3HKZG

The x-ray crystal structure of rna polymerase from archaea
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
113
structure length
113
Chain Sequence
VAQEIILSCEINSIERGSLKNLSMVNMSCNGFNVSFDIIDSINIFSQKEKVKVIISKNRPSYSHDDFCGHGYIVTELKDSSLNNGNKYTTIISLYGLLVKIISNKESFLRTSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit A'
total genus 12
structure length 113
sequence length 113
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF16992 RNA_pol_RpbG DNA-directed RNA polymerase, subunit G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hkzG00
1VQLA 2UUAQ 4AQYL 2UXCQ 4A76A 4HIOA 4LFBL 4DR5Q 1CSQA 3S2DH 5GROA 1E7ZA 4YWMA 1X65A 4PZ6A 2DUDA 1Q8KA 4LUVA 1X54A 1K8GA 2ZTEA 3JC66 3CXCA 4DR6L 1Y1WG 2ZM6Q 2Q2UA 2XTIA 3H3VH 4ALPA 1KAWA 4IOCA 2JA7H 3M85A 2VNUD 4GN5A 3HOUG 4IOAA 1NMGA 3A5ZB 1VQ7A 5JJKA 2N49A 4DUZL 1VQHA 4LF6L 2RHSB 4JI4L 4NPSA 4DKAC 4DV1Q 4JI2L 1IL2A 1WFQA 4HJAA 2PI2E 4LFAQ 1KIXA 3EBEA 2UUCQ 1IBKL 4HIKA 1JJCB 2I5MX 2MQHA 4O2DA 4RMFA 4A3BH 2A1AA 4LF8L 3WWVA 5GQOA 4ME3A 1NBWA 3AEVA 5AJ3L 4IPGA 2JQOA 4A3FG 4IJLA 1LYLA 2EQSA 2K52A 4Y52H 1ASZA 3HOVG 3CW2C 4K0KL 4JBWA 4BBSG 3TS0A 2JK8A 2A8VA 2IY5B 4OWTB 2PI2A 1X3GA 1EYGA 4A3LG 3CPFA 1FL0A 3G48A 2YYZA 1SE8A 1JE5A 1PYBA 3CP0A 1TWGH 1VQEA 5C0XI 4HJ5A 1NJIC 2EIFA 3PUXA 5IP7G 4AIMA 5C3EH 1XMOQ 1KRTA 3GTOH 3T1YL 3Q8DA 4DV4L 2R93H 3GTGH 3HFZB 1S3OA 3NBHB 1JT8A 2RF4A 2KHJA 2Z0SA 4GNXB 3GTPH 1UEBA 5GAGC 1A62A 1NY4A 3KLWA 4LUOA 3T1YQ 5E7NA 5M3MH 5M3FG 4A3MG 4P73A 1N36Q 2WAQE 3GTQH 3HOZH 3PO3G 1K9MC 3CAMA 1QZGA 2OCEA 4GNXC 3H15A 1I3QH 4A3IG 1UE5A 1Z47A 2OTLA 1UE7A 2KHIA 3BZKA 2ES2A 4BY7G 4DR6Q 3GO5A 5BR8Q 1MJEA 4LFCQ 3TRZA 4IFDJ 2K5HA 4XIGS 1EIYB 2GVAA 4DR2L 1UE6A 1VQKA 3PO2H 1KQSA 3PUWA 3S1NH 2NN6G 1XMOL 2R7ZG 4A93H 3HOYG 3M4OH 4OONA 1A63A 4JV5L 5C44G 4DV4Q 1YI2A 2RCNA 2NZOA 1BVSA 3ULPA 2VZAA 4JI0Q 3U4ZA 4JI7Q 4AYBE 3G6EA 3BJUA 5C4XG 3S17H 1E3PA 2Q2TA 1HNXQ 1JMCA 1KHIA 1SMXA 4YY3Q 3AYHB 2JEAI 3M9BA 4DR1L 1XNQL 4X65L 4A3CH 2JA6G 2CKZB 4LF4L 4OX9Q 4QJFA 4LF7Q 1NMFA 4R4QA 4LFCL 4B3SL 3KF6A 3RN2A 2CWPA 1N8RC 1HJPA 2L15A 4P75A 4YCWA 3NENA 1EIFA 2CFMA 2VY3A 3I55A 2R92G 1Z9FA 1B8AA 1VQ4A 2IHFA 1QZHA 1T9HA 3CD6A 5IYBG 1Q12A 4OXPA 1GM5A 2KBNA 3U58A 4Y7NH 5LMNQ 2JA5H 4L5RC 1Y1VG 4DR4Q 3UDGA 3CCLA 1X6OA 2NZHA 2E5LQ 4A3KH 2E2HH 3EIVA 4HIDA 1KXLA 5JJIA 1JJGA 1A8VA 3D0FA 3PIPA 3KF8B 1CKOA 1I5FA 2HIVA 4JV5Q 4DV0Q 2JJQA 3G71A 4B3SQ 2BH2A 4HJ8A 1TXYA 1E22A 2WAQG 3F1ZA 1I50H 4GS3A 1N9WA 1HNZL 4LF5Q 4POFA 4P72A 4HIMA 3GTJH 1QUQB 4DR5L 1CUKA 2LXKA 2R7FA 5GADC 1RIPA 1HH2P 2C35B 2IHEA 2YTYA 3HKZE 1PH2A 2UU9Q 1AH9A 4GLVB 4GOPB 1YIJA 1X3EA 3KFUA 1CKNA 3BU2A 1TWAH 5C0XG 2QA4A 1PVOA 4DV7L 1IBMQ 4BY7H 3I2ZA 3CF5A 5EAYA 3VDYA 1L2FA 4DR7Q 4X62L 4X66Q 1Q81C 4LFBQ 4JI5Q 1VCIA 3PV0A 4DR3Q 3HOUH 3ZJYC 4APVA 4B3RQ 5FLMG 1EWIA 3KJPA 4DUYQ 2VUMG 1WCMH 1FVIA 3RR5A 4A3GG 1Y1WH 4AYBG 3CC4A 3E9HA 2ZJPA 4LF8Q 4LF9L 3ICEA 1Q82C 4PZ7A 1OXVA 3T1HQ 4DNIA 1FGUA 3L7ZC 3RNUA 1XMQQ 3PUZA 1B70B 1L0WA 1N34L 1GVPA 1W3SA 4A3JH 2HT1A 1VQMA 1UE1A 3OYYA 3J7A5 3I4MH 1YEZA 3OTOQ 4WJ4A 1I6HH 5DLQE 3A0JA 3L2PA 3CMEA 4LUZA 1K8AC 2YV5A 3UE0A 5HGQA 2WB1E 4JOIC 3M3YH 5M3MG 4DPGA 1WOCA 2I5LX 1QVCA 4GN3B 2NVTH 3A74A 5J3BA 4C3HH 2JA9A 3F8TA 1C7YA 1V9PA 2HQLA 2ATWA 3CCJA 2PQAA 4GOPC 1WYDA 3MXNB 3RLNA 2YU9H 3I4NG 4JOIA 2R6GA 3HKSA 4KI0A 4PMWA 3HOXG 2VQEL 2CWAA 3W1GA 2OQ0A 1E1OA 1Q1BA 5HY6A 5IYCG 3K7UC 3STBD 4MNOA 4DUZQ 1X9NA 2CCZA 4JI6Q 4GKKQ 3UDXA 3J81j 4PG3A 2RHQB 1SROA 4J15A 4YY3L 1GD7A 1HR0L 1VQ9A 2VQEQ 2OTJA 4JI5L 1J5EQ 2E2IH 4UP9A 4B3TQ 2UXDL 4H02A 5C44H 3M4QA 4R4TA 4DV5Q 1SRUA 4EQ5A 4JBKA 4QL5A 2OWOA 2NVQH 1NE3A 5IYDG 4R4OA 4IPCA 1YHAA 2AWNA 3CC7A 2OQKA 3JAMi 2I0QA 3PF4A 2UXDQ 2FXQA 4RG1A 3KDFB 5LMUL 4DV1L 3I4MG 1DGSA 4PZ8A 4UP8A 4A3JG 3S1QH 3CMAA 5GAEC 1CSPA 3PUVA 3I4NH 4LF4Q 5FJ8G 1YNXA 1FJGL 1B7YB 4JCVE 1YITA 5LMUQ 1WI5A 3GTKH 3PO3H 2ZTCA 4A3EH 3U50C 2EXDA 4KHZA 1XPUA 3RZDH 3DLLA 3CC2A 2VQFL 1Q7YC 2F3IA 5IWAL 3A5UA 4POGA 3AQQA 1TWFH 1SLJA 1VQFA 4A3FH 1HR0Q 3PSIA 1VQ8A 4JI8L 2ASBA 4IPDA 2JEBI 4O0AA 5C0XJ 2R93G 1OXXK 4DV2L 4A3EG 1XNQQ 1XNRL 3S14H 1HZBA 2K5NA 4OWXB 2MO0A 3KDFA 3F2CA 3TQYA 3GTMH 1VQNA 1OXSC 2VL6A 1Y1VH 1L1OA 3RLFA 2LXJA 4YWLA 1PH7A 1G6PA 2KCMA 4A4IA 4BBSH 1OXUA 2XGTA 2UXBL 2ZJRA 1M90C 2WP8J 2KENA 4LW1A 4DK6C 1SFOH 4BY1H 1P8LA 1PFSA 2Z6KA 2HHHL 2AKWB 2JA8H 2ZJQA 4YWKA 1GKHA 1C0AA 1Q86C 5FJ8H 1OTCA 4LNQA 3K81C 4EX5A 3M4PA 3S24A 4DV3L 4YCVA 5IYBH 2B3GA 3TEHB 1IBLQ 4WJ3M 3RLOA 4QGUA 4DV5L 4JYAQ 3J80i 5IY0A 3PUYA 1HZ9A 1PH8A 1M1KC 4B3RL 4MTNA 5LMNL 1G291 4GN4B 3W1BA 4C2MH 4NB3A 3K8AA 4DR3L 3RN5A 1YJ9A 1VS0A 2JA7G 2MFIA 2V1CC 3L0OA 5M3FH 2WB1G 3OTOL 4JI6L 4DUYL 1MJCA 5M5XH 4JYAL 3S15H 4JI1Q 5GAHC 3H0GG 4HJ9A 3HKZG 2E2JH 1V1QA 1MIUA 2N78A 1HNWL 4LF9Q 2B63G 3PF5A 4QIWE 3I4OA 4DV0L 1HNXL 2NVXH 3D31A 1K3RA 2YTXA 1N33Q 3PO2G 4JI2Q 3NELA 4A3DG 1VQJA 1E24A 1VQPA 3KJOA 1X56A 2F4VQ 1HZAA 2B63H 2D0PA 2VW9A 1XTDA 3CCQA 3ULJA 5FLXc 5AJ3Q 1WJJA 1WCMG 2HHHQ 3H3VI 3HOVH 2B29A 3UDFA 1YZ6A 4R1JA 3PIOA 3ER0A 1A0IA 1PA6A 1D7QA 2K4KA 1HNWQ 3HOXH 1VQCA 4DV2Q 2A19A 1LM0A 1CKNB 1YVCA 2AWOA 1KD1C 1PH3A 3CCRA 2D62A 1U0LA 5IE8A 2JA8G 4BA1I 5ELNA 1BBWA 1CKMA 1XMQL 1PH5A 1V43A 4LWCA 5C4JH 3I56A 1R9TH 3DM3A 2VS1A 1IBKQ 1O7IA 4LF7L 3E9IA 4A75A 5IYCH 4GOPA 3LGJA 4JBJA 4FDBA 4A3BG 1EOVA 5JEAG 2KCTA 4GKJL 4A3KG 2H5XA 1YJWA 2F4VL 2K50A 3F2DA 4HJ7A 2HIXA 1HR0W 1TWHH 3FP9A 3STBC 1N32Q 4JG2A 4DV6Q 3AFPA 4R4IA 2VQFQ 4YHHQ 3G4SA 2CQOA 4NXNL 4GNXA 3E0EA 3BZCA 2NVYH 4NXML 3RZOH 2Q2IA 1MKHA 3K7AH 3TS2A 4YCUA 3B6YA 3NEMA 2UU9L 5C3EG 1J5EL 2UXBQ 3GDEA 4X64L 5BR8L 2YTVA 4IO9A 4A3DH 1VQAA 3J80c 2IX1A 4B3ML 4A3CG 1VQGA 3AFQA 4GLXA 2Z6KC 4KLKA 3S1MH 2GVBA 1EQQA 2D0OA 1EFWA 2N3SA 3W5OA 3CCSA 1BBUA 2VUMH 4JC0A 4A3GH 1NTGA 4DR4L 2AHOB 5IP9H 5C4XH 1PH4A 2I5HA 3CPWA 2K75A 4XTCS 4AQYQ 2UXCL 2R92H 3OW2A 1XNRQ 3S1RH 4GKKL 2MNAA 1I94L 4AH6A 4C3IH 2MO1A 4OO1I 4NXMQ 1QVGA 3M7NA 3TREA 1N34Q 3J7ZC 1SN8A 2R7ZH 4DR7L 3S2HH 1C9OA 2JA6H 1AE3A 5JEAJ 2JA5G 5JJLA 1KC8C 1L1OC 1PH6A 2BA1A 1N32L 1YHBA 2UUCL 1YJNA 2E5LL 4IFDI 1IZ6A 1X3FA 1PHJA 1AE2A 4YHHL 4BA2I 4QY7A 4UP7A 4TVAB 3T1HL 3MEFA 3F2BA 2UUBQ 3HOWG 1XJVA 2Y0SG 4LF5L 1EUJA 4JI1L 1YBYA 1G51A 1QUQA 3CCUA 4X65Q 4DV7Q 1IBML 2WFWA 1HNZQ 4OWWB 4GKJQ 1XPRA 4MZ9A 3ERSX 4A93G 5M5WH 2UUBL 1PH1A 1LUZA 4DAYB 2N8NA 4X66L 2GN5A 4BBRG 4X62Q 2E8GA 4UPAA 1ASYA 1K0RA 1P16A 4P71A 3CCEA 1RL2A 2NN6I 5IP7H 1E1TA 1IBLL 1QVFA 1Q1EA 4KHPL 2Q2HA 3KF6B 5M5YH 3CCMA 1YHQA 5LMNW 2LSSA 3CQZH 3GD7A 4B3TL 4JI3Q 1JB7A 1PH9A 2BH8A 3UE1A 1UWVA 2ALYB 4UY8C 4BXXH 3H0GH 5IYDH 3J81i 1JJ2A 4A3MH 4L5TA 1VQBA 2QEXA 1BKBA 1Q46A 2QGQA 2ZM6L 1I94Q 3HOYH 3HOWH 1N36L 3SGIA 4B3MQ 3UDIA 1D8LA 1VQDA 2PNHA 1U5KA 5H1SE 1L1OB 2UUAL 1IYJB 4LF6Q 1FJGQ 1S40A 5K36G 2ZTDA 3U4VA 1VQOA 1S72A 3I7FA 4BBRH 4DR1Q 1KL9A 4DR2Q 4L5SA 4KHPQ 2IT1A 4A3LH 4X64Q 4IPHA 3PGZA 4P74A 3FKIG 5IWAQ 4DAMA 3HOZG 4JI3L 2DGYA 4JBMA 3GTLH 3PCOB 4OO1G 3EN2A 4QQBX 5FLMH 2K14A 4DK3C 3FKIH 1TWCH 3K80C 1OXTA 1PYSB 4DV6L 1PV4A 4BXXG 5IT9c 2F52A 2PQAB 2BA0A 3KOJA 3KYHC 3ULLA 3IRBA 4K0KQ 3JAMc 1GO3E 4L5QA 1K83H 2ID0A 2PMZE 4JI4Q 3S16H 1EQRA 1SR3A 1LTLA 1K73C 4OX9L 1VQ6A 4JI8Q 4A3IH 4DV3Q 2K5VA 1H95A 1HZCA 3J81c 1Y14B 4TQUS 1X55A 1VQ5A 1J6QA 4JI0L 4JI7L 4NXNQ 1N33L 1XPOA 4X6AH 2Y0SE 4R4CA 2JE6I 3K0XA 4BY1G 2R7DA 4IFDG 5ELOA 1IXRA 4IJHA 2AMCB 1VQIA 1W2BA 2IX0A 5IP9G 4GLAC 4C3JH 3FHWA 4LFAL 3CCVA 1KRSA
chains in the Genus database with same CATH superfamily
1VQLA 2UUAQ 3NUCA 3C2PA 2UXCQ 1ZXTA 3S2DH 2J4XA 3D4WA 3VR6A 2F0WA 2NVTB 4YWMA 5C4HA 1X65A 1Q8KA 1PTOF 1STYA 3CRLC 4ALPA 1KAWA 2QDBA 4J6HA 3KLRA 1U4PA 1DCZA 3GV6A 3VYRA 1I4QA 4G7HC 2VNUD 4GN5A 3HOUG 2R7ZB 1BBXC 4LF6L 2AQ2B 4DKAC 4DV1Q 4DK0A 1IL2A 2D9UA 1KIXA 4OIJA 5EBCA 1DYQA 3EBEA 2RBMA 4TRDA 4HIKA 2UUCQ 1JJCB 3HP3A 4O2DA 4RMFA 4A3BH 2A1AA 3A55A 5GQOA 1NBWA 3AEVA 3GP7A 5AJ3L 4IPGA 4XYQA 3S2DB 1LYLA 1E0BA 1EU4A 2EQSA 3I4LA 1ASZA 3IKJA 4JBWA 4BBSG 4OHJA 5IGEA 1EYGA 2L0CA 2PI2A 1SMYC 3ZYYX 2EVBA 2YYZA 3L9AX 5IP7G 1EWCA 1PZJD 2F3VA 4OELB 1ILPA 1JT8A 3NBHB 3MXPA 4QCLA 4O42A 3KLWA 2EY1A 4P73A 3PO3G 1K9MC 4A3IG 3NK9A 1I3QH 3TP8A 1GHKA 1XX8A 3L3OC 1MJEA 3TRZA 5CR3A 1STGA 2K5HA 1EIYB 4DR2L 1KQSA 1EYCA 3PUWA 1EY8A 1A63A 5C44G 2Z4IA 4DV4Q 2NZOA 3CQZB 1BVSA 4JI0Q 3G6EA 2MJ8A 2PZWA 3S17H 4HTHA 5CORA 2E74C 4KV6A 1Y1VB 5CV5A 1KHIA 1SNMA 3TP6A 2JP1A 3J7YW 1NCVA 2HUGA 4A3CH 1EWHA 2CKZB 2JYOA 2JN4A 1NMFA 1B53A 1I3QB 5FK9C 2L1BA 4KKTA 1N8RC 1HJPA 2L15A 4YCWA 3KBGA 5E4XA 2KEEA 5E4WC 1C4QA 1Z9FA 3PO3B 2PYKA 3E6ZX 5IYBG 4Y7NH 5LMNQ 4K14A 4FXDA 3P1HA 3EA6A 4L6TB 5D14A 3DWQA 1LTAD 4PV1C 4A3KH 2E2HH 4HIDA 5JJIA 3D0FA 3PIPA 2HIVA 4JV5Q 5C5MA 4K5VA 4B3SQ 1TXYA 4HIMA 3PIP3 4DR5L 2LXKA 2R7FA 1VF5C 2IHEA 2TSSA 2YTYA 2K32A 2UU9Q 4M8AA 4GOPB 4PMBA 2HCIA 3VR4A 2ENBA 1CKNA 3NWTA 1TWAH 1X3PA 4K6LA 2QA4A 4DV7L 5EAYA 1L2FA 3QG1A 4X62L 4B9WA 5ELCA 4APVA 5FLMG 1EWIA 3RR5A 1FVIA 2HD3A 4IUPA 2AQ3B 4QMGA 4KN4C 4HAEA 4C2MB 3BYTB 4ULLA 1I4PA 5EJWA 2LKVA 2RSNA 1XMQQ 2CHBD 1GVPA 1VQMA 1UE1A 3AB9A 3MXGA 2NVXB 5JJZA 2QF7A 3UE0A 2WB1E 2ZXRA 3H6MA 1SBBB 3N52A 3JAML 5J3BA 1G2TA 5CV9A 1XWEA 3RLNA 2CVRA 4PMWA 4RA8A 1JCKB 1EY7A 3J81j 4PG3A 2OTJA 1HR0L 4JI5L 2E2IH 4UP9A 4IN3A 4R4TA 1JE4A 1SRUA 3ERQA 4KK7A 4QL5A 2OWOA 4R4OA 2B2UA 4IPCA 3K58A 2UXDQ 2FXQA 5JVH3 3I70A 1LT6D 4LF4Q 1YNXA 