3HKZC

The x-ray crystal structure of rna polymerase from archaea
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
385
structure length
370
Chain Sequence
PYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYTKIENVVSSTSIDIASMSIILQLDNEMLKDKGVTVDDVKKAIGRLKLGDFMIEESEDSTLNINFANIDSIAALFKLRDKILNTKIKGIKGIKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit A'
total genus 52
structure length 370
sequence length 385
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3hkzC02
2WAQC 4AYBC 4QIWC 2Y0SC 3HKZC 2PMZC 2WB1C
chains in the Genus database with same CATH superfamily
2AQ0A 4IL6U 3EZ5A 4GXKA 3PW2A 5AKKA 4DWIA 4RQNA 2PMZF 8ICAA 1D8YA 1SKWA 1UT5A 1QSLA 2GH1A 1ZQEA 3WK6A 1WUDA 5AK4A 2Y9TA 5KFCA 4Y2XA 2KIVA 4KLIA 3SAFA 3PX4A 1FO4A 7ICMA 3ORYA 2GO7A 2A1JA 4ELUA 4U6PA 1L7PA 5J8YA 5AHXA 1UA0A 1UHUA 4O3RA 3MDCA 2KSOA 3ICXA 4AP9A 3V72A 3RB0A 2Q0ZX 3F53A 4KLGA 5ALQA 4A8EA 1NKBA 5J2KA 4BGDA 4RQ6A 2H3ZA 3UMBA 4USAA 1PVRA 2EH9A 3N7RC 1JI7A 4GIBA 1TVAA 4Y2UA 3E0FA 4ECRA 1HUZA 4M9GA 4RPZA 2KJ9A 2OWOA 2BCRA 3DEEA 3IHQB 4LZGA 3C21A 3L5KA 3WK9A 1MN8A 2FE9A 4B9TA 3AMZA 4QZ9A 1L8OA 5ALMA 2HHTA 2WF8A 2W3SA 5BOMA 9ICXA 3QUBA 2WHEA 5AM1A 8ICSA 2JR5A 5HHHA 3GU3A 3KOOA 2JGAA 3O0FA 5AKJA 1SZPA 4RU9A 4F8RA 4DL7A 1LKYA 5EE0A 5KFYA 2JZBB 5AKXA 7ICVA 5KFZA 2F77X 5KG1A 4MFCA 7ICLA 1L3SA 4NLGA 2ZIXA 5KNIA 1N48A 4TQRA 2W9BB 4C7ZA 2HHUA 1D9FA 4BWMA 2VA2A 1X40A 1ZQHA 1RM6C 4TURA 3T5KA 2WAQC 7ICRA 4Y2QA 4PGQA 5C5JA 3UMCA 4TUQA 2C2RA 5KT3A 4NLNA 4OO1J 3D6JA 5DQHA 4LZDA 2UVVA 5L1MA 2F1JA 4UAUA 4DOCA 2C22A 2BKEA 3RRHA 4RQ7A 3T5JA 2KFZA 4KX3A 4DL3A 1S5LU 2XI9A 1SIJA 3UMGA 3GIMA 2NRZA 4ECZA 4CCHA 5ALJA 3C5GA 1O03A 4O5CA 2EZZA 2KEYA 3THVA 2OM6A 1COOA 3SAGA 5J2FA 1PK3A 2I5HA 8ICFA 4PZNA 5J0OA 2R18A 2ZIUA 3V6JA 5E79U 3L4PA 5CJ7A 2HSZA 3T5LA 5KG3A 4RQ2A 1JXEA 5KFJA 5ALNA 1SGGA 4NY8A 4F93B 9ICWA 4ZH4A 1WG8A 2PFPA 5AICA 2Y1JA 8ICYA 3QZ8A 2XICA 4O3QA 4Y2VA 2E5SA 2QLTA 7ICUA 5KFGA 1KLNA 2MA1A 1ZQDA 5KTQA 4UAYA 4Q8FA 3KFUF 2HOIA 3GIKA 2BCQA 5DG8A 3EW9A 4B9SA 1ZQOA 2GLEA 4CGZA 3J81j 3CNHA 4UQGA 2FMSA 9ICNA 1YZ7A 4ECWA 3UXOA 2R8KA 1T7PA 3QZ7A 2G08A 2F8LA 5KFTA 4J9OA 2PFQA 3BQ2A 1PZNA 1XS9D 2AGQA 1DXSA 4C4RA 3EUB2 4EX6A 2KZMA 3V7LA 3PSTA 5DB7A 4J9LA 5J0WA 2FJ6A 4TUSA 2IOFK 4DFMA 4G3IA 1P7DA 2XVTA 5EWGA 1TK0A 4Q44A 2ZIVB 2PI5A 1HJPA 1N62A 1PUZA 4YXMA 4FS1A 1DK3A 2YB1A 1SV0A 5ALFA 5ALSA 4GLXA 1QQ6A 4DQPA 2W04A 4O3SA 2H3QA 5KFAA 2G5IB 3A0HU 2KVCA 4I27A 4UB8U 5G5HA 3LYSA 3PY8A 4O0IA 3JPRA 2YY6A 1NK8A 1N5WA 4JMUA 1BPDA 5EE1A 1Q3VA 5GTHU 2V4QA 1T3NA 3AQFA 4O3PA 4Y2PA 1X42A 2ODGA 1RQLA 2FMPA 4AYBC 2PFNA 2ZG6A 5HP4A 2ZIWB 3C5FA 2HHVA 3RBEA 1KFSA 5KAIU 2XGQA 3ZDDA 3SR6A 8ICKA 1JXLA 3KTQA 2KV2A 3PV8A 2P35A 2F76X 1UT8A 7ICIA 3QUQA 4UARA 4K4IA 5ALLA 2G0AA 3LDAA 2LBOA 2C2EA 3CP8A 3HX0A 1TAUA 1U48A 4MEYA 4P0PA 3GQCA 4QZAA 5KFNA 4QZEA 2IBKA 5J2EA 1ZQZA 4UAZA 7ICSA 3I1YA 3JPQA 4Z6FA 3KKAA 4QWEA 1TK5A 2MUTA 2WB1C 4EEYA 2WFAA 1NKEA 5L9XA 1KEJA 1D8LA 4ECUA 1AROP 3NUQA 4ED0A 5J2AA 3I76A 3PW5A 5HNKA 4C80A 4NV0A 2YMLA 3QUCA 1ZQSA 5BPCA 4Y2RA 3M8RA 1Z1BA 1JUDA 3B0YA 3GIJA 2WF9A 2HVIA 1KBUA 3BQ1A 3T79A 3QU2A 5FP0A 2F3NA 4QZFA 3IRUA 4NLCA 5DGBA 2KMDA 1Z4OA 1WYGA 5J2JA 1LVHA 2PMZC 2LKYA 4J9NA 3HP6A 3TQ1A 1ZETA 4DQQA 5IINA 2DFLA 2BPCA 3PMNA 2VKQA 3HT3A 1ZQLA 2BCUA 1CEZA 4MF8A 3ZDCA 3OHAA 3AM9A 4JUZA 3QU9A 1NJWA 8ICRA 2BCSA 9ICMA 1JRPA 1D9DA 2PFOA 3N4MB 3MGIA 2W8LA 4C8LA 4RPYA 4GXJA 3ZI4A 3QE9Y 1NK7A 1F5SA 2B21A 5AKZA 4KITB 4DFPA 4PL1A 3RBDA 3WKDA 2AGOA 4DSJA 2YMMA 1ZQVA 3RJFA 4OJPA 4CRXA 2W9CA 1S0MA 2IMWP 5KG4A 2AQ4A 1ZD4A 2W03A 5AK6A 3OSNA 4YVZA 3FM9A 2ZTCA 2Q4TA 4DSEA 3NRZA 4F92B 2LPEA 3AQEA 3QEBZ 4ZOHC 4RQ3A 1J2NA 5ALYA 2ZTDA 3M7DA 2W11A 4JV1A 3C1ZA 3RAQA 8ICLA 1RYUA 1ZQGA 2WTFA 3UXNA 1NNLA 2ZJ8A 5HR7A 2K4HA 3GV8B 4M04A 2UVUA 3RTVA 3F2BA 3H40A 5J0TA 3KHGA 2HOFA 8ICCA 9ICLA 3E58A 1SL2A 3BS5B 4ECQA 1Q46A 4U7CA 2JV3A 2HHQA 8ICXA 2F2AB 5KFXA 2KHQA 3MBYA 3MABA 4I2IA 2QKQA 3H8JA 2ASJA 2RP5A 4F72A 5G5GA 4HYKA 2ZIWA 3LWMA 4LVSA 8ICNA 5KL1B 1HUOA 4JV0A 5DBAA 9ICBA 5DBCA 2ZXHA 5B66U 4ECSA 3HKZF 3G6VA 4KLHA 3GILA 3Q8RB 3F5EA 5IIMA 3WKEA 4IR1A 3NVWA 1BPYA 2IOHA 4KN7A 5KFWA 2HBKA 3IG5A 1RYSA 4KN4A 