA 1F0ZA 2INCC 5H8YE 3A8QA 1MAIA 3GYOA 1WH3A 1CQVA 4YTPB 1GC7A 1HTOA 4QJ5B 5IKCM 5AUKA 1SHCA 3PVLA 4RGTA 3RNBC 2IGHA 1M7RA 3D8EA 2BCJA 2R61A 4AJYB 2PIAA 2OJRA 4HPLB 2R2OA 5TR5A 3DQVA 3NWFA 4WJPA 1J0GA 2X18A 2DLWA 3NZ3A 5FK9C 1XF5L 3KY9A 4IOIE 2ELAA 2KTRA 4ZYSA 1E6EB 3TEWA 4C00A 2WGSA 4XWXA 2AQ1B 5BYQA 5BMIA 4W9LA 4WWPA 4DK5A 5HHDG 1SE4A 2JX5A 1K8RB 3VUWA 2HJ1A 4JL9A 3VUYA 2FNJB 3NHEB 1WI0A 1PUTA 5HI1A 4RGMA 3ZRCA 2OEDA 4BVUC 4C80A 3M1IB 1E8YA 2JYTA 1FHXA 3MC0B 2KACA 3ZTDA 2HDEA 4HHVA 1VZ6A 5I2SA 3TO1A 5CLLB 5IP4D 3RPFC 1YNTE 3PSCA 4HK2A 2M4NA 1XO3A 2M56B 4AQ7A 3DBRB 3WAMA 2Z0PA 3KYDD 3W5UB 3H6NA 3P4RB 4OZAA 3VOQA 1FNVA 3ZJUA 3ZQ4A 1ZPSA 4TUUA 3R7QA 5I4DA 2GCLA 2UVMA 2IGDA 5CHVC 3A9JA 1V5MA 2LKOA 1P5TA 2WXFA 2PW9A 3DBRI 3ZJTA 2ZNVC 3Q3NC 4CHJA 4WAFA 2A4ZA 1WFYA 2WXLA 3U2SC 4LNKA 2ROVA 3BINA 2J0JA 4HDQA 1SE3A 4MH8A 1AN8A 2RPQA 1I35A 1V1OA 3P2BA 2AQ2B 3R7RA 1E7VA 1F2RI 4OW0A 1FGYA 2MDXA 2BW2A 3P42A 3L54A 2JZZA 5LG4B 1ZGUB 4A90A 2L3ZA 5G2NA 1UBIA 4REZA 1JRUA 1FXTB 2KC1A 1UEFA 4DX90 1I42A 1NENB 1MIXA 2DX5A 4D6WA 4HJKA 1MK9B 3DBSA 4HB3B 1Z2MA 3NWDA 4C7YA 2V1YA 4B6WA 3AULA 3RD2A 3FVCA 3OHMB 3H8HA 3FILB 2WHIA 4WURA 2W2XD 3A9KA 4JGHB 4CYEA 3ECIA 4NJ6A 1S1QB 3ZDMC 2JPHA 4OSNA 1OY2A 4KVGB 4A5KA 4DXGA 4P16A 1IP9A 2K8EA 4JX1C 4AS1A 2V4LA 4A6QA 2Y3AA 4W9IA 2WNMA 1PMSA 3NUHB 1P0RA 1SGHA 2JU6X 2N1WA 1ZDXA 1C79A 4HB0B 3Q8AA 4XE0A 3APFA 2YT2A 4IM0A 1NDDA 3L16A 3KH0A 1JW9D 1GNUA 1V5TA 2CJNA 2WXQA 2LYDA 4HAZB
chains in the Genus database with same CATH topology
5CLQB 4HVBA 4XZ4A 3VTVA 2LULA 4GU2A 1FB8A 2JUOA 5C79A 3VH3B 3RUIB 3PREA 2Y5BB 2IO1B 4LJOB 3VAWA 2LJ5A 2GJYA 3V62A 2JZ3B 3ZVVA 2KJ6A 1WJUA 2VRWB 3MJWA 2Z0DB 1ZC4B 3PLVA 2LI5A 1SIFA 3PPAA 2LOZA 2KANA 5G55A 5FI0A 2C7MB 1R4MI 2HD5B 2DAJA 2GCJA 3TIXA 3O65B 1TXDA 4Z2NA 2HTHB 4GZUA 2KK8A 3WALA 3ZRFA 3CSFA 2BF8B 4NQKE 1XD4A 2DKQA 1WJMA 2COAA 2K8CA 2KNBA 2B3AA 4CHMA 2GBJA 4A3OA 3KUCB 4EEWA 4LJPB 5KHQA 4GN1A 2ADZA 2FCMA 3V60A 1WRDB 2JP2A 3ZO5B 1YX6B 4TKNA 2KWUB 2Z59B 3RZWC 2CHXA 1RRPB 2HE7A 4W9JA 2HTHA 1WYWB 4MSMB 2W9NA 3ZIMA 1GG3A 2IO2B 1V86A 3QAQA 2L05A 4Z2MB 1V49A 1OTRB 4HAYB 3FM8C 2P8VA 2P0FA 3VTWA 5J2RA 2KFKB 2C9WB 4NSWA 3SNHA 5JHGA 3RCPA 2BKFA 2Q13A 3JYUA 4ANWA 4MGZE 4BFRA 3VUXA 2RLOA 1M94A 1YJ1A 3DXDA 3VTUA 1H4RA 1TZ1A 4M8NA 2CY5A 3TJPA 3MPXA 2CHWA 3ML9A 3KSYA 3H1UA 1OQYA 4IWQA 1U29A 1SE9A 3UZTA 2KXJA 2WWZA 5DHAB 1C1YB 2D9YA 2J0MA 1AARA 3W1SA 3N3KB 4HCNB 1ZC3B 1Z5SB 5C16A 1CMXB 2KDFB 4FJVB 2L0FA 4KHAA 5AEKB 4IWPA 3PTFC 3D8DA 2Y7BA 3ZVRA 5LONB 2L7RA 2KGXB 2GOWA 3DPDA 1OGWA 5L83A 1LXDA 1XODA 3HHMA 1S3SG 3JSVB 1P6SA 2MBQA 2C5LC 1WE6A 4ICUA 4HB2B 4PQ0A 3PVUA 2JWZA 4W9EA 3RCZA 3CMMB 2FJLA 3IHPC 3V61A 1XQQA 2WX1A 3F5RA 2RUKB 5KQ4A 2DN6A 2PPHA 4IC7B 4I6LB 4AJWA 3WIMA 2BPSA 4FBJB 4HPMB 4KV2A 2MBBB 3L13A 3PHWB 4GDLB 3VHTC 4F8CB 1KM7A 2DYMA 3ENEA 1U5DA 4GXBA 3RT3B 2M38A 2JVCA 4M8MA 1YD8U 1WIAA 1WJ4A 3EFUA 4NQLB 5GMVA 1T0YA 1M7EA 3KZ1A 1V2YA 2PE6B 2K6QA 4KZ0A 1YQBA 5KQ1A 2MP2B 4DDID 1J0WA 2O2VB 3U8ZA 2MBHA 2MFQA 3P6AA 2KUPA 1X1MA 1MIZB 4GDLA 2YT1A 2IBIB 2NZ8B 4A6FB 4WQOB 1KI1B 3SU8X 3QX1A 1WGUA 3APDA 1UPQA 3EC8A 2QKMA 3P7ZA 4IAPA 5AZHA 4ANUA 3IFWB 2LGXA 1H10A 5GOWB 3SUZA 1OQNA 2LWPA 3JW0X 2C7HA 4WJNA 1I7AA 1NU2A 2KJHB 2E2XA 3M95A 1XR0B 2NBWB 2YF0A 3R66C 2K8HA 2K00A 1WMHB 1EGXA 2CRFA 3EHVA 4A6KA 4BKGA 2RNRB 2NS5A 2IFSA 2EKEC 5HE1A 5FI1A 1UELA 2CS4A 2UZRA 2I5FA 2J0KA 4K7SA 3QA8A 1FGZA 1K5DB 2YT0A 5LLIA 2KMAA 1PFJA 3BY4B 4BBKA 2R2QA 3OLMD 1WX8A 3ZNGC 2RR9A 2XBBC 3SD5A 2DHZA 2DFKA 1PQSA 2YS5A 2MKRA 3OANA 2MLBA 2GBKA 2L00B 1WY8A 4GDKA 1UD7A 3TBLD 3ODWA 3KYCD 4WAAA 2FIDA 3AXCA 5DCNA 2O6VD 2K2JA 3T8MA 3OJ4B 4F7GA 1MKEA 2KC2A 3SDLC 2ASQA 3A9JB 1KOTA 4W9FA 1Y8RC 1WXSA 2G3QB 2ZEQA 3GYPA 4IFSA 1W1GA 2XEWA 3V6EB 4KSKC 1L2NA 4HAWB 5HKHA 3NOBA 3ZNID 3X23A 3R3MA 5D2MB 1U5EA 1X05A 3L0WB 2LGDA 3QK0A 5J3QA 4G50A 4HWIB 3RZFA 3CF6E 2Z0OA 1V5OA 1Q0WB 1WM2A 2ZVOA 3BJIA 1NI2A 4PYUA 4PNKA 1WXAA 2DX5B 1HE8A 4DHZE 4MGKE 3A1QB 2KN5A 3DVGY 4E71A 1WR1A 3B1LX 2UZSA 4IWOA 5CTRC 1U4AA 3PG7A 1KLVA 1EAZA 3A9KB 2JY6A 2LVQA 2AWTA 3X0WA 5L95C 3PP2A 2MRPA 1R4NI 2LXAA 2MCNB 4I6PA 1E5WA 3PGEA 2MQJA 4MGYE 1WGDA 2O6VB 2KCJA 4BOZB 2KVRA 5JLJB 3A1QA 2FCSA 2YRYA 3IG3A 2D9XA 2D07B 2NMBA 1XKEA 1NBFC 4WJ7A 2DAFA 3HW2B 2CAYA 2KHWB 2Z0QA 4JIOU 3QIJA 2IY1B 2CKHB 2JF5A 2O6VA 2ZCCA 4CO7A 3OAWA 3EECA 2N0YA 2LOXA 1TJ6A 4DHZB 4DWFA 5C23A 1D3ZA 5DPTA 1EF1A 1X11A 2FUHB 4DBGA 1FHWA 4BKTA 1DDWA 4KAXB 3VH4B 3IVFA 1WR6E 4KDIC 3RULA 3ZUNA 1XX0A 3DOWA 3D8FA 4MT7A 1RAXA 4WJQA 2KDEB 4HAVB 2OTXA 2AEHA 4B95A 1PLSA 1LQBA 1TGZB 2RGNB 5LXIB 2N7DA 4K7UA 3VDZA 3OJ3A 4X57B 5EDSA 4OVUA 1W1HA 3NY5A 3ML4A 1DBHA 1V61A 2H7DA 5HE0A 4LCDE 1MG8A 3A8PA 4W9CA 4LDTD 2GMIC 1Q67A 1X1GA 3HM3A 1MK7B 3TL5A 1ZSQA 5KHOA 3WA0A 5LOPB 3NS8A 4HB4B 4DHJD 1Z87A 2P0DA 4G11A 4FULA 2PEAA 2MW5A 4E74A 3LJUX 2EC1A 2UYZB 4DX8A 2DYOA 2KDIA 2VSZA 4E3CA 4C0AA 3VQIA 3PRMB 2EMSA 5CHFA 4OVVA 5C6RA 3DBHI 4NY0A 4BOSC 2ZPNA 4KIKA 4W9HA 1EUVB 5JHAA 4NAWA 3RYTA 1QC6A 2D3GA 3UQBA 2KD0A 4HDOA 1DDVA 1X86A 3QWMA 2BYEA 2QHOA 3I3TB 2NBVB 2KKCA 2RVBB 2WYQA 4W9KA 3T9LA 2MSED 2LXCA 2IZVB 1P3RA 3U30A 2BWFA 2WDTB 4PS7A 2FIFA 1H8CA 2VKIA 3UIPB 4A20A 4IM2A 2K1FA 2MBOA 5CHWA 4AWJA 4LDTB 4EKUA 4GMVA 2C7NB 4WWOA 4GPTB 4PS3A 4D0NB 2KX0A 1LM8B 4BBNF 2LVPA 4NJ7A 4P7IA 2NCNA 3QQ8B 2K2UA 2BGFA 2RGFA 2ROZB 1X1FA 2REXA 3DDCB 3ZTCA 2CHZA 4XX5A 3DVNU 2KFJA 5D3YA 4TQ1A 3QARA 2VRRB 2G4SA 3WYFB 1ZVRA 3N7CA 3PS6A 2CODA 2W2XC 3H7SA 3N30A 4IOYX 3ONSA 4PYZA 3KUDB 1FAOA 4MY6A 3M62B 3HM6X 4FN2A 2N4FA 5JH5C 1U27A 2JXXA 4K17A 3GOEA 3NSUA 4IUMB 4WJOA 1XD3B 5E6OA 4K2PA 4KSLC 4KHOA 1WGYA 2K39A 4Y94A 1W1DA 2BKRB 4HLEA 1BAKA 4RM9A 1MPHA 2LUEA 4ASWC 5L81A 2GS0A 1AQCA 2KQSA 3H7PB 1DROA 5LXHA 3W1SC 5AZGA 2IO3B 5D3VA 3ULCA 2A5UA 3CSTA 5D3XA 1KJTA 4PS8A 1RJ2A 2ZNVB 4MSQB 1WI1A 2BYFA 2JRHA 4J6IA 2G45B 1F9JA 4EUTA 3M63B 3WAOA 2AL3A 2M17A 1ZW7A 2KTFA 4EJNA 1UPRA 4NPNA 4JQWC 4TQ0A 2JRIB 3H7PA 4GDKB 2I1KA 5HE2A 3SO6A 2YS3A 3UGBB 1E8ZA 5C1ZA 1TBEA 5JZEB 2YVCA 1Q1OA 2KDBA 4G3XB 1K5GB 3ODXA 1V6EA 4EMOA 1A5RA 4IM3A 5EFXA 4N9F4 3UIOB 5DH9B 4FJZA 3APCA 2MA9B 4MM3A 4AUQC 3DXEA 2ZCBA 4GB9A 1N3HA 1WE7A 1UNRA 3KUZA 4HAUB 2YSZA 2I5CA 5D7GA 4FHKA 3VXWA 3AI5A 3IBEA 2DYNA 3GZNI 3Q3JA 2N23A 3L17A 1WGHA 2LVOA 3V6CB 4AP4C 1LB1A 1EVHA 2DHJA 3LDZE 2LRWA 4EZKA 2QKLA 1IRSA 3AU4A 1P1AA 1NTYA 4HXDA 1V89A 4BKSD 3A33B 3M3JA 4II3B 1E90A 2G35A 1WX9A 2KLGA 3PRPB 3K9PB 1V88A 1KZ7A 2DTCA 5FR6A 4KHBB 2V3SA 4CHKA 3PT2B 4WWNA 2KO3A 1YX5B 4GGQA 4FA6A 1VCBA 4H8SA 3QJZA 3F0WA 2KQ7A 2NBUA 3DXCA 3DCGA 4ANXA 4F7UP 4HATB 2LD9A 1P3QU 4K2OA 1V5UA 2KOXA 3JVZX 2BYVE 2DZJA 4BBNC 3MDBC 3HK0A 1V9JA 4G0NB 2N1VA 2GBRA 1WGQA 3D32A 1TTNA 2KMCA 4ZRKA 2KWCA 2NPTB 3Q3FA 1FOEA 3V5WA 5JHBA 3PEGA 4F7HA 4IW0A 4EOYA 4FADA 5BO4B 2DZIA 1WXMA 3L10B 3QHTA 3B0AA 3PHXB 4FLHA 4KZCA 3S2AA 5DPRA 5J3YA 2D9WA 2ZJDA 1RRBA 2DZKA 5DPWA 2PE9A 4DXAB 2CU1A 4ZRJA 4RMAA 2KWVB 2MWNB 1EF5A 1DYNA 4MJSB 2NPTA 4ICVA 4ZRIA 1WZ0A 