3HKZC

The x-ray crystal structure of rna polymerase from archaea
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
385
structure length
370
Chain Sequence
PYLEEKVKQASNILPQKIVDDLKNLILNKEIIVTRDEIDKIFDLAIKEYSEGLIAPGEAIGIVAAQSVGEPGTQMTLGLPRLIEIVDAKKVPSTPMMTIYLTDEYKRDRDKALEVARKLEYTKIENVVSSTSIDIASMSIILQLDNEMLKDKGVTVDDVKKAIGRLKLGDFMIEESEDSTLNINFANIDSIAALFKLRDKILNTKIKGIKGIKRAIVQKKGDEYIILTDGSNLSGVLSVKGVDVAKVETNNIREIEEVFGIEAAREIIIREISKVLAEQGLDVDIRHILLIADVMTRTGIVRQIGRHGVTGEKNSVLARAAFEVTVKHLLDAAARGDVEEFKGVVENIIIGHPIKLGTGMVELTMRPILR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 52
structure length 370
sequence length 385
chains with identical sequence M
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.390 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3hkzC02
4AYBC 2WB1C 2PMZC 2Y0SC 3HKZC 4QIWC 2WAQC
chains in the Genus database with same CATH superfamily
2KG5A 1JN3A 1L8LA 4F72A 2AJQA 9ICSA 1JX4A 4NM2A 1IM4A 4EZ9A 3QU9A 1ZQAA 1RPLA 3RH6A 5KT2A 1DGJA 3AL0B 3MR5A 1FFVA 2JH1A 4P0QB 5DG9A 2I5HA 2VIXA 2ZIXA 5J2KA 2Y1JA 4FBTA 4JK1A 3BQ0A 3ORYA 7ICGA 3ZD8A 2YQEA 5AKYA 3PW7A 4DQSA 5AHXA 4ECRA 1BPYA 3CYMA 3FC4A 4QZDA 5J2HA 2G5IB 2ZG6A 2XO7A 2HBLA 1LKYA 3PW2A 2C2RA 4EBDA 4Y2RA 3QYPA 4Y2XA 4ECWA 5KG6A 1WCLA 4F5RA 1S77D 5DB8A 2FPMA 3IM1A 4DQQA 1ZQIA 1QQ6A 3PV8A 8ICMA 3AQEA 8ICZA 4Z6EA 4DWIA 2WF5A 1L3UA 4C8KA 4KITB 3ZDDA 2W9MA 3CW2C 4QIWC 5DQIA 4J9SA 5KFZA 2DF4B 8ICJA 4UAYA 2HI0A 5J8YC 2D8CA 1IG6A 3NASA 2ZUCA 2Z7JA 3KHGA 1TK0A 2G09A 5AKLA 3V7KA 2KVSA 2BHNA 3Q8MA 2RLTA 4BWMA 1NKBA 1CI4A 4RQ2A 1K5OA 3TANA 1U45A 5CWRA 4ED6A 1S76D 4ECQA 1A6SA 4LJXA 2ZJ8A 3HKZC 5IINA 2ASDA 2XIDA 8ICUA 4JV2A 2KJ9A 1NI3A 4IS7A 3FYHA 1WYGA 4I2DA 4QZFA 2C22A 1SV0C 1JMSA 2VKQA 2QB0A 7ICMA 2KHVA 3RAQA 4DL4A 2BPGA 4CE6A 2FMQA 4B6JA 3GIKA 2J6UA 5ALRA 5DLFA 1Q8KA 2KMDA 1XWLA 9ICQA 2R8IA 5ALWA 2P6RA 1Y88A 2AGQA 4F3OA 4RUCA 1ZQKA 1SKWA 4RZRA 1X9SA 4DL6A 5KNIA 3NVZA 2KIVA 3HW8A 1PK1A 2QARB 4I27A 1XSNA 4P0PB 3NS1A 4YCXA 1SL0A 3IDWA 3B0XA 1V9PA 2DL0A 2HOQA 5CR0A 5ALOA 3F2BA 3E58A 4DFPA 2HW3A 2JEGA 3PR5B 3NVVA 3H4BA 3BS5A 2H3QA 3RJGA 5HHIA 2BQRA 3RAXA 5AKKA 4DL2A 5JRTA 3ISCA 5FP0A 4I2FA 4Q45A 4FE3A 4EYHB 4Q8EA 3UPQA 3H8JA 3QZ8A 1UHUA 2K89A 1Z19A 5HR7A 5TISU 4QWDA 1DGSA 3KFUF 2XGQA 5ALNA 4C7ZA 2K60A 3SYZA 4JV1A 5J0XA 4MFCA 1N60A 1DRGA 3KOOA 4C8LA 5JUMA 5D49A 2OXOA 2WF6A 4EELA 2CXYA 1H38A 2EAOA 3AMZA 1D8YA 2KVCA 4B9SA 5L1KA 3ZDEA 2ISOA 2PI5A 1QQ5A 4PL1A 4RQ8A 3PW4A 4O3MA 4CCHA 3V7JA 1ZOLA 4DFDA 1PVPA 5HR6A 1WWUA 4C8OA 4UB4A 2K4HA 3V6HA 1ZRMA 1ZQDA 4DL5A 1PVQA 2WF7A 3RH5A 4RQ4A 4FZLA 2KZZA 1RQNA 3D2SA 4YR2A 4QW8A 1ZXIA 2E8NA 1JUDA 8ICCA 2FPLA 2Y1IA 3JPPA 5KFTA 5KFQA 3I1YA 3EPIA 4EENA 4RQ0A 9ICEA 3MDAA 3RB6A 1SL1A 3H7IA 2P66A 4E0DA 5DB6A 1QSYA 3WK4A 5B66U 4QNLA 3F2CA 2BPFA 1T7PA 2B0CA 3UMBA 5AKGA 4X5VA 4PGXA 2LMRA 2A19A 2WF9A 2JRZA 5KFDA 5KFFA 4ED8A 4EX6A 5CJ7A 8ICAA 3ICXA 4TUPA 4F5PA 2AU0A 2W3RA 1COOA 1XSPA 5EWFA 5KFRA 3C23A 4MF2A 2F1JA 3H0MB 2WFAA 2W7PA 3F2DA 5AKEA 2FI1A 4I2GA 2JEFA 2KTQA 1ZD3A 2MUTA 2OHFA 2Q0ZX 5G5HA 2F44A 1RG6A 4TURA 3RTVA 2EANA 1X40A 5J0UA 4P4PA 4M6WA 4OCZA 8ICQA 2KICA 2HHVA 2V9WA 2ODGA 4M9HA 1X42A 2K8CB 2BKEA 4JMUA 3WK5A 5ALMA 2WTFA 4ED2A 3WKBA 5CEHA 1ZQJA 4R66A 1RXWA 1N2XA 3TADC 1NK5A 3MABA 4R8UA 2XGPA 4YMNA 3H0RB 4MFFA 3EWAA 1B22A 9ICUA 3JPSA 1X2IA 9ICKA 1MQ2A 4Z6DA 4IRCA 1T4GA 4PZOA 1ZQ1C 1SV4A 5KFUA 4P4OA 4XUSA 4NM1A 2W7OA 9ICOA 1OXJA 3FDSA 3E2EA 3UMCA 1OW5A 1Z1VA 1J2NA 4F4XA 2KKPA 3ISDA 2JR5A 3MR6A 3JPOA 1JROA 3N7RC 2R8JA 4O3NA 2EQYA 5ALKA 5AM5A 4DSLA 1X6JA 4YMOA 4J03A 3WKCA 1RM6C 4I2HA 4EX7A 7ICKA 5J2GA 1S97A 4NLNA 1PVRA 1CUKA 4OJ6A 5KG4A 3Q8KA 5HMMA 3C5FA 2PFNA 2R8GA 5DG7A 5BOMA 3SAFA 3BQ1A 4RQNA 3SAGA 3OSNA 3PNCA 2GH1A 1ZQRA 2ZXIA 5J2IA 4DQRA 3UXOA 8ICHA 2JZBA 2IOFA 3PO5A 5AIAA 2AQ4A 4PGQA 3QNMA 4Z6CA 4U6PA 3GILA 2LHTA 4UAUA 4WJ3B 3SZ2A 2F77X 1ZQYA 1J2MA 5L1MA 2FMSA 2OCEA 5KFJA 4ED7A 3D2NA 4ELTA 5AI8A 4YMMA 5L1IA 2HHWA 4OO1J 3C2KA 5KFPA 2E1FA 4RU9A 4NLCA 2E5SA 1MC8A 5KFYA 4BWJA 4QIWF 2PFQA 5KFIA 3PZPA 3PSFA 4QZHA 5AKJA 1SKSA 2BDUA 3NGDA 3SD7A 4KN4A 2PXIA 2MAXA 4C8NA 5DQGA 4UB3A 3MFIA 3NVWA 2F2AB 5DGAA 2ATLA 1BNOA 1RXVA 3D2QA 2JEJA 1D9FA 4ZH4A 4NXZA 4Y2TA 3MGHA 3E0FA 