3HK0A

Crystal structure of the ra and ph domains of grb10
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
243
structure length
230
Chain Sequence
KQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWSQQSLLQNFLNSSSSPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSAAPRHLQLLADLEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTSWMTAFRLLKYGMLLYQNYRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 10
publication title Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 230
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3hk0A02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3hk0A01
1V49A 2FJLA 3M63B 3GYOA 2WYQA 5C23A 1WGYA 2O6VA 3TBLD 3PVLA 3NOBA 2M8SA 4NY0A 2PE6B 4MSQB 3TCAA 4W9EA 2L1CA 2BYEA 4WWOA 3KY9A 1R4NI 3UIPB 4BBKA 3ZNZB 2K8HA 5G55A 1RJ2A 2FCQA 2FUHB 1RAXA 3WALA 4ICUA 2K6QA 1WGUA 3DDCB 5LXIB 4DHZE 2GMIC 4KAXB 3D8FA 4DWFA 2P8VA 2FCNA 4XZ4A 4FJZA 5C5BB 4B9KA 3ZIMA 5CHFA 3DXCA 4BKTA 3WAOA 3VIAA 2G35A 3L13A 1WI1A 3HQCA 1EVHA 1U5FA 4K81A 5D3YA 3SYXA 3KZ1A 4KHOA 3Q3JA 3H9DA 3JW0X 2I5CA 2FCSA 2LGXA 2JRHA 2N4FA 3WAMA 4PYUA 2ASQA 3U7DA 1A5RA 1WGQA 3ZTCA 2J0MA 2JPHA 4MGYE 4HCNB 4OVUA 5G2NA 1M7EA 2PE9A 2KGXB 2OJRA 4TQ1A 5E6PA 4NQLB 1WXAA 3EFUA 2D9WA 1WM3A 2XBBC 3KUCB 2DHZA 2V3SA 3QK0A 2D2QA 1PMSA 4BKGA 3RZFA 1X86A 5LOPB 3A8QA 2BPSA 4TKNA 1X1MA 2HTHB 5DCNA 3TJPA 2NBWB 2CS4A 2JZZA 1AWEA 2KHWB 3A1QB 4CHJA 4HVBA 3KSYA 1XQQA 4PS7A 2KTFA 2PZ1A 5CHWA 2XK5B 1PLSA 1Y19B 1I2HA 2ZJDA 2N9XA 2C7HA 5HKHA 1U5DA 4TV3A 2YS5A 1KZ7A 3H6NA 5D3XA 2RSUA 3M3JA 2WDTB 4GIVA 2H7DA 5AEKB 4JIOU 4MM3A 2P0HA 3A9KA 2D10A 4G3XB 1H4RA 3QJZA 4OVVA 3RT3B 2RUKB 1UNPA 3T9LA 3LJ3A 1YX6B 4FN2A 4W9DA 2K39A 3ONSA 5J2RA 2IY1B 4Z2MB 2K00A 1X11A 4CHKA 4FJVB 2DZIA 1KM7A 1XX0A 2A4ZA 2MBEA 2ADZA 2JVCA 4NQKE 4B95A 4NSWA 2LVQA 2KTRB 2L05A 2K2UA 2IZVB 5DHAB 2ZVOA 1EGXA 4HAVB 3ULCA 4DK5A 3KW5B 4MY6A 2LOZA 3PSEB 2MBQA 1V89A 1IPGA 2FNJB 1DYNA 4MH0E 5D27A 5D3VA 2RSGA 3PZDA 2ZNVB 1P98A 2RLOA 2ZCBA 1WZ0A 2DZMA 3DCGA 2IO0B 3ZVVA 2GCLA 3PRMB 1V2YA 3IVFA 2X18A 2QKMA 2MSED 3T8MA 2GCJA 2W2XD 1EF5A 2V1YA 4LJPB 3S2AA 3BJIA 3VXWA 3DBSA 3TO1A 2N1WA 5DPWA 1EUVB 2D4QA 3VVWB 5E6OA 2H7EA 1EO6A 3A8PA 4GN1A 3PVWA 2MBBB 2JRIB 4GU2A 3W1SA 4A6HA 2VSZA 3APDA 3U8ZA 5D7GA 2KCJA 3PGEA 2J7QB 3K9PB 2Z0QA 1V5MA 2L00B 3QWMA 1J0GA 2NPTA 2RR9A 1WJMA 1KJTA 4KVGB 4M0WB 2Y8GA 4K1RB 4II2B 2YS3A 1WX7A 3NZUA 1V5OA 2HJ8A 5EFXA 2L76A 4W9IA 4IM2A 3VHTC 5C1ZA 4H8SA 1Y8RC 2COCA 2M1MA 1BTKA 2D9XA 3KRXA 4LCDE 2BF8B 2GS0A 2UWQA 1WMHB 4IC7B 2W9NA 3QC8B 1LFDA 3VFKA 3BY4B 3RZWC 3RYTA 1LXDA 1WF9A 2LKOA 4A6FA 3PTFC 1V81A 4NPNA 4GMVA 2EJ8A 1Z2MA 2LGDA 4ZYNA 1U29A 3MHSD 1WJ4A 2L0FA 3C0RB 3KH0A 3QCAA 3QAQA 4L6EA 2N23A 4YONA 1MK9B 3M62B 5DPTA 1UPRA 4WSFA 2IYBA 5L81A 2C7MB 4PS3A 2P0FA 3QQ8B 3VOQA 3WYFB 1V80A 4RM9A 2BKRB 1ZVRA 1UBIA 1KZGA 1CMXB 4IG7B 1RLFA 3PG7A 2KWUB 3M95A 1TJ6A 1OY2A 1XD3B 1X1GA 1V5TA 2NMBA 4HATB 4KHAA 3UQAA 2LVPA 1WE6A 4EZJA 3TMPB 2KOXA 4EZLA 4CYEA 2WX1A 4KIKB 3QIJA 2RD0A 2MKRA 3KRWA 1WX8A 1WJUA 1ZM0A 5HE0A 4IWQA 2KWCA 2R2QA 3UZTA 5JHBA 4MDKE 1QC6A 5DHFB 1TGZB 2NZ8B 4II3B 2WX0A 1P5TA 3A33B 1U27A 2DAJA 2I1KA 4KZ0A 2XEWA 3VAWA 1XODA 2OQBA 3ZVRA 2KQSA 3PRZA 2GBNA 3UIOB 2RGNB 2UZSA 2CR5A 4GSWA 2KD0A 4GOCA 4EFOA 1GC6A 2W2WA 3UF8A 2COAA 4EKUA 4KDLB 2LASA 2R0DA 2JXXA 3WANA 2MP2A 2DX5B 4DDGD 4ANXA 1LM8B 1WGRA 5C5BA 1P6SA 2KVRA 4F7ZA 4W9FA 2LYDA 4E3CA 3R3MA 4CHMA 5J3QA 3FSSA 1OEYJ 4PS8A 2KMCA 1WR6E 2YRYA 3DQVA 3B1LX 5AZGA 5C16A 1YQBA 2EMSA 5D6JB 2W2XC 3QARA 3AU5A 3JVZX 3NHEB 2D3GA 3DXDA 2DYMA 2MP2B 3RCPA 4GDKB 3VH3B 1K5DB 2GJYA 3ZNID 1I42A 1FHOA 3ALBA 1J19A 4HB2B 2JP2A 1W1HA 2CY5A 1UEFA 2PEAA 2KQ7A 2BYFA 4K7WA 2JUOA 1Z5SB 2HTHA 4HDOA 2LJ5A 3NS8A 4W9GA 2J0KA 2LRUA 4B6WA 3A1QA 1WFYA 4A3OA 4MGKE 4P7IA 4BFRA 2XK5A 3SU8X 3CIKA 4HAXB 4ZRIA 1ISNA 1U5EA 2MQJA 1UH6A 1FB8A 2D07B 2G3QB 4NAWA 2ELBA 4FLHA 2KDEB 1WR1A 2JWZA 4KZCA 1SE9A 1WXVA 2CHZA 4IWPA 1NTYA 1K5GB 2YF0A 5CHVC 2CODA 2ZCCA 5J3TA 2ELAA 2KWVB 2FIDA 5D94A 1WJ6A 3K9OB 1KLVA 3V6EB 5KQ1A 5EDSA 4XC2A 5LLIA 4MELA 2N9PC 1MIXA 2YSZA 4BVUC 4K2PA 1UNRA 2MX2A 1YD8U 1WM2A 2Z0OA 2DHJA 4TUUA 2Z0EB 4ANWA 4NAWB 1KOTA 3CXBB 4HB0B 1QQGA 2L7RA 3Q3FA 4FA6A 4K7SA 1UZXB 5AZFA 4DHZB 4IAPA 4F7UP 4IM0A 1MG8A 3DVNU 4GMXB 3N3KB 3PHWB 3SDLC 3DVGX 5D2MB 5CLLB 5FR6A 3DXEA 2KTRA 5CTRC 2YT1A 2EC1A 1WY8A 5DH9B 3A9JA 4N9F4 1RFAA 1I35A 1P0RA 3H7PA 3ZRCA 4HAUB 3VTUA 5IAAC 3RUIB 1B55A 3ZNGC 4AJWA 4DHJB 2FIFA 1AARA 4DXAB 3B0AA 3R7RA 4FHJA 1P3RA 5DI9B 2C7NB 1FXTB 2DKPA 3PRPB 4EUTA 2YVCA 3V6CB 1WIAA 4PQ0A 5JLJB 2G45B 3PEGA 2JF5A 4HPMB 1E8XA 4K7UA 1WVHA 1WGDA 5KCVA 1YJ1A 2REXA 1V88A 2KX3A 1M7RA 3OLMD 5J17A 1MKEA 1C1YB 2DHKA 3VDZA 3A9JB 1LQBA 3VUXA 2UVMA 3H7PB 2Q13A 2HD5B 3V60A 4MK0A 3VTVA 2K8CA 1WE7A 3IHPC 2LXCA 2MWNB 4MT7A 2CKHB 2KLCA 3FEHA 2KKCA 4HXDA 1XCGA 3P7ZA 1U2BA 3H7SA 1OGWA 2QHOA 3DBHI 4IOYX 4W9LA 1ZW7A 1E5WA 3EHVA 2DKQA 5KHOA 3SV1A 1D3ZA 2LVOA 1OEYA 1NU2A 3P2BA 2E2XA 2KFJA 5JH5C 5JHGA 3RULA 3PV1A 4LDTB 1WX9A 4XWXA 2RGFA 1EAZA 5LONB 4HPLB 1I7AA 2M38A 5HE2A 4Z2NA 3DPDA 3TW1A 4F8CB 3UQBA 1DBHA 1MPHA 4CO7A 1R4MI 1DROA 1WMHA 5L83A 3OANA 2PJHA 2I1JA 2BGFA 5BO4B 3SHQA 2MDXA 3ODXA 4W9CA 2KMAA 3VQIA 4W9KA 1BWNA 2KK8A 4IUMB 4BBNF 3HIZA 4W9HA 3O96A 4M8MA 2Y5BB 2DYOA 3MPXA 3ZDMC 4GDLA 1GG3A 1MIZB 3VUYA 2L8JA 2Z0PA 4WJNA 4HAYB 3VH4B 4E74A 3ECIA 3DOWA 2M14A 4FHKA 5J18A 1YIWA 5DIFB 1FGYA 1WGGA 1BT0A 5CLQB 3OJ3A 1VD2A 1IYFA 4ASWC 2DYBA 4NJ6A 2DENB 3GOEA 2LXAA 4WJQA 2KJ6A 2IO1B 2DA0A 1G6JA 4HLEA 2DZJA 2K8BA 3HW2B 3PHXB 2BWES 2GBRA 4GDLB 3PREA 3I3TB 2DLWA 5JZEB 3DBLI 4GPTB 3IBEA 2LOXA 4KIKA 4BBNC 2NCNA 1J0WA 2ZZPB 3P6AA 2C5LC 2LI5A 1OMWA 3ML9A 3B08A 3G9WA 1GUAB 1FGZA 1T0YA 2YS1A 3GYPA 1XD4A 2R2OA 3IG3A 2EKEC 4DX90 1E7UA 3W1SC 4GB9A 4B6HA 3CSTA 4URKA 4ZRKA 4WJ7A 1TZ1A 4ZRJA 1BAKA 2AWTA 2A5UA 3JYUA 3AI5A 3ZNHB 3NZSA 2LUEA 1P1AA 4JGHB 1M94A 2CU1A 2BWFA 3RD2A 4JQWC 4I6LB 2O2VB 2Z0DB 4F7HA 3OAWA 1NI2A 2MRPA 4I6NB 3PSCA 2DX5A 4HAWB 4AJYB 1H8CA 4F7GA 2XQNM 2JZ3B 2QKLA 3PS6A 1NBFC 2D9VA 1TBEA 5C6RA 1WXMA 4NNJB 2D11A 1V5PA 5C79A 2M17A 4FBJB 3LDZE 3KVFB 4DHJD 3ZUNA 1YX5B 2V4LA 2L2IA 2JY6A 4MGIE 4MSMB 2KFKA 4HB4B 1PFJA 2Z59B 3WA0A 4KV2A 2NBUA 4GDKA 3KUDB 1V5UA 1UGMA 1ZC4B 3R7QA 2DN6A 3ZLZA 2LWPA 4YL8A 4ZDVA 5TR5A 5FI0A 4WQOB 2KJRA 3BINA 2D9ZA 3EECA 1EF1A 1OTRB 1SGHA 1LB1A 1W1DA 1E90A 2NVUI 1SIFA 3PT2B 2MCNB 2KFKB 2KLGA 3QWZB 3NSUA 4FADA 3KYDD 5LXHA 2KNBA 1WRDB 4IFSA 1W1GA 1JRUA 4G50A 1J8CA 3D8EA 2NR2A 3AULA 3QBVB 2DAFA 4G0NB 3TFMA 4LDTD 1AQCA 4WVFB 2N1VA 4AP4C 2OTXA 1GNUA 4PNKA 3PP2A 3APFA 1WYWB 2O6VB 4IW0A 3N7CA 4GXBA 4GGQA 2KC1A 4AWJA 2IO3B 2KDFB 3RCZA 3SUZA 4HJKA 2B3AA 2LG1A 3ML8A 3CMMB 4D0NB 4K2OA 1S1QB 4JL9A 1GC7A 4HDQA 2J0JA 4LJOB 4JLCA 1E8WA 1K8RB 3HK0A 2KANA 1MK7B 1WG7A 1V61A 4ANUA 2YT0A 1FHXA 1X05A 2CRFA 4DDID 2AYOB 2N0YA 3ODWA 1U5GA 4RM8A 2AEHA 2UYZB 2KO3A 3GZNI 1IP9A 3ZDTA 1WJ1A 3ZO5B 1WH3A 4TQ0A 2VRRB 1F9JA 4C0AA 3JSVA 4BOSC 4MJSA 1WXSA 4BKSD 4HK2A 1TTNA 3CSFA 1V86A 5KHQA 1WJNA 4F1SA 4GZUA 2IFSA 2AL6A 2DTCA 4NJ7A 5HE1A 2NBVB 2PPHA 5J3YA 2DHIA 4MGZE 2BKFA 4IM3A 3D8DA 3WIMA 1Q5WB 4WWNA 1Q0WB 2IO2B 2KUPA 2M4NA 2DX1A 3JSVB 4MJSB 3PLVA 3ODOA 4G11A 2AL3A 1WZ3A 4FULA 5E6NA 3F0WA 5D3WA 2ZVNA 2JT4B 1MAIA 3L16A 2YLMA 3R66C 2V76A 1FAOA 3QA8A 4RMAA 1E7VA 3ZRFA 4HHVA 2IYDB 3EC8A 2L3ZA 3ZTDA 1ZC3B 2GBJA 1XT9B 2CHWA 2WWZA 2KZRA 3V61A 3T06A 4TYZA 1UBQA 5GMVA 1S3SG 1NTVA 3A9KB 2VRWB 3SO6A 3HM6X 2K6DB 1RRPB 4HAZB 3IFWB 3ULBA 3L17A 5JHAA 1VCBA 4DX8A 3KUZA 4ANVA 3SNHA 4KHBB 4PYZA 4A20A 2ROZB 2MA9B 3HHMA 2K2JA 2C60A 2LRWA 2M0XA 2MW5A 5IA7A 3HM3A 1Q1OA 1SHCA 3OJ4B 4BKSA 2ZEQA 3L0WB 1OQYA 1ZGUB 4MEMA 3MJWA 1Z87A 1V9JA 3AU4A 1IRSA 3SD5A 2GOWA 2COFA 2LD9A 5GOWB 2HE7A 3W1YA 2K25A 2ZNVC 2MFQA 2NS5A 1OQNA 2Y7BA 5DPSA 2D9YA 1C3TA 3N30A 4E71A 4J6IA 1HE8A 4DBGA 2C9WB 2J59M 1L2NA 2RNRB 3L54A 1Q67A 1TQZA 3A98B 2N7DA 5L95C 3PVUA 1FOEA 1TXDA 2KDIA 1H10A 4A6KA 2GBMA 2RPQA 4EOYA 1LW3A 4K17A 2MBOA 2KJHB 4ICVA 1X1FA 3M1IB 3AXCA 4EZKA 3AJ4A 2IY0B 2LGYA 1RRBA 3A4RA 1WGHA 4I6PA 2CAYA 2O6VD 1NDDA 1L7YA 2GBKA 2I5FA 2DFKA 2CY4A 3TL5A 1ZSQA 4HB3B 1FHWA 3N32A 5KQ4A 2O2VA 2NPTB 4IWOA 1QZEA 1WI0A 1V6EA 3U30A 3VUWA 3TIXA 5JP4A 5HE3A 2N7EA 3TVVA 2G4DB 1P9DU 3VTWA 1PQSA 4BOZB 2KXJA 3ZKJC 4M8NA 3UINB 4X57B 3LJUX 4KSLC 2OOBB 5JHHA 4HWIB 4WJPA 4A3PA 4KDIC 2CHXA 2UZRA 3WAPA 2KN5A 2P0DA 1UD7A 2DZKA 4AUQC 1GJZA 5DPRA 4DBBA 2FCMA 3X0WA 2LULA 4AOFA 3MTNB 2LZ6A 3L08A 1N3HA 1E8YA 2BCJA 1UELA 2DYNA 3DVGY 4EMOA 4EJNA 4KSKC 4W9JA 2FAZA 2N9EB 3QX1A 1Y5OA 4A6FB 1P3QU 3DBRI 3F5RA 3PLUA 3MDBC 3V5WA 3DVNV 2EMTA 1XR0B 2K1FA 4FJYA 3L10B 2KC2A 5FI1A 4WJOA 1U4AA 1DDVA 2IBIB 3X23A 2ZPYA 3APCA 2DYQA 3D32A 2RVBB 3ENEA 5AZHA 2MWSB 3A4SC 1ZKHA 2BYVE 5CX3A 3NY5A 3QHTA 4Y94A 1DDMA 3O65B 4WWPA 3FM8C 2VKIA 3KYCD 4A5KA 2MLBA 2KX0A 4WAAA 3V62A 2KDBA 3ML4A 1KI1B 2Y8FA 3ZW3A 1E8ZA 2ROVA 1XKEA 3PPAA 3H1UA 2G4SA 2R09A 1UPQA 4XX5A 4EEWA 2ZPNA 1BTNA 2MBHA 4HCPB 1UNQA 3CF6E 1DDWA 2L0TA 3UGBB
chains in the Genus database with same CATH superfamily