3KRWA 1U5GA 1WG7A 2WX0A 4M0WB 2W2WA 1Y5OA 5DIFB 2ZVNA 2L76A 3ML8A 1I2HA 4B9KA 2PZ1A 2D10A 5JHHA 2KLCA 3K9OB 1WM3A 2N9EB 2IYBA 4L6EA 4MJSA 4BKSA 2MWSB 2N9XA 2H7EA 4ZYNA 1G6JA 2DHIA 3TFMA 4IG7B 3ZNHB 1XT9B 1XCGA 2ZZPB 3UQAA 4YL8A 1B55A 2COCA 3AJ4A 1FHOA 1P98A 3SV1A 2RSGA 4K7WA 1UNQA 1OEYA 2M1MA 2AYOB 4HCPB 4F7ZA 1Y19B 1L7YA 1BWNA 3A98B 5IA7A 3CXBB 2Y8GA 1WVHA 2P0HA 3VIAA 5D6JB 5J3TA 5AZFA 2COFA 1LFDA 1ISNA 2RSUA 3CIKA 3ZW3A 3KRXA 1ZKHA 5E6NA 2EJ8A 1P9DU 2PJHA 3ODOA 1WJNA 2NR2A 1QZEA 4KIKB 2JT4B 4NAWB 2Y8FA 5E6PA 5J18A 3DVNV 3G9WA 2DYBA 2J7QB 4FHJA 1LW3A 2M0XA 5CX3A 5D27A 2AL6A 4I6NB 2DX1A 2KJRA 2GBMA 2M8SA 4JLCA 2DZMA 1VD2A 1QQGA 3ZLZA 1BTKA 2DENB 3FSSA 2LRUA 1ZM0A 3KW5B 1J19A 2V76A 1GUAB 3VFKA 1V80A 3MHSD 2XK5B 4II2B 4URKA 1UGMA 4W9GA 3DBLI 2R09A 3A4RA 2IO0B 1YIWA 5DHFB 2DYQA 2MBEA 2FAZA 2LASA 2LGYA 2N7EA 2LZ6A 3UINB 2D2QA 1UBQA 3QC8B 3LJ3A 2CR5A 2FCNA 1IYFA 1UH6A 5D3WA 1BT0A 2K8BA 2KFKA 3TW1A 2KZRA 2XK5A 2OOBB 3H9DA 2ZPYA 4EZJA 3O96A 2I1JA 1WZ3A 4WVFB 3PLUA 1UZXB 3ALBA 2RD0A 3SYXA 3TMPB 4A3PA 4DHJB 1E8WA 1TQZA 4GOCA 2XQNM 3ZDTA 4DBBA 2ELBA 4GMXB 4AOFA 2K25A 2IY0B 3UF8A 3QBVB 1U5FA 2CY4A 1OEYJ 5C5BB 3N32A 2LG1A 3TCAA 4ANVA 2BWES 3B08A 1IPGA 2EMTA 4NNJB 1E7UA 3MTNB 4K1RB 2L1CA 2L0TA 3WANA 3HIZA 3TVVA 1GC6A 5DI9B 2FCQA 4TYZA 3L08A 3JSVA 5KCVA 4MEMA 4RM8A 4MGIE 5D94A 2OQBA 1AWEA 4DDGD 4MELA 5JP4A 1E8XA 5IAAC 1V81A 5C5BA 3PSEB 3VVWB 2D9VA 3ULBA 3DVGX 4TV3A 1WJ6A 4MDKE 3PV1A 3W1YA 4EFOA 2HJ8A 3SHQA 4KDLB 4MK0A 3ZNZB 1DDMA 2KX3A 2K6DB 1WX7A 1EO6A 2NVUI 4GIVA 4HAXB 2DKPA 3KVFB 1WXVA 4GSWA 2R0DA 3HQCA 1KZGA 3T06A 2MP2A 3PZDA 2MX2A 1WJ1A 1C3TA 2G4DB 1RLFA 1U2BA 4MH0E 3AU5A 2O2VA 2D11A 2GBNA 2YLMA 2N9PC 4B6HA 1NTVA 4XC2A 3FEHA 4FJYA 4EZLA 1WGRA 4A6FA 3A4SC 2YS1A 3C0RB 2L8JA 2DA0A 5HE3A 4ZDVA 1BTNA 4A6HA 2C60A 1GJZA 1OMWA 2DHKA 3WAPA 2M14A 1Q5WB 1RFAA 5DPSA 2D4QA 4YONA 2Z0EB 5J17A 3QWZB 3PRZA 1J8CA 3QCAA 4K81A 1UNPA 1V5PA 4WSFA 3U7DA 2KTRB 3NZSA 2L2IA 3ZKJC 3PVWA 4W9DA 2IYDB 1WGGA 1WMHA 2J59M 4F1SA 2UWQA 2D9ZA 1WF9A 3NZUA 3A8QA 1MAIA 3GYOA 1WH3A 1GC7A 1SHCA 3PVLA 1M7RA 3D8EA 2BCJA 4AJYB 4HPLB 2OJRA 2R2OA 5TR5A 3DQVA 4WJPA 1J0GA 2X18A 2DLWA 3KY9A 2ELAA 2KTRA 4XWXA 4W9LA 4WWPA 4DK5A 1K8RB 3VUWA 4JL9A 3VUYA 2FNJB 3NHEB 1WI0A 3ZRCA 4BVUC 3M1IB 1E8YA 1FHXA 3ZTDA 4HHVA 3TO1A 5CLLB 3PSCA 4HK2A 2M4NA 3WAMA 2Z0PA 3KYDD 3H6NA 3VOQA 4TUUA 3R7QA 2GCLA 2UVMA 5CHVC 3A9JA 1V5MA 2LKOA 1P5TA 3DBRI 2ZNVC 4CHJA 2A4ZA 1WFYA 2ROVA 3BINA 2J0JA 4HDQA 2RPQA 1I35A 3P2BA 3R7RA 1E7VA 1FGYA 2MDXA 3L54A 2JZZA 1ZGUB 2L3ZA 5G2NA 1UBIA 1JRUA 1FXTB 2KC1A 1UEFA 4DX90 1I42A 1MIXA 2DX5A 4HJKA 1MK9B 3DBSA 4HB3B 1Z2MA 2V1YA 4B6WA 3AULA 3RD2A 2W2XD 3A9KA 4JGHB 4CYEA 3ECIA 4NJ6A 3ZDMC 1S1QB 2JPHA 1OY2A 4KVGB 4A5KA 1IP9A 2V4LA 4W9IA 1PMSA 1P0RA 1SGHA 2N1WA 4HB0B 3APFA 4IM0A 1NDDA 3L16A 3KH0A 1GNUA 1V5TA 2LYDA 4HAZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLQ B;  4HVB A;  4XZ4 A;  3VTV A;  2LUL A;  4GU2 A;  1FB8 A;  2JUO A;  5C79 A;  3VH3 B;  3RUI B;  3PRE A;  2Y5B B;  2IO1 B;  4LJO B;  3VAW A;  2LJ5 A;  2GJY A;  3V62 A;  2JZ3 B;  3ZVV A;  2KJ6 A;  1WJU A;  2VRW B;  3MJW A;  2Z0D B;  1ZC4 B;  3PLV A;  2LI5 A;  1SIF A;  3PPA A;  2LOZ A;  2KAN A;  5G55 A;  5FI0 A;  2C7M B;  1R4M I;  2HD5 B;  2DAJ A;  2GCJ A;  3TIX A;  3O65 B;  1TXD A;  4Z2N A;  2HTH B;  4GZU A;  2KK8 A;  3WAL A;  3ZRF A;  3CSF A;  2BF8 B;  4NQK E;  1XD4 A;  2DKQ A;  1WJM A;  2COA A;  2K8C A;  2KNB A;  2B3A A;  4CHM A;  2GBJ A;  4A3O A;  3KUC B;  4EEW A;  4LJP B;  5KHQ A;  4GN1 A;  2ADZ A;  2FCM A;  3V60 A;  1WRD B;  2JP2 A;  3ZO5 B;  1YX6 B;  4TKN A;  2KWU B;  2Z59 B;  3RZW C;  2CHX A;  1RRP B;  2HE7 A;  4W9J A;  2HTH A;  1WYW B;  4MSM B;  2W9N A;  3ZIM A;  1GG3 A;  2IO2 B;  1V86 A;  3QAQ A;  2L05 A;  4Z2M B;  1V49 A;  1OTR B;  4HAY B;  3FM8 C;  2P8V A;  2P0F A;  3VTW A;  5J2R A;  2KFK B;  2C9W B;  4NSW A;  3SNH A;  5JHG A;  3RCP A;  2BKF A;  2Q13 A;  3JYU A;  4ANW A;  4MGZ E;  4BFR A;  3VUX A;  2RLO A;  1M94 A;  1YJ1 A;  3DXD A;  3VTU A;  1H4R A;  1TZ1 A;  4M8N A;  2CY5 A;  3TJP A;  3MPX A;  2CHW A;  3ML9 A;  3KSY A;  3H1U A;  1OQY A;  4IWQ A;  1U29 A;  1SE9 A;  3UZT A;  2KXJ A;  2WWZ A;  5DHA B;  1C1Y B;  2D9Y A;  2J0M A;  1AAR A;  3W1S A;  3N3K B;  4HCN B;  1ZC3 B;  1Z5S B;  5C16 A;  1CMX B;  2KDF B;  4FJV B;  2L0F A;  4KHA A;  5AEK B;  4IWP A;  3PTF C;  3D8D A;  2Y7B A;  3ZVR A;  5LON B;  2L7R A;  2KGX B;  2GOW A;  3DPD A;  1OGW A;  5L83 A;  1LXD A;  1XOD A;  3HHM A;  1S3S G;  3JSV B;  1P6S A;  2MBQ A;  2C5L C;  1WE6 A;  4ICU A;  4HB2 B;  4PQ0 A;  3PVU A;  2JWZ A;  4W9E A;  3RCZ A;  3CMM B;  2FJL A;  3IHP C;  3V61 A;  1XQQ A;  2WX1 A;  3F5R A;  2RUK B;  5KQ4 A;  2DN6 A;  2PPH A;  4IC7 B;  4I6L B;  4AJW A;  3WIM A;  2BPS A;  4FBJ B;  4HPM B;  4KV2 A;  2MBB B;  3L13 A;  3PHW B;  4GDL B;  3VHT C;  4F8C B;  1KM7 A;  2DYM A;  3ENE A;  1U5D A;  4GXB A;  3RT3 B;  2M38 A;  2JVC A;  4M8M A;  1YD8 U;  1WIA A;  1WJ4 A;  3EFU A;  4NQL B;  5GMV A;  1T0Y A;  1M7E A;  3KZ1 A;  1V2Y A;  2PE6 B;  2K6Q A;  4KZ0 A;  1YQB A;  5KQ1 A;  2MP2 B;  4DDI D;  1J0W A;  2O2V B;  3U8Z A;  2MBH A;  2MFQ A;  3P6A A;  2KUP A;  1X1M A;  1MIZ B;  4GDL A;  2YT1 A;  2IBI B;  2NZ8 B;  4A6F B;  4WQO B;  1KI1 B;  3SU8 X;  3QX1 A;  1WGU A;  3APD A;  1UPQ A;  3EC8 A;  2QKM A;  3P7Z A;  4IAP A;  5AZH A;  4ANU A;  3IFW B;  2LGX A;  1H10 A;  5GOW B;  3SUZ A;  1OQN A;  2LWP A;  3JW0 X;  2C7H A;  4WJN A;  1I7A A;  1NU2 A;  2KJH B;  2E2X A;  3M95 A;  1XR0 B;  2NBW B;  2YF0 A;  3R66 C;  2K8H A;  2K00 A;  1WMH B;  1EGX A;  2CRF A;  3EHV A;  4A6K A;  4BKG A;  2RNR B;  2NS5 A;  2IFS A;  2EKE C;  5HE1 A;  5FI1 A;  1UEL A;  2CS4 A;  2UZR A;  2I5F A;  2J0K A;  4K7S A;  3QA8 A;  1FGZ A;  1K5D B;  2YT0 A;  5LLI A;  2KMA A;  1PFJ A;  3BY4 B;  4BBK A;  2R2Q A;  3OLM D;  1WX8 A;  3ZNG C;  2RR9 A;  2XBB C;  3SD5 A;  2DHZ A;  2DFK A;  1PQS A;  2YS5 A;  2MKR A;  3OAN A;  2MLB A;  2GBK A;  2L00 B;  1WY8 A;  4GDK A;  1UD7 A;  3TBL D;  3ODW A;  3KYC D;  4WAA A;  2FID A;  3AXC A;  5DCN A;  2O6V D;  2K2J A;  3T8M A;  3OJ4 B;  4F7G A;  1MKE A;  2KC2 A;  3SDL C;  2ASQ A;  3A9J B;  1KOT A;  4W9F A;  1Y8R C;  1WXS A;  2G3Q B;  2ZEQ A;  3GYP A;  4IFS A;  1W1G A;  2XEW A;  3V6E B;  4KSK C;  1L2N A;  4HAW B;  5HKH A;  3NOB A;  3ZNI D;  3X23 A;  3R3M A;  5D2M B;  1U5E A;  1X05 A;  3L0W B;  2LGD A;  3QK0 A;  5J3Q A;  4G50 A;  4HWI B;  3RZF A;  3CF6 E;  2Z0O A;  1V5O A;  1Q0W B;  1WM2 A;  2ZVO A;  3BJI A;  1NI2 A;  4PYU A;  4PNK A;  1WXA A;  2DX5 B;  1HE8 A;  4DHZ E;  4MGK E;  3A1Q B;  2KN5 A;  3DVG Y;  4E71 A;  1WR1 A;  3B1L X;  2UZS A;  4IWO A;  5CTR C;  1U4A A;  3PG7 A;  1KLV A;  1EAZ A;  3A9K B;  2JY6 A;  2LVQ A;  2AWT A;  3X0W A;  5L95 C;  3PP2 A;  2MRP A;  1R4N I;  2LXA A;  2MCN B;  4I6P A;  1E5W A;  3PGE A;  2MQJ A;  4MGY E;  1WGD A;  2O6V B;  2KCJ A;  4BOZ B;  2KVR A;  5JLJ B;  3A1Q A;  2FCS A;  2YRY A;  3IG3 A;  2D9X A;  2D07 B;  2NMB A;  1XKE A;  1NBF