3HKZC

The x-ray crystal structure of rna polymerase from archaea
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
385
structure length
370
Chain Sequence
PYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYTKIENVVSSTSIDIASMSIILQLDNEMLKDKGVTVDDVKKAIGRLKLGDFMIEESEDSTLNINFANIDSIAALFKLRDKILNTKIKGIKGIKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 52
structure length 370
sequence length 385
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3hkzC02
2WAQC 4AYBC 3HKZC 2WB1C 2PMZC 4QIWC 2Y0SC
chains in the Genus database with same CATH superfamily
4F5PA 3F2BA 3PSIA 4KLFA 2W9BB 1TKDA 4FS2A 4R8UB 4IS7A 1ZJMA 4F92B 4EBEA 4Y2XA 5DLGA 1K1QA 4QZBA 2H5XA 2EZXA 3A0HU 3TQ1A 5CP2A 2FE9A 2A3VA 2WF5A 1DK2A 4QZIA 4F72A 4UAUA 3KOOA 8ICPA 3NUQA 4QW9A 3RJHA 4O5EA 2E8OA 5HP4A 2EANA 2AJQA 1XSPA 1HIWA 5KFBA 4B9TA 3PSPA 2BPFA 1SWWA 1MN8A 3D2NA 5DBBA 5DGAA 4QWBA 4R64A 3CRXA 1VJ5A 1J2NA 4IQWA 3NVYA 3S6JA 4RNNA 4RU9A 4Y2RA 3ZDDA 1Z1VA 2ATLA 5DG9A 2G07A 5KFJA 2HI0A 1L3UA 1S8OA 4JV1A 1U4BA 2W7OA 3M6KA 5F9NA 4RQ4A 3K75D 3TADC 1QQ7A 3AUOA 4MHVA 4I27A 4RQ7A 4QW8A 7ICGA 4ED8A 1NK5A 4C4TA 5B66U 2E8MA 2VJ4A 3TFRA 2AQ0A 3SQIA 1UA1A 1ZQJA 4PZNA 5ALZA 4Q43A 1SIJA 3QU7A 3ZDEA 2BZFA 2W11A 2EAOA 2KEYA 3V7KA 2JHDA 2IMWP 2HHQA 1S9FA 5ALFA 5AM2A 3GFKB 1SZPA 5A0LA 4ECVA 2ZIVB 1ZQTA 3TANA 2BKEA 1S77D 4BWMA 1L7MA 2E1EA 4QZCA 3OJUA 2FPLA 1JXEA 5ALXA 2W9CA 4YD1A 2KZ3A 2ZUCA 2VIXA 3AQEA 3QZ7A 2CRXA 1ZQ1C 2H3VA 3OHBA 2Y9UA 1QCKA 1X66A 5KT5A 5J2CA 3PX0A 4KLEA 1NZPA 3F5EA 5AKJA 3Q8SB 5H2FU 1HJPA 4Z6CA 5KNIA 4YN4A 4QWDA 4C8KA 4G9BA 5JUMA 4NY8A 5KG0A 5J0OA 3JPPA 2YMPA 4ELVA 4RUAA 4CCHA 1IV8A 4ECSA 3EZ5A 2PFOA 2VJ5A 2DUYA 1U45A 2AGOA 5EWEA 4ZOHC 1LKYA 2OH2A 2BQ3A 3ZD8A 3DEEA 3RBEA 2ZIXB 3EWAA 4LZDA 4RQMA 1EXNA 2DPJA 3H8MA 4PL2A 2HHTA 3G6VA 3KKAC 5KG4A 4J9PA 3RJGA 1ZD4A 2XC9A 4Y2QA 2AGPA 5ALOA 4MEYA 7ICLA 3MGVA 3RR8A 2UVWA 2HCFA 3ZDAA 2ASDA 3EPIA 2BHNA 3C21A 2YTUA 5F3XB 4UAYA 1TFRA 2OM6A 5DDYA 3OJSA 1Z19A 2RLTA 3B0XA 2QLTA 3GIIA 4DSKA 4FZLA 2FPMA 3NVVA 3UMGA 5AI6A 2EQYA 4NV0A 4J9LA 4C0ZA 2G5IB 4DSFA 5KFIA 5J2BA 5DG8A 1KKXA 4I2AA 4O0IA 3JPQA 4RPZA 3RH6A 3M9MB 1JRPA 3GV7B 3QYPA 3QEBZ 5J2AA 3TKAA 2DF4B 2K8BB 5B5EU 4M9HA 4NXZA 4NLGA 3H40A 9ICCA 2AH5A 4EBDA 9ICWA 4DLGA 5KFSA 4RQ6A 4DQSA 9ICXA 3MGIA 4YR3A 8ICWA 1WWVA 4NLZA 2IOHA 1T7PA 2LMRA 1Z1BA 1U47A 4NL9C 5D4BA 4KLUA 1URJA 1ZD2P 4PHAA 3GV8B 3MR2A 2D8CA 2JEGA 4GC7A 5CB1A 2BCUA 1JUDA 4KLMA 3JPOA 4PZOA 4JV2A 1S0OA 3QE9Y 3BJYA 7ICMA 5C0YA 4GC6A 7ICHA 4PL1A 5J0XA 4B9LA 4C4SA 1L7NA 2XY5A 2MU2A 3D2QA 1LB2B 1UT5A 1O08A 3V6JA 3TFSA 2WTFA 3N97B 1ZQMA 3NRWA 1KLNA 1KW4A 3BDPA 2PFPA 5KAIU 1X9MA 9ICTA 4QWEA 2DKZA 3F53A 2W9BA 1J2MA 2XCAA 4PHEA 1PZNA 5AKGA 4B9VA 2FMQA 4DWIA 2R8JA 5AKEA 3NS1A 2XGQA 3KD3A 3PW5A 4RPXA 1J97A 4WJ3B 3MGHA 1SV4A 2DBYA 4HYKA 2C22A 5HHIA 2HVHA 3F2DA 3WKDA 2RDIA 2GH1A 3GIKA 2W3RA 1ZQZA 4QWCA 5KFEA 9ICEA 3KTQA 4XA5A 3SR6A 3Q8KA 3ISCA 4PHDA 4YR2A 2LKYA 1RYSA 3Q8RB 4TQRA 3QUTA 9ICPA 2NRVA 3WK4A 9ICBA 4P0PB 3F2CA 1NKBA 3CNHA 3E2EA 2MSNA 2WB1C 1RM6C 4ECQA 5J0PA 5CWRA 4Y2TA 1SXEA 4RUCA 5ALMA 1S0NA 3V7LA 2OCEA 2W9CB 2UVRA 3IDWA 2W9MA 1Q8KA 5AKXA 4FBUA 2KE7A 8ICIA 4KLGA 2FLPA 8ICZA 1SV0C 3GILA 4F71A 3AU6A 2LPEA 4DSIA 1ZQRA 4YMOA 1AROP 3GU3A 5HR6A 1BPEA 3N4MB 3RR7A 3IG8A 2JEIA 1RQNA 1SL2A 1L3VA 4Y2PA 1F44A 1ZQWA 2HVIA 1PK3A 4ELUA 5AKHA 3I1YA 2ZTDA 3JPRA 9ICIA 1XSLA 2F76X 5EE3A 3ZDBA 3PR4A 4I2FA 4BUGA 4RNOA 4UB1A 2NV3A 1Q3VA 1LKYB 4AYBC 1NK8A 3H8JA 3N7RC 1Y88A 2OXOA 1D8LA 5AM3A 2E1FA 4DL2A 2W03A 5KFYA 9ICUA 3MABA 4QZ8A 9ICFA 4KN4A 4RQ8A 2HHSA 3C1ZA 5J2JA 2J6TA 2ODGA 2HBJA 3Q8PB 4QJFB 3PX6A 4YCXA 2P35A 5KT7A 3UQ0A 2ASLA 4R63A 5JU5A 9ICMA 5KFXA 4UBCA 2BCSA 3PY8A 3I76A 4ED6A 4K4HA 4KX3A 2W7PA 3OSNA 2E5SA 2BGWA 1QQ6A 2ZJ5A 4USAA 3O0FA 8ICVA 2F1JA 4ED7A 5EE0A 4BWJA 1NKCA 1LVHA 5F9LA 2PFNA 3MDAA 3B0YA 2R8HA 3WKEA 1QQ5A 2BCQA 3RFAA 3PR5B 4FS1A 2XY6A 1T8EA 5L9XA 4F5QA 3NVZA 2WAQC 2ZXHA 4AP9A 2HMXA 4M0AA 5J0RA 1O03A 4IQTA 5TZVA 3ETRA 4US8A 1X6IA 3QXGA 3N7SC 4ECWA 5CHGA 2C2DA 2HHVA 2RQ5A 4IL6U 2BDPA 4I2EA 1XU4A 1CI4A 3RJEA 1BPDA 4OJ6A 3OTQA 5ALHA 5D46A 4DFKA 2EAMA 2B6GA 3ORYA 1NI3A 2K4HA 4NWIA 2XI9A 4RNMA 1JXLA 4DFMA 2Z7JA 