4BWGB 5I6WA 3GTKH 2ZTCA 3D3RA 3U50C 3OW7A 2EXDA 4I7AA 1JWUD 5CBAE 3A5UA 1RD9D 1SLJA 1VQFA 2ASBA 3PSIA 2KCNA 5C0XJ 2R93G 3GTOB 3H0GB 1XNQQ 1BO0A 3EFXD 4OWXB 1F9PA 5I2YA 2K6AA 3KDFA 2WKDA 4QIWB 1EY9A 3GTMH 2VL6A 3MFGA 1L1OA 3RLFA 1SXTA 1GUTA 3KBXA 4YWLA 3W2DA 5M3MB 3Q0AA 1PH7A 1ET6A 1JQYD 5C5LA 4CDFC 1OXUA 3VR5A 2ZJRA 2WP8J 1F77A 4BY1H 1EIHA 2Z9HA 2K7VA 1G8ZD 1H9MA 4KKSA 1T5XD 1O7YA 3HS0C 3M4PA 4WJ3M 2SEBD 4KHVA 1YNNC 3MXUA 1HZ9A 1PH8A 4HR7B 1PDQA 5CMDA 4RKBA 1DM0B 4LF8L 3L0OA 5M3FH 3OTOL 4JI6L 2DNEA 3H0GG 5JAVA 3HKZG 4RWSC 1V1QA 1HNWL 2EYMA 4DV0L 1HNXL 3D31A 4QF4A 1I6VC 1N33Q 1FNUA 5ELBA 1X56A 2IWHA 4DN4M 1XTDA 3FVQA 5FLXc 5AJ3Q 2HHHQ 1WCMG 4CJ0B 5FLXE 5M5YB 1A0IA 4XQQA 1CT1D 1GJXA 2K4KA 4B08A 3KLSA 5KYLA 2BDOA 2NVYB 2C5CA 4J8QA 4DV2Q 1CKNB 2PW5A 1U0LA 2FMMA 5ELNA 1BBWA 2CW0C 4N9TA 1V43A 1CHPD 3E5SA 4CKEA 4OL7A 4Q5VA 1ZKOA 1IBKQ 1O7IA 4O1NA 4GOPA 4FDBA 2Y0SB 3SK6A 1VF7A 1O7ZA 4A3BG 1B9NA 1BCPC 3MWYW 4A3KG 1RF2D 3MA2B 3F2DA 1TWHH 3STBC 4A3FB 1SYCA 3G4SA 4NXNL 2XRSD 3E0EA 5LL6X 2NVYH 1JWMD 2Q2IA 2D5DA 3TS2A 4C1NI 2EY6A 4CDEC 2Z6BA 3GDEA 5BR8L 4ZUIA 1F2MA 1Z7TA 1UUPA 2IX1A 4B3ML 1VQGA 3AFQA 4GLXA 5M9OA 2Z6KC 4KLKA 1DOLA 1U9RA 2D0OA 5I4DA 1EFWA 1GHJA 2R92H 1BUVT 3OW2A 1XNRQ 4GKKL 1RHPA 2MO1A 1NAPA 1N34Q 2NN6H 3S2HH 1C9OA 2JA5G 5JJLA 3R3OA 1L1OC 5IGCA 3HOYB 3J80L 1PHJA 4YHHL 1MBYA 4QY7A 3I73A 2UUBQ 4C3HG 4H44C 3SR1A 1G51A 4RCNA 4DV7Q 2WFWA 4GKJQ 1TS2A 4RH6A 2WINB 4BBRG 1KNAA 1ASYA 1K0RA 1KLUD 2E2DC 2EYFA 4K2LA 1QJOA 3KLSX 3NHHA 4IQZA 4M1UB 1AN8A 5LMNW 3CQZH 1QOHA 4JI3Q 1TY2A 1RCVD 1UWVA 4N8FA 3UE1A 2OT2A 4UY8C 3S2HB 1WTVA 3URYA 2QGQA 5ELDA 4EQPA 2ZM6L 3HOYH 3HOWH 4P2CB 3C1FA 3A54A 1RTNA 1D8LA 5J1ZA 2OXPA 1U5KA 1DXMA 3OHXC 1QCBD 1S40A 1ENCA 4BBRH 4NW2A 4A3LH 2IT1A 5I2XA 4X64Q 4P74A 3PGZA 1KTKA 3MC0B 3SK5A 1PLFA 3OMCA 4JI3L 3GTLH 3PO2B 4OO1G 1HFNA 3EN2A 3OWEB 1PYWD 3FKIH 3UI2A 4BXXG 1CQFA 1TS3A 1PFNA 1K28A 1EL0A 3KOJA 3QJYA 2AUJD 1EEFD 2PZTA 3JAMc 4G57A 4L5QA 5COYA 2EJGC 2ID0A 1IKLA 4KD3A 2I46A 1D5XC 2XIWA 5EBDA 1HRJA 2LS01 3I3CA 4WORA 1H95A 4JI7L 1Y14B 4TQUS 4L8JA 3J81E 4LK1C 3I91A 4R4CA 4BY1G 3I4MB 1IXRA 2IX0A 5IP9G 1EYAA 1Q3LA 5KIXA 3VYSA 1WTHA 3JC66 2ZM6Q 3Q24A 3KUPA 4IOCA 4MHEA 1F9SA 3M85A 3MAQA 3A5ZB 1VQ7A 5JJKA 1QG7A 1EY5A 4WJWA 2K28A 1TU2B 2RHSB 4JI4L 4NPSA 2PI2E 5TSSA 2L5TA 2NVQB 4RGTA 2O2LD 3EJIA 2MQHA 2A73B 1I4XA 1KNEA 4PQXA 3S1QB 2JQOA 3HOVG 1SEBD 3AMUA 5I6YA 2IY5B 4OWTB 3MHBA 5C4XB 4XQJA 1FL0A 1CTMA 3G48A 3HG9A 3M4OB 1NJIC 4HJ5A 5C0XI 2EIFA 1A15A 4AIMA 1YNND 3Q8DA 2N88A 2RF4A 2Z0SA 5DAUA 3GTPH 2PPBC 5GAGC 3X3MA 3GTQH 2P5ZX 3HOZH 1N36Q 1B9MA 2A69C 1QZGA 5BN3A 2CH4A 1UE5A 1Z47A 3DUZA 4R8IA 3GO5A 5BR8Q 4LFCQ 4XIGS 3DMUA 2L11A 1QNKA 1VQKA 3S1NH 4C3IB 4A93H 3M4OH 4OONA 3OOCA 1KDAA 1JB3A 2RCNA 3T53B 4FXKC 3U4ZA 4XT3B 5C4XG 2Q2TA 3K59A 1HNXQ 4CHTB 4DFAA 3VR3A 1SMXA 3ITPA 2EY2A 1STNA 4HN7A 1IKMA 2JA6G 4K5WA 4QJFA 3K5MA 1DOMA 1MSHA 4B3SL 3KF6A 2CWPA 2A6ED 2F0NA 3NENA 1EIFA 3I55A 1M8AA 1D1KA 1B8AA 2SDFA 2B63B 1QZHA 1RJTA 1V8QA 5D3IB 4BY7B 3G7LA 1Q12A 2KBNA 2JA5H 5L37A 1Y1VG 3CCLA 1X6OA 2E5LQ 4ZQ3A 3EIVA 3SDZA 1LT5D 1A8VA 2JXMB 3KF8B 1CKOA 4DV0Q 3A8JE 4IUTA 3F1ZA 1R4QB 4EQNA 4A3JB 4LF5Q 4P72A 1QUQB 4RFBA 5GADC 1HH2P 2C35B 1A3VA 3PIO3 1E2ZA 2QW7A 4GLVB 3M3YB 4HCEA 1YIJA 2SNMA 1ML0D 5IOCA 1HUMA 4BY7H 1PVOA 4C3HB 3I2ZA 3CF5A 2CH4W 4LFBQ 3PV0A 3HOUH 3ZJYC 1WTQA 3BDOA 3KJPA 4DAYA 5KNDA 4DUYQ 1SAPA 3GV3A 4AYBG 1Y1WH 3E9HA 3CC4A 1Y8OB 2B2YC 3CU7A 4V190 3L7ZC 1LT4D 4A3JH 5A2QE 5NUCA 2VXWA 2QCPX 2F0EA 5DLQE 1J8IA 2F0SA 5HGQA 1Z6HA 1H9RA 4JOIC 3M3YH 5M3MG 2M9VA 3VYUA 4C3HH 2J0TD 1C7YA 4X3UA 3QIAA 4E6IA 3CCJA 1LTBD 2PQAA 1WYDA 3MXNB 5DNFA 4V0BA 3HOXG 2VQEL 2G9DA 4DUZQ 3K7UC 2X6GA 4FF3A 4GKKQ 4YY3L 1GD7A 4HSPA 2F0HA 4H02A 5C44H 1ILQA 3F2UA 4EQ5A 4JBKA 1BF4A 3CC7A 1Q8IA 1WVLA 1BCPF 3HZXA 2ICEC 1QB5D 4KY6A 3DWPA 2I0QA 3PF4A 4ABNA 2K5WA 3KDFB 5LMUL 3I4MG 5FO7B 4PZ8A 4A3JG 1WTWA 5JPMC 3VR2A 5GAEC 3I4NH 1NR2A 5FJ8G 5JPNC 1FJGL 1B7YB 1I4RA 4JCVE 5FOBB 5LMUQ 4KHZA 1XPUA 3DEOA 1I4HA 3R93A 1Q7YC 1HR0Q 2B2VA 5D3DA 4IPDA 2JEBI 4DA2A 3E0JA 1G6ZA 2LFNA 3WOFA 1HZBA 2K5NA 2QDLA 5C44B 3F2CA 2LY7A 5JOBA 1VQNA 1PTOC 3NBHA 4A3DB 1I50B 4G7ZC 3BVZA 3I4NB 4JK1C 1SFOH 1P8LA 1PFSA 2L12A 2JA8H 2ZJQA 4K8IA 4YWKA 2XN9C 1GKHA 2ZXPA 4GZYC 2SOBA 4FO2A 3QO2A 1EFID 3S24A 3H09A 2B3GA 3TEHB 5CV8A 3PUYA 3T56B 3CRKC 4MTNA 1SNQA 1G291 1A2TA 3MEHA 4NB3A 3K8AA 2EE1A 3RN5A 4LF9Q 1PRTC 1MJCA 1EY4A 3S15H 2FJ2A 4JI1Q 2F3WA 1F9RA 3QR8A 2A69D 3PF5A 4BBRB 2YTXA 4WRDA 5M5WB 2F4VQ 3FKIB 1ESFA 3FEWX 3NQTA 2D0PA 1EY0A 1O78A 1DD2A 3ULJA 1GOZA 1SJHD 1WJJA 2PMZB 4F7XA 3UDFA 1YZ6A 2B2UC 4R1JA 5DM63 4HEDA 4C56C 4XXEA 3ER0A 4A3MB 1MGSA 1PA6A 1M4VA 1D7QA 2DJFC 1AP0A 3J81L 1L0XB 3MZ5A 3T16A 1DOKA 2AWOA 1PH3A 3CCRA 1U4LA 5IODA 4JW0A 5IE8A 1JOQA 5ELFA 4CJ2C 1ONLA 2MP1A 1BQQT 4XT1B 3DM3A 4K5XA 1WD0A 4EVOA 4A75A 5IYCH 3MXNA 1EOVA 1SE4A 1WTRA 4RGOS 2FHTA 1HR0W 3FP9A 1N32Q 4JG2A 4DV6Q 4F8MA 3RZOH 3K7AH 1MKHA 3SVMA 2O4XA 5IT9L 1VQAA 2ZXOA 3J80c 1K8MA 4C3JB 4DAVA 4A3CG 2Z4HA 1JICA 2N3SA 3CCSA 1BBUA 5E1FA 1NTGA 4DR4L 2AHOB 5C4XH 3Q23A 2K75A 4XTCS 4AQYQ 3S1RH 2IPKD 2MNAA 4OO1I 3RZDB 1HXYD 3CHBD 4X3TA 1W6KA 2R7ZH 1DZ1A 1KC8C 1YNJD 2FFKB 1YHBA 3K5NA 2UUCL 2E5LL 2V4DA 1X3QA 5DEHA 4BA2I 3GTQB 4UP7A 3MEFA 3F2BA 3HOWG 2Y0SG 4A3BB 3SXHA 4LAAA 1QUQA 1T5EA 2TMPA 4OWWB 3MVVA 4RHSA 4MZ9A 5LHY1 1XPRA 2UUBL 1DONA 4DAYB 4CJ1B 4X66L 5E3FA 4JVZA 3CCEA 1K3BC 3S1NB 1IBLL 5IP7H 1Q1EA 3P75A 3S1RB 4RHRA 5BN4A 1YHQA 1PRTB 4B3TL 3TZDA 5IYDH 3D6WA 4BXXH 3S14B 1K83B 1UAPA 2E2HB 2QEXA 1BKBA 1Q46A 3D4DA 1JC7A 2IW3A 3HOXB 3SGIA 4B3MQ 3UDIA 2BE5D 2BE5C 1B4OA 3I90A 1LACA 1IYJB 5K36G 1PTOB 2ZTDA 3U4VA 3I7FA 4DR1Q 1KL9A 4KHPQ 4L5SA 2O5IC 4IPHA 3Q22A 2DGYA 2F0QA 2FMCA 4QQBX 1PV4A 1VMPA 3CKIB 3LWUA 5K5PA 3IFDA 3KYHC 2BA0A 1D5ZC 2WACA 3K0YA 4K0KQ 3HOVB 3LX0A 1GO3E 1K83H 3BS1A 1RKNA 1TVXA 3S17B 2B39A 1EQRA 4X3KA 1VQ6A 1HTPA 1PTOD 2F4IA 1X55A 1J6QA 4NXNQ 4X6AH 5HURA 1Q90A 2JE6I 3VA5A 4IFDG 3GQBA 4ME5A 1W2BA 1EZ6A 5EKIA 1TIID 3DM1A 3CCVA 1TKWB 3KFUA 4IALA 4HIOA 3TSSA 3ND9A 4MTKA 4PZ6A 3R8BA 4LUVA 1WD1A 1X54A 2ZTEA 2B8GA 3HOUB 4PMCA 3EVQA 1Y1WG 2Q2UA 2XTIA 5T1GA 2ICIA 2JA7H 4IOAA 2WV6D 1AFPA 2N49A 3TP5A 1LTGD 4H13C 4DUZL 2N55A 1PXUA 4JI2L 4HJAA 2BCOA 4DGZA 5FO9B 2OF1A 2RDGA 1R9TB 2I5MX 5G3LD 3WWVA 5DM73 4ME3A 5FKAC 1TS4A 1PMRA 4Y52H 4K0KL 2JK8A 2Z8LA 2A8VA 1AZPA 1UEAB 1Y8NB 4A3LG 2LMCB 1EEID 1PYBA 2K33A 1TWGH 3CP0A 1GUNA 4MIUA 4TSSA 3K57A 2RSOA 2XWJB 5C3EH 1XMOQ 4U673 3GTOH 2R93H 3GTGH 1C48A 3HFZB 2D2CC 1S3OA 4IZ8A 2KHJA 4GNXB 1D5MC 1ICFB 2HDLA 1BDOA 4ODGA 3SHLA 1A62A 1NY4A 4LUOA 4BS9A 5M3FG 5M3MH 4A3MG 1F2ZA 1Y8PB 2OTLA 3H15A 3A8KE 5J22A 1J9OA 2ES2A 3BYYB 1PZID 4IFDJ 1UE6A 2KVMA 2WIIB 2NN6G 1XMOL 5D65A 3NPPA 2R61A 5C4ZA 4CKCA 3ULPA 2VZAA 1CZGA 2MUYA 4JI7Q 3S16B 3BJUA 2RQXA 2R93B 1E3PA 2E2IB 1EOTA 2K04A 3GTGB 2XSCA 1E2VA 1STAA 1JMCA 5IGBA 1QE6A 2JEAI 1XNQL 4LF4L 4OX9Q 1CFMA 4N8X1 1G2SA 4LFCL 3K5OA 3RN2A 1JOKA 4C3IG 1IW7C 2CFMA 2VY3A 3NTIA 2IHFA 2Q8IB 1T9HA 1O80A 1TWCB 1L0YB 4DR4Q 1WTOA 1BCPB 1VDZA 1KXLA 3GTMB 3SK8A 1I5FA 1HA6A 2DY7A 4HJ8A 1E22A 1HNZL 2WKCA 2SNSA 5CV4A 2MPMA 4KY5A 3FPPA 2K03A 4X3SA 1CA5A 4BY1B 1AH9A 2A6HD 1X3EA 1WTPA 3G6JB 4XDXA 3OSOA 4NKLA 2NUCA 1IBMQ 1QNUA 5IGDA 1V1PA 3VDYA 3HEJA 4X66Q 1VCIA 3FPUB 1NR4A 3DHQA 4B3RQ 4XYOA 1G91A 1TWHB 2CQAA 4LF8Q 2XVSA 5LL6S 1GUGA 4PZ7A 2KEDA 1OXVA 4UAIA 3RNUA 3PUZA 1N34L 2HT1A 1FR3A 1W3SA 4NP5A 4WJ4A 3PQIA 1I6HH 1K8AC 1EU3A 2YV5A 2L9HA 1D6EC 1HQMC 2I5LX 4WFN3 1QVCA 2NVTH 2NTTA 3A74A 4HMJA 2ATWA 1SNCA 4GOPC 2EOTA 3I4NG 4A3EB 1LABA 2R6GA 3HKSA 4CGYB 2CWAA 2OQ0A 1E1OA 1Q1BA 1TWFB 5HY6A 2ZT9C 3STBD 5KNBA 4JI6Q 1X9NA 3UDXA 2WAQB 2RHQB 4NMZA 2VQEQ 1IYUA 2IX3A 5KGUA 2EPBA 3MTSA 3M4QA 4DV5Q 1NE3A 5IYDG 1YHAA 2AWNA 2EYJA 4S3SA 1ZYRC 2OQKA 3JAMi 4KKUA 2EY5A 1LTTD 1DGSA 2A6HC 1CSPA 1MD2D 4RGNA 1B2TA 2H1EA 1SSOA 3PO3H 4A3EH 3MFYA 2GA4B 3RZDH 3DLLA 3CC2A 2VQFL 4QUFA 4POGA 3AQQA 1TWFH 3S9WA 4Y7NB 2NBFA 4QUCA 4A3FH 4JI8L 3TBIB 4O0AA 4DV2L 4A3EG 2MO0A 5I9OA 1OXSC 1TY0A 2HCCA 4DXGA 3HOWB 2F0IA 3OPOA 2LXJA 2KCMA 3M7GA 3BG3A 2A74C 2E2JB 2CW0D 2K5DA 2UXBL 1M90C 1STEA 4LW1A 4DK6C 3NXWA 4CDCC 1TWAB 2R92B 5IGGA 5KNCA 1NUCA 1Q86C 2RDHA 4ZUJA 4QB4A 2B2TA 4EX5A 2Q8TA 1W6JA 1GUWA 4QGUA 4DV5L 1IHZA 1M1KC 4DR3L 2QKIC 4C2MH 1SYFA 1YJ9A 2KOLA 2MFIA 2WB1G 2EYOA 3C1EA 5CYUA 3BDCA 5GAHC 2E2JH 1MIUA 4QIWE 2NVXH 1K3RA 4JI2Q 3NELA 1VQJA 2NZ1D 1SJED 1E24A 1ENFA 3KJOA 1VQPA 3FDTA 1HZAA 3D8GA 2VW9A 3FRPB 4DXFA 3HOVH 2B29A 2Z1CA 3SEBA 4DNRB 1EQTA 2L55A 3QB3A 1WCMB 2F0GA 2HQEA 1VQCA 2A19A 2G5DA 1MSGA 2O5JC 2D62A 2K05A 1FNWA 3P20A 4CBVA 2K01A 4BA1I 2JA8G 1CKMA 2FINB 2B2VC 2VS1A 2OEOA 3H3VC 2F0TA 4LF7L 3E9IA 1MHWC 3LGJA 1MI2A 5JEAG 2KCTA 3GTKB 4KJOA 3OWFA 2F4VL 1A3TA 2HIXA 2PCFB 4HJ7A 2JA7B 3HGBA 1H9JA 3BDLA 4R4IA 5C3WA 3BZCA 2AQ1B 3RMHA 4YCUA 3B6YA 3GTPB 3NEMA 5IT9E 2UU9L 5C3EG 1J5EL 1B3AA 1PRTF 2WB1B 5J39A 3HOZB 3KF8A 5EPLA 2VB2X 4ZKBB 4JC0A 2VUMH 4A3GH 2K1BA 5IP9H 1PH4A 1JR0D 3CPWA 2UXCL 1KDBA 2RVLA 1JORA 1SNDA 1I94L 5FO8B 4C3IH 4RGMA 4DK1A 2PW7A 1TWGB 1Y69U 1QVGA 2KA7A 3M7NA 1SN8A 4TKOB 4HMIA 2JA6H 5M3FB 2L4NA 5IIFA 1LTRD 3T1HL 4TVAB 1B1ZA 1D2BA 1F2YA 2EYLA 2XWBB 1EUJA 1AW7A 3DWAA 4FXGC 1KABA 1IBML 1PFBA 1HNZQ 4A93G 3ERSX 1PH1A 1LUZA 5ELEA 4A3GB 2N8NA 2VUMB 2GN5A 1SDFA 2PO4A 5KRUA 4UPAA 