C;  4WJ7 A;  2DAF A;  3HW2 B;  2CAY A;  2KHW B;  2Z0Q A;  4JIO U;  3QIJ A;  2IY1 B;  2CKH B;  2JF5 A;  2O6V A;  2ZCC A;  4CO7 A;  3OAW A;  3EEC A;  2N0Y A;  2LOX A;  1TJ6 A;  4DHZ B;  4DWF A;  5C23 A;  1D3Z A;  5DPT A;  1EF1 A;  1X11 A;  2FUH B;  4DBG A;  1FHW A;  4BKT A;  1DDW A;  4KAX B;  3VH4 B;  3IVF A;  1WR6 E;  4KDI C;  3RUL A;  3ZUN A;  1XX0 A;  3DOW A;  3D8F A;  4MT7 A;  1RAX A;  4WJQ A;  2KDE B;  4HAV B;  2OTX A;  2AEH A;  4B95 A;  1PLS A;  1LQB A;  1TGZ B;  2RGN B;  5LXI B;  2N7D A;  4K7U A;  3VDZ A;  3OJ3 A;  4X57 B;  5EDS A;  4OVU A;  1W1H A;  3NY5 A;  3ML4 A;  1DBH A;  1V61 A;  2H7D A;  5HE0 A;  4LCD E;  1MG8 A;  3A8P A;  4W9C A;  4LDT D;  2GMI C;  1Q67 A;  1X1G A;  3HM3 A;  1MK7 B;  3TL5 A;  1ZSQ A;  5KHO A;  3WA0 A;  5LOP B;  3NS8 A;  4HB4 B;  4DHJ D;  1Z87 A;  2P0D A;  4G11 A;  4FUL A;  2PEA A;  2MW5 A;  4E74 A;  3LJU X;  2EC1 A;  2UYZ B;  4DX8 A;  2DYO A;  2KDI A;  2VSZ A;  4E3C A;  4C0A A;  3VQI A;  3PRM B;  2EMS A;  5CHF A;  4OVV A;  5C6R A;  3DBH I;  4NY0 A;  4BOS C;  2ZPN A;  4KIK A;  4W9H A;  1EUV B;  5JHA A;  4NAW A;  3RYT A;  1QC6 A;  2D3G A;  3UQB A;  2KD0 A;  4HDO A;  1DDV A;  1X86 A;  3QWM A;  2BYE A;  2QHO A;  3I3T B;  2NBV B;  2KKC A;  2RVB B;  2WYQ A;  4W9K A;  3T9L A;  2MSE D;  2LXC A;  2IZV B;  1P3R A;  3U30 A;  2BWF A;  2WDT B;  4PS7 A;  2FIF A;  1H8C A;  2VKI A;  3UIP B;  4A20 A;  4IM2 A;  2K1F A;  2MBO A;  5CHW A;  4AWJ A;  4LDT B;  4EKU A;  4GMV A;  2C7N B;  4WWO A;  4GPT B;  4PS3 A;  4D0N B;  2KX0 A;  1LM8 B;  4BBN F;  2LVP A;  4NJ7 A;  4P7I A;  2NCN A;  3QQ8 B;  2K2U A;  2BGF A;  2RGF A;  2ROZ B;  1X1F A;  2REX A;  3DDC B;  3ZTC A;  2CHZ A;  4XX5 A;  3DVN U;  2KFJ A;  5D3Y A;  4TQ1 A;  3QAR A;  2VRR B;  2G4S A;  3WYF B;  1ZVR A;  3N7C A;  3PS6 A;  2COD A;  2W2X C;  3H7S A;  3N30 A;  4IOY X;  3ONS A;  4PYZ A;  3KUD B;  1FAO A;  4MY6 A;  3M62 B;  3HM6 X;  4FN2 A;  2N4F A;  5JH5 C;  1U27 A;  2JXX A;  4K17 A;  3GOE A;  3NSU A;  4IUM B;  4WJO A;  1XD3 B;  5E6O A;  4K2P A;  4KSL C;  4KHO A;  1WGY A;  2K39 A;  4Y94 A;  1W1D A;  2BKR B;  4HLE A;  1BAK A;  4RM9 A;  1MPH A;  2LUE A;  4ASW C;  5L81 A;  2GS0 A;  1AQC A;  2KQS A;  3H7P B;  1DRO A;  5LXH A;  3W1S C;  5AZG A;  2IO3 B;  5D3V A;  3ULC A;  2A5U A;  3CST A;  5D3X A;  1KJT A;  4PS8 A;  1RJ2 A;  2ZNV B;  4MSQ B;  1WI1 A;  2BYF A;  2JRH A;  4J6I A;  2G45 B;  1F9J A;  4EUT A;  3M63 B;  3WAO A;  2AL3 A;  2M17 A;  1ZW7 A;  2KTF A;  4EJN A;  1UPR A;  4NPN A;  4JQW C;  4TQ0 A;  2JRI B;  3H7P A;  4GDK B;  2I1K A;  5HE2 A;  3SO6 A;  2YS3 A;  3UGB B;  1E8Z A;  5C1Z A;  1TBE A;  5JZE B;  2YVC A;  1Q1O A;  2KDB A;  4G3X B;  1K5G B;  3ODX A;  1V6E A;  4EMO A;  1A5R A;  4IM3 A;  5EFX A;  4N9F 4;  3UIO B;  5DH9 B;  4FJZ A;  3APC A;  2MA9 B;  4MM3 A;  4AUQ C;  3DXE A;  2ZCB A;  4GB9 A;  1N3H A;  1WE7 A;  1UNR A;  3KUZ A;  4HAU B;  2YSZ A;  2I5C A;  5D7G A;  4FHK A;  3VXW A;  3AI5 A;  3IBE A;  2DYN A;  3GZN I;  3Q3J A;  2N23 A;  3L17 A;  1WGH A;  2LVO A;  3V6C B;  4AP4 C;  1LB1 A;  1EVH A;  2DHJ A;  3LDZ E;  2LRW A;  4EZK A;  2QKL A;  1IRS A;  3AU4 A;  1P1A A;  1NTY A;  4HXD A;  1V89 A;  4BKS D;  3A33 B;  3M3J A;  4II3 B;  1E90 A;  2G35 A;  1WX9 A;  2KLG A;  3PRP B;  3K9P B;  1V88 A;  1KZ7 A;  2DTC A;  5FR6 A;  4KHB B;  2V3S A;  4CHK A;  3PT2 B;  4WWN A;  2KO3 A;  1YX5 B;  4GGQ A;  4FA6 A;  1VCB A;  4H8S A;  3QJZ A;  3F0W A;  2KQ7 A;  2NBU A;  3DXC A;  3DCG A;  4ANX A;  4F7U P;  4HAT B;  2LD9 A;  1P3Q U;  4K2O A;  1V5U A;  2KOX A;  3JVZ X;  2BYV E;  2DZJ A;  4BBN C;  3MDB C;  3HK0 A;  1V9J A;  4G0N B;  2N1V A;  2GBR A;  1WGQ A;  3D32 A;  1TTN A;  2KMC A;  4ZRK A;  2KWC A;  2NPT B;  3Q3F A;  1FOE A;  3V5W A;  5JHB A;  3PEG A;  4F7H A;  4IW0 A;  4EOY A;  4FAD A;  5BO4 B;  2DZI A;  1WXM A;  3L10 B;  3QHT A;  3B0A A;  3PHX B;  4FLH A;  4KZC A;  3S2A A;  5DPR A;  5J3Y A;  2D9W A;  2ZJD A;  1RRB A;  2DZK A;  5DPW A;  2PE9 A;  4DXA B;  2CU1 A;  4ZRJ A;  4RMA A;  2KWV B;  2MWN B;  1EF5 A;  1DYN A;  4MJS B;  2NPT A;  4ICV A;  4ZRI A;  1WZ0 A;  3KRW A;  1U5G A;  1WG7 A;  2WX0 A;  4M0W B;  2W2W A;  1Y5O A;  5DIF B;  2ZVN A;  2L76 A;  3ML8 A;  1I2H A;  4B9K A;  2PZ1 A;  2D10 A;  5JHH A;  2KLC A;  3K9O B;  1WM3 A;  2N9E B;  2IYB A;  4L6E A;  4MJS A;  4BKS A;  2MWS B;  2N9X A;  2H7E A;  4ZYN A;  1G6J A;  2DHI A;  3TFM A;  4IG7 B;  3ZNH B;  1XT9 B;  1XCG A;  2ZZP B;  3UQA A;  4YL8 A;  1B55 A;  2COC A;  3AJ4 A;  1FHO A;  1P98 A;  3SV1 A;  2RSG A;  4K7W A;  1UNQ A;  1OEY A;  2M1M A;  2AYO B;  4HCP B;  4F7Z A;  1Y19 B;  1L7Y A;  1BWN A;  3A98 B;  5IA7 A;  3CXB B;  2Y8G A;  1WVH A;  2P0H A;  3VIA A;  5D6J B;  5J3T A;  5AZF A;  2COF A;  1LFD A;  1ISN A;  2RSU A;  3CIK A;  3ZW3 A;  3KRX A;  1ZKH A;  5E6N A;  2EJ8 A;  1P9D U;  2PJH A;  3ODO A;  1WJN A;  2NR2 A;  1QZE A;  4KIK B;  2JT4 B;  4NAW B;  2Y8F A;  5E6P A;  5J18 A;  3DVN V;  3G9W A;  2DYB A;  2J7Q B;  4FHJ A;  1LW3 A;  2M0X A;  5CX3 A;  5D27 A;  2AL6 A;  4I6N B;  2DX1 A;  2KJR A;  2GBM A;  2M8S A;  4JLC A;  2DZM A;  1VD2 A;  1QQG A;  3ZLZ A;  1BTK A;  2DEN B;  3FSS A;  2LRU A;  1ZM0 A;  3KW5 B;  1J19 A;  2V76 A;  1GUA B;  3VFK A;  1V80 A;  3MHS D;  2XK5 B;  4II2 B;  4URK A;  1UGM A;  4W9G A;  3DBL I;  2R09 A;  3A4R A;  2IO0 B;  1YIW A;  5DHF B;  2DYQ A;  2MBE A;  2FAZ A;  2LAS A;  2LGY A;  2N7E A;  2LZ6 A;  3UIN B;  2D2Q A;  1UBQ A;  3QC8 B;  3LJ3 A;  2CR5 A;  2FCN A;  1IYF A;  1UH6 A;  5D3W A;  1BT0 A;  2K8B A;  2KFK A;  3TW1 A;  2KZR A;  2XK5 A;  2OOB B;  3H9D A;  2ZPY A;  4EZJ A;  3O96 A;  2I1J A;  1WZ3 A;  4WVF B;  3PLU A;  1UZX B;  3ALB A;  2RD0 A;  3SYX A;  3TMP B;  4A3P A;  4DHJ B;  1E8W A;  1TQZ A;  4GOC A;  2XQN M;  3ZDT A;  4DBB A;  2ELB A;  4GMX B;  4AOF A;  2K25 A;  2IY0 B;  3UF8 A;  3QBV B;  1U5F A;  2CY4 A;  1OEY J;  5C5B B;  3N32 A;  2LG1 A;  3TCA A;  4ANV A;  2BWE S;  3B08 A;  1IPG A;  2EMT A;  4NNJ B;  1E7U A;  3MTN B;  4K1R B;  2L1C A;  2L0T A;  3WAN A;  3HIZ A;  3TVV A;  1GC6 A;  5DI9 B;  2FCQ A;  4TYZ A;  3L08 A;  3JSV A;  5KCV A;  4MEM A;  4RM8 A;  4MGI E;  5D94 A;  2OQB A;  1AWE A;  4DDG D;  4MEL A;  5JP4 A;  1E8X A;  5IAA C;  1V81 A;  5C5B A;  3PSE B;  3VVW B;  2D9V A;  3ULB A;  3DVG X;  4TV3 A;  1WJ6 A;  4MDK E;  3PV1 A;  3W1Y A;  4EFO A;  2HJ8 A;  3SHQ A;  4KDL B;  4MK0 A;  3ZNZ B;  1DDM A;  2KX3 A;  2K6D B;  1WX7 A;  1EO6 A;  2NVU I;  4GIV A;  4HAX B;  2DKP A;  3KVF B;  1WXV A;  4GSW A;  2R0D A;  3HQC A;  1KZG A;  3T06 A;  2MP2 A;  3PZD A;  2MX2 A;  1WJ1 A;  1C3T A;  2G4D B;  1RLF A;  1U2B A;  4MH0 E;  3AU5 A;  2O2V A;  2D11 A;  2GBN A;  2YLM A;  2N9P C;  4B6H A;  1NTV A;  4XC2 A;  3FEH A;  4FJY A;  4EZL A;  1WGR A;  4A6F A;  3A4S C;  2YS1 A;  3C0R B;  2L8J A;  2DA0 A;  5HE3 A;  4ZDV A;  1BTN A;  4A6H A;  2C60 A;  1GJZ A;  1OMW A;  2DHK A;  3WAP A;  2M14 A;  1Q5W B;  1RFA A;  5DPS A;  2D4Q A;  4YON A;  2Z0E B;  5J17 A;  3QWZ B;  3PRZ A;  1J8C A;  3QCA A;  4K81 A;  1UNP A;  