4QZ8A 3EPIA 5DB8A 3RH6A 1XNSA 9ICHA 2R8HA 4IC9A 4DQRA 2NRVA 3FAHA 3GV7B 5JUMA 2XIDA 1NK0A 1SXEA 4IS7A 5AKYA 4NWIA 5KFHA 3WU2U 4C4SA 2HBJA 4YCXA 2KJ8A 7ICNA 1V38A 2IA6A 5KFPA 4ECVA 9ICOA 5AK5A 2RDIA 3MR5A 1L3UA 2KD1A 3TADC 4IRDA 4RNMA 3K4GA 9ICTA 3Q8LA 4CNQA 4CE6A 4DFJA 4GXIA 3M1YA 3K1ZA 4RT2A 5ALEA 3RR8A 4QIWC 2MU2A 2LM1A 4UASA 3RFAA 5ALRA 1O08A 3MFHA 2V9WA 1QLNA 4DSKA 2RRDA 3A0BU 4DEZA 5KT7A 5HR6A 1XC9A 4DS5A 4DL5A 4F5QA 2LI6A 1SL0A 4BWJA 1BNPA 1YT3A 2ASDA 2BZFA 4KLLA 5DQGA 4M2YA 3LVVA 2XY5A 2BCVA 4E0DA 2RLTA 2R8GA 1DOQA 1XSPA 3AN1A 3K1RB 1TV9A 3VCBA 5AKGA 1KFTA 5KT4A 3LVWA 4DF8A 3SI8A 5J2DA 3RH5A 2W55A 2K8AA 2FLLA 5IIJA 1JMSA 5J2IA 2ZXIA 2AU0A 2KG5A 1OXJA 1ZQ1C 5A0LA 2F8KA 3SEIA 5JRTA 2ASLA 4NLZA 4R63A 4KLJA 3U26A 5KG5A 1TKDA 3M8SA 3ALRA 1CI4A 3R9KA 4I2HA 2FMQA 4GFJA 2W43A 3IG8A 1RXVA 1X6IA 2OEHA 9ICSA 9ICGA 4KLSA 4F5PA 4I29A 2BHNA 5J0XA 3OHBA 4RNOA 3PVXA 5CHGA 2NV3A 4F4ZA 2ESEA 4OCZA 2JEJA 3OJUA 3LWLA 1PVPA 1TAMA 4P2HA 3RAXA 1XO0A 1XU4A 1A77A 5AM3A 2XY6A 4FS2A 3KHLA 3T5HA 3HWTA 3TANA 1KSPA 1N60A 5ALVA 4DQSA 1X9XA 4NJ8A 5J29A 3V6HA 4DL6A 3PNCA 1TE2A 4MHVA 7ICGA 3E2EA 3JPTA 4F5OA 2QB0B 4DF4A 1KL9A 1RZTA 3M6KA 3RJKA 4FBUA 1B43A 2EANA 5J2HA 4I28A 3KHRA 1BPZA 8ICBA 3PSIA 3NASA 4K4GA 5KFRA 3D2QA 4B6JA 2NRTA 3PSPA 4FZNA 5J0RA 2AXTU 5KG2A 3GFKB 2NO4A 3C23A 1PK1A 1ZYQA 3PW0A 2A1AA 4UB4A 3DDHA 1KRPA 2KKPA 1LKYB 2BQUA 2K8CB 4C8MA 2H3VA 1KW4A 4RT3A 5HMLA 4ED8A 2PKEA 4R8UA 2PXIA 2R8IA 2Z7JA 2YB4A 3N7SC 4IQVA 5KAFU 5KG6A 7ICTA 3QU7A 7ICPA 2HDOA 1ZQBA 9ICFA 3MGVA 3PO4A 2DL0A 4TUPA 4NLKA 4PGYA 3SV3A 4KLTA 4K4HA 3RB6A 4DOAA 2Y0SF 1FIQA 7ICQA 4Y2SA 2DQNB 9ICVA 2RDJA 4M9LA 2IOFA 5DG9A 1PK1B 5JTIA 1JX4A 2QB1A 4QWBA 5KFVA 2BDUA 2KZZA 3IN5A 1U47A 3B0XA 3MC1A 1ZRMA 3MR3A 4Y2TA 1S97A 1B0XA 3H0MB 4P4OA 4QWCA 4QZHA 3SV4A 5J2CA 4QZIA 3ISCA 4C8KA 4R8UB 3PR4A 2DUYA 5KG7A 4FZMA 1QCKA 1SZHA 2XGPA 2WF5A 2J6TA 2JEIA 4YP3A 1T94A 5GTIU 4M47A 2NO5A 3AUOA 4OD0A 2UVRA 2YTUA 1L7NA 4XQ8A 5ALTA 4ECXA 3JPOA 2WAQF 4EBDA 4PJ0U 2KNJA 3SYZA 4KLMA 2KTQA 2KOBA 4FZLA 5EWEA 4P0PB 3QUTA 3FDSA 1NOMA 1K1QA 4YMMA 4QW8A 3WK4A 3RR7A 2KVSA 2HI0A 4FE3A 4CDGA 4YQWA 2BR0A 2RQ5A 3C2KA 5DDMA 1LV5A 3CW2C 3RB3A 1ZJMA 1DGJA 1KDHA 2D6FC 1N5XA 3SMVA 4XRHA 1NJYA 1Q8KA 1ZXIA 5EE9A 5D4BA 4KLOA 2MAXA 2ZIVA 4MEXA 2K89A 1Z1VA 3NVZA 1NK5A 4BDPA 1SXDA 1SL1A 1Q3UA 2FPMA 2CPRA 1V85A 3T3FA 4G9BA 4QZCA 2CN1A 2FLNA 4I2BA 3UPQA 1SB3C 2ALZA 3KBBA 3RRGA 1SWVA 2ZUDA 4CF3A 1COKA 2W9MA 4M9JA 3JPPA 1ZQYA 2KHVA 3ONNA 4NXZA 5KFUA 1AQ6A 4NL9A 4R66A 3S6JA 5KT6A 3RB4A 1MQ3A 3PZPA 1ZOLA 2GOLA 2G06A 1MC8A 4C7YA 2EAPA 3TFRA 2KK0A 3LK9A 3NVVA 1N61A 4MFAA 5IIOA 3M9NB 1ZJNA 1L3TA 4US9A 4NLBA 3MFIA 2W3RA 5DLGA 4F71A 4CF4A 4DQIA 3RJJA 1T4GA 3H0RB 1ECWA 2JH1A 3EPGA 1ZQIA 4F4KA 3NGDA 1NJXA 5KFKA 2ZJAA 1ED1A 1A0PA 3TI0A 4R64A 3OJSA 2MUTB 4O3MA 8ICOA 1FFUA 2QARA 5C0YA 2YQEA 1RQNA 3G6YA 8ICMA 1QQ5A 4YXJA 2E1EA 3BJYA 1NK6A 1SV0C 5AM2A 5KFDA 9ICEA 2ES6A 4UB6U 4RQ1A 2DWQA 3V7KA 3F5AA 4PPXA 4PHEA 1S10A 8ICQA 1NZBA 4IR9A 1IG6A 4LJXA 2A3VA 4F4WA 1U49A 4KX5A 3ISBA 1XWLA 2G5HB 2JMGA 2ISOA 5ALHA 3Q8SB 5AKHA 2YMQA 1N63A 4OJLA 5B5EU 4F5RA 5CWRA 3KZIU 2LMRA 5TZVA 4ED6A 2KP7A 2E8OA 1KQQA 5AM0A 2EQYA 5AM4A 1MSWD 3IM1A 8ICIA 5L1KA 5IIKA 3ETLA 5DKWA 1X66A 3RF9A 3ISDA 4KLUA 4OJ6A 1Z3EB 1F44A 3FYHA 5DDYA 3H8WA 2W8KA 3Q8MA 5IILA 9ICIA 2DF4B 2F44A 4C8OA 5KFLA 1ZQRA 1ZQKA 2G09A 3V7JA 4ECTA 5L1LA 1Y88A 4IRKA 4ED7A 4YMNA 4J9SA 3TADA 4EEKA 5J8YC 2Y1IA 3H0LB 4NL9C 3SD7A 3IDWA 2ZIXB 4UW9A 1S0VA 2HVHA 4GC7A 4KTQA 1RDFA 5KFMA 4I2FA 2KSOB 4EENA 3N97B 4Z6CA 5CEHA 2LYAA 1SV4A 4RUAA 1NZPA 4YN4A 4J9PA 1URJA 5AI5A 3MDAA 1PVQA 1X9SA 2AGPA 4RQ0A 4PHAA 2VA3A 1ZQPA 1RPLA 2J6UA 2EDUA 5ALZA 1S9FA 1NKCA 2NRXA 5AK3A 3ZD9A 2QARB 2BQ3A 2LHTA 2KZ3A 2BDPA 4QWAA 2ATLA 3HPOA 4I2GA 1RXWA 5DLFA 3PMLA 4JK1A 4YR0A 2DGZA 3ZDAA 5KT5A 7ICEA 4EYIB 4MFFA 4O5KA 2W7PA 3KZXA 1QSSA 3ZDBA 1WCNA 3CYMA 1ZQQA 1NK4A 1VDVA 3HKZC 1YZ6A 8ICEA 1GO3F 3QU5A 4IQWA 4RQ8A 4EX7A 3KKAC 1L6NA 2K4EA 5BOLA 3WK8A 3TFSA 1SKSA 2LYHA 1JROA 4AYBF 2N1RA 4IQTA 4UBCA 2KN7A 2OXOA 4C8NA 4YD2A 7ICJA 5DG7A 4BXOA 2W9BA 3RH4A 3GIIA 4KLQA 2VANA 3RJIA 3I28A 3BZKA 1L7MA 4QW9A 2RHFA 2HOQA 1ZQJA 4PGXA 5CB1A 5D46A 1L7OA 