2G5HB 4M9LA 5L1JA 8ICUA 4EEYA 4GXKA 5HNKA 4ACOA 5AKZA 3T5LA 4X5VA 1RXWA 4NLCA 1IG6A 2OHFA 1OXJA 4IQUA 2BPGA 1ZQQA 4BJQA 4DEZA 3PW7A 3NTUA 4TURA 1ZRNA 3OHAA 1ZQEA 2IHNA 2MA1A 5KT6A 4EYHB 1XSNA 1MQ3A 2YB4A 9ICNA 5CA7A 4QWAA 2F1IA 5L1IA 4C8OA 4O3QA 2LBOA 3RJJA 1PK1A 2K8AA 1KTQA 3H8SA 3BZCA 8ICMA 4EX7A 2WHEA 1HUZA 4UAZA 4DOCA 1BVSA 4YD2A 2H3ZA 5J8YA 4FFDA 1CUKA 2ZUDA 5AK3A 9ICHA 1KL9A 2KIVA 5G5GA 2PXIA 2KG5A 3DDHA 4F5OA 4QIWF 1F0MA 4UB6U 3HKZC 1NK6A 2HSZA 4I2IA 4O5KA 3RH5A 5AI8A 4I29A 1H38A 2HBKA 2JRZA 1KRPA 4DFJA 5AKLA 5DB8A 4MFFA 1ZQVA 2EAPA 3KHGA 4Y2JA 1JX4A 2VANA 5J0WA 4RT3A 4BX9C 2GOLA 4GFJA 1X42A 3GDXA 3UQ2A 5BPCA 4JK1A 5IIMA 7ICQA 4E0DA 5IIKA 4XRHA 3VC8A 1KQQA 1NK7A 4P0PA 5KFOA 5DKWA 3V72A 4KTQA 1OW5A 1UCVA 3V6HA 2IBKA 2AHOB 5KFZA 3B9JA 3PW4A 3C2MA 3GQCA 1PVRA 3SYZA 1KBUA 4QNLA 2W55A 4UAVA 5AI9A 5KFTA 3AMZA 3BQ0A 3E0FA 8ICGA 2FDRA 5HMMA 3KZXA 2QARB 2V4RA 2Y0SF 2OWOA 5ALTA 4PH5A 1RYUA 3ISBA 3WKAA 4RT2A 2LYAA 2GLEA 4CF5A 1SL0A 2KHVA 3ISDA 3H0LB 3KBBA 5J0UA 1V85A 3HX0A 9ICQA 1RXVA 4P2HA 4Q45A 2DKXA 4K4IA 4TUPA 1HUOA 4CNQA 4F4WA 3A0BU 1S10A 3PZPA 4TQSA 1ZQFA 4C7ZA 7ICSA 2BQUA 1PUZA 5ALJA 3C5GA 3BQ2A 5ALQA 4QZHA 4NLKA 2K60A 3OSPA 5G5HA 3V7JA 4A8EA 3IP4B 1KN5A 1QTMA 1ZQBA 3M8SA 4CDGA 4JWNA 1XNSA 2BCVA 2LI6A 1C7YA 2HOFA 3VCBA 1XS9D 2KMDA 4J9SA 2JH1A 4KLDA 4ECZA 2H3IA 4M47A 4Y2UA 2I6XA 3QEAZ 4DQPA 2AQ4A 2EH9A 7ICRA 5J29A 4KMUA 5ALDA 1PVPA 4Z6FA 3RRGA 4PHPA 1RQLA 4CF3A 1D9DA 4G3IA 3C28A 2YMLA 4M04A 3C5FA 3QU5A 1JN3A 1YZ7A 5AIBA 2F2AB 5TISU 4DS4A 2WF6A 4Z6EA 4ECRA 1F5SA 3GZFA 3SV3A 4P4PA 1S76D 4KN7A 3F5AA 2A1JB 1L8LA 2J6UA 4UB2A 4YR0A 3H7IA 5AI4A 2F44A 5JRTA 3U26A 2GO7A 5L1MA 2B21A 3FDSA 3M1YA 2JEFA 3ETLA 2PFQA 3KHHA 5KFUA 3MFIA 2HBMA 1K1SA 4IRDA 1ZD3A 7ICEA 5KG5A 2A1AA 5KG7A 3KHRA 2KFNA 1DRGA 1M6YA 4OJOA 4F93B 4QZGA 4KLSA 3WK9A 2KP7A 5KTQA 2NO5A 2ISOA 3K4GA 5J0YA 2IOFA 5JTIA 2ZJAA 3UMBA 1ZQCA 3THVA 2NYVA 1PK1B 1A76A 4F3OA 2K4IA 3HP6A 4MFAA 4PGYA 3QX7A 2R18A 1ECWA 2IHMA 2QB0B 1L7PA 3T79A 3RJIA 1WCNA 3Q8MA 2YN4A 4I28A 2W04A 1UT8A 3CW2C 4KX5A 1T4GA 5KFDA 4U7CA 8ICHA 2FMPA 3TARA 8ICSA 3JPNA 3UM9A 4IRCA 1SXDA 2AGQA 4NJ8A 1N60A 3ZDCA 1SZHA 5IIJA 2LYBA 4BXOA 4M9GA 2PKEA 5AIAA 2W3SA 2QKQA 2H3QA 2NRTA 4ICAA 4C8MA 3PMNA 3MR3A 8ICNA 5KFAA 7ICKA 5J0SA 4ECYA 2RRDA 4GXIA 2I1QA 2NRXA 1SKRA 2PMZF 3BZKA 5EE1A 5KFGA 2KFZA 2W9AA 1NK9A 1Z4NA 1CRXA 4FE3A 2MRLA 1OUQA 3EW9A 3SEIA 1TAUA 2KJ8A 3LDAA 2UVUA 3SENA 5ALIA 9ICAA 4EZ9A 1D9FA 2HHWA 1U49A 3Q8QB 1WYGA 3MR5A 4RPYA 3ZD9A 4FZNA 8ICKA 8ICTA 2JGAA 1L3SA 1Z00B 9ICJA 3TADA 5KFKA 3WKCA 5ALRA 1DK3A 2LYHA 4UASA 8ICQA 4QZFA 3PO4A 5J2HA 1ZD5A 2LM1A 3IM1A 5KT2A 3E58A 4OJPA 7ICIA 1UHUA 2ZJ8A 4PGXA 3EPGA 4UARA 4C7YA 2KKVA 1FFVA 5IINA 4UB8U 3N28A 5EWGA 7ICNA 1HEKA 2ZTEA 4OJLA 3BS5B 2KK0A 4QZDA 5L1KA 2WF8A 4IRKA 4YQWA 3LWMA 1RG6A 2BDUA 4EEKA 3M7DA 3BQTA 1TK5A 4IR9A 2YB1A 4M6WA 3C2LA 5KFFA 2HOIA 1NJYA 5ALVA 3D6JA 2M0NA 7ICPA 7ICTA 4OO1J 4IR1A 1U9LA 2I5HA 2KOBA 5KG6A 3UMCA 4DSLA 3LYSA 2QARA 4M9JA 2MUTB 1X9XA 3R9KA 1B43A 4RQ0A 2ISPA 4DOAA 2KSOA 9ICRA 5KFCA 9ICSA 4UQGA 2HOQA 5AM0A 1KFTA 4F5NA 1XC9A 1ZQLA 1XO0A 5AKYA 1X9WA 1ZXIA 2ZXIA 2VKQA 2ZIUB 1ZYQA 1DGJA 3KZIU 2ZIWB 4I2CA 1FO4A 4MEXA 4UBBA 1RDFA 2BR0A 4P4OA 2JMGA 4M9NA 4ELTA 3ED5A 5EE9A 4RQ3A 2AXTU 5KL1B 1T94A 3KKAA 4LZGA 4F4KA 4OD0A 5KFVA 5DDMA 2BPCA 1MA7A 4PGQA 2PI5A 1N63A 1K5OA 2W43A 5ALYA 2CN1A 3NASA 2FMSA 4NM1A 4KLIA 8ICAA 4GLXA 4Y2VA 1N2XA 3V6KA 4KLTA 5CEHA 4KLOA 2Y9TA 4UW9A 5DB7A 5CR0A 4QZEA 5L1LA 1XWLA 3RTVA 3AEVA 3MFHA 3WK5A 2A1JA 4J9KA 2B0CA 2EDUA 3C1YA 4CGZA 3G6YA 3OPXA 2FLLA 2Y1JA 3SI8A 3FAHA 5J2EA 1T3QA 4C8LA 1WUDA 2AU0A 5KL8B 3EYZA 4ECTA 3NRZA 1FIQA 4NL9A 3UXOA 2QB1A 5AM1A 3HT3A 2KVSA 1JIHA 3C23A 4BXOB 4ED0A 4NLBA 4TUSA 2K8CB 3BQ7A 8ICFA 3AN1A 4KLQA 3QUQA 3GIMA 1IIPA 2K4PA 1TVAA 9ICGA 1S0VA 4YMMA 4US9A 2XVTA 4YP3A 3HRDD 1X40A 3TAPA 8ICBA 4FO6A 5KFWA 1ZQXA 4RQ5A 3PW2A 4B9MA 3C2KA 4QZAA 3IG5A 2M9NA 5J0TA 2G08A 4CRXA 5DB9A 3M9NB 1N5WA 3AM9A 3QUCA 1NOMA 2QB0A 4HAIA 4F91B 1S97A 1MSWD 1Z3EB 2R8IA 5KFRA 2XO7A 4U6PA 4JUZA 4RQ1A 1SKWA 1ZQGA 3QU9A 3IRUA 1COKA 1N56A 1KDHA 3RH4A 4EZ6A 3HILA 4KLLA 4RZRA 4KITB 5EWFA 1UA0A 4ECUA 4UB5A 3RB6A 4DS5A 5DG7A 1KSPA 