1V5P A;  4WSF A;  3U7D A;  2KTR B;  3NZS A;  2L2I A;  3ZKJ C;  3PVW A;  4W9D A;  2IYD B;  1WGG A;  1WMH A;  2J59 M;  4F1S A;  2UWQ A;  2D9Z A;  1WF9 A;  3NZU A;  3A8Q A;  1MAI A;  3GYO A;  1WH3 A;  1GC7 A;  1SHC A;  3PVL A;  1M7R A;  3D8E A;  2BCJ A;  4AJY B;  4HPL B;  2OJR A;  2R2O A;  5TR5 A;  3DQV A;  4WJP A;  1J0G A;  2X18 A;  2DLW A;  3KY9 A;  2ELA A;  2KTR A;  4XWX A;  4W9L A;  4WWP A;  4DK5 A;  1K8R B;  3VUW A;  4JL9 A;  3VUY A;  2FNJ B;  3NHE B;  1WI0 A;  3ZRC A;  4BVU C;  3M1I B;  1E8Y A;  1FHX A;  3ZTD A;  4HHV A;  3TO1 A;  5CLL B;  3PSC A;  4HK2 A;  2M4N A;  3WAM A;  2Z0P A;  3KYD D;  3H6N A;  3VOQ A;  4TUU A;  3R7Q A;  2GCL A;  2UVM A;  5CHV C;  3A9J A;  1V5M A;  2LKO A;  1P5T A;  3DBR I;  2ZNV C;  4CHJ A;  2A4Z A;  1WFY A;  2ROV A;  3BIN A;  2J0J A;  4HDQ A;  2RPQ A;  1I35 A;  3P2B A;  3R7R A;  1E7V A;  1FGY A;  2MDX A;  3L54 A;  2JZZ A;  1ZGU B;  2L3Z A;  5G2N A;  1UBI A;  1JRU A;  1FXT B;  2KC1 A;  1UEF A;  4DX9 0;  1I42 A;  1MIX A;  2DX5 A;  4HJK A;  1MK9 B;  3DBS A;  4HB3 B;  1Z2M A;  2V1Y A;  4B6W A;  3AUL A;  3RD2 A;  2W2X D;  3A9K A;  4JGH B;  4CYE A;  3ECI A;  4NJ6 A;  3ZDM C;  1S1Q B;  2JPH A;  1OY2 A;  4KVG B;  4A5K A;  1IP9 A;  2V4L A;  4W9I A;  1PMS A;  1P0R A;  1SGH A;  2N1W A;  4HB0 B;  3APF A;  4IM0 A;  1NDD A;  3L16 A;  3KH0 A;  1GNU A;  1V5T A;  2LYD A;  4HAZ B; 
#chains in the Genus database with same CATH topology
 5CLQ B;  4HVB A;  4XZ4 A;  3VTV A;  1FMA D;  1ESF A;  2LUL A;  4GU2 A;  1FB8 A;  3RNF C;  3ZYY X;  2JUO A;  3HUI A;  5C79 A;  3VH3 B;  3RUI B;  3PRE A;  1J7B A;  3Q8E A;  2Y5B B;  2IO1 B;  1NYQ A;  4LJO B;  1MHX A;  3VAW A;  2LJ5 A;  3AN1 A;  2GJY A;  1R4M B;  3V62 A;  2JZ3 B;  3ZVV A;  5BYR A;  3R2I A;  2KJ6 A;  1WJU A;  2K0P A;  2LGS A;  2VRW B;  3MJW A;  2JXT A;  2Z0D B;  2KYW A;  1ZC4 B;  2Z13 A;  3PLV A;  4TMA B;  2LI5 A;  1SIF A;  2BT6 A;  2I38 A;  3PO0 A;  2BS2 B;  1UF0 A;  1FRR A;  1WGK A;  3PPA A;  1KH0 A;  2LOZ A;  2KAN A;  5G55 A;  5FI0 A;  3P63 A;  2C7M B;  1R4M I;  2HD5 B;  2DAJ A;  5TSS A;  1BML C;  2GCJ A;  1I4R A;  3TIX A;  4C56 C;  3O65 B;  1TXD A;  1AWD A;  3DWG C;  4Z2N A;  2HTH B;  2D3B A;  3EUB 2;  1KTK A;  4GZU A;  2KK8 A;  4YT0 B;  3WAL A;  3ZRF A;  3CSF A;  2BF8 B;  1XXG A;  4NQK E;  3MC8 A;  1XD4 A;  1OQR A;  1MG4 A;  2DKQ A;  1WJM A;  5IN7 A;  2COA A;  2K8C A;  3NRZ A;  2KNB A;  2B3A A;  4CHM A;  1F2R C;  2GBJ A;  3AEF B;  4A3O A;  2ICI A;  3KUC B;  4EEW A;  1J7A A;  2WXJ A;  2EEL A;  4LJP B;  5KHQ A;  1F77 A;  3ABV B;  4GN1 A;  2WLB A;  2ADZ A;  2FCM A;  2ACZ B;  3V60 A;  1WRD B;  2JP2 A;  3ZO5 B;  3U52 E;  1YX6 B;  4TKN A;  4KGS A;  4XDC A;  2KWU B;  2Z59 B;  3RZW C;  2CHX A;  3B77 A;  1RRP B;  2HE7 A;  4W9J A;  2HTH A;  1WYW B;  4MSM B;  3DBH B;  2W9N A;  3ZIM A;  1GG3 A;  4C4V B;  3DHG C;  2J42 A;  2IO2 B;  3IT6 B;  1V86 A;  3QAQ A;  2L05 A;  4Z2M B;  1V49 A;  1OTR B;  1XLN A;  4HAY B;  4XDD A;  3FM8 C;  4RNA A;  2P8V A;  2P0F A;  3VTW A;  5J2R A;  2WXK A;  2KFK B;  3I57 A;  1KLG D;  2C9W B;  4RCO A;  4NSW A;  3SNH A;  5JHG A;  3RCP A;  1PFD A;  2Q13 A;  2BKF A;  3JYU A;  4ANW A;  1IBX A;  4MGZ E;  4BFR A;  3VUX A;  2RLO A;  1M94 A;  2ZKM X;  1YJ1 A;  3AED B;  3DXD A;  3C8Y A;  1HEZ E;  2VZK D;  3VTU A;  1H4R A;  1TZ1 A;  4M8N A;  2CY5 A;  1VLB A;  5HG2 A;  4YTN B;  2Z59 A;  3TJP A;  3MPX A;  1T3Q A;  1XLQ A;  1SXT A;  2CHW A;  3ML9 A;  4UDU C;  1QOF A;  3KSY A;  3H1U A;  1OQY A;  4IWQ A;  4C4V A;  1U29 A;  2AQ3 B;  2XNA C;  1SE9 A;  3UZT A;  3N9Y C;  2K5P A;  2KXJ A;  2WWZ A;  3RNC C;  5DHA B;  3RMK C;  2HTM E;  1C1Y B;  2D9Y A;  2J0M A;  1AAR A;  3W1S A;  1I4G A;  3N3K B;  4HCN B;  4ZRQ A;  1ZC3 B;  1Z5S B;  5C16 A;  1CMX B;  2V3P A;  3KWV A;  2WXM A;  4OT1 A;  2KDF B;  4FJV B;  3MHZ A;  1SJE D;  2WXR A;  2L0F A;  1PYW D;  4KHA A;  3EA6 A;  1JAL A;  3GE8 C;  5AEK B;  4IWP A;  3PTF C;  3D8D A;  2Y7B A;  3ZVR A;  5LON B;  2L7R A;  5EE1 A;  2KGX B;  2GOW A;  4A55 A;  1TKE A;  2L52 A;  3DPD A;  1OGW A;  5L83 A;  1VDV A;  1LXD A;  3AE4 B;  1XOD A;  1FIQ A;  3HHM A;  1S3S G;  3JSV B;  1P6S A;  2MBQ A;  4ARC A;  3AE1 B;  2C5L C;  2DLB A;  1WE6 A;  3P1M A;  2G1E A;  4ICU A;  4HB2 B;  4PQ0 A;  4ZRP A;  4LLG M;  3PVU A;  5IRS A;  2JWZ A;  3U7Z A;  4K3C A;  4W9E A;  3RCZ A;  3CMM B;  2FJL A;  3IHP C;  2NBV A;  1XQQ A;  3V61 A;  1JWB D;  2WX1 A;  3F5R A;  2RUK B;  5G5H A;  5KQ4 A;  2DN6 A;  2PPH A;  4IC7 B;  4I6L B;  2GLS A;  4AJW A;  3AM9 A;  4DQO C;  3WIM A;  3C19 A;  1UWX A;  3GS2 A;  2BPS A;  1C77 A;  4FBJ B;  4HPM B;  4KV2 A;  2MBB B;  1C4A A;  4J3O D;  1IGD A;  3L13 A;  3PHW B;  4GDL B;  4ITK A;  3ZXV A;  3VHT C;  4F8C B;  1KM7 A;  2DYM A;  3ENE A;  1U5D A;  4GXB A;  3RT3 B;  3AV8 A;  2M38 A;  2JVC A;  4M8M A;  1YD8 U;  3O13 A;  4WIP A;  1WIA A;  1WJ4 A;  3EFU A;  2VZK B;  3AEG B;  5BMH A;  3A58 A;  4NQL B;  5GMV A;  1T0Y A;  1M7E A;  3KZ1 A;  2KIE A;  1V2Y A;  2NTS A;  2PE6 B;  2I2Y A;  2K6Q A;  2WQY B;  4KZ0 A;  1YQB A;  5KQ1 A;  3L4P A;  2MP2 B;  2RRF A;  2M0A A;  4LNO A;  2JSV X;  4DDI D;  1J0W A;  4LNF A;  4XWT A;  1PDX A;  1J7C A;  2O2V B;  3U8Z A;  4HJG E;  2MBH A;  2MFQ A;  3P6A A;  2KUP A;  1YQ3 B;  2LHD A;  1X1M A;  4BZA A;  1XCQ L;  1MIZ B;  1JML A;  4GDL A;  2Z4D A;  2YT1 A;  4ZHP A;  2IBI B;  4M02 A;  2NZ8 B;  4A6F B;  4JE3 B;  4WQO B;  1KI1 B;  3SU8 X;  3QX1 A;  1WGU A;  3APD A;  1UPQ A;  3EC8 A;  1P7F A;  2NMQ A;  3Q14 C;  2QKM A;  4RGO S;  3P7Z A;  4IAP A;  5AZH A;  4ANU A;  4ARI A;  1VRA B;  3IFW B;  1ET9 A;  2LGX A;  3N1Y C;  5E6J A;  2YEP F;  3ZJV A;  1H10 A;  5GOW B;  1FXA A;  3SUZ A;  1E10 A;  3Q3O C;  1OQN A;  2LWP A;  3E9S A;  3JW0 X;  2C7H A;  4WJN A;  1I7A A;  4Q2J A;  1NU2 A;  2KJH B;  2E2X A;  4YSZ B;  3M95 A;  1XR0 B;  2NBW B;  3HRD D;  1E0Z A;  2YF0 A;  4IKG A;  3R66 C;  2N7J A;  2K8H A;  4H2A A;  2K00 A;  1WMH B;  1EGX A;  1NYR A;  2BBC A;  2INN E;  2CJO A;  2CRF A;  3EHV A;  2KN4 A;  4A6K A;  4BKG A;  3NWA A;  2RNR B;  1D6E C;  4CQN A;  3Q6B A;  1DOI A;  2NS5 A;  2IFS A;  2EKE C;  5HE1 A;  5FI1 A;  1MVK A;  2D5G A;  1UEL A;  2CS4 A;  2UZR A;  2I5F A;  2J0K A;  4K7S A;  3QA8 A;  1FGZ A;  4LK0 M;  1K5D B;  3NVV A;  2YT0 A;  5LLI A;  2GRI A;  2KMA A;  1GB1 A;  1PFJ A;  1OQQ A;  3BY4 B;  4BBK A;  4HRO A;  3VR9 B;  2R2Q A;  3LB8 C;  3OLM D;  1WX8 A;  1CZP A;  3ZNG C;  3AEA B;  5GXG B;  2RR9 A;  2XBB C;  3SD5 A;  1MI1 A;  1TS5 A;  2DHZ A;  2DFK A;  1PQS A;  2YS5 A;  2MKR A;  3OAN A;  2MLB A;  2GBK A;  2L00 B;  3MP9 A;  2GI9 A;  3TEZ A;  1WY8 A;  4GDK A;  1UD7 A;  3TBL D;  3ODW A;  3KYC D;  4WAA A;  2FID A;  3AXC A;  5DCN A;  2KWD A;  2O6V D;  2K2J A;  1STE A;  3RNE C;  3T8M A;  1YQ4 B;  3OJ4 B;  4F7G A;  1MKE A;  2KC2 A;  2LGI A;  4RGN A;  3SDL C;  2R2Y A;  2SAK A;  2Z8L A;  3NVY A;  2LEK A;  5T8I A;  4XWW A;  4CSQ A;  2ASQ A;  3P4Q B;  2WU5 B;  2QSD A;  3A9J B;  1KOT A;  1D5X C;  4W9F A;  1TYG B;  1Y8R C;  1WXS A;  