3HKZN

The x-ray crystal structure of rna polymerase from archaea
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit A'
total genus 12
structure length 64
sequence length 64
chains with identical sequence W
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hkzN00
3FIWA 4A3MJ 1MBEA 2YS9A 1GT0C 1IDYA 5EEAA 3DCFA 4MIMA 2XGEA 3TEDA 5K7HA 3MVPA 5HODA 3IV5A 2E1OA 4I76A 2R5ZA 1HLVA 2H1KA 1TWCJ 5E3LA 2TCTA 5BNGA 3NARA 1ETOA 4M3BA 4QIWN 3SFIA 3GTPJ 4XIDA 2DMUA 2LY9A 2MSYA 3G1MA 3LSGA 2JK3A 3PO2J 1OFCX 1HDPA 2AO9A 3OSGA 2DA5A 4UUSB 2O9LA 2L7FP 4A3LJ 1JUSA 2FQ4A 2L0KA 1LE8B 3A01A 1RESA 1VI0A 4V2FA 1H89C 3H3VK 4UUSA 1LFUP 5F0HA 5FLMJ 3PO3J 4DYCA 3HB9A 3L1PA 3CMYA 3O8HA 2DTZA 4W97A 3M4OJ 2CQQA 1QVUA 2WB1N 3CCYA 4ABZA 3BR0A 4A3BJ 2HOSA 5IYCJ 2WV1A 1BL0A 4AUXA 2M8GX 4AC0A 1E3OC 2GBYA 5M5WJ 2PMZN 5EYRA 3JREA 2XPUA 1IGNA 5JLWA 2M9HA 1ORKA 4A3IJ 2JWTA 2DA7A 1F43A 5K7ZA 4X6AJ 2VUMJ 3VPRA 4JX6A 4EEFG 5FKLA 2R5ZB 1JT6A 4W1UA 2DA1A 4A3CJ 5EG0B 3FISA 5EDNA 2K9QA 4IHWA 2ZB9A 3HOYJ 4BBSJ 3JRCA 1I6HJ 1W0UA 1XG1A 1DU0A 3ZQGA 2HOTA 1ETXA 1MH4A 1T33A 1VF9A 4FE4A 1JKOC 1GVDA 1ZR4A 2X9DA 4DYRA 1MH3A 3JRGA 1FTZA 1JJ8C 3CQZJ 5DS9A 2Y0SN 2GM4A 1WH5A 3K2AA 3OOUA 1MNMC 1U9NA 3ZQLA 3FKIJ 2HXIA 2HYJA 4BKXA 1BW5A 2LLKA 2Y2ZA 1SANA 1IV6A 3A03A 3GTOJ 4QSHA 2DMNA 2CQXA 3HKZN 4MLOA 3JRFA 3E7LA 1TWGJ 1U9OA 3HOVJ 4A3DJ 1U78A 2CJJA 1RKTA 4XRSA 4FTHA 2E2IJ 2JA5J 4MFEA 2E2JJ 4UUTA 5C4XJ 3GTQJ 2ME0A 5FKMA 2M0CA 4B1RA 4BXXJ 1RPWA 1YRNB 2K9NA 3IH2A 4BBRJ 4D5CA 1MBGA 5FLVA 4XK4A 2H8RA 1G2HA 2DMQA 3GBGA 1K83J 1PUFA 5E3OA 2I10A 1ETQA 3BG5A 2YUSA 3BQZA 2HQ5A 3MKLA 1B8IA 2WAQN 2HI3A 3I4MJ 2CUFA 5F08A 1X2MA 3HBLA 5J1UA 4A93J 5M5XJ 5GPCA 2XGDA 3JRHA 5F04A 1LE8A 1JKPC 2KDZA 2Y31A 4QTRA 2NOGA 3S16J 1I3QJ 3I4NJ 1XC5A 2ID3A 3ZQCA 1H88C 3BR5A 3LSRA 5IOYA 5EZHA 5K7FA 3HM5A 4LOCA 3FK6A 4FISA 1GV2A 2EQRA 3CDLA 1B8IB 1FTTA 2X48A 1DU6A 1JJ6C 4DYQA 2JMWA 1AU7A 4S0HB 2LD5A 2E2HJ 2CRGA 1RETA 4JP0A 1IDZA 5EF6A 2XPWA 2NVXJ 1MBJA 1RR7A 1WGXA 2DMTA 2HOAA 2Y9YA 1P7JA 1NK2P 1FIAA 3MN2A 2NS8A 5M3MJ 2XPVA 4XICA 1TWAJ 2XB5A 1JTYA 3JRAA 1ZQ3P 1ITYA 2EZHA 2VI6A 4C3JJ 1JGGA 4A3JJ 2B63J 3S1NJ 1JKQC 3WHBA 3LOCA 2W48A 5GP9A 1BJZA 1UMQA 2JA6J 3BTCA 1QRYA 2K9SA 4C2MJ 1O4XA 3GTGJ 3G1LA 2R7ZJ 3LNQA 2M34A 1ETKA 2VPRA 4V2GA 3BT9A 1POGA 1Y1VJ 3BR2A 3K7AJ 3GTMJ 4J19A 3OSFA 2CUEA 3S2DJ 4DW6A 3Q0UA 2N8GA 1SFOJ 3S17J 1EF4A 2NVYJ 4HNVA 1B72B 2L7MP 3M3YJ 4RDUA 4A69C 3TP0A 2MW8A 4FCYA 4A3EJ 3Q3SA 3BG3A 3HEFA 3S2HJ 1BA5A 1OCPA 9ANTA 2AHQA 2XRLA 4IHVA 4M3EA 2LVSA 3HOUJ 3BR1A 2FX0A 4B4CA 2ECCA 3D1NI 3QPSA 1JUMA 4NDLA 4CYCA 4Y52J 2LKXA 4IHXA 3W6VA 3BTIA 3GTLJ 1S7EA 2O7OA 2DA3A 1OJLA 4JX4A 3S1RJ 3HOWJ 1BW6A 4BY1J 3RZDJ 3C2BA 2X6OA 4JYKA 1ZTRA 5C3EJ 1T56A 4C3HJ 4GFBA 2FJ1A 1HDDC 3HDDA 1MBKA 3A01B 4A3GJ 1U8BA 5F0CA 3JR9A 3BG9A 5FKNA 3ZOBA 4IHYA 2HXOA 3F0CA 5E3MA 2YU9J 1YRNA 2RAEA 2LR8A 2QF7A 3HOZJ 2GLOA 3O8GA 3HOXJ 2VKVA 1IC8A 4FE7A 4X1EA 4XRSG 1JTXA 3B6AA 4D5FA 1A5JA 2OPTA 3TP3A 2NS7A 2R93J 4Y7NJ 1CQTA 2LFBA 5FJ8J 3HGGA 2ID6A 2EZLA 1LFBA 1P7IA 2IEKA 3IH3A 1JKRC 5FKKA 4B3AA 2DN0A 2ME6A 4D7MA 5E3NA 2XB0X 2IAIA 2JN6A 4MO7A 2Y30A 2R5YA 3S1QJ 2R5YB 1MBFA 3B6CA 5C44J 3ZQHA 2COBA 5J1YA 2E19A 1AKHB 3TW6A 3BR6A 2JA8J 2DA4A 1Z77A 2EZIA 1HOMA 3LSJA 3UKGA 2KT0A 2DA6A 3BR3A 1QPIA 5IPAA 2ELKA 1HCRA 1GV5A 1UG2A 3SJMA 3RKQA 4IEJA 1W0TA 3JRIA 1ZKGA 4XRMA 3Q0WA 2JA7J 1FEXA 5F0FA 1XS9A 3WHCA 2K40A 1ETVA 4M6VA 2Y9ZA 1MSEC 1IUFA 1R9TJ 2DMPA 1I50J 4DZJA 3BQYA 3H0GJ 1TC3C 4RBOA 2VKEA 2DA2A 4BY7J 1Q1VA 3HGYA 1IJWC 3PM1A 2G0EA 3A02A 5IOZA 1NTCA 1ZK8A 4L5EA 4C3IJ 1OCTC 4M3GA 3NAUA 5IYBJ 1D5YA 5IP9J 1APLC 2M2EA 5JLXA 3BTLA 5EGOA 5M3FJ 1ETYA 2OF7A 1WI3A 3JRBA 1X58A 4DZPA 2EH3A 5J3LA 1JT0A 4MFDA 1IG7A 2MG4A 1VNDA 2HDDA 1GUUA 4M3DA 5EGOB 1IRZA 4CYCB 2D5VA 1PUFB 3DEWA 3S15J 3G1OA 3GTJJ 2MGQA 1FIPA 4M3FA 4G12A 2EBIA 5IP6A 2IBDA 5IP7J 1VFCA 5IYDJ 3QPLA 1H8AC 1WCMJ 5M5YJ 1HF0A 4A3FJ 3IH4A 1JUPA 5EZGA 2L7ZA 3S14J 4JX5A 1X2NA 3QQAA 2XSDC 1A6IA 2TRTA 1AHDP 1TWHJ 2R92J 5C4JJ 1ZGWA 2CU7A 2LTPA 1Z0XA 2ECBA 5FKOA 5GPAA 1F36A 2L9RA 3RQIA 1WPKA 2JJ7A 1B72A 2EZKA 5F1JA 3RZOJ 1QVTA 2FD5A 2DJNA 1ETWA 1RKWA 3ZQFA 3JRDA 3FK7A 2XGCA 1FJLA 5DTDA 2R0QC 2QCOA 1ZR2A 1MSFC 1MBHA 1AKHA 1NK3P 3OIOA 3S1MJ 5F27A 1Y1WJ 3TW7A 4I6ZA 2NVTJ 4D7NA 1WH7A 3BTJA 1ENHA 2NVQJ 3SDGA 2LK2A 1K61A 5EG0A 3Q0VA 1UHSA 1TWFJ 2P81A 2LP0A 2O8KA 3GTKJ 3ZQIA 5J1RA 3LSPA 4A3KJ 1GDTA 4AYBN
chains in the Genus database with same CATH superfamily