1V49A 5H8YE 2FJLA 3M63B 3GYOA 4HJGE 2WYQA 5C23A 1WGYA 2O6VA 1N5WA 3TBLD 3PVLA 3NOBA 2M8SA 4N59A 4NY0A 4D6WA 1C4CA 3HRDD 3ZJTA 2PE6B 2N9LA 4MSQB 1QOBA 3TCAA 4W9EA 3BK1A 2L1CA 1T6BX 3FILA 3DHIC 2H88B 2BYEA 4WWOA 3KY9A 1R4NI 3HUIA 1Y56A 2DLBA 3UIPB 1I7HA 4BBKA 3ZNZB 2K8HA 2N7JA 5G55A 3FVCA 1RJ2A 1BMLC 2FCQA 4HRSA 1FNUA 2FUHB 1RAXA 5I2MA 1HXYD 1RFKA 3WALA 4ICUA 2K6QA 1WGUA 3DDCB 5LXIB 4DHZE 1L0XB 2K3UA 3DBHB 2GMIC 4KAXB 1QQRA 3D8FA 2R2YA 1WGKA 2QJLA 1LO5D 4DWFA 2P8VA 2FCNA 4JWUC 3U2SC 5BMHA 1QF6A 4XZ4A 4FJZA 4RGMA 3U4EG 2BTEA 5C5BB 4B9KA 3ZIMA 5CHFA 3TEYA 3DXCA 1TKYA 4BKTA 3WAOA 3VIAA 3RNEC 4KKJA 2G35A 3L13A 1WI1A 2HDEA 2YEPF 3HQCA 1EVHA 1U5FA 4K81A 5D3YA 3SYXA 3AEEB 3KZ1A 4KHOA 3Q3JA 4US9A 3H9DA 3JW0X 2I5CA 2FCSA 4GNKB 2LGXA 2JRHA 2N4FA 4AQ7A 1C4AA 3WAMA 4PYUA 4FXCA 2ASQA 1R4MB 3U7DA 1ZOYB 1A5RA 1WGQA 2J0MA 2JPHA 2N0SB 4MGYE 3ZTCA 4HCNB 4OVUA 4RGOS 3P4QB 1M7EA 5G2NA 2PE9A 1TS4A 3AE9B 1K51A 2KGXB 2GI9A 2OJRA 4TQ1A 4NQLB 5E6PA 4LTUA 1WXAA 3EFUA 2D9WA 3NWDA 1WM3A 2Y5CA 2XBBC 3KUCB 5BYQA 2DHZA 2V3SA 1SE3A 3QK0A 2D2QA 1PMSA 1GPXA 2LFIA 4BKGA 3RZFA 1X86A 5LOPB 1L0YB 3A8QA 2BPSA 4RH6A 4TKNA 1X1MA 1C77A 2EKIA 3ZXVA 2ZKMX 2HTHB 5DCNA 3AMZA 3TJPA 2NBWB 2CS4A 2JZZA 1ET6A 1AWEA 4YSYB 2KHWB 3A1QB 4CHJA 4HVBA 3KSYA 1XQQA 4PS7A 1WYGA 2KTFA 2PZ1A 1T5XD 5CHWA 2JQRB 2XK5B 2V0GA 1PLSA 2LGIA 1Y19B 1I2HA 1EM7A 2ZJDA 3RN9C 2N9XA 2C7HA 5HKHA 1SB3C 1U5DA 4TV3A 3ZQ4A 4EE2A 2YS5A 1KZ7A 5BYSA 1PYWD 2JYEA 3H6NA 5D3XA 2RSUA 1E0ZA 1ZXHA 3DCXA 3M3JA 2WDTB 4GIVA 1D5MC 2H7DA 5AEKB 4JIOU 1FCCC 2MJEA 2OHFA 4MM3A 2WXHA 2P0HA 1FFUA 3A9KA 1R7SA 3DBLB 2D10A 3AV8A 4G3XB 1H4RA 3QJZA 4OVVA 3RT3B 2RUKB 1UNPA 4TMAB 3T9LA 3LJ3A 1YX6B 4C56C 3AE1B 3AE7B 4FN2A 4W9DA 2K39A 2I38A 3ONSA 1DOYA 5J2RA 2IY1B 4Z2MB 2D5GA 1NYRA 4Q2JA 2K00A 5TSSA 1X11A 3AE4B 4CHKA 4FJVB 1I4GA 2DZIA 1KM7A 1I4HA 1XX0A 1T0RC 2A4ZA 2MBEA 1D6EC 2ADZA 2WDVB 2JVCA 4MM3B 1WSPA 2LEKA 3N1XC 3SR6A 4NQKE 4B95A 4NSWA 2LVQA 4IKGA 1RYJA 3AE3B 2KTRB 3I57A 2L05A 4H2AA 2K2UA 2IZVB 1M4VA 5DHAB 2ZVOA 1EGXA 4HAVB 3B77A 3ULCA 4DK5A 3KW5B 4MY6A 2LOZA 3PSEB 2MBQA 2K22A 1V89A 1IPGA 2D3CA 2K49A 2FNJB 3AH7A 1F1HA 1DYNA 4MH0E 2WXLA 2WXKA 5D27A 5D3VA 2RSGA 3PZDA 2ZNVB 1P98A 2RLOA 1D4BA 2ZCBA 1WZ0A 1LGRA 2DZMA 3DCGA 2IO0B 1SE4A 2KWDA 2WGSA 3AEFB 3ZVVA 2BYTA 2GCLA 1C79A 4YT0B 3PRMB 1HQRD 1V2YA 3GB1A 2X18A 3IVFA 4ZOHC 2QKMA 2MSED 3NS1A 3TEXA 3T8MA 3RFZB 2GCJA 1NEKB 2IGGA 2M0AA 4ZRPA 2W2XD 1IBXB 1EF5A 2V1YA 3A58A 1EWCA 4RGTA 4LJPB 4ZYSA 3E56A 1EU3A 3S2AA 3FAHA 5IP4D 1VLBA 3BJIA 3VXWA 3DBSA 3TO1A 2N1WA 5DPWA 1EUVB 4XWTA 2D4QA 3VVWB 5E6OA 2R61A 2H7EA 1T77A 1EO6A 5T8IA 3A8PA 4GN1A 5H92C 1FPYA 3PVWA 2MBBB 2JRIB 2NTSA 2JYTA 4GU2A 2OJWA 3W1SA 4A6HA 2VSZA 3APDA 3U8ZA 5D7GA 2KCJA 3VR9B 3PGEA 2J7QB 2WXJA 3K9PB 5D3IB 2Z0QA 1V5MA 3TSSA 2L00B 3QWMA 2JZPA 1J0GA 1DGJA 1XF5L 2NPTA 2RR9A 1WJMA 1KJTA 4KVGB 4LNOA 1NI3A 4M0WB 2Y8GA 5IN7A 3NRZA 2WNMA 4K1RB 3ETRA 4II2B 2YS3A 1WX7A 3NZUA 1UGJA 2I2YA 1JALA 1V5OA 3ZJUA 4NJCA 4ZHPA 2HJ8A 2WU5B 5EFXA 3DHGC 2L76A 4W9IA 4IM2A 3VHTC 5C1ZA 4H8SA 1Y8RC 1KFYB 1CQVA 2KMMA 2Z13A 2COCA 2LJIA 2E6XA 2M1MA 1BTKA 2D9XA 3KRXA 1PDXA 1XO3A 4LCDE 2BF8B 2GS0A 1A70A 2UWQA 1WMHB 2LHDA 4IC7B 2W9NA 4ZRQA 3C19A 3QC8B 1CK1A 1LFDA 3VFKA 3Q3MC 3BY4B 3RYTA 1LXDA 1WF9A 3RZWC 1BXTA 2LKOA 4A6FA 3PTFC 4N6EB 3C8YA 1V81A 4NPNA 2WXPA 4GMVA 3P42A 3W5VB 4XDDA 4C4VB 2EJ8A 3J9CA 1Z2MA 3Q8EA 2NMQA 2LGDA 4ZYNA 1U29A 3SFDB 1PGBA 3OHMB 1ESFA 3MHSD 1WJ4A 2L0FA 3C0RB 2V3PA 3KH0A 2W3RA 3QCAA 3KQ4A 3QAQA 2BS3B 4L6EA 2N23A 4YONA 1MK9B 3M62B 4LLGM 1VZ8A 5DPTA 1UPRA 4WSFA 1QOFA 2IYBA 2RDGA 4RF1A 4D2KA 3CWIA 3AE6B 2OEDA 5L81A 2C7MB 1N63A 4PS3A 2P0FA 3QQ8B 3VOQA 4WURA 3ZXRA 3WYFB 4C7YA 1UWXA 1V80A 3SEBA 3Q8BA 4RM9A 2MH7A 3FKYA 2BKRB 1ZVRA 1UBIA 1KZGA 1CMXB 4IG7B 1RLFA 4OVZA 3PG7A 2PW9A 2KWUB 1B1ZA 1SSNA 3AE8B 4CSQA 3M95A 1TJ6A 4L1BA 1OY2A 2INCC 1XD3B 1X1GA 4PT5A 1V5TA 2V9HA 2NMBA 4HATB 3ZJVA 4KHAA 2GB1A 3UQAA 2LVPA 1WE6A 4EZJA 1AW7A 1QKZA 3TMPB 2KOXA 3WCQA 1FD6A 4EZLA 4CYEA 2WX1A 4DXFA 4KIKB 3QIJA 2RD0A 2MKRA 1SIJA 2D3AA 3KRWA 1WX8A 1WJUA 4GLSC 1D5ZC 1ZM0A 1V1OA 4P1CC 5HE0A 4IWQA 2KWCA 2R2QA 3UZTA 3Q8CA 5JHBA 4MDKE 1XLOA 1QC6A 5DHFB 3TUOA 1XLNA 1TGZB 4JPSA 2NZ8B 1HEZE 1MJDA 2NTTA 2WX0A 4II3B 2XNAC 5HI1A 1P5TA 3A33B 1U27A 2DAJA 2I1KA 4KZ0A 2XEWA 3VAWA 5BYRA 1P7FA 1N5XA 1XODA 2OQBA 3ZVRA 2KQSA 3PRZA 2GBNA 3UIOB 1JRPA 2AX5A 2RGNB 2KT7A 2UZSA 2CR5A 1FMAD 2KD0A 4GSWA 4GOCA 4EFOA 1GC6A 2W2WA 3UF8A 2COAA 4EKUA 4KDLB 4C7ZA 2LASA 2R0DA 2WXMA 2JXXA 3WANA 2KAJA 2WXGA 2GRIA 1TY2A 2MP2A 2DX5B 4ACFA 4DDGD 2QMTA 1L4DB 2MEKA 4ANXA 1LM8B 3VR8B 4HEA1 4QXAB 1F0ZA 1MHXA 1WGRA 1UF0A 4YTMB 5C5BA 1P6SA 2KVRA 4F7ZA 1VZ6A 1K52A 1HZ6A 4W9FA 3UGBB 2LYDA 1XXGA 5HG2A 3IAM1 1E7PB 4E3CA 3R3MA 4CHMA 1MVKA 5J3QA 3FSSA 2WP9B 1OEYJ 4PS8A 2KMCA 1WR6E 3H8HA 2YRYA 1DOIA 3DQVA 5EE0A 3B1LX 4XGAB 2SEBD 5AZGA 1KH0A 3HVDA 5C16A 4WQMA 1YQBA 2EMSA 1EWYC 1FRRA 5D6JB 4B0EA 1VDVA 2INPE 4B0MA 2BBCA 2LGSA 2W2XC 3QARA 3AU5A 3JVZX 3NHEB 3MC9A 2D3GA 3DXDA 1QOGA 2DYMA 2MP2B 1XLPA 3RCPA 4GDKB 3VH3B 1C4PA 1K5DB 2GJYA 3ZNID 1I42A 1FHOA 5LG4B 3NUHB 2IDYA 1WWTA 1J19A 3ALBA 4HB2B 1KLGD 2JP2A 1FEHA 1W1HA 4REZA 2CY5A 1XCTL 1UEFA 2PEAA 1TY0A 2KQ7A 3RPFC 2Z4DA 2BYFA 1FM0D 4K7WA 2L52A 4L23A 2JUOA 1Z5SB 2HTHA 4HDOA 2LJ5A 3NS8A 4W9GA 3V05A 3N1ZC 3EA6A 2ON8A 2J0KA 2LRUA 4B6WA 3A1QA 1KF6B 1WFYA 4A3OA 4MGKE 4P7IA 1RWSA 3DWMA 4BFRA 4M00A 2XK5A 1F77A 3SU8X 3CIKA 4HAXB 2WQYB 4R3DA 4ZRIA 1JCKB 4LNIA 2W3SA 1ISNA 1U5EA 2MQJA 1UH6A 1ZXIA 1GOZA 4YTNB 1FB8A 3NWAA 3U12A 2D07B 2G3QB 4NAWA 2ELBA 2YEPB 4FLHA 2KDEB 1WR1A 4YSZB 5IO9A 2JWZA 1QLBB 2LMCA 1AN8A 1SE9A 1WXVA 2CHZA 4IWPA 1NTYA 4KZCA 4DXGA 4OHJA 1K5GB 2YF0A 5CHVC 2CODA 1FRDA 2KUQA 2ZCCA 1FFVA 5J3TA 2ELAA 2KWVB 2FIDA 2WS3B 3NWFA 5D94A 2Z8LA 1WJ6A 2QC8A 3K9OB 1KLVA 3V6EB 1XLQA 3KWLA 5KQ1A 5EDSA 4XC2A 5LLIA 1MFWA 3NVZA 3MC0B 4C00A 1HTQA 2JWUA 4MELA 2N9PC 1MIXA 2YSZA 4BVUC 4K2PA 1UNRA 2MX2A 1YD8U 1WM2A 2Z0OA 2IJ0A 2DHJA 4OT1A 4TUUA 4S0RA 4KGSA 2Z0EB 4ANWA 4NAWB 1KOTA 3CXBB 4J3OD 4HB0B 1QQGA 2L7RA 1ACCA 3Q3FA 1YN5A 3MFGA 3BVZA 4FA6A 4K7SA 1UZXB 5AZFA 5C2TB 4DHZB 4IAPA 4F7UP 4IM0A 2BW2A 1MG8A 3DVNU 4GMXB 3N3KB 3PHWB 3SDLC 3DVGX 4YTPB 1YJJA 5G5HA 5D2MB 5CLLB 5FR6A 3DXEA 2KTRA 5CTRC 2YT1A 3RI7C 2EC1A 1WY8A 5HFYA 4K3BA 5DH9B 3A9JA 4N9F4 4QAYA 1RFAA 1I35A 1P0RA 3H7PA 3ZRCA 4HAUB 3NVWA 3DHHC 3IT4B 3VTUA 5IAAC 1CJEA 3RUIB 1B55A 4WH4A 3ZNGC 4AJWA 4DHJB 2FIFA 1AARA 2G9HD 4DXAB 3B0AA 3R7RA 1HA5A 1I4PA 4FHJA 1P3RA 5DI9B 2C7NB 1FXTB 2DKPA 3BYYB 3PRPB 4EUTA 2YVCA 3V6CB 1ZE3D 1WIAA 2VZKB 4PQ0A 2CU3A 5JLJB 5I4DA 2K8EA 2G45B 3PEGA 2JF5A 1SJED 1E8XA 4HPMB 1CZPA 4K7UA 4PK1A 1WVHA 1WGDA 2L32A 3VRAB 5KCVA 1YJ1A 1V97A 2REXA 1V88A 2KX3A 3AEBB 5FKAC 4BAXA 1IBXA 1M7RA 3OLMD 2WDQB 4AS1A 5J17A 1MKEA 1C1YB 2DHKA 1P7EA 3VDZA 4S17A 3A9JB 1LQBA 2UVMA 3VUXA 3H7PB 3DBRB 2Q13A 2MJ3A 2HD5B 3V60A 4MK0A 1SF0A 1C9FA 3VTVA 1VZ7A 2K8CA 1WE7A 3IHPC 1UNSA 1JQ4A 2LXCA 2MWNB 3R2IA 4MT7A 2CKHB 2KLCA 3FEHA 2KKCA 2WXOA 4QJ5B 1IUEA 3NVYA 4HXDA 4ZHOA 1XCGA 3P7ZA 2RPVA 4MT5A 1U2BA 3H7SA 4P1BC 1UWMA 3MJ5A 1OGWA 3IXSA 2QHOA 3DBHI 4IOYX 4W9LA 1E6EB 1ZW7A 2KIGA 1L4ZB 1E5WA 3EHVA 4ARCA 4ITKA 2DKQA 2X8XX 5KHOA 4M0WA 1FCLA 3SV1A 1ET9A 3PZ7A 1D3ZA 1ZDXA 2LVOA 1OEYA 3GE8C 1NU2A 3P2BA 2E2XA 2KFJA 2YT2A 5JH5C 3RNAC 5JHGA 1N61A 1V1PA 3RULA 3PV1A 4RF0A 1T3QA 4LDTB 3KLSX 3I5JC 1WX9A 4XWXA 2KQ4X 1YQ3B 1EAZA 2RGFA 5LONB 4HPLB 1I7AA 2M38A 5HE2A 4Z2NA 1ROEA 3DPDA 2L1AA 1PFDA 3TW1A 4F8CB 4YSXB 3UQBA 1DBHA 1MPHA 4CO7A 1R4MI 3I63C 1DROA 4JWSC 2N9KA 1D5XC 1IGCA 1WMHA 5L83A 4RFBA 3OANA 2PJHA 2I1JA 2AQ2B 2BGFA 5BO4B 3SHQA 2MDXA 3ODXA 4W9CA 2KMAA 3VQIA 4W9KA 1TS3A 1BWNA 3RNFC 2KK8A 4IUMB 4BBNF 3B9JA 3HIZA 4W9HA 3O96A 1N60A 4M8MA 2X38A 2Y5BB 2QSDA 1WRIA 4C4VA 2DYOA 3MPXA 5G5GA 3ZDMC 4GDLA 1GG3A 1MIZB 1MI1A 3RNGC 3VUYA 2L8JA 2Z0PA 4P6VF 4WJNA 4HAYB 2UU7A 3VH4B 3Q3NC 1KTKA 4IOIE 4E74A 3ECIA 1V1PB 1WXQA 2WXFA 3DOWA 2M14A 4KKIA 2KN4A 4FHKA 3P4SB 4UDUC 5J18A 1J7AA 3VRBB 1YIWA 5DIFB 1T0SC 1FGYA 1R4NB 1WGGA 1BT0A 5CLQB 3OJ3A 1VD2A 1IYFA 1L5PA 1OQQA 4ASWC 2DYBA 3PO0A 4NJ6A 2DENB 3GOEA 1F2RI 2LXAA 4WJQA 2KJ6A 3BIID 1IGDA 2IO1B 2DA0A 1G6JA 4HLEA 2DZJA 2FE8A 2K8BA 3O13A 3HW2B 3PHXB 3W5UB 2BWES 4MH8A 4GOUA 2GBRA 4GDLB 5BMGA 3PREA 3AEGB 4M01A 1TS5A 4TSSA 3I3TB 2DLWA 5JZEB 3DBLI 1TT5B 4GPTB 3BK2A 1TYGB 3IBEA 2LOXA 4KIKA 4BBNC 2NCNA 1J0WA 2ZZPB 3P6AA 2C5LC 2LI5A 4DQOC 1OMWA 3ML9A 3B08A 3BVGA 3BYTB 3G9WA 2PLPA 1GUAB 1FGZA 1T0YA 2YS1A 3GYPA 1XD4A 2R2OA 3IG3A 4A55A 5BMIA 1N62A 3GZNB 5EE1A 5FR3A 2EKEC 4DX90 4N58A 1E7UA 1SE2A 3W1SC 2FUG1 4GB9A 4B6HA 3CSTA 2QEJC 4URKA 4ZRKA 2WLBA 1E9MA 4WJ7A 5C3JB 1TZ1A 3N20C 4ZRJA 1BAKA 1NENB 2AWTA 2A5UA 4HPPA 3JYUA 3AI5A 3OWEB 4P16A 3ZNHB 3GP7A 3NZSA 2LUEA 1ZYIA 1P1AA 1VR9A 4JGHB 1M94A 2CU1A 2BWFA 2JSVX 3RD2A 4JQWC 4I6LB 2O2VB 2RMMA 2Z0DB 2Z59A 4F7HA 3OAWA 3U7ZA 1NI2A 2MRPA 4I6NB 1E10A 4YWGG 3PSCA 2DX5A 4OW0A 4USAA 4HAWB 4AJYB 2W54A 1N6ZA 2WXQA 1JMLA 4K3CA 1H8CA 4F7GA 2XQNM 2JZ3B 2JU6X 3RMKC 2QKLA 5AUIA 1SXTA 3PS6A 3B2FA 3E9SA 1NBFC 2D9VA 1TBEA 5C6RA 1WXMA 1KLUD 1NVID 1NYQA 1TS2A 5IOIA 3N9YC 4NNJB 2D11A 3EGRA 1V5PA 5C79A 2D3BA 2M17A 4FBJB 3LDZE 3KVFB 1FXIA 2RDBC 4DHJD 3BWUD 3ZUNA 2GLSA 1YX5B 2V4LA 2L2IA 2JY6A 4MGIE 4MSMB 2KFKA 4HB4B 4NAMA 2K9XA 3AB5A 2VZKD 1PFJA 2K0PA 2Z59B 3P4RB 1V8CA 3WA0A 5D3DA 3NG0A 3ZYYX 1DOXA 4KV2A 2NBUA 3RNBC 4GDKA 5JXVA 3KUDB 2KVZA 1V5UA 3AM9A 1UGMA 1ZC4B 1YOVB 4LNNA 3R7QA 2DN6A 3ZLZA 2W82A 2LWPA 4YL8A 4ZDVA 5TR5A 5FI0A 1KRHA 4KX6B 4WQOB 2Z14A 2KJRA 3BINA 2D9ZA 4HKZE 3EECA 1I4XA 1EF1A 1OTRB 1SGHA 1LB1A 1W1DA 2IGDA 2E3TA 1E90A 2NVUI 3GE3C 1SIFA 1PGXA 3PT2B 1VRAB 2MCNB 4CQNA 3NVVA 2KFKB 5EE9A 2KLGA 3QWZB 3NSUA 4FADA 3KYDD 5LXHA 2KNBA 1WRDB 2FJUB 4IFSA 1W1GA 1QOAA 1JRUA 4G50A 1JWUD 2IPKD 2LUMA 2KIEA 1J8CA 1FNWA 2PKOA 3D8EA 2NR2A 1YN3A 3AULA 3MC8A 2ZW0A 4OSNA 3PZ8A 3QBVB 5GXGB 2GUMA 2J53A 3IT6B 2DAFA 4G0NB 3TFMA 4LDTD 1AQCA 4WVFB 2N1VA 4AP4C 2OTXA 1GNUA 4PNKA 3PP2A 3URYA 3APFA 1WYWB 2O6VB 3GS2A 4IW0A 3N7CA 4GXBA 1L6UA 2KC1A 4GGQA 4AWJA 2IO3B 3HSAA 4BZAA 2KDFB 3RCZA 4XYCA 3SUZA 3LB8C 4HJKA 2B3AA 1OFFA 2LG1A 3ML8A 3CMMB 1TZOA 4D0NB 2SAKA 3P63A 5IKCM 4K2OA 1S1QB 4JL9A 2NBVA 1GC7A 4HDQA 2J0JA 4LJOB 4JLCA 1E8WA 3NW8A 1K8RB 3FILB 3HK0A 2KANA 3AEAB 2QDFA 1MK7B 1WG7A 1V61A 4ANUA 2YT0A 1FHXA 1X05A 4JX1C 2CRFA 4DDID 2AYOB 2N0YA 1F52A 