3FYHA 4MF8A 7ICVA 1X2IA 1N61A 2BCRA 1YT3A 5AI0A 1QLNA 2DGZA 4YG2A 2E3TA 1S5LU 5ALEA 2RDJA 4CF4A 5J0QA 3L4PA 2KHQA 1SGGA 2JR5A 3M9OB 4O3MA 2KICA 5HMLA 9ICKA 4Y2SA 3SV4A 4DQRA 2RHFA 7ICFA 2ZUBA 3CP8A 2FLNA 1RZTA 2YY6A 3NGDA 2KVCA 5IILA 2YMMA 3PSFA 5J2GA 3KHLA 5ALUA 1YZ6A 1NZBA 3KFUF 3J81j 3L3FX 5AM4A 4UB4A 2F8LA 4O3SA 1B0XA 1ZQPA 2KZMA 1BPZA 3UXPA 2F77X 4YMNA 3T5KA 4M6WB 1V38A 2LM4A 5ALGA 1C20A 1Z00A 2XY7A 2UVVA 3H8WA 8ICCA 5J2IA 1SV0A 3FM9A 4DCCA 1PVQA 4DL4A 8ICYA 2KZZA 1NJZA 1DGSA 1WG8A 4DL3A 1A0PA 5KT4A 3M6ZA 4F2RA 4O9MA 1Q46A 2D3DA 1BNOA 2ESEA 8ICRA 3RAXA 2KSOB 1TV9A 4Y2YA 2XGPA 1SB3C 1NJXA 3RRHA 1KEJA 1JMSA 2F8KA 4UAWA 2WF9A 2XICA 3C29A 2J6SA 2HDOA 4I2DA 2N1RA 1SL1A 2V4QA 1ZETA 5AI5A 3BS5A 2WB1F 5AK5A 5J2FA 4FZMA 2CXYA 1L8OA 5ALSA 4XUSA 2KTQA 9ICOA 5AHXA 3MR6A 4ED1A 2EZYA 4NM2A 4I2JA 7ICJA 1ZQAA 3PO5A 2R8KA 2KV2A 1L3TA 3RJFA 1NNLA 2JZBA 4DSEA 4R65A 3JPSA 1KFSA 1ZOLA 4JB3A 4IQVA 1V97A 4DL6A 5CJ7A 1ZQSA 2W54A 4F5RA 2MUTA 4C4RA 3GV5B 2P66A 5ALPA 2GWSA 5DBAA 3T3FA 1NK4A 7ICOA 3QZ8A 2HW3A 3QU2A 4R66A 5DQHA 4P0QB 3SMVA 4C8NA 3MBYA 4O5CA 4O3OA 1FEZA 2C28A 5AK6A 1Z4OA 3HPOA 5KG1A 4AYBF 4DOBA 2ZIUA 2DFLA 1XO1A 3QNMA 2ZIWA 2E8NA 4JWMA 2ALZA 4XQ8A 4DLEA 2C2RA 4EBCA 2ZTCA 1TK0A 1D8YA 1Q3UA 3LVWA 4F4YA 5D49A 5KFNA 4GXJA 5ALWA 4KLJA 5DBCA 4C80A 1GO3F 4RQ2A 3IN5A 2W8KA 2K89A 5IIOA 4J9QA 1TAQA 2EZZA 3WK7A 4YFKA 2R8GA 3H4BA 2YMQA 2CPRA 2KIWA 2OYYA 3PNCA 2H3FA 4B9UA 3RBDA 1BGXT 2WFAA 4BGDA 4P4MA 2KJ9A 3PMLA 2RP5A 1UQVA 1FFUA 2DPIA 5CRXA 1IXRA 1VLBA 5AKKA 3SD7A 2G0AA 3ZI4A 2W8LA 2Y1IA 2L5YA 4QIWC 5KG2A 2HHXA 2HHUA 1DOQA 1P7DA 5GTIU 1ZQIA 2WF7A 3ICXA 4F8RA 8ICJA 3D2SA 4JV0A 3RB3A 1D8BA 1JI7A 3PX4A 1MC8A 4ED3A 4BDPA 5AM5A 1CEZA 2KNJA 5ALLA 4YXMA 2WAQF 2O6KA 1X6JA 2JH7A 5K4LA 5EOZA 2BQRA 2NRZA 4F4XA 3H0MB 1QSSA 4PPXA 1JROA 2ES6A 5DGBA 5FP0A 1X9SA 5J8YC 3LK9A 5DQIA 4IC9A 3HWTA 1DXSA 1TAMA 2XIDA 1IM4A 2JV3A 2ZG6A 3WK8A 4ED2A 4UATA 3RJKA 4J03A 4R8UA 5AICA 4YVZA 3AL0B 4KMOB 4O3NA 1WCLA 1B4FA 3WU2U 1ED1A 1ZQOA 5ALKA 4DFPA 2FJ6A 4Q44A 4EELA 2OEHA 5KFLA 5J2DA 5KG3A 3QUBA 5DLFA 7ICUA 3N7PD 4Q8FA 3NVWA 4B6JA 4I2HA 5C5JA 2Y0SC 4J9MA 2G06A 3JPTA 2NRWA 4DQQA 2P6RA 5IIIA 2HBLA 4EYIB 3L5KA 2KN7A 2FPKA 4DO9A 3H4DA 4GIBA 4J9NA 4EENA 2DQNB 4DQIA 4PJ0U 1AQ6A 4DL5A 5KFQA 8ICXA 2ASJA 3ALRA 2Q4TA 4OCZA 1NKEA 2MAXA 4TUQA 4MF2A 3ONNA 1ZQYA 5KT3A 4O3RA 3UPQA 4OJ5A 5J2KA 5HHHA 2K4EA 4NLNA 3LWLA 3K1ZA 3AQFA 2A19A 4DFDA 2NO4A 3TACB 4DF8A 2YX8A 1N62A 3RAQA 3RB0A 1A77A 3HKZF 8ICEA 1T3NA 3SAHA 3K1RB 5E79U 3PV8A 1RPLA 3WKBA 2JZBB 3H0RB 4DF4A 4ECXA 2ZIVA 2KKPA 5GTHU 4J9OA 4K4GA 2I9GA 3TI0A 1TE2A 2IOFK 1ZQDA 1S0MA 5KAFU 4O3PA 4Q8EA 1SKSA 4F4ZA 3EUB2 1SWVA 2D6FC 3LVVA 4LVSA 2F1HA 4JMUA 5KFPA 3HW8A 3SAGA 1B22A 2KD1A 2JXJA 4QZ9A 4J9RA 3Q8LA 1L5UA 4KLHA 3AU2A 3SAFA 5T14A 2VA2A 3GIJA 2PI4A 2DWQA 2KJ5A 1BPXA 2Q0ZX 1N48A 3WK6A 1UPHA 2V9WA 3T5HA 2LHTA 3QU4A 1RYRA 4MFCA 8ICLA 3M8RA 1U48A 5DB6A 1LV5A 1NK0A 3PSTA 1KFDA 3MC1A 2F3NA 2DL0A 5AK4A 4UB3A 9ICVA 3BQ1A 1NJWA 1BNPA 1BPYA 3UXNA 1TK8A 8ICOA 1QSYA 3OGUA 3MDCA 2ZIXA 3DV9A 4B9NA 3IV6A 4LJXA 4Z6DA 1L6NA 3IHQB 1ZQKA 1BPBA 5HR7A 1ZJNA 5BOMA 4P0QA 3PVXA 1QSLA 3I28A 3SZ2A 4I2GA 1JALA 2JEJA 5KFHA 1VDVA 1ZQNA 4DL7A 1ZQHA 1A6SA 4F50A 2XCPA 4RQNA 1V9PA 5DQGA 1QH9A 4CE6A 1L7OA 4DSJA 9ICLA 1COOA 5AKIA 1MQ2A 5BOLA 4EX6A 3T5JA 3PW0A 3RF9A 3BS7A 2C2EA 2E8PA 2IA6A 4B9SA 5ALNA 1ZRMA 2YQEA 4YXJA 3TAQA 1WWUA 1ZQUA 3G6XA 3CYMA 4M2YA 4FBTA 3HJEA 4I2BA 3RB4A 2VA8A 2PMZC 2P6UA 2FI1A 5KFMA 4ZH4A 4F2SA 3FC4A 2VA3A 1N5XA 2G09A
chains in the Genus database with same CATH topology