4A3MJ 4HQMA 3ESWB 4BUPA 2QQ8A 3DCFA 4MIMA 2XGEA 3TEDA 3F8MA 2PN6A 4IKFA 3CCRI 2V79A 1WQ2A 2K3PA 5E1XA 3I56I 2R5ZA 4HDUA 2XDVA 3VYSB 5J8CA 3E5QA 4IHSA 4WX9A 3NARA 3P9KA 1ETOA 3L09A 4BDYA 3WGIA 3KYDB 2GIZA 1FBQA 2ZNZA 3CTAA 5HS7A 3ZMVA 2CFOA 3LSGA 3K4MA 2E34A 1OFCX 3DPLC 3W2WA 5HLIA 3DPTA 3CZ6A 1D8KA 1MMAA 2AO9A 2HQNA 2DA5A 4UVAA 2K7LA 2NAZA 3TBIA 3K70D 2HU9A 1BJAA 3CMAI 3IRQA 4YEJA 1JUSA 5GAGJ 1N25A 4V2FA 1I5ZA 3J80Z 1Z05A 4HRIA 5F0HA 1HKQA 4HBLA 1A35A 1XMAA 4LITA 4DYCA 3QOEA 2EFOA 3ZMSA 3CMMA 4KN4X 3PNTA 4XSXF 4PJ0C 2CQQA 1QVUA 2JUGA 2EJRA 2FMLA 4ABZA 1SC7A 1ZN2A 3MAJA 4MTEA 2HOSA 2EINH 1XSVA 3TKYA 3OYFA 2MLGA 2M8GX 4G7HF 3K10A 2GBYA 5M5WJ 1G4DA 1FP2A 4AVZA 3JREA 3AL0C 2L9NA 2F48A 2HPIA 2XPUA 2QGUA 1EH8A 3P9IA 3ROUA 3SZTA 4BXUA 1ORKA 2CH0A 5JLWA 3L2UA 4OIQF 3DEUA 3ABKH 2ZNYA 2R7VA 1YW7A 2DA7A 3DU6A 4YELA 4ITVA 3LAJA 3VPRA 3D0SA 3FMRA 3I54A 1BM9A 2JA2A 2QENA 1MW7A 2R5ZB 1A36A 3RI4A 5LGUA 2GZWA 4DQ2A 2CGPA 1P4AA 2HDCA 2V7FA 3NQOA 4L9NA 2VJJA 4OIRF 5ICFA 1T0FC 2O0YA 2ZB9A 2IRFG 2KPMA 3R0AA 5JVTA 4IXAA 4C2TA 3HOSA 1KU3A 3FM5A 3ZQGA 4ZDPA 3J81K 2HOTA 1HA8A 2UXNA 1CGPA 2LH9A 1MH3A 3FXMA 2PQ8A 4E7KA 2VT2A 3K4NA 1D0YA 1QHGA 1JJ8C 1IXRC 1W36D 3H9QA 3KPHA 2WY8Q 1ZAOA 2KQRA 1WH5A 2BYVE 2I5UA 1MJAA 3FKIJ 1SD5A 3GLLA 2HXIA 2HYJA 1SANA 2Y0SA 3HKZN 4GO1A 4XM3A 1TWGJ 3HOVJ 3R0JA 1Z7LA 3CD6I 5D5XB 2JA5J 2E2IJ 5BMZA 4MFEA 2KISA 3SQNA 4HF1A 2WWYA 5C4XJ 2ME0A 1SD7A 4B1RA 2OQRA 3GVAA 1YRNB 4U0WA 2KLOA 3IH2A 2VOOA 2I8DA 3EETA 2DO7A 4L9VA 3PJRA 1XCVA 4RB1A 2FE3A 4GYGA 2BY0A 2XAHA 3I53A 1K83J 3ZQQA 2L2OA 2Y0MA 4GRIA 3CJNA 2HI3A 3K4CA 1I27A 2VBZA 5M5XJ 2Q2EA 5F04A 4P1WA 1VQ8I 3DTIA 2XHKA 3FBNB 3S16J 1I3QJ 2A69F 1I1GA 2VT3A 3KP4A 1XC5A 2JRMA 4S04A 2ID3A 2DPUA 3I4NJ 3HG9A 4LIVA 4Y17A 1MMSA 1O7FA 4N4NB 3ZMTA 2ESNA 1O3TA 3BROA 5HS9A 1SVLA 3C2GA 4E7LA 4LOCA 2V9PA 3U1KA 1SEUA 5LRSA 1GV2A 4RGSA 3CUQB 3CCUI 2V1DA 3BC8A 1FTTA 1OCRH 2CQKA 1YJWI 4FHTA 5DCMA 2DT5A 2KJCA 1ODDA 4NC6A 4DYQA 4HPQA 3DBRB 4Y33A 2GQQA 4F91B 2DYSH 2LD5A 1FMWA 4CCLA 2DK5A 2OAZA 4PUSA 3FWEA 1RETA 3N97A 1N77A 2AXTC 2XPWA 3D5RC 1FBUA 1FLIA 1U5TB 4K2EA 1VQNI 4I98B 4V19K 2DQRA 1NH3A 1RR7A 2HOAA 3WGHA 1VQ6I 2KIFA 3N05A 4YG2F 2ISZA 4MGRA 1FOYA 1DDNA 1TWAJ 2XB5A 4G9YA 1KQ0A 2CW8A 1JTYA 3JRAA 1ZQ3P 1B1BA 1JGGA 4C3JJ 5E17F 1JKQC 3CCLI 3WHBA 5DUKA 1LFPA 4PJNA 4LB6B 3WTSC 1R58A 3GFMA 2K9SA 4G6TB 1UJ8A 2BW3B 4C2MJ 3WTYC 4KDPA 2JSCA 4GDFA 3G1LA 2R7ZJ 3LNQA 4XLFA 1TL8A 1RC9A 2K9LA 3H5AA 2XRNA 3BT9A 1VQMI 1QQIA 3GTMJ 3O3KA 3K69A 2QYOA 3OSFA 3ASNH 4DW6A 4M72A 2LYCA 2Y48A 2QSHX 2HZTA 4XORA 1EF4A 1A04A 1G3WA 2NVYJ 4BHBA 1V4RA 4HV6A 2EA2A 2IT0A 4RDUA 4A69C 5BOXA 2E7WA 3LSIA 3E6BA 3J7AY 3VEPA 4IRHA 3Q3SA 3BG3A 5DCFA 2RN7A 2W00A 4KMUX 1J5YA 3Q5FA 3U21A 3OIQA 3HRSA 4NDLA 4Y52J 2STTA 3W6VA 3IKVA 4IZZA 1FOXA 1EH7A 1OJLA 4HX4A 1GLNA 2QSFX 3CESA 1U8RA 4A6DA 4BXFA 3HIFA 2ZJ2A 1YITI 4M73A 3JAMK 2LY2A 4JYKA 3MQ0A 3COAC 1STZA 2KIUA 4GFBA 1PP7U 4A3GJ 1MBKA 2VQLA 5ILVA 4ZJZA 3E0JB 3L7WA 1YIOA 3J7YJ 3QYFA 5CJ9A 1RR8C 2EB7A 3AG2H 1MIJA 4BACA 3I0TA 4IQJA 5EEHA 4EM0B 4LD5A 4A0ZA 4Q5SF 2BHYA 3D5SC 2JRTA 3BJOA 5AIPA 2H27A 2P4WA 2HPMA 4Z6YA 3HOZJ 2VKVA 5EEGA 1IXCA 2FQ3A 2LREA 3FXOA 3S93A 5E8IA 1JTXA 4Y3OA 4D5FA 2NS7A 3OYIA 1I6XA 3HGGA 2DFHA 4LK1F 3DBLB 4ON0A 3JW4A 1B9NA 5LLQA 1YJ9I 3HC7A 4B3AA 3E5UA 2ME6A 2KHMA 4HLYA 1WJBA 1W5TA 2Q0OA 1XDUA 1U0JA 1X1AA 4ZTJA 1BN5A 2Y30A 5HDKA 3I4PA 3VDXA 2DU9A 2LBFB 4MQVA 1IO2A 4UV8A 3ABLH 3ONQA 3TOAA 1FSEA 2RC4A 3ZQHA 4ENMA 3OYBA 2PBIA 1Z6TA 2QQAA 2ZFWA 2HDWA 3REOA 1VTNC 2IA0A 2JA8J 2ETHA 3SYTA 3MWMA 2FOKA 2P8TA 4XONA 1HCRA 3SJMA 3FMQA 1IAWA 2VOPA 2Z2SB 5AIQA 2CV1A 1WFXA 1XS9A 2K40A 3S3NA 4BGDA 4RAFA 2Y9ZA 1G6NA 4CZCA 3V7CA 1YI2I 1CF7B 4QPOA 4NBQA 5K5QA 1I3AA 1I50J 3EDPA 4DZJA 1YS6A 4BEHA 3OYEA 1R22A 2WAFA 3G2BA 1TC3C 2FRHA 5CVRA 2W57A 4PJMA 4YIIA 4BDZA 2XAQA 1Q1VA 2G0EA 3SHFA 2QEXI 2W24A 2K85A 5IOZA 3KP2A 1NTCA 3AFHA 1OCTC 5CPRB 2M7AA 5IP9J 1APLC 2CQNA 4IL6C 2DT6A 4ZYGA 3BTLA 2HNHA 3F8BA 1ETYA 5LHHA 4DZPA 2EH3A 1LDKB 2KIMA 2MG4A 3GUDA 2NYXA 5EGOB 3RYPA 3HPGA 1PUFB 2EFWA 3BY6A 4HNUA 1FC3A 1QZZA 2ELHA 4CCNA 3CP2A 2L02A 1UFMA 3LWFA 2F5VA 5IP7J 1XCBA 4KUMA 4FQGA 2LY1A 1VFCA 2NS0A 2EWNA 2J5PA 2L7ZA 4Q47A 4JX5A 3OYLA 3SDBA 2KFDA 1K6YA 4DGWB 2H1LA 3UNGC 5C4JJ 1ZGWA 1O3QA 4NC7A 5GPAA 5CVVA 3RQIA 1WPKA 4F52A 2HKOA 3ERMA 2ZC2A 5FROA 2W25A 3H9JA 4EATA 2JJ7A 1KU7A 3RZOJ 3V42A 1VQ7I 1JHHA 2MD0A 1D3YA 3L2WA 1RKWA 2D1HA 2L4MA 4U7BA 3U9GA 1IF1A 3SZGA 4RB2C 2XGCA 1YW8A 3DBHB 1UB9A 2F5DA 4C9YA 3A1YA 4EGZA 3CUQC 3MZ8A 1SD6A 1R1VA 1UG0A 3OIOA 2DJIA 2FSWA 2H94A 4XBFA 1D1CA 4HQEA 4XLHA 3PL8A 3TW7A 1WH7A 1X3UA 1BOAA 2NVQJ 4J01A 3Q0VA 3V8LA 1TWFJ 1EJ9A 5H20A 3H36A 3ZQIA 1GXPA 4M9ZA 3FZVA 3FIWA 1MBEA 2A05A 3ZR8X 4ANJA 1IDYA 4DOZA 5EEAA 2ZMEA 3P7NA 4XMYA 2E1OA 2CW7A 5J47A 4N4OB 1FSHA 1TWCJ 2L01A 2TCTA 3F6VA 1YYVA 4F55A 1R5ID 1S5LC 4RMNA 4EGYA 4I09A 5DD4A 1YLFA 2HKXA 3G73A 2MSYA 3G1MA 