4XQNA 1RL2A 2NN6I 1QVFA 4K2KA 4KHPL 2Q2HA 3KF6B 5M5YH 2X6LA 3CCMA 1JB7A 1PH9A 2ALYB 2AUKA 3H0GH 3J81i 1UNSA 4L5TA 1VQBA 1A3UA 3SE0A 2F0MA 1N36L 1LO5D 3HKZB 2PNHA 1VQDA 4DNTB 1RDPD 4HSVA 1L1OB 2BDNA 5A2QL 3NSWA 4FVMA 1VQOA 4ID6A 4DR2Q 1STBA 1STHA 1EZ8A 5IWAQ 3NQIA 3HOZG 3PCOB 4K8JA 4FF1A 4ZRZA 2K14A 5EQ0A 4DK3C 1TWCH 3K80C 1OXTA 1PYSB 4DV6L 4A93B 5IT9c 1FNVA 3ULLA 3IRBA 2KCCA 1ET9A 1HUNA 1LTLA 1K73C 1B44D 4JI8Q 4A3IH 5C3XA 1HZCA 1VQ5A 4JI0L 1N33L 1XPOA 3WOEA 2R7DA 2RKSA 3SK4A 5EPKA 4B9XA 2AMCB 1TT2A 4IFDH 4GLAC 5CGKA 2F1MA 3ND8A 3FHWA 5C4JB 4LF5L 4AQYL 4A76A 5T1IA 4LFBL 4DR5Q 1CSQA 1E2WA 5GROA 1E7ZA 2DUDA 2RCFA 3D6CA 1K8GA 4C1NK 3CXCA 4DR6L 2EDGA 2IJ0A 4HCSA 3RUZA 4EGVA 2HDMA 3H3VH 4F87A 1NMGA 4AYBB 1IYVA 2F0UA 1PRTD 4ZAIA 2NYZD 1VQHA 1KLGD 1PFMA 1WFQA 4KMUC 4LFAQ 1I6HB 3OIQA 1IBKL 3WDNA 1H9SB 4PNYA 2RA4A 2QILA 1BNZA 4A3FG 4IJLA 3S1MB 2IL8A 2K52A 1JOOA 2I07B 3CW2C 2RDFA 3TS0A 1HHVA 5HGTA 1X3GA 4G4KA 1C8CA 3CPFA 1XTCD 1SE8A 1JE5A 1VQEA 3A7AB 1CM9A 1BXTA 3PUXA 1KRTA 3T1YL 4UDUC 1FGBD 4DV4L 1SE2A 2EZVA 1UEBA 2PZUA 3T1YQ 5EGTA 1CHQD 5E7NA 1F2LA 2WAQE 3CAMA 2OCEA 4GNXC 2B2TC 1UE7A 2KHIA 4F88A 3BZKA 4BY7G 3RD4A 4DR6Q 2NTSA 2EJFC 2GVAA 3GTLB 3EQLC 3PO2H 2JA8B 2M00A 2MHVA 3N6RA 2R7ZG 1KAAA 3HOYG 1SNPA 1U4RA 3ONAB 4JV5L 1KDCA 2DNCA 5ISRA 1YI2A 2KQ3A 3I72A 2M2LA 3C3LA 2EJMA 4AYBE 1WTXA 5CBEE 4JPBW 4YY3Q 3AYHB 3M9BA 4DR1L 4X65L 3NE5B 3K5LA 4OIKA 4RCOA 4LF7Q 4R4QA 3U9OA 4LMQD 3DXJC 4NDXA 3U9SA 1K8OA 2MGSA 4P75A 2R92G 1VQ4A 3W3AA 1SMYD 3CD6A 4OXPA 4RAUC 1GM5A 3U58A 4L5RC 3UDGA 2NZHA 5JEAH 2X69A 1V1PB 1YNJC 1JJGA 2JJQA 3G71A 2BH2A 2DJGC 2WAQG 1I50H 2KUMA 1N9WA 4GS3A 4POFA 4MN3A 2KECA 2PQEA 3GTJH 3NTKA 1A6XA 1CUKA 1AZQA 1RIPA 2G9HD 1PH2A 3HKZE 3NP8A 2A5HA 4Q0FA 3A56A 3IL8A 1TQOA 4H0LC 1SNOA 3BU2A 5C0XG 1S5BD 2R3ZA 1XYIA 5FLXL 1FYCA 1HCZA 4DR7Q 1Q81C 4JI5Q 4DR3Q 4ILWA 4IUVA 1JWSD 2VUMG 1WCMH 4A3GG 3ICEA 4LF9L 2ZJPA 1R4PB 1Q82C 2EYPA 5CV7A 3T1HQ 1U4MA 3A7LA 4DNIA 1FGUA 2DY8A 1L0WA 1B70B 2B2WC 1NNXA 1ENAA 1GUSA 3OYYA 3J7A5 1YEZA 3I4MH 1S5FD 3GTJB 1SYDA 1FD7D 4I65A 3K6OA 3OTOQ 3A0JA 3L2PA 3CMEA 4LUZA 3VA7A 2XRQD 1BR9A 1IW7D 1WOCA 4DPGA 4GN3B 3IAYA 3AU7A 3H94A 1LLRD 2JA9A 3F8TA 1V9PA 2HQLA 3D4RA 2NB0A 2YU9H 3V2TA 4JOIA 4KI0A 2J7ZA 3M4YA 4FF2A 3W1GA 2CCZA 3NBIA 5IYCG 4MNOA 3T13A 3J7AV 1HTLD 1SROA 4J15A 1VQ9A 1H9SA 3T4AC 1J5EQ 4B3TQ 1LTID 2UXDL 2JSOA 2NVQH 2PNRC 4UHVA 4EQOA 4KY7A 4L63B 1HA5A 5EKKA 4RG1A 3HRZC 3J80E 4DV1L 4J1MA 3S1QH 4UP8A 2B8FA 3CMAA 2F0PA 3PUVA 4R9WA 2DN8A 1EYDA 1YITA 2BOSA 1WI5A 5C6AA 2F0FA 2YU9B 1RTOA 3P7JA 4FP5D 3QOJA 2F3IA 5IWAL 1VQ8A 5I9PA 2JA5B 1D1IA 5KEEA 1OXXK 2JA6B 1XNRL 3S14H 2B2WA 3TQYA 3K7AB 3E3XA 4DU9A 1Y1VH 5BN5A 1EQVA 5CC4A 1G6PA 4A4IA 4BBSH 2E75C 4DAPA 2XGTA 3DEPA 2KENA 2Z6KA 2HHHL 3NTHA 4Z9CB 2AKWB 1EIGA 1GXDC 1C0AA 1OTCA 5FJ8H 3BVGA 4ZCKA 3K81C 4LNQA 1XXGA 4KN7C 4DV3L 3JAME 4YCVA 5IYBH 1IBLQ 3RLOA 4JYAQ 1EY6A 1SYEA 3J80i 5IY0A 4IURA 2H4OA 2EYHA 1DJRD 1TR5A 4GN4B 5LMNL 3W1BA 4A3KB 4B3RL 3I8ZA 4ZLTF 1LV9A 2JA7G 1VS0A 4OEMB 2V1CC 3TN2A 4ZK9B 4ZYSA 4DUYL 4JYAL 5M5XH 3O13A 4HJ9A 1ZYRD 2N78A 4BBSB 1TS5A 2B63G 1OO9B 3I4OA 1SYBA 4YIJA 3PO2G 5CV6A 1S5DD 4A3DG 1HPCA 4CDDC 2B63H 1LTSD 4IUQA 2F0OA 2F0LA 4KJNA 3V05A 3CCQA 1X32A 3H3VI 4IUNA 4OO1H 3LNNA 3R2TA 3PIOA 4R8NA 3LWEA 1S4ZA 1HFGA 4A3IB 1HNWQ 5K36H 3HOXH 5M5XB 1SYGA 1LM0A 1YVCA 4LJZC 4N9PA 1KD1C 1V1OA 2KJXA 1VMCA 4H7BA 1PTOH 1XMQL 1PH5A 4LWCA 5C4JH 3I56A 1R9TH 2F03A 2K5QA 1LT3D 1HQRD 5JVG3 1I4GA 1ESRA 3C46A 1H9KA 4JBJA 1B3QA 3IFTA 2A68C 4GKJL 2H5XA 1YJWA 1BCPD 4FNFA 2K50A 3TP7A 1Y1WB 3AFPA 3R2IA 2VQFQ 2NWGA 4YHHQ 2QEJC 3VYTA 2CQOA 1CZWA 4GNXA 3BVMA 5G3LF 2XNAC 4NXML 3OIPA 3A8IE 2UXBQ 4X64L 4A3DH 4IO9A 1QILA 2YTVA 2F0KA 4IUUA 1ICWA 3EROA 3S1MH 2GVBA 1EQQA 1SFOB 2A6EC 3W5OA 2F0JA 3X3NA 4C3JG 1SE3A 2E76C 2I5HA 5KYIA 1S5ED 2F0VA 3BZDB 5IGFA 4AH6A 2Q8RE 4NXMQ 1CA6A 3H91A 3TREA 3J7ZC 4DR7L 1AE3A 5JEAJ 1PH6A 2BA1A 1N32L 1YJNA 4IFDI 1IZ6A 1X3FA 4DF7A 1AE2A 2C9OA 3TMEA 1XJVA 1B50A 4JI1L 1YBYA 3CCUA 1O7LA 1AEXA 4X65Q 1QWYA 1II3A 5M5WH 4X62Q 4ZKCB 2E8GA 1P16A 4P71A 2A68D 4KD4A 1E1TA 2LSSA 3GD7A 3TZUA 2BH8A 3J7AF 5C3EB 1JJ2A 4A3MH 4CKBA 4K6DA 4I7ZC 2VB3X 3FMCA 4OGQC 1I94Q 2F0DA 1BOSA 3PMFA 1RODA 1S5CD 1CQVA 4FF4A 3OMGA 1IL8A 5H1SE 3T51B 5EPJA 3NWSA 2UUAL 4LF6Q 1PZKD 5AFWA 1FJGQ 1F9QA 1S72A 2EXZA 4U68A 1ZEQX 3FKIG 4DAMA 4JBMA 1NSNS 5FLMH 5F2DA 3V96A 1GUOA 3QWNA 2F52A 2PQAB 5EKLA 5C0XH 4RKLA 2PMZE 1CK1A 4JI4Q 3S16H 1SR3A 4OX9L 1K0SA 1A2UA 1CI3M 4KTAA 4DV3Q 2K5VA 3KK7A 3S15B 3Q6SA 3J81c 3RZOB 2KHSA 2Y0SE 3K0XA 5A35A 4FYDA 5ELOA 4G7OC 2B2YA 3TDQA 4IJHA 1VQIA 4C3JH 3QOLA 4LFAL 1KRSA
chains in the Genus database with same CATH topology
1VQLA 2UUAQ 4AQYL 2UXCQ 4A76A 4HIOA 4LFBL 4DR5Q 1CSQA 3S2DH 5GROA 1E7ZA 4YWMA 1X65A 4PZ6A 2DUDA 1Q8KA 4LUVA 1X54A 1K8GA 2ZTEA 3JC66 3CXCA 4DR6L 1Y1WG 2ZM6Q 2Q2UA 2XTIA 3H3VH 4ALPA 1KAWA 4IOCA 2JA7H 3M85A 2VNUD 4GN5A 3HOUG 4IOAA 1NMGA 3A5ZB 1VQ7A 5JJKA 2N49A 4DUZL 1VQHA 4LF6L 2RHSB 4JI4L 4NPSA 4DKAC 4DV1Q 4JI2L 1IL2A 1WFQA 4HJAA 2PI2E 4LFAQ 1KIXA 3EBEA 2UUCQ 1IBKL 4HIKA 1JJCB 2I5MX 2MQHA 4O2DA 4RMFA 4A3BH 2A1AA 4LF8L 3WWVA 5GQOA 4ME3A 1NBWA 3AEVA 5AJ3L 4IPGA 2JQOA 4A3FG 4IJLA 1LYLA 2EQSA 2K52A 4Y52H 1ASZA 3HOVG 3CW2C 4K0KL 4JBWA 4BBSG 3TS0A 2JK8A 2A8VA 2IY5B 4OWTB 2PI2A 1X3GA 1EYGA 4A3LG 3CPFA 1FL0A 3G48A 2YYZA 1SE8A 1JE5A 1PYBA 3CP0A 1TWGH 1VQEA 5C0XI 4HJ5A 1NJIC 2EIFA 3PUXA 5IP7G 4AIMA 5C3EH 1XMOQ 1KRTA 3GTOH 3T1YL 3Q8DA 4DV4L 2R93H 3GTGH 3HFZB 1S3OA 3NBHB 1JT8A 2RF4A 2KHJA 2Z0SA 4GNXB 3GTPH 1UEBA 5GAGC 1A62A 1NY4A 3KLWA 4LUOA 3T1YQ 5E7NA 5M3MH 5M3FG 4A3MG 4P73A 1N36Q 2WAQE 3GTQH 3HOZH 3PO3G 1K9MC 3CAMA 1QZGA 2OCEA 4GNXC 3H15A 1I3QH 4A3IG 1UE5A 1Z47A 2OTLA 1UE7A 2KHIA 3BZKA 2ES2A 4BY7G 4DR6Q 3GO5A 5BR8Q 1MJEA 4LFCQ 3TRZA 4IFDJ 2K5HA 4XIGS 1EIYB 2GVAA 4DR2L 1UE6A 1VQKA 3PO2H 1KQSA 3PUWA 3S1NH 2NN6G 1XMOL 2R7ZG 4A93H 3HOYG 3M4OH 4OONA 1A63A 4JV5L 5C44G 4DV4Q 1YI2A 2RCNA 2NZOA 1BVSA 3ULPA 2VZAA 4JI0Q 3U4ZA 4JI7Q 4AYBE 3G6EA 3BJUA 5C4XG 3S17H 1E3PA 2Q2TA 1HNXQ 1JMCA 1KHIA 1SMXA 4YY3Q 3AYHB 2JEAI 3M9BA 4DR1L 1XNQL 4X65L 4A3CH 2JA6G 2CKZB 4LF4L 4OX9Q 4QJFA 4LF7Q 1NMFA 4R4QA 4LFCL 4B3SL 3KF6A 3RN2A 2CWPA 1N8RC 1HJPA 2L15A 4P75A 4YCWA 3NENA 1EIFA 2CFMA 2VY3A 3I55A 2R92G 1Z9FA 1B8AA 1VQ4A 2IHFA 1QZHA 1T9HA 3CD6A 5IYBG 1Q12A 4OXPA 1GM5A 2KBNA 3U58A 4Y7NH 5LMNQ 2JA5H 4L5RC 1Y1VG 4DR4Q 3UDGA 3CCLA 1X6OA 2NZHA 2E5LQ 4A3KH 2E2HH 3EIVA 4HIDA 1KXLA 5JJIA 1JJGA 1A8VA 3D0FA 3PIPA 3KF8B 1CKOA 1I5FA 2HIVA 4JV5Q 4DV0Q 2JJQA 3G71A 4B3SQ 2BH2A 4HJ8A 1TXYA 1E22A 2WAQG 3F1ZA 1I50H 4GS3A 1N9WA 1HNZL 4LF5Q 4POFA 4P72A 4HIMA 3GTJH 1QUQB 4DR5L 1CUKA 2LXKA 2R7FA 5GADC 1RIPA 1HH2P 2C35B 2IHEA 2YTYA 3HKZE 1PH2A 2UU9Q 1AH9A 4GLVB 4GOPB 1YIJA 1X3EA 3KFUA 1CKNA 3BU2A 1TWAH 5C0XG 2QA4A 1PVOA 4DV7L 1IBMQ 4BY7H 3I2ZA 3CF5A 5EAYA 3VDYA 1L2FA 4DR7Q 4X62L 4X66Q 1Q81C 4LFBQ 4JI5Q 1VCIA 3PV0A 4DR3Q 3HOUH 3ZJYC 4APVA 4B3RQ 5FLMG 1EWIA 3KJPA 4DUYQ 2VUMG 1WCMH 1FVIA 3RR5A 4A3GG 1Y1WH 4AYBG 3CC4A 3E9HA 2ZJPA 4LF8Q 4LF9L 3ICEA 1Q82C 4PZ7A 1OXVA 3T1HQ 4DNIA 1FGUA 3L7ZC 3RNUA 1XMQQ 3PUZA 1B70B 1L0WA 1N34L 1GVPA 1W3SA 4A3JH 2HT1A 1VQMA 1UE1A 3OYYA 3J7A5 3I4MH 1YEZA 3OTOQ 4WJ4A 1I6HH 5DLQE 3A0JA 3L2PA 3CMEA 4LUZA 1K8AC 2YV5A 3UE0A 5HGQA 2WB1E 4JOIC 3M3YH 5M3MG 4DPGA 1WOCA 2I5LX 1QVCA 4GN3B 2NVTH 3A74A 5J3BA 4C3HH 2JA9A 3F8TA 1C7YA 1V9PA 2HQLA 2ATWA 3CCJA 2PQAA 4GOPC 1WYDA 3MXNB 3RLNA 2YU9H 3I4NG 4JOIA 2R6GA 3HKSA 4KI0A 4PMWA 3HOXG 2VQEL 2CWAA 3W1GA 2OQ0A 1E1OA 1Q1BA 5HY6A 5IYCG 3K7UC 3STBD 4MNOA 4DUZQ 1X9NA 2CCZA 4JI6Q 4GKKQ 3UDXA 3J81j 4PG3A 2RHQB 1SROA 4J15A 4YY3L 1GD7A 1HR0L 1VQ9A 2VQEQ 2OTJA 4JI5L 1J5EQ 2E2IH 4UP9A 4B3TQ 2UXDL 4H02A 5C44H 3M4QA 4R4TA 4DV5Q 1SRUA 4EQ5A 4JBKA 4QL5A 2OWOA 2NVQH 1NE3A 5IYDG 4R4OA 4IPCA 1YHAA 2AWNA 3CC7A 2OQKA 3JAMi 2I0QA 3PF4A 2UXDQ 2FXQA 4RG1A 3KDFB 5LMUL 4DV1L 3I4MG 1DGSA 4PZ8A 4UP8A 4A3JG 3S1QH 3CMAA 5GAEC 1CSPA 3PUVA 3I4NH 4LF4Q 5FJ8G 1YNXA 1FJGL 1B7YB 4JCVE 1YITA 5LMUQ 1WI5A 3GTKH 3PO3H 2ZTCA 4A3EH 3U50C 2EXDA 4KHZA 1XPUA 3RZDH 3DLLA 3CC2A 2VQFL 1Q7YC 2F3IA 5IWAL 3A5UA 4POGA 3AQQA 1TWFH 1SLJA 1VQFA 4A3FH 1HR0Q 3PSIA 1VQ8A 4JI8L 2ASBA 4IPDA 2JEBI 4O0AA 5C0XJ 2R93G 1OXXK 4DV2L 4A3EG 1XNQQ 1XNRL 3S14H 1HZBA 2K5NA 4OWXB 2MO0A 3KDFA 3F2CA 3TQYA 3GTMH 1VQNA 1OXSC 2VL6A 1Y1VH 1L1OA 3RLFA 2LXJA 4YWLA 1PH7A 1G6PA 2KCMA 4A4IA 4BBSH 1OXUA 2XGTA 2UXBL 2ZJRA 1M90C 2WP8J 2KENA 4LW1A 4DK6C 1SFOH 4BY1H 1P8LA 1PFSA 2Z6KA 2HHHL 2AKWB 2JA8H 2ZJQA 4YWKA 1GKHA 1C0AA 1Q86C 5FJ8H 1OTCA 4LNQA 3K81C 4EX5A 3M4PA 3S24A 4DV3L 4YCVA 5IYBH 2B3GA 3TEHB 1IBLQ 4WJ3M 3RLOA 4QGUA 4DV5L 4JYAQ 3J80i 5IY0A 3PUYA 1HZ9A 1PH8A 1M1KC 4B3RL 4MTNA 5LMNL 1G291 4GN4B 3W1BA 4C2MH 4NB3A 3K8AA 4DR3L 3RN5A 1YJ9A 1VS0A 2JA7G 2MFIA 2V1CC 3L0OA 5M3FH 2WB1G 3OTOL 4JI6L 4DUYL 1MJCA 5M5XH 4JYAL 3S15H 4JI1Q 5GAHC 3H0GG 4HJ9A 3HKZG 2E2JH 1V1QA 1MIUA 2N78A 1HNWL 4LF9Q 2B63G 3PF5A 4QIWE 3I4OA 4DV0L 1HNXL 2NVXH 3D31A 1K3RA 2YTXA 1N33Q 3PO2G 4JI2Q 3NELA 4A3DG 1VQJA 1E24A 1VQPA 3KJOA 1X56A 2F4VQ 1HZAA 2B63H 2D0PA 2VW9A 1XTDA 3CCQA 3ULJA 5FLXc 5AJ3Q 1WJJA 1WCMG 2HHHQ 3H3VI 3HOVH 2B29A 3UDFA 1YZ6A 4R1JA 3PIOA 3ER0A 1A0IA 1PA6A 1D7QA 2K4KA 1HNWQ 3HOXH 1VQCA 4DV2Q 2A19A 1LM0A 1CKNB 1YVCA 2AWOA 1KD1C 1PH3A 3CCRA 2D62A 1U0LA 5IE8A 2JA8G 4BA1I 5ELNA 1BBWA 1CKMA 1XMQL 1PH5A 1V43A 