3ODWA 1U5GA 4RM8A 3DWGC 3LYYA 2PTLA 2AEHA 2UYZB 2KO3A 2ACZB 3GZNI 1IP9A 3ZDTA 1WJ1A 3ZO5B 1WH3A 4WWMA 4TQ0A 2VRRB 1F9JA 4C0AA 4XE0A 3JSVA 4BOSC 1TJEA 1YQ4B 4MJSA 1WXSA 3MP9A 4BKSD 2M56B 4HK2A 2BS4B 1YNTE 2MJDA 1ZPSA 1TTNA 2PMVA 2VH1A 4QJ3B 1T0QC 3CSFA 2KR0A 3Q8AA 1V86A 5KHQA 1WJNA 4F1SA 1ZDVA 2BB6A 3Q14C 3Q3OC 2JX5A 4GZUA 2IFSA 2AL6A 2DTCA 4NJ7A 5HE1A 2NBVB 4DIXA 2PPHA 1MPEA 1K53A 5J3YA 2JXTA 3AEDB 2DHIA 1YN4A 4MGZE 2J4XA 2BKFA 4A6QA 4ARIA 2Y3AA 4QJ4B 1DYQA 4IM3A 2AQ1B 1FXAA 4OZAA 3D8DA 3WIMA 1Q5WB 4WWNA 1Q0WB 2IO2B 2KUPA 2V3NA 1Q10A 3W2DA 2M4NA 3NJTA 2DX1A 3JSVB 1HZ5A 4MJSB 2ICIA 1PGAA 1J7CA 3I9V1 3PLVA 3ODOA 3CIRB 5LNK1 3LXFA 4G11A 2J52A 3RNCC 2AL3A 4XDCA 2J42A 4A90A 1WZ3A 2KDMA 4FULA 5E6NA 1QILA 3F0WA 3SFEB 5D3WA 2ZVNA 5AUKA 2JT4B 1MAIA 3L16A 2L83A 3Q8FA 2YLMA 3R66C 2V76A 4HROA 1FAOA 4RNAA 2ZW1A 1SEBD 3QA8A 4KHBA 2CJOA 1F2RC 2IGHA 4RMAA 1E7VA 3ZRFA 3TEZA 1BUIC 3AE5B 4HHVA 2IYDB 3EC8A 1JW9D 2DWQA 3P1MA 3AN1A 1PUTA 2L3ZA 3HIEA 3ZTDA 1ZC3B 2GBJA 3BZDB 1XT9B 3P4PB 2CHWA 2WWZA 1GAQB 2KZRA 3N1YC 3V61A 3T06A 2PVOD 4TYZA 1UBQA 4YXDB 5GMVA 1JROA 1GB1A 1S3SG 4WAFA 1NTVA 3A9KB 1I4QA 2B76B 4KGRA 2VRWB 3SO6A 3EFCA 4IDIA 3HM6X 2K6DB 1RRPB 4HAZB 3IFWB 3ULBA 4MACA 3L17A 4KGTA 2QILA 3V3XA 2DBYA 4XWWA 5JHAA 1VCBA 4DX8A 1I4RA 3KUZA 4ANVA 1TKEA 2BS2B 3SNHA 4KHBB 4PYZA 4A20A 1MG4A 2ROZB 2MA9B 3HHMA 2K2JA 2C60A 2LRWA 4OZBA 2M0XA 2KACA 1JWSD 2CJNA 1MHHE 3BVMA 2WXNA 2MW5A 5IA7A 3HM3A 1Q1OA 3FC4A 1SHCA 3OJ4B 4BKSA 2ZEQA 3L0WB 2M19A 1OQYA 1ZGUB 1J7BA 4MEMA 1HTOA 3MJWA 1Z87A 1V9JA 2HJ1A 3AU4A 2W55A 1IRSA 1RM6C 3AE2B 3SD5A 2AQ3B 2GOWA 2COFA 2LD9A 4M02A 5GOWB 2HE7A 3W1YA 1B9RA 2K25A 4L1RA 3EUB2 2WDRB 3T3NA 2ZNVC 2MFQA 2NS5A 1OQNA 2Y7BA 2Y5PA 1SBBB 3Q2AC 1L0VB 5DPSA 4US8A 1EU4A 2D9YA 2BB5A 3N30A 1C3TA 4E71A 4J6IA 1HE8A 3IAS1 4DBGA 2C9WB 2J59M 1L2NA 2RNRB 3L54A 4A9AA 1Q67A 4RGNA 1ENFA 1XCQL 1TQZA 3A98B 2N7DA 3L4PA 5L95C 1JWAD 3PVUA 3ZGZA 1FOEA 5I2SA 1TXDA 2BVCA 2WU2B 2KDIA 2LHEA 2G1EA 1TIFA 1H10A 4A6KA 2GBMA 2RPQA 2MHJA 3TEWA 4EOYA 4C80A 2RRFA 2PIAA 1LW3A 4K17A 2MBOA 1SJHD 2KJHB 2XN9C 2TSSA 2K5PA 4ICVA 2BQQA 3AECB 1X1FA 3M1IB 3AXCA 4LK0M 1AWDA 4EZKA 3W9CB 3AJ4A 2IY0B 2LGYA 2QIEB 1RRBA 2RDHA 4RCOA 2H89B 3A4RA 1WGHA 4I6PA 3HVZA 5FK9C 4HSIA 2CAYA 2O6VD 1NDDA 1L7YA 2GBKA 1STEA 2I5FA 2DFKA 4HKQA 3MHZA 1ZUD2 3NZ3A 2CY4A 3TL5A 1ZSQA 4HB3B 1ZP0B 3Q69A 4JE3B 1FHWA 3KWVA 5IRSA 3N32A 1YMHE 5EE3A 5KQ4A 4LNKA 2O2VA 2NPTB 4IWOA 1QZEA 1WI0A 1V6EA 1GB4A 3U30A 3VUWA 1QT9A 3TIXA 5JP4A 2DNFA 3ABVB 5HE3A 2N7EA 3TVVA 2EELA 2G4DB 1P9DU 3VTWA 4NZLB 1PQSA 4BOZB 2KXJA 3ZKJC 4M8NA 3UINB 1OQRA 4X57B 5MPOA 3LJUX 2KYWA 4KSLC 2OOBB 5JHHA 4HWIB 2ONQA 4WJPA 4A3PA 4KDIC 2CHXA 3OG5A 2UZRA 3WAPA 2KN5A 2P0DA 1UD7A 2DZKA 4AUQC 1GJZA 5DPRA 4DBBA 2FCMA 3X0WA 2LULA 2PVGC 2Q5WD 4AOFA 3MTNB 1K50A 1JWBD 2LZ6A 3L08A 1N3HA 1E8YA 2BCJA 1UELA 2DYNA 3DVGY 4EMOA 4EJNA 4KSKC 4W9JA 2FAZA 2N9EB 3QX1A 1Y5OA 4A6FB 1P3QU 3DBRI 3F5RA 1VJKA 1YJIA 3PLUA 3MDBC 3V5WA 1L6VA 3DVNV 3B2GA 2EMTA 1XR0B 2K1FA 2V4IB 4FJYA 1FO4A 1FNVA 4LNFA 3L10B 2KC2A 2QCZA 1C78A 5FI1A 5M4YB 4WJOA 1U4AA 1DDVA 3UI3A 2IBIB 3X23A 2ZPYA 3APCA 2DYQA 4O1NA 3D32A 4L2YA 2RVBB 3ENEA 5AZHA 2MWSB 3A4SC 4WIPA 4A8XC 1ZKHA 2INDC 2BYVE 1C76A 5CX3A 1TKGA 1MI0A 3NY5A 3QHTA 3U52E 3T3OA 3R8BA 4OZCA 4Y94A 1DDMA 1JWMD 3O65B 2INNE 4WWPA 3FM8C 1XEEA 2VKIA 2VH2A 3KYCD 4A5KA 2FBWB 2MLBA 2KX0A 4WAAA 3V62A 1FIQA 2KDBA 3R2TA 3ML4A 1KI1B 2Y8FA 3Q6BA 3ZW3A 1E8ZA 2ROVA 2WHIA 1XKEA 3PPAA 2WXRA 2G4SA 3H1UA 2R09A 1UPQA 4XX5A 4EEWA 1UUPA 5HHDG 1AYFA 2WXIA 2ZPNA 1BTNA 2MBHA 4HCPB 1UNQA 2BT6A 3CF6E 2HTME 5E6JA 1DDWA 2L0TA
chains in the Genus database with same CATH topology
1V49A 2FJLA 3M63B 3GYOA 2WYQA 5C23A 1WGYA 2O6VA 3TBLD 3PVLA 3NOBA 2M8SA 4NY0A 2PE6B 4MSQB 3TCAA 4W9EA 2L1CA 2BYEA 4WWOA 3KY9A 1R4NI 3UIPB 4BBKA 3ZNZB 2K8HA 5G55A 1RJ2A 2FCQA 2FUHB 1RAXA 3WALA 4ICUA 2K6QA 1WGUA 3DDCB 5LXIB 4DHZE 2GMIC 4KAXB 3D8FA 4DWFA 2P8VA 2FCNA 4XZ4A 4FJZA 5C5BB 4B9KA 3ZIMA 5CHFA 3DXCA 4BKTA 3WAOA 3VIAA 2G35A 3L13A 1WI1A 3HQCA 1EVHA 1U5FA 4K81A 5D3YA 3SYXA 3KZ1A 4KHOA 3Q3JA 3H9DA 3JW0X 2I5CA 2FCSA 2LGXA 2JRHA 2N4FA 3WAMA 4PYUA 2ASQA 3U7DA 1A5RA 1WGQA 3ZTCA 2J0MA 2JPHA 4MGYE 4HCNB 4OVUA 5G2NA 1M7EA 2PE9A 2KGXB 2OJRA 4TQ1A 5E6PA 4NQLB 1WXAA 3EFUA 2D9WA 1WM3A 2XBBC 3KUCB 2DHZA 2V3SA 3QK0A 2D2QA 1PMSA 4BKGA 3RZFA 1X86A 5LOPB 3A8QA 2BPSA 4TKNA 1X1MA 2HTHB 5DCNA 3TJPA 2NBWB 2CS4A 2JZZA 1AWEA 2KHWB 3A1QB 4CHJA 4HVBA 3KSYA 1XQQA 4PS7A 2KTFA 2PZ1A 5CHWA 2XK5B 1PLSA 1Y19B 1I2HA 2ZJDA 2N9XA 2C7HA 5HKHA 1U5DA 4TV3A 2YS5A 1KZ7A 3H6NA 5D3XA 2RSUA 3M3JA 2WDTB 4GIVA 2H7DA 5AEKB 4JIOU 4MM3A 2P0HA 3A9KA 2D10A 4G3XB 1H4RA 3QJZA 4OVVA 3RT3B 2RUKB 1UNPA 3T9LA 3LJ3A 1YX6B 4FN2A 4W9DA 2K39A 3ONSA 5J2RA 2IY1B 4Z2MB 2K00A 1X11A 4CHKA 4FJVB 2DZIA 1KM7A 1XX0A 2A4ZA 2MBEA 2ADZA 2JVCA 4NQKE 4B95A 4NSWA 2LVQA 2KTRB 2L05A 2K2UA 2IZVB 5DHAB 2ZVOA 1EGXA 4HAVB 3ULCA 4DK5A 3KW5B 4MY6A 2LOZA 3PSEB 2MBQA 1V89A 1IPGA 2FNJB 1DYNA 4MH0E 5D27A 5D3VA 2RSGA 3PZDA 2ZNVB 1P98A 2RLOA 2ZCBA 1WZ0A 2DZMA 3DCGA 2IO0B 3ZVVA 2GCLA 3PRMB 1V2YA 3IVFA 2X18A 2QKMA 2MSED 3T8MA 2GCJA 2W2XD 1EF5A 2V1YA 4LJPB 3S2AA 3BJIA 3VXWA 3DBSA 3TO1A 2N1WA 5DPWA 1EUVB 2D4QA 3VVWB 5E6OA 2H7EA 1EO6A 3A8PA 4GN1A 3PVWA 2MBBB 2JRIB 4GU2A 3W1SA 4A6HA 2VSZA 3APDA 3U8ZA 5D7GA 2KCJA 3PGEA 2J7QB 3K9PB 2Z0QA 1V5MA 2L00B 3QWMA 1J0GA 2NPTA 2RR9A 1WJMA 1KJTA 4KVGB 4M0WB 2Y8GA 4K1RB 4II2B 2YS3A 1WX7A 3NZUA 1V5OA 2HJ8A 5EFXA 2L76A 4W9IA 4IM2A 3VHTC 5C1ZA 4H8SA 1Y8RC 2COCA 2M1MA 1BTKA 2D9XA 3KRXA 4LCDE 2BF8B 2GS0A 2UWQA 1WMHB 4IC7B 2W9NA 3QC8B 1LFDA 3VFKA 3BY4B 3RZWC 3RYTA 1LXDA 1WF9A 2LKOA 4A6FA 3PTFC 1V81A 4NPNA 4GMVA 2EJ8A 1Z2MA 2LGDA 4ZYNA 1U29A 3MHSD 1WJ4A 2L0FA 3C0RB 3KH0A 3QCAA 3QAQA 4L6EA 2N23A 4YONA 1MK9B 3M62B 5DPTA 1UPRA 4WSFA 2IYBA 5L81A 2C7MB 4PS3A 2P0FA 3QQ8B 3VOQA 3WYFB 1V80A 4RM9A 2BKRB 1ZVRA 1UBIA 1KZGA 1CMXB 4IG7B 1RLFA 3PG7A 2KWUB 3M95A 1TJ6A 1OY2A 1XD3B 1X1GA 1V5TA 2NMBA 4HATB 4KHAA 3UQAA 2LVPA 1WE6A 4EZJA 3TMPB 2KOXA 4EZLA 4CYEA 2WX1A 4KIKB 3QIJA 2RD0A 2MKRA 3KRWA 1WX8A 1WJUA 1ZM0A 5HE0A 4IWQA 2KWCA 2R2QA 3UZTA 5JHBA 4MDKE 1QC6A 5DHFB 1TGZB 2NZ8B 4II3B 2WX0A 1P5TA 3A33B 1U27A 2DAJA 2I1KA 4KZ0A 2XEWA 3VAWA 1XODA 2OQBA 3ZVRA 2KQSA 3PRZA 2GBNA 3UIOB 2RGNB 2UZSA 2CR5A 4GSWA 2KD0A 4GOCA 4EFOA 1GC6A 2W2WA 3UF8A 2COAA 4EKUA 4KDLB 2LASA 2R0DA 2JXXA 3WANA 2MP2A 2DX5B 4DDGD 4ANXA 1LM8B 1WGRA 5C5BA 1P6SA 2KVRA 4F7ZA 4W9FA 2LYDA 4E3CA 3R3MA 4CHMA 5J3QA 3FSSA 1OEYJ 4PS8A 2KMCA 1WR6E 2YRYA 3DQVA 3B1LX 5AZGA 5C16A 1YQBA 2EMSA 5D6JB 2W2XC 3QARA 3AU5A 3JVZX 3NHEB 2D3GA 3DXDA 2DYMA 2MP2B 3RCPA 4GDKB 3VH3B 1K5DB 2GJYA 3ZNID 1I42A 1FHOA 3ALBA 1J19A 4HB2B 2JP2A 1W1HA 2CY5A 1UEFA 2PEAA 2KQ7A 2BYFA 4K7WA 2JUOA 1Z5SB 2HTHA 4HDOA 2LJ5A 3NS8A 4W9GA 2J0KA 2LRUA 4B6WA 3A1QA 1WFYA 4A3OA 4MGKE 4P7IA 4BFRA 2XK5A 3SU8X 3CIKA 4HAXB 4ZRIA 1ISNA 1U5EA 2MQJA 1UH6A 1FB8A 2D07B 2G3QB 4NAWA 2ELBA 4FLHA 2KDEB 1WR1A 2JWZA 4KZCA 1SE9A 1WXVA 2CHZA 4IWPA 1NTYA 1K5GB 2YF0A 5CHVC 2CODA 2ZCCA 5J3TA 2ELAA 2KWVB 2FIDA 5D94A 1WJ6A 3K9OB 1KLVA 3V6EB 5KQ1A 5EDSA 4XC2A 5LLIA 4MELA 2N9PC 1MIXA 2YSZA 4BVUC 4K2PA 1UNRA 2MX2A 1YD8U 1WM2A 2Z0OA 2DHJA 4TUUA 2Z0EB 4ANWA 4NAWB 1KOTA 3CXBB 4HB0B 1QQGA 2L7RA 3Q3FA 4FA6A 4K7SA 1UZXB 5AZFA 4DHZB 4IAPA 4F7UP 4IM0A 1MG8A 3DVNU 4GMXB 3N3KB 3PHWB 3SDLC 3DVGX 5D2MB 5CLLB 5FR6A 3DXEA 2KTRA 5CTRC 2YT1A 2EC1A 1WY8A 5DH9B 3A9JA 4N9F4 1RFAA 1I35A 1P0RA 3H7PA 3ZRCA 4HAUB 3VTUA 5IAAC 3RUIB 1B55A 3ZNGC 4AJWA 4DHJB 2FIFA 1AARA 4DXAB 3B0AA 3R7RA 4FHJA 1P3RA 5DI9B 2C7NB 1FXTB 2DKPA 3PRPB 4EUTA 2YVCA 3V6CB 1WIAA 4PQ0A 5JLJB 2G45B 3PEGA 2JF5A 4HPMB 1E8XA 4K7UA 1WVHA 1WGDA 5KCVA 1YJ1A 2REXA 1V88A 2KX3A 1M7RA 3OLMD 5J17A 1MKEA 1C1YB 2DHKA 3VDZA 3A9JB 1LQBA 3VUXA 2UVMA 3H7PB 2Q13A 2HD5B 3V60A 4MK0A 3VTVA 2K8CA 1WE7A 3IHPC 2LXCA 2MWNB 4MT7A 2CKHB 2KLCA 3FEHA 2KKCA 4HXDA 1XCGA 3P7ZA 1U2BA 3H7SA 1OGWA 2QHOA 3DBHI 4IOYX 4W9LA 1ZW7A 1E5WA 3EHVA 2DKQA 5KHOA 3SV1A 1D3ZA 2LVOA 1OEYA 1NU2A 3P2BA 2E2XA 2KFJA 5JH5C 5JHGA 3RULA 3PV1A 4LDTB 1WX9A 4XWXA 2RGFA 1EAZA 5LONB 4HPLB 1I7AA 2M38A 5HE2A 4Z2NA 3DPDA 3TW1A 4F8CB 3UQBA 1DBHA 1MPHA 4CO7A 1R4MI 1DROA 1WMHA 5L83A 3OANA 2PJHA 2I1JA 2BGFA 5BO4B 3SHQA 2MDXA 3ODXA 4W9CA 2KMAA 3VQIA 4W9KA 1BWNA 2KK8A 4IUMB 4BBNF 3HIZA 4W9HA 3O96A 4M8MA 2Y5BB 2DYOA 3MPXA 3ZDMC 4GDLA 1GG3A 1MIZB 3VUYA 2L8JA 2Z0PA 4WJNA 4HAYB 3VH4B 4E74A 3ECIA 3DOWA 2M14A 4FHKA 5J18A 1YIWA 5DIFB 1FGYA 1WGGA 1BT0A 5CLQB 3OJ3A 1VD2A 1IYFA 4ASWC 2DYBA 4NJ6A 2DENB 3GOEA 2LXAA 4WJQA 2KJ6A 2IO1B 2DA0A 1G6JA 4HLEA 2DZJA 2K8BA 3HW2B 3PHXB 2BWES 2GBRA 4GDLB 3PREA 3I3TB 2DLWA 5JZEB 3DBLI 4GPTB 3IBEA 2LOXA 4KIKA 4BBNC 2NCNA 1J0WA 2ZZPB 3P6AA 2C5LC 2LI5A 1OMWA 3ML9A 3B08A 3G9WA 1GUAB 1FGZA 1T0YA 2YS1A 3GYPA 1XD4A 2R2OA 3IG3A 2EKEC 4DX90 1E7UA 3W1SC 4GB9A 4B6HA 3CSTA 4URKA 4ZRKA 4WJ7A 1TZ1A 4ZRJA 1BAKA 2AWTA 2A5UA 3JYUA 3AI5A 3ZNHB 3NZSA 2LUEA 1P1AA 4JGHB 1M94A 2CU1A 2BWFA 3RD2A 4JQWC 4I6LB 2O2VB 2Z0DB 4F7HA 3OAWA 1NI2A 2MRPA 4I6NB 3PSCA 2DX5A 4HAWB 4AJYB 1H8CA 4F7GA 2XQNM 2JZ3B 2QKLA 3PS6A 1NBFC 2D9VA 1TBEA 5C6RA 1WXMA 4NNJB 2D11A 1V5PA 5C79A 2M17A 4FBJB 3LDZE 3KVFB 4DHJD 3ZUNA 1YX5B 2V4LA 2L2IA 2JY6A 4MGIE 4MSMB 2KFKA 4HB4B 1PFJA 2Z59B 3WA0A 4KV2A 2NBUA 4GDKA 3KUDB 1V5UA 1UGMA 1ZC4B 3R7QA 2DN6A 3ZLZA 2LWPA 4YL8A 4ZDVA 5TR5A 5FI0A 4WQOB 2KJRA 3BINA 2D9ZA 3EECA 1EF1A 1OTRB 1SGHA 1LB1A 1W1DA 1E90A 2NVUI 1SIFA 3PT2B 2MCNB 2KFKB 2KLGA 3QWZB 3NSUA 4FADA 3KYDD 5LXHA 2KNBA 1WRDB 4IFSA 1W1GA 1JRUA 4G50A 1J8CA 3D8EA 2NR2A 3AULA 3QBVB 2DAFA 4G0NB 3TFMA 4LDTD 1AQCA 4WVFB 2N1VA 4AP4C 2OTXA 1GNUA 4PNKA 3PP2A 3APFA 1WYWB 2O6VB 4IW0A 3N7CA 4GXBA 4GGQA 2KC1A 4AWJA 2IO3B 2KDFB 3RCZA 3SUZA 4HJKA 