2YX8A 2O6KA 1D8BA 5KL8B 4TQSA 1UPHA 4DFKA 1SWWA 2NYVA 4MF2A 1ZRNA 2DKZA 3OGUA 1L8LA 1KTQA 1XSNA 2HBMA 4RUCA 2WB1F 1HIWA 1BPBA 4F2SA 1K1SA 3ED5A 2DKXA 3NS1A 4BUGA 4JB3A 2FLPA 5AKIA 5ALXA 4RQMA 2K4IA 3C1YA 2F1HA 3C2MA 3RJEA 2C28A 1ZQAA 4J03A 4EZ9A 3MGHA 3PX0A 4KLDA 3PSFA 2XO7A 4R65A 4PZOA 7ICOA 2JXJA 3UQ2A 2P6UA 5CA7A 5KT2A 4B9MA 4UAVA 4UAWA 1ZQFA 9ICJA 3M9OB 4HAIA 1KKXA 3K75D 2IHMA 2J6SA 3ZDEA 1J2MA 2CXYA 4YMOA 1X6JA 2L5YA 1IIPA 5F9LA 2YMPA 3H4DA 2BPGA 4EBCA 2E8NA 7ICFA 5J2BA 3L3FX 4DO9A 4I2CA 2MRLA 4WJ3B 3RJHA 1S77D 4YR2A 1T8EA 4P4MA 1BNOA 5K4LA 4FO6A 3HRDD 4ED3A 4C0ZA 2CRXA 9ICPA 4DSFA 2KE7A 5HHIA 4UATA 4ELVA 3BS7A 1QSYA 4YD1A 8ICZA 4ED1A 4IQUA 2E8MA 4Y2JA 3CRXA 1TAQA 8ICGA 1OUQA 1L5UA 1SKRA 5CRXA 3NRWA 7ICHA 3C29A 2EAOA 5J0QA 3D2SA 2HBLA 5AI8A 5ALGA 1F0MA 3WKCA 4B9UA 3QYPA 1K5OA 4F2RA 4CF5A 3BZCA 3D2NA 1WCLA 3SZ2A 5ALUA 4EBEA 5AKLA 4UB5A 5AKEA 3ETRA 4J9RA 2E1FA 8ICJA 3TAPA 5AM5A 4ECYA 4I2JA 2FI1A 4O3NA 2JHDA 5L1IA 3UXPA 3PR5B 4M6WA 4EELA 1TFRA 1BPXA 4I2EA 4F50A 2HMXA 1IV8A 2FPLA 1A76A 2P66A 5KFSA 4J9KA 4PHPA 4DL4A 4M0AA 1ZQMA 2ZJ5A 4RZRA 2VJ5A 4QZBA 4KMOB 4BJQA 2H3IA 3JPSA 5ALPA 4IRCA 2HHWA 4C4TA 1A6SA 2VJ4A 2V4RA 4PH5A 3V6KA 7ICKA 4QJFB 4NM1A 1MA7A 3M6ZA 3OSPA 1QTMA 3UQ0A 4UB3A 1UQVA 2KJ5A 4DSIA 4F5NA 2ZUBA 5AI4A 5TISU 3JPNA 5DB9A 1C20A 2ZTEA 5HMMA 1WWVA 3WK7A 4J9QA 3AEVA 8ICHA 2K8BB 3PW4A 5CP2A 3BQ0A 3FC4A 2JEGA 2EAMA 4KMUA 1RYRA 2JZBA 2XCPA 1ZQUA 3KHHA 2EZYA 8ICUA 1T3QA 5EOZA 1KFDA 3TACB 1CRXA 4JWMA 2LYBA 5DBBA 3PX6A 2OYYA 3WKBA 5J0PA 2M9NA 4ICAA 2HHXA 4PHDA 5EWFA 4F4XA 5AI0A 1DRGA 9ICCA 1XO1A 2B0CA 3OPXA 3IP4B 4Z6EA 5F3XB 4O5EA 1NI3A 3QU4A 4QIWF 4JV2A 1CUKA 2EZXA 3VC8A 3WKAA 4O9MA 4P4PA 4O3OA 5J2GA 3H7IA 2WF6A 1XSLA 5KG0A 4PL2A 4DSLA 3PO5A 5D49A 1HEKA 4OJOA 1JIHA 4DOBA 5J0SA 4X5VA 4YFKA 3IV6A 3G6XA 1X9WA 3H8MA 4YG2A 4ACOA 2ISPA 2AH5A 2R8JA 1QH9A 4F91B 1KN5A 5JU5A 2VIXA 1Z4NA 2NRWA 5AI9A 2W7OA 9ICUA 3QXGA 2ZIUB 3Q8KA 4FFDA 2HHSA 2WF7A 4KLEA 3M9MB 4UBBA 2I6XA 2K4PA 1M6YA 5J0UA 2JH7A 2VA8A 1S0NA 2KFNA 4QNLA 3NTUA 2OHFA 1X9MA 1S8OA 1C7YA 5ALIA 1UCVA 4I2DA 1ZQNA 1X2IA 5H2FU 1U9LA 3GV5B 2FDRA 5AI6A 1VJ5A 2ZUCA 3B9JA 2P6RA 5F9NA 2UVWA 1ZD3A 4I2AA 1U45A 1V97A 5DB6A 4F4YA 3H4BA 1FEZA 1OW5A 3C28A 8ICWA 3SAHA 1ZQWA 2K60A 3HW8A 3NVYA 5T14A 1ZD5A 3WK5A 2Y9UA 4QZDA 2IHNA 4RNNA 4J9MA 2F1IA 2I9GA 4DCCA 4GC6A 1Z00A 4JWNA 3TKAA 5L1JA 1EXNA 3BS5A 1JALA 4M9NA 2XY7A 4BX9C 2H5XA 1LB2B 1DGSA 5ALWA 1NJZA 2M0NA 2W9AA 5ALOA 5ALDA 3RJGA 5KFQA 4B9NA 3TAQA 1ZD2P 3ZD8A 1VLBA 1QQ7A 8ICPA 3QNMA 3HJEA 2H3FA 3MR6A 4RQ4A 2LM4A 4B9VA 2DPJA 1WWUA 2D8CA 2QB0A 2W54A 1DK2A 9ICKA 3C2LA 2C2DA 1V9PA 3AU6A 1Z00B 4DLEA 4EZ6A 4Y2YA 3DV9A 1ZQXA 2B6GA 5KFOA 2PI4A 2A19A 4US8A 2AHOB 5DGAA 1BVSA 3F2DA 3AU2A 3GDXA 2W9CB 3N28A 1UA1A 3EWAA 1S76D 9ICRA 3BQTA 1N2XA 2XCAA 4XA5A 2DPIA 3F2CA 4Z6DA 1IXRA 1N56A 5AIAA 5KFIA 3QEAZ 1B22A 1TK8A 3HILA 3EYZA 4EYHB 1U4BA 2FPKA 2Y0SC 1J97A 3KD3A 4RQ5A 5ALKA 5EE3A 3Q8QB 3TARA 9ICQA 4QWDA 3UM9A 4DS4A 2OH2A 2I1QA 2GWSA 1FFVA 5IIIA 1ZQCA 2YN4A 4ED2A 5J0YA 2MSNA 1NK9A 4RPXA 2E8PA 4Q43A 4KLFA 3QX7A 5CR0A 4M6WB 8ICVA 2BQRA 2G07A 5KFFA 1ZQTA 4FBTA 4P0QB 1MQ2A 2D3DA 2XC9A 4OJ5A 4DFDA 3SENA 4ELTA 4F3OA 4Q8EA 1RG6A 5DQIA 8ICTA 3SQIA 1H38A 5AIBA 1Z19A 4M9HA 4UB1A 2AJQA 4DLGA 3Q8PB 2DBYA 1L3VA 2OCEA 1S0OA 1B4FA 3GZFA 5KFBA 3H8SA 4XUSA 3MR2A 4BXOB 2JEFA 1IM4A 3BDPA 4YR3A 4DL2A 2BPFA 2KICA 2KIWA 3AL0B 2HCFA 3N7PD 3PW7A 4Q45A 2A1JB 9ICAA 3OTQA 5KFEA 2JRZA 4UB2A 4P0QA 1BGXT 4NM2A 2KKVA 2E3TA 1BPEA 2HW3A 4B9LA 1JN3A 4QZGA 2BGWA 3BQ7A
chains in the Genus database with same CATH topology