4KLFA 2KSOB 3V72A 2ZIVB 3HKZF 4DSKA 1QSSA 2ZJAA 2YY6A 3L5KA 2ZIWA 2KZ3A 5F9NA 9ICNA 4US9A 5KAIU 2DPIA 1L7PA 4Y2SA 4KLGA 1UA0A 8ICRA 1X9WA 4QWBA 2YB4A 1S0MA 4UB6U 5AI9A 5AM3A 3IN5A 1BPEA 3UM9A 3QXGA 2FMPA 1M6YA 5AK6A 4ECTA 1D9DA 1U4BA 1QLNA 5IIIA 3QU2A 2E8PA 4UAVA 1SWVA 3DDHA 4KLDA 4UASA 3IP4B 2Y9TA 3KHLA 5E79U 2DWQA 1T94A 5DBCA 3GV5B 4DFMA 2P35A 4FFDA 4DS4A 3AQFA 3M9NB 2AGOA 5A0LA 3LK9A 9ICFA 4NLZA 5DG8A 1L5UA 2PFPA 4R63A 1NK4A 2IMWP 2W9BB 7ICHA 1BGXT 5KFVA 4RT3A 3PMNA 8ICIA 2CPRA 3TAQA 9ICRA 5KFAA 3TAPA 4UQGA 3MDCA 5J2CA 3T5HA 1SV0A 3ETLA 4C0ZA 3Q8SB 1CRXA 2ZIXB 4RT2A 4EZ6A 9ICWA 4Y2UA 2W9AA 4DF4A 2W03A 1K1QA 2RRDA 1T8EA 4RQ6A 2XY6A 2ZXHA 2K4PA 5F9LA 2ZTDA 5ALYA 4GIBA 4F91B 1T3NA 7ICTA 2H3IA 5AI0A 1IV8A 4US8A 4ECSA 5DDYA 5IILA 5AK3A 1U9LA 5AI4A 3LVVA 3EW9A 4F4KA 4F71A 4Z6FA 4IQUA 4YR3A 2DPJA 3K75D 2HHQA 3VC8A 4FZMA 1Q3VA 2GO7A 1NK0A 2IOHA 4C4RA 5DGBA 3FM9A 4PZNA 1P7DA 4QZBA 7ICUA 4DL3A 1L3VA 3QE9Y 1EXNA 1TAMA 2EZXA 1SWWA 1XC9A 3GQCA 9ICIA 1MN8A 5KT4A 3LWLA 4C80A 2EAPA 2F1HA 4TQRA 4XQ8A 2EH9A 2O6KA 1TK8A 3NRZA 5C5JA 4I2EA 3PX0A 1ZQWA 3EUB2 2KOBA 3HRDD 5F3XB 1SIJA 2RDIA 3JPRA 4RNOA 2HSZA 5DBAA 3H8SA 1Z4OA 1FIQA 4GLXA 2H3FA 1RDFA 4UAWA 1N48A 4FBUA 2PFOA 5EWEA 4BXOA 3BZKA 2DBYA 4EBEA 1Z00B 5AM4A 3RJHA 3HWTA 1L7MA 4AYBC 2J6TA 4YVZA 4M0AA 2RP5A 1ZQXA 2XCPA 1DK3A 1S8OA 2W04A 1LVHA 1X9XA 5J2FA 1RQLA 2HBMA 1JXLA 1PK1B 4OJ5A 3WK9A 4C7YA 3N4MB 4DF8A 1S0NA 5J0PA 4DLGA 4F2RA 3GIIA 5DB9A 4J9MA 3NRWA 4G3IA 3RRGA 3IHQB 4RNNA 3PR4A 1YZ7A 1SZHA 3KHRA 2V4QA 5KT5A 3CNHA 2IHNA 5KFMA 2LM1A 1Z4NA 4DCCA 2E8OA 1UT5A 4DFKA 4TUQA 1WG8A 4ECZA 4QW9A 3ISBA 1SKRA 2A1AA 1KRPA 3KD3A 2LKYA 5KFWA 3SV3A 3THVA 5ALDA 2H3ZA 1GO3F 1ZQMA 3WKDA 2BZFA 2JMGA 1ZD4A 4JV0A 5IIOA 4ZOHC 4TUSA 4KLUA 4PH5A 2F8KA 8ICFA 2F8LA 1LV5A 4DQIA 1U49A 2C28A 3AN1A 4ED1A 4IRKA 1NJWA 2BR0A 1ZRNA 4YD1A 3M8SA 4R65A 1K1SA 3QUTA 2FJ6A 2VJ4A 2ALZA 1DK2A 4KTQA 1V85A 1PZNA 5DQHA 4FS2A 3PVXA 4PPXA 3JPNA 1SXEA 1NJZA 2QKQA 4DQPA 2K4EA 4MEXA 1WUDA 4P0PA 2NRXA 4RPZA 1HEKA 2YB1A 3BDPA 2GOLA 2A1JB 3A0BU 5B5EU 2RDJA 4FO6A 3PX4A 2ZIUB 9ICJA 5L1JA 4YQWA 4O3SA 1RYUA 3C2MA 3LVWA 4JUZA 4QJFB 4UB5A 1V38A 4MEYA 4F4WA 3TADA 4ELVA 5DDMA 4QWCA 4NY8A 3GZFA 2LYAA 5J2DA 3PW5A 5EE0A 1ZD5A 1IXRA 2I1QA 2UVRA 2KHQA 5KL1B 3UXNA 4O3PA 5D46A 7ICQA 3BQ2A 9ICLA 3ALRA 1ZQBA 5KL8B 1XSLA 2YMMA 1TE2A 8ICXA 5AKXA 2LI6A 1ZYQA 4UB1A 4J9NA 4KX5A 1RYSA 5KFCA 3PX6A 4DS5A 5AK5A 1QCKA 4F5OA 3M6ZA 5ALLA 3OSPA 4U7CA 4J9OA 2HOIA 4Y2JA 3F53A 2KN7A 2WAQC 5ALXA 3Q8RB 4ECXA 4OD0A 7ICNA 1U48A 1MA7A 2OH2A 1ZQPA 1V97A 9ICTA 2VANA 4FZNA 4CF5A 1B0XA 1FO4A 5JU5A 4UBBA 2BCUA 1PK3A 3TI0A 3R9KA 1TK5A 4AP9A 1NK9A 2BCRA 5J0QA 2DKZA 1F5SA 2HDOA 2E3TA 1ZJMA 3SMVA 3OJUA 4F92B 1SXDA 2DQNB 1KSPA 1A0PA 3ETRA 3LYSA 1C20A 8ICOA 4KX3A 4F4YA 1Q46A 2KEYA 2JEIA 4IQVA 5KFOA 8ICSA 1L6NA 2QB1A 2N1RA 3WKEA 1BPDA 2VJ5A 3FAHA 3ONNA 4F2SA 8ICVA 2BCVA 5ALGA 3HX0A 3RJKA 2W54A 8ICNA 2XVTA 5KG0A 4PHPA 4F5QA 4FS1A 3RH4A 3RJEA 4DEZA 4QZ9A 5KFLA 3SAHA 1BPBA 9ICHA 2BPCA 2MA1A 3OHBA 3B9JA 2G5HB 2OYYA 4C4SA 3TFRA 1HIWA 2JH7A 2FLLA 3V7LA 1BVSA 2KD1A 5DBBA 4KLOA 5KAFU 3BQ7A 5KFKA 9ICPA 3T5LA 4RQ3A 2AGPA 4ACOA 3N97B 1QTMA 4GC7A 2PKEA 1N63A 4EBCA 4ED0A 4I29A 4PJ0U 1COKA 1NKCA 1XNSA 5J0RA 4KLEA 5J2EA 4HAIA 2C2EA 5KFXA 3T5KA 8ICKA 1TFRA 4Q8FA 4DSIA 3BJYA 1F44A 3TACB 4F93B 4UATA 3JPQA 4O5EA 4ED3A 4GFJA 2XICA 4ICAA 4DSJA 1ZQQA 4I2BA 3M9OB 3C29A 8ICEA 5DKWA 3QZ7A 3QU4A 2FLPA 2FDRA 7ICJA 9ICCA 3RB0A 1WWVA 4RQ1A 2GWSA 4GXJA 7ICIA 8ICLA 2AXTU 2XY7A 1ZJNA 4I2IA 3QUCA 4DFJA 4EEKA 3G6YA 2IBKA 3AUOA 3ZDCA 1KL9A 4BUGA 2VA8A 4K4IA 3PW0A 2FPKA 5CA7A 1FFUA 3M6KA 3OPXA 1URJA 2PMZC 2ZIWB 2ZJ5A 1ZQEA 4MFAA 4IQWA 5AI6A 3LWMA 5EWGA 2W8KA 1SGGA 3SQIA 2HOFA 4RUAA 3H8MA 1MSWD 1NOMA 5EE1A 3PMLA 4RNMA 1ZQGA 5IIMA 4OJOA 3BQTA 5KFGA 3N7PD 1S9FA 4M04A 4AYBF 3C2LA 7ICFA 2UVWA 4Y2YA 1Z1BA 4DL7A 5ALQA 3T5JA 1KLNA 2AHOB 4O3QA 5TZVA 3MR3A 3UXPA 2K8BB 4B9TA 3MR2A 2EDUA 4PL2A 2W9CB 5EE9A 1B43A 4GC6A 5KFHA 2YMQA 1KN5A 2IHMA 1ZQTA 5CP2A 1YT3A 4YP3A 4EYIB 5J29A 4LVSA 3UQ2A 2K4IA 4I28A 2ZTEA 2E8MA 2DUYA 5KT6A 4NJ8A 3RR7A 1L8OA 2VA2A 9ICXA 8ICWA 3PSTA 4PHEA 2KSOA 1KFSA 1L7NA 2ZIVA 2D3DA 4NLBA 1KTQA 3Q8LA 3C28A 4KN7A 1YZ6A 1KFTA 3DEEA 5ALHA 3L3FX 2F76X 5CRXA 