2BE5F 3DPUA 1KYZA 1FYMA 1KZHA 5L3EA 2CUJA 3DP7A 5ILUA 3ECHA 4ZYAA 2Z16A 5TRDA 5HDGA 1RRJA 4A3LJ 2M8EA 5LRRA 2L0KA 3CP8A 1H89C 3OYGA 4GYIA 1W36C 2Z9OA 2IGOA 4AM3A 1W5CC 5HS8A 2GOMA 2FBKA 4FETA 1QBJA 2LF7A 1B9MA 3CC2I 3L1PA 2KJBA 3DXJF 2DTZA 4W97A 1N75A 2WB1N 3CCYA 1J75A 2IP2A 3BR0A 3QPTA 5D8KB 2X1EA 5IYCJ 2WV1A 2L3DA 1BL0A 4AUXA 3U1DA 1E3OC 3KP6A 1Z67A 1K78B 2XROA 4HV5A 2PMZN 3W2AA 2QQ9A 1CF7A 3AKZA 5GAEJ 3PUBA 5BPIA 3AG3H 1DGWY 4NQWA 1PJRA 3QAHA 2ZXHA 4XKBA 5K7ZA 2H09A 4X6AJ 2VUMJ 3GW2A 3VYRB 3L2QA 5FKLA 3H0DA 2PFBA 1JE8A 3KP3A 1JT6A 2E1CA 3E1SA 3BPVA 4A3CJ 5EDNA 2K9QA 1FBSA 4IHWA 4JK1X 2RNJA 2IGKA 3MZHA 1L3LA 4II2A 1W5SA 1XG1A 1ZG3A 1ETXA 2R7OA 4JOMA 4XLNF 1MH4A 1VF9A 3E5XA 1BC7C 1ZR4A 3JRGA 4XQFA 5DM6F 1FTZA 2FA5A 3CQZJ 4UHTA 2W7NA 2LOOA 3PIOF 4G94A 3OOUA 1U9NA 4OMYA 4EVIA 1RI7A 5B66C 5D6EA 2P7VB 4BS9A 1JGSA 1X1PA 5K5OA 4LJZF 3PSFA 1YHQI 3IKTA 4QSHA 4MLOA 4NUBA 3OS0A 4ZDLA 1U9OA 2XF6A 4A3DJ 2HVQA 3BOQA 3WGGA 3K1PA 5CYVA 1T6SA 2WA0A 3GTQJ 3BJ6A 3RKYA 4BXXJ 1ON2A 2JUCA 4AIJA 3RPUD 4BBRJ 2DI3A 1ONVA 4EJUA 4YRVA 5FLVA 4PGGA 3V7SA 3KZIC 3ZGKA 2H8RA 4OINF 3EYYA 3GBGA 2JTVA 1HSJA 1PUFA 2A61A 2DBBA 3NWTA 1ETQA 3BG5A 3MKLA 2XVCA 1F5TA 2WAQN 3RYRA 3WTZA 1K4TA 1TNSA 1X2MA 2VJ5A 5E20A 5J1UA 3QOPA 2LSOA 5DV5A 4C30A 5H6RA 2QWWA 2NOGA 2AS5F 4PJLA 1ZRCA 2CYYA 5IY5H 1H88C 4H4KC 2ZO4A 5IOYA 3M07A 3LSRA 1TW3A 2P5KA 2BV6A 3OYJA 3OL4A 3CC7I 3FK6A 3ABTA 2XV4S 2B7EA 1MMNA 2IW5A 2HR3A 3JSPA 3CDLA 1LVKA 4PCQA 1JXSA 2KZVA 2DCEA 1RNLA 1ZHFA 4RA2A 4J00A 1Z91A 3OYKA 3I64A 4EJTA 3GZNB 4KIBA 4XOPA 1N78A 3HRMA 1L0OC 2XASA 2VASA 5KAIC 3OYNA 3BPXA 4IHTA 1ZLJA 2PJRB 2WBMA 5FLXZ 2IJLA 2HYGD 4XLCA 4UY8I 4EJOA 2OD5A 2VN2A 4E7HA 2DXIA 4KJZA 5TJJA 4HNTA 2Y9YA 3MZYA 1R00A 1G8XA 3BCAA 2OV7A 1FIAA 2AXLA 3EPZA 5M3MJ 4MTDA 4ZDOA 3RSNA 4PSWA 2VE8A 4HF0A 2EZHA 2XIGA 4XSZF 2B63J 5FFXA 3UR3C 3MEXA 4CCJA 5GP9A 2R7UA 3WTUC 3ZMUA 1P4XA 1YFHA 4F92B 1P92A 3GTGJ 1P6RA 1WZ2A 5BPDA 3DLLF 4V2GA 4CO8A 2HQAA 4LG0B 3CCQI 2VODA 4EMSA 5L3GA 2HWVA 3BR2A 1G59A 4J19A 5CVIA 1MMDA 2CUEA 4ZYEA 2N8GA 2EA4A 2ZFUA 2NNYA 1R5HA 3S17J 1E3PA 1YX3A 1WJAA 4HOBA 2VQGA 2AQFA 3OR2C 4HNVA 5JHUA 2L7MP 1ZG5A 4CUGA 1Z1DA 1K79A 1WJFA 4FCYA 2UZKA 3CUOA 1ZG1A 1OCPA 2XRLA 2OCCH 3E6CC 4M3EA 2CO5A 2LVSA 1SVMA 1UELB 4BL0B 1IZ1A 1FPQA 3QPSA 2B9SA 1RUNA 1MJ9A 2XAGA 1I1SA 4CYCA 2RQPA 3LMMA 2HTJA 1QZEA 4WXCA 4IHXA 4DBQA 4N9HA 1TNTA 3HXLA 1IRGA 2VJ4A 3X2QH 4N9IA 4P9FA 1S7EA 2DA3A 1DUXC 2JPBA 2NOJB 5AONA 4XL9A 1BW6A 5JHFA 4PFPA 3WG9A 2AQEA 2OQGA 4IPAA 2CG4A 2ZMEC 3CJRB 3ASOH 3N4MA 1ZTRA 1T56A 1HDDC 5B5EC 2P5VA 2XSJC 2ZXIA 4B44A 2K5CA 1BI1A 3LQQA 3M1EA 5FKNA 1LPQA 2RREA 4IHYA 3LSTA 2FOWA 2HXOA 3F0CA 1YRNA 3JAMZ 1XMKA 5LBQA 3KLNA 2GLOA 4IO9F 4BE0A 5J8FA 1DPRA 2M87A 2OCEA 2IVMA 3C2HA 4ZTFA 3RDIA 2MD5A 1XGMA 3KEYA 4XRSG 1RUOA 3CF5F 1XSXA 5B3SH 3I59B 5DDGA 2DODA 3B6AA 2OPTA 5KCMA 3TP3A 3HKZA 3VOEA 2R93J 5H6QA 1OPCA 4KT5C 1CQTA 4L0ZB 4BYYA 3TGNA 2EZLA 2Y69H 4L5JA 1QO0D 5TISC 3LA2A 1AOYA 1LFBA 3OWTA 1X3WB 1LEAA 2ZSHB 2DFFA 1OYWA 3GMEA 3LFUA 2DN0A 5E3NA 1LJ9A 3R60A 3CO6C 2X85A 2EV0A 2V1XA 1KYWA 3ZXSA 2R5YA 3OYMA 2E5ZA 1T98A 2LG4A 4DJAA 3B6CA 3H5NA 4HG2A 5JFRA 2MA3A 2GA2A 2COBA 2VLAA 4R79A 3CCSI 4OU0A 4Z2YA 2LBFA 2IS2A 4IOCF 1AKHB 2VXDA 2ZKZA 1Z77A 2BY2A 3VYTB 2UV1A 5D5VB 2KT0A 3ZPLA 3BZKA 1LDDA 4HDVA 1BR4A 5IPAA 1GV5A 1UG2A 1LNWA 3VYUB 4A0YA 3RKQA 3M9AA 5HNFA 3JRIA 3OY9A 3IWFA 3Q0WA 4IQ4A 4RAYA 1FEXA 2ISYA 4YIFA 3BWGA 1SMYF 3M7GA 1R36A 1HBXG 1IUFA 2WAEA 3FMSA 2K86A 5DCMB 1K4SA 3H0GJ 1IN5A 4IRGA 4U7DA 1NG7A 5F6FA 5CQGA 3GYHX 1J0RA 2L54A 2VKEA 2DA2A 4AIDA 2VL8A 4AWXB 2Z99A 4BY7J 3I3LA 5KHDA 4XKWA 2EFQA 4DNCA 1W7PB 4CYDA 2A5WA 3MCZA 1ZK8A 4KA4A 4I99C 4M3GA 5IYBJ 4Q4ZF 4LB5A 5LHIA 2LKSA 4UNOA 4KFCA 2M2EA 2KZGA 4I7HA 1B6AA 3WTXC 4AYBA 1EV7A 4EM1A 1XGNA 4MNUA 5JLXA 1HQCA 4AD9A 2Q2EB 2X0LA 1GXQA 3ERED 2OF7A 2ZJQF 3MFKA 5B1BH 5J3LA 4LMYA 4MFDA 1VQOI 3S32A 1ERDA 1GUUA 4I02A 4M3DA 3W3CA 4KYWA 2L4AA 2KP6A 2QQBA 2D5VA 2CMPA 1KQ9A 4G6DA 3KLOA 4ENJA 4WXHA 2MGQA 1FIPA 5J4YA 1RZ4A 2OZUA 3R4KA 3CDIA 2IS4A 3Q9SA 4YIRX 5IYDJ 3QPLA 5M5YJ 3VB2A 4A3FJ 2FU4A 4OAZA 4B48A 1JUPA 1MZBA 3T1BA 1Q1HA 4BQOA 5DD8A 4AIHA 3QQAA 1A6IA 4NHJA 2Z1DA 3QP5A 3H3UA 3DLAA 4ESBA 2CU7A 5JI6A 1Z0XA 1BBYA 2UXXA 4HX7A 1F36A 2L9RA 3V8JA 1K6OA 1ZYRF 2M4GA 5L3DA 4NB5A 1HC8A 5E79C 2FD5A 2DJNA 1D0XA 2QZ8A 1ETWA 4LK0F 3GXOA 3IHUA 5HOOA 1H9GA 3K70C 2QCOA 1ZR2A 1MSFC 1MBHA 2DAOA 5LD2C 2E5NA 4HF2A 4L18B 2W1OA 3S1MJ 2EILH 1V5GA 5KVRA 1QNTA 1OCCH 1R23A 4GGGA 4YFKF 3NWSA 3OYAA 3ISPA 2VC0A 4A5NA 4I6ZA 3DEEA 2NVTJ 3KP7A 1V5FA 1ZGAA 2CS3A 2Z3YA 2W84A 3LA3A 2HS5A 3SDGA 2LK2A 1SD4A 2GOXB 1K61A 2P81A 2O8KA 3DFGA 5H2FC 3GTKJ 3WTWC 5J1RA 4CA0A 2CQ7A 4Y13A 1QZYA 1XDSA 2O03A 2E71A 3B73A 1H9TA 1SFEA 2YS9A 4F93B 2H6CA 3OL3A 4PZJA 5K7HA 3MVPA 2DLLA 3KYCB 3BZ6A 3IUOA 2H1KA 2KRFA 5E3LA 5BNGA 2PJRA 3DTEA 4M3BA 4QIWN 3SFIA 3GTPJ 1LDJA 4RAGA 4XIDA 3GFIA 5J40A 4OOIA 5DM7F 2XKOA 1T95A 1B59A 2JK3A 2ZXWH 3PO2J 2A3SA 3C7JA 4EM2A 1HDPA 3W6KB 5GADJ 4XN3A 3OSGA 3FXRA 4UUSB 2OTJI 2L7FP 3TQNA 1FY7A 3PQKA 4CSWA 1FT9A 1A6QA 2X6XA 1LE8B 1VI0A 1BR1A 4KITB 3T8RA 3FXQA 4M9XA 3HHGA 4ASNA 4BQQA 1LFUP 2RGVA 4PK4A 4BAYA 4JQFA 4KICA 3HB9A 3OIPA 3MKZA 3CMYA 2VE9A 3KCCA 3M4OJ 3F22A 4IF4A 1W1WE 4A3BJ 4O3MA 5FFZA 2PG4A 3I5UA 1WJ5A 1WWXA 3MD2A 4H0EA 2WAQA 2Q8KA 1IN8A 2KMUA 2M9HA 4C2UA 4A3IJ 2D45A 4ZH4F 4BNCA 5HLHA 1OKRA 1F43A 5ICGA 1X4OA 2CV2A 4EEFG 1ZARA 3IC7A 3SZPA 3H5RA 1FWZA 1ZH5A 4MQ9F 2QKMB 2X4HA 2IS1A 3LA7A 3DF8A 3FISA 4BBSJ 3JRCA 1B4AA 2COMA 3HRTA 1I6HJ 2PMUA 3D5LA 2VIXA 1T33A 3P5JA 4FE4A 1JKOC 4DYRA 1IN7A 1P2FA 3EUAA 3FDYA 1T8IA 3PNVA 3K2AA 3G71I 1R5GA 2WC2A 4YFXF 1BW5A 4BKXA 2E7XA 2LLKA 2Y2ZA 1P4WA 4I01A 2HFHA 1IV6A 3A03A 3GTOJ 5LEJA 1BIBA 3JRFA 3TOBA 2WTEA 1FMVA 2MH2A 2IS6A 3K9TA 3EUHC 3BP8A 4L9JA 3CMEI 1RKTA 3TO7A 3WG7H 4XRSA 1HXDA 4FTHA 4I2OA 4PSXA 2WY7Q 3QP6A 3KYLA 2VJIA 5E8GA 1YG2A 3HUGA 3GX4X 1MKMA 2L9VA 2P5LC 3GO5A 3CCMI 3EUKL 4E4HA 2FXAA 1RPWA 2K9NA 3RKXA 1MBGA 3OS1A 2HZDA 3IRRA 3OS2A 2GXAA 1MGTA 2VKDA 3J7AO 3WU1B 2L9SA 1SFKA 2I10A 5E3OA 1B8IA 2YUSA 3BQZA 1HW2A 1ZRDA 3M8EA 2CUFA 2HQRA 3C1DA 5F08A 3HBLA 3DV8A 5GPCA 2XGDA 2OUMA 2HYFA 2YX4A 1JKPC 2KDZA 1LE8A 3L00A 3LFKA 2Y31A 3FKJA 4HW0A 1JI8A 2J5OA 3GZ6A 5FGMA 4WCGA 2ESHA 1OCZH 1WJDA 3M8JA 3HRUA 3QODA 3ML6A 4UXNA 2EPFA 4FISA 4MHGA 2LMDA 1UAAA 1G3SA 2EQRA 2EIKH 1B8IB 4M9SA 1DU6A 2OBPA 4PDKA 2MABA 3FXLA 2KL4A 3I9V2 3CC4I 3KZZA 5D4SA 3ZP5A 3BCBA 3BLYA 3IAS2 4F3QA 2CRGA 3QU3A 3H3ZA 3AL0B 4BEHB 1VQ4I 3K6GA 1IDZA 2DDBA 4CCMA 4E7SA 3HL2A 4EJWA 5ILSA 3F8FA 4LLNA 1V5EA 2V9KA 1NK2P 1TT0A 2IA2A 3KEQA 1YW9A 2XPVA 3G3ZA 3QU6A 4XICA 3ZMZA 1UHWA 4CCOA 5GTHC 1XB4A 2ZXJA 2VI6A 4A3JJ 3S1NJ 3RJPA 1S9HA 3HJEA 1O3RA 1BI2A 1QRYA 3BTCA 1G3YA 3F23A 5D6FA 4LIUA 1REPC 2M34A 1ETKA 3C3WA 5HLGA 2F5CA 4A0XA 3CJQB 4ETSA 3HOTA 3K7AJ 2R7FA 5D5UB 3S2DJ 1U5TA 1XN7A 3Q0UA 1SFOJ 1KGSA 2K4BA 3ABMH 3RKWA 4RB3C 1FYKA 4HSTA 2XC7A 4G7OF 2E1MC 3A0HC 3TDZC 3M3YJ 4XRFA 2JZYA 4L0YB 3BDDA 2IXSA 3TP0A 5DUIA 4AVPA 4CZZA 4A3EJ 2C6YA 3K4BA 2H8WA 1XGOA 1OYIA 4ESFA 3HEFA 1BA5A 3DKXA 3PIPF 4TV7A 1S6LA 3DTKA 3HOUJ 2UUZA 3ZCOA 2M30A 2BEOA 2FX0A 1BOBA 4B43A 4B4CA 1T39A 1QA6A 2F4MB 3ZN1A 4IRIA 1ON1A 5LFAA 1P9QC 3EQLF 2M5WA 2LKXA 1WI9A 2V4JC 5EJCA 1V55H 1X19A 1X1BA 5K1YA 2O7OA 5JVGF 1XMXA 4OIOF 4OMZA 3HOWJ 4BY1J 3RZDJ 4IOAF 4BH9A 3DWLE 3PNYA 5FD5A 2DQLA 2X6OA 3C2BA 3R6SA 5C3EJ 3F3XA 1T2KA 4A2UA 3HDDA 3A01B 3VODA 5GTIC 2VB6A 1DP7P 1V3FA 3DKWA 3JR9A 1XX5A 3BG9A 3I58A 4WXDA 3ZOBA 4MEXF 2JT1A 3GEZA 5L3FA 4KIGA 4KMFA 1SVOA 5E3MA 2RV8A 3GLXA 2YU9J 4EV0A 1PVEA 4RS8A 3IWZA 1VQ9I 1GHCA 3VFZA 3OYCA 2GWRA 1DQUA 3O6BB 1TQIA 4Y15A 3HSFA 3TO6A 3O8GA 2GA1A 2IGMA 4ZYHA 2FMYA 4G6QA 5A2QK 4KNYA 2E1NA 3NRVA 4FE7A 4X1EA 4G7ZF 2QUFA 3FHZA 1MNDA 2PMHA 3FX3A 3KIOA 2NXNB 3JTHA 3L2CA 4XR6A 1K7AA 2R7TA 5FJ8J 4IX7A 1BC8C 4M71A 4O5VA 2X1DA 2ELJA 2KIQA 1Z9CA 2A07F 1J2XA 1KONA 2IEKA 3IH3A 2ZBKA 5FKKA 4II3A 2VBXA 3HPHA 4D7MA 3SEQA 1VQLI 3CCJI 5ICEA 2A68F 4MO7A 4CHUA 1PP8F 3BG7A 3KE2A 3S1QJ 2E1MB 4ZC3A 5FLXK 1D1AA 1NG6A 2PX9A 3TL4X 2LF8A 5C44J 3QRFF 1W7PD 3CF2A 2WADA 4BJTA 4BU2A 2MH9A 4YFNF 3S8PA 3WE2A 1G3TA 3TW6A 2ADUA 1S7OA 2DA4A 4LGWA 3IL2A 2EZIA 3LSJA 1XD7A 3BR3A 4F7ZA 1EH6A 2ELKA 4B8XA 4E7ZA 3DKYA 3V4GA 3GF2A 2KRHA 4XRMA 3PSIA 1J9IA 5F0FA 4KIFA 1Y6IA 3WHCA 4A12A 1J59A 2BHZA 5CLSA 4HEA2 5CKTA 4RGUA 1MSEC 1C0WA 4FX0A 1R9TJ 4D9JA 1E17A 3K0LA 5FO5A 3MKYB 4MEYF 2XKPA 3M1CA 2PI0A 1MD0A 4UVCA 1UHMA 5CQEA 2DOFA 2DFIA 2MFZA 4UV9A 1YIJI 3O2PE 1X4PA 4CICA 4FASD 3HGYA 3ULQB 1UZCA 2W82A 1WJEA 3J81Z 1T0FA 4L5EA 2CSOA 2HGCA 4UB6C 2R4GA 4BJ6C 4E7JA 5FD6A 4IVNA 5M3FJ 3FHNA 3EYIA 2XF5A 4I0AA 3SEZA 4CXFA 1JT0A 3ELKA 3TMOA 1IG7A 2EIMH 1VNDA 1E2XA 3F6OA 2BGCA 4CYCB 1WVRA 4X0GA 3DEWA 3G1OA 3L2RA 2BY3A 3A0BC 4M3FA 4G12A 1ZREA 4BJ5C 4BE1A 2K4JA 1FX7A 1LEBA 2JSPA 1TT5B 3K4KA 4P96A 4RLFA 1HW1A 2F4IA 2E35A 2QKLB 5EZGA 5IT9K 2DT7B 3RQ4A 2XSDC 2TRTA 2Y75A 1TWHJ 1USTA 2BXYA 2JPCA 3LSKA 2EV5A 2V6CA 2LTPA 2ECBA 2RVCA 3BJAA 3Q9VA 5FKOA 1T38A 2MC4A 2K3FA 3IP4B 5DYMA 1R6RA 2CFXA 2Z5UA 2HEOA 3CO7C 1QVTA 4NNJA 3KEOA 2K27A 5IT3A 1XGSA 3JRDA 1SFXA 1X3ZB 3FK7A 5J4VA 3JSOA 1ULYA 3G6EI 1FJLA 2X6WA 2CWEA 4P55A 3RTRA 2LRDA 2YU3A 1OQYA 5B1AH 4RAZA 1NK3P 2NNNA 2MBFA 1LQ1A 3B02A 2XUBA 2LNBA 2KKOA 3VSKA 5LHGA 4XLPF 4ENNA 2RQQA 4S05A 4D7NA 4CDGA 3BTJA 4DIQA 1ENHA 1YQAA 3FM3A 3H35A 2R7WA 4E7IA 2A5YB 5EG0A 5J6XA 4ZZLA 2VKHA 2LP0A 