4LWCA 5C4JH 3I56A 1R9TH 3DM3A 2VS1A 1IBKQ 1O7IA 4LF7L 3E9IA 4A75A 5IYCH 4GOPA 3LGJA 4JBJA 4FDBA 4A3BG 1EOVA 5JEAG 2KCTA 4GKJL 4A3KG 2H5XA 1YJWA 2F4VL 2K50A 3F2DA 4HJ7A 2HIXA 1HR0W 1TWHH 3FP9A 3STBC 1N32Q 4JG2A 4DV6Q 3AFPA 4R4IA 2VQFQ 4YHHQ 3G4SA 2CQOA 4NXNL 4GNXA 3E0EA 3BZCA 2NVYH 4NXML 3RZOH 2Q2IA 1MKHA 3K7AH 3TS2A 4YCUA 3B6YA 3NEMA 2UU9L 5C3EG 1J5EL 2UXBQ 3GDEA 4X64L 5BR8L 2YTVA 4IO9A 4A3DH 1VQAA 3J80c 2IX1A 4B3ML 4A3CG 1VQGA 3AFQA 4GLXA 2Z6KC 4KLKA 3S1MH 2GVBA 1EQQA 2D0OA 1EFWA 2N3SA 3W5OA 3CCSA 1BBUA 2VUMH 4JC0A 4A3GH 1NTGA 4DR4L 2AHOB 5IP9H 5C4XH 1PH4A 2I5HA 3CPWA 2K75A 4XTCS 4AQYQ 2UXCL 2R92H 3OW2A 1XNRQ 3S1RH 4GKKL 2MNAA 1I94L 4AH6A 4C3IH 2MO1A 4OO1I 4NXMQ 1QVGA 3M7NA 3TREA 1N34Q 3J7ZC 1SN8A 2R7ZH 4DR7L 3S2HH 1C9OA 2JA6H 1AE3A 5JEAJ 2JA5G 5JJLA 1KC8C 1L1OC 1PH6A 2BA1A 1N32L 1YHBA 2UUCL 1YJNA 2E5LL 4IFDI 1IZ6A 1X3FA 1PHJA 1AE2A 4YHHL 4BA2I 4QY7A 4UP7A 4TVAB 3T1HL 3MEFA 3F2BA 2UUBQ 3HOWG 1XJVA 2Y0SG 4LF5L 1EUJA 4JI1L 1YBYA 1G51A 1QUQA 3CCUA 4X65Q 4DV7Q 1IBML 2WFWA 1HNZQ 4OWWB 4GKJQ 1XPRA 4MZ9A 3ERSX 4A93G 5M5WH 2UUBL 1PH1A 1LUZA 4DAYB 2N8NA 4X66L 2GN5A 4BBRG 4X62Q 2E8GA 4UPAA 1ASYA 1K0RA 1P16A 4P71A 3CCEA 1RL2A 2NN6I 5IP7H 1E1TA 1IBLL 1QVFA 1Q1EA 4KHPL 2Q2HA 3KF6B 5M5YH 3CCMA 1YHQA 5LMNW 2LSSA 3CQZH 3GD7A 4B3TL 4JI3Q 1JB7A 1PH9A 2BH8A 3UE1A 1UWVA 2ALYB 4UY8C 4BXXH 3H0GH 5IYDH 3J81i 1JJ2A 4A3MH 4L5TA 1VQBA 2QEXA 1BKBA 1Q46A 2QGQA 2ZM6L 1I94Q 3HOYH 3HOWH 1N36L 3SGIA 4B3MQ 3UDIA 1D8LA 1VQDA 2PNHA 1U5KA 5H1SE 1L1OB 2UUAL 1IYJB 4LF6Q 1FJGQ 1S40A 5K36G 2ZTDA 3U4VA 1VQOA 1S72A 3I7FA 4BBRH 4DR1Q 1KL9A 4DR2Q 4L5SA 4KHPQ 2IT1A 4A3LH 4X64Q 4IPHA 3PGZA 4P74A 3FKIG 5IWAQ 4DAMA 3HOZG 4JI3L 2DGYA 4JBMA 3GTLH 3PCOB 4OO1G 3EN2A 4QQBX 5FLMH 2K14A 4DK3C 3FKIH 1TWCH 3K80C 1OXTA 1PYSB 4DV6L 1PV4A 4BXXG 5IT9c 2F52A 2PQAB 2BA0A 3KOJA 3KYHC 3ULLA 3IRBA 4K0KQ 3JAMc 1GO3E 4L5QA 1K83H 2ID0A 2PMZE 4JI4Q 3S16H 1EQRA 1SR3A 1LTLA 1K73C 4OX9L 1VQ6A 4JI8Q 4A3IH 4DV3Q 2K5VA 1H95A 1HZCA 3J81c 1Y14B 4TQUS 1X55A 1VQ5A 1J6QA 4JI0L 4JI7L 4NXNQ 1N33L 1XPOA 4X6AH 2Y0SE 4R4CA 2JE6I 3K0XA 4BY1G 2R7DA 4IFDG 5ELOA 1IXRA 4IJHA 2AMCB 1VQIA 1W2BA 2IX0A 5IP9G 4GLAC 4C3JH 3FHWA 4LFAL 3CCVA 1KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL A;  2UUA Q;  4AQY L;  2UXC Q;  4A76 A;  4HIO A;  4LFB L;  4DR5 Q;  1CSQ A;  3S2D H;  5GRO A;  1E7Z A;  4YWM A;  1X65 A;  4PZ6 A;  2DUD A;  1Q8K A;  4LUV A;  1X54 A;  1K8G A;  2ZTE A;  3JC6 6;  3CXC A;  4DR6 L;  1Y1W G;  2ZM6 Q;  2Q2U A;  2XTI A;  3H3V H;  4ALP A;  1KAW A;  4IOC A;  2JA7 H;  3M85 A;  2VNU D;  4GN5 A;  3HOU G;  4IOA A;  1NMG A;  3A5Z B;  1VQ7 A;  5JJK A;  2N49 A;  4DUZ L;  1VQH A;  4LF6 L;  2RHS B;  4JI4 L;  4NPS A;  4DKA C;  4DV1 Q;  4JI2 L;  1IL2 A;  1WFQ A;  4HJA A;  2PI2 E;  4LFA Q;  1KIX A;  3EBE A;  2UUC Q;  1IBK L;  4HIK A;  1JJC B;  2I5M X;  2MQH A;  4O2D A;  4RMF A;  4A3B H;  2A1A A;  4LF8 L;  3WWV A;  5GQO A;  4ME3 A;  1NBW A;  3AEV A;  5AJ3 L;  4IPG A;  2JQO A;  4A3F G;  4IJL A;  1LYL A;  2EQS A;  2K52 A;  4Y52 H;  1ASZ A;  3HOV G;  3CW2 C;  4K0K L;  4JBW A;  4BBS G;  3TS0 A;  2JK8 A;  2A8V A;  2IY5 B;  4OWT B;  2PI2 A;  1X3G A;  1EYG A;  4A3L G;  3CPF A;  1FL0 A;  3G48 A;  2YYZ A;  1SE8 A;  1JE5 A;  1PYB A;  3CP0 A;  1TWG H;  1VQE A;  5C0X I;  4HJ5 A;  1NJI C;  2EIF A;  3PUX A;  5IP7 G;  4AIM A;  5C3E H;  1XMO Q;  1KRT A;  3GTO H;  3T1Y L;  3Q8D A;  4DV4 L;  2R93 H;  3GTG H;  3HFZ B;  1S3O A;  3NBH B;  1JT8 A;  2RF4 A;  2KHJ A;  2Z0S A;  4GNX B;  3GTP H;  1UEB A;  5GAG C;  1A62 A;  1NY4 A;  3KLW A;  4LUO A;  3T1Y Q;  5E7N A;  5M3M H;  5M3F G;  4A3M G;  4P73 A;  1N36 Q;  2WAQ E;  3GTQ H;  3HOZ H;  3PO3 G;  1K9M C;  3CAM A;  1QZG A;  2OCE A;  4GNX C;  3H15 A;  1I3Q H;  4A3I G;  1UE5 A;  1Z47 A;  2OTL A;  1UE7 A;  2KHI A;  3BZK A;  2ES2 A;  4BY7 G;  4DR6 Q;  3GO5 A;  5BR8 Q;  1MJE A;  4LFC Q;  3TRZ A;  4IFD J;  2K5H A;  4XIG S;  1EIY B;  2GVA A;  4DR2 L;  1UE6 A;  1VQK A;  3PO2 H;  1KQS A;  3PUW A;  3S1N H;  2NN6 G;  1XMO L;  2R7Z G;  4A93 H;  3HOY G;  3M4O H;  4OON A;  1A63 A;  4JV5 L;  5C44 G;  4DV4 Q;  1YI2 A;  2RCN A;  2NZO A;  1BVS A;  3ULP A;  2VZA A;  4JI0 Q;  3U4Z A;  4JI7 Q;  4AYB E;  3G6E A;  3BJU A;  5C4X G;  3S17 H;  1E3P A;  2Q2T A;  1HNX Q;  1JMC A;  1KHI A;  1SMX A;  4YY3 Q;  3AYH B;  2JEA I;  3M9B A;  4DR1 L;  1XNQ L;  4X65 L;  4A3C H;  2JA6 G;  2CKZ B;  4LF4 L;  4OX9 Q;  4QJF A;  4LF7 Q;  1NMF A;  4R4Q A;  4LFC L;  4B3S L;  3KF6 A;  3RN2 A;  2CWP A;  1N8R C;  1HJP A;  2L15 A;  4P75 A;  4YCW A;  3NEN A;  1EIF A;  2CFM A;  2VY3 A;  3I55 A;  2R92 G;  1Z9F A;  1B8A A;  1VQ4 A;  2IHF A;  1QZH A;  1T9H A;  3CD6 A;  5IYB G;  1Q12 A;  4OXP A;  1GM5 A;  2KBN A;  3U58 A;  4Y7N H;  5LMN Q;  2JA5 H;  4L5R C;  1Y1V G;  4DR4 Q;  3UDG A;  3CCL A;  1X6O A;  2NZH A;  2E5L Q;  4A3K H;  2E2H H;  3EIV A;  4HID A;  1KXL A;  5JJI A;  1JJG A;  1A8V A;  3D0F A;  3PIP A;  3KF8 B;  1CKO A;  1I5F A;  2HIV A;  4JV5 Q;  4DV0 Q;  2JJQ A;  3G71 A;  4B3S Q;  2BH2 A;  4HJ8 A;  1TXY A;  1E22 A;  2WAQ G;  3F1Z A;  1I50 H;  4GS3 A;  1N9W A;  1HNZ L;  4LF5 Q;  4POF A;  4P72 A;  4HIM A;  3GTJ H;  1QUQ B;  4DR5 L;  1CUK A;  2LXK A;  2R7F A;  5GAD C;  1RIP A;  1HH2 P;  2C35 B;  2IHE A;  2YTY A;  3HKZ E;  1PH2 A;  2UU9 Q;  1AH9 A;  4GLV B;  4GOP B;  1YIJ A;  1X3E A;  3KFU A;  1CKN A;  3BU2 A;  1TWA H;  5C0X G;  2QA4 A;  1PVO A;  4DV7 L;  1IBM Q;  4BY7 H;  3I2Z A;  3CF5 A;  5EAY A;  3VDY A;  1L2F A;  4DR7 Q;  4X62 L;  4X66 Q;  1Q81 C;  4LFB Q;  4JI5 Q;  1VCI A;  3PV0 A;  4DR3 Q;  3HOU H;  3ZJY C;  4APV A;  4B3R Q;  5FLM G;  1EWI A;  3KJP A;  4DUY Q;  2VUM G;  1WCM H;  1FVI A;  3RR5 A;  4A3G G;  1Y1W H;  4AYB G;  3CC4 A;  3E9H A;  2ZJP A;  4LF8 Q;  4LF9 L;  3ICE A;  1Q82 C;  4PZ7 A;  1OXV A;  3T1H Q;  4DNI A;  1FGU A;  3L7Z C;  3RNU A;  1XMQ Q;  3PUZ A;  1B70 B;  1L0W A;  1N34 L;  1GVP A;  1W3S A;  4A3J H;  2HT1 A;  1VQM A;  1UE1 A;  3OYY A;  3J7A 5;  3I4M H;  1YEZ A;  3OTO Q;  4WJ4 A;  1I6H H;  5DLQ E;  3A0J A;  3L2P A;  3CME A;  4LUZ A;  1K8A C;  2YV5 A;  3UE0 A;  5HGQ A;  2WB1 E;  4JOI C;  3M3Y H;  5M3M G;  4DPG A;  1WOC A;  2I5L X;  1QVC A;  4GN3 B;  2NVT H;  3A74 A;  5J3B A;  4C3H H;  2JA9 A;  3F8T A;  1C7Y A;  1V9P A;  2HQL A;  2ATW A;  3CCJ A;  2PQA A;  4GOP C;  1WYD A;  3MXN B;  3RLN A;  2YU9 H;  3I4N G;  4JOI A;  2R6G A;  3HKS A;  4KI0 A;  4PMW A;  3HOX G;  2VQE L;  2CWA A;  3W1G A;  2OQ0 A;  1E1O A;  1Q1B A;  5HY6 A;  5IYC G;  3K7U C;  3STB D;  4MNO A;  4DUZ Q;  1X9N A;  2CCZ A;  4JI6 Q;  4GKK Q;  3UDX A;  3J81 j;  4PG3 A;  2RHQ B;  1SRO A;  4J15 A;  4YY3 L;  1GD7 A;  1HR0 L;  1VQ9 A;  2VQE Q;  2OTJ A;  4JI5 L;  1J5E Q;  2E2I H;  4UP9 A;  4B3T Q;  2UXD L;  4H02 A;  5C44 H;  3M4Q A;  4R4T A;  4DV5 Q;  1SRU A;  4EQ5 A;  4JBK A;  4QL5 A;  2OWO A;  2NVQ H;  1NE3 A;  5IYD G;  4R4O A;  4IPC A;  1YHA A;  2AWN A;  3CC7 A;  2OQK A;  3JAM i;  2I0Q A;  3PF4 A;  2UXD Q;  2FXQ A;  4RG1 A;  3KDF B;  5LMU L;  4DV1 L;  3I4M G;  1DGS A;  4PZ8 A;  4UP8 A;  4A3J G;  3S1Q H;  3CMA A;  5GAE C;  1CSP A;  3PUV A;  3I4N H;  4LF4 Q;  5FJ8 G;  1YNX A;  1FJG L;  1B7Y B;  4JCV E;  1YIT A;  5LMU Q;  1WI5 A;  3GTK H;  3PO3 H;  2ZTC A;  4A3E H;  3U50 C;  2EXD A;  4KHZ A;  1XPU A;  3RZD H;  3DLL A;  3CC2 A;  2VQF L;  1Q7Y C;  2F3I A;  5IWA L;  3A5U A;  4POG A;  3AQQ A;  1TWF H;  1SLJ A;  1VQF A;  4A3F H;  1HR0 Q;  3PSI A;  1VQ8 A;  4JI8 L;  2ASB A;  4IPD A;  2JEB I;  4O0A A;  5C0X J;  2R93 G;  1OXX K;  4DV2 L;  4A3E G;  1XNQ Q;  1XNR L;  3S14 H;  1HZB A;  2K5N A;  4OWX B;  2MO0 A;  3KDF A;  3F2C A;  3TQY A;  3GTM H;  1VQN A;  1OXS C;  2VL6 A;  1Y1V H;  1L1O A;  3RLF A;  2LXJ A;  4YWL A;  1PH7 A;  1G6P A;  2KCM A;  4A4I A;  4BBS H;  1OXU A;  2XGT A;  2UXB L;  2ZJR A;  1M90 C;  2WP8 J;  2KEN A;  4LW1 A;  4DK6 C;  1SFO H;  4BY1 H;  1P8L A;  1PFS A;  2Z6K A;  2HHH L;  2AKW B;  2JA8 H;  2ZJQ A;  4YWK A;  1GKH A;  1C0A A;  1Q86 C;  5FJ8 H;  1OTC A;  4LNQ A;  3K81 C;  4EX5 A;  3M4P A;  3S24 A;  4DV3 L;  4YCV A;  5IYB H;  2B3G A;  3TEH B;  1IBL Q;  4WJ3 M;  3RLO A;  4QGU A;  4DV5 L;  4JYA Q;  3J80 i;  5IY0 A;  3PUY A;  1HZ9 A;  1PH8 A;  1M1K C;  4B3R L;  4MTN A;  5LMN L;  1G29 1;  4GN4 B;  3W1B A;  4C2M H;  4NB3 A;  3K8A A;  4DR3 L;  3RN5 A;  1YJ9 A;  1VS0 A;  2JA7 G;  2MFI A;  2V1C C;  3L0O A;  5M3F H;  2WB1 G;  3OTO L;  4JI6 L;  4DUY L;  1MJC A;  5M5X H;  4JYA L;  3S15 H;  4JI1 Q;  5GAH C;  3H0G G;  4HJ9 A;  3HKZ G;  2E2J H;  1V1Q A;  1MIU A;  2N78 A;  1HNW L;  4LF9 Q;  2B63 G;  3PF5 A;  4QIW E;  3I4O A;  4DV0 L;  1HNX L;  2NVX H;  3D31 A;  1K3R A;  2YTX A;  1N33 Q;  3PO2 G;  4JI2 Q;  3NEL A;  4A3D G;  1VQJ A;  1E24 A;  1VQP A;  3KJO A;  1X56 A;  2F4V Q;  1HZA A;  2B63 H;  2D0P A;  2VW9 A;  1XTD A;  3CCQ A;  3ULJ A;  5FLX c;  5AJ3 Q;  1WJJ A;  1WCM G;  2HHH Q;  3H3V I;  3HOV H;  2B29 A;  3UDF A;  1YZ6 A;  4R1J A;  3PIO A;  3ER0 A;  1A0I A;  1PA6 A;  1D7Q A;  2K4K A;  1HNW Q;  3HOX H;  1VQC A;  4DV2 Q;  2A19 A;  1LM0 A;  1CKN B;  1YVC A;  2AWO A;  1KD1 C;  1PH3 A;  3CCR A;  2D62 A;  1U0L A;  5IE8 A;  2JA8 G;  4BA1 I;  5ELN A;  1BBW A;  1CKM A;  1XMQ L;  1PH5 A;  1V43 A;  4LWC A;  5C4J H;  3I56 A;  1R9T H;  3DM3 A;  2VS1 A;  1IBK Q;  1O7I A;  4LF7 L;  3E9I A;  4A75 A;  5IYC H;  4GOP A;  3LGJ A;  4JBJ A;  4FDB