3DCX A;  2K9X A;  4HEA 1;  3RNG C;  2G3Q B;  2ZEQ A;  3GYP A;  1WSP A;  4IFS A;  1W1G A;  2XEW A;  4MAC A;  3V6E B;  4KSK C;  1L2N A;  4HAW B;  1YN3 A;  1TZO A;  5HKH A;  3NOB A;  3ZNI D;  2IGG A;  5D3I B;  4ZOH C;  3X23 A;  3R3M A;  5D3D A;  5D2M B;  2BS4 B;  1TS2 A;  5IO9 A;  1U5E A;  1X05 A;  3L0W B;  5G5G A;  1AYF A;  2LGD A;  3Q8F A;  3QK0 A;  5J3Q A;  4G50 A;  4HWI B;  3GE3 C;  3RZF A;  3CF6 E;  2Z0O A;  1V5O A;  1Q0W B;  1WM2 A;  2ZVO A;  3B2F A;  3BJI A;  1NI2 A;  2BB5 A;  3Q69 A;  4PYU A;  2N9K A;  4PNK A;  1WXA A;  2DX5 B;  3DWM A;  1HE8 A;  4DHZ E;  4P1C C;  4MGK E;  3A1Q B;  1GPX A;  2KN5 A;  1R4N B;  1MPE A;  3DVG Y;  2BS3 B;  4E71 A;  1WR1 A;  3B1L X;  2KVZ A;  2UZS A;  4IWO A;  5CTR C;  1U4A A;  1C78 A;  3PG7 A;  1KLV A;  4WWM A;  1EAZ A;  3A9K B;  2JY6 A;  2LVQ A;  1FPY A;  2AWT A;  3X0W A;  5L95 C;  3PP2 A;  2PTL A;  2MRP A;  1FO4 A;  1KRH A;  1CK1 A;  1R4N I;  2LXA A;  2FBW B;  2MCN B;  4I6P A;  3WCQ A;  1N5X A;  1E5W A;  4KX6 B;  3PGE A;  4MT5 A;  2MQJ A;  2L32 A;  4MGY E;  1WGD A;  2O6V B;  2KCJ A;  4BOZ B;  4DXF A;  2DNF A;  2KVR A;  5JLJ B;  2JYE A;  4LNN A;  3URY A;  3A1Q A;  2FCS A;  2YRY A;  3IG3 A;  2D9X A;  2D07 B;  4M01 A;  2NMB A;  2WDV B;  1XKE A;  3HVZ A;  1NBF C;  2J53 A;  2WXN A;  2K22 A;  1CJE A;  4WJ7 A;  2DAF A;  3HW2 B;  2CAY A;  1FNW A;  2KHW B;  2FUG 1;  1WXQ A;  3Q2A C;  1EWY C;  2Z0Q A;  4DIX A;  2MHJ A;  4JIO U;  3QIJ A;  1ZE3 D;  2IY1 B;  2CKH B;  2UU7 A;  2JF5 A;  2O6V A;  2ZCC A;  3HVD A;  4CO7 A;  3OAW A;  1EU3 A;  1QOB A;  3EEC A;  4RH6 A;  2N0Y A;  2LOX A;  1TJ6 A;  1ZP0 B;  2WXG A;  2J52 A;  4DHZ B;  4DWF A;  1ZOY B;  2IJ0 A;  1V1P A;  5C23 A;  5EE3 A;  2ONQ A;  1L4D B;  1D3Z A;  5DPT A;  1EF1 A;  1X11 A;  1PGB A;  3AE8 B;  2FUH B;  4DBG A;  1FRD A;  1FHW A;  4BKT A;  4S0R A;  4O1N A;  1DDW A;  4KAX B;  3VH4 B;  3IVF A;  1WR6 E;  4OZC A;  2ON8 A;  4KDI C;  3RUL A;  2D3A A;  3ZUN A;  2LFI A;  3AH7 A;  1XX0 A;  3P4P B;  3DOW A;  3D8F A;  4MT7 A;  1RAX A;  3CWI A;  4WJQ A;  2KDE B;  4HAV B;  2OTX A;  2AEH A;  4B95 A;  4A9A A;  1ZYI A;  1PLS A;  1LQB A;  1TGZ B;  2RGN B;  1P7E A;  5LXI B;  2N7D A;  4K7U A;  2KAJ A;  3VDZ A;  3OJ3 A;  2N9L A;  1N63 A;  2PVO D;  1N60 A;  3TUO A;  4X57 B;  5EDS A;  4OVU A;  1W1H A;  1TS4 A;  1N62 A;  3TEX A;  3NY5 A;  2H88 B;  3ML4 A;  1DBH A;  1V61 A;  2H7D A;  5HE0 A;  4LCD E;  1MG8 A;  3A8P A;  4W9C A;  4LDT D;  4WH4 A;  2GMI C;  1Q67 A;  1IBX B;  1X1G A;  1SEB D;  3HM3 A;  4P6V F;  3SEB A;  1MK7 B;  3TL5 A;  4QXA B;  1ZSQ A;  5KHO A;  3WA0 A;  3RNA C;  5LOP B;  3NS8 A;  4HB4 B;  4DHJ D;  1Z87 A;  1HXY D;  2P0D A;  4G11 A;  3IAM 1;  4FUL A;  4N58 A;  2PEA A;  2MW5 A;  4E74 A;  3LJU X;  3ETR A;  1Y56 A;  2EC1 A;  1YJI A;  2UYZ B;  3NW8 A;  4LNI A;  1C9F A;  4YXD B;  2Q5W D;  4QAY A;  4DX8 A;  2DYO A;  2KDI A;  2VSZ A;  3NG0 A;  2PMV A;  4E3C A;  4C0A A;  3VQI A;  3PRM B;  2EMS A;  2K49 A;  5CHF A;  4OVV A;  5C6R A;  2KDM A;  2MJD A;  2BQQ A;  3DBH I;  4NY0 A;  4BOS C;  2JQR B;  2ZPN A;  4KIK A;  1MFW A;  1EUV B;  4W9H A;  5JHA A;  2LJI A;  4NAW A;  3RYT A;  1QC6 A;  2D3G A;  3UQB A;  2KD0 A;  3IT4 B;  2QIE B;  4HDO A;  4L23 A;  1ACC A;  1DDV A;  4YSX B;  1EU4 A;  2E3T A;  4RF0 A;  1X86 A;  4HSI A;  5IOI A;  3QWM A;  1RFK A;  2BYE A;  2IDY A;  1QOG A;  2QHO A;  3PZ8 A;  1I4Q A;  3I3T B;  1VZ7 A;  4GLS C;  2W55 A;  1D5M C;  1JCK B;  2WP9 B;  2WXO A;  2W82 A;  2NBV B;  2KKC A;  5H92 C;  2RVB B;  2WYQ A;  4W9K A;  3T9L A;  2MSE D;  2LXC A;  1JWM D;  2IZV B;  3J9C A;  1T0S C;  1P3R A;  3U30 A;  2BWF A;  1VR9 A;  2WDT B;  4PS7 A;  3R8B A;  2FIF A;  1H8C A;  2VKI A;  3UIP B;  4A20 A;  1VJK A;  4IM2 A;  2K1F A;  1E9M A;  2MBO A;  5CHW A;  3BVG A;  3HSA A;  4AWJ A;  1KLU D;  4LDT B;  1N6Z A;  4QJ4 B;  2MJE A;  3ZXR A;  2AX5 A;  4EKU A;  4GMV A;  2C7N B;  4WWO A;  4GPT B;  4PS3 A;  4D0N B;  2KX0 A;  2N0S B;  1LM8 B;  1KFY B;  3AE5 B;  3E56 A;  4BBN F;  2LVP A;  4JWU C;  4NJ7 A;  4P7I A;  2NCN A;  3QQ8 B;  2K2U A;  2H89 B;  2BGF A;  2RGF A;  2QDF A;  2ROZ B;  2BTE A;  1X1F A;  2REX A;  4EE2 A;  3DDC B;  3ZTC A;  2CHZ A;  2WXP A;  3VRB B;  4XX5 A;  1EWC A;  3DVN U;  1UNS A;  2KFJ A;  1YMH E;  3LYY A;  5D3Y A;  2QC8 A;  4TQ1 A;  3QAR A;  2VRR B;  3VRA B;  2FE8 A;  2G4S A;  3WYF B;  1ZVR A;  3N7C A;  1GAQ B;  3PS6 A;  2COD A;  1TY2 A;  2W2X C;  3H7S A;  1HTQ A;  3N30 A;  4IOY X;  3ONS A;  4PYZ A;  3KUD B;  1FAO A;  1ET6 A;  4FXC A;  4MY6 A;  3M62 B;  3HM6 X;  2N4F A;  4FN2 A;  5JH5 C;  2Z14 A;  3HIE A;  1U27 A;  5LNK 1;  4US9 A;  2JXX A;  3PZ7 A;  4K17 A;  3GOE A;  3NSU A;  1L6V A;  3MFG A;  1C4P A;  4IUM B;  4WJO A;  1XD3 B;  3CIR B;  5E6O A;  4K2P A;  1SJH D;  4KSL C;  4KHO A;  1WGY A;  2K39 A;  3MJ5 A;  1TKY A;  4Y94 A;  1W1D A;  2E6X A;  2BKR B;  1TJE A;  3IXS A;  1UUP A;  4HLE A;  4D2K A;  1WYG A;  1BAK A;  4RM9 A;  1MPH A;  3LXF A;  2LUE A;  4ASW C;  5L81 A;  2GS0 A;  1AQC A;  5EE9 A;  2KQS A;  3BWU D;  3KLS X;  3H7P B;  5HFY A;  1DRO A;  5LXH A;  3W1S C;  5AZG A;  2IO3 B;  3W5V B;  5D3V A;  3ULC A;  2A5U A;  2KT7 A;  3CST A;  5D3X A;  1KJT A;  2SEB D;  4PS8 A;  1RJ2 A;  2ZNV B;  1L0Y B;  4YTM B;  1UWM A;  2GUM A;  4MSQ B;  3OG5 A;  1WI1 A;  2BYF A;  2JRH A;  3AE9 B;  2Y5C A;  3NVZ A;  3I5J C;  2G45 B;  1F9J A;  4J6I A;  3T3N A;  4EUT A;  3Q3M C;  3M63 B;  1C76 A;  3WAO A;  2AL3 A;  2B76 B;  2M17 A;  4GOU A;  1ZW7 A;  2QEJ C;  2KTF A;  4EJN A;  1UPR A;  4NPN A;  4JQW C;  1JWA D;  4TQ0 A;  2JRI B;  2PKO A;  3H7P A;  4GDK B;  2I1K A;  5HE2 A;  3SO6 A;  2YS3 A;  3UGB B;  2LMC A;  1E8Z A;  5C1Z A;  1TBE A;  3B9J A;  1XLO A;  5JZE B;  2YVC A;  4L1R A;  1Q1O A;  2KDB A;  4G3X B;  1K5G B;  1QT9 A;  2KQ4 X;  1N5W A;  4M00 A;  4HKZ E;  3ODX A;  2PLP A;  1I4P A;  1V6E A;  1YN4 A;  4EMO A;  1A5R A;  4IM3 A;  4PK1 A;  5EFX A;  1F1H A;  5FKA C;  4N9F 4;  3UIO B;  1LGR A;  2W3R A;  1PGX A;  3AEE B;  1T77 A;  5DH9 B;  4FJZ A;  1FD6 A;  1FNU A;  1SIJ A;  3APC A;  3U12 A;  3GZN B;  2MA9 B;  4MM3 A;  4AUQ C;  3DXE A;  4L1B A;  2ZCB A;  3TSS A;  4GB9 A;  2YEP B;  1N3H A;  1WE7 A;  1UNR A;  3KUZ A;  4HAU B;  2YSZ A;  2I5C A;  4KGT A;  1XLP A;  5D7G A;  1I4X A;  4FHK A;  3VXW A;  1TKG A;  3AI5 A;  3RI7 C;  3IBE A;  2DYN A;  3GZN I;  1RM6 C;  3Q3J A;  2N23 A;  3L17 A;  1WGH A;  1ZXH A;  2LVO A;  3V6C B;  4AP4 C;  1LB1 A;  1AW7 A;  2WDQ B;  1EVH A;  2DHJ A;  1TIF A;  3LDZ E;  2LRW A;  4EZK A;  2QKL A;  1IRS A;  3AU4 A;  1L6U A;  1P1A A;  1NTY A;  1IGC A;  2QMT A;  4HXD A;  1V89 A;  4BKS D;  3A33 B;  3M3J A;  4II3 B;  1E90 A;  4JPS A;  2G35 A;  1WX9 A;  2KLG A;  3PRP B;  3K9P B;  1V88 A;  4XYC A;  1KZ7 A;  2DTC A;  5FR6 A;  4KHB B;  1FEH A;  2V3S A;  4CHK A;  3PT2 B;  4WWN A;  2KO3 A;  1YX5 B;  4GGQ A;  2OHF A;  2J4X A;  4FA6 A;  1VCB A;  1XEE A;  1FFV A;  4H8S A;  3QJZ A;  1QOA A;  3U4E G;  3F0W A;  2KQ7 A;  3BK2 A;  3NJT A;  1NEK B;  2NBU A;  3V3X A;  5C3J B;  