4RB0A 2KRCA 1GDTA 1U5TC 4AYBN 5DS9A 4HA8A 3LL7A 4B47A 1R4NB 3A2KA 1GT0C 1TQPA 5HODA 3I71A 1R4MB 3IV5A 3ZMDA 4HYEA 4I76A 3KP5A 1HLVA 3ZQ7A 4KT6A 1BIAA 5ICCA 6PAXA 2M45A 4RM3A 3R61A 1ZGJA 2DMUA 2QBYA 2LY9A 1IUYA 1S3JA 2BZTA 2KDOA 3A4CA 3L2VA 4BQNA 5D4RA 1SAUA 3QWLA 2O9LA 2GIVA 4ESJA 4I0BA 2JVHA 2FQ4A 4ZZDA 2PMZA 1RESA 5FB2A 3A01A 5D5WB 3H3VK 2W4SA 3K4JA 4UUSA 3L9FA 5FLMJ 5GAHJ 1IRXA 3PO3J 1X1DA 3AG1H 4JBAA 2HVRA 1LVAA 2DDAA 2O8XA 1VQKI 3BZCA 3DU5A 3O8HA 3HZJA 4FT8A 2R7XA 4RGXA 2V1NA 1DPUA 1KU2A 1Z3XA 2CW0F 4OWRB 2QBYB 3GZ5A 3F8CA 5ERIA 2VBYA 3WE3A 4AC0A 2YX7A 1ZLKA 2G7HA 5HDNA 2F6CA 3BG6A 5EYRA 4RGRA 4BHCA 3H92A 2W85A 3WODF 1IGNA 4E70A 1R1TA 2JWTA 4R8HA 2M0MA 1Z7UA 3LSHA 3I55I 4JX6A 4Q48A 4CCKA 1QHHD 4BE2A 4W1UA 1MJBA 2BVLA 1O7LA 2DA1A 3AAFA 1ACIA 5EG0B 1F4KA 4FX4A 1QGPA 3RPQA 5LGTA 1E0EA 3HOYJ 3OR1C 2EV6A 3CCEI 1M1EB 2BW3A 1W0UA 1DU0A 2G7UA 1Z21A 4O6JA 2VBWA 1WSUA 2OC6A 1GVDA 3F8NA 1TLHB 2GAUA 2X9DA 4LG0A 1R71A 2RKHA 2H6BA 1TZLA 1OISA 1AWCA 1EKEA 1FOWA 2K02A 2Y0SN 2BOLA 2GM4A 1OCOH 1Z6RA 4P5OA 3ABUA 1MNMC 3AG4H 1MMGA 3ZQLA 1IW7F 1BI3A 2LKPA 2DK8A 2CQXA 2DMNA 1S72I 2B0LA 2QVOA 5LGNA 3E7LA 1OLTA 2DFEA 4PFOA 3S3MA 2IA1A 2VONA 1U78A 2CJJA 3GCMA 4WWCA 2CV0A 2F4OB 1Z3YA 3WU0A 2E2JJ 2R7DA 4UUTA 1KQ8A 3I59A 1D8JA 4P9UA 2XAFA 5FKMA 2M0CA 2FF4A 3RPUA 2DTRA 2VPLA 3KZYA 1Y0UA 3E6MA 2Q1ZB 4GXOA 4UVBA 4B3XA 4D5CA 3CUQA 2BVMA 5E1WA 2ACJA 4XK4A 1OYYA 2JVGA 3CJTB 1G2HA 2DMQA 3F21A 2HQ5A 2QSGX 3HTUA 2LDUA 3I4MJ 4A93J 2G9WA 3JRHA 1U3EM 2STWA 2A6HF 3PFIA 4QTRA 1MNEA 4HAMA 3ZQCA 2FNPA 3BR5A 2F5FA 5EZHA 1W7PA 2RDPA 1XPXA 2YSRA 5K7FA 3HM5A 1FNNA 3F9KA 4QLCU 4D1QA 2F2EA 1F1ZA 1OR7C 2DW4A 4U87A 4OIPF 2X48A 5HVQC 1D5VA 1TBXA 4HX8A 4XN0A 5LEKA 4XOTA 2JMWA 5K5RA 1JJ6C 2LC2A 3OYHA 2UWMA 4OAYA 2BBYA 1AU7A 1HKSA 3CCVI 4S0HB 2VQHA 2E2HJ 4UUVA 1Y8QB 2X6YA 3K2ZA 3SFZA 2ZMEB 5KAFC 2DPDA 5E18F 4JP0A 2ICWG 2WB1A 1HSTA 5EF6A 2NVXJ 5ED4A 3M8FA 2D1VA 1VQ5I 1FZPB 1MBJA 2F5EA 2EFPA 1WGXA 2DMTA 4PGHA 4RM2A 1P7JA 3T8TA 2HVSA 3WTVC 3FXJA 1IRFA 3MN2A 3W2VA 1LKXA 2NS8A 3OV8A 3FXKA 4E6KG 5FRNA 1ITYA 4Y4RA 5D8LB 2VXZA 4LG3A 3LOCA 2W48A 5KK1A 1BJZA 1UMQA 4DBRA 2JA6J 5KNLA 1TQMA 1IN4A 1YS7A 5F1RA 1XSDA 1O4XA 2OZ6A 2V1UA 2VPRA 1TP4A 3CLQA 1POGA 2P0WA 4U0YA 1Y1VJ 3VWBA 4B09A 3OMYA 3K4LA 5FRMA 2XF7A 4L9TA 5DEQA 5JR3A 1RIOH 2E36A 4CGZA 1HKTA 1U2WA 4U88A 1W4MA 3HSEA 3LAPA 1B72B 1BR2A 2RNGA 4NQWB 3OOPA 3SXYA 2FEZA 2MW8A 3MMYB 4KISA 5L3CA 3W6JB 2ZCWA 3LQRA 3S2HJ 4XLAA 2AHQA 4WK8F 4IHVA 9ANTA 1TW2A 3RCOA 3BR1A 1R1UA 2OA4A 1SMTA 2GXGA 2ECCA 3GFJA 3D1NI 4U0VA 1JUMA 3PFYA 1IN6A 1O3SA 4EQQA 2QA4I 1GVJA 3FXUA 3E6DA 5TGTA 4A6EA 3S3OA 3BTIA 3GTLJ 1S8NA 3J80K 3FF5A 2IPQX 1S29A 2PJPA 4R1HA 2VC1A 4JX4A 5A2QZ 2NVUB 3S1RJ 1AA7A 2FUG2 4UB8C 4KN7X 1EA3A 2HOEA 2V26A 1J09A 2M3AA 2X1CA 1LUJB 4ZYDA 1J7KA 4GCVA 4C3HJ 2O61A 2FJ1A 2O3FA 4M6XA 1U8BA 3LSMA 5F0CA 2JQ7A 2R7QA 2E60A 2QM3A 2R7SA 1T08B 4LLGF 1IV8A 5HNHA 1IXSB 1YX5A 3T0YA 2DOEA 2RAEA 2ZJPF 1MDMB 2LR8A 2QF7A 3VSLA 3G4SI 1R7JA 1JHFA 3HOXJ 2P6SA 5F64A 1IC8A 2IGNA 3QPHA 1V54H 1VZ0A 3CDHA 4PJJA 3J7ZI 2GXBA 4LFUA 1F9NA 2WV0A 1A5JA 4CH7A 2MC3A 2V6EA 2PEXA 1QU3A 1YE9A 4WF2A 2CUZA 4Y7NJ 2LFBA 3WU2C 2ID6A 3ZRGA 4BHPA 1YOVB 2L7KA 3V8KA 1P7IA 2A6TA 1JKRC 2M7BA 4HZFA 1SAXA 1WJCA 4G8XA 2XB0X 2IAIA 2JN6A 2EFNA 2K9MA 5CVJA 4RLQA 2R5YB 1MBFA 3TDUC 2XGXA 4QPQA 2O5RA 2HTSA 1YJNI 2M4KA 4AU7A 5J1YA 2E19A 3OYDA 3BR6A 4AIKA 4L5IA 1HOMA 2BY1A 3UKGA 1VQPI 5HLTA 3EUHA 2DA6A 1QPIA 2L5QA 3QYBA 2OTLI 1BI0A 2OU2A 4IEJA 1W0TA 3CLOA 1WKMA 1ZELA 4NC8A 1ZKGA 3JCUC 2JA7J 3NEUA 2OJED 2O6GE 2XAJA 2VQCA 1ETVA 4M6VA 3K1NA 3TO9A 2A6EF 5IT9Z 1D1BA 2DMPA 1OR7A 1DGRM 4HLXA 3WTTC 1O57A 2FBIA 3BQYA 2DOAA 4D0PA 4RBOA 3C18A 1NHAA 3DQVC 1ZRFA 3PQJA 3GWZA 3RIRA 1FYLA 2FNAA 3T5XA 1MDMA 1YTYA 1YO5C 1PYVA 1IJWC 3PM1A 2D2WA 1K78A 3A02A 3IAM2 1DP3A 4XKVA 2R7RA 4C3IJ 1Y8RB 3NAUA 1D5YA 4XKCA 2M1BA 4M6YA 1KU9A 2X51A 4ENKA 1FOKA 5EGOA 1E3HA 1WI3A 3F72A 3JRBA 3MKWB 1X58A 3HYIA 1LB2A 1S7AA 2FBHA 3KETA 4BQAA 2QLZA 3H9GA 4XNFA 1D0ZA 2HDDA 1IRZA 1PDNC 2P6TA 3QYEA 2XAUA 3E97A 3HTSB 1TTYA 1Y0NA 3S15J 2P7CB 1R49A 3GTJJ 4QWQA 3KX2A 5IP6A 2EBIA 2DYRH 2IBDA 3ECOA 1X1CA 2EK5A 3HSRA 2MYSA 1UCRA 1H8AC 2NRAC 1WCMJ 1SFUA 1HF0A 3IH4A 3S14J 1X2NA 4M74A 3HUGB 1AHDP 1I39A 2R92J 4IJAA 1PUEE 3HHHA 3JTGA 2TDXA 2V9VA 1A31A 1FP1D 3H1CA 5L3BA 4A5MA 1USSA 1KA8A 2Z33A 2BXZA 3V7RA 1B72A 2EZKA 5F1JA 4N0BA 2PLYA 2R3SA 3P9CA 1OMIA 1Y39A 3ZQFA 4LLLA 1Y56A 5DTDA 2EIJH 2MLKA 2R0QC 4EJVA 1U6GA 2YPRA 3FBIB 5E1ZB 3K1MA 1AKHA 5BS6A 1H0MA 5BQTA 1HW5A 3S2WA 2YR2A 3ZN0A 1XTAA 5F27A 5CVUA 1Y1WJ 2ZSIB 3KFWX 1QPMA 2ZJRF 1WRJA 3E3VA 3PUFA 4HSRA 4XLEA 1UHSA 1WHUA 4A3KJ 3LSPA 3GFLA 3U2RA