2HOIA 4GFJA 2Q4TA 3IG8A 2LYAA 2F77X 4P0PA 5CRXA 3AQEA 3F5AA 3NRWA 2PMZF 4CGZA 4NWIA 3F2CA 2D6FC 3C29A 2HBMA 3SMVA 3MGVA 2HBJA 1NZBA 3D2SA 2HBLA 2GH1A 1URJA 2WB1F 1HIWA 2ZIXA 3M7DA 1WUDA 2WB1C 2ZIVA 1PVQA 3N7SC 2K89A 2YB4A 2KJ8A 2A3VA 2Y0SC 2G08A 2F8LA 1CRXA 3D2NA 2LYBA 2Y0SF 3SAFA 1Q3UA 4BUGA 3NUQA 4KX5A 2OYYA 2G5HB 2CPRA 5HR7A 2K4HA 2NV3A 2JMGA 2CN1A 2KD1A 3C28A 3PSTA 4ICAA 4NV0A 2DQNB 4U6PA 2K4IA 2WAQC 1PVPA 1TAMA 3F2BA 1Z1BA 2E1FA 3SAHA 4OJLA 1DRGA 2HOFA 1P7DA 2LHTA 2XVTA 3OPXA 5T14A 1KBUA 3T79A 3K1ZA 1XO0A 3IP4B 3ICXA 2ZIVB 2OH2A 4QIWC 2BDUA 3IN5A 2KHVA 4QIWF 3RFAA 4NLCA 4OO1J 3ONNA 4U7CA 3VC8A 3PSFA 2YB1A 2F2AB 2JHDA 2RRDA 3F53A 3H0MB 4A8EA 2DGZA 2KHQA 2PMZC 2HMXA 2W04A 5HR6A 2LKYA 4PL2A 2H3QA 4KX3A 2W7PA 3KZXA 2G5IB 3PZPA 2XI9A 2GOLA 2H3ZA 2G06A 2KVCA 1HEKA 1PVRA 3CYMA 2G07A 3LYSA 3RF9A 3N7RC 4OJOA 4BX9C 2RP5A 2VKQA 4P0QB 1YT3A 3HKZC 2ZIWA 3E0FA 4OJ5A 4OJ6A 3M6KA 4FZMA 3LVVA 1F44A 2KEYA 1IIPA 2M0NA 4JMUA 2VJ5A 2OM6A 1GO3F 1SZHA 5KL1B 1Q3VA 3SAGA 3SQIA 1Z19A 2ZXHA 2DF4B 2KJ9A 4NLBA 4ACOA 1T94A 4KMOB 4BJQA 1L6NA 2K4EA 2H3IA 3L3FX 3AQFA 2MRLA 2G09A 3PSIA 3VCBA 3H0RB 1ECWA 3HKZF 2R18A 2JH1A 2H3FA 2ZIUA 3DEEA 2VJ4A 4AYBC 4WJ3B 1A6SA 3D2QA 2VIXA 3F5EA 3PSPA 4FZNA 3LVWA 2ZG6A 4AYBF 3GZFA 4QJFB 2N1RA 2W7OA 2ZIWB 1MA7A 1ED1A 1A0PA 2OXOA 2K8AA 2ZIUB 3M6ZA 3H0LB 4PL1A 2WAQF 4O3MA 2KNJA 2ZIXB 2KICA 2KIWA 3AL0B 2HBKA 2KJ5A 3IG5A 5C0YA 2ZXIA 2KOBA 4C0ZA 3N7PD 2CRXA 2KKPA 1ZQ1C 4FZLA 5A0LA 4P0PB 2RHFA 2JH7A 4OJPA 2K8CB 4CRXA 2KV2A 2E1EA 2HOQA 3GU3A 4P0QA 2H3VA 3F2DA 2F76X 2KKVA 4QNLA 4IC9A 1XNSA 2XICA 3ALRA 2JGAA 3O0FA 2W03A 2E5SA 2G0AA 2YX8A 4FE3A 2LBOA 1D8BA 5KL8B 2K8BB 3CRXA 2MA1A 3CP8A 4CDGA 2Z7JA 2XIDA 3KFUF 1OUQA 1UPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ C;  4AYB C;  4QIW C;  2Y0S C;  3HKZ C;  2PMZ C;  2WB1 C; 
#chains in the Genus database with same CATH topology
 2AQ0 A;  4IL6 U;  3EZ5 A;  4GXK A;  3PW2 A;  5AKK A;  4DWI A;  4RQN A;  2PMZ F;  8ICA A;  1D8Y A;  1SKW A;  1UT5 A;  1QSL A;  2GH1 A;  1ZQE A;  3WK6 A;  1WUD A;  5AK4 A;  2Y9T A;  5KFC A;  4Y2X A;  2KIV A;  4KLI A;  3SAF A;  3PX4 A;  1FO4 A;  7ICM A;  3ORY A;  2GO7 A;  2A1J A;  4ELU A;  4U6P A;  1L7P A;  5J8Y A;  5AHX A;  1UA0 A;  1UHU A;  4O3R A;  3MDC A;  2KSO A;  3ICX A;  4AP9 A;  3V72 A;  3RB0 A;  2Q0Z X;  3F53 A;  4KLG A;  5ALQ A;  4A8E A;  1NKB A;  5J2K A;  4BGD A;  4RQ6 A;  2H3Z A;  3UMB A;  4USA A;  1PVR A;  2EH9 A;  3N7R C;  1JI7 A;  4GIB A;  1TVA A;  4Y2U A;  3E0F A;  4ECR A;  1HUZ A;  4M9G A;  4RPZ A;  2KJ9 A;  2OWO A;  2BCR A;  3DEE A;  3IHQ B;  4LZG A;  3C21 A;  3L5K A;  3WK9 A;  1MN8 A;  2FE9 A;  4B9T A;  3AMZ A;  4QZ9 A;  1L8O A;  5ALM A;  2HHT A;  2WF8 A;  2W3S A;  5BOM A;  9ICX A;  3QUB A;  2WHE A;  5AM1 A;  8ICS A;  2JR5 A;  5HHH A;  3GU3 A;  3KOO A;  2JGA A;  3O0F A;  5AKJ A;  1SZP A;  4RU9 A;  4F8R A;  4DL7 A;  1LKY A;  5EE0 A;  5KFY A;  2JZB B;  5AKX A;  7ICV A;  5KFZ A;  2F77 X;  5KG1 A;  4MFC A;  7ICL A;  1L3S A;  4NLG A;  2ZIX A;  5KNI A;  1N48 A;  4TQR A;  2W9B B;  4C7Z A;  2HHU A;  1D9F A;  4BWM A;  2VA2 A;  1X40 A;  1ZQH A;  1RM6 C;  4TUR A;  3T5K A;  2WAQ C;  7ICR A;  4Y2Q A;  4PGQ A;  5C5J A;  3UMC A;  4TUQ A;  2C2R A;  5KT3 A;  4NLN A;  4OO1 J;  3D6J A;  5DQH A;  4LZD A;  2UVV A;  5L1M A;  2F1J A;  4UAU A;  4DOC A;  2C22 A;  2BKE A;  3RRH A;  4RQ7 A;  3T5J A;  2KFZ A;  4KX3 A;  4DL3 A;  1S5L U;  2XI9 A;  1SIJ A;  3UMG A;  3GIM A;  2NRZ A;  4ECZ A;  4CCH A;  5ALJ A;  3C5G A;  1O03 A;  4O5C A;  2EZZ A;  2KEY A;  3THV A;  2OM6 A;  1COO A;  3SAG A;  5J2F A;  1PK3 A;  2I5H A;  8ICF A;  4PZN A;  5J0O A;  2R18 A;  2ZIU A;  3V6J A;  5E79 U;  3L4P A;  5CJ7 A;  2HSZ A;  3T5L A;  5KG3 A;  4RQ2 A;  1JXE A;  5KFJ A;  5ALN A;  1SGG A;  4NY8 A;  4F93 B;  9ICW A;  4ZH4 A;  1WG8 A;  2PFP A;  5AIC A;  2Y1J A;  8ICY A;  3QZ8 A;  2XIC A;  4O3Q A;  4Y2V A;  2E5S A;  2QLT A;  7ICU A;  5KFG A;  1KLN A;  2MA1 A;  1ZQD A;  5KTQ A;  4UAY A;  4Q8F A;  3KFU F;  2HOI A;  3GIK A;  2BCQ A;  5DG8 A;  3EW9 A;  4B9S A;  1ZQO A;  2GLE A;  4CGZ A;  3J81 j;  3CNH A;  4UQG A;  2FMS A;  9ICN A;  1YZ7 A;  4ECW A;  3UXO A;  2R8K A;  1T7P A;  3QZ7 A;  2G08 A;  2F8L A;  5KFT A;  4J9O A;  2PFQ A;  3BQ2 A;  1PZN A;  1XS9 D;  2AGQ A;  1DXS A;  4C4R A;  3EUB 2;  4EX6 A;  2KZM A;  3V7L A;  3PST A;  5DB7 A;  4J9L A;  5J0W A;  2FJ6 A;  4TUS A;  2IOF K;  4DFM A;  4G3I A;  1P7D A;  2XVT A;  5EWG A;  1TK0 A;  4Q44 A;  2ZIV B;  2PI5 A;  1HJP A;  1N62 A;  1PUZ A;  4YXM A;  4FS1 A;  1DK3 A;  2YB1 A;  1SV0 A;  5ALF A;  5ALS A;  4GLX A;  1QQ6 A;  4DQP A;  2W04 A;  4O3S A;  2H3Q A;  5KFA A;  2G5I B;  3A0H U;  2KVC A;  4I27 A;  4UB8 U;  5G5H A;  3LYS A;  3PY8 A;  4O0I A;  3JPR A;  2YY6 A;  1NK8 A;  1N5W A;  4JMU A;  1BPD A;  5EE1 A;  