2B3AA 2LG1A 3ML8A 3CMMB 4D0NB 4K2OA 1S1QB 4JL9A 1GC7A 4HDQA 2J0JA 4LJOB 4JLCA 1E8WA 1K8RB 3HK0A 2KANA 1MK7B 1WG7A 1V61A 4ANUA 2YT0A 1FHXA 1X05A 2CRFA 4DDID 2AYOB 2N0YA 3ODWA 1U5GA 4RM8A 2AEHA 2UYZB 2KO3A 3GZNI 1IP9A 3ZDTA 1WJ1A 3ZO5B 1WH3A 4TQ0A 2VRRB 1F9JA 4C0AA 3JSVA 4BOSC 4MJSA 1WXSA 4BKSD 4HK2A 1TTNA 3CSFA 1V86A 5KHQA 1WJNA 4F1SA 4GZUA 2IFSA 2AL6A 2DTCA 4NJ7A 5HE1A 2NBVB 2PPHA 5J3YA 2DHIA 4MGZE 2BKFA 4IM3A 3D8DA 3WIMA 1Q5WB 4WWNA 1Q0WB 2IO2B 2KUPA 2M4NA 2DX1A 3JSVB 4MJSB 3PLVA 3ODOA 4G11A 2AL3A 1WZ3A 4FULA 5E6NA 3F0WA 5D3WA 2ZVNA 2JT4B 1MAIA 3L16A 2YLMA 3R66C 2V76A 1FAOA 3QA8A 4RMAA 1E7VA 3ZRFA 4HHVA 2IYDB 3EC8A 2L3ZA 3ZTDA 1ZC3B 2GBJA 1XT9B 2CHWA 2WWZA 2KZRA 3V61A 3T06A 4TYZA 1UBQA 5GMVA 1S3SG 1NTVA 3A9KB 2VRWB 3SO6A 3HM6X 2K6DB 1RRPB 4HAZB 3IFWB 3ULBA 3L17A 5JHAA 1VCBA 4DX8A 3KUZA 4ANVA 3SNHA 4KHBB 4PYZA 4A20A 2ROZB 2MA9B 3HHMA 2K2JA 2C60A 2LRWA 2M0XA 2MW5A 5IA7A 3HM3A 1Q1OA 1SHCA 3OJ4B 4BKSA 2ZEQA 3L0WB 1OQYA 1ZGUB 4MEMA 3MJWA 1Z87A 1V9JA 3AU4A 1IRSA 3SD5A 2GOWA 2COFA 2LD9A 5GOWB 2HE7A 3W1YA 2K25A 2ZNVC 2MFQA 2NS5A 1OQNA 2Y7BA 5DPSA 2D9YA 1C3TA 3N30A 4E71A 4J6IA 1HE8A 4DBGA 2C9WB 2J59M 1L2NA 2RNRB 3L54A 1Q67A 1TQZA 3A98B 2N7DA 5L95C 3PVUA 1FOEA 1TXDA 2KDIA 1H10A 4A6KA 2GBMA 2RPQA 4EOYA 1LW3A 4K17A 2MBOA 2KJHB 4ICVA 1X1FA 3M1IB 3AXCA 4EZKA 3AJ4A 2IY0B 2LGYA 1RRBA 3A4RA 1WGHA 4I6PA 2CAYA 2O6VD 1NDDA 1L7YA 2GBKA 2I5FA 2DFKA 2CY4A 3TL5A 1ZSQA 4HB3B 1FHWA 3N32A 5KQ4A 2O2VA 2NPTB 4IWOA 1QZEA 1WI0A 1V6EA 3U30A 3VUWA 3TIXA 5JP4A 5HE3A 2N7EA 3TVVA 2G4DB 1P9DU 3VTWA 1PQSA 4BOZB 2KXJA 3ZKJC 4M8NA 3UINB 4X57B 3LJUX 4KSLC 2OOBB 5JHHA 4HWIB 4WJPA 4A3PA 4KDIC 2CHXA 2UZRA 3WAPA 2KN5A 2P0DA 1UD7A 2DZKA 4AUQC 1GJZA 5DPRA 4DBBA 2FCMA 3X0WA 2LULA 4AOFA 3MTNB 2LZ6A 3L08A 1N3HA 1E8YA 2BCJA 1UELA 2DYNA 3DVGY 4EMOA 4EJNA 4KSKC 4W9JA 2FAZA 2N9EB 3QX1A 1Y5OA 4A6FB 1P3QU 3DBRI 3F5RA 3PLUA 3MDBC 3V5WA 3DVNV 2EMTA 1XR0B 2K1FA 4FJYA 3L10B 2KC2A 5FI1A 4WJOA 1U4AA 1DDVA 2IBIB 3X23A 2ZPYA 3APCA 2DYQA 3D32A 2RVBB 3ENEA 5AZHA 2MWSB 3A4SC 1ZKHA 2BYVE 5CX3A 3NY5A 3QHTA 4Y94A 1DDMA 3O65B 4WWPA 3FM8C 2VKIA 3KYCD 4A5KA 2MLBA 2KX0A 4WAAA 3V62A 2KDBA 3ML4A 1KI1B 2Y8FA 3ZW3A 1E8ZA 2ROVA 1XKEA 3PPAA 3H1UA 2G4SA 2R09A 1UPQA 4XX5A 4EEWA 2ZPNA 1BTNA 2MBHA 4HCPB 1UNQA 3CF6E 1DDWA 2L0TA 3UGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V49 A;  2FJL A;  3M63 B;  3GYO A;  2WYQ A;  5C23 A;  1WGY A;  2O6V A;  3TBL D;  3PVL A;  3NOB A;  2M8S A;  4NY0 A;  2PE6 B;  4MSQ B;  3TCA A;  4W9E A;  2L1C A;  2BYE A;  4WWO A;  3KY9 A;  1R4N I;  3UIP B;  4BBK A;  3ZNZ B;  2K8H A;  5G55 A;  1RJ2 A;  2FCQ A;  2FUH B;  1RAX A;  3WAL A;  4ICU A;  2K6Q A;  1WGU A;  3DDC B;  5LXI B;  4DHZ E;  2GMI C;  4KAX B;  3D8F A;  4DWF A;  2P8V A;  2FCN A;  4XZ4 A;  4FJZ A;  5C5B B;  4B9K A;  3ZIM A;  5CHF A;  3DXC A;  4BKT A;  3WAO A;  3VIA A;  2G35 A;  3L13 A;  1WI1 A;  3HQC A;  1EVH A;  1U5F A;  4K81 A;  5D3Y A;  3SYX A;  3KZ1 A;  4KHO A;  3Q3J A;  3H9D A;  3JW0 X;  2I5C A;  2FCS A;  2LGX A;  2JRH A;  2N4F A;  3WAM A;  4PYU A;  2ASQ A;  3U7D A;  1A5R A;  1WGQ A;  3ZTC A;  2J0M A;  2JPH A;  4MGY E;  4HCN B;  4OVU A;  5G2N A;  1M7E A;  2PE9 A;  2KGX B;  2OJR A;  4TQ1 A;  5E6P A;  4NQL B;  1WXA A;  3EFU A;  2D9W A;  1WM3 A;  2XBB C;  3KUC B;  2DHZ A;  2V3S A;  3QK0 A;  2D2Q A;  1PMS A;  4BKG A;  3RZF A;  1X86 A;  5LOP B;  3A8Q A;  2BPS A;  4TKN A;  1X1M A;  2HTH B;  5DCN A;  3TJP A;  2NBW B;  2CS4 A;  2JZZ A;  1AWE A;  2KHW B;  3A1Q B;  4CHJ A;  4HVB A;  3KSY A;  1XQQ A;  4PS7 A;  2KTF A;  2PZ1 A;  5CHW A;  2XK5 B;  1PLS A;  1Y19 B;  1I2H A;  2ZJD A;  2N9X A;  2C7H A;  5HKH A;  1U5D A;  4TV3 A;  2YS5 A;  1KZ7 A;  3H6N A;  5D3X A;  2RSU A;  3M3J A;  2WDT B;  4GIV A;  2H7D A;  5AEK B;  4JIO U;  4MM3 A;  2P0H A;  3A9K A;  2D10 A;  4G3X B;  1H4R A;  3QJZ A;  4OVV A;  3RT3 B;  2RUK B;  1UNP A;  3T9L A;  3LJ3 A;  1YX6 B;  4FN2 A;  4W9D A;  2K39 A;  3ONS A;  5J2R A;  2IY1 B;  4Z2M B;  2K00 A;  1X11 A;  4CHK A;  4FJV B;  2DZI A;  1KM7 A;  1XX0 A;  2A4Z A;  2MBE A;  2ADZ A;  2JVC A;  4NQK E;  4B95 A;  4NSW A;  2LVQ A;  2KTR B;  2L05 A;  2K2U A;  2IZV B;  5DHA B;  2ZVO A;  1EGX A;  4HAV B;  3ULC A;  4DK5 A;  3KW5 B;  4MY6 A;  2LOZ A;  3PSE B;  2MBQ A;  1V89 A;  1IPG A;  2FNJ B;  1DYN A;  4MH0 E;  5D27 A;  5D3V A;  2RSG A;  3PZD A;  2ZNV B;  1P98 A;  2RLO A;  2ZCB A;  1WZ0 A;  2DZM A;  3DCG A;  2IO0 B;  3ZVV A;  2GCL A;  3PRM B;  1V2Y A;  3IVF A;  2X18 A;  2QKM A;  2MSE D;  3T8M A;  2GCJ A;  2W2X D;  1EF5 A;  2V1Y A;  4LJP B;  3S2A A;  3BJI A;  3VXW A;  3DBS A;  3TO1 A;  2N1W A;  5DPW A;  1EUV B;  2D4Q A;  3VVW B;  5E6O A;  2H7E A;  1EO6 A;  3A8P A;  4GN1 A;  3PVW A;  2MBB B;  2JRI B;  4GU2 A;  3W1S A;  4A6H A;  2VSZ A;  3APD A;  3U8Z A;  5D7G A;  2KCJ A;  3PGE A;  2J7Q B;  3K9P B;  2Z0Q A;  1V5M A;  2L00 B;  3QWM A;  1J0G A;  2NPT A;  2RR9 A;  1WJM A;  1KJT A;  4KVG B;  4M0W B;  2Y8G A;  4K1R B;  4II2 B;  2YS3 A;  1WX7 A;  3NZU A;  1V5O A;  2HJ8 A;  5EFX A;  2L76 A;  4W9I A;  4IM2 A;  3VHT C;  5C1Z A;  4H8S A;  1Y8R C;  2COC A;  2M1M A;  1BTK A;  2D9X A;  3KRX A;  4LCD E;  2BF8 B;  2GS0 A;  2UWQ A;  1WMH B;  4IC7 B;  2W9N A;  3QC8 B;  1LFD A;  3VFK A;  3BY4 B;  3RZW C;  3RYT A;  1LXD A;  1WF9 A;  2LKO A;  4A6F A;  3PTF C;  1V81 A;  4NPN A;  4GMV A;  2EJ8 A;  1Z2M A;  2LGD A;  4ZYN A;  1U29 A;  3MHS D;  1WJ4 A;  2L0F A;  3C0R B;  3KH0 A;  3QCA A;  3QAQ A;  4L6E A;  2N23 A;  4YON A;  1MK9 B;  3M62 B;  5DPT A;  1UPR A;  4WSF A;  2IYB A;  5L81 A;  2C7M B;  4PS3 A;  2P0F A;  3QQ8 B;  3VOQ A;  3WYF B;  1V80 A;  4RM9 A;  2BKR B;  1ZVR A;  1UBI A;  1KZG A;  1CMX B;  4IG7 B;  1RLF A;  3PG7 A;  2KWU B;  3M95 A;  1TJ6 A;  1OY2 A;  1XD3 B;  1X1G A;  1V5T A;  2NMB A;  4HAT B;  4KHA A;  3UQA A;  2LVP A;  1WE6 A;  4EZJ A;  3TMP B;  2KOX A;  4EZL A;  4CYE A;  2WX1 A;  4KIK B;  3QIJ A;  2RD0 A;  2MKR A;  3KRW A;  1WX8 A;  1WJU A;  1ZM0 A;  5HE0 A;  4IWQ A;  2KWC A;  2R2Q A;  3UZT A;  5JHB A;  4MDK E;  1QC6 A;  5DHF B;  1TGZ B;  2NZ8 B;  4II3 B;  2WX0 A;  1P5T A;  3A33 B;  1U27 A;  2DAJ A;  2I1K A;  4KZ0 A;  2XEW A;  3VAW A;  1XOD A;  2OQB A;  3ZVR A;  2KQS A;  3PRZ A;  2GBN A;  3UIO B;  2RGN B;  2UZS A;  2CR5 A;  4GSW A;  2KD0 A;  4GOC A;  4EFO A;  1GC6 A;  2W2W A;  3UF8 A;  2COA A;  4EKU A;  4KDL B;  2LAS A;  2R0D A;  2JXX A;  3WAN A;  2MP2 A;  2DX5 B;  4DDG D;  4ANX A;  1LM8 B;  1WGR A;  5C5B A;  1P6S A;  2KVR A;  4F7Z A;  4W9F A;  2LYD A;  4E3C A;  3R3M A;  4CHM A;  5J3Q A;  3FSS A;  1OEY J;  4PS8 A;  2KMC A;  1WR6 E;  2YRY A;  3DQV A;  3B1L X;  5AZG A;  5C16 A;  1YQB A;  2EMS A;  5D6J B;  2W2X C;  3QAR A;  3AU5 A;  3JVZ X;  3NHE B;  2D3G A;  3DXD A;  2DYM A;  2MP2 B;  3RCP A;  4GDK B;  3VH3 B;  1K5D B;  2GJY A;  3ZNI D;  1I42 A;  1FHO A;  3ALB A;  1J19 A;  4HB2 B;  2JP2 A;  1W1H A;  2CY5 A;  1UEF A;  2PEA A;  2KQ7 A;  2BYF A;  4K7W A;  2JUO A;  1Z5S B;  2HTH A;  4HDO A;  2LJ5 A;  3NS8 A;  4W9G A;  2J0K A;  2LRU A;  4B6W A;  3A1Q A;  1WFY A;  4A3O A;  4MGK E;  4P7I A;  4BFR A;  2XK5 A;  3SU8 X;  3CIK A;  4HAX B;  4ZRI A;  1ISN A;  1U5E A;  2MQJ A;  1UH6 A;  1FB8 A;  2D07 B;  2G3Q B;  4NAW A;  2ELB A;  4FLH A;  2KDE B;  1WR1 A;  2JWZ A;  4KZC A;  1SE9 A;  1WXV A;  2CHZ A;  4IWP A;  1NTY A;  1K5G B;  2YF0 A;  5CHV C;  2COD A;  2ZCC A;  5J3T A;  2ELA A;  2KWV B;  2FID A;  5D94 A;  1WJ6 A;  3K9O B;  1KLV A;  3V6E B;  5KQ1 A;  5EDS A;  4XC2 A;  5LLI A;  4MEL A;  2N9P C;  1MIX A;  2YSZ A;  4BVU C;  4K2P A;  1UNR A;  2MX2 A;  1YD8 U;  1WM2 A;  2Z0O A;  2DHJ A;  4TUU A;  2Z0E B;  4ANW A;  4NAW B;  1KOT A;  3CXB B;  4HB0 B;  1QQG A;  2L7R A;  3Q3F A;  4FA6 A;  4K7S A;  1UZX B;  5AZF A;  4DHZ B;  4IAP A;  4F7U P;  4IM0 A;  1MG8 A;  3DVN U;  4GMX B;  3N3K B;  3PHW B;  3SDL C;  3DVG X;  5D2M B;  5CLL B;  5FR6 A;  3DXE A;  2KTR A;  5CTR C;  2YT1 A;  2EC1 A;  1WY8 A;  5DH9 B;  3A9J A;  4N9F 4;  1RFA A;  1I35 A;  1P0R A;  3H7P A;  3ZRC A;  4HAU B;  3VTU A;  5IAA C;  3RUI B;  1B55 A;  3ZNG C;  4AJW A;  4DHJ B;  2FIF A;  1AAR A;  4DXA B;  3B0A A;  3R7R A;  4FHJ A;  1P3R A;  5DI9 B;  2C7N B;  1FXT B;  2DKP A;  3PRP B;  4EUT A;  2YVC A;  3V6C B;  1WIA A;  4PQ0 A;  5JLJ B;  2G45 B;  3PEG A;  2JF5 A;  4HPM B;  1E8X A;  4K7U A;  1WVH A;  1WGD A;  5KCV A;  1YJ1 A;  2REX A;  1V88 A;  2KX3 A;  1M7R A;  3OLM D;  5J17 A;  1MKE A;  1C1Y B;  2DHK A;  3VDZ A;  3A9J B;  1LQB A;  3VUX A;  2UVM A;  3H7P B;  2Q13 A;  2HD5 B;  3V60 A;  4MK0 A;  3VTV A;  2K8C A;  1WE7 A;  3IHP C;  2LXC A;  2MWN B;  4MT7 A;  2CKH B;  2KLC A;  3FEH A;  2KKC A;  4HXD A;  1XCG A;  3P7Z A;  1U2B A;  3H7S A;  1OGW A;  2QHO A;  3DBH I;  4IOY X;  4W9L A;  1ZW7 A;  1E5W A;  3EHV A;  2DKQ A;  5KHO A;  3SV1 A;  1D3Z A;  2LVO A;  1OEY A;  1NU2 A;  3P2B A;  2E2X A;  2KFJ A;  5JH5 C;  5JHG A;  3RUL A;  3PV1 A;  4LDT B;  1WX9 A;  4XWX A;  2RGF A;  1EAZ A;  5LON B;  4HPL B;  1I7A A;  2M38 A;  5HE2 A;  4Z2N A;  3DPD A;  3TW1 A;  4F8C B;  3UQB A;  1DBH A;  1MPH A;  4CO7 A;  1R4M I;  1DRO A;  1WMH A;  5L83 A;  3OAN A;  2PJH A;  2I1J A;  2BGF A;  5BO4 B;  3SHQ A;  2MDX A;  3ODX A;  4W9C A;  2KMA A;  3VQI A;  4W9K A;  1BWN A;  2KK8 A;  4IUM B;  4BBN F;  3HIZ A;  4W9H A;  3O96 A;  4M8M A;  2Y5B B;  2DYO A;  3MPX A;  3ZDM C;  4GDL A;  1GG3 A;  1MIZ B;  3VUY A;  2L8J A;  2Z0P A;  4WJN A;  4HAY B;  3VH4 B;  4E74 A;  3ECI A;  3DOW A;  2M14 A;  4FHK A;  5J18 A;  1YIW A;  5DIF B;  1FGY A;  1WGG A;  1BT0 A;  5CLQ B;  3OJ3 A;  1VD2 A;  1IYF A;  4ASW C;  2DYB A;  4NJ6 A;  2DEN B;  3GOE A;  2LXA A;  4WJQ A;  2KJ6 A;  2IO1 B;  2DA0 A;  1G6J A;  4HLE A;  2DZJ A;  2K8B A;  3HW2 B;  3PHX