A;  4A3B G;  1EOV A;  5JEA G;  2KCT A;  4GKJ L;  4A3K G;  2H5X A;  1YJW A;  2F4V L;  2K50 A;  3F2D A;  4HJ7 A;  2HIX A;  1HR0 W;  1TWH H;  3FP9 A;  3STB C;  1N32 Q;  4JG2 A;  4DV6 Q;  3AFP A;  4R4I A;  2VQF Q;  4YHH Q;  3G4S A;  2CQO A;  4NXN L;  4GNX A;  3E0E A;  3BZC A;  2NVY H;  4NXM L;  3RZO H;  2Q2I A;  1MKH A;  3K7A H;  3TS2 A;  4YCU A;  3B6Y A;  3NEM A;  2UU9 L;  5C3E G;  1J5E L;  2UXB Q;  3GDE A;  4X64 L;  5BR8 L;  2YTV A;  4IO9 A;  4A3D H;  1VQA A;  3J80 c;  2IX1 A;  4B3M L;  4A3C G;  1VQG A;  3AFQ A;  4GLX A;  2Z6K C;  4KLK A;  3S1M H;  2GVB A;  1EQQ A;  2D0O A;  1EFW A;  2N3S A;  3W5O A;  3CCS A;  1BBU A;  2VUM H;  4JC0 A;  4A3G H;  1NTG A;  4DR4 L;  2AHO B;  5IP9 H;  5C4X H;  1PH4 A;  2I5H A;  3CPW A;  2K75 A;  4XTC S;  4AQY Q;  2UXC L;  2R92 H;  3OW2 A;  1XNR Q;  3S1R H;  4GKK L;  2MNA A;  1I94 L;  4AH6 A;  4C3I H;  2MO1 A;  4OO1 I;  4NXM Q;  1QVG A;  3M7N A;  3TRE A;  1N34 Q;  3J7Z C;  1SN8 A;  2R7Z H;  4DR7 L;  3S2H H;  1C9O A;  2JA6 H;  1AE3 A;  5JEA J;  2JA5 G;  5JJL A;  1KC8 C;  1L1O C;  1PH6 A;  2BA1 A;  1N32 L;  1YHB A;  2UUC L;  1YJN A;  2E5L L;  4IFD I;  1IZ6 A;  1X3F A;  1PHJ A;  1AE2 A;  4YHH L;  4BA2 I;  4QY7 A;  4UP7 A;  4TVA B;  3T1H L;  3MEF A;  3F2B A;  2UUB Q;  3HOW G;  1XJV A;  2Y0S G;  4LF5 L;  1EUJ A;  4JI1 L;  1YBY A;  1G51 A;  1QUQ A;  3CCU A;  4X65 Q;  4DV7 Q;  1IBM L;  2WFW A;  1HNZ Q;  4OWW B;  4GKJ Q;  1XPR A;  4MZ9 A;  3ERS X;  4A93 G;  5M5W H;  2UUB L;  1PH1 A;  1LUZ A;  4DAY B;  2N8N A;  4X66 L;  2GN5 A;  4BBR G;  4X62 Q;  2E8G A;  4UPA A;  1ASY A;  1K0R A;  1P16 A;  4P71 A;  3CCE A;  1RL2 A;  2NN6 I;  5IP7 H;  1E1T A;  1IBL L;  1QVF A;  1Q1E A;  4KHP L;  2Q2H A;  3KF6 B;  5M5Y H;  3CCM A;  1YHQ A;  5LMN W;  2LSS A;  3CQZ H;  3GD7 A;  4B3T L;  4JI3 Q;  1JB7 A;  1PH9 A;  2BH8 A;  3UE1 A;  1UWV A;  2ALY B;  4UY8 C;  4BXX H;  3H0G H;  5IYD H;  3J81 i;  1JJ2 A;  4A3M H;  4L5T A;  1VQB A;  2QEX A;  1BKB A;  1Q46 A;  2QGQ A;  2ZM6 L;  1I94 Q;  3HOY H;  3HOW H;  1N36 L;  3SGI A;  4B3M Q;  3UDI A;  1D8L A;  1VQD A;  2PNH A;  1U5K A;  5H1S E;  1L1O B;  2UUA L;  1IYJ B;  4LF6 Q;  1FJG Q;  1S40 A;  5K36 G;  2ZTD A;  3U4V A;  1VQO A;  1S72 A;  3I7F A;  4BBR H;  4DR1 Q;  1KL9 A;  4DR2 Q;  4L5S A;  4KHP Q;  2IT1 A;  4A3L H;  4X64 Q;  4IPH A;  3PGZ A;  4P74 A;  3FKI G;  5IWA Q;  4DAM A;  3HOZ G;  4JI3 L;  2DGY A;  4JBM A;  3GTL H;  3PCO B;  4OO1 G;  3EN2 A;  4QQB X;  5FLM H;  2K14 A;  4DK3 C;  3FKI H;  1TWC H;  3K80 C;  1OXT A;  1PYS B;  4DV6 L;  1PV4 A;  4BXX G;  5IT9 c;  2F52 A;  2PQA B;  2BA0 A;  3KOJ A;  3KYH C;  3ULL A;  3IRB A;  4K0K Q;  3JAM c;  1GO3 E;  4L5Q A;  1K83 H;  2ID0 A;  2PMZ E;  4JI4 Q;  3S16 H;  1EQR A;  1SR3 A;  1LTL A;  1K73 C;  4OX9 L;  1VQ6 A;  4JI8 Q;  4A3I H;  4DV3 Q;  2K5V A;  1H95 A;  1HZC A;  3J81 c;  1Y14 B;  4TQU S;  1X55 A;  1VQ5 A;  1J6Q A;  4JI0 L;  4JI7 L;  4NXN Q;  1N33 L;  1XPO A;  4X6A H;  2Y0S E;  4R4C A;  2JE6 I;  3K0X A;  4BY1 G;  2R7D A;  4IFD G;  5ELO A;  1IXR A;  4IJH A;  2AMC B;  1VQI A;  1W2B A;  2IX0 A;  5IP9 G;  4GLA C;  4C3J H;  3FHW A;  4LFA L;  3CCV A;  1KRS A; 
#chains in the Genus database with same CATH topology
 1VQL A;  2UUA Q;  3NUC A;  3C2P A;  2UXC Q;  1ZXT A;  3S2D H;  2J4X A;  3D4W A;  3VR6 A;  2F0W A;  2NVT B;  4YWM A;  5C4H A;  1X65 A;  1Q8K A;  1PTO F;  1STY A;  3CRL C;  4ALP A;  1KAW A;  2QDB A;  4J6H A;  3KLR A;  1U4P A;  1DCZ A;  3GV6 A;  3VYR A;  1I4Q A;  4G7H C;  2VNU D;  4GN5 A;  3HOU G;  2R7Z B;  1BBX C;  4LF6 L;  2AQ2 B;  4DKA C;  4DV1 Q;  4DK0 A;  1IL2 A;  2D9U A;  1KIX A;  4OIJ A;  5EBC A;  1DYQ A;  3EBE A;  2RBM A;  4TRD A;  4HIK A;  2UUC Q;  1JJC B;  3HP3 A;  4O2D A;  4RMF A;  4A3B H;  2A1A A;  3A55 A;  5GQO A;  1NBW A;  3AEV A;  3GP7 A;  5AJ3 L;  4IPG A;  4XYQ A;  3S2D B;  1LYL A;  1E0B A;  1EU4 A;  2EQS A;  3I4L A;  1ASZ A;  3IKJ A;  4JBW A;  4BBS G;  4OHJ A;  5IGE A;  1EYG A;  2L0C A;  2PI2 A;  1SMY C;  3ZYY X;  2EVB A;  2YYZ A;  3L9A X;  5IP7 G;  1EWC A;  1PZJ D;  2F3V A;  4OEL B;  1ILP A;  1JT8 A;  3NBH B;  3MXP A;  4QCL A;  4O42 A;  3KLW A;  2EY1 A;  4P73 A;  3PO3 G;  1K9M C;  4A3I G;  3NK9 A;  1I3Q H;  3TP8 A;  1GHK A;  1XX8 A;  3L3O C;  1MJE A;  3TRZ A;  5CR3 A;  1STG A;  2K5H A;  1EIY B;  4DR2 L;  1KQS A;  1EYC A;  3PUW A;  1EY8 A;  1A63 A;  5C44 G;  2Z4I A;  4DV4 Q;  2NZO A;  3CQZ B;  1BVS A;  4JI0 Q;  3G6E A;  2MJ8 A;  2PZW A;  3S17 H;  4HTH A;  5COR A;  2E74 C;  4KV6 A;  1Y1V B;  5CV5 A;  1KHI A;  1SNM A;  3TP6 A;  2JP1 A;  3J7Y W;  1NCV A;  2HUG A;  4A3C H;  1EWH A;  2CKZ B;  2JYO A;  2JN4 A;  1NMF A;  1B53 A;  1I3Q B;  5FK9 C;  2L1B A;  4KKT A;  1N8R C;  1HJP A;  2L15 A;  4YCW A;  3KBG A;  5E4X A;  2KEE A;  5E4W C;  1C4Q A;  1Z9F A;  3PO3 B;  2PYK A;  3E6Z X;  5IYB G;  4Y7N H;  5LMN Q;  4K14 A;  4FXD A;  3P1H A;  3EA6 A;  4L6T B;  5D14 A;  3DWQ A;  1LTA D;  4PV1 C;  4A3K H;  2E2H H;  4HID A;  5JJI A;  3D0F A;  3PIP A;  2HIV A;  4JV5 Q;  5C5M A;  4K5V A;  4B3S Q;  1TXY A;  4HIM A;  3PIP 3;  4DR5 L;  2LXK A;  2R7F A;  1VF5 C;  2IHE A;  2TSS A;  2YTY A;  2K32 A;  2UU9 Q;  4M8A A;  4GOP B;  4PMB A;  2HCI A;  3VR4 A;  2ENB A;  1CKN A;  3NWT A;  1TWA H;  1X3P A;  4K6L A;  2QA4 A;  4DV7 L;  5EAY A;  1L2F A;  3QG1 A;  4X62 L;  4B9W A;  5ELC A;  4APV A;  5FLM G;  1EWI A;  3RR5 A;  1FVI A;  2HD3 A;  4IUP A;  2AQ3 B;  4QMG A;  4KN4 C;  4HAE A;  4C2M B;  3BYT B;  4ULL A;  1I4P A;  5EJW A;  2LKV A;  2RSN A;  1XMQ Q;  2CHB D;  1GVP A;  1VQM A;  1UE1 A;  3AB9 A;  3MXG A;  2NVX B;  5JJZ A;  2QF7 A;  3UE0 A;  2WB1 E;  2ZXR A;  3H6M A;  1SBB B;  3N52 A;  3JAM L;  5J3B A;  1G2T A;  5CV9 A;  1XWE A;  3RLN A;  2CVR A;  4PMW A;  4RA8 A;  1JCK B;  1EY7 A;  3J81 j;  4PG3 A;  2OTJ A;  1HR0 L;  4JI5 L;  2E2I H;  4UP9 A;  4IN3 A;  4R4T A;  1JE4 A;  1SRU A;  3ERQ A;  4KK7 A;  4QL5 A;  2OWO A;  4R4O A;  2B2U A;  4IPC A;  3K58 A;  2UXD Q;  2FXQ A;  5JVH 3;  3I70 A;  1LT6 D;  4LF4 Q;  1YNX A;  4BWG B;  5I6W A;  3GTK H;  2ZTC A;  3D3R A;  3U50 C;  3OW7 A;  2EXD A;  4I7A A;  1JWU D;  5CBA E;  3A5U A;  1RD9 D;  1SLJ A;  1VQF A;  2ASB A;  3PSI A;  2KCN A;  5C0X J;  2R93 G;  3GTO B;  3H0G B;  1XNQ Q;  1BO0 A;  3EFX D;  4OWX B;  1F9P A;  5I2Y A;  2K6A A;  3KDF A;  2WKD A;  4QIW B;  1EY9 A;  3GTM H;  2VL6 A;  3MFG A;  1L1O A;  3RLF A;  1SXT A;  1GUT A;  3KBX A;  4YWL A;  3W2D A;  5M3M B;  3Q0A A;  1PH7 A;  1ET6 A;  1JQY D;  5C5L A;  4CDF C;  1OXU A;  3VR5 A;  2ZJR A;  2WP8 J;  1F77 A;  4BY1 H;  1EIH A;  2Z9H A;  2K7V A;  1G8Z D;  1H9M A;  4KKS A;  1T5X D;  1O7Y A;  3HS0 C;  3M4P A;  4WJ3 M;  2SEB D;  4KHV A;  1YNN C;  3MXU A;  1HZ9 A;  1PH8 A;  4HR7 B;  1PDQ A;  5CMD A;  4RKB A;  1DM0 B;  4LF8 L;  3L0O A;  5M3F H;  3OTO L;  4JI6 L;  2DNE A;  3H0G G;  5JAV A;  3HKZ G;  4RWS C;  1V1Q A;  1HNW L;  2EYM A;  4DV0 L;  1HNX L;  3D31 A;  4QF4 A;  1I6V C;  1N33 Q;  1FNU A;  5ELB A;  1X56 A;  2IWH A;  4DN4 M;  1XTD A;  3FVQ A;  5FLX c;  5AJ3 Q;  2HHH Q;  1WCM G;  4CJ0 B;  5FLX E;  5M5Y B;  1A0I A;  4XQQ A;  1CT1 D;  1GJX A;  2K4K A;  4B08 A;  3KLS A;  5KYL A;  2BDO A;  2NVY B;  2C5C A;  4J8Q A;  4DV2 Q;  1CKN B;  2PW5 A;  1U0L A;  2FMM A;  5ELN A;  1BBW A;  2CW0 C;  4N9T A;  1V43 A;  1CHP D;  3E5S A;  4CKE A;  4OL7 A;  4Q5V A;  1ZKO A;  1IBK Q;  1O7I A;  4O1N A;  4GOP A;  4FDB A;  2Y0S B;  3SK6 A;  1VF7 A;  1O7Z A;  4A3B G;  1B9N A;  1BCP C;  3MWY W;  4A3K G;  1RF2 D;  3MA2 B;  3F2D A;  1TWH H;  3STB C;  4A3F B;  1SYC A;  3G4S A;  4NXN L;  2XRS D;  3E0E A;  5LL6 X;  2NVY H;  1JWM D;  2Q2I A;  2D5D A;  3TS2 A;  4C1N I;  2EY6 A;  4CDE C;  2Z6B A;  3GDE A;  5BR8 L;  4ZUI A;  1F2M A;  1Z7T A;  1UUP A;  2IX1 A;  4B3M L;  1VQG A;  3AFQ A;  4GLX A;  5M9O A;  2Z6K C;  4KLK A;  1DOL A;  1U9R A;  2D0O A;  5I4D A;  1EFW A;  1GHJ A;  2R92 H;  1BUV T;  3OW2 A;  1XNR Q;  4GKK L;  1RHP A;  2MO1 A;  1NAP A;  1N34 Q;  2NN6 H;  3S2H H;  1C9O A;  2JA5 G;  5JJL A;  3R3O A;  1L1O C;  5IGC A;  3HOY B;  3J80 L;  1PHJ A;  4YHH L;  1MBY A;  4QY7 A;  3I73 A;  2UUB Q;  4C3H G;  4H44 C;  3SR1 A;  1G51 A;  4RCN A;  4DV7 Q;  2WFW A;  4GKJ Q;  1TS2 A;  4RH6 A;  2WIN B;  4BBR G;  1KNA A;  1ASY A;  1K0R A;  1KLU D;  2E2D C;  2EYF A;  4K2L A;  1QJO A;  3KLS X;  3NHH A;  4IQZ A;  4M1U B;  1AN8 A;  5LMN W;  3CQZ H;  1QOH A;  4JI3 Q;  1TY2 A;  1RCV D;  1UWV A;  4N8F A;  3UE1 A;  2OT2 A;  4UY8 C;  3S2H B;  1WTV A;  3URY A;  2QGQ A;  5ELD A;  4EQP A;  2ZM6 L;  3HOY H;  3HOW H;  4P2C B;  3C1F A;  3A54 A;  1RTN A;  1D8L A;  5J1Z A;  2OXP A;  1U5K A;  1DXM A;  3OHX C;  1QCB D;  1S40 A;  1ENC A;  4BBR H;  4NW2 A;  4A3L H;  2IT1 A;  5I2X A;  4X64 Q;  4P74 A;  3PGZ A;  1KTK A;  3MC0 B;  3SK5 A;  1PLF A;  3OMC A;  4JI3 L;  3GTL H;  3PO2 B;  4OO1 G;  1HFN A;  3EN2 A;  3OWE B;  1PYW D;  3FKI H;  3UI2 A;  4BXX G;  1CQF A;  1TS3 A;  1PFN A;  1K28 A;  1EL0 A;  3KOJ A;  3QJY A;  2AUJ D;  1EEF D;  2PZT A;  3JAM c;  4G57 A;  4L5Q A;  5COY A;  2EJG C;  2ID0 A;  1IKL A;  4KD3 A;  2I46 A;  1D5X C;  2XIW A;  5EBD A;  1HRJ A;  2LS0 1;  3I3C A;  4WOR A;  1H95 A;  4JI7 L;  1Y14 B;  4TQU S;  4L8J A;  3J81 E;  4LK1 C;  3I91 A;  4R4C A;  4BY1 G;  3I4M B;  1IXR A;  2IX0 A;  5IP9 G;  1EYA A;  1Q3L A;  5KIX A;  3VYS A;  1WTH A;  3JC6 6;  2ZM6 Q;  3Q24 A;  3KUP A;  4IOC