1Q3V A;  5GTH U;  2V4Q A;  1T3N A;  3AQF A;  4O3P A;  4Y2P A;  1X42 A;  2ODG A;  1RQL A;  2FMP A;  4AYB C;  2PFN A;  2ZG6 A;  5HP4 A;  2ZIW B;  3C5F A;  2HHV A;  3RBE A;  1KFS A;  5KAI U;  2XGQ A;  3ZDD A;  3SR6 A;  8ICK A;  1JXL A;  3KTQ A;  2KV2 A;  3PV8 A;  2P35 A;  2F76 X;  1UT8 A;  7ICI A;  3QUQ A;  4UAR A;  4K4I A;  5ALL A;  2G0A A;  3LDA A;  2LBO A;  2C2E A;  3CP8 A;  3HX0 A;  1TAU A;  1U48 A;  4MEY A;  4P0P A;  3GQC A;  4QZA A;  5KFN A;  4QZE A;  2IBK A;  5J2E A;  1ZQZ A;  4UAZ A;  7ICS A;  3I1Y A;  3JPQ A;  4Z6F A;  3KKA A;  4QWE A;  1TK5 A;  2MUT A;  2WB1 C;  4EEY A;  2WFA A;  1NKE A;  5L9X A;  1KEJ A;  1D8L A;  4ECU A;  1ARO P;  3NUQ A;  4ED0 A;  5J2A A;  3I76 A;  3PW5 A;  5HNK A;  4C80 A;  4NV0 A;  2YML A;  3QUC A;  1ZQS A;  5BPC A;  4Y2R A;  3M8R A;  1Z1B A;  1JUD A;  3B0Y A;  3GIJ A;  2WF9 A;  2HVI A;  1KBU A;  3BQ1 A;  3T79 A;  3QU2 A;  5FP0 A;  2F3N A;  4QZF A;  3IRU A;  4NLC A;  5DGB A;  2KMD A;  1Z4O A;  1WYG A;  5J2J A;  1LVH A;  2PMZ C;  2LKY A;  4J9N A;  3HP6 A;  3TQ1 A;  1ZET A;  4DQQ A;  5IIN A;  2DFL A;  2BPC A;  3PMN A;  2VKQ A;  3HT3 A;  1ZQL A;  2BCU A;  1CEZ A;  4MF8 A;  3ZDC A;  3OHA A;  3AM9 A;  4JUZ A;  3QU9 A;  1NJW A;  8ICR A;  2BCS A;  9ICM A;  1JRP A;  1D9D A;  2PFO A;  3N4M B;  3MGI A;  2W8L A;  4C8L A;  4RPY A;  4GXJ A;  3ZI4 A;  3QE9 Y;  1NK7 A;  1F5S A;  2B21 A;  5AKZ A;  4KIT B;  4DFP A;  4PL1 A;  3RBD A;  3WKD A;  2AGO A;  4DSJ A;  2YMM A;  1ZQV A;  3RJF A;  4OJP A;  4CRX A;  2W9C A;  1S0M A;  2IMW P;  5KG4 A;  2AQ4 A;  1ZD4 A;  2W03 A;  5AK6 A;  3OSN A;  4YVZ A;  3FM9 A;  2ZTC A;  2Q4T A;  4DSE A;  3NRZ A;  4F92 B;  2LPE A;  3AQE A;  3QEB Z;  4ZOH C;  4RQ3 A;  1J2N A;  5ALY A;  2ZTD A;  3M7D A;  2W11 A;  4JV1 A;  3C1Z A;  3RAQ A;  8ICL A;  1RYU A;  1ZQG A;  2WTF A;  3UXN A;  1NNL A;  2ZJ8 A;  5HR7 A;  2K4H A;  3GV8 B;  4M04 A;  2UVU A;  3RTV A;  3F2B A;  3H40 A;  5J0T A;  3KHG A;  2HOF A;  8ICC A;  9ICL A;  3E58 A;  1SL2 A;  3BS5 B;  4ECQ A;  1Q46 A;  4U7C A;  2JV3 A;  2HHQ A;  8ICX A;  2F2A B;  5KFX A;  2KHQ A;  3MBY A;  3MAB A;  4I2I A;  2QKQ A;  3H8J A;  2ASJ A;  2RP5 A;  4F72 A;  5G5G A;  4HYK A;  2ZIW A;  3LWM A;  4LVS A;  8ICN A;  5KL1 B;  1HUO A;  4JV0 A;  5DBA A;  9ICB A;  5DBC A;  2ZXH A;  5B66 U;  4ECS A;  3HKZ F;  3G6V A;  4KLH A;  3GIL A;  3Q8R B;  3F5E A;  5IIM A;  3WKE A;  4IR1 A;  3NVW A;  1BPY A;  2IOH A;  4KN7 A;  5KFW A;  2HBK A;  3IG5 A;  1RYS A;  4KN4 A;  4QZ8 A;  3EPI A;  5DB8 A;  3RH6 A;  1XNS A;  9ICH A;  2R8H A;  4IC9 A;  4DQR A;  2NRV A;  3FAH A;  3GV7 B;  5JUM A;  2XID A;  1NK0 A;  1SXE A;  4IS7 A;  5AKY A;  4NWI A;  5KFH A;  3WU2 U;  4C4S A;  2HBJ A;  4YCX A;  2KJ8 A;  7ICN A;  1V38 A;  2IA6 A;  5KFP A;  4ECV A;  9ICO A;  5AK5 A;  2RDI A;  3MR5 A;  1L3U A;  2KD1 A;  3TAD C;  4IRD A;  4RNM A;  3K4G A;  9ICT A;  3Q8L A;  4CNQ A;  4CE6 A;  4DFJ A;  4GXI A;  3M1Y A;  3K1Z A;  4RT2 A;  5ALE A;  3RR8 A;  4QIW C;  2MU2 A;  2LM1 A;  4UAS A;  3RFA A;  5ALR A;  1O08 A;  3MFH A;  2V9W A;  1QLN A;  4DSK A;  2RRD A;  3A0B U;  4DEZ A;  5KT7 A;  5HR6 A;  1XC9 A;  4DS5 A;  4DL5 A;  4F5Q A;  2LI6 A;  1SL0 A;  4BWJ A;  1BNP A;  1YT3 A;  2ASD A;  2BZF A;  4KLL A;  5DQG A;  4M2Y A;  3LVV A;  2XY5 A;  2BCV A;  4E0D A;  2RLT A;  2R8G A;  1DOQ A;  1XSP A;  3AN1 A;  3K1R B;  1TV9 A;  3VCB A;  5AKG A;  1KFT A;  5KT4 A;  3LVW A;  4DF8 A;  3SI8 A;  5J2D A;  3RH5 A;  2W55 A;  2K8A A;  2FLL A;  5IIJ A;  1JMS A;  5J2I A;  2ZXI A;  2AU0 A;  2KG5 A;  1OXJ A;  1ZQ1 C;  5A0L A;  2F8K A;  3SEI A;  5JRT A;  2ASL A;  4NLZ A;  4R63 A;  4KLJ A;  3U26 A;  5KG5 A;  1TKD A;  3M8S A;  3ALR A;  1CI4 A;  3R9K A;  4I2H A;  2FMQ A;  4GFJ A;  2W43 A;  3IG8 A;  1RXV A;  1X6I A;  2OEH A;  9ICS A;  9ICG A;  4KLS A;  4F5P A;  4I29 A;  2BHN A;  5J0X A;  3OHB A;  4RNO A;  3PVX A;  5CHG A;  2NV3 A;  4F4Z A;  2ESE A;  4OCZ A;  2JEJ A;  3OJU A;  3LWL A;  1PVP A;  1TAM A;  4P2H A;  3RAX A;  1XO0 A;  1XU4 A;  1A77 A;  5AM3 A;  2XY6 A;  4FS2 A;  3KHL A;  3T5H A;  3HWT A;  3TAN A;  1KSP A;  1N60 A;  5ALV A;  4DQS A;  1X9X A;  4NJ8 A;  5J29 A;  3V6H A;  4DL6 A;  3PNC A;  1TE2 A;  4MHV A;  7ICG A;  3E2E A;  3JPT A;  