B;  2BWE S;  2GBR A;  4GDL B;  3PRE A;  3I3T B;  2DLW A;  5JZE B;  3DBL I;  4GPT B;  3IBE A;  2LOX A;  4KIK A;  4BBN C;  2NCN A;  1J0W A;  2ZZP B;  3P6A A;  2C5L C;  2LI5 A;  1OMW A;  3ML9 A;  3B08 A;  3G9W A;  1GUA B;  1FGZ A;  1T0Y A;  2YS1 A;  3GYP A;  1XD4 A;  2R2O A;  3IG3 A;  2EKE C;  4DX9 0;  1E7U A;  3W1S C;  4GB9 A;  4B6H A;  3CST A;  4URK A;  4ZRK A;  4WJ7 A;  1TZ1 A;  4ZRJ A;  1BAK A;  2AWT A;  2A5U A;  3JYU A;  3AI5 A;  3ZNH B;  3NZS A;  2LUE A;  1P1A A;  4JGH B;  1M94 A;  2CU1 A;  2BWF A;  3RD2 A;  4JQW C;  4I6L B;  2O2V B;  2Z0D B;  4F7H A;  3OAW A;  1NI2 A;  2MRP A;  4I6N B;  3PSC A;  2DX5 A;  4HAW B;  4AJY B;  1H8C A;  4F7G A;  2XQN M;  2JZ3 B;  2QKL A;  3PS6 A;  1NBF C;  2D9V A;  1TBE A;  5C6R A;  1WXM A;  4NNJ B;  2D11 A;  1V5P A;  5C79 A;  2M17 A;  4FBJ B;  3LDZ E;  3KVF B;  4DHJ D;  3ZUN A;  1YX5 B;  2V4L A;  2L2I A;  2JY6 A;  4MGI E;  4MSM B;  2KFK A;  4HB4 B;  1PFJ A;  2Z59 B;  3WA0 A;  4KV2 A;  2NBU A;  4GDK A;  3KUD B;  1V5U A;  1UGM A;  1ZC4 B;  3R7Q A;  2DN6 A;  3ZLZ A;  2LWP A;  4YL8 A;  4ZDV A;  5TR5 A;  5FI0 A;  4WQO B;  2KJR A;  3BIN A;  2D9Z A;  3EEC A;  1EF1 A;  1OTR B;  1SGH A;  1LB1 A;  1W1D A;  1E90 A;  2NVU I;  1SIF A;  3PT2 B;  2MCN B;  2KFK B;  2KLG A;  3QWZ B;  3NSU A;  4FAD A;  3KYD D;  5LXH A;  2KNB A;  1WRD B;  4IFS A;  1W1G A;  1JRU A;  4G50 A;  1J8C A;  3D8E A;  2NR2 A;  3AUL A;  3QBV B;  2DAF A;  4G0N B;  3TFM A;  4LDT D;  1AQC A;  4WVF B;  2N1V A;  4AP4 C;  2OTX A;  1GNU A;  4PNK A;  3PP2 A;  3APF A;  1WYW B;  2O6V B;  4IW0 A;  3N7C A;  4GXB A;  4GGQ A;  2KC1 A;  4AWJ A;  2IO3 B;  2KDF B;  3RCZ A;  3SUZ A;  4HJK A;  2B3A A;  2LG1 A;  3ML8 A;  3CMM B;  4D0N B;  4K2O A;  1S1Q B;  4JL9 A;  1GC7 A;  4HDQ A;  2J0J A;  4LJO B;  4JLC A;  1E8W A;  1K8R B;  3HK0 A;  2KAN A;  1MK7 B;  1WG7 A;  1V61 A;  4ANU A;  2YT0 A;  1FHX A;  1X05 A;  2CRF A;  4DDI D;  2AYO B;  2N0Y A;  3ODW A;  1U5G A;  4RM8 A;  2AEH A;  2UYZ B;  2KO3 A;  3GZN I;  1IP9 A;  3ZDT A;  1WJ1 A;  3ZO5 B;  1WH3 A;  4TQ0 A;  2VRR B;  1F9J A;  4C0A A;  3JSV A;  4BOS C;  4MJS A;  1WXS A;  4BKS D;  4HK2 A;  1TTN A;  3CSF A;  1V86 A;  5KHQ A;  1WJN A;  4F1S A;  4GZU A;  2IFS A;  2AL6 A;  2DTC A;  4NJ7 A;  5HE1 A;  2NBV B;  2PPH A;  5J3Y A;  2DHI A;  4MGZ E;  2BKF A;  4IM3 A;  3D8D A;  3WIM A;  1Q5W B;  4WWN A;  1Q0W B;  2IO2 B;  2KUP A;  2M4N A;  2DX1 A;  3JSV B;  4MJS B;  3PLV A;  3ODO A;  4G11 A;  2AL3 A;  1WZ3 A;  4FUL A;  5E6N A;  3F0W A;  5D3W A;  2ZVN A;  2JT4 B;  1MAI A;  3L16 A;  2YLM A;  3R66 C;  2V76 A;  1FAO A;  3QA8 A;  4RMA A;  1E7V A;  3ZRF A;  4HHV A;  2IYD B;  3EC8 A;  2L3Z A;  3ZTD A;  1ZC3 B;  2GBJ A;  1XT9 B;  2CHW A;  2WWZ A;  2KZR A;  3V61 A;  3T06 A;  4TYZ A;  1UBQ A;  5GMV A;  1S3S G;  1NTV A;  3A9K B;  2VRW B;  3SO6 A;  3HM6 X;  2K6D B;  1RRP B;  4HAZ B;  3IFW B;  3ULB A;  3L17 A;  5JHA A;  1VCB A;  4DX8 A;  3KUZ A;  4ANV A;  3SNH A;  4KHB B;  4PYZ A;  4A20 A;  2ROZ B;  2MA9 B;  3HHM A;  2K2J A;  2C60 A;  2LRW A;  2M0X A;  2MW5 A;  5IA7 A;  3HM3 A;  1Q1O A;  1SHC A;  3OJ4 B;  4BKS A;  2ZEQ A;  3L0W B;  1OQY A;  1ZGU B;  4MEM A;  3MJW A;  1Z87 A;  1V9J A;  3AU4 A;  1IRS A;  3SD5 A;  2GOW A;  2COF A;  2LD9 A;  5GOW B;  2HE7 A;  3W1Y A;  2K25 A;  2ZNV C;  2MFQ A;  2NS5 A;  1OQN A;  2Y7B A;  5DPS A;  2D9Y A;  1C3T A;  3N30 A;  4E71 A;  4J6I A;  1HE8 A;  4DBG A;  2C9W B;  2J59 M;  1L2N A;  2RNR B;  3L54 A;  1Q67 A;  1TQZ A;  3A98 B;  2N7D A;  5L95 C;  3PVU A;  1FOE A;  1TXD A;  2KDI A;  1H10 A;  4A6K A;  2GBM A;  2RPQ A;  4EOY A;  1LW3 A;  4K17 A;  2MBO A;  2KJH B;  4ICV A;  1X1F A;  3M1I B;  3AXC A;  4EZK A;  3AJ4 A;  2IY0 B;  2LGY A;  1RRB A;  3A4R A;  1WGH A;  4I6P A;  2CAY A;  2O6V D;  1NDD A;  1L7Y A;  2GBK A;  2I5F A;  2DFK A;  2CY4 A;  3TL5 A;  1ZSQ A;  4HB3 B;  1FHW A;  3N32 A;  5KQ4 A;  2O2V A;  2NPT B;  4IWO A;  1QZE A;  1WI0 A;  1V6E A;  3U30 A;  3VUW A;  3TIX A;  5JP4 A;  5HE3 A;  2N7E A;  3TVV A;  2G4D B;  1P9D U;  3VTW A;  1PQS A;  4BOZ B;  2KXJ A;  3ZKJ C;  4M8N A;  3UIN B;  4X57 B;  3LJU X;  4KSL C;  2OOB B;  5JHH A;  4HWI B;  4WJP A;  4A3P A;  4KDI C;  2CHX A;  2UZR A;  3WAP A;  2KN5 A;  2P0D A;  1UD7 A;  2DZK A;  4AUQ C;  1GJZ A;  5DPR A;  4DBB A;  2FCM A;  3X0W A;  2LUL A;  4AOF A;  3MTN B;  2LZ6 A;  3L08 A;  1N3H A;  1E8Y A;  2BCJ A;  1UEL A;  2DYN A;  3DVG Y;  4EMO A;  4EJN A;  4KSK C;  4W9J A;  2FAZ A;  2N9E B;  3QX1 A;  1Y5O A;  4A6F B;  1P3Q U;  3DBR I;  3F5R A;  3PLU A;  3MDB C;  3V5W A;  3DVN V;  2EMT A;  1XR0 B;  2K1F A;  4FJY A;  3L10 B;  2KC2 A;  5FI1 A;  4WJO A;  1U4A A;  1DDV A;  2IBI B;  3X23 A;  2ZPY A;  3APC A;  2DYQ A;  3D32 A;  2RVB B;  3ENE A;  5AZH A;  2MWS B;  3A4S C;  1ZKH A;  2BYV E;  5CX3 A;  3NY5 A;  3QHT A;  4Y94 A;  1DDM A;  3O65 B;  4WWP A;  3FM8 C;  2VKI A;  3KYC D;  4A5K A;  2MLB A;  2KX0 A;  4WAA A;  3V62 A;  2KDB A;  3ML4 A;  1KI1 B;  2Y8F A;  3ZW3 A;  1E8Z A;  2ROV A;  1XKE A;  3PPA A;  3H1U A;  2G4S A;  2R09 A;  1UPQ A;  4XX5 A;  4EEW A;  2ZPN A;  1BTN A;  2MBH A;  4HCP B;  1UNQ A;  3CF6 E;  1DDW A;  2L0T A;  3UGB B; 
#chains in the Genus database with same CATH topology
 1V49 A;  5H8Y E;  2FJL A;  3M63 B;  3GYO A;  4HJG E;  2WYQ A;  5C23 A;  1WGY A;  2O6V A;  1N5W A;  3TBL D;  3PVL A;  3NOB A;  2M8S A;  4N59 A;  4NY0 A;  4D6W A;  1C4C A;  3HRD D;  3ZJT A;  2PE6 B;  2N9L A;  4MSQ B;  1QOB A;  3TCA A;  4W9E A;  3BK1 A;  2L1C A;  1T6B X;  3FIL A;  3DHI C;  2H88 B;  2BYE A;  4WWO A;  3KY9 A;  1R4N I;  3HUI A;  1Y56 A;  2DLB A;  3UIP B;  1I7H A;  4BBK A;  3ZNZ B;  2K8H A;  2N7J A;  5G55 A;  3FVC A;  1RJ2 A;  1BML C;  2FCQ A;  4HRS A;  1FNU A;  2FUH B;  1RAX A;  5I2M A;  1HXY D;  1RFK A;  3WAL A;  4ICU A;  2K6Q A;  1WGU A;  3DDC B;  5LXI B;  4DHZ E;  1L0X B;  2K3U A;  3DBH B;  2GMI C;  4KAX B;  1QQR A;  3D8F A;  2R2Y A;  1WGK A;  2QJL A;  1LO5 D;  4DWF A;  2P8V A;  2FCN A;  4JWU C;  3U2S C;  5BMH A;  1QF6 A;  4XZ4 A;  4FJZ A;  4RGM A;  3U4E G;  2BTE A;  5C5B B;  4B9K A;  3ZIM A;  5CHF A;  3TEY A;  3DXC A;  1TKY A;  4BKT A;  3WAO A;  3VIA A;  3RNE C;  4KKJ A;  2G35 A;  3L13 A;  1WI1 A;  2HDE A;  2YEP F;  3HQC A;  1EVH A;  1U5F A;  4K81 A;  5D3Y A;  3SYX A;  3AEE B;  3KZ1 A;  4KHO A;  3Q3J A;  4US9 A;  3H9D A;  3JW0 X;  2I5C A;  2FCS A;  4GNK B;  2LGX A;  2JRH A;  2N4F A;  4AQ7 A;  1C4A A;  3WAM A;  4PYU A;  4FXC A;  2ASQ A;  1R4M B;  3U7D A;  1ZOY B;  1A5R A;  1WGQ A;  2J0M A;  2JPH A;  2N0S B;  4MGY E;  3ZTC A;  4HCN B;  4OVU A;  4RGO S;  3P4Q B;  1M7E A;  5G2N A;  2PE9 A;  1TS4 A;  3AE9 B;  1K51 A;  2KGX B;  2GI9 A;  2OJR A;  4TQ1 A;  4NQL B;  5E6P A;  4LTU A;  1WXA A;  3EFU A;  2D9W A;  3NWD A;  1WM3 A;  2Y5C A;  2XBB C;  3KUC B;  5BYQ A;  2DHZ A;  2V3S A;  1SE3 A;  3QK0 A;  2D2Q A;  1PMS A;  1GPX A;  2LFI A;  4BKG A;  3RZF A;  1X86 A;  5LOP B;  1L0Y B;  3A8Q A;  2BPS A;  4RH6 A;  4TKN A;  1X1M A;  1C77 A;  2EKI A;  3ZXV A;  2ZKM X;  2HTH B;  5DCN A;  3AMZ A;  3TJP A;  2NBW B;  2CS4 A;  2JZZ A;  1ET6 A;  1AWE A;  4YSY B;  2KHW B;  3A1Q B;  4CHJ A;  4HVB A;  3KSY A;  1XQQ A;  4PS7 A;  1WYG A;  2KTF A;  2PZ1 A;  1T5X D;  5CHW A;  2JQR B;  2XK5 B;  2V0G A;  1PLS A;  2LGI A;  1Y19 B;  1I2H A;  1EM7 A;  2ZJD A;  3RN9 C;  2N9X A;  2C7H A;  5HKH A;  1SB3 C;  1U5D A;  4TV3 A;  3ZQ4 A;  4EE2 A;  2YS5 A;  1KZ7 A;  5BYS A;  1PYW D;  2JYE A;  3H6N A;  5D3X A;  2RSU A;  1E0Z A;  1ZXH A;  3DCX A;  3M3J A;  2WDT B;  4GIV A;  1D5M C;  2H7D A;  5AEK B;  4JIO U;  1FCC C;  2MJE A;  2OHF A;  4MM3 A;  2WXH A;  2P0H A;  1FFU A;  3A9K A;  1R7S A;  3DBL B;  2D10 A;  3AV8 A;  4G3X B;  1H4R A;  3QJZ A;  4OVV A;  3RT3 B;  2RUK B;  1UNP A;  4TMA B;  3T9L A;  3LJ3 A;  1YX6 B;  4C56 C;  3AE1 B;  3AE7 B;  4FN2 A;  4W9D A;  2K39 A;  2I38 A;  3ONS A;  1DOY A;  5J2R A;  2IY1 B;  4Z2M B;  2D5G A;  1NYR A;  4Q2J A;  2K00 A;  5TSS A;  1X11 A;  3AE4 B;  4CHK A;  4FJV B;  1I4G A;  2DZI A;  1KM7 A;  1I4H A;  1XX0 A;  1T0R C;  2A4Z A;  2MBE A;  1D6E C;  2ADZ A;  2WDV B;  2JVC A;  4MM3 B;  1WSP A;  2LEK A;  3N1X C;  3SR6 A;  4NQK E;  4B95 A;  4NSW A;  2LVQ A;  4IKG A;  1RYJ A;  3AE3 B;  2KTR B;  3I57 A;  2L05 A;  4H2A A;  2K2U A;  2IZV B;  1M4V A;  5DHA B;  2ZVO A;  1EGX A;  4HAV B;  3B77 A;  3ULC A;  4DK5 A;  3KW5 B;  4MY6 A;  2LOZ A;  3PSE B;  2MBQ A;  2K22 A;  1V89 A;  1IPG A;  2D3C A;  2K49 A;  2FNJ B;  3AH7 A;  1F1H A;  1DYN A;  4MH0 E;  2WXL A;  2WXK A;  5D27 A;  5D3V A;  2RSG A;  3PZD A;  2ZNV B;  1P98 A;  2RLO A;  1D4B A;  2ZCB A;  1WZ0 A;  1LGR A;  2DZM A;  3DCG A;  2IO0 B;  1SE4 A;  2KWD A;  2WGS A;  3AEF B;  3ZVV A;  2BYT A;  2GCL A;  1C79 A;  4YT0 B;  3PRM B;  1HQR D;  1V2Y A;  3GB1 A;  2X18 A;  3IVF A;  4ZOH C;  2QKM A;  2MSE D;  3NS1 A;  3TEX A;  3T8M A;  3RFZ B;  2GCJ A;  1NEK B;  2IGG A;  2M0A A;  4ZRP A;  2W2X D;  1IBX B;  1EF5 A;  2V1Y A;  3A58 A;  1EWC A;  4RGT A;  4LJP B;  4ZYS A;  3E56 A;  1EU3 A;  3S2A A;  3FAH A;  5IP4 D;  1VLB A;  3BJI A;  3VXW A;  3DBS A;  3TO1 A;  2N1W A;  5DPW A;  1EUV B;  4XWT A;  2D4Q A;  3VVW B;  5E6O A;  2R61 A;  2H7E A;  1T77 A;  1EO6 A;  5T8I A;  3A8P A;  4GN1 A;  5H92 C;  1FPY A;  3PVW A;  2MBB B;  2JRI B;  2NTS A;  2JYT A;  4GU2 A;  2OJW A;  3W1S A;  4A6H A;  2VSZ A;  3APD A;  3U8Z A;  5D7G A;  2KCJ A;  3VR9 B;  3PGE A;  2J7Q B;  2WXJ A;  3K9P B;  5D3I B;  2Z0Q A;  1V5M A;  3TSS A;  2L00 B;  3QWM A;  2JZP A;  1J0G A;  1DGJ A;  1XF5 L;  2NPT A;  2RR9 A;  1WJM A;  1KJT A;  4KVG B;  4LNO A;  1NI3 A;  4M0W B;  2Y8G A;  5IN7 A;  3NRZ A;  2WNM A;  4K1R B;  3ETR A;  4II2 B;  2YS3 A;  1WX7 A;  3NZU A;  1UGJ A;  2I2Y A;  1JAL A;  1V5O A;  3ZJU