2XI9A 3VCBA 4BX9C 2Y0SC 2M9NA 5GTIU 3OGUA 2AQ0A 3GIMA 2RQ5A 3BZCA 8ICGA 1ZQOA 1LKYB 4BDPA 3B0YA 9ICMA 1KEJA 1LB2B 1RZTA 4O3OA 2VA3A 3GFKB 2KJ8A 3QU5A 1S0OA 2K8AA 5CB1A 4QWAA 2BQ3A 3QU7A 3NUQA 2F1IA 3GIJA 4C8MA 2W9BA 4ECUA 5AKZA 1SL2A 2CN1A 4TQSA 4A8EA 4B9VA 3JPTA 3ZDAA 4F8RA 3AM9A 1TAUA 4MF8A 5AM0A 1JRPA 1UQVA 2EZYA 3SENA 3G6XA 1JI7A 1D8LA 4YXMA 5ALUA 2R18A 5AI5A 3S6JA 4BXOB 3H40A 4KLHA 3MGIA 4K4HA 3RRHA 3L4PA 2RHFA 3U26A 4YG2A 5KG7A 3ZI4A 1SZPA 3K4GA 1FEZA 1ZQVA 1L7OA 4P0QA 3HT3A 1DXSA 2G08A 2AH5A 2QB0B 1UT8A 4EEYA 5AICA 4NLGA 3F5EA 1X66A 4XA5A 4IL6U 1JALA 5KG3A 3RFAA 4KLMA 1XO1A 4PHAA 1ZETA 4CF3A 1N5XA 2LPEA 5ALPA 1TKDA 3D6JA 4O9MA 5ALZA 4CDGA 3GV8B 4KLJA 3KKAC 4UAZA 1PUZA 2W55A 2NRVA 4UW9A 2L5YA 3GU3A 4RPXA 4IQTA 5KT7A 4OJPA 3OJSA 2MSNA 1MQ3A 4I2AA 3TARA 4P2HA 5KFNA 1KFDA 1KDHA 2WAQF 1U47A 2HHTA 3KTQA 2LM4A 2WB1C 5KFSA 3LDAA 3SR6A 4I2CA 3PSPA 5ALSA 5EOZA 2BCSA 4F5NA 9ICVA 1ZD2P 1NKEA 3BS5B 2I6XA 5D4BA 2HMXA 2KKVA 2YMLA 5KTQA 4YD2A 1Z00A 2HHXA 3RB4A 5L9XA 2Q4TA 2DKXA 2NRTA 1T3QA 4GXIA 5CHGA 1F0MA 1CEZA 4QZGA 4Y2QA 1NJXA 4M9NA 2HVHA 2LYBA 8ICPA 1S0VA 4B9MA 4KLTA 7ICRA 3RB3A 3V6JA 2WHEA 4B9LA 4QZCA 3WK8A 1KW4A 1KKXA 1ZQZA 4DSFA 2KJ5A 4O5KA 3TFSA 3N28A 2R8HA 4NWIA 4UBCA 1Q3UA 1ED1A 4J9PA 3MFHA 1N56A 3KZIU 2XY5A 4KLSA 5L1LA 5C0YA 4BJQA 1RYRA 3PO4A 5J0OA 3OHAA 1XU4A 4ECVA 5HMLA 4UB2A 4Q44A 1KQQA 3HILA 3IV6A 3A0HU 1L3SA 1NZPA 4USAA 7ICPA 2QARA 1B4FA 3Q8QB 2W11A 2NO5A 3N7SC 1OUQA 2CRXA 3HP6A 2OWOA 2HBJA 2BDPA 3PSIA 3PY8A 1N61A 3NVYA 5J0YA 3I76A 4NV0A 4BGDA 1J97A 4M2YA 3M1YA 3HPOA 7ICOA 2LBOA 2IOFK 4RPYA 7ICSA 5J0SA 3H4DA 2ESEA 5AK4A 2W8LA 4UB8U 5J0TA 2ASJA 3EZ5A 3MGVA 3QEBZ 4R64A 3SEIA 5ALFA 5IIJA 7ICVA 3TQ1A 2B21A 4RQ5A 4Q43A 1JIHA 3SV4A 2OEHA 5J2AA 1VDVA 5KG5A 2A1JA 3CP8A 1NNLA 5J0WA 4CRXA 2ZIUA 2H3VA 5ALJA 1HJPA 1ZQCA 4QZEA 5H2FU 2QLTA 4GXKA 3RBDA 5DB7A 5T14A 4YFKA 1ZQHA 4M9JA 1TAQA 4G9BA 5AKHA 2ISPA 2W43A 1BPZA 2MUTB 2MU2A 9ICAA 4RQMA 2ES6A 3GV7B 2MRLA 1DOQA 3TKAA 5DLGA 3RF9A 3T79A 3NTUA 1X9MA 3WK6A 4M6WB 8ICYA 4O3RA 2NYVA 5IIKA 1C7YA 1UA1A 2KP7A 1O08A 2BCQA 5ALEA 2NO4A 2V4RA 2ASLA 2PMZF 2H5XA 2XC9A 1ZQNA 3O0FA 3UQ0A 5BOLA 1TV9A 4DOBA 1XS9D 3K1ZA 1S10A 1HUZA 4R8UB 4HYKA 2G06A 3ED5A 1Z3EB 1S5LU 1TVAA 4MHVA 2JV3A 4NL9A 4ECYA 3CRXA 2HBKA 1NK6A 5G5GA 3M8RA 2OM6A 2G0AA 4QWEA 2D6FC 7ICLA 3GDXA 3AU6A 3T3FA 3ZDBA 4Y2VA 4IC9A 1A76A 2YMPA 3AEVA 4Y2PA 2E1EA 4DOCA 1D8BA 1O03A 2P6UA 1N62A 1X6IA 2KZMA 4KLLA 5J2BA 2B6GA 4B9NA 1WCNA 2M0NA 4IRDA 5KFEA 1AROP 3MC1A 4PHDA 2HHSA 4C4TA 2WF8A 2NRZA 5AKIA 3OTQA 5ALIA 5KG2A 4DO9A 2ZUBA 1BNPA 4LZDA 4M9LA 5AIBA 2KNJA 2HCFA 2JZBB 5HHHA 1VJ5A 4KLIA 8ICBA 1A77A 2BQUA 2LYHA 4XRHA 4J9RA 2Y0SF 4J9QA 9ICBA 4IR1A 3UMGA 2EAMA 4JWMA 2KIWA 1ZQFA 2YX8A 4JB3A 2NRWA 4LZGA 1ZQLA 3RJJA 1XO0A 4F4ZA 4J9LA 2PI4A 5ALVA 3MBYA 3C1ZA 3C5GA 1L3TA 4I2JA 1IIPA 1VLBA 8ICTA 5HNKA 3J81j 5AM2A 5KG1A 2JGAA 1NK7A 2KV2A 4NL9C 4JWNA 4DOAA 3DV9A 4O0IA 2DGZA 3EYZA 4KMOB 2KFNA 1SB3C 4YN4A 4KLQA 4J9KA 1UPHA 1JXEA 3KBBA 2YTUA 2JXJA 4CNQA 2JHDA 4O5CA 9ICGA 3BS7A 2KFZA 2Y9UA 3C21A 2ZUDA 2HVIA 3IG5A 5ALTA 1QSLA 1AQ6A 2UVUA 4CF4A 3QUQA 1N5WA 3M9MB 4PGYA 2UVVA 2NV3A 3K1RB 2C2DA 4CGZA 3QEAZ 5AM1A 5EE3A 3H8WA 3WKAA 3IG8A 4DSEA 1ZQUA 4YR0A 1QH9A 4YXJA 3IRUA 4OJLA 2EZZA 3KHHA 3RBEA 5KT3A 4RQ7A 1QQ7A 3EPGA 2XCAA 1BPXA 4NLKA 3F5AA 7ICEA 1ZQSA 2FE9A 5JTIA 5BPCA 1NK8A 2A3VA 2KK0A 4M47A 2IA6A 1NJYA 3WU2U 2W3SA 4QZIA 5K4LA 4B9UA 3G6VA 4QZAA 4IR9A 5KFBA 2WB1F 3Q8PB 4ELUA 3C1YA 3KZXA 1UCVA 2J6SA 3I28A 2R8KA 4UARA 5J8YA 4M9GA 4QZ8A 2HHUA 4KMUA 3M7DA 3QX7A 1HUOA 3RJFA 3RR8A 2ZTCA 3RJIA 3QUBA 2FLNA 3HJEA 2GLEA 3KKAA 4DLEA 3H0LB 3AU2A 4F50A 2G07A 1ECWA 1NZBA 3SI8A 5HP4A 2DFLA 5GTHU 3V6KA 3WK7A 5J2JA 2YN4A 2I9GA 4K4GA 2BGWA 2F3NA 4P4MA 2KE7A 3ZD9A 1KBUA 2W9CA
chains in the Genus database with same CATH topology