3VCBA 4AYBC 1MA7A 2CPRA 2XICA 4OJ6A 2R18A 2KIWA 2HBKA 3N7RC 4U6PA 2OYYA 3C29A 3F2BA 2KD1A 2OXOA 2N1RA 1ECWA 2H3FA 2JH1A 3PSIA 2H3IA 5A0LA 2ZIVB 2WB1F 3SAFA 5T14A 2CN1A 2KKVA 4FZLA 3T79A 4WJ3B 2E1EA 2KJ5A 4FZMA 2K4HA 2E1FA 2KJ9A 4NWIA 2XI9A 1Z19A 4NV0A 1HEKA 2HBLA 2W03A 2G5IB 4OJLA 4C0ZA 1PVPA 1UPHA 2RP5A 2W04A 2LHTA 2Z7JA 2G5HB 5CRXA 4KX5A 4BX9C 2GOLA 3PSTA 4GFJA 3F2DA 4U7CA 2G0AA 2GH1A 2A3VA 3C28A 2HBJA 2VIXA 3AQEA 4ACOA 2CRXA 1ZQ1C 1YT3A 2H3VA 2DQNB 4NLCA 2DGZA 2BDUA 1SZHA 4QJFB 3M7DA 4QIWC 2DF4B 3ALRA 2K8BB 2LYBA 4BJQA 2F2AB 3NUQA 3VC8A 2YB1A 2KV2A 2Q4TA 1P7DA 2ZIXA 2HOIA 4P0PA 3ICXA 2LKYA 1L6NA 3ONNA 3D2SA 3F5EA 1D8BA 2M0NA 5HR7A 2H3QA 4ICAA 4OO1J 4OJ5A 2KHQA 3GZFA 1HIWA 4O3MA 2KICA 3F5AA 2K4EA 4P0QA 2KNJA 2MA1A 4CGZA 4P0PB 3K1ZA 3PSPA 3AQFA 2WAQF 4KX3A 2W7PA 3F2CA 1Z1BA 2RHFA 2E5SA 3D2NA 2KOBA 3OPXA 2WB1C 1PVRA 2RRDA 2YB4A 3LYSA 1URJA 2JH7A 2YX8A 3CP8A 3CRXA 1KBUA 4QNLA 3H0MB 4P0QB 2KVCA 1WUDA 2PMZF 2LBOA 3O0FA 3PSFA 5KL8B 3E0FA 3SMVA 2VJ5A 1A6SA 3KZXA 2K8AA 3HKZF 1NZBA 3KFUF 1CRXA 2G07A 2HBMA 2Y0SF 2HOQA 3L3FX 4FE3A 3SAHA 2F8LA 2MRLA 1OUQA 1Q3VA 4AYBF 4IC9A 2W7OA 2LYAA 2OH2A 1TAMA 2XIDA 2ZIUA 3M6KA 3DEEA 1XO0A 2F77X 2KHVA 2KJ8A 5C0YA 2ZIXB 2ZG6A 2ZIWA 3H0LB 1DRGA 4NLBA 3H0RB 3RF9A 4PL1A 2ZIVA 2H3ZA 4OJOA 2HOFA 2KKPA 3GU3A 2ZXIA 5HR6A 2K8CB 4PL2A 2VKQA 3IG8A 3AL0B 2ZIUB 4KMOB 3RFAA 1PVQA 1IIPA 4FZNA 2ZIWB 3D2QA 2JGAA 2VJ4A 3LVWA 1Q3UA 1F44A 3PZPA 2WAQC 2JMGA 1ED1A 2XVTA 2ZXHA 3SQIA 2HMXA 1A0PA 3CYMA 3NRWA 3M6ZA 5KL1B 3MGVA 2F76X 1GO3F 3IN5A 4QIWF 1T94A 4A8EA 2PMZC 3N7SC 3N7PD 3IP4B 2KEYA 2K89A 3F53A 3IG5A 3LVVA 2D6FC 4CRXA 2G08A 3HKZC 2K4IA 4JMUA 2JHDA 4OJPA 4CDGA 3SAGA 1XNSA 2Y0SC 4BUGA 2G06A 2G09A 2NV3A 2OM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ C;  4AYB C;  3HKZ C;  2WB1 C;  2PMZ C;  4QIW C;  2Y0S C; 
#chains in the Genus database with same CATH topology
 4F5P A;  3F2B A;  3PSI A;  4KLF A;  2W9B B;  1TKD A;  4FS2 A;  4R8U B;  4IS7 A;  1ZJM A;  4F92 B;  4EBE A;  4Y2X A;  5DLG A;  1K1Q A;  4QZB A;  2H5X A;  2EZX A;  3A0H U;  3TQ1 A;  5CP2 A;  2FE9 A;  2A3V A;  2WF5 A;  1DK2 A;  4QZI A;  4F72 A;  4UAU A;  3KOO A;  8ICP A;  3NUQ A;  4QW9 A;  3RJH A;  4O5E A;  2E8O A;  5HP4 A;  2EAN A;  2AJQ A;  1XSP A;  1HIW A;  5KFB A;  4B9T A;  3PSP A;  2BPF A;  1SWW A;  1MN8 A;  3D2N A;  5DBB A;  5DGA A;  4QWB A;  4R64 A;  3CRX A;  1VJ5 A;  1J2N A;  4IQW A;  3NVY A;  3S6J A;  4RNN A;  4RU9 A;  4Y2R A;  3ZDD A;  1Z1V A;  2ATL A;  5DG9 A;  2G07 A;  5KFJ A;  2HI0 A;  1L3U A;  1S8O A;  4JV1 A;  1U4B A;  2W7O A;  3M6K A;  5F9N A;  4RQ4 A;  3K75 D;  3TAD C;  1QQ7 A;  3AUO A;  4MHV A;  4I27 A;  4RQ7 A;  4QW8 A;  7ICG A;  4ED8 A;  1NK5 A;  4C4T A;  5B66 U;  2E8M A;  2VJ4 A;  3TFR A;  2AQ0 A;  3SQI A;  1UA1 A;  1ZQJ A;  4PZN A;  5ALZ A;  4Q43 A;  1SIJ A;  3QU7 A;  3ZDE A;  2BZF A;  2W11 A;  2EAO A;  2KEY A;  3V7K A;  2JHD A;  2IMW P;  2HHQ A;  1S9F A;  5ALF A;  5AM2 A;  3GFK B;  1SZP A;  5A0L A;  4ECV A;  2ZIV B;  1ZQT A;  3TAN A;  2BKE A;  1S77 D;  4BWM A;  1L7M A;  2E1E A;  4QZC A;  3OJU A;  2FPL A;  1JXE A;  5ALX A;  2W9C A;  4YD1 A;  2KZ3 A;  2ZUC A;  2VIX A;  3AQE A;  3QZ7 A;  2CRX A;  1ZQ1 C;  2H3V A;  3OHB A;  2Y9U A;  1QCK A;  1X66 A;  5KT5 A;  5J2C A;  3PX0 A;  4KLE A;  1NZP A;  3F5E A;  5AKJ A;  3Q8S B;  5H2F U;  1HJP A;  4Z6C A;  5KNI A;  4YN4 A;  4QWD A;  4C8K A;  4G9B A;  5JUM A;  4NY8 A;  5KG0 A;  5J0O A;  3JPP A;  2YMP A;  4ELV A;  4RUA A;  4CCH A;  1IV8 A;  4ECS A;  3EZ5 A;  2PFO A;  2VJ5 A;  2DUY A;  1U45 A;  2AGO A;  5EWE A;  4ZOH C;  1LKY A;  2OH2 A;  2BQ3 A;  3ZD8 A;  3DEE A;  3RBE A;  2ZIX B;  3EWA A;  4LZD A;  4RQM A;  1EXN A;  2DPJ A;  3H8M A;  4PL2 A;  2HHT A;  3G6V A;  3KKA C;  5KG4 A;  4J9P A;  3RJG A;  1ZD4 A;  2XC9 A;  4Y2Q A;  2AGP A;  5ALO A;  4MEY A;  7ICL A;  3MGV A;  3RR8 A;  2UVW A;  2HCF A;  3ZDA A;  2ASD A;  3EPI A;  2BHN A;  3C21 A;  2YTU A;  5F3X B;  4UAY A;  1TFR A;  2OM6 A;  5DDY A;  3OJS A;  1Z19 A;  2RLT A;  3B0X A;  2QLT A;  3GII A;  4DSK A;  4FZL A;  2FPM A;  3NVV A;  3UMG A;  5AI6 A;  2EQY A;  4NV0 A;  4J9L A;  4C0Z A;  2G5I B;  4DSF A;  5KFI A;  5J2B A;  5DG8 A;  1KKX A;  4I2A A;  4O0I A;  3JPQ A;  4RPZ A;  3RH6 A;  3M9M B;  1JRP A;  3GV7 B;  3QYP A;  3QEB Z;  5J2A A;  3TKA A;  2DF4 B;  2K8B B;  5B5E U;  4M9H A;  4NXZ A;  4NLG A;  3H40 A;  9ICC A;  2AH5 A;  4EBD A;  9ICW A;  4DLG A;  5KFS A;  4RQ6 A;  4DQS A;  9ICX A;  3MGI A;  4YR3 A;  8ICW A;  1WWV A;  4NLZ A;  2IOH A;  1T7P A;  2LMR A;  1Z1B A;  1U47 A;  4NL9 C;  5D4B A;  4KLU A;  1URJ A;  1ZD2 P;  4PHA A;  3GV8 B;  3MR2 A;  2D8C A;  2JEG A;  4GC7 A;  5CB1 A;  2BCU A;  1JUD A;  4KLM A;  3JPO A;  4PZO A;  4JV2 A;  1S0O A;  3QE9 Y;  3BJY A;  7ICM A;  5C0Y A;  4GC6 A;  7ICH A;  4PL1 A;  5J0X A;  