chains in the Genus database with same CATH topology
3FIWA 4A3MJ 1MBEA 2YS9A 1GT0C 1IDYA 5EEAA 3DCFA 4MIMA 2XGEA 3TEDA 5K7HA 3MVPA 5HODA 3IV5A 2E1OA 4I76A 2R5ZA 1HLVA 2H1KA 1TWCJ 5E3LA 2TCTA 5BNGA 3NARA 1ETOA 4M3BA 4QIWN 3SFIA 3GTPJ 4XIDA 2DMUA 2LY9A 2MSYA 3G1MA 3LSGA 2JK3A 3PO2J 1OFCX 1HDPA 2AO9A 3OSGA 2DA5A 4UUSB 2O9LA 2L7FP 4A3LJ 1JUSA 2FQ4A 2L0KA 1LE8B 3A01A 1RESA 1VI0A 4V2FA 1H89C 3H3VK 4UUSA 1LFUP 5F0HA 5FLMJ 3PO3J 4DYCA 3HB9A 3L1PA 3CMYA 3O8HA 2DTZA 4W97A 3M4OJ 2CQQA 1QVUA 2WB1N 3CCYA 4ABZA 3BR0A 4A3BJ 2HOSA 5IYCJ 2WV1A 1BL0A 4AUXA 2M8GX 4AC0A 1E3OC 2GBYA 5M5WJ 2PMZN 5EYRA 3JREA 2XPUA 1IGNA 5JLWA 2M9HA 1ORKA 4A3IJ 2JWTA 2DA7A 1F43A 5K7ZA 4X6AJ 2VUMJ 3VPRA 4JX6A 4EEFG 5FKLA 2R5ZB 1JT6A 4W1UA 2DA1A 4A3CJ 5EG0B 3FISA 5EDNA 2K9QA 4IHWA 2ZB9A 3HOYJ 4BBSJ 3JRCA 1I6HJ 1W0UA 1XG1A 1DU0A 3ZQGA 2HOTA 1ETXA 1MH4A 1T33A 1VF9A 4FE4A 1JKOC 1GVDA 1ZR4A 2X9DA 4DYRA 1MH3A 3JRGA 1FTZA 1JJ8C 3CQZJ 5DS9A 2Y0SN 2GM4A 1WH5A 3K2AA 3OOUA 1MNMC 1U9NA 3ZQLA 3FKIJ 2HXIA 2HYJA 4BKXA 1BW5A 2LLKA 2Y2ZA 1SANA 1IV6A 3A03A 3GTOJ 4QSHA 2DMNA 2CQXA 3HKZN 4MLOA 3JRFA 3E7LA 1TWGJ 1U9OA 3HOVJ 4A3DJ 1U78A 2CJJA 1RKTA 4XRSA 4FTHA 2E2IJ 2JA5J 4MFEA 2E2JJ 4UUTA 5C4XJ 3GTQJ 2ME0A 5FKMA 2M0CA 4B1RA 4BXXJ 1RPWA 1YRNB 2K9NA 3IH2A 4BBRJ 4D5CA 1MBGA 5FLVA 4XK4A 2H8RA 1G2HA 2DMQA 3GBGA 1K83J 1PUFA 5E3OA 2I10A 1ETQA 3BG5A 2YUSA 3BQZA 2HQ5A 3MKLA 1B8IA 2WAQN 2HI3A 3I4MJ 2CUFA 5F08A 1X2MA 3HBLA 5J1UA 4A93J 5M5XJ 5GPCA 2XGDA 3JRHA 5F04A 1LE8A 1JKPC 2KDZA 2Y31A 4QTRA 2NOGA 3S16J 1I3QJ 3I4NJ 1XC5A 2ID3A 3ZQCA 1H88C 3BR5A 3LSRA 5IOYA 5EZHA 5K7FA 3HM5A 4LOCA 3FK6A 4FISA 1GV2A 2EQRA 3CDLA 1B8IB 1FTTA 2X48A 1DU6A 1JJ6C 4DYQA 2JMWA 1AU7A 4S0HB 2LD5A 2E2HJ 2CRGA 1RETA 4JP0A 1IDZA 5EF6A 2XPWA 2NVXJ 1MBJA 1RR7A 1WGXA 2DMTA 2HOAA 2Y9YA 1P7JA 1NK2P 1FIAA 3MN2A 2NS8A 5M3MJ 2XPVA 4XICA 1TWAJ 2XB5A 1JTYA 3JRAA 1ZQ3P 1ITYA 2EZHA 2VI6A 4C3JJ 1JGGA 4A3JJ 2B63J 3S1NJ 1JKQC 3WHBA 3LOCA 2W48A 5GP9A 1BJZA 1UMQA 2JA6J 3BTCA 1QRYA 2K9SA 4C2MJ 1O4XA 3GTGJ 3G1LA 2R7ZJ 3LNQA 2M34A 1ETKA 2VPRA 4V2GA 3BT9A 1POGA 1Y1VJ 3BR2A 3K7AJ 3GTMJ 4J19A 3OSFA 2CUEA 3S2DJ 4DW6A 3Q0UA 2N8GA 1SFOJ 3S17J 1EF4A 2NVYJ 4HNVA 1B72B 2L7MP 3M3YJ 4RDUA 4A69C 3TP0A 2MW8A 4FCYA 4A3EJ 3Q3SA 3BG3A 3HEFA 3S2HJ 1BA5A 1OCPA 9ANTA 2AHQA 2XRLA 4IHVA 4M3EA 2LVSA 3HOUJ 3BR1A 2FX0A 4B4CA 2ECCA 3D1NI 3QPSA 1JUMA 4NDLA 4CYCA 4Y52J 2LKXA 4IHXA 3W6VA 3BTIA 3GTLJ 1S7EA 2O7OA 2DA3A 1OJLA 4JX4A 3S1RJ 3HOWJ 1BW6A 4BY1J 3RZDJ 3C2BA 2X6OA 4JYKA 1ZTRA 5C3EJ 1T56A 4C3HJ 4GFBA 2FJ1A 1HDDC 3HDDA 1MBKA 3A01B 4A3GJ 1U8BA 5F0CA 3JR9A 3BG9A 5FKNA 3ZOBA 4IHYA 2HXOA 3F0CA 5E3MA 2YU9J 1YRNA 2RAEA 2LR8A 2QF7A 3HOZJ 2GLOA 3O8GA 3HOXJ 2VKVA 1IC8A 4FE7A 4X1EA 4XRSG 1JTXA 3B6AA 4D5FA 1A5JA 2OPTA 3TP3A 2NS7A 2R93J 4Y7NJ 1CQTA 2LFBA 5FJ8J 3HGGA 2ID6A 2EZLA 1LFBA 1P7IA 2IEKA 3IH3A 1JKRC 5FKKA 4B3AA 2DN0A 2ME6A 4D7MA 5E3NA 2XB0X 2IAIA 2JN6A 4MO7A 2Y30A 2R5YA 3S1QJ 2R5YB 1MBFA 3B6CA 5C44J 3ZQHA 2COBA 5J1YA 2E19A 1AKHB 3TW6A 3BR6A 2JA8J 2DA4A 1Z77A 2EZIA 1HOMA 3LSJA 3UKGA 2KT0A 2DA6A 3BR3A 1QPIA 5IPAA 2ELKA 1HCRA 1GV5A 1UG2A 3SJMA 3RKQA 4IEJA 1W0TA 3JRIA 1ZKGA 4XRMA 3Q0WA 2JA7J 1FEXA 5F0FA 1XS9A 3WHCA 2K40A 1ETVA 4M6VA 2Y9ZA 1MSEC 1IUFA 1R9TJ 2DMPA 1I50J 4DZJA 3BQYA 3H0GJ 1TC3C 4RBOA 2VKEA 2DA2A 4BY7J 1Q1VA 3HGYA 1IJWC 3PM1A 2G0EA 3A02A 5IOZA 1NTCA 1ZK8A 4L5EA 4C3IJ 1OCTC 4M3GA 3NAUA 5IYBJ 1D5YA 5IP9J 1APLC 2M2EA 5JLXA 3BTLA 5EGOA 5M3FJ 1ETYA 2OF7A 1WI3A 3JRBA 1X58A 4DZPA 2EH3A 5J3LA 1JT0A 4MFDA 1IG7A 2MG4A 1VNDA 2HDDA 1GUUA 4M3DA 5EGOB 1IRZA 4CYCB 2D5VA 1PUFB 3DEWA 3S15J 3G1OA 3GTJJ 2MGQA 1FIPA 4M3FA 4G12A 2EBIA 5IP6A 2IBDA 5IP7J 1VFCA 5IYDJ 3QPLA 1H8AC 1WCMJ 5M5YJ 1HF0A 4A3FJ 3IH4A 1JUPA 5EZGA 2L7ZA 3S14J 4JX5A 1X2NA 3QQAA 2XSDC 1A6IA 2TRTA 1AHDP 1TWHJ 2R92J 5C4JJ 1ZGWA 2CU7A 2LTPA 1Z0XA 2ECBA 5FKOA 5GPAA 1F36A 2L9RA 3RQIA 1WPKA 2JJ7A 1B72A 2EZKA 5F1JA 3RZOJ 1QVTA 2FD5A 2DJNA 1ETWA 1RKWA 3ZQFA 3JRDA 3FK7A 2XGCA 1FJLA 5DTDA 2R0QC 2QCOA 1ZR2A 1MSFC 1MBHA 1AKHA 1NK3P 3OIOA 3S1MJ 5F27A 1Y1WJ 3TW7A 4I6ZA 2NVTJ 4D7NA 1WH7A 3BTJA 1ENHA 2NVQJ 3SDGA 2LK2A 1K61A 5EG0A 3Q0VA 1UHSA 1TWFJ 2P81A 2LP0A 2O8KA 3GTKJ 3ZQIA 5J1RA 3LSPA 4A3KJ 1GDTA 4AYBN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIW A;  4A3M J;  1MBE A;  2YS9 A;  1GT0 C;  1IDY A;  5EEA A;  3DCF A;  4MIM A;  2XGE A;  3TED A;  5K7H A;  3MVP A;  5HOD A;  3IV5 A;  2E1O A;  4I76 A;  2R5Z A;  1HLV A;  2H1K A;  1TWC J;  5E3L A;  2TCT A;  5BNG A;  3NAR A;  1ETO A;  4M3B A;  4QIW N;  3SFI A;  3GTP J;  4XID A;  2DMU A;  2LY9 A;  2MSY A;  3G1M A;  3LSG A;  2JK3 A;  3PO2 J;  1OFC X;  1HDP A;  2AO9 A;  3OSG A;  2DA5 A;  4UUS B;  2O9L A;  2L7F P;  4A3L J;  1JUS A;  2FQ4 A;  2L0K A;  1LE8 