2F8LA 2KOBA 1MA7A 1T94A 4AYBF 2VKQA 2OH2A 2NV3A 3AQFA 4PL1A 4FZNA 4O3MA 3CP8A 5A0LA 2KHVA 2LYBA 2ZIUA 4CRXA 2M0NA 1Z1BA 2H3VA 2R18A 2KICA 4U6PA 2LHTA 1PVPA 4CGZA 4WJ3B 5HR6A 2VJ4A 2H3FA 5T14A 2K8BB 2CPRA 3AL0B 2F77X 2KJ5A 3IG8A 2RHFA 2K8CB 4JMUA 1F44A 4PL2A 4NWIA 2K4HA 2JH1A 4C0ZA 1Q3UA 1PVQA 1CRXA 4P0QB 1ED1A 2K4EA 3SMVA 2ZIXB 1WUDA 2DQNB 3D2NA 2MRLA 4OJLA 4P0PA 4GFJA 4P0QA 1A0PA 2W03A 2XICA 3RF9A 2VIXA 4FZLA 2ZIXA 4ICAA 1HEKA 2RRDA 2YB1A 2KNJA 2G08A 2GOLA 2RP5A 4BJQA 3N7PD 3T79A 3D2SA 2ZXHA 2ZIUB 4OO1J 1YT3A 3LYSA 3C29A 3F5EA 2K4IA 2E1FA 2W04A 4KX3A 4NLCA 2Y0SF 3CYMA 3RFAA 2E5SA 2KEYA 3F5AA 2H3IA 1L6NA 4QIWF 2A3VA 2N1RA 2HBMA 3PZPA 3PSFA 2VJ5A 3H0RB 2G5IB 3ONNA 4OJ5A 2ZG6A 3PSTA 2BDUA 2HBLA 2KIWA 3LVWA 2YX8A 2ZIVA 4AYBC 4P0PB 4NLBA 4QJFB 2PMZF 1ZQ1C 3O0FA 3C28A 4CDGA 2W7OA 3AQEA 2WB1F 3DEEA 3L3FX 4QNLA 2F76X 2XVTA 3LVVA 3F2CA 1XO0A 5CRXA 2F2AB 2XI9A 3GZFA 3KZXA 3N7SC 3NRWA 2LYAA 1OUQA 2CRXA 3VCBA 3K1ZA 2HOQA 2HBJA 2KKPA 2Y0SC 3D2QA 4BX9C 3GU3A 4BUGA 5C0YA 1SZHA 2G06A 3PSIA 3F2BA 4QIWC 3M7DA 2KHQA 5KL1B 3N7RC 3SAHA 4OJPA 3VC8A 2DF4B 2H3QA 3E0FA 4FZMA 1Q3VA 1IIPA 3ALRA 2MA1A 2ZIVB 3HKZF 3M6KA 3OPXA 2WAQF 4NV0A 3CRXA 2HBKA 1URJA 2PMZC 3H0LB 2ZIWB 1P7DA 2JGAA 2G5HB 2OYYA 4FE3A 1HIWA 2KV2A 5KL8B 3ICXA 2Z7JA 2ZIWA 1XNSA 2G09A 2DGZA 2G07A 1ECWA 2JH7A 2WB1C 1NZBA 4KMOB 2KD1A 3PSPA 2KJ8A 2K89A 4KX5A 1TAMA 1Z19A 2K8AA 2LBOA 5HR7A 1UPHA 2YB4A 2OM6A 2LKYA 2G0AA 1PVRA 3NUQA 3M6ZA 4OJ6A 3KFUF 4ACOA 3H0MB 3SQIA 2HOFA 2JHDA 3IN5A 1A6SA 2H3ZA 4U7CA 2W7PA 2D6FC 1GO3F 3F2DA 2HOIA 3F53A 3MGVA 3HKZC 2CN1A 2WAQC 1KBUA 2HMXA 2KKVA 3SAFA 1DRGA 2JMGA 3IG5A 4A8EA 4IC9A 4OJOA 2Q4TA 2XIDA 2OXOA 3IP4B 3SAGA 2E1EA 2KJ9A 1D8BA 2GH1A 2KVCA 2ZXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB C;  2WB1 C;  2PMZ C;  2Y0S C;  3HKZ C;  4QIW C;  2WAQ C; 
#chains in the Genus database with same CATH topology
 2KG5 A;  1JN3 A;  1L8L A;  4F72 A;  2AJQ A;  9ICS A;  1JX4 A;  4NM2 A;  1IM4 A;  4EZ9 A;  3QU9 A;  1ZQA A;  1RPL A;  3RH6 A;  5KT2 A;  1DGJ A;  3AL0 B;  3MR5 A;  1FFV A;  2JH1 A;  4P0Q B;  5DG9 A;  2I5H A;  2VIX A;  2ZIX A;  5J2K A;  2Y1J A;  4FBT A;  4JK1 A;  3BQ0 A;  3ORY A;  7ICG A;  3ZD8 A;  2YQE A;  5AKY A;  3PW7 A;  4DQS A;  5AHX A;  4ECR A;  1BPY A;  3CYM A;  3FC4 A;  4QZD A;  5J2H A;  2G5I B;  2ZG6 A;  2XO7 A;  2HBL A;  1LKY A;  3PW2 A;  2C2R A;  4EBD A;  4Y2R A;  3QYP A;  4Y2X A;  4ECW A;  5KG6 A;  1WCL A;  4F5R A;  1S77 D;  5DB8 A;  2FPM A;  3IM1 A;  4DQQ A;  1ZQI A;  1QQ6 A;  3PV8 A;  8ICM A;  3AQE A;  8ICZ A;  4Z6E A;  4DWI A;  2WF5 A;  1L3U A;  4C8K A;  4KIT B;  3ZDD A;  2W9M A;  3CW2 C;  4QIW C;  5DQI A;  4J9S A;  5KFZ A;  2DF4 B;  8ICJ A;  4UAY A;  2HI0 A;  5J8Y C;  2D8C A;  1IG6 A;  3NAS A;  2ZUC A;  2Z7J A;  3KHG A;  1TK0 A;  2G09 A;  5AKL A;  3V7K A;  2KVS A;  2BHN A;  3Q8M A;  2RLT A;  4BWM A;  1NKB A;  1CI4 A;  4RQ2 A;  1K5O A;  3TAN A;  1U45 A;  5CWR A;  4ED6 A;  1S76 D;  4ECQ A;  1A6S A;  4LJX A;  2ZJ8 A;  3HKZ C;  5IIN A;  2ASD A;  2XID A;  8ICU A;  4JV2 A;  2KJ9 A;  1NI3 A;  4IS7 A;  3FYH A;  1WYG A;  4I2D A;  4QZF A;  2C22 A;  1SV0 C;  1JMS A;  2VKQ A;  2QB0 A;  7ICM A;  2KHV A;  3RAQ A;  4DL4 A;  2BPG A;  4CE6 A;  2FMQ A;  4B6J A;  3GIK A;  2J6U A;  5ALR A;  5DLF A;  1Q8K A;  2KMD A;  1XWL A;  9ICQ A;  2R8I A;  5ALW A;  2P6R A;  1Y88 A;  2AGQ A;  4F3O A;  4RUC A;  1ZQK A;  1SKW A;  4RZR A;  1X9S A;  4DL6 A;  5KNI A;  3NVZ A;  2KIV A;  3HW8 A;  1PK1 A;  2QAR B;  4I27 A;  1XSN A;  4P0P B;  3NS1 A;  4YCX A;  1SL0 A;  3IDW A;  3B0X A;  1V9P A;  2DL0 A;  2HOQ A;  5CR0 A;  5ALO A;  3F2B A;  3E58 A;  4DFP A;  2HW3 A;  2JEG A;  3PR5 B;  3NVV A;  3H4B A;  3BS5 A;  2H3Q A;  3RJG A;  5HHI A;  2BQR A;  3RAX A;  5AKK A;  4DL2 A;  5JRT A;  3ISC A;  5FP0 A;  4I2F A;  4Q45 A;  4FE3 A;  4EYH B;  4Q8E A;  3UPQ A;  3H8J A;  3QZ8 A;  1UHU A;  2K89 A;  1Z19 A;  5HR7 A;  5TIS U;  4QWD A;  1DGS A;  3KFU F;  2XGQ A;  5ALN A;  4C7Z A;  2K60 A;  3SYZ A;  4JV1 A;  5J0X A;  4MFC A;  1N60 A;  1DRG A;  3KOO A;  4C8L A;  5JUM A;  5D49 A;  2OXO A;  2WF6 A;  4EEL A;  2CXY A;  1H38 A;  2EAO A;  3AMZ A;  1D8Y A;  2KVC A;  4B9S A;  5L1K A;  3ZDE A;  2ISO A;  2PI5 A;  1QQ5 A;  4PL1 A;  4RQ8 A;  3PW4 A;  4O3M A;  4CCH A;  3V7J A;  1ZOL A;  4DFD A;  1PVP A;  5HR6 A;  1WWU A;  4C8O A;  4UB4 A;  2K4H A;  3V6H A;  1ZRM A;  1ZQD A;  4DL5 A;  1PVQ A;  2WF7 A;  3RH5 A;  4RQ4 A;  4FZL A;  2KZZ A;  1RQN A;  3D2S A;  4YR2 A;  4QW8 A;  1ZXI A;  2E8N A;  1JUD A;  8ICC A;  2FPL A;  2Y1I A;  3JPP A;  5KFT A;  5KFQ A;  3I1Y A;  3EPI A;  4EEN A;  4RQ0 A;  9ICE A;  3MDA A;  3RB6 A;  1SL1 