A;  4MHE A;  1F9S A;  3M85 A;  3MAQ A;  3A5Z B;  1VQ7 A;  5JJK A;  1QG7 A;  1EY5 A;  4WJW A;  2K28 A;  1TU2 B;  2RHS B;  4JI4 L;  4NPS A;  2PI2 E;  5TSS A;  2L5T A;  2NVQ B;  4RGT A;  2O2L D;  3EJI A;  2MQH A;  2A73 B;  1I4X A;  1KNE A;  4PQX A;  3S1Q B;  2JQO A;  3HOV G;  1SEB D;  3AMU A;  5I6Y A;  2IY5 B;  4OWT B;  3MHB A;  5C4X B;  4XQJ A;  1FL0 A;  1CTM A;  3G48 A;  3HG9 A;  3M4O B;  1NJI C;  4HJ5 A;  5C0X I;  2EIF A;  1A15 A;  4AIM A;  1YNN D;  3Q8D A;  2N88 A;  2RF4 A;  2Z0S A;  5DAU A;  3GTP H;  2PPB C;  5GAG C;  3X3M A;  3GTQ H;  2P5Z X;  3HOZ H;  1N36 Q;  1B9M A;  2A69 C;  1QZG A;  5BN3 A;  2CH4 A;  1UE5 A;  1Z47 A;  3DUZ A;  4R8I A;  3GO5 A;  5BR8 Q;  4LFC Q;  4XIG S;  3DMU A;  2L11 A;  1QNK A;  1VQK A;  3S1N H;  4C3I B;  4A93 H;  3M4O H;  4OON A;  3OOC A;  1KDA A;  1JB3 A;  2RCN A;  3T53 B;  4FXK C;  3U4Z A;  4XT3 B;  5C4X G;  2Q2T A;  3K59 A;  1HNX Q;  4CHT B;  4DFA A;  3VR3 A;  1SMX A;  3ITP A;  2EY2 A;  1STN A;  4HN7 A;  1IKM A;  2JA6 G;  4K5W A;  4QJF A;  3K5M A;  1DOM A;  1MSH A;  4B3S L;  3KF6 A;  2CWP A;  2A6E D;  2F0N A;  3NEN A;  1EIF A;  3I55 A;  1M8A A;  1D1K A;  1B8A A;  2SDF A;  2B63 B;  1QZH A;  1RJT A;  1V8Q A;  5D3I B;  4BY7 B;  3G7L A;  1Q12 A;  2KBN A;  2JA5 H;  5L37 A;  1Y1V G;  3CCL A;  1X6O A;  2E5L Q;  4ZQ3 A;  3EIV A;  3SDZ A;  1LT5 D;  1A8V A;  2JXM B;  3KF8 B;  1CKO A;  4DV0 Q;  3A8J E;  4IUT A;  3F1Z A;  1R4Q B;  4EQN A;  4A3J B;  4LF5 Q;  4P72 A;  1QUQ B;  4RFB A;  5GAD C;  1HH2 P;  2C35 B;  1A3V A;  3PIO 3;  1E2Z A;  2QW7 A;  4GLV B;  3M3Y B;  4HCE A;  1YIJ A;  2SNM A;  1ML0 D;  5IOC A;  1HUM A;  4BY7 H;  1PVO A;  4C3H B;  3I2Z A;  3CF5 A;  2CH4 W;  4LFB Q;  3PV0 A;  3HOU H;  3ZJY C;  1WTQ A;  3BDO A;  3KJP A;  4DAY A;  5KND A;  4DUY Q;  1SAP A;  3GV3 A;  4AYB G;  1Y1W H;  3E9H A;  3CC4 A;  1Y8O B;  2B2Y C;  3CU7 A;  4V19 0;  3L7Z C;  1LT4 D;  4A3J H;  5A2Q E;  5NUC A;  2VXW A;  2QCP X;  2F0E A;  5DLQ E;  1J8I A;  2F0S A;  5HGQ A;  1Z6H A;  1H9R A;  4JOI C;  3M3Y H;  5M3M G;  2M9V A;  3VYU A;  4C3H H;  2J0T D;  1C7Y A;  4X3U A;  3QIA A;  4E6I A;  3CCJ A;  1LTB D;  2PQA A;  1WYD A;  3MXN B;  5DNF A;  4V0B A;  3HOX G;  2VQE L;  2G9D A;  4DUZ Q;  3K7U C;  2X6G A;  4FF3 A;  4GKK Q;  4YY3 L;  1GD7 A;  4HSP A;  2F0H A;  4H02 A;  5C44 H;  1ILQ A;  3F2U A;  4EQ5 A;  4JBK A;  1BF4 A;  3CC7 A;  1Q8I A;  1WVL A;  1BCP F;  3HZX A;  2ICE C;  1QB5 D;  4KY6 A;  3DWP A;  2I0Q A;  3PF4 A;  4ABN A;  2K5W A;  3KDF B;  5LMU L;  3I4M G;  5FO7 B;  4PZ8 A;  4A3J G;  1WTW A;  5JPM C;  3VR2 A;  5GAE C;  3I4N H;  1NR2 A;  5FJ8 G;  5JPN C;  1FJG L;  1B7Y B;  1I4R A;  4JCV E;  5FOB B;  5LMU Q;  4KHZ A;  1XPU A;  3DEO A;  1I4H A;  3R93 A;  1Q7Y C;  1HR0 Q;  2B2V A;  5D3D A;  4IPD A;  2JEB I;  4DA2 A;  3E0J A;  1G6Z A;  2LFN A;  3WOF A;  1HZB A;  2K5N A;  2QDL A;  5C44 B;  3F2C A;  2LY7 A;  5JOB A;  1VQN A;  1PTO C;  3NBH A;  4A3D B;  1I50 B;  4G7Z C;  3BVZ A;  3I4N B;  4JK1 C;  1SFO H;  1P8L A;  1PFS A;  2L12 A;  2JA8 H;  2ZJQ A;  4K8I A;  4YWK A;  2XN9 C;  1GKH A;  2ZXP A;  4GZY C;  2SOB A;  4FO2 A;  3QO2 A;  1EFI D;  3S24 A;  3H09 A;  2B3G A;  3TEH B;  5CV8 A;  3PUY A;  3T56 B;  3CRK C;  4MTN A;  1SNQ A;  1G29 1;  1A2T A;  3MEH A;  4NB3 A;  3K8A A;  2EE1 A;  3RN5 A;  4LF9 Q;  1PRT C;  1MJC A;  1EY4 A;  3S15 H;  2FJ2 A;  4JI1 Q;  2F3W A;  1F9R A;  3QR8 A;  2A69 D;  3PF5 A;  4BBR B;  2YTX A;  4WRD A;  5M5W B;  2F4V Q;  3FKI B;  1ESF A;  3FEW X;  3NQT A;  2D0P A;  1EY0 A;  1O78 A;  1DD2 A;  3ULJ A;  1GOZ A;  1SJH D;  1WJJ A;  2PMZ B;  4F7X A;  3UDF A;  1YZ6 A;  2B2U C;  4R1J A;  5DM6 3;  4HED A;  4C56 C;  4XXE A;  3ER0 A;  4A3M B;  1MGS A;  1PA6 A;  1M4V A;  1D7Q A;  2DJF C;  1AP0 A;  3J81 L;  1L0X B;  3MZ5 A;  3T16 A;  1DOK A;  2AWO A;  1PH3 A;  3CCR A;  1U4L A;  5IOD A;  4JW0 A;  5IE8 A;  1JOQ A;  5ELF A;  4CJ2 C;  1ONL A;  2MP1 A;  1BQQ T;  4XT1 B;  3DM3 A;  4K5X A;  1WD0 A;  4EVO A;  4A75 A;  5IYC H;  3MXN A;  1EOV A;  1SE4 A;  1WTR A;  4RGO S;  2FHT A;  1HR0 W;  3FP9 A;  1N32 Q;  4JG2 A;  4DV6 Q;  4F8M A;  3RZO H;  3K7A H;  1MKH A;  3SVM A;  2O4X A;  5IT9 L;  1VQA A;  2ZXO A;  3J80 c;  1K8M A;  4C3J B;  4DAV A;  4A3C G;  2Z4H A;  1JIC A;  2N3S A;  3CCS A;  1BBU A;  5E1F A;  1NTG A;  4DR4 L;  2AHO B;  5C4X H;  3Q23 A;  2K75 A;  4XTC S;  4AQY Q;  3S1R H;  2IPK D;  2MNA A;  4OO1 I;  3RZD B;  1HXY D;  3CHB D;  4X3T A;  1W6K A;  2R7Z H;  1DZ1 A;  1KC8 C;  1YNJ D;  2FFK B;  1YHB A;  3K5N A;  2UUC L;  2E5L L;  2V4D A;  1X3Q A;  5DEH A;  4BA2 I;  3GTQ B;  4UP7 A;  3MEF A;  3F2B A;  3HOW G;  2Y0S G;  4A3B B;  3SXH A;  4LAA A;  1QUQ A;  1T5E A;  2TMP A;  4OWW B;  3MVV A;  4RHS A;  4MZ9 A;  5LHY 1;  1XPR A;  2UUB L;  1DON A;  4DAY B;  4CJ1 B;  4X66 L;  5E3F A;  4JVZ A;  3CCE A;  1K3B C;  3S1N B;  1IBL L;  5IP7 H;  1Q1E A;  3P75 A;  3S1R B;  4RHR A;  5BN4 A;  1YHQ A;  1PRT B;  4B3T L;  3TZD A;  5IYD H;  3D6W A;  4BXX H;  3S14 B;  1K83 B;  1UAP A;  2E2H B;  2QEX A;  1BKB A;  1Q46 A;  3D4D A;  1JC7 A;  2IW3 A;  3HOX B;  3SGI A;  4B3M Q;  3UDI A;  2BE5 D;  2BE5 C;  1B4O A;  3I90 A;  1LAC A;  1IYJ B;  5K36 G;  1PTO B;  2ZTD A;  3U4V A;  3I7F A;  4DR1 Q;  1KL9 A;  4KHP Q;  4L5S A;  2O5I C;  4IPH A;  3Q22 A;  2DGY A;  2F0Q A;  2FMC A;  4QQB X;  1PV4 A;  1VMP A;  3CKI B;  3LWU A;  5K5P A;  3IFD A;  3KYH C;  2BA0 A;  1D5Z C;  2WAC A;  3K0Y A;  4K0K Q;  3HOV B;  3LX0 A;  1GO3 E;  1K83 H;  3BS1 A;  1RKN A;  1TVX A;  3S17 B;  2B39 A;  1EQR A;  4X3K A;  1VQ6 A;  1HTP A;  1PTO D;  2F4I A;  1X55 A;  1J6Q A;  4NXN Q;  4X6A H;  5HUR A;  1Q90 A;  2JE6 I;  3VA5 A;  4IFD G;  3GQB A;  4ME5 A;  1W2B A;  1EZ6 A;  5EKI A;  1TII D;  3DM1 A;  3CCV A;  1TKW B;  3KFU A;  4IAL A;  4HIO A;  3TSS A;  3ND9 A;  4MTK A;  4PZ6 A;  3R8B A;  4LUV A;  1WD1 A;  1X54 A;  2ZTE A;  2B8G A;  3HOU B;  4PMC A;  3EVQ A;  1Y1W G;  2Q2U A;  2XTI A;  5T1G A;  2ICI A;  2JA7 H;  4IOA A;  2WV6 D;  1AFP A;  2N49 A;  3TP5 A;  1LTG D;  4H13 C;  4DUZ L;  2N55 A;  1PXU A;  4JI2 L;  4HJA A;  2BCO A;  4DGZ A;  5FO9 B;  2OF1 A;  2RDG A;  1R9T B;  2I5M X;  5G3L D;  3WWV A;  5DM7 3;  4ME3 A;  5FKA C;  1TS4 A;  1PMR A;  4Y52 H;  4K0K L;  2JK8 A;  2Z8L A;  2A8V A;  1AZP A;  1UEA B;  1Y8N B;  4A3L G;  2LMC B;  1EEI D;  1PYB A;  2K33 A;  1TWG H;  3CP0 A;  1GUN A;  4MIU A;  4TSS A;  3K57 A;  2RSO A;  2XWJ B;  5C3E H;  1XMO Q;  4U67 3;  3GTO H;  2R93 H;  3GTG H;  1C48 A;  3HFZ B;  2D2C C;  1S3O A;  4IZ8 A;  2KHJ A;  4GNX B;  1D5M C;  1ICF B;  2HDL A;  1BDO A;  4ODG A;  3SHL A;  1A62 A;  1NY4 A;  4LUO A;  4BS9 A;  5M3F G;  5M3M H;  4A3M G;  1F2Z A;  1Y8P B;  2OTL A;  3H15 A;  3A8K E;  5J22 A;  1J9O A;  2ES2 A;  3BYY B;  1PZI D;  4IFD J;  1UE6 A;  2KVM A;  2WII B;  2NN6 G;  1XMO L;  5D65 A;  3NPP A;  2R61 A;  5C4Z A;  4CKC A;  3ULP A;  2VZA A;  1CZG A;  2MUY A;  4JI7 Q;  3S16 B;  3BJU A;  2RQX A;  2R93 B;  1E3P A;  2E2I B;  1EOT A;  2K04 A;  3GTG B;  2XSC A;  1E2V A;  1STA A;  1JMC A;  5IGB A;  1QE6 A;  2JEA I;  1XNQ L;  4LF4 L;  4OX9 Q;  1CFM A;  4N8X 1;  1G2S A;  4LFC L;  3K5O A;  3RN2 A;  1JOK A;  4C3I G;  1IW7 C;  2CFM A;  2VY3 A;  3NTI A;  2IHF A;  2Q8I B;  1T9H A;  1O80 A;  1TWC B;  1L0Y B;  4DR4 Q;  1WTO A;  1BCP B;  1VDZ A;  1KXL A;  3GTM B;  3SK8 A;  1I5F A;  1HA6 A;  2DY7 A;  4HJ8 A;  1E22 A;  1HNZ L;  2WKC A;  2SNS A;  5CV4 A;  2MPM A;  4KY5 A;  3FPP A;  2K03 A;  4X3S A;  1CA5 A;  4BY1 B;  1AH9 A;  2A6H D;  1X3E A;  1WTP A;  3G6J B;  4XDX A;  3OSO A;  4NKL A;  2NUC A;  1IBM Q;  1QNU A;  5IGD A;  1V1P A;  3VDY A;  3HEJ A;  4X66 Q;  1VCI A;  3FPU B;  1NR4 A;  3DHQ A;  4B3R Q;  4XYO A;  1G91 A;  1TWH B;  2CQA A;  4LF8 Q;  2XVS A;  5LL6 S;  1GUG A;  4PZ7 A;  2KED A;  1OXV A;  4UAI A;  3RNU A;  3PUZ A;  1N34 L;  2HT1 A;  1FR3 A;  1W3S A;  4NP5 A;  4WJ4 A;  3PQI A;  1I6H H;  1K8A C;  1EU3 A;  2YV5 A;  2L9H A;  1D6E C;  1HQM C;  2I5L X;  4WFN 3;  1QVC A;  2NVT H;  2NTT A;  3A74 A;  4HMJ A;  2ATW A;  1SNC A;  4GOP C;  2EOT A;  3I4N G;  4A3E B;  1LAB A;  2R6G A;  3HKS A;  4CGY B;  2CWA A;  2OQ0 A;  1E1O A;  1Q1B A;  1TWF B;  5HY6 A;  2ZT9 C;  3STB D;  5KNB A;  4JI6 Q;  1X9N A;  3UDX A;  2WAQ B;  2RHQ B;  4NMZ A;  2VQE Q;  1IYU A;  2IX3 A;  5KGU A;  2EPB A;  3MTS A;  3M4Q A;  4DV5 Q;  1NE3 A;  5IYD G;  1YHA A;  2AWN A;  2EYJ A;  4S3S A;  1ZYR C;  2OQK A;  3JAM i;  4KKU A;  2EY5 A;  1LTT D;  1DGS A;  2A6H C;  1CSP A;  1MD2 D;  4RGN A;  1B2T A;  2H1E A;  1SSO A;  3PO3 H;  4A3E H;  3MFY A;  2GA4 B;  3RZD H;  3DLL A;  3CC2 A;  2VQF L;  4QUF A;  4POG A;  3AQQ A;  1TWF H;  3S9W A;  4Y7N B;  2NBF A;  4QUC A;  4A3F H;  4JI8 L;  3TBI B;  4O0A A;  4DV2 L;  4A3E G;  2MO0 A;  5I9O A;  1OXS C;  1TY0 A;  2HCC A;  4DXG A;  3HOW B;  2F0I A;  3OPO A;  2LXJ A;  2KCM A;  3M7G A;  3BG3 A;  2A74 C;  2E2J B;  2CW0 D;  2K5D A;  2UXB L;  1M90 C;  1STE A;  4LW1 A;  4DK6 C;  3NXW A;  4CDC C;  1TWA B;  2R92 B;  5IGG A;  5KNC A;  1NUC A;  1Q86 C;  2RDH A;  4ZUJ A;  4QB4 A;  2B2T A;  4EX5 A;  2Q8T A;  1W6J A;  1GUW A;  4QGU A;  4DV5 L;  1IHZ A;  1M1K C;  4DR3 L;  2QKI C;  4C2M H;  1SYF A;  1YJ9 A;  2KOL A;  2MFI A;  2WB1 G;  2EYO A;  3C1E A;  5CYU A;  3BDC A;  5GAH C;  2E2J H;  1MIU A;  4QIW E;  2NVX H;  1K3R A;  4JI2 Q;  3NEL A;  1VQJ A;  2NZ1 D;  1SJE D;  1E24 A;  