B;  3A01 A;  1RES A;  1VI0 A;  4V2F A;  1H89 C;  3H3V K;  4UUS A;  1LFU P;  5F0H A;  5FLM J;  3PO3 J;  4DYC A;  3HB9 A;  3L1P A;  3CMY A;  3O8H A;  2DTZ A;  4W97 A;  3M4O J;  2CQQ A;  1QVU A;  2WB1 N;  3CCY A;  4ABZ A;  3BR0 A;  4A3B J;  2HOS A;  5IYC J;  2WV1 A;  1BL0 A;  4AUX A;  2M8G X;  4AC0 A;  1E3O C;  2GBY A;  5M5W J;  2PMZ N;  5EYR A;  3JRE A;  2XPU A;  1IGN A;  5JLW A;  2M9H A;  1ORK A;  4A3I J;  2JWT A;  2DA7 A;  1F43 A;  5K7Z A;  4X6A J;  2VUM J;  3VPR A;  4JX6 A;  4EEF G;  5FKL A;  2R5Z B;  1JT6 A;  4W1U A;  2DA1 A;  4A3C J;  5EG0 B;  3FIS A;  5EDN A;  2K9Q A;  4IHW A;  2ZB9 A;  3HOY J;  4BBS J;  3JRC A;  1I6H J;  1W0U A;  1XG1 A;  1DU0 A;  3ZQG A;  2HOT A;  1ETX A;  1MH4 A;  1T33 A;  1VF9 A;  4FE4 A;  1JKO C;  1GVD A;  1ZR4 A;  2X9D A;  4DYR A;  1MH3 A;  3JRG A;  1FTZ A;  1JJ8 C;  3CQZ J;  5DS9 A;  2Y0S N;  2GM4 A;  1WH5 A;  3K2A A;  3OOU A;  1MNM C;  1U9N A;  3ZQL A;  3FKI J;  2HXI A;  2HYJ A;  4BKX A;  1BW5 A;  2LLK A;  2Y2Z A;  1SAN A;  1IV6 A;  3A03 A;  3GTO J;  4QSH A;  2DMN A;  2CQX A;  3HKZ N;  4MLO A;  3JRF A;  3E7L A;  1TWG J;  1U9O A;  3HOV J;  4A3D J;  1U78 A;  2CJJ A;  1RKT A;  4XRS A;  4FTH A;  2E2I J;  2JA5 J;  4MFE A;  2E2J J;  4UUT A;  5C4X J;  3GTQ J;  2ME0 A;  5FKM A;  2M0C A;  4B1R A;  4BXX J;  1RPW A;  1YRN B;  2K9N A;  3IH2 A;  4BBR J;  4D5C A;  1MBG A;  5FLV A;  4XK4 A;  2H8R A;  1G2H A;  2DMQ A;  3GBG A;  1K83 J;  1PUF A;  5E3O A;  2I10 A;  1ETQ A;  3BG5 A;  2YUS A;  3BQZ A;  2HQ5 A;  3MKL A;  1B8I A;  2WAQ N;  2HI3 A;  3I4M J;  2CUF A;  5F08 A;  1X2M A;  3HBL A;  5J1U A;  4A93 J;  5M5X J;  5GPC A;  2XGD A;  3JRH A;  5F04 A;  1LE8 A;  1JKP C;  2KDZ A;  2Y31 A;  4QTR A;  2NOG A;  3S16 J;  1I3Q J;  3I4N J;  1XC5 A;  2ID3 A;  3ZQC A;  1H88 C;  3BR5 A;  3LSR A;  5IOY A;  5EZH A;  5K7F A;  3HM5 A;  4LOC A;  3FK6 A;  4FIS A;  1GV2 A;  2EQR A;  3CDL A;  1B8I B;  1FTT A;  2X48 A;  1DU6 A;  1JJ6 C;  4DYQ A;  2JMW A;  1AU7 A;  4S0H B;  2LD5 A;  2E2H J;  2CRG A;  1RET A;  4JP0 A;  1IDZ A;  5EF6 A;  2XPW A;  2NVX J;  1MBJ A;  1RR7 A;  1WGX A;  2DMT A;  2HOA A;  2Y9Y A;  1P7J A;  1NK2 P;  1FIA A;  3MN2 A;  2NS8 A;  5M3M J;  2XPV A;  4XIC A;  1TWA J;  2XB5 A;  1JTY A;  3JRA A;  1ZQ3 P;  1ITY A;  2EZH A;  2VI6 A;  4C3J J;  1JGG A;  4A3J J;  2B63 J;  3S1N J;  1JKQ C;  3WHB A;  3LOC A;  2W48 A;  5GP9 A;  1BJZ A;  1UMQ A;  2JA6 J;  3BTC A;  1QRY A;  2K9S A;  4C2M J;  1O4X A;  3GTG J;  3G1L A;  2R7Z J;  3LNQ A;  2M34 A;  1ETK A;  2VPR A;  4V2G A;  3BT9 A;  1POG A;  1Y1V J;  3BR2 A;  3K7A J;  3GTM J;  4J19 A;  3OSF A;  2CUE A;  3S2D J;  4DW6 A;  3Q0U A;  2N8G A;  1SFO J;  3S17 J;  1EF4 A;  2NVY J;  4HNV A;  1B72 B;  2L7M P;  3M3Y J;  4RDU A;  4A69 C;  3TP0 A;  2MW8 A;  4FCY A;  4A3E J;  3Q3S A;  3BG3 A;  3HEF A;  3S2H J;  1BA5 A;  1OCP A;  9ANT A;  2AHQ A;  2XRL A;  4IHV A;  4M3E A;  2LVS A;  3HOU J;  3BR1 A;  2FX0 A;  4B4C A;  2ECC A;  3D1N I;  3QPS A;  1JUM A;  4NDL A;  4CYC A;  4Y52 J;  2LKX A;  4IHX A;  3W6V A;  3BTI A;  3GTL J;  1S7E A;  2O7O A;  2DA3 A;  1OJL A;  4JX4 A;  3S1R J;  3HOW J;  1BW6 A;  4BY1 J;  3RZD J;  3C2B A;  2X6O A;  4JYK A;  1ZTR A;  5C3E J;  1T56 A;  4C3H J;  4GFB A;  2FJ1 A;  1HDD C;  3HDD A;  1MBK A;  3A01 B;  4A3G J;  1U8B A;  5F0C A;  3JR9 A;  3BG9 A;  5FKN A;  3ZOB A;  4IHY A;  2HXO A;  3F0C A;  5E3M A;  2YU9 J;  1YRN A;  2RAE A;  2LR8 A;  2QF7 A;  3HOZ J;  2GLO A;  3O8G A;  3HOX J;  2VKV A;  1IC8 A;  4FE7 A;  4X1E A;  4XRS G;  1JTX A;  3B6A A;  4D5F A;  1A5J A;  2OPT A;  3TP3 A;  2NS7 A;  2R93 J;  4Y7N J;  1CQT A;  2LFB A;  5FJ8 J;  3HGG A;  2ID6 A;  2EZL A;  1LFB A;  1P7I A;  2IEK A;  3IH3 A;  1JKR C;  5FKK A;  4B3A A;  2DN0 A;  2ME6 A;  4D7M A;  5E3N A;  2XB0 X;  2IAI A;  2JN6 A;  4MO7 A;  2Y30 A;  2R5Y A;  3S1Q J;  2R5Y B;  1MBF A;  3B6C A;  5C44 J;  3ZQH A;  2COB A;  5J1Y A;  2E19 A;  1AKH B;  3TW6 A;  3BR6 A;  2JA8 J;  2DA4 A;  1Z77 A;  2EZI A;  1HOM A;  3LSJ A;  3UKG A;  2KT0 A;  2DA6 A;  3BR3 A;  1QPI A;  5IPA A;  2ELK A;  1HCR A;  1GV5 A;  1UG2 A;  3SJM A;  3RKQ A;  4IEJ A;  1W0T A;  3JRI A;  1ZKG A;  4XRM A;  3Q0W A;  2JA7 J;  1FEX A;  5F0F A;  1XS9 A;  3WHC A;  2K40 A;  1ETV A;  4M6V A;  2Y9Z A;  1MSE C;  1IUF A;  1R9T J;  2DMP A;  1I50 J;  4DZJ A;  3BQY A;  3H0G J;  1TC3 C;  4RBO A;  2VKE A;  2DA2 A;  4BY7 J;  1Q1V A;  3HGY A;  1IJW C;  3PM1 A;  2G0E A;  3A02 A;  5IOZ A;  1NTC A;  1ZK8 A;  4L5E A;  4C3I J;  1OCT C;  4M3G A;  3NAU A;  5IYB J;  1D5Y A;  5IP9 J;  1APL C;  2M2E A;  5JLX A;  3BTL A;  5EGO A;  5M3F J;  1ETY A;  2OF7 A;  1WI3 A;  3JRB A;  1X58 A;  4DZP A;  2EH3 A;  5J3L A;  1JT0 A;  4MFD A;  1IG7 A;  2MG4 A;  1VND