4B9L A;  4C4S A;  1L7N A;  2XY5 A;  2MU2 A;  3D2Q A;  1LB2 B;  1UT5 A;  1O08 A;  3V6J A;  3TFS A;  2WTF A;  3N97 B;  1ZQM A;  3NRW A;  1KLN A;  1KW4 A;  3BDP A;  2PFP A;  5KAI U;  1X9M A;  9ICT A;  4QWE A;  2DKZ A;  3F53 A;  2W9B A;  1J2M A;  2XCA A;  4PHE A;  1PZN A;  5AKG A;  4B9V A;  2FMQ A;  4DWI A;  2R8J A;  5AKE A;  3NS1 A;  2XGQ A;  3KD3 A;  3PW5 A;  4RPX A;  1J97 A;  4WJ3 B;  3MGH A;  1SV4 A;  2DBY A;  4HYK A;  2C22 A;  5HHI A;  2HVH A;  3F2D A;  3WKD A;  2RDI A;  2GH1 A;  3GIK A;  2W3R A;  1ZQZ A;  4QWC A;  5KFE A;  9ICE A;  3KTQ A;  4XA5 A;  3SR6 A;  3Q8K A;  3ISC A;  4PHD A;  4YR2 A;  2LKY A;  1RYS A;  3Q8R B;  4TQR A;  3QUT A;  9ICP A;  2NRV A;  3WK4 A;  9ICB A;  4P0P B;  3F2C A;  1NKB A;  3CNH A;  3E2E A;  2MSN A;  2WB1 C;  1RM6 C;  4ECQ A;  5J0P A;  5CWR A;  4Y2T A;  1SXE A;  4RUC A;  5ALM A;  1S0N A;  3V7L A;  2OCE A;  2W9C B;  2UVR A;  3IDW A;  2W9M A;  1Q8K A;  5AKX A;  4FBU A;  2KE7 A;  8ICI A;  4KLG A;  2FLP A;  8ICZ A;  1SV0 C;  3GIL A;  4F71 A;  3AU6 A;  2LPE A;  4DSI A;  1ZQR A;  4YMO A;  1ARO P;  3GU3 A;  5HR6 A;  1BPE A;  3N4M B;  3RR7 A;  3IG8 A;  2JEI A;  1RQN A;  1SL2 A;  1L3V A;  4Y2P A;  1F44 A;  1ZQW A;  2HVI A;  1PK3 A;  4ELU A;  5AKH A;  3I1Y A;  2ZTD A;  3JPR A;  9ICI A;  1XSL A;  2F76 X;  5EE3 A;  3ZDB A;  3PR4 A;  4I2F A;  4BUG A;  4RNO A;  4UB1 A;  2NV3 A;  1Q3V A;  1LKY B;  4AYB C;  1NK8 A;  3H8J A;  3N7R C;  1Y88 A;  2OXO A;  1D8L A;  5AM3 A;  2E1F A;  4DL2 A;  2W03 A;  5KFY A;  9ICU A;  3MAB A;  4QZ8 A;  9ICF A;  4KN4 A;  4RQ8 A;  2HHS A;  3C1Z A;  5J2J A;  2J6T A;  2ODG A;  2HBJ A;  3Q8P B;  4QJF B;  3PX6 A;  4YCX A;  2P35 A;  5KT7 A;  3UQ0 A;  2ASL A;  4R63 A;  5JU5 A;  9ICM A;  5KFX A;  4UBC A;  2BCS A;  3PY8 A;  3I76 A;  4ED6 A;  4K4H A;  4KX3 A;  2W7P A;  3OSN A;  2E5S A;  2BGW A;  1QQ6 A;  2ZJ5 A;  4USA A;  3O0F A;  8ICV A;  2F1J A;  4ED7 A;  5EE0 A;  4BWJ A;  1NKC A;  1LVH A;  5F9L A;  2PFN A;  3MDA A;  3B0Y A;  2R8H A;  3WKE A;  1QQ5 A;  2BCQ A;  3RFA A;  3PR5 B;  4FS1 A;  2XY6 A;  1T8E A;  5L9X A;  4F5Q A;  3NVZ A;  2WAQ C;  2ZXH A;  4AP9 A;  2HMX A;  4M0A A;  5J0R A;  1O03 A;  4IQT A;  5TZV A;  3ETR A;  4US8 A;  1X6I A;  3QXG A;  3N7S C;  4ECW A;  5CHG A;  2C2D A;  2HHV A;  2RQ5 A;  4IL6 U;  2BDP A;  4I2E A;  1XU4 A;  1CI4 A;  3RJE A;  1BPD A;  4OJ6 A;  3OTQ A;  5ALH A;  5D46 A;  4DFK A;  2EAM A;  2B6G A;  3ORY A;  1NI3 A;  2K4H A;  4NWI A;  2XI9 A;  4RNM A;  1JXL A;  4DFM A;  2Z7J A;  2G5H B;  4M9L A;  5L1J A;  8ICU A;  4EEY A;  4GXK A;  5HNK A;  4ACO A;  5AKZ A;  3T5L A;  4X5V A;  1RXW A;  4NLC A;  1IG6 A;  2OHF A;  1OXJ A;  4IQU A;  2BPG A;  1ZQQ A;  4BJQ A;  4DEZ A;  3PW7 A;  3NTU A;  4TUR A;  1ZRN A;  3OHA A;  1ZQE A;  2IHN A;  2MA1 A;  5KT6 A;  4EYH B;  1XSN A;  1MQ3 A;  2YB4 A;  9ICN A;  5CA7 A;  4QWA A;  2F1I A;  5L1I A;  4C8O A;  4O3Q A;  2LBO A;  3RJJ A;  1PK1 A;  2K8A A;  1KTQ A;  3H8S A;  3BZC A;  8ICM A;  4EX7 A;  2WHE A;  1HUZ A;  4UAZ A;  4DOC A;  1BVS A;  4YD2 A;  2H3Z A;  5J8Y A;  4FFD A;  1CUK A;  2ZUD A;  5AK3 A;  9ICH A;  1KL9 A;  2KIV A;  5G5G A;  2PXI A;  2KG5 A;  3DDH A;  4F5O A;  4QIW F;  1F0M A;  4UB6 U;  3HKZ C;  1NK6 A;  2HSZ A;  4I2I A;  4O5K A;  3RH5 A;  5AI8 A;  4I29 A;  1H38 A;  2HBK A;  2JRZ A;  1KRP A;  4DFJ A;  5AKL A;  5DB8 A;  4MFF A;  1ZQV A;  2EAP A;  3KHG A;  4Y2J A;  1JX4 A;  2VAN A;  5J0W A;  4RT3 A;  4BX9 C;  2GOL A;  4GFJ A;  1X42 A;  3GDX A;  3UQ2 A;  5BPC A;  4JK1 A;  5IIM A;  7ICQ A;  4E0D A;  5IIK A;  4XRH A;  3VC8 A;  1KQQ A;  1NK7 A;  4P0P A;  5KFO A;  5DKW A;  3V72 A;  4KTQ A;  1OW5 A;  1UCV A;  3V6H A;  2IBK A;  2AHO B;  5KFZ A;  3B9J A;  3PW4 A;  3C2M A;  3GQC A;  1PVR A;  3SYZ A;  1KBU A;  4QNL A;  2W55 A;  4UAV A;  5AI9 A;  5KFT A;  3AMZ A;  3BQ0 A;  3E0F A;  8ICG A;  2FDR A;  5HMM A;  3KZX A;  2QAR B;  2V4R A;  2Y0S F;  2OWO A;  5ALT A;  4PH5 A;  1RYU A;  3ISB A;  3WKA A;  4RT2 A;  2LYA A;  2GLE A;  4CF5 A;  1SL0 A;  2KHV A;  3ISD A;  3H0L B;  3KBB A;  5J0U A;  1V85 A;  3HX0 A;  9ICQ A;  1RXV A;  4P2H A;  4Q45 A;  2DKX A;  4K4I A;  4TUP A;  1HUO A;  4CNQ A;  4F4W A;  3A0B U;  1S10 A;  3PZP A;  4TQS A;  1ZQF A;  4C7Z