A;  3H7I A;  2P66 A;  4E0D A;  5DB6 A;  1QSY A;  3WK4 A;  5B66 U;  4QNL A;  3F2C A;  2BPF A;  1T7P A;  2B0C A;  3UMB A;  5AKG A;  4X5V A;  4PGX A;  2LMR A;  2A19 A;  2WF9 A;  2JRZ A;  5KFD A;  5KFF A;  4ED8 A;  4EX6 A;  5CJ7 A;  8ICA A;  3ICX A;  4TUP A;  4F5P A;  2AU0 A;  2W3R A;  1COO A;  1XSP A;  5EWF A;  5KFR A;  3C23 A;  4MF2 A;  2F1J A;  3H0M B;  2WFA A;  2W7P A;  3F2D A;  5AKE A;  2FI1 A;  4I2G A;  2JEF A;  2KTQ A;  1ZD3 A;  2MUT A;  2OHF A;  2Q0Z X;  5G5H A;  2F44 A;  1RG6 A;  4TUR A;  3RTV A;  2EAN A;  1X40 A;  5J0U A;  4P4P A;  4M6W A;  4OCZ A;  8ICQ A;  2KIC A;  2HHV A;  2V9W A;  2ODG A;  4M9H A;  1X42 A;  2K8C B;  2BKE A;  4JMU A;  3WK5 A;  5ALM A;  2WTF A;  4ED2 A;  3WKB A;  5CEH A;  1ZQJ A;  4R66 A;  1RXW A;  1N2X A;  3TAD C;  1NK5 A;  3MAB A;  4R8U A;  2XGP A;  4YMN A;  3H0R B;  4MFF A;  3EWA A;  1B22 A;  9ICU A;  3JPS A;  1X2I A;  9ICK A;  1MQ2 A;  4Z6D A;  4IRC A;  1T4G A;  4PZO A;  1ZQ1 C;  1SV4 A;  5KFU A;  4P4O A;  4XUS A;  4NM1 A;  2W7O A;  9ICO A;  1OXJ A;  3FDS A;  3E2E A;  3UMC A;  1OW5 A;  1Z1V A;  1J2N A;  4F4X A;  2KKP A;  3ISD A;  2JR5 A;  3MR6 A;  3JPO A;  1JRO A;  3N7R C;  2R8J A;  4O3N A;  2EQY A;  5ALK A;  5AM5 A;  4DSL A;  1X6J A;  4YMO A;  4J03 A;  3WKC A;  1RM6 C;  4I2H A;  4EX7 A;  7ICK A;  5J2G A;  1S97 A;  4NLN A;  1PVR A;  1CUK A;  4OJ6 A;  5KG4 A;  3Q8K A;  5HMM A;  3C5F A;  2PFN A;  2R8G A;  5DG7 A;  5BOM A;  3SAF A;  3BQ1 A;  4RQN A;  3SAG A;  3OSN A;  3PNC A;  2GH1 A;  1ZQR A;  2ZXI A;  5J2I A;  4DQR A;  3UXO A;  8ICH A;  2JZB A;  2IOF A;  3PO5 A;  5AIA A;  2AQ4 A;  4PGQ A;  3QNM A;  4Z6C A;  4U6P A;  3GIL A;  2LHT A;  4UAU A;  4WJ3 B;  3SZ2 A;  2F77 X;  1ZQY A;  1J2M A;  5L1M A;  2FMS A;  2OCE A;  5KFJ A;  4ED7 A;  3D2N A;  4ELT A;  5AI8 A;  4YMM A;  5L1I A;  2HHW A;  4OO1 J;  3C2K A;  5KFP A;  2E1F A;  4RU9 A;  4NLC A;  2E5S A;  1MC8 A;  5KFY A;  4BWJ A;  4QIW F;  2PFQ A;  5KFI A;  3PZP A;  3PSF A;  4QZH A;  5AKJ A;  1SKS A;  2BDU A;  3NGD A;  3SD7 A;  4KN4 A;  2PXI A;  2MAX A;  4C8N A;  5DQG A;  4UB3 A;  3MFI A;  3NVW A;  2F2A B;  5DGA A;  2ATL A;  1BNO A;  1RXV A;  3D2Q A;  2JEJ A;  1D9F A;  4ZH4 A;  4NXZ A;  4Y2T A;  3MGH A;  3E0F A;  4KLF A;  2KSO B;  3V72 A;  2ZIV B;  3HKZ F;  4DSK A;  1QSS A;  2ZJA A;  2YY6 A;  3L5K A;  2ZIW A;  2KZ3 A;  5F9N A;  9ICN A;  4US9 A;  5KAI U;  2DPI A;  1L7P A;  4Y2S A;  4KLG A;  1UA0 A;  8ICR A;  1X9W A;  4QWB A;  2YB4 A;  1S0M A;  4UB6 U;  5AI9 A;  5AM3 A;  3IN5 A;  1BPE A;  3UM9 A;  3QXG A;  2FMP A;  1M6Y A;  5AK6 A;  4ECT A;  1D9D A;  1U4B A;  1QLN A;  5III A;  3QU2 A;  2E8P A;  4UAV A;  1SWV A;  3DDH A;  4KLD A;  4UAS A;  3IP4 B;  2Y9T A;  3KHL A;  5E79 U;  2DWQ A;  1T94 A;  5DBC A;  3GV5 B;  4DFM A;  2P35 A;  4FFD A;  4DS4 A;  3AQF A;  3M9N B;  2AGO A;  5A0L A;  3LK9 A;  9ICF A;  4NLZ A;  5DG8 A;  1L5U A;  2PFP A;  4R63 A;  1NK4 A;  2IMW P;  2W9B B;  7ICH A;  1BGX T;  5KFV A;  4RT3 A;  3PMN A;  8ICI A;  2CPR A;  3TAQ A;  9ICR A;  5KFA A;  3TAP A;  4UQG A;  3MDC A;  5J2C A;  3T5H A;  1SV0 A;  3ETL A;  4C0Z A;  3Q8S B;  1CRX A;  2ZIX B;  4RT2 A;  4EZ6 A;  9ICW A;  4Y2U A;  2W9A A;  4DF4 A;  2W03 A;  1K1Q A;  2RRD A;  1T8E A;  4RQ6 A;  2XY6 A;  2ZXH A;  2K4P A;  5F9L A;  2ZTD A;  5ALY A;  4GIB A;  4F91 B;  1T3N A;  7ICT A;  2H3I A;  5AI0 A;  1IV8 A;  4US8 A;  4ECS A;  5DDY A;  5IIL A;  5AK3 A;  1U9L A;  5AI4 A;  3LVV A;  3EW9 A;  4F4K A;  4F71 A;  4Z6F A;  4IQU A;  4YR3 A;  2DPJ A;  3K75 D;  2HHQ A;  3VC8 A;  4FZM A;  1Q3V A;  2GO7 A;  1NK0 A;  2IOH A;  4C4R A;  5DGB A;  3FM9 A;  4PZN A;  1P7D A;  4QZB A;  7ICU A;  4DL3 A;  1L3V A;  3QE9 Y;  1EXN A;  1TAM A;  2EZX A;  1SWW A;  1XC9 A;  3GQC A;  9ICI A;  1MN8 A;  5KT4 A;  3LWL A;  4C80 A;  2EAP A;  2F1H A;  4TQR A;  4XQ8 A;  2EH9 A;  2O6K A;  1TK8 A;  3NRZ A;  5C5J A;  4I2E A;  3PX0 A;  1ZQW A;  3EUB 2;  2KOB A;  3HRD D;  5F3X B;  1SIJ A;  2RDI A;  3JPR A;  4RNO A;  2HSZ A;  5DBA A;  3H8S A;  1Z4O A;  1FIQ A;  4GLX A;  2H3F A;  1RDF A;  4UAW A;  1N48 A;  4FBU A;  2PFO A;  5EWE A;  4BXO A;  3BZK A;  2DBY A;  4EBE A;  1Z00 B;  5AM4 A;  3RJH A;  3HWT A;  1L7M A;  4AYB C;  2J6T A;  4YVZ A;  4M0A A;  2RP5 A;  1ZQX A;  2XCP A;  1DK3 