1ENF A;  3KJO A;  1VQP A;  3FDT A;  1HZA A;  3D8G A;  2VW9 A;  3FRP B;  4DXF A;  3HOV H;  2B29 A;  2Z1C A;  3SEB A;  4DNR B;  1EQT A;  2L55 A;  3QB3 A;  1WCM B;  2F0G A;  2HQE A;  1VQC A;  2A19 A;  2G5D A;  1MSG A;  2O5J C;  2D62 A;  2K05 A;  1FNW A;  3P20 A;  4CBV A;  2K01 A;  4BA1 I;  2JA8 G;  1CKM A;  2FIN B;  2B2V C;  2VS1 A;  2OEO A;  3H3V C;  2F0T A;  4LF7 L;  3E9I A;  1MHW C;  3LGJ A;  1MI2 A;  5JEA G;  2KCT A;  3GTK B;  4KJO A;  3OWF A;  2F4V L;  1A3T A;  2HIX A;  2PCF B;  4HJ7 A;  2JA7 B;  3HGB A;  1H9J A;  3BDL A;  4R4I A;  5C3W A;  3BZC A;  2AQ1 B;  3RMH A;  4YCU A;  3B6Y A;  3GTP B;  3NEM A;  5IT9 E;  2UU9 L;  5C3E G;  1J5E L;  1B3A A;  1PRT F;  2WB1 B;  5J39 A;  3HOZ B;  3KF8 A;  5EPL A;  2VB2 X;  4ZKB B;  4JC0 A;  2VUM H;  4A3G H;  2K1B A;  5IP9 H;  1PH4 A;  1JR0 D;  3CPW A;  2UXC L;  1KDB A;  2RVL A;  1JOR A;  1SND A;  1I94 L;  5FO8 B;  4C3I H;  4RGM A;  4DK1 A;  2PW7 A;  1TWG B;  1Y69 U;  1QVG A;  2KA7 A;  3M7N A;  1SN8 A;  4TKO B;  4HMI A;  2JA6 H;  5M3F B;  2L4N A;  5IIF A;  1LTR D;  3T1H L;  4TVA B;  1B1Z A;  1D2B A;  1F2Y A;  2EYL A;  2XWB B;  1EUJ A;  1AW7 A;  3DWA A;  4FXG C;  1KAB A;  1IBM L;  1PFB A;  1HNZ Q;  4A93 G;  3ERS X;  1PH1 A;  1LUZ A;  5ELE A;  4A3G B;  2N8N A;  2VUM B;  2GN5 A;  1SDF A;  2PO4 A;  5KRU A;  4UPA A;  4XQN A;  1RL2 A;  2NN6 I;  1QVF A;  4K2K A;  4KHP L;  2Q2H A;  3KF6 B;  5M5Y H;  2X6L A;  3CCM A;  1JB7 A;  1PH9 A;  2ALY B;  2AUK A;  3H0G H;  3J81 i;  1UNS A;  4L5T A;  1VQB A;  1A3U A;  3SE0 A;  2F0M A;  1N36 L;  1LO5 D;  3HKZ B;  2PNH A;  1VQD A;  4DNT B;  1RDP D;  4HSV A;  1L1O B;  2BDN A;  5A2Q L;  3NSW A;  4FVM A;  1VQO A;  4ID6 A;  4DR2 Q;  1STB A;  1STH A;  1EZ8 A;  5IWA Q;  3NQI A;  3HOZ G;  3PCO B;  4K8J A;  4FF1 A;  4ZRZ A;  2K14 A;  5EQ0 A;  4DK3 C;  1TWC H;  3K80 C;  1OXT A;  1PYS B;  4DV6 L;  4A93 B;  5IT9 c;  1FNV A;  3ULL A;  3IRB A;  2KCC A;  1ET9 A;  1HUN A;  1LTL A;  1K73 C;  1B44 D;  4JI8 Q;  4A3I H;  5C3X A;  1HZC A;  1VQ5 A;  4JI0 L;  1N33 L;  1XPO A;  3WOE A;  2R7D A;  2RKS A;  3SK4 A;  5EPK A;  4B9X A;  2AMC B;  1TT2 A;  4IFD H;  4GLA C;  5CGK A;  2F1M A;  3ND8 A;  3FHW A;  5C4J B;  4LF5 L;  4AQY L;  4A76 A;  5T1I A;  4LFB L;  4DR5 Q;  1CSQ A;  1E2W A;  5GRO A;  1E7Z A;  2DUD A;  2RCF A;  3D6C A;  1K8G A;  4C1N K;  3CXC A;  4DR6 L;  2EDG A;  2IJ0 A;  4HCS A;  3RUZ A;  4EGV A;  2HDM A;  3H3V H;  4F87 A;  1NMG A;  4AYB B;  1IYV A;  2F0U A;  1PRT D;  4ZAI A;  2NYZ D;  1VQH A;  1KLG D;  1PFM A;  1WFQ A;  4KMU C;  4LFA Q;  1I6H B;  3OIQ A;  1IBK L;  3WDN A;  1H9S B;  4PNY A;  2RA4 A;  2QIL A;  1BNZ A;  4A3F G;  4IJL A;  3S1M B;  2IL8 A;  2K52 A;  1JOO A;  2I07 B;  3CW2 C;  2RDF A;  3TS0 A;  1HHV A;  5HGT A;  1X3G A;  4G4K A;  1C8C A;  3CPF A;  1XTC D;  1SE8 A;  1JE5 A;  1VQE A;  3A7A B;  1CM9 A;  1BXT A;  3PUX A;  1KRT A;  3T1Y L;  4UDU C;  1FGB D;  4DV4 L;  1SE2 A;  2EZV A;  1UEB A;  2PZU A;  3T1Y Q;  5EGT A;  1CHQ D;  5E7N A;  1F2L A;  2WAQ E;  3CAM A;  2OCE A;  4GNX C;  2B2T C;  1UE7 A;  2KHI A;  4F88 A;  3BZK A;  4BY7 G;  3RD4 A;  4DR6 Q;  2NTS A;  2EJF C;  2GVA A;  3GTL B;  3EQL C;  3PO2 H;  2JA8 B;  2M00 A;  2MHV A;  3N6R A;  2R7Z G;  1KAA A;  3HOY G;  1SNP A;  1U4R A;  3ONA B;  4JV5 L;  1KDC A;  2DNC A;  5ISR A;  1YI2 A;  2KQ3 A;  3I72 A;  2M2L A;  3C3L A;  2EJM A;  4AYB E;  1WTX A;  5CBE E;  4JPB W;  4YY3 Q;  3AYH B;  3M9B A;  4DR1 L;  4X65 L;  3NE5 B;  3K5L A;  4OIK A;  4RCO A;  4LF7 Q;  4R4Q A;  3U9O A;  4LMQ D;  3DXJ C;  4NDX A;  3U9S A;  1K8O A;  2MGS A;  4P75 A;  2R92 G;  1VQ4 A;  3W3A A;  1SMY D;  3CD6 A;  4OXP A;  4RAU C;  1GM5 A;  3U58 A;  4L5R C;  3UDG A;  2NZH A;  5JEA H;  2X69 A;  1V1P B;  1YNJ C;  1JJG A;  2JJQ A;  3G71 A;  2BH2 A;  2DJG C;  2WAQ G;  1I50 H;  2KUM A;  1N9W A;  4GS3 A;  4POF A;  4MN3 A;  2KEC A;  2PQE A;  3GTJ H;  3NTK A;  1A6X A;  1CUK A;  1AZQ A;  1RIP A;  2G9H D;  1PH2 A;  3HKZ E;  3NP8 A;  2A5H A;  4Q0F A;  3A56 A;  3IL8 A;  1TQO A;  4H0L C;  1SNO A;  3BU2 A;  5C0X G;  1S5B D;  2R3Z A;  1XYI A;  5FLX L;  1FYC A;  1HCZ A;  4DR7 Q;  1Q81 C;  4JI5 Q;  4DR3 Q;  4ILW A;  4IUV A;  1JWS D;  2VUM G;  1WCM H;  4A3G G;  3ICE A;  4LF9 L;  2ZJP A;  1R4P B;  1Q82 C;  2EYP A;  5CV7 A;  3T1H Q;  1U4M A;  3A7L A;  4DNI A;  1FGU A;  2DY8 A;  1L0W A;  1B70 B;  2B2W C;  1NNX A;  1ENA A;  1GUS A;  3OYY A;  3J7A 5;  1YEZ A;  3I4M H;  1S5F D;  3GTJ B;  1SYD A;  1FD7 D;  4I65 A;  3K6O A;  3OTO Q;  3A0J A;  3L2P A;  3CME A;  4LUZ A;  3VA7 A;  2XRQ D;  1BR9 A;  1IW7 D;  1WOC A;  4DPG A;  4GN3 B;  3IAY A;  3AU7 A;  3H94 A;  1LLR D;  2JA9 A;  3F8T A;  1V9P A;  2HQL A;  3D4R A;  2NB0 A;  2YU9 H;  3V2T A;  4JOI A;  4KI0 A;  2J7Z A;  3M4Y A;  4FF2 A;  3W1G A;  2CCZ A;  3NBI A;  5IYC G;  4MNO A;  3T13 A;  3J7A V;  1HTL D;  1SRO A;  4J15 A;  1VQ9 A;  1H9S A;  3T4A C;  1J5E Q;  4B3T Q;  1LTI D;  2UXD L;  2JSO A;  2NVQ H;  2PNR C;  4UHV A;  4EQO A;  4KY7 A;  4L63 B;  1HA5 A;  5EKK A;  4RG1 A;  3HRZ C;  3J80 E;  4DV1 L;  4J1M A;  3S1Q H;  4UP8 A;  2B8F A;  3CMA A;  2F0P A;  3PUV A;  4R9W A;  2DN8 A;  1EYD A;  1YIT A;  2BOS A;  1WI5 A;  5C6A A;  2F0F A;  2YU9 B;  1RTO A;  3P7J A;  4FP5 D;  3QOJ A;  2F3I A;  5IWA L;  1VQ8 A;  5I9P A;  2JA5 B;  1D1I A;  5KEE A;  1OXX K;  2JA6 B;  1XNR L;  3S14 H;  2B2W A;  3TQY A;  3K7A B;  3E3X A;  4DU9 A;  1Y1V H;  5BN5 A;  1EQV A;  5CC4 A;  1G6P A;  4A4I A;  4BBS H;  2E75 C;  4DAP A;  2XGT A;  3DEP A;  2KEN A;  2Z6K A;  2HHH L;  3NTH A;  4Z9C B;  2AKW B;  1EIG A;  1GXD C;  1C0A A;  1OTC A;  5FJ8 H;  3BVG A;  4ZCK A;  3K81 C;  4LNQ A;  1XXG A;  4KN7 C;  4DV3 L;  3JAM E;  4YCV A;  5IYB H;  1IBL Q;  3RLO A;  4JYA Q;  1EY6 A;  1SYE A;  3J80 i;  5IY0 A;  4IUR A;  2H4O A;  2EYH A;  1DJR D;  1TR5 A;  4GN4 B;  5LMN L;  3W1B A;  4A3K B;  4B3R L;  3I8Z A;  4ZLT F;  1LV9 A;  2JA7 G;  1VS0 A;  4OEM B;  2V1C C;  3TN2 A;  4ZK9 B;  4ZYS A;  4DUY L;  4JYA L;  5M5X H;  3O13 A;  4HJ9 A;  1ZYR D;  2N78 A;  4BBS B;  1TS5 A;  2B63 G;  1OO9 B;  3I4O A;  1SYB A;  4YIJ A;  3PO2 G;  5CV6 A;  1S5D D;  4A3D G;  1HPC A;  4CDD C;  2B63 H;  1LTS D;  4IUQ A;  2F0O A;  2F0L A;  4KJN A;  3V05 A;  3CCQ A;  1X32 A;  3H3V I;  4IUN A;  4OO1 H;  3LNN A;  3R2T A;  3PIO A;  4R8N A;  3LWE A;  1S4Z A;  1HFG A;  4A3I B;  1HNW Q;  5K36 H;  3HOX H;  5M5X B;  1SYG A;  1LM0 A;  1YVC A;  4LJZ C;  4N9P A;  1KD1 C;  1V1O A;  2KJX A;  1VMC A;  4H7B A;  1PTO H;  1XMQ L;  1PH5 A;  4LWC A;  5C4J H;  3I56 A;  1R9T H;  2F03 A;  2K5Q A;  1LT3 D;  1HQR D;  5JVG 3;  1I4G A;  1ESR A;  3C46 A;  1H9K A;  4JBJ A;  1B3Q A;  3IFT A;  2A68 C;  4GKJ L;  2H5X A;  1YJW A;  1BCP D;  4FNF A;  2K50 A;  3TP7 A;  1Y1W B;  3AFP A;  3R2I A;  2VQF Q;  2NWG A;  4YHH Q;  2QEJ C;  3VYT A;  2CQO A;  1CZW A;  4GNX A;  3BVM A;  5G3L F;  2XNA C;  4NXM L;  3OIP A;  3A8I E;  2UXB Q;  4X64 L;  4A3D H;  4IO9 A;  1QIL A;  2YTV A;  2F0K A;  4IUU A;  1ICW A;  3ERO A;  3S1M H;  2GVB A;  1EQQ A;  1SFO B;  2A6E C;  3W5O A;  2F0J A;  3X3N A;  4C3J G;  1SE3 A;  2E76 C;  2I5H A;  5KYI A;  1S5E D;  2F0V A;  3BZD B;  5IGF A;  4AH6 A;  2Q8R E;  4NXM Q;  1CA6 A;  3H91 A;  3TRE A;  3J7Z C;  4DR7 L;  1AE3 A;  5JEA J;  1PH6 A;  2BA1 A;  1N32 L;  1YJN A;  4IFD I;  1IZ6 A;  1X3F A;  4DF7 A;  1AE2 A;  2C9O A;  3TME A;  1XJV A;  1B50 A;  4JI1 L;  1YBY A;  3CCU A;  1O7L A;  1AEX A;  4X65 Q;  1QWY A;  1II3 A;  5M5W H;  4X62 Q;  4ZKC B;  2E8G A;  1P16 A;  4P71 A;  2A68 D;  4KD4 A;  1E1T A;  2LSS A;  3GD7 A;  3TZU A;  2BH8 A;  3J7A F;  5C3E B;  1JJ2 A;  4A3M H;  4CKB A;  4K6D A;  4I7Z C;  2VB3 X;  3FMC A;  4OGQ C;  1I94 Q;  2F0D A;  1BOS A;  3PMF A;  1ROD A;  1S5C D;  1CQV A;  4FF4 A;  3OMG A;  1IL8 A;  5H1S E;  3T51 B;  5EPJ A;  3NWS A;  2UUA L;  4LF6 Q;  1PZK D;  5AFW A;  1FJG Q;  1F9Q A;  1S72 A;  2EXZ A;  4U68 A;  1ZEQ X;  3FKI G;  4DAM A;  4JBM A;  1NSN S;  5FLM H;  5F2D A;  3V96 A;  1GUO A;  3QWN A;  2F52 A;  2PQA B;  5EKL A;  5C0X H;  4RKL A;  2PMZ E;  1CK1 A;  4JI4 Q;  3S16 H;  1SR3 A;  4OX9 L;  1K0S A;  1A2U A;  1CI3 M;  4KTA A;  4DV3 Q;  2K5V A;  3KK7 A;  3S15 B;  3Q6S A;  3J81 c;  3RZO B;  2KHS A;  2Y0S E;  3K0X A;  5A35 A;  4FYD A;  5ELO A;  4G7O C;  2B2Y A;  3TDQ A;  4IJH A;  1VQI A;  4C3J H;  3QOL A;  4LFA L;  1KRS A; 
#chains in the Genus database with same CATH homology