A;  7ICS A;  2BQU A;  1PUZ A;  5ALJ A;  3C5G A;  3BQ2 A;  5ALQ A;  4QZH A;  4NLK A;  2K60 A;  3OSP A;  5G5H A;  3V7J A;  4A8E A;  3IP4 B;  1KN5 A;  1QTM A;  1ZQB A;  3M8S A;  4CDG A;  4JWN A;  1XNS A;  2BCV A;  2LI6 A;  1C7Y A;  2HOF A;  3VCB A;  1XS9 D;  2KMD A;  4J9S A;  2JH1 A;  4KLD A;  4ECZ A;  2H3I A;  4M47 A;  4Y2U A;  2I6X A;  3QEA Z;  4DQP A;  2AQ4 A;  2EH9 A;  7ICR A;  5J29 A;  4KMU A;  5ALD A;  1PVP A;  4Z6F A;  3RRG A;  4PHP A;  1RQL A;  4CF3 A;  1D9D A;  4G3I A;  3C28 A;  2YML A;  4M04 A;  3C5F A;  3QU5 A;  1JN3 A;  1YZ7 A;  5AIB A;  2F2A B;  5TIS U;  4DS4 A;  2WF6 A;  4Z6E A;  4ECR A;  1F5S A;  3GZF A;  3SV3 A;  4P4P A;  1S76 D;  4KN7 A;  3F5A A;  2A1J B;  1L8L A;  2J6U A;  4UB2 A;  4YR0 A;  3H7I A;  5AI4 A;  2F44 A;  5JRT A;  3U26 A;  2GO7 A;  5L1M A;  2B21 A;  3FDS A;  3M1Y A;  2JEF A;  3ETL A;  2PFQ A;  3KHH A;  5KFU A;  3MFI A;  2HBM A;  1K1S A;  4IRD A;  1ZD3 A;  7ICE A;  5KG5 A;  2A1A A;  5KG7 A;  3KHR A;  2KFN A;  1DRG A;  1M6Y A;  4OJO A;  4F93 B;  4QZG A;  4KLS A;  3WK9 A;  2KP7 A;  5KTQ A;  2NO5 A;  2ISO A;  3K4G A;  5J0Y A;  2IOF A;  5JTI A;  2ZJA A;  3UMB A;  1ZQC A;  3THV A;  2NYV A;  1PK1 B;  1A76 A;  4F3O A;  2K4I A;  3HP6 A;  4MFA A;  4PGY A;  3QX7 A;  2R18 A;  1ECW A;  2IHM A;  2QB0 B;  1L7P A;  3T79 A;  3RJI A;  1WCN A;  3Q8M A;  2YN4 A;  4I28 A;  2W04 A;  1UT8 A;  3CW2 C;  4KX5 A;  1T4G A;  5KFD A;  4U7C A;  8ICH A;  2FMP A;  3TAR A;  8ICS A;  3JPN A;  3UM9 A;  4IRC A;  1SXD A;  2AGQ A;  4NJ8 A;  1N60 A;  3ZDC A;  1SZH A;  5IIJ A;  2LYB A;  4BXO A;  4M9G A;  2PKE A;  5AIA A;  2W3S A;  2QKQ A;  2H3Q A;  2NRT A;  4ICA A;  4C8M A;  3PMN A;  3MR3 A;  8ICN A;  5KFA A;  7ICK A;  5J0S A;  4ECY A;  2RRD A;  4GXI A;  2I1Q A;  2NRX A;  1SKR A;  2PMZ F;  3BZK A;  5EE1 A;  5KFG A;  2KFZ A;  2W9A A;  1NK9 A;  1Z4N A;  1CRX A;  4FE3 A;  2MRL A;  1OUQ A;  3EW9 A;  3SEI A;  1TAU A;  2KJ8 A;  3LDA A;  2UVU A;  3SEN A;  5ALI A;  9ICA A;  4EZ9 A;  1D9F A;  2HHW A;  1U49 A;  3Q8Q B;  1WYG A;  3MR5 A;  4RPY A;  3ZD9 A;  4FZN A;  8ICK A;  8ICT A;  2JGA A;  1L3S A;  1Z00 B;  9ICJ A;  3TAD A;  5KFK A;  3WKC A;  5ALR A;  1DK3 A;  2LYH A;  4UAS A;  8ICQ A;  4QZF A;  3PO4 A;  5J2H A;  1ZD5 A;  2LM1 A;  3IM1 A;  5KT2 A;  3E58 A;  4OJP A;  7ICI A;  1UHU A;  2ZJ8 A;  4PGX A;  3EPG A;  4UAR A;  4C7Y A;  2KKV A;  1FFV A;  5IIN A;  4UB8 U;  3N28 A;  5EWG A;  7ICN A;  1HEK A;  2ZTE A;  4OJL A;  3BS5 B;  2KK0 A;  4QZD A;  5L1K A;  2WF8 A;  4IRK A;  4YQW A;  3LWM A;  1RG6 A;  2BDU A;  4EEK A;  3M7D A;  3BQT A;  1TK5 A;  4IR9 A;  2YB1 A;  4M6W A;  3C2L A;  5KFF A;  2HOI A;  1NJY A;  5ALV A;  3D6J A;  2M0N A;  7ICP A;  7ICT A;  4OO1 J;  4IR1 A;  1U9L A;  2I5H A;  2KOB A;  5KG6 A;  3UMC A;  4DSL A;  3LYS A;  2QAR A;  4M9J A;  2MUT B;  1X9X A;  3R9K A;  1B43 A;  4RQ0 A;  2ISP A;  4DOA A;  2KSO A;  9ICR A;  5KFC A;  9ICS A;  4UQG A;  2HOQ A;  5AM0 A;  1KFT A;  4F5N A;  1XC9 A;  1ZQL A;  1XO0 A;  5AKY A;  1X9W A;  1ZXI A;  2ZXI A;  2VKQ A;  2ZIU B;  1ZYQ A;  1DGJ A;  3KZI U;  2ZIW B;  4I2C A;  1FO4 A;  4MEX A;  4UBB A;  1RDF A;  2BR0 A;  4P4O A;  2JMG A;  4M9N A;  4ELT A;  3ED5 A;  5EE9 A;  4RQ3 A;  2AXT U;  5KL1 B;  1T94 A;  3KKA A;  4LZG A;  4F4K A;  4OD0 A;  5KFV A;  5DDM A;  2BPC A;  1MA7 A;  4PGQ A;  2PI5 A;  1N63 A;  1K5O A;  2W43 A;  5ALY A;  2CN1 A;  3NAS A;  2FMS A;  4NM1 A;  4KLI A;  8ICA A;  4GLX A;  4Y2V A;  1N2X A;  3V6K A;  4KLT A;  5CEH A;  4KLO A;  2Y9T A;  4UW9 A;  5DB7 A;  5CR0 A;  4QZE A;  5L1L A;  1XWL A;  3RTV A;  3AEV A;  3MFH A;  3WK5 A;  2A1J A;  4J9K A;  2B0C A;  2EDU A;  3C1Y A;  4CGZ A;  3G6Y A;  3OPX A;  2FLL A;  2Y1J A;  3SI8 A;  3FAH A;  5J2E A;  1T3Q A;  4C8L A;  1WUD A;  2AU0 A;  5KL8 B;  3EYZ A;  4ECT A;  3NRZ A;  1FIQ A;  4NL9 A;  3UXO A;  2QB1 A;  5AM1 A;  3HT3 A;  2KVS A;  1JIH A;  3C23 A;  4BXO B;  4ED0 A;  4NLB A;  4TUS A;  2K8C B;  3BQ7 A;  8ICF A;  3AN1 A;  4KLQ A;  3QUQ A;  3GIM A;  1IIP A;  2K4P A;  1TVA A;  9ICG A;  1S0V A;  4YMM A;  4US9 A;  2XVT A;  4YP3 A;  3HRD D;  1X40 A;  3TAP A;  8ICB A;  4FO6 A;  5KFW A;  1ZQX A;  4RQ5 A;  3PW2 A;  4B9M A;  3C2K A;  4QZA A;  3IG5 A;  2M9N A;  