A;  1S8O A;  2W04 A;  1LVH A;  1X9X A;  5J2F A;  1RQL A;  2HBM A;  1JXL A;  1PK1 B;  4OJ5 A;  3WK9 A;  4C7Y A;  3N4M B;  4DF8 A;  1S0N A;  5J0P A;  4DLG A;  4F2R A;  3GII A;  5DB9 A;  4J9M A;  3NRW A;  4G3I A;  3RRG A;  3IHQ B;  4RNN A;  3PR4 A;  1YZ7 A;  1SZH A;  3KHR A;  2V4Q A;  5KT5 A;  3CNH A;  2IHN A;  5KFM A;  2LM1 A;  1Z4N A;  4DCC A;  2E8O A;  1UT5 A;  4DFK A;  4TUQ A;  1WG8 A;  4ECZ A;  4QW9 A;  3ISB A;  1SKR A;  2A1A A;  1KRP A;  3KD3 A;  2LKY A;  5KFW A;  3SV3 A;  3THV A;  5ALD A;  2H3Z A;  1GO3 F;  1ZQM A;  3WKD A;  2BZF A;  2JMG A;  1ZD4 A;  4JV0 A;  5IIO A;  4ZOH C;  4TUS A;  4KLU A;  4PH5 A;  2F8K A;  8ICF A;  2F8L A;  1LV5 A;  4DQI A;  1U49 A;  2C28 A;  3AN1 A;  4ED1 A;  4IRK A;  1NJW A;  2BR0 A;  1ZRN A;  4YD1 A;  3M8S A;  4R65 A;  1K1S A;  3QUT A;  2FJ6 A;  2VJ4 A;  2ALZ A;  1DK2 A;  4KTQ A;  1V85 A;  1PZN A;  5DQH A;  4FS2 A;  3PVX A;  4PPX A;  3JPN A;  1SXE A;  1NJZ A;  2QKQ A;  4DQP A;  2K4E A;  4MEX A;  1WUD A;  4P0P A;  2NRX A;  4RPZ A;  1HEK A;  2YB1 A;  3BDP A;  2GOL A;  2A1J B;  3A0B U;  5B5E U;  2RDJ A;  4FO6 A;  3PX4 A;  2ZIU B;  9ICJ A;  5L1J A;  4YQW A;  4O3S A;  1RYU A;  3C2M A;  3LVW A;  4JUZ A;  4QJF B;  4UB5 A;  1V38 A;  4MEY A;  4F4W A;  3TAD A;  4ELV A;  5DDM A;  4QWC A;  4NY8 A;  3GZF A;  2LYA A;  5J2D A;  3PW5 A;  5EE0 A;  1ZD5 A;  1IXR A;  2I1Q A;  2UVR A;  2KHQ A;  5KL1 B;  3UXN A;  4O3P A;  5D46 A;  7ICQ A;  3BQ2 A;  9ICL A;  3ALR A;  1ZQB A;  5KL8 B;  1XSL A;  2YMM A;  1TE2 A;  8ICX A;  5AKX A;  2LI6 A;  1ZYQ A;  4UB1 A;  4J9N A;  4KX5 A;  1RYS A;  5KFC A;  3PX6 A;  4DS5 A;  5AK5 A;  1QCK A;  4F5O A;  3M6Z A;  5ALL A;  3OSP A;  4U7C A;  4J9O A;  2HOI A;  4Y2J A;  3F53 A;  2KN7 A;  2WAQ C;  5ALX A;  3Q8R B;  4ECX A;  4OD0 A;  7ICN A;  1U48 A;  1MA7 A;  2OH2 A;  1ZQP A;  1V97 A;  9ICT A;  2VAN A;  4FZN A;  4CF5 A;  1B0X A;  1FO4 A;  5JU5 A;  4UBB A;  2BCU A;  1PK3 A;  3TI0 A;  3R9K A;  1TK5 A;  4AP9 A;  1NK9 A;  2BCR A;  5J0Q A;  2DKZ A;  1F5S A;  2HDO A;  2E3T A;  1ZJM A;  3SMV A;  3OJU A;  4F92 B;  1SXD A;  2DQN B;  1KSP A;  1A0P A;  3ETR A;  3LYS A;  1C20 A;  8ICO A;  4KX3 A;  4F4Y A;  1Q46 A;  2KEY A;  2JEI A;  4IQV A;  5KFO A;  8ICS A;  1L6N A;  2QB1 A;  2N1R A;  3WKE A;  1BPD A;  2VJ5 A;  3FAH A;  3ONN A;  4F2S A;  8ICV A;  2BCV A;  5ALG A;  3HX0 A;  3RJK A;  2W54 A;  8ICN A;  2XVT A;  5KG0 A;  4PHP A;  4F5Q A;  4FS1 A;  3RH4 A;  3RJE A;  4DEZ A;  4QZ9 A;  5KFL A;  3SAH A;  1BPB A;  9ICH A;  2BPC A;  2MA1 A;  3OHB A;  3B9J A;  2G5H B;  2OYY A;  4C4S A;  3TFR A;  1HIW A;  2JH7 A;  2FLL A;  3V7L A;  1BVS A;  2KD1 A;  5DBB A;  4KLO A;  5KAF U;  3BQ7 A;  5KFK A;  9ICP A;  3T5L A;  4RQ3 A;  2AGP A;  4ACO A;  3N97 B;  1QTM A;  4GC7 A;  2PKE A;  1N63 A;  4EBC A;  4ED0 A;  4I29 A;  4PJ0 U;  1COK A;  1NKC A;  1XNS A;  5J0R A;  4KLE A;  5J2E A;  4HAI A;  2C2E A;  5KFX A;  3T5K A;  8ICK A;  1TFR A;  4Q8F A;  4DSI A;  3BJY A;  1F44 A;  3TAC B;  4F93 B;  4UAT A;  3JPQ A;  4O5E A;  4ED3 A;  4GFJ A;  2XIC A;  4ICA A;  4DSJ A;  1ZQQ A;  4I2B A;  3M9O B;  3C29 A;  8ICE A;  5DKW A;  3QZ7 A;  3QU4 A;  2FLP A;  2FDR A;  7ICJ A;  9ICC A;  3RB0 A;  1WWV A;  4RQ1 A;  2GWS A;  4GXJ A;  7ICI A;  8ICL A;  2AXT U;  2XY7 A;  1ZJN A;  4I2I A;  3QUC A;  4DFJ A;  4EEK A;  3G6Y A;  2IBK A;  3AUO A;  3ZDC A;  1KL9 A;  4BUG A;  2VA8 A;  4K4I A;  3PW0 A;  2FPK A;  5CA7 A;  1FFU A;  3M6K A;  3OPX A;  1URJ A;  2PMZ C;  2ZIW B;  2ZJ5 A;  1ZQE A;  4MFA A;  4IQW A;  5AI6 A;  3LWM A;  5EWG A;  2W8K A;  1SGG A;  3SQI A;  2HOF A;  4RUA A;  3H8M A;  1MSW D;  1NOM A;  5EE1 A;  3PML A;  4RNM A;  1ZQG A;  5IIM A;  4OJO A;  3BQT A;  5KFG A;  3N7P D;  1S9F A;  4M04 A;  4AYB F;  3C2L A;  7ICF A;  2UVW A;  4Y2Y A;  1Z1B A;  4DL7 A;  5ALQ A;  3T5J A;  1KLN A;  2AHO B;  4O3Q A;  5TZV A;  3MR3 A;  3UXP A;  2K8B B;  4B9T A;  3MR2 A;  2EDU A;  4PL2 A;  2W9C B;  5EE9 A;  1B43 A;  4GC6 A;  5KFH A;  2YMQ A;  1KN5 A;  2IHM A;  1ZQT A;  5CP2 A;  1YT3 A;  4YP3 A;  4EYI B;  5J29 A;  4LVS A;  3UQ2 A;  2K4I A;  4I28 A;  2ZTE A;  2E8M A;  2DUY A;  5KT6 A;  4NJ8 A;  3RR7 A;  1L8O A;  2VA2 A;  9ICX A;  8ICW A;  3PST A;  4PHE A;  2KSO A;  1KFS A;  1L7N A;  2ZIV A;  2D3D A;  