A;  4NJC A;  4ZHP A;  2HJ8 A;  2WU5 B;  5EFX A;  3DHG C;  2L76 A;  4W9I A;  4IM2 A;  3VHT C;  5C1Z A;  4H8S A;  1Y8R C;  1KFY B;  1CQV A;  2KMM A;  2Z13 A;  2COC A;  2LJI A;  2E6X A;  2M1M A;  1BTK A;  2D9X A;  3KRX A;  1PDX A;  1XO3 A;  4LCD E;  2BF8 B;  2GS0 A;  1A70 A;  2UWQ A;  1WMH B;  2LHD A;  4IC7 B;  2W9N A;  4ZRQ A;  3C19 A;  3QC8 B;  1CK1 A;  1LFD A;  3VFK A;  3Q3M C;  3BY4 B;  3RYT A;  1LXD A;  1WF9 A;  3RZW C;  1BXT A;  2LKO A;  4A6F A;  3PTF C;  4N6E B;  3C8Y A;  1V81 A;  4NPN A;  2WXP A;  4GMV A;  3P42 A;  3W5V B;  4XDD A;  4C4V B;  2EJ8 A;  3J9C A;  1Z2M A;  3Q8E A;  2NMQ A;  2LGD A;  4ZYN A;  1U29 A;  3SFD B;  1PGB A;  3OHM B;  1ESF A;  3MHS D;  1WJ4 A;  2L0F A;  3C0R B;  2V3P A;  3KH0 A;  2W3R A;  3QCA A;  3KQ4 A;  3QAQ A;  2BS3 B;  4L6E A;  2N23 A;  4YON A;  1MK9 B;  3M62 B;  4LLG M;  1VZ8 A;  5DPT A;  1UPR A;  4WSF A;  1QOF A;  2IYB A;  2RDG A;  4RF1 A;  4D2K A;  3CWI A;  3AE6 B;  2OED A;  5L81 A;  2C7M B;  1N63 A;  4PS3 A;  2P0F A;  3QQ8 B;  3VOQ A;  4WUR A;  3ZXR A;  3WYF B;  4C7Y A;  1UWX A;  1V80 A;  3SEB A;  3Q8B A;  4RM9 A;  2MH7 A;  3FKY A;  2BKR B;  1ZVR A;  1UBI A;  1KZG A;  1CMX B;  4IG7 B;  1RLF A;  4OVZ A;  3PG7 A;  2PW9 A;  2KWU B;  1B1Z A;  1SSN A;  3AE8 B;  4CSQ A;  3M95 A;  1TJ6 A;  4L1B A;  1OY2 A;  2INC C;  1XD3 B;  1X1G A;  4PT5 A;  1V5T A;  2V9H A;  2NMB A;  4HAT B;  3ZJV A;  4KHA A;  2GB1 A;  3UQA A;  2LVP A;  1WE6 A;  4EZJ A;  1AW7 A;  1QKZ A;  3TMP B;  2KOX A;  3WCQ A;  1FD6 A;  4EZL A;  4CYE A;  2WX1 A;  4DXF A;  4KIK B;  3QIJ A;  2RD0 A;  2MKR A;  1SIJ A;  2D3A A;  3KRW A;  1WX8 A;  1WJU A;  4GLS C;  1D5Z C;  1ZM0 A;  1V1O A;  4P1C C;  5HE0 A;  4IWQ A;  2KWC A;  2R2Q A;  3UZT A;  3Q8C A;  5JHB A;  4MDK E;  1XLO A;  1QC6 A;  5DHF B;  3TUO A;  1XLN A;  1TGZ B;  4JPS A;  2NZ8 B;  1HEZ E;  1MJD A;  2NTT A;  2WX0 A;  4II3 B;  2XNA C;  5HI1 A;  1P5T A;  3A33 B;  1U27 A;  2DAJ A;  2I1K A;  4KZ0 A;  2XEW A;  3VAW A;  5BYR A;  1P7F A;  1N5X A;  1XOD A;  2OQB A;  3ZVR A;  2KQS A;  3PRZ A;  2GBN A;  3UIO B;  1JRP A;  2AX5 A;  2RGN B;  2KT7 A;  2UZS A;  2CR5 A;  1FMA D;  2KD0 A;  4GSW A;  4GOC A;  4EFO A;  1GC6 A;  2W2W A;  3UF8 A;  2COA A;  4EKU A;  4KDL B;  4C7Z A;  2LAS A;  2R0D A;  2WXM A;  2JXX A;  3WAN A;  2KAJ A;  2WXG A;  2GRI A;  1TY2 A;  2MP2 A;  2DX5 B;  4ACF A;  4DDG D;  2QMT A;  1L4D B;  2MEK A;  4ANX A;  1LM8 B;  3VR8 B;  4HEA 1;  4QXA B;  1F0Z A;  1MHX A;  1WGR A;  1UF0 A;  4YTM B;  5C5B A;  1P6S A;  2KVR A;  4F7Z A;  1VZ6 A;  1K52 A;  1HZ6 A;  4W9F A;  3UGB B;  2LYD A;  1XXG A;  5HG2 A;  3IAM 1;  1E7P B;  4E3C A;  3R3M A;  4CHM A;  1MVK A;  5J3Q A;  3FSS A;  2WP9 B;  1OEY J;  4PS8 A;  2KMC A;  1WR6 E;  3H8H A;  2YRY A;  1DOI A;  3DQV A;  5EE0 A;  3B1L X;  4XGA B;  2SEB D;  5AZG A;  1KH0 A;  3HVD A;  5C16 A;  4WQM A;  1YQB A;  2EMS A;  1EWY C;  1FRR A;  5D6J B;  4B0E A;  1VDV A;  2INP E;  4B0M A;  2BBC A;  2LGS A;  2W2X C;  3QAR A;  3AU5 A;  3JVZ X;  3NHE B;  3MC9 A;  2D3G A;  3DXD A;  1QOG A;  2DYM A;  2MP2 B;  1XLP A;  3RCP A;  4GDK B;  3VH3 B;  1C4P A;  1K5D B;  2GJY A;  3ZNI D;  1I42 A;  1FHO A;  5LG4 B;  3NUH B;  2IDY A;  1WWT A;  1J19 A;  3ALB A;  4HB2 B;  1KLG D;  2JP2 A;  1FEH A;  1W1H A;  4REZ A;  2CY5 A;  1XCT L;  1UEF A;  2PEA A;  1TY0 A;  2KQ7 A;  3RPF C;  2Z4D A;  2BYF A;  1FM0 D;  4K7W A;  2L52 A;  4L23 A;  2JUO A;  1Z5S B;  2HTH A;  4HDO A;  2LJ5 A;  3NS8 A;  4W9G A;  3V05 A;  3N1Z C;  3EA6 A;  2ON8 A;  2J0K A;  2LRU A;  4B6W A;  3A1Q A;  1KF6 B;  1WFY A;  4A3O A;  4MGK E;  4P7I A;  1RWS A;  3DWM A;  4BFR A;  4M00 A;  2XK5 A;  1F77 A;  3SU8 X;  3CIK A;  4HAX B;  2WQY B;  4R3D A;  4ZRI A;  1JCK B;  4LNI A;  2W3S A;  1ISN A;  1U5E A;  2MQJ A;  1UH6 A;  1ZXI A;  1GOZ A;  4YTN B;  1FB8 A;  3NWA A;  3U12 A;  2D07 B;  2G3Q B;  4NAW A;  2ELB A;  2YEP B;  4FLH A;  2KDE B;  1WR1 A;  4YSZ B;  5IO9 A;  2JWZ A;  1QLB B;  2LMC A;  1AN8 A;  1SE9 A;  1WXV A;  2CHZ A;  4IWP A;  1NTY A;  4KZC A;  4DXG A;  4OHJ A;  1K5G B;  2YF0 A;  5CHV C;  2COD A;  1FRD A;  2KUQ A;  2ZCC A;  1FFV A;  5J3T A;  2ELA A;  2KWV B;  2FID A;  2WS3 B;  3NWF A;  5D94 A;  2Z8L A;  1WJ6 A;  2QC8 A;  3K9O B;  1KLV A;  3V6E B;  1XLQ A;  3KWL A;  5KQ1 A;  5EDS A;  4XC2 A;  5LLI A;  1MFW A;  3NVZ A;  3MC0 B;  4C00 A;  1HTQ A;  2JWU A;  4MEL A;  2N9P C;  1MIX A;  2YSZ A;  4BVU C;  4K2P A;  1UNR A;  2MX2 A;  1YD8 U;  1WM2 A;  2Z0O A;  2IJ0 A;  2DHJ A;  4OT1 A;  4TUU A;  4S0R A;  4KGS A;  2Z0E B;  4ANW A;  4NAW B;  1KOT A;  3CXB B;  4J3O D;  4HB0 B;  1QQG A;  2L7R A;  1ACC A;  3Q3F A;  1YN5 A;  3MFG A;  3BVZ A;  4FA6 A;  4K7S A;  1UZX B;  5AZF A;  5C2T B;  4DHZ B;  4IAP A;  4F7U P;  4IM0 A;  2BW2 A;  1MG8 A;  3DVN U;  4GMX B;  3N3K B;  3PHW B;  3SDL C;  3DVG X;  4YTP B;  1YJJ A;  5G5H A;  5D2M B;  5CLL B;  5FR6 A;  3DXE A;  2KTR A;  5CTR C;  2YT1 A;  3RI7 C;  2EC1 A;  1WY8 A;  5HFY A;  4K3B A;  5DH9 B;  3A9J A;  4N9F 4;  4QAY A;  1RFA A;  1I35 A;  1P0R A;  3H7P A;  3ZRC A;  4HAU B;  3NVW A;  3DHH C;  3IT4 B;  3VTU A;  5IAA C;  1CJE A;  3RUI B;  1B55 A;  4WH4 A;  3ZNG C;  4AJW A;  4DHJ B;  2FIF A;  1AAR A;  2G9H D;  4DXA B;  3B0A A;  3R7R A;  1HA5 A;  1I4P A;  4FHJ A;  1P3R A;  5DI9 B;  2C7N B;  1FXT B;  2DKP A;  3BYY B;  3PRP B;  4EUT A;  2YVC A;  3V6C B;  1ZE3 D;  1WIA A;  2VZK B;  4PQ0 A;  2CU3 A;  5JLJ B;  5I4D A;  2K8E A;  2G45 B;  3PEG A;  2JF5 A;  1SJE D;  1E8X A;  4HPM B;  1CZP A;  4K7U A;  4PK1 A;  1WVH A;  1WGD A;  2L32 A;  3VRA B;  5KCV A;  1YJ1 A;  1V97 A;  2REX A;  1V88 A;  2KX3 A;  3AEB B;  5FKA C;  4BAX A;  1IBX A;  1M7R A;  3OLM D;  2WDQ B;  4AS1 A;  5J17 A;  1MKE A;  1C1Y B;  2DHK A;  1P7E A;  3VDZ A;  4S17 A;  3A9J B;  1LQB A;  2UVM A;  3VUX A;  3H7P B;  3DBR B;  2Q13 A;  2MJ3 A;  2HD5 B;  3V60 A;  4MK0 A;  1SF0 A;  1C9F A;  3VTV A;  1VZ7 A;  2K8C A;  1WE7 A;  3IHP C;  1UNS A;  1JQ4 A;  2LXC A;  2MWN B;  3R2I A;  4MT7 A;  2CKH B;  2KLC A;  3FEH A;  2KKC A;  2WXO A;  4QJ5 B;  1IUE A;  3NVY A;  4HXD A;  4ZHO A;  1XCG A;  3P7Z A;  2RPV A;  4MT5 A;  1U2B A;  3H7S A;  4P1B C;  1UWM A;  3MJ5 A;  1OGW A;  3IXS A;  2QHO A;  3DBH I;  4IOY X;  4W9L A;  1E6E B;  1ZW7 A;  2KIG A;  1L4Z B;  1E5W A;  3EHV A;  4ARC A;  4ITK A;  2DKQ A;  2X8X X;  5KHO A;  4M0W A;  1FCL A;  3SV1 A;  1ET9 A;  3PZ7 A;  1D3Z A;  1ZDX A;  2LVO A;  1OEY A;  3GE8 C;  1NU2 A;  3P2B A;  2E2X A;  2KFJ A;  2YT2 A;  5JH5 C;  3RNA C;  5JHG A;  1N61 A;  1V1P A;  3RUL A;  3PV1 A;  4RF0 A;  1T3Q A;  4LDT B;  3KLS X;  3I5J C;  1WX9 A;  4XWX A;  2KQ4 X;  1YQ3 B;  1EAZ A;  2RGF A;  5LON B;  4HPL B;  1I7A A;  2M38 A;  5HE2 A;  4Z2N A;  1ROE A;  3DPD A;  2L1A A;  1PFD A;  3TW1 A;  4F8C B;  4YSX B;  3UQB A;  1DBH A;  1MPH A;  4CO7 A;  1R4M I;  3I63 C;  1DRO A;  4JWS C;  2N9K A;  1D5X C;  1IGC A;  1WMH A;  5L83 A;  4RFB A;  3OAN A;  2PJH A;  2I1J A;  2AQ2 B;  2BGF A;  5BO4 B;  3SHQ A;  2MDX A;  3ODX A;  4W9C A;  2KMA A;  3VQI A;  4W9K A;  1TS3 A;  1BWN A;  3RNF C;  2KK8 A;  4IUM B;  4BBN F;  3B9J A;  3HIZ A;  4W9H A;  3O96 A;  1N60 A;  4M8M A;  2X38 A;  2Y5B B;  2QSD A;  1WRI A;  4C4V A;  2DYO A;  3MPX A;  5G5G A;  3ZDM C;  4GDL A;  1GG3 A;  1MIZ B;  1MI1 A;  3RNG C;  3VUY A;  2L8J A;  2Z0P A;  4P6V F;  4WJN A;  4HAY B;  2UU7 A;  3VH4 B;  3Q3N C;  1KTK A;  4IOI E;  4E74 A;  3ECI A;  1V1P B;  1WXQ A;  2WXF A;  3DOW A;  2M14 A;  4KKI A;  2KN4 A;  4FHK A;  3P4S B;  4UDU C;  5J18 A;  1J7A A;  3VRB B;  1YIW A;  5DIF B;  1T0S C;  1FGY A;  1R4N B;  1WGG A;  1BT0 A;  5CLQ B;  3OJ3 A;  1VD2 A;  1IYF A;  1L5P A;  1OQQ A;  4ASW C;  2DYB A;  3PO0 A;  4NJ6 A;  2DEN B;  3GOE A;  1F2R I;  2LXA A;  4WJQ A;  2KJ6 A;  3BII D;  1IGD A;  2IO1 B;  2DA0 A;  1G6J A;  4HLE A;  2DZJ A;  2FE8 A;  2K8B A;  3O13 A;  3HW2 B;  3PHX B;  3W5U B;  2BWE S;  4MH8 A;  4GOU A;  2GBR A;  4GDL B;  5BMG A;  3PRE A;  3AEG B;  4M01 A;  1TS5 A;  4TSS A;  3I3T B;  2DLW A;  5JZE B;  3DBL I;  1TT5 B;  4GPT B;  3BK2 A;  1TYG B;  3IBE A;  2LOX A;  4KIK A;  4BBN C;  2NCN A;  1J0W A;  2ZZP B;  3P6A A;  2C5L C;  2LI5 A;  4DQO C;  1OMW A;  3ML9 A;  3B08 A;  3BVG A;  3BYT B;  3G9W A;  2PLP A;  1GUA B;  1FGZ A;  1T0Y A;  2YS1 A;  3GYP A;  1XD4 A;  2R2O A;  3IG3 A;  4A55 A;  5BMI A;  1N62 A;  3GZN B;  5EE1 A;  5FR3 A;  2EKE C;  4DX9 0;  4N58 A;  1E7U A;  1SE2 A;  3W1S C;  2FUG 1;  4GB9 A;  4B6H A;  3CST A;  2QEJ C;  4URK A;  4ZRK A;  2WLB A;  1E9M A;  4WJ7 A;  5C3J B;  1TZ1 A;  3N20 C;  4ZRJ A;  1BAK A;  1NEN B;  2AWT A;  2A5U A;  4HPP A;  3JYU A;  3AI5 A;  3OWE B;  4P16 A;  3ZNH B;  3GP7 A;  3NZS A;  2LUE A;  1ZYI A;  1P1A A;  1VR9 A;  4JGH B;  1M94 A;  2CU1 A;  2BWF A;  2JSV X;  3RD2 A;  4JQW C;  4I6L B;  2O2V B;  2RMM A;  2Z0D B;  2Z59 A;  4F7H A;  3OAW A;  3U7Z A;  1NI2 A;  2MRP A;  4I6N B;  1E10 A;  4YWG G;  3PSC A;  2DX5 A;  4OW0 A;  4USA A;  4HAW B;  4AJY B;  2W54 A;  1N6Z A;  2WXQ A;  1JML A;  4K3C A;  1H8C A;  4F7G A;  2XQN M;  2JZ3 B;  2JU6 X;  3RMK C;  2QKL A;  5AUI A;  1SXT A;  3PS6 A;  3B2F A;  3E9S A;  1NBF C;  2D9V A;  1TBE A;  5C6R A;  1WXM A;  1KLU D;  1NVI D;  1NYQ A;  1TS2 A;  5IOI A;  3N9Y C;  4NNJ B;  2D11 A;  3EGR A;  1V5P A;  5C79 A;  2D3B A;  2M17 A;  4FBJ B;  3LDZ E;  3KVF B;  1FXI A;  2RDB C;  4DHJ D;  3BWU D;  3ZUN A;  2GLS A;  1YX5 B;  2V4L A;  2L2I A;  2JY6 A;  4MGI E;  4MSM B;  2KFK A;  4HB4 B;  4NAM A;  2K9X A;  3AB5 A;  2VZK D;  1PFJ A;  2K0P A;  2Z59 B;  3P4R B;  1V8C A;  3WA0 A;  5D3D A;  3NG0 A;  3ZYY X;  1DOX A;  4KV2 A;  2NBU A;  3RNB C;  4GDK A;  5JXV A;  3KUD B;  2KVZ A;  1V5U A;  3AM9 A;  1UGM A;  1ZC4 B;  1YOV B;  4LNN A;  3R7Q A;  2DN6 A;  3ZLZ A;  2W82 A;  2LWP A;  4YL8 A;  4ZDV A;  5TR5 A;  5FI0 A;  1KRH A;  4KX6 B;  4WQO B;  2Z14 A;  2KJR A;  3BIN A;  2D9Z A;  4HKZ E;  3EEC A;  1I4X A;  1EF1 A;  1OTR B;  1SGH A;  1LB1 A;  1W1D A;  2IGD A;  2E3T A;  1E90 A;  2NVU I;  3GE3 C;  1SIF A;  1PGX A;  3PT2 B;  1VRA B;  2MCN B;  4CQN A;  3NVV A;  2KFK B;  5EE9 A;  2KLG A;  3QWZ B;  3NSU A;  4FAD A;  3KYD D;  5LXH A;  2KNB A;  1WRD B;  2FJU B;  4IFS A;  1W1G A;  1QOA A;  1JRU A;  4G50 A;  1JWU D;  2IPK D;  2LUM A;  2KIE A;  1J8C A;  1FNW A;  2PKO A;  3D8E A;  2NR2 A;  1YN3 A;  3AUL A;  3MC8 A;  2ZW0 A;  4OSN A;  3PZ8 A;  3QBV B;  5GXG B;  2GUM A;  2J53 A;  3IT6 B;  2DAF A;  4G0N B;  3TFM A;  4LDT D;  1AQC A;  4WVF B;  2N1V A;  4AP4 C;  2OTX A;  1GNU A;  4PNK A;  3PP2 A;  3URY A;  3APF A;  1WYW B;  2O6V B;  3GS2 A;  4IW0 A;  3N7C A;  4GXB A;  1L6U A;  2KC1 A;  4GGQ A;  4AWJ A;  2IO3 B;  3HSA A;  4BZA A;  2KDF B;  3RCZ A;  4XYC A;  3SUZ A;  3LB8 C;  4HJK A;  2B3A A;  1OFF A;  2LG1 A;  3ML8 A;  3CMM B;  1TZO A;  4D0N B;  2SAK A;  3P63 A;  5IKC M;  4K2O A;  1S1Q B;  4JL9 A;  2NBV A;  1GC7 A;  4HDQ A;  2J0J A;  4LJO B;  4JLC A;  1E8W A;  3NW8 A;  1K8R B;  3FIL B;  3HK0 A;  2KAN A;  3AEA B;  2QDF A;  1MK7 B;  1WG7 A;  1V61 A;  4ANU A;  2YT0 A;  1FHX A;  1X05 A;  4JX1 C;  2CRF A;  4DDI D;  2AYO B;  2N0Y A;  1F52 A;  3ODW A;  1U5G A;  4RM8 A;  3DWG C;  3LYY A;  2PTL A;  2AEH A;  2UYZ B;  2KO3 A;  2ACZ B;  3GZN I;  1IP9 A;  3ZDT A;  1WJ1 A;  3ZO5 B;  1WH3 A;  4WWM A;  4TQ0 A;  2VRR B;  1F9J A;  4C0A A;  4XE0 A;  3JSV A;  4BOS C;  1TJE A;  1YQ4 B;  4MJS A;  1WXS A;  3MP9 A;  4BKS D;  2M56 B;  4HK2 A;  2BS4 B;  1YNT E;  2MJD A;  1ZPS A;  1TTN A;  2PMV A;  2VH1 A;  4QJ3 B;  1T0Q C;  3CSF A;  2KR0 A;  3Q8A A;  1V86 A;  5KHQ A;  1WJN A;  4F1S A;  1ZDV A;  2BB6 A;  3Q14 C;  3Q3O C;  2JX5 A;  4GZU A;  2IFS A;  2AL6 A;  2DTC A;  4NJ7 A;  5HE1 A;  2NBV B;  4DIX A;  2PPH A;  1MPE A;  1K53 A;  5J3Y A;  2JXT A;  3AED B;  2DHI A;  1YN4 A;  4MGZ E;  2J4X A;  2BKF A;  4A6Q A;  4ARI A;  2Y3A A;  4QJ4 B;  1DYQ A;  4IM3 A;  2AQ1 B;  1FXA A;  4OZA A;  3D8D A;  3WIM A;  1Q5W B;  4WWN A;  1Q0W B;  2IO2 B;  2KUP A;  2V3N A;  1Q10 A;  3W2D A;  2M4N A;  3NJT A;  2DX1 A;  3JSV B;  1HZ5 A;  4MJS B;  2ICI A;  1PGA A;  1J7C A;  3I9V 1;  3PLV A;  3ODO A;  3CIR B;  5LNK 1;  3LXF A;  4G11 A;  2J52 A;  3RNC C;  2AL3 A;  4XDC A;  2J42 A;  4A90 A;  1WZ3 A;  2KDM A;  4FUL A;  5E6N A;  1QIL A;  3F0W A;  3SFE B;  5D3W A;  2ZVN A;  5AUK A;  2JT4 B;  1MAI A;  3L16 A;  2L83 A;  3Q8F A;  2YLM A;  3R66 C;  2V76 A;  4HRO A;  1FAO A;  4RNA A;  2ZW1 A;  1SEB D;  3QA8 A;  4KHB A;  2CJO A;  1F2R C;  2IGH A;  4RMA A;  1E7V A;  3ZRF A;  3TEZ A;  1BUI C;  3AE5 B;  4HHV A;  2IYD B;  3EC8 A;  1JW9 D;  2DWQ A;  3P1M A;  3AN1 A;  1PUT A;  2L3Z A;  3HIE A;  3ZTD A;  1ZC3 B;  2GBJ A;  3BZD B;  1XT9 B;  3P4P B;  2CHW A;  2WWZ A;  1GAQ B;  2KZR A;  3N1Y C;  3V61 A;  3T06 A;  2PVO D;  4TYZ A;  1UBQ A;  4YXD B;  5GMV A;  1JRO A;  1GB1 A;  1S3S G;  4WAF A;  1NTV A;  3A9K B;  1I4Q A;  2B76 B;  4KGR A;  2VRW B;  3SO6 A;  3EFC A;  4IDI A;  3HM6 X;  2K6D B;  1RRP B;  4HAZ B;  3IFW B;  3ULB A;  4MAC A;  3L17 A;  4KGT A;  2QIL A;  3V3X A;  2DBY A;  4XWW A;  5JHA A;  1VCB A;  4DX8 A;  1I4R A;  3KUZ A;  4ANV A;  1TKE A;  2BS2 B;  3SNH A;  4KHB B;  4PYZ A;  4A20 A;  1MG4 A;  2ROZ B;  2MA9 B;  3HHM A;  2K2J A;  2C60 A;  2LRW A;  4OZB A;  2M0X A;  2KAC A;  1JWS D;  2CJN A;  1MHH E;  3BVM A;  2WXN A;  2MW5 A;  5IA7 A;  3HM3 A;  1Q1O A;  3FC4 A;  1SHC A;  3OJ4 B;  4BKS A;  2ZEQ A;  3L0W B;  2M19 A;  1OQY A;  1ZGU B;  1J7B A;  4MEM A;  1HTO A;  3MJW A;  1Z87 A;  1V9J A;  2HJ1 A;  3AU4 A;  2W55 A;  1IRS A;  1RM6 C;  3AE2 B;  3SD5 A;  2AQ3 B;  2GOW A;  2COF A;  2LD9 A;  4M02 A;  5GOW B;  2HE7 A;  3W1Y A;  1B9R A;  2K25 A;  4L1R A;  3EUB 2;  2WDR B;  3T3N A;  2ZNV C;  2MFQ A;  2NS5 A;  1OQN A;  2Y7B A;  2Y5P A;  1SBB B;  3Q2A C;  1L0V B;  5DPS A;  4US8 A;  1EU4 A;  2D9Y A;  2BB5 A;  3N30 A;  1C3T A;  4E71 A;  4J6I A;  1HE8 A;  3IAS 1;  4DBG A;  2C9W B;  2J59 M;  1L2N A;  2RNR B;  3L54 A;  4A9A A;  1Q67 A;  4RGN A;  1ENF A;  1XCQ L;  1TQZ A;  3A98 B;  2N7D A;  3L4P A;  5L95 C;  1JWA D;  3PVU A;  3ZGZ A;  1FOE A;  5I2S A;  1TXD A;  2BVC A;  2WU2 B;  2KDI A;  2LHE A;  2G1E A;  1TIF A;  1H10 A;  4A6K A;  2GBM A;  2RPQ A;  2MHJ A;  3TEW A;  4EOY A;  4C80 A;  2RRF A;  2PIA A;  1LW3 A;  4K17 A;  2MBO A;  1SJH D;  2KJH B;  2XN9 C;  2TSS A;  2K5P A;  4ICV A;  2BQQ A;  3AEC B;  1X1F A;  3M1I B;  3AXC A;  4LK0 M;  1AWD A;  4EZK A;  3W9C B;  3AJ4 A;  2IY0 B;  2LGY A;  2QIE B;  1RRB A;  2RDH A;  4RCO A;  2H89 B;  3A4R A;  1WGH A;  4I6P A;  3HVZ A;  5FK9 C;  4HSI A;  2CAY A;  2O6V D;  1NDD A;  1L7Y A;  2GBK A;  1STE A;  2I5F A;  2DFK A;  4HKQ A;  3MHZ A;  1ZUD 2;  3NZ3 A;  2CY4 A;  3TL5 A;  1ZSQ A;  4HB3 B;  1ZP0 B;  3Q69 A;  4JE3 B;  1FHW A;  3KWV A;  5IRS A;  3N32 A;  1YMH E;  5EE3 A;  5KQ4 A;  4LNK A;  2O2V A;  2NPT B;  4IWO A;  1QZE A;  1WI0 A;  1V6E A;  1GB4 A;  3U30 A;  3VUW A;  1QT9 A;  3TIX A;  5JP4 A;  2DNF A;  3ABV B;  5HE3 A;  2N7E A;  3TVV A;  2EEL A;  2G4D B;  1P9D U;  3VTW A;  4NZL B;  1PQS A;  4BOZ B;  2KXJ A;  3ZKJ C;  4M8N A;  3UIN B;  1OQR A;  4X57 B;  5MPO A;  3LJU X;  2KYW A;  4KSL C;  2OOB B;  5JHH A;  4HWI B;  2ONQ A;  4WJP A;  4A3P A;  4KDI C;  2CHX A;  3OG5 A;  2UZR A;  3WAP A;  2KN5 A;  2P0D A;  1UD7 A;  2DZK A;  4AUQ C;  1GJZ A;  5DPR A;  4DBB A;  2FCM A;  3X0W A;  2LUL A;  2PVG C;  2Q5W D;  4AOF A;  3MTN B;  1K50 A;  1JWB D;  2LZ6 A;  3L08 A;  1N3H A;  1E8Y A;  2BCJ A;  1UEL A;  2DYN A;  3DVG Y;  4EMO A;  4EJN A;  4KSK C;  4W9J A;  2FAZ A;  2N9E B;  3QX1 A;  1Y5O A;  4A6F B;  1P3Q U;  3DBR I;  3F5R A;  1VJK A;  1YJI A;  3PLU A;  3MDB C;  3V5W A;  1L6V A;  3DVN V;  3B2G A;  2EMT A;  1XR0 B;  2K1F A;  2V4I B;  4FJY A;  1FO4 A;  1FNV A;  4LNF A;  3L10 B;  2KC2 A;  2QCZ A;  1C78 A;  5FI1 A;  5M4Y B;  4WJO A;  1U4A A;  1DDV A;  3UI3 A;  2IBI B;  3X23 A;  2ZPY A;  3APC A;  2DYQ A;  4O1N A;  3D32 A;  4L2Y A;  2RVB B;  3ENE A;  5AZH A;  2MWS B;  3A4S C;  4WIP A;  4A8X C;  1ZKH A;  2IND C;  2BYV E;  1C76 A;  5CX3 A;  1TKG A;  1MI0 A;  3NY5 A;  3QHT A;  3U52 E;  3T3O A;  3R8B A;  4OZC A;  4Y94 A;  1DDM A;  1JWM D;  3O65 B;  2INN E;  4WWP A;  3FM8 C;  1XEE A;  2VKI A;  2VH2 A;  3KYC D;  4A5K A;  2FBW B;  2MLB A;  2KX0 A;  4WAA A;  3V62 A;  1FIQ A;  2KDB A;  3R2T A;  3ML4 A;  1KI1 B;  2Y8F A;  3Q6B A;  3ZW3 A;  1E8Z A;  2ROV A;  2WHI A;  1XKE A;  3PPA A;  2WXR A;  2G4S A;  3H1U A;  2R09 A;  1UPQ A;  4XX5 A;  4EEW A;  1UUP A;  5HHD G;  1AYF A;  2WXI A;  2ZPN A;  1BTN A;  2MBH A;  4HCP B;  1UNQ A;  2BT6 A;  3CF6 E;  2HTM E;  5E6J A;  1DDW A;  2L0T A; 
#chains in the Genus database with same CATH homology
 1V49 A;  2FJL A;  3M63 B;  3GYO A;  2WYQ A;  5C23 A;  1WGY A;  2O6V A;  3TBL D;  3PVL A;  3NOB A;  2M8S A;  4NY0 A;  2PE6 B;  4MSQ B;  3TCA A;  4W9E A;  2L1C A;  2BYE A;  4WWO A;  3KY9 A;  1R4N I;  3UIP B;  4BBK A;  3ZNZ B;  2K8H A;  5G55 A;  1RJ2 A;  2FCQ A;  2FUH B;  1RAX A;  3WAL A;  4ICU A;  2K6Q A;  1WGU A;  3DDC B;  5LXI B;  4DHZ E;  2GMI C;  4KAX B;  3D8F A;  4DWF A;  2P8V A;  2FCN A;  4XZ4 A;  4FJZ A;  5C5B B;  4B9K A;  3ZIM A;  5CHF A;  3DXC A;  4BKT A;  3WAO A;  3VIA A;  2G35 A;  3L13 A;  1WI1 A;  3HQC A;  1EVH A;  1U5F A;  4K81 A;  5D3Y A;  3SYX A;  3KZ1 A;  4KHO A;  3Q3J A;  3H9D A;  3JW0 X;  2I5C A;  2FCS A;  2LGX A;  2JRH A;  2N4F A;  3WAM A;  4PYU A;  2ASQ A;  3U7D A;  1A5R A;  1WGQ A;  3ZTC A;  2J0M A;  2JPH A;  4MGY E;  4HCN B;  4OVU A;  5G2N A;  1M7E A;  2PE9 A;  2KGX B;  2OJR A;  4TQ1 A;  5E6P A;  4NQL B;  1WXA A;  3EFU A;  2D9W A;  1WM3 A;  2XBB C;  3KUC B;  2DHZ A;  2V3S A;  3QK0 A;  2D2Q A;  1PMS A;  4BKG A;  3RZF A;  1X86 A;  5LOP B;  3A8Q A;  2BPS A;  4TKN A;  1X1M A;  2HTH B;  5DCN A;  3TJP A;  2NBW B;  2CS4 A;  2JZZ A;  1AWE A;  2KHW B;  3A1Q B;  4CHJ A;  4HVB A;  3KSY A;  1XQQ A;  4PS7 A;  2KTF A;  2PZ1 A;  5CHW A;  2XK5 B;  1PLS A;  1Y19 B;  1I2H A;  2ZJD A;  2N9X A;  2C7H A;  5HKH A;  1U5D A;  4TV3 A;  2YS5 A;  1KZ7 A;  3H6N A;  5D3X A;  2RSU A;  3M3J A;  2WDT B;  4GIV A;  2H7D A;  5AEK B;  4JIO U;  4MM3 A;  2P0H A;  3A9K A;  2D10 A;  4G3X B;  1H4R A;  3QJZ A;  4OVV A;  3RT3 B;  2RUK B;  1UNP A;  3T9L A;  3LJ3 A;  1YX6 B;  4FN2 A;  4W9D A;  2K39 A;  3ONS A;  5J2R A;  2IY1 B;  4Z2M B;  2K00 A;  1X11 A;  4CHK A;  4FJV B;  2DZI A;  1KM7 A;  1XX0 A;  2A4Z A;  2MBE A;  2ADZ A;  2JVC A;  4NQK E;  4B95 A;  4NSW A;  2LVQ A;  2KTR B;  2L05 A;  2K2U A;  2IZV B;  5DHA B;  2ZVO A;  1EGX A;  4HAV B;  3ULC A;  4DK5 A;  3KW5 B;  4MY6 A;  2LOZ A;  3PSE B;  2MBQ A;  1V89 A;  1IPG A;  2FNJ B;  1DYN A;  4MH0 E;  5D27 A;  5D3V A;  2RSG A;  3PZD A;  2ZNV B;  1P98 A;  2RLO A;  2ZCB A;  1WZ0 A;  2DZM A;  3DCG A;  2IO0 B;  3ZVV A;  2GCL A;  3PRM B;  1V2Y A;  3IVF A;  2X18 A;  2QKM A;  2MSE D;  3T8M A;  2GCJ A;  2W2X D;  1EF5 A;  2V1Y A;  4LJP B;  3S2A A;  3BJI A;  3VXW A;  3DBS A;  3TO1 A;  2N1W A;  5DPW A;  1EUV B;  2D4Q A;  3VVW B;  5E6O A;  2H7E A;  1EO6 A;  3A8P A;  4GN1 A;  3PVW A;  2MBB B;  2JRI B;  4GU2 A;  3W1S A;  4A6H A;  2VSZ A;  3APD A;  3U8Z A;  5D7G A;  2KCJ A;  3PGE A;  2J7Q B;  3K9P B;  2Z0Q A;  1V5M A;  2L00 B;  3QWM A;  1J0G A;  2NPT A;  2RR9 A;  1WJM A;  1KJT A;  4KVG B;  4M0W B;  2Y8G A;  4K1R B;  4II2 B;  2YS3 A;  1WX7 A;  3NZU A;  1V5O A;  2HJ8 A;  5EFX A;  2L76 A;  4W9I A;  4IM2 A;  3VHT C;  5C1Z A;  4H8S A;  1Y8R C;  2COC A;  2M1M A;  1BTK A;  2D9X A;  3KRX A;  4LCD E;  2BF8 B;  2GS0 A;  2UWQ A;  1WMH B;  4IC7 