5J0T A;  2G08 A;  4CRX A;  5DB9 A;  3M9N B;  1N5W A;  3AM9 A;  3QUC A;  1NOM A;  2QB0 A;  4HAI A;  4F91 B;  1S97 A;  1MSW D;  1Z3E B;  2R8I A;  5KFR A;  2XO7 A;  4U6P A;  4JUZ A;  4RQ1 A;  1SKW A;  1ZQG A;  3QU9 A;  3IRU A;  1COK A;  1N56 A;  1KDH A;  3RH4 A;  4EZ6 A;  3HIL A;  4KLL A;  4RZR A;  4KIT B;  5EWF A;  1UA0 A;  4ECU A;  4UB5 A;  3RB6 A;  4DS5 A;  5DG7 A;  1KSP A;  3FYH A;  4MF8 A;  7ICV A;  1X2I A;  1N61 A;  2BCR A;  1YT3 A;  5AI0 A;  1QLN A;  2DGZ A;  4YG2 A;  2E3T A;  1S5L U;  5ALE A;  2RDJ A;  4CF4 A;  5J0Q A;  3L4P A;  2KHQ A;  1SGG A;  2JR5 A;  3M9O B;  4O3M A;  2KIC A;  5HML A;  9ICK A;  4Y2S A;  3SV4 A;  4DQR A;  2RHF A;  7ICF A;  2ZUB A;  3CP8 A;  2FLN A;  1RZT A;  2YY6 A;  3NGD A;  2KVC A;  5IIL A;  2YMM A;  3PSF A;  5J2G A;  3KHL A;  5ALU A;  1YZ6 A;  1NZB A;  3KFU F;  3J81 j;  3L3F X;  5AM4 A;  4UB4 A;  2F8L A;  4O3S A;  1B0X A;  1ZQP A;  2KZM A;  1BPZ A;  3UXP A;  2F77 X;  4YMN A;  3T5K A;  4M6W B;  1V38 A;  2LM4 A;  5ALG A;  1C20 A;  1Z00 A;  2XY7 A;  2UVV A;  3H8W A;  8ICC A;  5J2I A;  1SV0 A;  3FM9 A;  4DCC A;  1PVQ A;  4DL4 A;  8ICY A;  2KZZ A;  1NJZ A;  1DGS A;  1WG8 A;  4DL3 A;  1A0P A;  5KT4 A;  3M6Z A;  4F2R A;  4O9M A;  1Q46 A;  2D3D A;  1BNO A;  2ESE A;  8ICR A;  3RAX A;  2KSO B;  1TV9 A;  4Y2Y A;  2XGP A;  1SB3 C;  1NJX A;  3RRH A;  1KEJ A;  1JMS A;  2F8K A;  4UAW A;  2WF9 A;  2XIC A;  3C29 A;  2J6S A;  2HDO A;  4I2D A;  2N1R A;  1SL1 A;  2V4Q A;  1ZET A;  5AI5 A;  3BS5 A;  2WB1 F;  5AK5 A;  5J2F A;  4FZM A;  2CXY A;  1L8O A;  5ALS A;  4XUS A;  2KTQ A;  9ICO A;  5AHX A;  3MR6 A;  4ED1 A;  2EZY A;  4NM2 A;  4I2J A;  7ICJ A;  1ZQA A;  3PO5 A;  2R8K A;  2KV2 A;  1L3T A;  3RJF A;  1NNL A;  2JZB A;  4DSE A;  4R65 A;  3JPS A;  1KFS A;  1ZOL A;  4JB3 A;  4IQV A;  1V97 A;  4DL6 A;  5CJ7 A;  1ZQS A;  2W54 A;  4F5R A;  2MUT A;  4C4R A;  3GV5 B;  2P66 A;  5ALP A;  2GWS A;  5DBA A;  3T3F A;  1NK4 A;  7ICO A;  3QZ8 A;  2HW3 A;  3QU2 A;  4R66 A;  5DQH A;  4P0Q B;  3SMV A;  4C8N A;  3MBY A;  4O5C A;  4O3O A;  1FEZ A;  2C28 A;  5AK6 A;  1Z4O A;  3HPO A;  5KG1 A;  4AYB F;  4DOB A;  2ZIU A;  2DFL A;  1XO1 A;  3QNM A;  2ZIW A;  2E8N A;  4JWM A;  2ALZ A;  4XQ8 A;  4DLE A;  2C2R A;  4EBC A;  2ZTC A;  1TK0 A;  1D8Y A;  1Q3U A;  3LVW A;  4F4Y A;  5D49 A;  5KFN A;  4GXJ A;  5ALW A;  4KLJ A;  5DBC A;  4C80 A;  1GO3 F;  4RQ2 A;  3IN5 A;  2W8K A;  2K89 A;  5IIO A;  4J9Q A;  1TAQ A;  2EZZ A;  3WK7 A;  4YFK A;  2R8G A;  3H4B A;  2YMQ A;  2CPR A;  2KIW A;  2OYY A;  3PNC A;  2H3F A;  4B9U A;  3RBD A;  1BGX T;  2WFA A;  4BGD A;  4P4M A;  2KJ9 A;  3PML A;  2RP5 A;  1UQV A;  1FFU A;  2DPI A;  5CRX A;  1IXR A;  1VLB A;  5AKK A;  3SD7 A;  2G0A A;  3ZI4 A;  2W8L A;  2Y1I A;  2L5Y A;  4QIW C;  5KG2 A;  2HHX A;  2HHU A;  1DOQ A;  1P7D A;  5GTI U;  1ZQI A;  2WF7 A;  3ICX A;  4F8R A;  8ICJ A;  3D2S A;  4JV0 A;  3RB3 A;  1D8B A;  1JI7 A;  3PX4 A;  1MC8 A;  4ED3 A;  4BDP A;  5AM5 A;  1CEZ A;  2KNJ A;  5ALL A;  4YXM A;  2WAQ F;  2O6K A;  1X6J A;  2JH7 A;  5K4L A;  5EOZ A;  2BQR A;  2NRZ A;  4F4X A;  3H0M B;  1QSS A;  4PPX A;  1JRO A;  2ES6 A;  5DGB A;  5FP0 A;  1X9S A;  5J8Y C;  3LK9 A;  5DQI A;  4IC9 A;  3HWT A;  1DXS A;  1TAM A;  2XID A;  1IM4 A;  2JV3 A;  2ZG6 A;  3WK8 A;  4ED2 A;  4UAT A;  3RJK A;  4J03 A;  4R8U A;  5AIC A;  4YVZ A;  3AL0 B;  4KMO B;  4O3N A;  1WCL A;  1B4F A;  3WU2 U;  1ED1 A;  1ZQO A;  5ALK A;  4DFP A;  2FJ6 A;  4Q44 A;  4EEL A;  2OEH A;  5KFL A;  5J2D A;  5KG3 A;  3QUB A;  5DLF A;  7ICU A;  3N7P D;  4Q8F A;  3NVW A;  4B6J A;  4I2H A;  5C5J A;  2Y0S C;  4J9M A;  2G06 A;  3JPT A;  2NRW A;  4DQQ A;  2P6R A;  5III A;  2HBL A;  4EYI B;  3L5K A;  2KN7 A;  2FPK A;  4DO9 A;  3H4D A;  4GIB A;  4J9N A;  4EEN A;  2DQN B;  4DQI A;  4PJ0 U;  1AQ6 A;  4DL5 A;  5KFQ A;  8ICX A;  2ASJ A;  3ALR A;  2Q4T A;  4OCZ A;  1NKE A;  2MAX A;  4TUQ A;  4MF2 A;  3ONN A;  1ZQY A;  5KT3 A;  4O3R A;  3UPQ A;  4OJ5 A;  5J2K A;  5HHH A;  2K4E A;  4NLN A;  3LWL A;  3K1Z A;  3AQF A;  2A19 A;  4DFD A;  2NO4 A;  3TAC B;  4DF8 A;  2YX8 A;  1N62 A;  3RAQ A;  3RB0 A;  1A77 A;  3HKZ F;  8ICE A;  1T3N A;  3SAH A;  3K1R B;  5E79 U;  3PV8 A;  1RPL