4F5O A;  2QB0 B;  4DF4 A;  1KL9 A;  1RZT A;  3M6K A;  3RJK A;  4FBU A;  1B43 A;  2EAN A;  5J2H A;  4I28 A;  3KHR A;  1BPZ A;  8ICB A;  3PSI A;  3NAS A;  4K4G A;  5KFR A;  3D2Q A;  4B6J A;  2NRT A;  3PSP A;  4FZN A;  5J0R A;  2AXT U;  5KG2 A;  3GFK B;  2NO4 A;  3C23 A;  1PK1 A;  1ZYQ A;  3PW0 A;  2A1A A;  4UB4 A;  3DDH A;  1KRP A;  2KKP A;  1LKY B;  2BQU A;  2K8C B;  4C8M A;  2H3V A;  1KW4 A;  4RT3 A;  5HML A;  4ED8 A;  2PKE A;  4R8U A;  2PXI A;  2R8I A;  2Z7J A;  2YB4 A;  3N7S C;  4IQV A;  5KAF U;  5KG6 A;  7ICT A;  3QU7 A;  7ICP A;  2HDO A;  1ZQB A;  9ICF A;  3MGV A;  3PO4 A;  2DL0 A;  4TUP A;  4NLK A;  4PGY A;  3SV3 A;  4KLT A;  4K4H A;  3RB6 A;  4DOA A;  2Y0S F;  1FIQ A;  7ICQ A;  4Y2S A;  2DQN B;  9ICV A;  2RDJ A;  4M9L A;  2IOF A;  5DG9 A;  1PK1 B;  5JTI A;  1JX4 A;  2QB1 A;  4QWB A;  5KFV A;  2BDU A;  2KZZ A;  3IN5 A;  1U47 A;  3B0X A;  3MC1 A;  1ZRM A;  3MR3 A;  4Y2T A;  1S97 A;  1B0X A;  3H0M B;  4P4O A;  4QWC A;  4QZH A;  3SV4 A;  5J2C A;  4QZI A;  3ISC A;  4C8K A;  4R8U B;  3PR4 A;  2DUY A;  5KG7 A;  4FZM A;  1QCK A;  1SZH A;  2XGP A;  2WF5 A;  2J6T A;  2JEI A;  4YP3 A;  1T94 A;  5GTI U;  4M47 A;  2NO5 A;  3AUO A;  4OD0 A;  2UVR A;  2YTU A;  1L7N A;  4XQ8 A;  5ALT A;  4ECX A;  3JPO A;  2WAQ F;  4EBD A;  4PJ0 U;  2KNJ A;  3SYZ A;  4KLM A;  2KTQ A;  2KOB A;  4FZL A;  5EWE A;  4P0P B;  3QUT A;  3FDS A;  1NOM A;  1K1Q A;  4YMM A;  4QW8 A;  3WK4 A;  3RR7 A;  2KVS A;  2HI0 A;  4FE3 A;  4CDG A;  4YQW A;  2BR0 A;  2RQ5 A;  3C2K A;  5DDM A;  1LV5 A;  3CW2 C;  3RB3 A;  1ZJM A;  1DGJ A;  1KDH A;  2D6F C;  1N5X A;  3SMV A;  4XRH A;  1NJY A;  1Q8K A;  1ZXI A;  5EE9 A;  5D4B A;  4KLO A;  2MAX A;  2ZIV A;  4MEX A;  2K89 A;  1Z1V A;  3NVZ A;  1NK5 A;  4BDP A;  1SXD A;  1SL1 A;  1Q3U A;  2FPM A;  2CPR A;  1V85 A;  3T3F A;  4G9B A;  4QZC A;  2CN1 A;  2FLN A;  4I2B A;  3UPQ A;  1SB3 C;  2ALZ A;  3KBB A;  3RRG A;  1SWV A;  2ZUD A;  4CF3 A;  1COK A;  2W9M A;  4M9J A;  3JPP A;  1ZQY A;  2KHV A;  3ONN A;  4NXZ A;  5KFU A;  1AQ6 A;  4NL9 A;  4R66 A;  3S6J A;  5KT6 A;  3RB4 A;  1MQ3 A;  3PZP A;  1ZOL A;  2GOL A;  2G06 A;  1MC8 A;  4C7Y A;  2EAP A;  3TFR A;  2KK0 A;  3LK9 A;  3NVV A;  1N61 A;  4MFA A;  5IIO A;  3M9N B;  1ZJN A;  1L3T A;  4US9 A;  4NLB A;  3MFI A;  2W3R A;  5DLG A;  4F71 A;  4CF4 A;  4DQI A;  3RJJ A;  1T4G A;  3H0R B;  1ECW A;  2JH1 A;  3EPG A;  1ZQI A;  4F4K A;  3NGD A;  1NJX A;  5KFK A;  2ZJA A;  1ED1 A;  1A0P A;  3TI0 A;  4R64 A;  3OJS A;  2MUT B;  4O3M A;  8ICO A;  1FFU A;  2QAR A;  5C0Y A;  2YQE A;  1RQN A;  3G6Y A;  8ICM A;  1QQ5 A;  4YXJ A;  2E1E A;  3BJY A;  1NK6 A;  1SV0 C;  5AM2 A;  5KFD A;  9ICE A;  2ES6 A;  4UB6 U;  4RQ1 A;  2DWQ A;  3V7K A;  3F5A A;  4PPX A;  4PHE A;  1S10 A;  8ICQ A;  1NZB A;  4IR9 A;  1IG6 A;  4LJX A;  2A3V A;  4F4W A;  1U49 A;  4KX5 A;  3ISB A;  1XWL A;  2G5H B;  2JMG A;  2ISO A;  5ALH A;  3Q8S B;  5AKH A;  2YMQ A;  1N63 A;  4OJL A;  5B5E U;  4F5R A;  5CWR A;  3KZI U;  2LMR A;  5TZV A;  4ED6 A;  2KP7 A;  2E8O A;  1KQQ A;  5AM0 A;  2EQY A;  5AM4 A;  1MSW D;  3IM1 A;  8ICI A;  5L1K A;  5IIK A;  3ETL A;  5DKW A;  1X66 A;  3RF9 A;  3ISD A;  4KLU A;  4OJ6 A;  1Z3E B;  1F44 A;  3FYH A;  5DDY A;  3H8W A;  2W8K A;  3Q8M A;  5IIL A;  9ICI A;  2DF4 B;  2F44 A;  4C8O A;  5KFL A;  1ZQR A;  1ZQK A;  2G09 A;  3V7J A;  4ECT A;  5L1L A;  1Y88 A;  4IRK A;  4ED7 A;  4YMN A;  4J9S A;  3TAD A;  4EEK A;  5J8Y C;  2Y1I A;  3H0L B;  4NL9 C;  3SD7 A;  3IDW A;  2ZIX B;  4UW9 A;  1S0V A;  2HVH A;  4GC7 A;  4KTQ A;  1RDF A;  5KFM A;  4I2F A;  2KSO B;  4EEN A;  3N97 B;  4Z6C A;  5CEH A;  2LYA A;  1SV4 A;  4RUA A;  1NZP A;  4YN4 A;  4J9P A;  1URJ A;  5AI5 A;  3MDA A;  1PVQ A;  1X9S A;  2AGP A;  4RQ0 A;  4PHA A;  2VA3 A;  1ZQP A;  1RPL A;  2J6U A;  2EDU A;  5ALZ A;  1S9F A;  1NKC A;  2NRX A;  5AK3 A;  3ZD9 A;  2QAR B;  2BQ3 A;  2LHT A;  2KZ3 A;  2BDP A;  4QWA A;  2ATL A;  3HPO A;  4I2G A;  1RXW A;  5DLF A;  3PML A;  4JK1 A;  4YR0 A;  2DGZ A;  3ZDA A;  5KT5 A;  7ICE A;  4EYI B;  4MFF A;  4O5K A;  2W7P A;  3KZX A;  1QSS A;  3ZDB A;  1WCN A;  3CYM A;  1ZQQ A;  1NK4 A;  1VDV A;  3HKZ C;  1YZ6 A;  8ICE A;  1GO3 F;  3QU5 