3DXC A;  3DCG A;  4NAM A;  4ANX A;  1OFF A;  4F7U P;  4HAT B;  2LD9 A;  4IDI A;  4B0E A;  3VR8 B;  1P3Q U;  4K2O A;  5FR3 A;  1V5U A;  2KOX A;  3JVZ X;  4ACF A;  2BYV E;  2DZJ A;  4BBN C;  3MDB C;  3HK0 A;  2RDG A;  3FAH A;  1V9J A;  4G0N B;  2BYT A;  2N1V A;  2GBR A;  1WGQ A;  4KHB A;  4L2Y A;  3D32 A;  1TTN A;  2KMC A;  4ZRK A;  2KWC A;  2NPT B;  3Q3F A;  2KIG A;  1JWS D;  1FOE A;  3V5W A;  5JHB A;  3PEG A;  4GNK B;  4KGR A;  1FXI A;  4F7H A;  4IW0 A;  4EOY A;  1K51 A;  4WQM A;  5EE0 A;  4FAD A;  5BO4 B;  2DZI A;  1WXM A;  3L10 B;  3QHT A;  3TEY A;  3B0A A;  3PHX B;  4FLH A;  4KZC A;  3S2A A;  5DPR A;  1D4B A;  5J3Y A;  2D9W A;  1LO5 D;  1V1P B;  5BMG A;  2ZJD A;  2DWQ A;  1RRB A;  5BYS A;  4N6E B;  2DZK A;  1JRO A;  5DPW A;  4NZL B;  2PE9 A;  1YOV B;  4USA A;  4DXA B;  2CU1 A;  1SE2 A;  1F52 A;  4ZRJ A;  4RMA A;  1FFU A;  2KWV B;  2MWN B;  1EF5 A;  1DYN A;  4MJS B;  2LUM A;  1I7H A;  2NPT A;  4ICV A;  4ZRI A;  2V4I B;  1WZ0 A;  3KRW A;  2PVG C;  1U5G A;  1RWS A;  1UGJ A;  1WG7 A;  2W54 A;  4RFB A;  2WX0 A;  1HZ6 A;  4M0W B;  3W2D A;  2W2W A;  1Y5O A;  5DIF B;  3BII D;  2ZVN A;  2L76 A;  3AB5 A;  1V8C A;  1DGJ A;  1XCT L;  3BYY B;  3ML8 A;  3N1Z C;  1I2H A;  4B9K A;  2PZ1 A;  2D10 A;  4LTU A;  5JHH A;  2KLC A;  3K9O B;  1VZ8 A;  1R7S A;  1WM3 A;  3FKY A;  3T3O A;  3BYT B;  3N1X C;  2INP E;  2N9E B;  2IYB A;  3N20 C;  2TSS A;  4L6E A;  4MJS A;  4BKS A;  3FIL A;  2MWS B;  2N9X A;  1DOY A;  2H7E A;  4ZYN A;  3BK1 A;  1G6J A;  2DHI A;  3I63 C;  3TFM A;  3RN9 C;  4IG7 B;  1V97 A;  5JXV A;  3ZNH B;  1IUE A;  3V05 A;  1XT9 B;  2IPK D;  1ENF A;  2WDR B;  3W9C B;  2WU2 B;  4M0W A;  1E7P B;  2QJL A;  1EM7 A;  1TY0 A;  1XCG A;  2ZZP B;  3UQA A;  1WRI A;  4YL8 A;  1B55 A;  1RYJ A;  1MHH E;  1FCC C;  2COC A;  3AJ4 A;  2D3C A;  2W3S A;  1FHO A;  1P98 A;  2KR0 A;  3SV1 A;  1YN5 A;  2RSG A;  4K7W A;  1UNQ A;  1OEY A;  2M1M A;  2AYO B;  4HCP B;  2WS3 B;  2OJW A;  4F7Z A;  3AMZ A;  3EFC A;  1Y19 B;  2BB6 A;  1NI3 A;  1L7Y A;  1BWN A;  3A98 B;  2RMM A;  2WXH A;  5IA7 A;  3CXB B;  4JWS C;  1GOZ A;  2Y8G A;  1WVH A;  4XGA B;  2P0H A;  3VIA A;  5D6J B;  5J3T A;  2G9H D;  1M4V A;  3BVM A;  5AZF A;  2COF A;  3DHH C;  3SFE B;  2M19 A;  1LFD A;  2Y5P A;  1ISN A;  5I2M A;  2RSU A;  3CIK A;  1ZDV A;  3EGR A;  3ZW3 A;  3KRX A;  1ZKH A;  5E6N A;  4KKJ A;  4KKI A;  4A8X C;  2EJ8 A;  1P9D U;  2PJH A;  2L83 A;  3ODO A;  1B1Z A;  4P1B C;  1SF0 A;  3BVZ A;  3B2G A;  1WJN A;  2V3N A;  2NR2 A;  1QZE A;  4KIK B;  2JT4 B;  3AE2 B;  4NAW B;  1NVI D;  2Y8F A;  4HPP A;  5E6P A;  5J18 A;  3DVN V;  4R3D A;  3KQ4 A;  3G9W A;  1B9R A;  1JWU D;  4S17 A;  2DYB A;  2J7Q B;  4FHJ A;  2BVC A;  1LW3 A;  2M0X A;  5CX3 A;  5D27 A;  2AL6 A;  2GB1 A;  4I6N B;  1JQ4 A;  3DHI C;  2DX1 A;  2EKI A;  1HA5 A;  2X38 A;  2KJR A;  1QLB B;  2GBM A;  2M8S A;  4JLC A;  2DZM A;  1VD2 A;  1QQG A;  3AEC B;  3ZLZ A;  1BTK A;  3NVW A;  2CU3 A;  4C7Z A;  2DEN B;  3DBL B;  1FCL A;  3FSS A;  2LRU A;  4ZHO A;  1ZM0 A;  3KW5 B;  1J19 A;  2V76 A;  1GUA B;  1ZXI A;  3Q8B A;  3VFK A;  1V80 A;  1K53 A;  3MHS D;  3KWL A;  2XK5 B;  2RDH A;  4II2 B;  4URK A;  1HZ5 A;  1UGM A;  3OWE B;  1T5X D;  2JZP A;  1MJD A;  4W9G A;  3DBL I;  2R09 A;  3A4R A;  2IO0 B;  1YIW A;  1A70 A;  5DHF B;  2DYQ A;  2MBE A;  2DBY A;  2FAZ A;  2LAS A;  2LGY A;  2N7E A;  2LZ6 A;  4PT5 A;  3UIN B;  2L1A A;  2D2Q A;  1UBQ A;  3QC8 B;  3LJ3 A;  2CR5 A;  2FCN A;  1IYF A;  2XN9 C;  1FM0 D;  4NJC A;  1UH6 A;  5D3W A;  1L5P A;  2NTT A;  1BT0 A;  1PGA A;  4YWG G;  2K8B A;  2KFK A;  3TW1 A;  1JRP A;  1L0X B;  2KZR A;  1SSN A;  2XK5 A;  2OOB B;  3H9D A;  2ZPY A;  4EZJ A;  3O96 A;  2I1J A;  5C2T B;  1WZ3 A;  4WVF B;  3AE7 B;  1UZX B;  1KF6 B;  3PLU A;  3IAS 1;  3ALB A;  2RD0 A;  3SYX A;  3AEB B;  4TSS A;  1MI0 A;  3FC4 A;  3TMP B;  4A3P A;  4DHJ B;  1E8W A;  1TQZ A;  2ZW1 A;  3AE6 B;  4GOC A;  1QF6 A;  2XQN M;  3ZDT A;  4DBB A;  2ELB A;  4GMX B;  4AOF A;  4OVZ A;  4YSY B;  2K25 A;  1DYQ A;  2IY0 B;  1ROE A;  4B0M A;  3UF8 A;  2V9H A;  3MC9 A;  3QBV B;  1C4C A;  1U5F A;  2CY4 A;  1OEY J;  5C5B B;  3N32 A;  1K52 A;  1QKZ A;  2LG1 A;  3R2T A;  2KMM A;  3TCA A;  4ANV A;  2BWE S;  4HKQ A;  3B08 A;  1IPG A;  4N59 A;  1L0V B;  2K3U A;  2EMT A;  4NNJ B;  1E7U A;  3MTN B;  4K1R B;  2L1C A;  2L0T A;  3WAN A;  3HIZ A;  3TVV A;  1GC6 A;  3P4S B;  4QJ3 B;  4US8 A;  5DI9 B;  2FCQ A;  4TYZ A;  5MPO A;  3L08 A;  3JSV A;  1BXT A;  5KCV A;  3BZD B;  4MEM A;  4RM8 A;  3RFZ B;  4MGI E;  5D94 A;  2OQB A;  1AWE A;  4K3B A;  4DDG D;  1QIL A;  3SFD B;  1HQR D;  4MEL A;  5JP4 A;  2IND C;  1E8X A;  2VH2 A;  5IAA C;  3UI3 A;  1DOX A;  1V81 A;  1T6B X;  2QIL A;  5C5B A;  1N61 A;  3PSE B;  3VVW B;  2D9V A;  3ULB A;  3DVG X;  4TV3 A;  1WJ6 A;  4MDK E;  3PV1 A;  3W1Y A;  4EFO A;  2HJ8 A;  2MH7 A;  3SHQ A;  4KDL B;  1I4H A;  4MK0 A;  3ZNZ B;  1DDM A;  2KX3 A;  3SR6 A;  2K6D B;  1WX7 A;  1EO6 A;  2FJU B;  2NVU I;  4GIV A;  4OZB A;  1BUI C;  4HAX B;  2DKP A;  1TT5 B;  3KVF B;  1WXV A;  4GSW A;  2ZW0 A;  2R0D A;  3HQC A;  1KZG A;  3T06 A;  2MP2 A;  3PZD A;  2QCZ A;  2MX2 A;  1WJ1 A;  5M4Y B;  1C3T A;  2G4D B;  1RLF A;  2X8X X;  1U2B A;  4MH0 E;  3AU5 A;  2O2V A;  2D11 A;  1D5Z C;  1YJJ A;  2GBN A;  2YLM A;  2N9P C;  2LHE A;  4B6H A;  1K50 A;  3GB1 A;  2MEK A;  1NTV A;  4XC2 A;  3FEH A;  4FJY A;  4EZL A;  1WGR A;  4A6F A;  4MM3 B;  1SB3 C;  3A4S C;  2YS1 A;  3C0R B;  1QQR A;  2L8J A;  2DA0 A;  5HE3 A;  1GB4 A;  4ZDV A;  1BTN A;  4OHJ A;  1T0Q C;  4A6H A;  2WXI A;  2VH1 A;  4HRS A;  2C60 A;  2JWU A;  1GJZ A;  1OMW A;  2DHK A;  3WAP A;  3I9V 1;  2M14 A;  4RF1 A;  1Q5W B;  1RFA A;  5DPS A;  4BAX A;  2D4Q A;  4YON A;  1TS3 A;  2Z0E B;  3NS1 A;  5J17 A;  5AUI A;  1Q10 A;  3Q8C A;  3GP7 A;  3ZGZ A;  3QWZ B;  3PRZ A;  2RPV A;  1J8C A;  3QCA A;  4K81 A;  1UNP A;  1V5P A;  4WSF A;  3U7D A;  2KTR B;  1T0R C;  3NZS A;  2L2I A;  3ZKJ C;  3PVW A;  2MJ3 A;  1ZUD 2;  4W9D A;  2IYD B;  1WGG A;  1WMH A;  1WWT A;  2J59 M;  2V0G A;  1L4Z B;  1SBB B;  2RDB C;  4F1S A;  3AE3 B;  2UWQ A;  2D9Z A;  2KUQ A;  1WF9 A;  3NZU A;  1F0Z A;  2INC C;  5H8Y E;  3A8Q A;  1MAI A;  3GYO A;  1WH3 A;  1CQV A;  4YTP B;  1GC7 A;  1HTO A;  4QJ5 B;  5IKC M;  5AUK A;  1SHC A;  3PVL A;  4RGT A;  3RNB C;  2IGH A;  1M7R A;  3D8E A;  2BCJ A;  2R61 A;  4AJY B;  2PIA A;  2OJR A;  4HPL B;  2R2O A;  5TR5 A;  3DQV A;  3NWF A;  4WJP A;  1J0G A;  2X18 A;  2DLW A;  3NZ3 A;  5FK9 C;  1XF5 L;  3KY9 A;  4IOI E;  2ELA A;  2KTR A;  4ZYS A;  1E6E B;  3TEW A;  4C00 A;  2WGS A;  4XWX A;  2AQ1 B;  5BYQ A;  5BMI A;  4W9L A;  4WWP A;  4DK5 A;  5HHD G;  1SE4 A;  2JX5 A;  1K8R B;  3VUW A;  2HJ1 A;  4JL9 A;  3VUY A;  2FNJ B;  3NHE B;  1WI0 A;  1PUT A;  5HI1 A;  4RGM A;  3ZRC A;  2OED A;  4BVU C;  4C80 A;  3M1I B;  1E8Y A;  2JYT A;  1FHX A;  3MC0 B;  2KAC A;  3ZTD A;  2HDE A;  4HHV A;  1VZ6 A;  5I2S A;  3TO1 A;  5CLL B;  5IP4 D;  