4NLB A;  1KTQ A;  3Q8L A;  3C28 A;  4KN7 A;  1YZ6 A;  1KFT A;  3DEE A;  5ALH A;  3L3F X;  2F76 X;  5CRX A;  2XI9 A;  3VCB A;  4BX9 C;  2Y0S C;  2M9N A;  5GTI U;  3OGU A;  2AQ0 A;  3GIM A;  2RQ5 A;  3BZC A;  8ICG A;  1ZQO A;  1LKY B;  4BDP A;  3B0Y A;  9ICM A;  1KEJ A;  1LB2 B;  1RZT A;  4O3O A;  2VA3 A;  3GFK B;  2KJ8 A;  3QU5 A;  1S0O A;  2K8A A;  5CB1 A;  4QWA A;  2BQ3 A;  3QU7 A;  3NUQ A;  2F1I A;  3GIJ A;  4C8M A;  2W9B A;  4ECU A;  5AKZ A;  1SL2 A;  2CN1 A;  4TQS A;  4A8E A;  4B9V A;  3JPT A;  3ZDA A;  4F8R A;  3AM9 A;  1TAU A;  4MF8 A;  5AM0 A;  1JRP A;  1UQV A;  2EZY A;  3SEN A;  3G6X A;  1JI7 A;  1D8L A;  4YXM A;  5ALU A;  2R18 A;  5AI5 A;  3S6J A;  4BXO B;  3H40 A;  4KLH A;  3MGI A;  4K4H A;  3RRH A;  3L4P A;  2RHF A;  3U26 A;  4YG2 A;  5KG7 A;  3ZI4 A;  1SZP A;  3K4G A;  1FEZ A;  1ZQV A;  1L7O A;  4P0Q A;  3HT3 A;  1DXS A;  2G08 A;  2AH5 A;  2QB0 B;  1UT8 A;  4EEY A;  5AIC A;  4NLG A;  3F5E A;  1X66 A;  4XA5 A;  4IL6 U;  1JAL A;  5KG3 A;  3RFA A;  4KLM A;  1XO1 A;  4PHA A;  1ZET A;  4CF3 A;  1N5X A;  2LPE A;  5ALP A;  1TKD A;  3D6J A;  4O9M A;  5ALZ A;  4CDG A;  3GV8 B;  4KLJ A;  3KKA C;  4UAZ A;  1PUZ A;  2W55 A;  2NRV A;  4UW9 A;  2L5Y A;  3GU3 A;  4RPX A;  4IQT A;  5KT7 A;  4OJP A;  3OJS A;  2MSN A;  1MQ3 A;  4I2A A;  3TAR A;  4P2H A;  5KFN A;  1KFD A;  1KDH A;  2WAQ F;  1U47 A;  2HHT A;  3KTQ A;  2LM4 A;  2WB1 C;  5KFS A;  3LDA A;  3SR6 A;  4I2C A;  3PSP A;  5ALS A;  5EOZ A;  2BCS A;  4F5N A;  9ICV A;  1ZD2 P;  1NKE A;  3BS5 B;  2I6X A;  5D4B A;  2HMX A;  2KKV A;  2YML A;  5KTQ A;  4YD2 A;  1Z00 A;  2HHX A;  3RB4 A;  5L9X A;  2Q4T A;  2DKX A;  2NRT A;  1T3Q A;  4GXI A;  5CHG A;  1F0M A;  1CEZ A;  4QZG A;  4Y2Q A;  1NJX A;  4M9N A;  2HVH A;  2LYB A;  8ICP A;  1S0V A;  4B9M A;  4KLT A;  7ICR A;  3RB3 A;  3V6J A;  2WHE A;  4B9L A;  4QZC A;  3WK8 A;  1KW4 A;  1KKX A;  1ZQZ A;  4DSF A;  2KJ5 A;  4O5K A;  3TFS A;  3N28 A;  2R8H A;  4NWI A;  4UBC A;  1Q3U A;  1ED1 A;  4J9P A;  3MFH A;  1N56 A;  3KZI U;  2XY5 A;  4KLS A;  5L1L A;  5C0Y A;  4BJQ A;  1RYR A;  3PO4 A;  5J0O A;  3OHA A;  1XU4 A;  4ECV A;  5HML A;  4UB2 A;  4Q44 A;  1KQQ A;  3HIL A;  3IV6 A;  3A0H U;  1L3S A;  1NZP A;  4USA A;  7ICP A;  2QAR A;  1B4F A;  3Q8Q B;  2W11 A;  2NO5 A;  3N7S C;  1OUQ A;  2CRX A;  3HP6 A;  2OWO A;  2HBJ A;  2BDP A;  3PSI A;  3PY8 A;  1N61 A;  3NVY A;  5J0Y A;  3I76 A;  4NV0 A;  4BGD A;  1J97 A;  4M2Y A;  3M1Y A;  3HPO A;  7ICO A;  2LBO A;  2IOF K;  4RPY A;  7ICS A;  5J0S A;  3H4D A;  2ESE A;  5AK4 A;  2W8L A;  4UB8 U;  5J0T A;  2ASJ A;  3EZ5 A;  3MGV A;  3QEB Z;  4R64 A;  3SEI A;  5ALF A;  5IIJ A;  7ICV A;  3TQ1 A;  2B21 A;  4RQ5 A;  4Q43 A;  1JIH A;  3SV4 A;  2OEH A;  5J2A A;  1VDV A;  5KG5 A;  2A1J A;  3CP8 A;  1NNL A;  5J0W A;  4CRX A;  2ZIU A;  2H3V A;  5ALJ A;  1HJP A;  1ZQC A;  4QZE A;  5H2F U;  2QLT A;  4GXK A;  3RBD A;  5DB7 A;  5T14 A;  4YFK A;  1ZQH A;  4M9J A;  1TAQ A;  4G9B A;  5AKH A;  2ISP A;  2W43 A;  1BPZ A;  2MUT B;  2MU2 A;  9ICA A;  4RQM A;  2ES6 A;  3GV7 B;  2MRL A;  1DOQ A;  3TKA A;  5DLG A;  3RF9 A;  3T79 A;  3NTU A;  1X9M A;  3WK6 A;  4M6W B;  8ICY A;  4O3R A;  2NYV A;  5IIK A;  1C7Y A;  1UA1 A;  2KP7 A;  1O08 A;  2BCQ A;  5ALE A;  2NO4 A;  2V4R A;  2ASL A;  2PMZ F;  2H5X A;  2XC9 A;  1ZQN A;  3O0F A;  3UQ0 A;  5BOL A;  1TV9 A;  4DOB A;  1XS9 D;  3K1Z A;  1S10 A;  1HUZ A;  4R8U B;  4HYK A;  2G06 A;  3ED5 A;  1Z3E B;  1S5L U;  1TVA A;  4MHV A;  2JV3 A;  4NL9 A;  4ECY A;  3CRX A;  2HBK A;  1NK6 A;  5G5G A;  3M8R A;  2OM6 A;  2G0A A;  4QWE A;  2D6F C;  7ICL A;  3GDX A;  3AU6 A;  3T3F A;  3ZDB A;  4Y2V A;  4IC9 A;  1A76 A;  2YMP A;  3AEV A;  4Y2P A;  2E1E A;  4DOC A;  1D8B A;  1O03 A;  2P6U A;  1N62 A;  1X6I A;  2KZM A;  4KLL A;  5J2B A;  2B6G A;  4B9N A;  1WCN A;  2M0N A;  4IRD A;  5KFE A;  1ARO P;  3MC1 A;  4PHD A;  2HHS A;  4C4T A;  2WF8 A;  2NRZ A;  5AKI A;  3OTQ A;  5ALI A;  5KG2 A;  4DO9 A;  2ZUB A;  1BNP A;  4LZD A;  4M9L A;  5AIB A;  2KNJ A;  2HCF A;  2JZB B;  5HHH A;  1VJ5 A;  4KLI A;  8ICB A;  1A77 A;  2BQU A;  2LYH A;  4XRH A;  4J9R A;  2Y0S F;  4J9Q A;  9ICB A;  4IR1 A;  3UMG A;  2EAM A;  4JWM A;  2KIW A;  1ZQF A;  2YX8 A;  4JB3 A;  