B;  2W9N A;  3QC8 B;  1LFD A;  3VFK A;  3BY4 B;  3RZW C;  3RYT A;  1LXD A;  1WF9 A;  2LKO A;  4A6F A;  3PTF C;  1V81 A;  4NPN A;  4GMV A;  2EJ8 A;  1Z2M A;  2LGD A;  4ZYN A;  1U29 A;  3MHS D;  1WJ4 A;  2L0F A;  3C0R B;  3KH0 A;  3QCA A;  3QAQ A;  4L6E A;  2N23 A;  4YON A;  1MK9 B;  3M62 B;  5DPT A;  1UPR A;  4WSF A;  2IYB A;  5L81 A;  2C7M B;  4PS3 A;  2P0F A;  3QQ8 B;  3VOQ A;  3WYF B;  1V80 A;  4RM9 A;  2BKR B;  1ZVR A;  1UBI A;  1KZG A;  1CMX B;  4IG7 B;  1RLF A;  3PG7 A;  2KWU B;  3M95 A;  1TJ6 A;  1OY2 A;  1XD3 B;  1X1G A;  1V5T A;  2NMB A;  4HAT B;  4KHA A;  3UQA A;  2LVP A;  1WE6 A;  4EZJ A;  3TMP B;  2KOX A;  4EZL A;  4CYE A;  2WX1 A;  4KIK B;  3QIJ A;  2RD0 A;  2MKR A;  3KRW A;  1WX8 A;  1WJU A;  1ZM0 A;  5HE0 A;  4IWQ A;  2KWC A;  2R2Q A;  3UZT A;  5JHB A;  4MDK E;  1QC6 A;  5DHF B;  1TGZ B;  2NZ8 B;  4II3 B;  2WX0 A;  1P5T A;  3A33 B;  1U27 A;  2DAJ A;  2I1K A;  4KZ0 A;  2XEW A;  3VAW A;  1XOD A;  2OQB A;  3ZVR A;  2KQS A;  3PRZ A;  2GBN A;  3UIO B;  2RGN B;  2UZS A;  2CR5 A;  4GSW A;  2KD0 A;  4GOC A;  4EFO A;  1GC6 A;  2W2W A;  3UF8 A;  2COA A;  4EKU A;  4KDL B;  2LAS A;  2R0D A;  2JXX A;  3WAN A;  2MP2 A;  2DX5 B;  4DDG D;  4ANX A;  1LM8 B;  1WGR A;  5C5B A;  1P6S A;  2KVR A;  4F7Z A;  4W9F A;  2LYD A;  4E3C A;  3R3M A;  4CHM A;  5J3Q A;  3FSS A;  1OEY J;  4PS8 A;  2KMC A;  1WR6 E;  2YRY A;  3DQV A;  3B1L X;  5AZG A;  5C16 A;  1YQB A;  2EMS A;  5D6J B;  2W2X C;  3QAR A;  3AU5 A;  3JVZ X;  3NHE B;  2D3G A;  3DXD A;  2DYM A;  2MP2 B;  3RCP A;  4GDK B;  3VH3 B;  1K5D B;  2GJY A;  3ZNI D;  1I42 A;  1FHO A;  3ALB A;  1J19 A;  4HB2 B;  2JP2 A;  1W1H A;  2CY5 A;  1UEF A;  2PEA A;  2KQ7 A;  2BYF A;  4K7W A;  2JUO A;  1Z5S B;  2HTH A;  4HDO A;  2LJ5 A;  3NS8 A;  4W9G A;  2J0K A;  2LRU A;  4B6W A;  3A1Q A;  1WFY A;  4A3O A;  4MGK E;  4P7I A;  4BFR A;  2XK5 A;  3SU8 X;  3CIK A;  4HAX B;  4ZRI A;  1ISN A;  1U5E A;  2MQJ A;  1UH6 A;  1FB8 A;  2D07 B;  2G3Q B;  4NAW A;  2ELB A;  4FLH A;  2KDE B;  1WR1 A;  2JWZ A;  4KZC A;  1SE9 A;  1WXV A;  2CHZ A;  4IWP A;  1NTY A;  1K5G B;  2YF0 A;  5CHV C;  2COD A;  2ZCC A;  5J3T A;  2ELA A;  2KWV B;  2FID A;  5D94 A;  1WJ6 A;  3K9O B;  1KLV A;  3V6E B;  5KQ1 A;  5EDS A;  4XC2 A;  5LLI A;  4MEL A;  2N9P C;  1MIX A;  2YSZ A;  4BVU C;  4K2P A;  1UNR A;  2MX2 A;  1YD8 U;  1WM2 A;  2Z0O A;  2DHJ A;  4TUU A;  2Z0E B;  4ANW A;  4NAW B;  1KOT A;  3CXB B;  4HB0 B;  1QQG A;  2L7R A;  3Q3F A;  4FA6 A;  4K7S A;  1UZX B;  5AZF A;  4DHZ B;  4IAP A;  4F7U P;  4IM0 A;  1MG8 A;  3DVN U;  4GMX B;  3N3K B;  3PHW B;  3SDL C;  3DVG X;  5D2M B;  5CLL B;  5FR6 A;  3DXE A;  2KTR A;  5CTR C;  2YT1 A;  2EC1 A;  1WY8 A;  5DH9 B;  3A9J A;  4N9F 4;  1RFA A;  1I35 A;  1P0R A;  3H7P A;  3ZRC A;  4HAU B;  3VTU A;  5IAA C;  3RUI B;  1B55 A;  3ZNG C;  4AJW A;  4DHJ B;  2FIF A;  1AAR A;  4DXA B;  3B0A A;  3R7R A;  4FHJ A;  1P3R A;  5DI9 B;  2C7N B;  1FXT B;  2DKP A;  3PRP B;  4EUT A;  2YVC A;  3V6C B;  1WIA A;  4PQ0 A;  5JLJ B;  2G45 B;  3PEG A;  2JF5 A;  4HPM B;  1E8X A;  4K7U A;  1WVH A;  1WGD A;  5KCV A;  1YJ1 A;  2REX A;  1V88 A;  2KX3 A;  1M7R A;  3OLM D;  5J17 A;  1MKE A;  1C1Y B;  2DHK A;  3VDZ A;  3A9J B;  1LQB A;  3VUX A;  2UVM A;  3H7P B;  2Q13 A;  2HD5 B;  3V60 A;  4MK0 A;  3VTV A;  2K8C A;  1WE7 A;  3IHP C;  2LXC A;  2MWN B;  4MT7 A;  2CKH B;  2KLC A;  3FEH A;  2KKC A;  4HXD A;  1XCG A;  3P7Z A;  1U2B A;  3H7S A;  1OGW A;  2QHO A;  3DBH I;  4IOY X;  4W9L A;  1ZW7 A;  1E5W A;  3EHV A;  2DKQ A;  5KHO A;  3SV1 A;  1D3Z A;  2LVO A;  1OEY A;  1NU2 A;  3P2B A;  2E2X A;  2KFJ A;  5JH5 C;  5JHG A;  3RUL A;  3PV1 A;  4LDT B;  1WX9 A;  4XWX A;  2RGF A;  1EAZ A;  5LON B;  4HPL B;  1I7A A;  2M38 A;  5HE2 A;  4Z2N A;  3DPD A;  3TW1 A;  4F8C B;  3UQB A;  1DBH A;  1MPH A;  4CO7 A;  1R4M I;  1DRO A;  1WMH A;  5L83 A;  3OAN A;  2PJH A;  2I1J A;  2BGF A;  5BO4 B;  3SHQ A;  2MDX A;  3ODX A;  4W9C A;  2KMA A;  3VQI A;  4W9K A;  1BWN A;  2KK8 A;  4IUM B;  4BBN F;  3HIZ A;  4W9H A;  3O96 A;  4M8M A;  2Y5B B;  2DYO A;  3MPX A;  3ZDM C;  4GDL A;  1GG3 A;  1MIZ B;  3VUY A;  2L8J A;  2Z0P A;  4WJN A;  4HAY B;  3VH4 B;  4E74 A;  3ECI A;  3DOW A;  2M14 A;  4FHK A;  5J18 A;  1YIW A;  5DIF B;  1FGY A;  1WGG A;  1BT0 A;  5CLQ B;  3OJ3 A;  1VD2 A;  1IYF A;  4ASW C;  2DYB A;  4NJ6 A;  2DEN B;  3GOE A;  2LXA A;  4WJQ A;  2KJ6 A;  2IO1 B;  2DA0 A;  1G6J A;  4HLE A;  2DZJ A;  2K8B A;  3HW2 B;  3PHX B;  2BWE S;  2GBR A;  4GDL B;  3PRE A;  3I3T B;  2DLW A;  5JZE B;  3DBL I;  4GPT B;  3IBE A;  2LOX A;  4KIK A;  4BBN C;  2NCN A;  1J0W A;  2ZZP B;  3P6A A;  2C5L C;  2LI5 A;  1OMW A;  3ML9 A;  3B08 A;  3G9W A;  1GUA B;  1FGZ A;  1T0Y A;  2YS1 A;  3GYP A;  1XD4 A;  2R2O A;  3IG3 A;  2EKE C;  4DX9 0;  1E7U A;  3W1S C;  4GB9 A;  4B6H A;  3CST A;  4URK A;  4ZRK A;  4WJ7 A;  1TZ1 A;  4ZRJ A;  1BAK A;  2AWT A;  2A5U A;  3JYU A;  3AI5 A;  3ZNH B;  3NZS A;  2LUE A;  1P1A A;  4JGH B;  1M94 A;  2CU1 A;  2BWF A;  3RD2 A;  4JQW C;  4I6L B;  2O2V B;  2Z0D B;  4F7H A;  3OAW A;  1NI2 A;  2MRP A;  4I6N B;  3PSC A;  2DX5 A;  4HAW B;  4AJY B;  1H8C A;  4F7G A;  2XQN M;  2JZ3 B;  2QKL A;  3PS6 A;  1NBF C;  2D9V A;  1TBE A;  5C6R A;  1WXM A;  4NNJ B;  2D11 A;  1V5P A;  5C79 A;  2M17 A;  4FBJ B;  3LDZ E;  3KVF B;  4DHJ D;  3ZUN A;  1YX5 B;  2V4L A;  2L2I A;  2JY6 A;  4MGI E;  4MSM B;  2KFK A;  4HB4 B;  1PFJ A;  2Z59 B;  3WA0 A;  4KV2 A;  2NBU A;  4GDK A;  3KUD B;  1V5U A;  1UGM A;  1ZC4 B;  3R7Q A;  2DN6 A;  3ZLZ A;  2LWP A;  4YL8 A;  4ZDV A;  5TR5 A;  5FI0 A;  4WQO B;  2KJR A;  3BIN A;  2D9Z A;  3EEC A;  1EF1 A;  1OTR B;  1SGH A;  1LB1 A;  1W1D A;  1E90 A;  2NVU I;  1SIF A;  3PT2 B;  2MCN B;  2KFK B;  2KLG A;  3QWZ B;  3NSU A;  4FAD A;  3KYD D;  5LXH A;  2KNB A;  1WRD B;  4IFS A;  1W1G A;  1JRU A;  4G50 A;  1J8C A;  3D8E A;  2NR2 A;  3AUL A;  3QBV B;  2DAF A;  4G0N B;  3TFM A;  4LDT D;  1AQC A;  4WVF B;  2N1V A;  4AP4 C;  2OTX A;  1GNU A;  4PNK A;  3PP2 A;  3APF A;  1WYW B;  2O6V B;  4IW0 A;  3N7C A;  4GXB A;  4GGQ A;  2KC1 A;  4AWJ A;  2IO3 B;  2KDF B;  3RCZ A;  3SUZ A;  4HJK A;  2B3A A;  2LG1 A;  3ML8 A;  3CMM B;  4D0N B;  4K2O A;  1S1Q B;  4JL9 A;  1GC7 A;  4HDQ A;  2J0J A;  4LJO B;  4JLC A;  1E8W A;  1K8R B;  3HK0 A;  2KAN A;  1MK7 B;  1WG7 A;  1V61 A;  4ANU A;  2YT0 A;  1FHX A;  1X05 A;  2CRF A;  4DDI D;  2AYO B;  2N0Y A;  3ODW A;  1U5G A;  4RM8 A;  2AEH A;  2UYZ B;  2KO3 A;  3GZN I;  1IP9 A;  3ZDT A;  1WJ1 A;  3ZO5 B;  1WH3 A;  4TQ0 A;  2VRR B;  1F9J A;  4C0A A;  3JSV A;  4BOS C;  4MJS A;  1WXS A;  4BKS D;  4HK2 A;  1TTN A;  3CSF A;  1V86 A;  5KHQ A;  1WJN A;  4F1S A;  4GZU A;  2IFS A;  2AL6 A;  2DTC A;  4NJ7 A;  5HE1 A;  2NBV B;  2PPH A;  5J3Y A;  2DHI A;  4MGZ E;  2BKF A;  4IM3 A;  3D8D A;  3WIM A;  1Q5W B;  4WWN A;  1Q0W B;  2IO2 B;  2KUP A;  2M4N A;  2DX1 A;  3JSV B;  4MJS B;  3PLV A;  3ODO A;  4G11 A;  2AL3 A;  1WZ3 A;  4FUL A;  5E6N A;  3F0W A;  5D3W A;  2ZVN A;  2JT4 B;  1MAI A;  3L16 A;  2YLM A;  3R66 C;  2V76 A;  1FAO A;  3QA8 A;  4RMA A;  1E7V A;  3ZRF A;  4HHV A;  2IYD B;  3EC8 A;  2L3Z A;  3ZTD A;  1ZC3 B;  2GBJ A;  1XT9 B;  2CHW A;  2WWZ A;  2KZR A;  3V61 A;  3T06 A;  4TYZ A;  1UBQ A;  5GMV A;  1S3S G;  1NTV A;  3A9K B;  2VRW B;  3SO6 A;  3HM6 X;  2K6D B;  1RRP B;  4HAZ B;  3IFW B;  3ULB A;  3L17 A;  5JHA A;  1VCB A;  4DX8 A;  3KUZ A;  4ANV A;  3SNH A;  4KHB B;  4PYZ A;  4A20 A;  2ROZ B;  2MA9 B;  3HHM A;  2K2J A;  2C60 A;  2LRW A;  2M0X A;  2MW5 A;  5IA7 A;  3HM3 A;  1Q1O A;  1SHC A;  3OJ4 B;  4BKS A;  2ZEQ A;  3L0W B;  1OQY A;  1ZGU B;  4MEM A;  3MJW A;  1Z87 A;  1V9J A;  3AU4 A;  1IRS A;  3SD5 A;  2GOW A;  2COF A;  2LD9 A;  5GOW B;  2HE7 A;  3W1Y A;  2K25 A;  2ZNV C;  2MFQ A;  2NS5 A;  1OQN A;  2Y7B A;  5DPS A;  2D9Y A;  1C3T A;  3N30 A;  4E71 A;  4J6I A;  1HE8 A;  4DBG A;  2C9W B;  2J59 M;  1L2N A;  2RNR B;  3L54 A;  1Q67 A;  1TQZ A;  3A98 B;  2N7D A;  5L95 C;  3PVU A;  1FOE A;  1TXD A;  2KDI A;  1H10 A;  4A6K A;  2GBM A;  2RPQ A;  4EOY A;  1LW3 A;  4K17 A;  2MBO A;  2KJH B;  4ICV A;  1X1F A;  3M1I B;  3AXC A;  4EZK A;  3AJ4 A;  2IY0 B;  2LGY A;  1RRB A;  3A4R A;  1WGH A;  4I6P A;  2CAY A;  2O6V D;  1NDD A;  1L7Y A;  2GBK A;  2I5F A;  2DFK A;  2CY4 A;  3TL5 A;  1ZSQ A;  4HB3 B;  1FHW A;  3N32 A;  5KQ4 A;  2O2V A;  2NPT B;  4IWO A;  1QZE A;  1WI0 A;  1V6E A;  3U30 A;  3VUW A;  3TIX A;  5JP4 A;  5HE3 A;  2N7E A;  3TVV A;  2G4D B;  1P9D U;  3VTW A;  1PQS A;  4BOZ B;  2KXJ A;  3ZKJ C;  4M8N A;  3UIN B;  4X57 B;  3LJU X;  4KSL C;  2OOB B;  5JHH A;  4HWI B;  4WJP A;  4A3P A;  4KDI C;  2CHX A;  2UZR A;  3WAP A;  2KN5 A;  2P0D A;  1UD7 A;  2DZK A;  4AUQ C;  1GJZ A;  5DPR A;  4DBB A;  2FCM A;  3X0W A;  2LUL A;  4AOF A;  3MTN B;  2LZ6 A;  3L08 A;  1N3H A;  1E8Y A;  2BCJ A;  1UEL A;  2DYN A;  3DVG Y;  4EMO A;  4EJN A;  4KSK C;  4W9J A;  2FAZ A;  2N9E B;  3QX1 A;  1Y5O A;  4A6F B;  1P3Q U;  3DBR I;  3F5R A;  3PLU A;  3MDB C;  3V5W A;  3DVN V;  2EMT A;  1XR0 B;  2K1F A;  4FJY A;  3L10 B;  2KC2 A;  5FI1 A;  4WJO A;  1U4A A;  1DDV A;  2IBI B;  3X23 A;  2ZPY A;  3APC A;  2DYQ A;  3D32 A;  2RVB B;  3ENE A;  5AZH A;  2MWS B;  3A4S C;  1ZKH A;  2BYV E;  5CX3 A;  3NY5 A;  3QHT A;  4Y94 A;  1DDM A;  3O65 B;  4WWP A;  3FM8 C;  2VKI A;  3KYC D;  4A5K A;  2MLB A;  2KX0 A;  4WAA A;  3V62 A;  2KDB A;  3ML4 A;  1KI1 B;  2Y8F A;  3ZW3 A;  1E8Z A;  2ROV A;  1XKE A;  3PPA A;  3H1U A;  2G4S A;  2R09 A;  1UPQ A;  4XX5 A;  4EEW A;  2ZPN A;  1BTN A;  2MBH A;  4HCP B;  1UNQ A;  3CF6 E;  1DDW A;  2L0T A;  3UGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...