3RPF C;  1YNT E;  3PSC A;  4HK2 A;  2M4N A;  1XO3 A;  2M56 B;  4AQ7 A;  3DBR B;  3WAM A;  2Z0P A;  3KYD D;  3W5U B;  3H6N A;  3P4R B;  4OZA A;  3VOQ A;  1FNV A;  3ZJU A;  3ZQ4 A;  1ZPS A;  4TUU A;  3R7Q A;  5I4D A;  2GCL A;  2UVM A;  2IGD A;  5CHV C;  3A9J A;  1V5M A;  2LKO A;  1P5T A;  2WXF A;  2PW9 A;  3DBR I;  3ZJT A;  2ZNV C;  3Q3N C;  4CHJ A;  4WAF A;  2A4Z A;  1WFY A;  2WXL A;  3U2S C;  4LNK A;  2ROV A;  3BIN A;  2J0J A;  4HDQ A;  1SE3 A;  4MH8 A;  1AN8 A;  2RPQ A;  1I35 A;  1V1O A;  3P2B A;  2AQ2 B;  3R7R A;  1E7V A;  1F2R I;  4OW0 A;  1FGY A;  2MDX A;  2BW2 A;  3P42 A;  3L54 A;  2JZZ A;  5LG4 B;  1ZGU B;  4A90 A;  2L3Z A;  5G2N A;  1UBI A;  4REZ A;  1JRU A;  1FXT B;  2KC1 A;  1UEF A;  4DX9 0;  1I42 A;  1NEN B;  1MIX A;  2DX5 A;  4D6W A;  4HJK A;  1MK9 B;  3DBS A;  4HB3 B;  1Z2M A;  3NWD A;  4C7Y A;  2V1Y A;  4B6W A;  3AUL A;  3RD2 A;  3FVC A;  3OHM B;  3H8H A;  3FIL B;  2WHI A;  4WUR A;  2W2X D;  3A9K A;  4JGH B;  4CYE A;  3ECI A;  4NJ6 A;  1S1Q B;  3ZDM C;  2JPH A;  4OSN A;  1OY2 A;  4KVG B;  4A5K A;  4DXG A;  4P16 A;  1IP9 A;  2K8E A;  4JX1 C;  4AS1 A;  2V4L A;  4A6Q A;  2Y3A A;  4W9I A;  2WNM A;  1PMS A;  3NUH B;  1P0R A;  1SGH A;  2JU6 X;  2N1W A;  1ZDX A;  1C79 A;  4HB0 B;  3Q8A A;  4XE0 A;  3APF A;  2YT2 A;  4IM0 A;  1NDD A;  3L16 A;  3KH0 A;  1JW9 D;  1GNU A;  1V5T A;  2CJN A;  2WXQ A;  2LYD A;  4HAZ B; 
#chains in the Genus database with same CATH homology
 5CLQ B;  4HVB A;  4XZ4 A;  3VTV A;  2LUL A;  4GU2 A;  1FB8 A;  2JUO A;  5C79 A;  3VH3 B;  3RUI B;  3PRE A;  2Y5B B;  2IO1 B;  4LJO B;  3VAW A;  2LJ5 A;  2GJY A;  3V62 A;  2JZ3 B;  3ZVV A;  2KJ6 A;  1WJU A;  2VRW B;  3MJW A;  2Z0D B;  1ZC4 B;  3PLV A;  2LI5 A;  1SIF A;  3PPA A;  2LOZ A;  2KAN A;  5G55 A;  5FI0 A;  2C7M B;  1R4M I;  2HD5 B;  2DAJ A;  2GCJ A;  3TIX A;  3O65 B;  1TXD A;  4Z2N A;  2HTH B;  4GZU A;  2KK8 A;  3WAL A;  3ZRF A;  3CSF A;  2BF8 B;  4NQK E;  1XD4 A;  2DKQ A;  1WJM A;  2COA A;  2K8C A;  2KNB A;  2B3A A;  4CHM A;  2GBJ A;  4A3O A;  3KUC B;  4EEW A;  4LJP B;  5KHQ A;  4GN1 A;  2ADZ A;  2FCM A;  3V60 A;  1WRD B;  2JP2 A;  3ZO5 B;  1YX6 B;  4TKN A;  2KWU B;  2Z59 B;  3RZW C;  2CHX A;  1RRP B;  2HE7 A;  4W9J A;  2HTH A;  1WYW B;  4MSM B;  2W9N A;  3ZIM A;  1GG3 A;  2IO2 B;  1V86 A;  3QAQ A;  2L05 A;  4Z2M B;  1V49 A;  1OTR B;  4HAY B;  3FM8 C;  2P8V A;  2P0F A;  3VTW A;  5J2R A;  2KFK B;  2C9W B;  4NSW A;  3SNH A;  5JHG A;  3RCP A;  2BKF A;  2Q13 A;  3JYU A;  4ANW A;  4MGZ E;  4BFR A;  3VUX A;  2RLO A;  1M94 A;  1YJ1 A;  3DXD A;  3VTU A;  1H4R A;  1TZ1 A;  4M8N A;  2CY5 A;  3TJP A;  3MPX A;  2CHW A;  3ML9 A;  3KSY A;  3H1U A;  1OQY A;  4IWQ A;  1U29 A;  1SE9 A;  3UZT A;  2KXJ A;  2WWZ A;  5DHA B;  1C1Y B;  2D9Y A;  2J0M A;  1AAR A;  3W1S A;  3N3K B;  4HCN B;  1ZC3 B;  1Z5S B;  5C16 A;  1CMX B;  2KDF B;  4FJV B;  2L0F A;  4KHA A;  5AEK B;  4IWP A;  3PTF C;  3D8D A;  2Y7B A;  3ZVR A;  5LON B;  2L7R A;  2KGX B;  2GOW A;  3DPD A;  1OGW A;  5L83 A;  1LXD A;  1XOD A;  3HHM A;  1S3S G;  3JSV B;  1P6S A;  2MBQ A;  2C5L C;  1WE6 A;  4ICU A;  4HB2 B;  4PQ0 A;  3PVU A;  2JWZ A;  4W9E A;  3RCZ A;  3CMM B;  2FJL A;  3IHP C;  3V61 A;  1XQQ A;  2WX1 A;  3F5R A;  2RUK B;  5KQ4 A;  2DN6 A;  2PPH A;  4IC7 B;  4I6L B;  4AJW A;  3WIM A;  2BPS A;  4FBJ B;  4HPM B;  4KV2 A;  2MBB B;  3L13 A;  3PHW B;  4GDL B;  3VHT C;  4F8C B;  1KM7 A;  2DYM A;  3ENE A;  1U5D A;  4GXB A;  3RT3 B;  2M38 A;  2JVC A;  4M8M A;  1YD8 U;  1WIA A;  1WJ4 A;  3EFU A;  4NQL B;  5GMV A;  1T0Y A;  1M7E A;  3KZ1 A;  1V2Y A;  2PE6 B;  2K6Q A;  4KZ0 A;  1YQB A;  5KQ1 A;  2MP2 B;  4DDI D;  1J0W A;  2O2V B;  3U8Z A;  2MBH A;  2MFQ A;  3P6A A;  2KUP A;  1X1M A;  1MIZ B;  4GDL A;  2YT1 A;  2IBI B;  2NZ8 B;  4A6F B;  4WQO B;  1KI1 B;  3SU8 X;  3QX1 A;  1WGU A;  3APD A;  1UPQ A;  3EC8 A;  2QKM A;  3P7Z A;  4IAP A;  5AZH A;  4ANU A;  3IFW B;  2LGX A;  1H10 A;  5GOW B;  3SUZ A;  1OQN A;  2LWP A;  3JW0 X;  2C7H A;  4WJN A;  1I7A A;  1NU2 A;  2KJH B;  2E2X A;  3M95 A;  1XR0 B;  2NBW B;  2YF0 A;  3R66 C;  2K8H A;  2K00 A;  1WMH B;  1EGX A;  2CRF A;  3EHV A;  4A6K A;  4BKG A;  2RNR B;  2NS5 A;  2IFS A;  2EKE C;  5HE1 A;  5FI1 A;  1UEL A;  2CS4 A;  2UZR A;  2I5F A;  2J0K A;  4K7S A;  3QA8 A;  1FGZ A;  1K5D B;  2YT0 A;  5LLI A;  2KMA A;  1PFJ A;  3BY4 B;  4BBK A;  2R2Q A;  3OLM D;  1WX8 A;  3ZNG C;  2RR9 A;  2XBB C;  3SD5 A;  2DHZ A;  2DFK A;  1PQS A;  2YS5 A;  2MKR A;  3OAN A;  2MLB A;  2GBK A;  2L00 B;  1WY8 A;  4GDK A;  1UD7 A;  3TBL D;  3ODW A;  3KYC D;  4WAA A;  2FID A;  3AXC A;  5DCN A;  2O6V D;  2K2J A;  3T8M A;  3OJ4 B;  4F7G A;  1MKE A;  2KC2 A;  3SDL C;  2ASQ A;  3A9J B;  1KOT A;  4W9F A;  1Y8R C;  1WXS A;  2G3Q B;  2ZEQ A;  3GYP A;  4IFS A;  1W1G A;  2XEW A;  3V6E B;  4KSK C;  1L2N A;  4HAW B;  5HKH A;  3NOB A;  3ZNI D;  3X23 A;  3R3M A;  5D2M B;  1U5E A;  1X05 A;  3L0W B;  2LGD A;  3QK0 A;  5J3Q A;  4G50 A;  4HWI B;  3RZF A;  3CF6 E;  2Z0O A;  1V5O A;  1Q0W B;  1WM2 A;  2ZVO A;  3BJI A;  1NI2 A;  4PYU A;  4PNK A;  1WXA A;  2DX5 B;  1HE8 A;  4DHZ E;  4MGK E;  3A1Q B;  2KN5 A;  3DVG Y;  4E71 A;  1WR1 A;  3B1L X;  2UZS A;  4IWO A;  5CTR C;  1U4A A;  3PG7 A;  1KLV A;  1EAZ A;  3A9K B;  2JY6 A;  2LVQ A;  2AWT A;  3X0W A;  5L95 C;  3PP2 A;  2MRP A;  1R4N I;  2LXA A;  2MCN B;  4I6P A;  1E5W A;  3PGE A;  2MQJ A;  4MGY E;  1WGD A;  2O6V B;  2KCJ A;  4BOZ B;  2KVR A;  5JLJ B;  3A1Q A;  2FCS A;  2YRY A;  3IG3 A;  2D9X A;  2D07 B;  2NMB A;  1XKE A;  1NBF C;  4WJ7 A;  2DAF A;  3HW2 B;  2CAY A;  2KHW B;  2Z0Q A;  4JIO U;  3QIJ A;  2IY1 B;  2CKH B;  2JF5 A;  2O6V A;  2ZCC A;  4CO7 A;  3OAW A;  3EEC A;  2N0Y A;  2LOX A;  1TJ6 A;  4DHZ B;  4DWF A;  5C23 A;  1D3Z A;  5DPT A;  1EF1 A;  1X11 A;  2FUH B;  4DBG A;  1FHW A;  4BKT A;  1DDW A;  4KAX B;  3VH4 B;  3IVF A;  1WR6 E;  4KDI C;  3RUL A;  3ZUN A;  1XX0 A;  3DOW A;  3D8F A;  4MT7 A;  1RAX A;  4WJQ A;  2KDE B;  4HAV B;  2OTX A;  2AEH A;  4B95 A;  1PLS A;  1LQB A;  1TGZ B;  2RGN B;  5LXI B;  2N7D A;  4K7U A;  3VDZ A;  3OJ3 A;  4X57 B;  5EDS A;  4OVU A;  1W1H A;  3NY5 A;  3ML4 A;  1DBH A;  1V61 A;  2H7D A;  5HE0 A;  4LCD E;  1MG8 A;  3A8P A;  4W9C A;  4LDT D;  2GMI C;  1Q67 A;  1X1G A;  3HM3 A;  1MK7 B;  3TL5 A;  1ZSQ A;  5KHO A;  3WA0 A;  5LOP B;  3NS8 A;  4HB4 B;  4DHJ D;  1Z87 A;  2P0D A;  4G11 A;  4FUL A;  2PEA A;  2MW5 A;  4E74 A;  3LJU X;  2EC1 A;  2UYZ B;  4DX8 A;  2DYO A;  2KDI A;  2VSZ A;  4E3C A;  4C0A A;  3VQI A;  3PRM B;  2EMS A;  5CHF A;  4OVV A;  5C6R A;  3DBH I;  4NY0 A;  4BOS C;  2ZPN A;  4KIK A;  4W9H A;  1EUV B;  5JHA A;  4NAW A;  3RYT A;  1QC6 A;  2D3G A;  3UQB A;  2KD0 A;  4HDO A;  1DDV A;  1X86 A;  3QWM A;  2BYE A;  2QHO A;  3I3T B;  2NBV B;  2KKC A;  2RVB B;  2WYQ A;  4W9K A;  3T9L A;  2MSE D;  2LXC A;  2IZV B;  1P3R A;  3U30 A;  2BWF A;  2WDT B;  4PS7 A;  2FIF A;  1H8C A;  2VKI A;  3UIP B;  4A20 A;  4IM2 A;  2K1F A;  2MBO