2NRW A;  4LZG A;  1ZQL A;  3RJJ A;  1XO0 A;  4F4Z A;  4J9L A;  2PI4 A;  5ALV A;  3MBY A;  3C1Z A;  3C5G A;  1L3T A;  4I2J A;  1IIP A;  1VLB A;  8ICT A;  5HNK A;  3J81 j;  5AM2 A;  5KG1 A;  2JGA A;  1NK7 A;  2KV2 A;  4NL9 C;  4JWN A;  4DOA A;  3DV9 A;  4O0I A;  2DGZ A;  3EYZ A;  4KMO B;  2KFN A;  1SB3 C;  4YN4 A;  4KLQ A;  4J9K A;  1UPH A;  1JXE A;  3KBB A;  2YTU A;  2JXJ A;  4CNQ A;  2JHD A;  4O5C A;  9ICG A;  3BS7 A;  2KFZ A;  2Y9U A;  3C21 A;  2ZUD A;  2HVI A;  3IG5 A;  5ALT A;  1QSL A;  1AQ6 A;  2UVU A;  4CF4 A;  3QUQ A;  1N5W A;  3M9M B;  4PGY A;  2UVV A;  2NV3 A;  3K1R B;  2C2D A;  4CGZ A;  3QEA Z;  5AM1 A;  5EE3 A;  3H8W A;  3WKA A;  3IG8 A;  4DSE A;  1ZQU A;  4YR0 A;  1QH9 A;  4YXJ A;  3IRU A;  4OJL A;  2EZZ A;  3KHH A;  3RBE A;  5KT3 A;  4RQ7 A;  1QQ7 A;  3EPG A;  2XCA A;  1BPX A;  4NLK A;  3F5A A;  7ICE A;  1ZQS A;  2FE9 A;  5JTI A;  5BPC A;  1NK8 A;  2A3V A;  2KK0 A;  4M47 A;  2IA6 A;  1NJY A;  3WU2 U;  2W3S A;  4QZI A;  5K4L A;  4B9U A;  3G6V A;  4QZA A;  4IR9 A;  5KFB A;  2WB1 F;  3Q8P B;  4ELU A;  3C1Y A;  3KZX A;  1UCV A;  2J6S A;  3I28 A;  2R8K A;  4UAR A;  5J8Y A;  4M9G A;  4QZ8 A;  2HHU A;  4KMU A;  3M7D A;  3QX7 A;  1HUO A;  3RJF A;  3RR8 A;  2ZTC A;  3RJI A;  3QUB A;  2FLN A;  3HJE A;  2GLE A;  3KKA A;  4DLE A;  3H0L B;  3AU2 A;  4F50 A;  2G07 A;  1ECW A;  1NZB A;  3SI8 A;  5HP4 A;  2DFL A;  5GTH U;  3V6K A;  3WK7 A;  5J2J A;  2YN4 A;  2I9G A;  4K4G A;  2BGW A;  2F3N A;  4P4M A;  2KE7 A;  3ZD9 A;  1KBU A;  2W9C A; 
#chains in the Genus database with same CATH homology
 2F8L A;  2KOB A;  1MA7 A;  1T94 A;  4AYB F;  2VKQ A;  2OH2 A;  2NV3 A;  3AQF A;  4PL1 A;  4FZN A;  4O3M A;  3CP8 A;  5A0L A;  2KHV A;  2LYB A;  2ZIU A;  4CRX A;  2M0N A;  1Z1B A;  2H3V A;  2R18 A;  2KIC A;  4U6P A;  2LHT A;  1PVP A;  4CGZ A;  4WJ3 B;  5HR6 A;  2VJ4 A;  2H3F A;  5T14 A;  2K8B B;  2CPR A;  3AL0 B;  2F77 X;  2KJ5 A;  3IG8 A;  2RHF A;  2K8C B;  4JMU A;  1F44 A;  4PL2 A;  4NWI A;  2K4H A;  2JH1 A;  4C0Z A;  1Q3U A;  1PVQ A;  1CRX A;  4P0Q B;  1ED1 A;  2K4E A;  3SMV A;  2ZIX B;  1WUD A;  2DQN B;  3D2N A;  2MRL A;  4OJL A;  4P0P A;  4GFJ A;  4P0Q A;  1A0P A;  2W03 A;  2XIC A;  3RF9 A;  2VIX A;  4FZL A;  2ZIX A;  4ICA A;  1HEK A;  2RRD A;  2YB1 A;  2KNJ A;  2G08 A;  2GOL A;  2RP5 A;  4BJQ A;  3N7P D;  3T79 A;  3D2S A;  2ZXH A;  2ZIU B;  4OO1 J;  1YT3 A;  3LYS A;  3C29 A;  3F5E A;  2K4I A;  2E1F A;  2W04 A;  4KX3 A;  4NLC A;  2Y0S F;  3CYM A;  3RFA A;  2E5S A;  2KEY A;  3F5A A;  2H3I A;  1L6N A;  4QIW F;  2A3V A;  2N1R A;  2HBM A;  3PZP A;  3PSF A;  2VJ5 A;  3H0R B;  2G5I B;  3ONN A;  4OJ5 A;  2ZG6 A;  3PST A;  2BDU A;  2HBL A;  2KIW A;  3LVW A;  2YX8 A;  2ZIV A;  4AYB C;  4P0P B;  4NLB A;  4QJF B;  2PMZ F;  1ZQ1 C;  3O0F A;  3C28 A;  4CDG A;  2W7O A;  3AQE A;  2WB1 F;  3DEE A;  3L3F X;  4QNL A;  2F76 X;  2XVT A;  3LVV A;  3F2C A;  1XO0 A;  5CRX A;  2F2A B;  2XI9 A;  3GZF A;  3KZX A;  3N7S C;  3NRW A;  2LYA A;  1OUQ A;  2CRX A;  3VCB A;  3K1Z A;  2HOQ A;  2HBJ A;  2KKP A;  2Y0S C;  3D2Q A;  4BX9 C;  3GU3 A;  4BUG A;  5C0Y A;  1SZH A;  2G06 A;  3PSI A;  3F2B A;  4QIW C;  3M7D A;  2KHQ A;  5KL1 B;  3N7R C;  3SAH A;  4OJP A;  3VC8 A;  2DF4 B;  2H3Q A;  3E0F A;  4FZM A;  1Q3V A;  1IIP A;  3ALR A;  2MA1 A;  2ZIV B;  3HKZ F;  3M6K A;  3OPX A;  2WAQ F;  4NV0 A;  3CRX A;  2HBK A;  1URJ A;  2PMZ C;  3H0L B;  2ZIW B;  1P7D A;  2JGA A;  2G5H B;  2OYY A;  4FE3 A;  1HIW A;  2KV2 A;  5KL8 B;  3ICX A;  2Z7J A;  2ZIW A;  1XNS A;  2G09 A;  2DGZ A;  2G07 A;  1ECW A;  2JH7 A;  2WB1 C;  1NZB A;  4KMO B;  2KD1 A;  3PSP A;  2KJ8 A;  2K89 A;  4KX5 A;  1TAM A;  1Z19 A;  2K8A A;  2LBO A;  5HR7 A;  1UPH A;  2YB4 A;  2OM6 A;  2LKY A;  2G0A A;  1PVR A;  3NUQ A;  3M6Z A;  4OJ6 A;  3KFU F;  4ACO A;  3H0M B;  3SQI A;  2HOF A;  2JHD A;  3IN5 A;  1A6S A;  2H3Z A;  4U7C A;  2W7P A;  2D6F C;  1GO3 F;  3F2D A;  2HOI A;  3F53 A;  3MGV A;  3HKZ C;  2CN1 A;  2WAQ C;  1KBU A;  2HMX A;  2KKV A;  3SAF A;  1DRG A;  2JMG A;  3IG5 A;  4A8E A;  4IC9 A;  4OJO A;  2Q4T A;  2XID A;  2OXO A;  3IP4 B;  3SAG A;  2E1E A;  2KJ9 A;  1D8B A;  2GH1 A;  2KVC A;  2ZXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...