 1VQL A;  2UUA Q;  4AQY L;  2UXC Q;  4A76 A;  4HIO A;  4LFB L;  4DR5 Q;  1CSQ A;  3S2D H;  5GRO A;  1E7Z A;  4YWM A;  1X65 A;  4PZ6 A;  2DUD A;  1Q8K A;  4LUV A;  1X54 A;  1K8G A;  2ZTE A;  3JC6 6;  3CXC A;  4DR6 L;  1Y1W G;  2ZM6 Q;  2Q2U A;  2XTI A;  3H3V H;  4ALP A;  1KAW A;  4IOC A;  2JA7 H;  3M85 A;  2VNU D;  4GN5 A;  3HOU G;  4IOA A;  1NMG A;  3A5Z B;  1VQ7 A;  5JJK A;  2N49 A;  4DUZ L;  1VQH A;  4LF6 L;  2RHS B;  4JI4 L;  4NPS A;  4DKA C;  4DV1 Q;  4JI2 L;  1IL2 A;  1WFQ A;  4HJA A;  2PI2 E;  4LFA Q;  1KIX A;  3EBE A;  2UUC Q;  1IBK L;  4HIK A;  1JJC B;  2I5M X;  2MQH A;  4O2D A;  4RMF A;  4A3B H;  2A1A A;  4LF8 L;  3WWV A;  5GQO A;  4ME3 A;  1NBW A;  3AEV A;  5AJ3 L;  4IPG A;  2JQO A;  4A3F G;  4IJL A;  1LYL A;  2EQS A;  2K52 A;  4Y52 H;  1ASZ A;  3HOV G;  3CW2 C;  4K0K L;  4JBW A;  4BBS G;  3TS0 A;  2JK8 A;  2A8V A;  2IY5 B;  4OWT B;  2PI2 A;  1X3G A;  1EYG A;  4A3L G;  3CPF A;  1FL0 A;  3G48 A;  2YYZ A;  1SE8 A;  1JE5 A;  1PYB A;  3CP0 A;  1TWG H;  1VQE A;  5C0X I;  4HJ5 A;  1NJI C;  2EIF A;  3PUX A;  5IP7 G;  4AIM A;  5C3E H;  1XMO Q;  1KRT A;  3GTO H;  3T1Y L;  3Q8D A;  4DV4 L;  2R93 H;  3GTG H;  3HFZ B;  1S3O A;  3NBH B;  1JT8 A;  2RF4 A;  2KHJ A;  2Z0S A;  4GNX B;  3GTP H;  1UEB A;  5GAG C;  1A62 A;  1NY4 A;  3KLW A;  4LUO A;  3T1Y Q;  5E7N A;  5M3M H;  5M3F G;  4A3M G;  4P73 A;  1N36 Q;  2WAQ E;  3GTQ H;  3HOZ H;  3PO3 G;  1K9M C;  3CAM A;  1QZG A;  2OCE A;  4GNX C;  3H15 A;  1I3Q H;  4A3I G;  1UE5 A;  1Z47 A;  2OTL A;  1UE7 A;  2KHI A;  3BZK A;  2ES2 A;  4BY7 G;  4DR6 Q;  3GO5 A;  5BR8 Q;  1MJE A;  4LFC Q;  3TRZ A;  4IFD J;  2K5H A;  4XIG S;  1EIY B;  2GVA A;  4DR2 L;  1UE6 A;  1VQK A;  3PO2 H;  1KQS A;  3PUW A;  3S1N H;  2NN6 G;  1XMO L;  2R7Z G;  4A93 H;  3HOY G;  3M4O H;  4OON A;  1A63 A;  4JV5 L;  5C44 G;  4DV4 Q;  1YI2 A;  2RCN A;  2NZO A;  1BVS A;  3ULP A;  2VZA A;  4JI0 Q;  3U4Z A;  4JI7 Q;  4AYB E;  3G6E A;  3BJU A;  5C4X G;  3S17 H;  1E3P A;  2Q2T A;  1HNX Q;  1JMC A;  1KHI A;  1SMX A;  4YY3 Q;  3AYH B;  2JEA I;  3M9B A;  4DR1 L;  1XNQ L;  4X65 L;  4A3C H;  2JA6 G;  2CKZ B;  4LF4 L;  4OX9 Q;  4QJF A;  4LF7 Q;  1NMF A;  4R4Q A;  4LFC L;  4B3S L;  3KF6 A;  3RN2 A;  2CWP A;  1N8R C;  1HJP A;  2L15 A;  4P75 A;  4YCW A;  3NEN A;  1EIF A;  2CFM A;  2VY3 A;  3I55 A;  2R92 G;  1Z9F A;  1B8A A;  1VQ4 A;  2IHF A;  1QZH A;  1T9H A;  3CD6 A;  5IYB G;  1Q12 A;  4OXP A;  1GM5 A;  2KBN A;  3U58 A;  4Y7N H;  5LMN Q;  2JA5 H;  4L5R C;  1Y1V G;  4DR4 Q;  3UDG A;  3CCL A;  1X6O A;  2NZH A;  2E5L Q;  4A3K H;  2E2H H;  3EIV A;  4HID A;  1KXL A;  5JJI A;  1JJG A;  1A8V A;  3D0F A;  3PIP A;  3KF8 B;  1CKO A;  1I5F A;  2HIV A;  4JV5 Q;  4DV0 Q;  2JJQ A;  3G71 A;  4B3S Q;  2BH2 A;  4HJ8 A;  1TXY A;  1E22 A;  2WAQ G;  3F1Z A;  1I50 H;  4GS3 A;  1N9W A;  1HNZ L;  4LF5 Q;  4POF A;  4P72 A;  4HIM A;  3GTJ H;  1QUQ B;  4DR5 L;  1CUK A;  2LXK A;  2R7F A;  5GAD C;  1RIP A;  1HH2 P;  2C35 B;  2IHE A;  2YTY A;  3HKZ E;  1PH2 A;  2UU9 Q;  1AH9 A;  4GLV B;  4GOP B;  1YIJ A;  1X3E A;  3KFU A;  1CKN A;  3BU2 A;  1TWA H;  5C0X G;  2QA4 A;  1PVO A;  4DV7 L;  1IBM Q;  4BY7 H;  3I2Z A;  3CF5 A;  5EAY A;  3VDY A;  1L2F A;  4DR7 Q;  4X62 L;  4X66 Q;  1Q81 C;  4LFB Q;  4JI5 Q;  1VCI A;  3PV0 A;  4DR3 Q;  3HOU H;  3ZJY C;  4APV A;  4B3R Q;  5FLM G;  1EWI A;  3KJP A;  4DUY Q;  2VUM G;  1WCM H;  1FVI A;  3RR5 A;  4A3G G;  1Y1W H;  4AYB G;  3CC4 A;  3E9H A;  2ZJP A;  4LF8 Q;  4LF9 L;  3ICE A;  1Q82 C;  4PZ7 A;  1OXV A;  3T1H Q;  4DNI A;  1FGU A;  3L7Z C;  3RNU A;  1XMQ Q;  3PUZ A;  1B70 B;  1L0W A;  1N34 L;  1GVP A;  1W3S A;  4A3J H;  2HT1 A;  1VQM A;  1UE1 A;  3OYY A;  3J7A 5;  3I4M H;  1YEZ A;  3OTO Q;  4WJ4 A;  1I6H H;  5DLQ E;  3A0J A;  3L2P A;  3CME A;  4LUZ A;  1K8A C;  2YV5 A;  3UE0 A;  5HGQ A;  2WB1 E;  4JOI C;  3M3Y H;  5M3M G;  4DPG A;  1WOC A;  2I5L X;  1QVC A;  4GN3 B;  2NVT H;  3A74 A;  5J3B A;  4C3H H;  2JA9 A;  3F8T A;  1C7Y A;  1V9P A;  2HQL A;  2ATW A;  3CCJ A;  2PQA A;  4GOP C;  1WYD A;  3MXN B;  3RLN A;  2YU9 H;  3I4N G;  4JOI A;  2R6G A;  3HKS A;  4KI0 A;  4PMW A;  3HOX G;  2VQE L;  2CWA A;  3W1G A;  2OQ0 A;  1E1O A;  1Q1B A;  5HY6 A;  5IYC G;  3K7U C;  3STB D;  4MNO A;  4DUZ Q;  1X9N A;  2CCZ A;  4JI6 Q;  4GKK Q;  3UDX A;  3J81 j;  4PG3 A;  2RHQ B;  1SRO A;  4J15 A;  4YY3 L;  1GD7 A;  1HR0 L;  1VQ9 A;  2VQE Q;  2OTJ A;  4JI5 L;  1J5E Q;  2E2I H;  4UP9 A;  4B3T Q;  2UXD L;  4H02 A;  5C44 H;  3M4Q A;  4R4T A;  4DV5 Q;  1SRU A;  4EQ5 A;  4JBK A;  4QL5 A;  2OWO A;  2NVQ H;  1NE3 A;  5IYD G;  4R4O A;  4IPC A;  1YHA A;  2AWN A;  3CC7 A;  2OQK A;  3JAM i;  2I0Q A;  3PF4 A;  2UXD Q;  2FXQ A;  4RG1 A;  3KDF B;  5LMU L;  4DV1 L;  3I4M G;  1DGS A;  4PZ8 A;  4UP8 A;  4A3J G;  3S1Q H;  3CMA A;  5GAE C;  1CSP A;  3PUV A;  3I4N H;  4LF4 Q;  5FJ8 G;  1YNX A;  1FJG L;  1B7Y B;  4JCV E;  1YIT A;  5LMU Q;  1WI5 A;  3GTK H;  3PO3 H;  2ZTC A;  4A3E H;  3U50 C;  2EXD A;  4KHZ A;  1XPU A;  3RZD H;  3DLL A;  3CC2 A;  2VQF L;  1Q7Y C;  2F3I A;  5IWA L;  3A5U A;  4POG A;  3AQQ A;  1TWF H;  1SLJ A;  1VQF A;  4A3F H;  1HR0 Q;  3PSI A;  1VQ8 A;  4JI8 L;  2ASB A;  4IPD A;  2JEB I;  4O0A A;  5C0X J;  2R93 G;  1OXX K;  4DV2 L;  4A3E G;  1XNQ Q;  1XNR L;  3S14 H;  1HZB A;  2K5N A;  4OWX B;  2MO0 A;  3KDF A;  3F2C A;  3TQY A;  3GTM H;  1VQN A;  1OXS C;  2VL6 A;  1Y1V H;  1L1O A;  3RLF A;  2LXJ A;  4YWL A;  1PH7 A;  1G6P A;  2KCM A;  4A4I A;  4BBS H;  1OXU A;  2XGT A;  2UXB L;  2ZJR A;  1M90 C;  2WP8 J;  2KEN A;  4LW1 A;  4DK6 C;  1SFO H;  4BY1 H;  1P8L A;  1PFS A;  2Z6K A;  2HHH L;  2AKW B;  2JA8 H;  2ZJQ A;  4YWK A;  1GKH A;  1C0A A;  1Q86 C;  5FJ8 H;  1OTC A;  4LNQ A;  3K81 C;  4EX5 A;  3M4P A;  3S24 A;  4DV3 L;  4YCV A;  5IYB H;  2B3G A;  3TEH B;  1IBL Q;  4WJ3 M;  3RLO A;  4QGU A;  4DV5 L;  4JYA Q;  3J80 i;  5IY0 A;  3PUY A;  1HZ9 A;  1PH8 A;  1M1K C;  4B3R L;  4MTN A;  5LMN L;  1G29 1;  4GN4 B;  3W1B A;  4C2M H;  4NB3 A;  3K8A A;  4DR3 L;  3RN5 A;  1YJ9 A;  1VS0 A;  2JA7 G;  2MFI A;  2V1C C;  3L0O A;  5M3F H;  2WB1 G;  3OTO L;  4JI6 L;  4DUY L;  1MJC A;  5M5X H;  4JYA L;  3S15 H;  4JI1 Q;  5GAH C;  3H0G G;  4HJ9 A;  3HKZ G;  2E2J H;  1V1Q A;  1MIU A;  2N78 A;  1HNW L;  4LF9 Q;  2B63 G;  3PF5 A;  4QIW E;  3I4O A;  4DV0 L;  1HNX L;  2NVX H;  3D31 A;  1K3R A;  2YTX A;  1N33 Q;  3PO2 G;  4JI2 Q;  3NEL A;  4A3D G;  1VQJ A;  1E24 A;  1VQP A;  3KJO A;  1X56 A;  2F4V Q;  1HZA A;  2B63 H;  2D0P A;  2VW9 A;  1XTD A;  3CCQ A;  3ULJ A;  5FLX c;  5AJ3 Q;  1WJJ A;  1WCM G;  2HHH Q;  3H3V I;  3HOV H;  2B29 A;  3UDF A;  1YZ6 A;  4R1J A;  3PIO A;  3ER0 A;  1A0I A;  1PA6 A;  1D7Q A;  2K4K A;  1HNW Q;  3HOX H;  1VQC A;  4DV2 Q;  2A19 A;  1LM0 A;  1CKN B;  1YVC A;  2AWO A;  1KD1 C;  1PH3 A;  3CCR A;  2D62 A;  1U0L A;  5IE8 A;  2JA8 G;  4BA1 I;  5ELN A;  1BBW A;  1CKM A;  1XMQ L;  1PH5 A;  1V43 A;  4LWC A;  5C4J H;  3I56 A;  1R9T H;  3DM3 A;  2VS1 A;  1IBK Q;  1O7I A;  4LF7 L;  3E9I A;  4A75 A;  5IYC H;  4GOP A;  3LGJ A;  4JBJ A;  4FDB A;  4A3B G;  1EOV A;  5JEA G;  2KCT A;  4GKJ L;  4A3K G;  2H5X A;  1YJW A;  2F4V L;  2K50 A;  3F2D A;  4HJ7 A;  2HIX A;  1HR0 W;  1TWH H;  3FP9 A;  3STB C;  1N32 Q;  4JG2 A;  4DV6 Q;  3AFP A;  4R4I A;  2VQF Q;  4YHH Q;  3G4S A;  2CQO A;  4NXN L;  4GNX A;  3E0E A;  3BZC A;  2NVY H;  4NXM L;  3RZO H;  2Q2I A;  1MKH A;  3K7A H;  3TS2 A;  4YCU A;  3B6Y A;  3NEM A;  2UU9 L;  5C3E G;  1J5E L;  2UXB Q;  3GDE A;  4X64 L;  5BR8 L;  2YTV A;  4IO9 A;  4A3D H;  1VQA A;  3J80 c;  2IX1 A;  4B3M L;  4A3C G;  1VQG A;  3AFQ A;  4GLX A;  2Z6K C;  4KLK A;  3S1M H;  2GVB A;  1EQQ A;  2D0O A;  1EFW A;  2N3S A;  3W5O A;  3CCS A;  1BBU A;  2VUM H;  4JC0 A;  4A3G H;  1NTG A;  4DR4 L;  2AHO B;  5IP9 H;  5C4X H;  1PH4 A;  2I5H A;  3CPW A;  2K75 A;  4XTC S;  4AQY Q;  2UXC L;  2R92 H;  3OW2 A;  1XNR Q;  3S1R H;  4GKK L;  2MNA A;  1I94 L;  4AH6 A;  4C3I H;  2MO1 A;  4OO1 I;  4NXM Q;  1QVG A;  3M7N A;  3TRE A;  1N34 Q;  3J7Z C;  1SN8 A;  2R7Z H;  4DR7 L;  3S2H H;  1C9O A;  2JA6 H;  1AE3 A;  5JEA J;  2JA5 G;  5JJL A;  1KC8 C;  1L1O C;  1PH6 A;  2BA1 A;  1N32 L;  1YHB A;  2UUC L;  1YJN A;  2E5L L;  4IFD I;  1IZ6 A;  1X3F A;  1PHJ A;  1AE2 A;  4YHH L;  4BA2 I;  4QY7 A;  4UP7 A;  4TVA B;  3T1H L;  3MEF A;  3F2B A;  2UUB Q;  3HOW G;  1XJV A;  2Y0S G;  4LF5 L;  1EUJ A;  4JI1 L;  1YBY A;  1G51 A;  1QUQ A;  3CCU A;  4X65 Q;  4DV7 Q;  1IBM L;  2WFW A;  1HNZ Q;  4OWW B;  4GKJ Q;  1XPR A;  4MZ9 A;  3ERS X;  4A93 G;  5M5W H;  2UUB L;  1PH1 A;  1LUZ A;  4DAY B;  2N8N A;  4X66 L;  2GN5 A;  4BBR G;  4X62 Q;  2E8G A;  4UPA A;  1ASY A;  1K0R A;  1P16 A;  4P71 A;  3CCE A;  1RL2 A;  2NN6 I;  5IP7 H;  1E1T A;  1IBL L;  1QVF A;  1Q1E A;  4KHP L;  2Q2H A;  3KF6 B;  5M5Y H;  3CCM A;  1YHQ A;  5LMN W;  2LSS A;  3CQZ H;  3GD7 A;  4B3T L;  4JI3 Q;  1JB7 A;  1PH9 A;  2BH8 A;  3UE1 A;  1UWV A;  2ALY B;  4UY8 C;  4BXX H;  3H0G H;  5IYD H;  3J81 i;  1JJ2 A;  4A3M H;  4L5T A;  1VQB A;  2QEX A;  1BKB A;  1Q46 A;  2QGQ A;  2ZM6 L;  1I94 Q;  3HOY H;  3HOW H;  1N36 L;  3SGI A;  4B3M Q;  3UDI A;  1D8L A;  1VQD A;  2PNH A;  1U5K A;  5H1S E;  1L1O B;  2UUA L;  1IYJ B;  4LF6 Q;  1FJG Q;  1S40 A;  5K36 G;  2ZTD A;  3U4V A;  1VQO A;  1S72 A;  3I7F A;  4BBR H;  4DR1 Q;  1KL9 A;  4DR2 Q;  4L5S A;  4KHP Q;  2IT1 A;  4A3L H;  4X64 Q;  4IPH A;  3PGZ A;  4P74 A;  3FKI G;  5IWA Q;  4DAM A;  3HOZ G;  4JI3 L;  2DGY A;  4JBM A;  3GTL H;  3PCO B;  4OO1 G;  3EN2 A;  4QQB X;  5FLM H;  2K14 A;  4DK3 C;  3FKI H;  1TWC H;  3K80 C;  1OXT A;  1PYS B;  4DV6 L;  1PV4 A;  4BXX G;  5IT9 c;  2F52 A;  2PQA B;  2BA0 A;  3KOJ A;  3KYH C;  3ULL A;  3IRB A;  4K0K Q;  3JAM c;  1GO3 E;  4L5Q A;  1K83 H;  2ID0 A;  2PMZ E;  4JI4 Q;  3S16 H;  1EQR A;  1SR3 A;  1LTL A;  1K73 C;  4OX9 L;  1VQ6 A;  4JI8 Q;  4A3I H;  4DV3 Q;  2K5V A;  1H95 A;  1HZC A;  3J81 c;  1Y14 B;  4TQU S;  1X55 A;  1VQ5 A;  1J6Q A;  4JI0 L;  4JI7 L;  4NXN Q;  1N33 L;  1XPO A;  4X6A H;  2Y0S E;  4R4C A;  2JE6 I;  3K0X A;  4BY1 G;  2R7D A;  4IFD G;  5ELO A;  1IXR A;  4IJH A;  2AMC B;  1VQI A;  1W2B A;  2IX0 A;  5IP9 G;  4GLA C;  4C3J H;  3FHW A;  4LFA L;  3CCV A;  1KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...