A;  5CHW A;  4AWJ A;  4LDT B;  4EKU A;  4GMV A;  2C7N B;  4WWO A;  4GPT B;  4PS3 A;  4D0N B;  2KX0 A;  1LM8 B;  4BBN F;  2LVP A;  4NJ7 A;  4P7I A;  2NCN A;  3QQ8 B;  2K2U A;  2BGF A;  2RGF A;  2ROZ B;  1X1F A;  2REX A;  3DDC B;  3ZTC A;  2CHZ A;  4XX5 A;  3DVN U;  2KFJ A;  5D3Y A;  4TQ1 A;  3QAR A;  2VRR B;  2G4S A;  3WYF B;  1ZVR A;  3N7C A;  3PS6 A;  2COD A;  2W2X C;  3H7S A;  3N30 A;  4IOY X;  3ONS A;  4PYZ A;  3KUD B;  1FAO A;  4MY6 A;  3M62 B;  3HM6 X;  4FN2 A;  2N4F A;  5JH5 C;  1U27 A;  2JXX A;  4K17 A;  3GOE A;  3NSU A;  4IUM B;  4WJO A;  1XD3 B;  5E6O A;  4K2P A;  4KSL C;  4KHO A;  1WGY A;  2K39 A;  4Y94 A;  1W1D A;  2BKR B;  4HLE A;  1BAK A;  4RM9 A;  1MPH A;  2LUE A;  4ASW C;  5L81 A;  2GS0 A;  1AQC A;  2KQS A;  3H7P B;  1DRO A;  5LXH A;  3W1S C;  5AZG A;  2IO3 B;  5D3V A;  3ULC A;  2A5U A;  3CST A;  5D3X A;  1KJT A;  4PS8 A;  1RJ2 A;  2ZNV B;  4MSQ B;  1WI1 A;  2BYF A;  2JRH A;  4J6I A;  2G45 B;  1F9J A;  4EUT A;  3M63 B;  3WAO A;  2AL3 A;  2M17 A;  1ZW7 A;  2KTF A;  4EJN A;  1UPR A;  4NPN A;  4JQW C;  4TQ0 A;  2JRI B;  3H7P A;  4GDK B;  2I1K A;  5HE2 A;  3SO6 A;  2YS3 A;  3UGB B;  1E8Z A;  5C1Z A;  1TBE A;  5JZE B;  2YVC A;  1Q1O A;  2KDB A;  4G3X B;  1K5G B;  3ODX A;  1V6E A;  4EMO A;  1A5R A;  4IM3 A;  5EFX A;  4N9F 4;  3UIO B;  5DH9 B;  4FJZ A;  3APC A;  2MA9 B;  4MM3 A;  4AUQ C;  3DXE A;  2ZCB A;  4GB9 A;  1N3H A;  1WE7 A;  1UNR A;  3KUZ A;  4HAU B;  2YSZ A;  2I5C A;  5D7G A;  4FHK A;  3VXW A;  3AI5 A;  3IBE A;  2DYN A;  3GZN I;  3Q3J A;  2N23 A;  3L17 A;  1WGH A;  2LVO A;  3V6C B;  4AP4 C;  1LB1 A;  1EVH A;  2DHJ A;  3LDZ E;  2LRW A;  4EZK A;  2QKL A;  1IRS A;  3AU4 A;  1P1A A;  1NTY A;  4HXD A;  1V89 A;  4BKS D;  3A33 B;  3M3J A;  4II3 B;  1E90 A;  2G35 A;  1WX9 A;  2KLG A;  3PRP B;  3K9P B;  1V88 A;  1KZ7 A;  2DTC A;  5FR6 A;  4KHB B;  2V3S A;  4CHK A;  3PT2 B;  4WWN A;  2KO3 A;  1YX5 B;  4GGQ A;  4FA6 A;  1VCB A;  4H8S A;  3QJZ A;  3F0W A;  2KQ7 A;  2NBU A;  3DXC A;  3DCG A;  4ANX A;  4F7U P;  4HAT B;  2LD9 A;  1P3Q U;  4K2O A;  1V5U A;  2KOX A;  3JVZ X;  2BYV E;  2DZJ A;  4BBN C;  3MDB C;  3HK0 A;  1V9J A;  4G0N B;  2N1V A;  2GBR A;  1WGQ A;  3D32 A;  1TTN A;  2KMC A;  4ZRK A;  2KWC A;  2NPT B;  3Q3F A;  1FOE A;  3V5W A;  5JHB A;  3PEG A;  4F7H A;  4IW0 A;  4EOY A;  4FAD A;  5BO4 B;  2DZI A;  1WXM A;  3L10 B;  3QHT A;  3B0A A;  3PHX B;  4FLH A;  4KZC A;  3S2A A;  5DPR A;  5J3Y A;  2D9W A;  2ZJD A;  1RRB A;  2DZK A;  5DPW A;  2PE9 A;  4DXA B;  2CU1 A;  4ZRJ A;  4RMA A;  2KWV B;  2MWN B;  1EF5 A;  1DYN A;  4MJS B;  2NPT A;  4ICV A;  4ZRI A;  1WZ0 A;  3KRW A;  1U5G A;  1WG7 A;  2WX0 A;  4M0W B;  2W2W A;  1Y5O A;  5DIF B;  2ZVN A;  2L76 A;  3ML8 A;  1I2H A;  4B9K A;  2PZ1 A;  2D10 A;  5JHH A;  2KLC A;  3K9O B;  1WM3 A;  2N9E B;  2IYB A;  4L6E A;  4MJS A;  4BKS A;  2MWS B;  2N9X A;  2H7E A;  4ZYN A;  1G6J A;  2DHI A;  3TFM A;  4IG7 B;  3ZNH B;  1XT9 B;  1XCG A;  2ZZP B;  3UQA A;  4YL8 A;  1B55 A;  2COC A;  3AJ4 A;  1FHO A;  1P98 A;  3SV1 A;  2RSG A;  4K7W A;  1UNQ A;  1OEY A;  2M1M A;  2AYO B;  4HCP B;  4F7Z A;  1Y19 B;  1L7Y A;  1BWN A;  3A98 B;  5IA7 A;  3CXB B;  2Y8G A;  1WVH A;  2P0H A;  3VIA A;  5D6J B;  5J3T A;  5AZF A;  2COF A;  1LFD A;  1ISN A;  2RSU A;  3CIK A;  3ZW3 A;  3KRX A;  1ZKH A;  5E6N A;  2EJ8 A;  1P9D U;  2PJH A;  3ODO A;  1WJN A;  2NR2 A;  1QZE A;  4KIK B;  2JT4 B;  4NAW B;  2Y8F A;  5E6P A;  5J18 A;  3DVN V;  3G9W A;  2DYB A;  2J7Q B;  4FHJ A;  1LW3 A;  2M0X A;  5CX3 A;  5D27 A;  2AL6 A;  4I6N B;  2DX1 A;  2KJR A;  2GBM A;  2M8S A;  4JLC A;  2DZM A;  1VD2 A;  1QQG A;  3ZLZ A;  1BTK A;  2DEN B;  3FSS A;  2LRU A;  1ZM0 A;  3KW5 B;  1J19 A;  2V76 A;  1GUA B;  3VFK A;  1V80 A;  3MHS D;  2XK5 B;  4II2 B;  4URK A;  1UGM A;  4W9G A;  3DBL I;  2R09 A;  3A4R A;  2IO0 B;  1YIW A;  5DHF B;  2DYQ A;  2MBE A;  2FAZ A;  2LAS A;  2LGY A;  2N7E A;  2LZ6 A;  3UIN B;  2D2Q A;  1UBQ A;  3QC8 B;  3LJ3 A;  2CR5 A;  2FCN A;  1IYF A;  1UH6 A;  5D3W A;  1BT0 A;  2K8B A;  2KFK A;  3TW1 A;  2KZR A;  2XK5 A;  2OOB B;  3H9D A;  2ZPY A;  4EZJ A;  3O96 A;  2I1J A;  1WZ3 A;  4WVF B;  3PLU A;  1UZX B;  3ALB A;  2RD0 A;  3SYX A;  3TMP B;  4A3P A;  4DHJ B;  1E8W A;  1TQZ A;  4GOC A;  2XQN M;  3ZDT A;  4DBB A;  2ELB A;  4GMX B;  4AOF A;  2K25 A;  2IY0 B;  3UF8 A;  3QBV B;  1U5F A;  2CY4 A;  1OEY J;  5C5B B;  3N32 A;  2LG1 A;  3TCA A;  4ANV A;  2BWE S;  3B08 A;  1IPG A;  2EMT A;  4NNJ B;  1E7U A;  3MTN B;  4K1R B;  2L1C A;  2L0T A;  3WAN A;  3HIZ A;  3TVV A;  1GC6 A;  5DI9 B;  2FCQ A;  4TYZ A;  3L08 A;  3JSV A;  5KCV A;  4MEM A;  4RM8 A;  4MGI E;  5D94 A;  2OQB A;  1AWE A;  4DDG D;  4MEL A;  5JP4 A;  1E8X A;  5IAA C;  1V81 A;  5C5B A;  3PSE B;  3VVW B;  2D9V A;  3ULB A;  3DVG X;  4TV3 A;  1WJ6 A;  4MDK E;  3PV1 A;  3W1Y A;  4EFO A;  2HJ8 A;  3SHQ A;  4KDL B;  4MK0 A;  3ZNZ B;  1DDM A;  2KX3 A;  2K6D B;  1WX7 A;  1EO6 A;  2NVU I;  4GIV A;  4HAX B;  2DKP A;  3KVF B;  1WXV A;  4GSW A;  2R0D A;  3HQC A;  1KZG A;  3T06 A;  2MP2 A;  3PZD A;  2MX2 A;  1WJ1 A;  1C3T A;  2G4D B;  1RLF A;  1U2B A;  4MH0 E;  3AU5 A;  2O2V A;  2D11 A;  2GBN A;  2YLM A;  2N9P C;  4B6H A;  1NTV A;  4XC2 A;  3FEH A;  4FJY A;  4EZL A;  1WGR A;  4A6F A;  3A4S C;  2YS1 A;  3C0R B;  2L8J A;  2DA0 A;  5HE3 A;  4ZDV A;  1BTN A;  4A6H A;  2C60 A;  1GJZ A;  1OMW A;  2DHK A;  3WAP A;  2M14 A;  1Q5W B;  1RFA A;  5DPS A;  2D4Q A;  4YON A;  2Z0E B;  5J17 A;  3QWZ B;  3PRZ A;  1J8C A;  3QCA A;  4K81 A;  1UNP A;  1V5P A;  4WSF A;  3U7D A;  2KTR B;  3NZS A;  2L2I A;  3ZKJ C;  3PVW A;  4W9D A;  2IYD B;  1WGG A;  1WMH A;  2J59 M;  4F1S A;  2UWQ A;  2D9Z A;  1WF9 A;  3NZU A;  3A8Q A;  1MAI A;  3GYO A;  1WH3 A;  1GC7 A;  1SHC A;  3PVL A;  1M7R A;  3D8E A;  2BCJ A;  4AJY B;  4HPL B;  2OJR A;  2R2O A;  5TR5 A;  3DQV A;  4WJP A;  1J0G A;  2X18 A;  2DLW A;  3KY9 A;  2ELA A;  2KTR A;  4XWX A;  4W9L A;  4WWP A;  4DK5 A;  1K8R B;  3VUW A;  4JL9 A;  3VUY A;  2FNJ B;  3NHE B;  1WI0 A;  3ZRC A;  4BVU C;  3M1I B;  1E8Y A;  1FHX A;  3ZTD A;  4HHV A;  3TO1 A;  5CLL B;  3PSC A;  4HK2 A;  2M4N A;  3WAM A;  2Z0P A;  3KYD D;  3H6N A;  3VOQ A;  4TUU A;  3R7Q A;  2GCL A;  2UVM A;  5CHV C;  3A9J A;  1V5M A;  2LKO A;  1P5T A;  3DBR I;  2ZNV C;  4CHJ A;  2A4Z A;  1WFY A;  2ROV A;  3BIN A;  2J0J A;  4HDQ A;  2RPQ A;  1I35 A;  3P2B A;  3R7R A;  1E7V A;  1FGY A;  2MDX A;  3L54 A;  2JZZ A;  1ZGU B;  2L3Z A;  5G2N A;  1UBI A;  1JRU A;  1FXT B;  2KC1 A;  1UEF A;  4DX9 0;  1I42 A;  1MIX A;  2DX5 A;  4HJK A;  1MK9 B;  3DBS A;  4HB3 B;  1Z2M A;  2V1Y A;  4B6W A;  3AUL A;  3RD2 A;  2W2X D;  3A9K A;  4JGH B;  4CYE A;  3ECI A;  4NJ6 A;  3ZDM C;  1S1Q B;  2JPH A;  1OY2 A;  4KVG B;  4A5K A;  1IP9 A;  2V4L A;  4W9I A;  1PMS A;  1P0R A;  1SGH A;  2N1W A;  4HB0 B;  3APF A;  4IM0 A;  1NDD A;  3L16 A;  3KH0 A;  1GNU A;  1V5T A;  2LYD A;  4HAZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...