A;  4IQW A;  4RQ8 A;  4EX7 A;  3KKA C;  1L6N A;  2K4E A;  5BOL A;  3WK8 A;  3TFS A;  1SKS A;  2LYH A;  1JRO A;  4AYB F;  2N1R A;  4IQT A;  4UBC A;  2KN7 A;  2OXO A;  4C8N A;  4YD2 A;  7ICJ A;  5DG7 A;  4BXO A;  2W9B A;  3RH4 A;  3GII A;  4KLQ A;  2VAN A;  3RJI A;  3I28 A;  3BZK A;  1L7M A;  4QW9 A;  2RHF A;  2HOQ A;  1ZQJ A;  4PGX A;  5CB1 A;  5D46 A;  1L7O A;  2YX8 A;  2O6K A;  1D8B A;  5KL8 B;  4TQS A;  1UPH A;  4DFK A;  1SWW A;  2NYV A;  4MF2 A;  1ZRN A;  2DKZ A;  3OGU A;  1L8L A;  1KTQ A;  1XSN A;  2HBM A;  4RUC A;  2WB1 F;  1HIW A;  1BPB A;  4F2S A;  1K1S A;  3ED5 A;  2DKX A;  3NS1 A;  4BUG A;  4JB3 A;  2FLP A;  5AKI A;  5ALX A;  4RQM A;  2K4I A;  3C1Y A;  2F1H A;  3C2M A;  3RJE A;  2C28 A;  1ZQA A;  4J03 A;  4EZ9 A;  3MGH A;  3PX0 A;  4KLD A;  3PSF A;  2XO7 A;  4R65 A;  4PZO A;  7ICO A;  2JXJ A;  3UQ2 A;  2P6U A;  5CA7 A;  5KT2 A;  4B9M A;  4UAV A;  4UAW A;  1ZQF A;  9ICJ A;  3M9O B;  4HAI A;  1KKX A;  3K75 D;  2IHM A;  2J6S A;  3ZDE A;  1J2M A;  2CXY A;  4YMO A;  1X6J A;  2L5Y A;  1IIP A;  5F9L A;  2YMP A;  3H4D A;  2BPG A;  4EBC A;  2E8N A;  7ICF A;  5J2B A;  3L3F X;  4DO9 A;  4I2C A;  2MRL A;  4WJ3 B;  3RJH A;  1S77 D;  4YR2 A;  1T8E A;  4P4M A;  1BNO A;  5K4L A;  4FO6 A;  3HRD D;  4ED3 A;  4C0Z A;  2CRX A;  9ICP A;  4DSF A;  2KE7 A;  5HHI A;  4UAT A;  4ELV A;  3BS7 A;  1QSY A;  4YD1 A;  8ICZ A;  4ED1 A;  4IQU A;  2E8M A;  4Y2J A;  3CRX A;  1TAQ A;  8ICG A;  1OUQ A;  1L5U A;  1SKR A;  5CRX A;  3NRW A;  7ICH A;  3C29 A;  2EAO A;  5J0Q A;  3D2S A;  2HBL A;  5AI8 A;  5ALG A;  1F0M A;  3WKC A;  4B9U A;  3QYP A;  1K5O A;  4F2R A;  4CF5 A;  3BZC A;  3D2N A;  1WCL A;  3SZ2 A;  5ALU A;  4EBE A;  5AKL A;  4UB5 A;  5AKE A;  3ETR A;  4J9R A;  2E1F A;  8ICJ A;  3TAP A;  5AM5 A;  4ECY A;  4I2J A;  2FI1 A;  4O3N A;  2JHD A;  5L1I A;  3UXP A;  3PR5 B;  4M6W A;  4EEL A;  1TFR A;  1BPX A;  4I2E A;  4F50 A;  2HMX A;  1IV8 A;  2FPL A;  1A76 A;  2P66 A;  5KFS A;  4J9K A;  4PHP A;  4DL4 A;  4M0A A;  1ZQM A;  2ZJ5 A;  4RZR A;  2VJ5 A;  4QZB A;  4KMO B;  4BJQ A;  2H3I A;  3JPS A;  5ALP A;  4IRC A;  2HHW A;  4C4T A;  1A6S A;  2VJ4 A;  2V4R A;  4PH5 A;  3V6K A;  7ICK A;  4QJF B;  4NM1 A;  1MA7 A;  3M6Z A;  3OSP A;  1QTM A;  3UQ0 A;  4UB3 A;  1UQV A;  2KJ5 A;  4DSI A;  4F5N A;  2ZUB A;  5AI4 A;  5TIS U;  3JPN A;  5DB9 A;  1C20 A;  2ZTE A;  5HMM A;  1WWV A;  3WK7 A;  4J9Q A;  3AEV A;  8ICH A;  2K8B B;  3PW4 A;  5CP2 A;  3BQ0 A;  3FC4 A;  2JEG A;  2EAM A;  4KMU A;  1RYR A;  2JZB A;  2XCP A;  1ZQU A;  3KHH A;  2EZY A;  8ICU A;  1T3Q A;  5EOZ A;  1KFD A;  3TAC B;  1CRX A;  4JWM A;  2LYB A;  5DBB A;  3PX6 A;  2OYY A;  3WKB A;  5J0P A;  2M9N A;  4ICA A;  2HHX A;  4PHD A;  5EWF A;  4F4X A;  5AI0 A;  1DRG A;  9ICC A;  1XO1 A;  2B0C A;  3OPX A;  3IP4 B;  4Z6E A;  5F3X B;  4O5E A;  1NI3 A;  3QU4 A;  4QIW F;  4JV2 A;  1CUK A;  2EZX A;  3VC8 A;  3WKA A;  4O9M A;  4P4P A;  4O3O A;  5J2G A;  3H7I A;  2WF6 A;  1XSL A;  5KG0 A;  4PL2 A;  4DSL A;  3PO5 A;  5D49 A;  1HEK A;  4OJO A;  1JIH A;  4DOB A;  5J0S A;  4X5V A;  4YFK A;  3IV6 A;  3G6X A;  1X9W A;  3H8M A;  4YG2 A;  4ACO A;  2ISP A;  2AH5 A;  2R8J A;  1QH9 A;  4F91 B;  1KN5 A;  5JU5 A;  2VIX A;  1Z4N A;  2NRW A;  5AI9 A;  2W7O A;  9ICU A;  3QXG A;  2ZIU B;  3Q8K A;  4FFD A;  2HHS A;  2WF7 A;  4KLE A;  3M9M B;  4UBB A;  2I6X A;  2K4P A;  1M6Y A;  5J0U A;  2JH7 A;  2VA8 A;  1S0N A;  2KFN A;  4QNL A;  3NTU A;  2OHF A;  1X9M A;  1S8O A;  1C7Y A;  5ALI A;  1UCV A;  4I2D A;  1ZQN A;  1X2I A;  5H2F U;  1U9L A;  3GV5 B;  2FDR A;  5AI6 A;  1VJ5 A;  2ZUC A;  3B9J A;  2P6R A;  5F9N A;  2UVW A;  1ZD3 A;  4I2A A;  1U45 A;  1V97 A;  5DB6 A;  4F4Y A;  3H4B A;  1FEZ A;  1OW5 A;  3C28 A;  8ICW A;  3SAH A;  1ZQW A;  2K60 A;  3HW8 A;  3NVY A;  5T14 A;  1ZD5 A;  3WK5 A;  2Y9U A;  4QZD A;  2IHN A;  4RNN A;  4J9M A;  2F1I A;  2I9G A;  4DCC A;  4GC6 A;  1Z00 A;  4JWN A;  3TKA A;  5L1J A;  1EXN A;  3BS5 A;  1JAL A;  4M9N A;  2XY7 A;  4BX9 C;  2H5X A;  1LB2 B;  1DGS A;  5ALW A;  1NJZ A;  2M0N A;  2W9A A;  5ALO A;  5ALD A;  3RJG A;  5KFQ A;  4B9N A;  3TAQ A;  1ZD2 P;  3ZD8 A;  1VLB A;  1QQ7 A;  8ICP A;  3QNM A;  3HJE A;  