A;  3WKB A;  2JZB B;  3H0R B;  4DF4 A;  4ECX A;  2ZIV A;  2KKP A;  5GTH U;  4J9O A;  4K4G A;  2I9G A;  3TI0 A;  1TE2 A;  2IOF K;  1ZQD A;  1S0M A;  5KAF U;  4O3P A;  4Q8E A;  1SKS A;  4F4Z A;  3EUB 2;  1SWV A;  2D6F C;  3LVV A;  4LVS A;  2F1H A;  4JMU A;  5KFP A;  3HW8 A;  3SAG A;  1B22 A;  2KD1 A;  2JXJ A;  4QZ9 A;  4J9R A;  3Q8L A;  1L5U A;  4KLH A;  3AU2 A;  3SAF A;  5T14 A;  2VA2 A;  3GIJ A;  2PI4 A;  2DWQ A;  2KJ5 A;  1BPX A;  2Q0Z X;  1N48 A;  3WK6 A;  1UPH A;  2V9W A;  3T5H A;  2LHT A;  3QU4 A;  1RYR A;  4MFC A;  8ICL A;  3M8R A;  1U48 A;  5DB6 A;  1LV5 A;  1NK0 A;  3PST A;  1KFD A;  3MC1 A;  2F3N A;  2DL0 A;  5AK4 A;  4UB3 A;  9ICV A;  3BQ1 A;  1NJW A;  1BNP A;  1BPY A;  3UXN A;  1TK8 A;  8ICO A;  1QSY A;  3OGU A;  3MDC A;  2ZIX A;  3DV9 A;  4B9N A;  3IV6 A;  4LJX A;  4Z6D A;  1L6N A;  3IHQ B;  1ZQK A;  1BPB A;  5HR7 A;  1ZJN A;  5BOM A;  4P0Q A;  3PVX A;  1QSL A;  3I28 A;  3SZ2 A;  4I2G A;  1JAL A;  2JEJ A;  5KFH A;  1VDV A;  1ZQN A;  4DL7 A;  1ZQH A;  1A6S A;  4F50 A;  2XCP A;  4RQN A;  1V9P A;  5DQG A;  1QH9 A;  4CE6 A;  1L7O A;  4DSJ A;  9ICL A;  1COO A;  5AKI A;  1MQ2 A;  5BOL A;  4EX6 A;  3T5J A;  3PW0 A;  3RF9 A;  3BS7 A;  2C2E A;  2E8P A;  2IA6 A;  4B9S A;  5ALN A;  1ZRM A;  2YQE A;  4YXJ A;  3TAQ A;  1WWU A;  1ZQU A;  3G6X A;  3CYM A;  4M2Y A;  4FBT A;  3HJE A;  4I2B A;  3RB4 A;  2VA8 A;  2PMZ C;  2P6U A;  2FI1 A;  5KFM A;  4ZH4 A;  4F2S A;  3FC4 A;  2VA3 A;  1N5X A;  2G09 A; 
#chains in the Genus database with same CATH homology
 3VCB A;  4AYB C;  1MA7 A;  2CPR A;  2XIC A;  4OJ6 A;  2R18 A;  2KIW A;  2HBK A;  3N7R C;  4U6P A;  2OYY A;  3C29 A;  3F2B A;  2KD1 A;  2OXO A;  2N1R A;  1ECW A;  2H3F A;  2JH1 A;  3PSI A;  2H3I A;  5A0L A;  2ZIV B;  2WB1 F;  3SAF A;  5T14 A;  2CN1 A;  2KKV A;  4FZL A;  3T79 A;  4WJ3 B;  2E1E A;  2KJ5 A;  4FZM A;  2K4H A;  2E1F A;  2KJ9 A;  4NWI A;  2XI9 A;  1Z19 A;  4NV0 A;  1HEK A;  2HBL A;  2W03 A;  2G5I B;  4OJL A;  4C0Z A;  1PVP A;  1UPH A;  2RP5 A;  2W04 A;  2LHT A;  2Z7J A;  2G5H B;  5CRX A;  4KX5 A;  4BX9 C;  2GOL A;  3PST A;  4GFJ A;  3F2D A;  4U7C A;  2G0A A;  2GH1 A;  2A3V A;  3C28 A;  2HBJ A;  2VIX A;  3AQE A;  4ACO A;  2CRX A;  1ZQ1 C;  1YT3 A;  2H3V A;  2DQN B;  4NLC A;  2DGZ A;  2BDU A;  1SZH A;  4QJF B;  3M7D A;  4QIW C;  2DF4 B;  3ALR A;  2K8B B;  2LYB A;  4BJQ A;  2F2A B;  3NUQ A;  3VC8 A;  2YB1 A;  2KV2 A;  2Q4T A;  1P7D A;  2ZIX A;  2HOI A;  4P0P A;  3ICX A;  2LKY A;  1L6N A;  3ONN A;  3D2S A;  3F5E A;  1D8B A;  2M0N A;  5HR7 A;  2H3Q A;  4ICA A;  4OO1 J;  4OJ5 A;  2KHQ A;  3GZF A;  1HIW A;  4O3M A;  2KIC A;  3F5A A;  2K4E A;  4P0Q A;  2KNJ A;  2MA1 A;  4CGZ A;  4P0P B;  3K1Z A;  3PSP A;  3AQF A;  2WAQ F;  4KX3 A;  2W7P A;  3F2C A;  1Z1B A;  2RHF A;  2E5S A;  3D2N A;  2KOB A;  3OPX A;  2WB1 C;  1PVR A;  2RRD A;  2YB4 A;  3LYS A;  1URJ A;  2JH7 A;  2YX8 A;  3CP8 A;  3CRX A;  1KBU A;  4QNL A;  3H0M B;  4P0Q B;  2KVC A;  1WUD A;  2PMZ F;  2LBO A;  3O0F A;  3PSF A;  5KL8 B;  3E0F A;  3SMV A;  2VJ5 A;  1A6S A;  3KZX A;  2K8A A;  3HKZ F;  1NZB A;  3KFU F;  1CRX A;  2G07 A;  2HBM A;  2Y0S F;  2HOQ A;  3L3F X;  4FE3 A;  3SAH A;  2F8L A;  2MRL A;  1OUQ A;  1Q3V A;  4AYB F;  4IC9 A;  2W7O A;  2LYA A;  2OH2 A;  1TAM A;  2XID A;  2ZIU A;  3M6K A;  3DEE A;  1XO0 A;  2F77 X;  2KHV A;  2KJ8 A;  5C0Y A;  2ZIX B;  2ZG6 A;  2ZIW A;  3H0L B;  1DRG A;  4NLB A;  3H0R B;  3RF9 A;  4PL1 A;  2ZIV A;  2H3Z A;  4OJO A;  2HOF A;  2KKP A;  3GU3 A;  2ZXI A;  5HR6 A;  2K8C B;  4PL2 A;  2VKQ A;  3IG8 A;  3AL0 B;  2ZIU B;  4KMO B;  3RFA A;  1PVQ A;  1IIP A;  4FZN A;  2ZIW B;  3D2Q A;  2JGA A;  2VJ4 A;  3LVW A;  1Q3U A;  1F44 A;  3PZP A;  2WAQ C;  2JMG A;  1ED1 A;  2XVT A;  2ZXH A;  3SQI A;  2HMX A;  1A0P A;  3CYM A;  3NRW A;  3M6Z A;  5KL1 B;  3MGV A;  2F76 X;  1GO3 F;  3IN5 A;  4QIW F;  1T94 A;  4A8E A;  2PMZ C;  3N7S C;  3N7P D;  3IP4 B;  2KEY A;  2K89 A;  3F53 A;  3IG5 A;  3LVV A;  2D6F C;  4CRX A;  2G08 A;  3HKZ C;  2K4I A;  4JMU A;  2JHD A;  4OJP A;  4CDG A;  3SAG A;  1XNS A;  2Y0S C;  4BUG A;  2G06 A;  2G09 A;  2NV3 A;  2OM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...