2H3F A;  3MR6 A;  4RQ4 A;  2LM4 A;  4B9V A;  2DPJ A;  1WWU A;  2D8C A;  2QB0 A;  2W54 A;  1DK2 A;  9ICK A;  3C2L A;  2C2D A;  1V9P A;  3AU6 A;  1Z00 B;  4DLE A;  4EZ6 A;  4Y2Y A;  3DV9 A;  1ZQX A;  2B6G A;  5KFO A;  2PI4 A;  2A19 A;  4US8 A;  2AHO B;  5DGA A;  1BVS A;  3F2D A;  3AU2 A;  3GDX A;  2W9C B;  3N28 A;  1UA1 A;  3EWA A;  1S76 D;  9ICR A;  3BQT A;  1N2X A;  2XCA A;  4XA5 A;  2DPI A;  3F2C A;  4Z6D A;  1IXR A;  1N56 A;  5AIA A;  5KFI A;  3QEA Z;  1B22 A;  1TK8 A;  3HIL A;  3EYZ A;  4EYH B;  1U4B A;  2FPK A;  2Y0S C;  1J97 A;  3KD3 A;  4RQ5 A;  5ALK A;  5EE3 A;  3Q8Q B;  3TAR A;  9ICQ A;  4QWD A;  3UM9 A;  4DS4 A;  2OH2 A;  2I1Q A;  2GWS A;  1FFV A;  5III A;  1ZQC A;  2YN4 A;  4ED2 A;  5J0Y A;  2MSN A;  1NK9 A;  4RPX A;  2E8P A;  4Q43 A;  4KLF A;  3QX7 A;  5CR0 A;  4M6W B;  8ICV A;  2BQR A;  2G07 A;  5KFF A;  1ZQT A;  4FBT A;  4P0Q B;  1MQ2 A;  2D3D A;  2XC9 A;  4OJ5 A;  4DFD A;  3SEN A;  4ELT A;  4F3O A;  4Q8E A;  1RG6 A;  5DQI A;  8ICT A;  3SQI A;  1H38 A;  5AIB A;  1Z19 A;  4M9H A;  4UB1 A;  2AJQ A;  4DLG A;  3Q8P B;  2DBY A;  1L3V A;  2OCE A;  1S0O A;  1B4F A;  3GZF A;  5KFB A;  3H8S A;  4XUS A;  3MR2 A;  4BXO B;  2JEF A;  1IM4 A;  3BDP A;  4YR3 A;  4DL2 A;  2BPF A;  2KIC A;  2KIW A;  3AL0 B;  2HCF A;  3N7P D;  3PW7 A;  4Q45 A;  2A1J B;  9ICA A;  3OTQ A;  5KFE A;  2JRZ A;  4UB2 A;  4P0Q A;  1BGX T;  4NM2 A;  2KKV A;  2E3T A;  1BPE A;  2HW3 A;  4B9L A;  1JN3 A;  4QZG A;  2BGW A;  3BQ7 A; 
#chains in the Genus database with same CATH homology
 2HOI A;  4GFJ A;  2Q4T A;  3IG8 A;  2LYA A;  2F77 X;  4P0P A;  5CRX A;  3AQE A;  3F5A A;  3NRW A;  2PMZ F;  4CGZ A;  4NWI A;  3F2C A;  2D6F C;  3C29 A;  2HBM A;  3SMV A;  3MGV A;  2HBJ A;  1NZB A;  3D2S A;  2HBL A;  2GH1 A;  1URJ A;  2WB1 F;  1HIW A;  2ZIX A;  3M7D A;  1WUD A;  2WB1 C;  2ZIV A;  1PVQ A;  3N7S C;  2K89 A;  2YB4 A;  2KJ8 A;  2A3V A;  2Y0S C;  2G08 A;  2F8L A;  1CRX A;  3D2N A;  2LYB A;  2Y0S F;  3SAF A;  1Q3U A;  4BUG A;  3NUQ A;  4KX5 A;  2OYY A;  2G5H B;  2CPR A;  5HR7 A;  2K4H A;  2NV3 A;  2JMG A;  2CN1 A;  2KD1 A;  3C28 A;  3PST A;  4ICA A;  4NV0 A;  2DQN B;  4U6P A;  2K4I A;  2WAQ C;  1PVP A;  1TAM A;  3F2B A;  1Z1B A;  2E1F A;  3SAH A;  4OJL A;  1DRG A;  2HOF A;  1P7D A;  2LHT A;  2XVT A;  3OPX A;  5T14 A;  1KBU A;  3T79 A;  3K1Z A;  1XO0 A;  3IP4 B;  3ICX A;  2ZIV B;  2OH2 A;  4QIW C;  2BDU A;  3IN5 A;  2KHV A;  4QIW F;  3RFA A;  4NLC A;  4OO1 J;  3ONN A;  4U7C A;  3VC8 A;  3PSF A;  2YB1 A;  2F2A B;  2JHD A;  2RRD A;  3F53 A;  3H0M B;  4A8E A;  2DGZ A;  2KHQ A;  2PMZ C;  2HMX A;  2W04 A;  5HR6 A;  2LKY A;  4PL2 A;  2H3Q A;  4KX3 A;  2W7P A;  3KZX A;  2G5I B;  3PZP A;  2XI9 A;  2GOL A;  2H3Z A;  2G06 A;  2KVC A;  1HEK A;  1PVR A;  3CYM A;  2G07 A;  3LYS A;  3RF9 A;  3N7R C;  4OJO A;  4BX9 C;  2RP5 A;  2VKQ A;  4P0Q B;  1YT3 A;  3HKZ C;  2ZIW A;  3E0F A;  4OJ5 A;  4OJ6 A;  3M6K A;  4FZM A;  3LVV A;  1F44 A;  2KEY A;  1IIP A;  2M0N A;  4JMU A;  2VJ5 A;  2OM6 A;  1GO3 F;  1SZH A;  5KL1 B;  1Q3V A;  3SAG A;  3SQI A;  1Z19 A;  2ZXH A;  2DF4 B;  2KJ9 A;  4NLB A;  4ACO A;  1T94 A;  4KMO B;  4BJQ A;  1L6N A;  2K4E A;  2H3I A;  3L3F X;  3AQF A;  2MRL A;  2G09 A;  3PSI A;  3VCB A;  3H0R B;  1ECW A;  3HKZ F;  2R18 A;  2JH1 A;  2H3F A;  2ZIU A;  3DEE A;  2VJ4 A;  4AYB C;  4WJ3 B;  1A6S A;  3D2Q A;  2VIX A;  3F5E A;  3PSP A;  4FZN A;  3LVW A;  2ZG6 A;  4AYB F;  3GZF A;  4QJF B;  2N1R A;  2W7O A;  2ZIW B;  1MA7 A;  1ED1 A;  1A0P A;  2OXO A;  2K8A A;  2ZIU B;  3M6Z A;  3H0L B;  4PL1 A;  2WAQ F;  4O3M A;  2KNJ A;  2ZIX B;  2KIC A;  2KIW A;  3AL0 B;  2HBK A;  2KJ5 A;  3IG5 A;  5C0Y A;  2ZXI A;  2KOB A;  4C0Z A;  3N7P D;  2CRX A;  2KKP A;  1ZQ1 C;  4FZL A;  5A0L A;  4P0P B;  2RHF A;  2JH7 A;  4OJP A;  2K8C B;  4CRX A;  2KV2 A;  2E1E A;  2HOQ A;  3GU3 A;  4P0Q A;  2H3V A;  3F2D A;  2F76 X;  2KKV A;  4QNL A;  4IC9 A;  1XNS A;  2XIC A;  3ALR A;  2JGA A;  3O0F A;  2W03 A;  2E5S A;  2G0A A;  2YX8 A;  4FE3 A;  2LBO A;  1D8B A;  5KL8 B;  2K8B B;  3CRX A;  2MA1 A;  3CP8 A;  4CDG A;  2Z7J A;  2XID A;  3KFU F;  1OUQ A;  1UPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...