A;  2HDD A;  1GUU A;  4M3D A;  5EGO B;  1IRZ A;  4CYC B;  2D5V A;  1PUF B;  3DEW A;  3S15 J;  3G1O A;  3GTJ J;  2MGQ A;  1FIP A;  4M3F A;  4G12 A;  2EBI A;  5IP6 A;  2IBD A;  5IP7 J;  1VFC A;  5IYD J;  3QPL A;  1H8A C;  1WCM J;  5M5Y J;  1HF0 A;  4A3F J;  3IH4 A;  1JUP A;  5EZG A;  2L7Z A;  3S14 J;  4JX5 A;  1X2N A;  3QQA A;  2XSD C;  1A6I A;  2TRT A;  1AHD P;  1TWH J;  2R92 J;  5C4J J;  1ZGW A;  2CU7 A;  2LTP A;  1Z0X A;  2ECB A;  5FKO A;  5GPA A;  1F36 A;  2L9R A;  3RQI A;  1WPK A;  2JJ7 A;  1B72 A;  2EZK A;  5F1J A;  3RZO J;  1QVT A;  2FD5 A;  2DJN A;  1ETW A;  1RKW A;  3ZQF A;  3JRD A;  3FK7 A;  2XGC A;  1FJL A;  5DTD A;  2R0Q C;  2QCO A;  1ZR2 A;  1MSF C;  1MBH A;  1AKH A;  1NK3 P;  3OIO A;  3S1M J;  5F27 A;  1Y1W J;  3TW7 A;  4I6Z A;  2NVT J;  4D7N A;  1WH7 A;  3BTJ A;  1ENH A;  2NVQ J;  3SDG A;  2LK2 A;  1K61 A;  5EG0 A;  3Q0V A;  1UHS A;  1TWF J;  2P81 A;  2LP0 A;  2O8K A;  3GTK J;  3ZQI A;  5J1R A;  3LSP A;  4A3K J;  1GDT A;  4AYB N; 
#chains in the Genus database with same CATH topology
 4A3M J;  4HQM A;  3ESW B;  4BUP A;  2QQ8 A;  3DCF A;  4MIM A;  2XGE A;  3TED A;  3F8M A;  2PN6 A;  4IKF A;  3CCR I;  2V79 A;  1WQ2 A;  2K3P A;  5E1X A;  3I56 I;  2R5Z A;  4HDU A;  2XDV A;  3VYS B;  5J8C A;  3E5Q A;  4IHS A;  4WX9 A;  3NAR A;  3P9K A;  1ETO A;  3L09 A;  4BDY A;  3WGI A;  3KYD B;  2GIZ A;  1FBQ A;  2ZNZ A;  3CTA A;  5HS7 A;  3ZMV A;  2CFO A;  3LSG A;  3K4M A;  2E34 A;  1OFC X;  3DPL C;  3W2W A;  5HLI A;  3DPT A;  3CZ6 A;  1D8K A;  1MMA A;  2AO9 A;  2HQN A;  2DA5 A;  4UVA A;  2K7L A;  2NAZ A;  3TBI A;  3K70 D;  2HU9 A;  1BJA A;  3CMA I;  3IRQ A;  4YEJ A;  1JUS A;  5GAG J;  1N25 A;  4V2F A;  1I5Z A;  3J80 Z;  1Z05 A;  4HRI A;  5F0H A;  1HKQ A;  4HBL A;  1A35 A;  1XMA A;  4LIT A;  4DYC A;  3QOE A;  2EFO A;  3ZMS A;  3CMM A;  4KN4 X;  3PNT A;  4XSX F;  4PJ0 C;  2CQQ A;  1QVU A;  2JUG A;  2EJR A;  2FML A;  4ABZ A;  1SC7 A;  1ZN2 A;  3MAJ A;  4MTE A;  2HOS A;  2EIN H;  1XSV A;  3TKY A;  3OYF A;  2MLG A;  2M8G X;  4G7H F;  3K10 A;  2GBY A;  5M5W J;  1G4D A;  1FP2 A;  4AVZ A;  3JRE A;  3AL0 C;  2L9N A;  2F48 A;  2HPI A;  2XPU A;  2QGU A;  1EH8 A;  3P9I A;  3ROU A;  3SZT A;  4BXU A;  1ORK A;  2CH0 A;  5JLW A;  3L2U A;  4OIQ F;  3DEU A;  3ABK H;  2ZNY A;  2R7V A;  1YW7 A;  2DA7 A;  3DU6 A;  4YEL A;  4ITV A;  3LAJ A;  3VPR A;  3D0S A;  3FMR A;  3I54 A;  1BM9 A;  2JA2 A;  2QEN A;  1MW7 A;  2R5Z B;  1A36 A;  3RI4 A;  5LGU A;  2GZW A;  4DQ2 A;  2CGP A;  1P4A A;  2HDC A;  2V7F A;  3NQO A;  4L9N A;  2VJJ A;  4OIR F;  5ICF A;  1T0F C;  2O0Y A;  2ZB9 A;  2IRF G;  2KPM A;  3R0A A;  5JVT A;  4IXA A;  4C2T A;  3HOS A;  1KU3 A;  3FM5 A;  3ZQG A;  4ZDP A;  3J81 K;  2HOT A;  1HA8 A;  2UXN A;  1CGP A;  2LH9 A;  1MH3 A;  3FXM A;  2PQ8 A;  4E7K A;  2VT2 A;  3K4N A;  1D0Y A;  1QHG A;  1JJ8 C;  1IXR C;  1W36 D;  3H9Q A;  3KPH A;  2WY8 Q;  1ZAO A;  2KQR A;  1WH5 A;  2BYV E;  2I5U A;  1MJA A;  3FKI J;  1SD5 A;  3GLL A;  2HXI A;  2HYJ A;  1SAN A;  2Y0S A;  3HKZ N;  4GO1 A;  4XM3 A;  1TWG J;  3HOV J;  3R0J A;  1Z7L A;  3CD6 I;  5D5X B;  2JA5 J;  2E2I J;  5BMZ A;  4MFE A;  2KIS A;  3SQN A;  4HF1 A;  2WWY A;  5C4X J;  2ME0 A;  1SD7 A;  4B1R A;  2OQR A;  3GVA A;  1YRN B;  4U0W A;  2KLO A;  3IH2 A;  2VOO A;  2I8D A;  3EET A;  2DO7 A;  4L9V A;  3PJR A;  1XCV A;  4RB1 A;  2FE3 A;  4GYG A;  2BY0 A;  2XAH A;  3I53 A;  1K83 J;  3ZQQ A;  2L2O A;  2Y0M A;  4GRI A;  3CJN A;  2HI3 A;  3K4C A;  1I27 A;  2VBZ A;  5M5X J;  2Q2E A;  5F04 A;  4P1W A;  1VQ8 I;  3DTI A;  2XHK A;  3FBN B;  3S16 J;  1I3Q J;  2A69 F;  1I1G A;  2VT3 A;  3KP4 A;  1XC5 A;  2JRM A;  4S04 A;  2ID3 A;  2DPU A;  3I4N J;  3HG9 A;  4LIV A;  4Y17 A;  1MMS A;  1O7F A;  4N4N B;  3ZMT A;  2ESN A;  1O3T A;  3BRO A;  5HS9 A;  1SVL A;  3C2G A;  4E7L A;  4LOC A;  2V9P A;  3U1K A;  1SEU A;  5LRS A;  1GV2 A;  4RGS A;  3CUQ B;  3CCU I;  2V1D A;  3BC8 A;  1FTT A;  1OCR H;  2CQK A;  1YJW I;  4FHT A;  5DCM A;  2DT5 A;  2KJC A;  1ODD A;  4NC6 A;  4DYQ A;  4HPQ A;  3DBR B;  4Y33 A;  2GQQ A;  4F91 B;  2DYS H;  2LD5 A;  1FMW A;  4CCL A;  2DK5 A;  2OAZ A;  4PUS A;  3FWE A;  1RET A;  3N97 A;  1N77 A;  2AXT C;  2XPW A;  3D5R C;  1FBU A;  1FLI A;  1U5T B;  4K2E A;  1VQN I;  4I98 B;  4V19 K;  2DQR A;  1NH3 A;  1RR7 A;  2HOA A;  3WGH A;  1VQ6 I;  2KIF A;  3N05 A;  4YG2 F;  2ISZ A;  4MGR A;  1FOY A;  1DDN A;  1TWA J;  2XB5 A;  4G9Y A;  1KQ0 A;  2CW8 A;  1JTY A;  3JRA A;  1ZQ3 P;  1B1B A;  1JGG A;  4C3J J;  5E17 F;  1JKQ C;  3CCL I;  3WHB A;  5DUK A;  1LFP A;  4PJN A;  4LB6 B;  3WTS C;  1R58 A;  3GFM A;  2K9S A;  4G6T B;  1UJ8 A;  2BW3 B;  4C2M J;  3WTY C;  4KDP A;  2JSC A;  4GDF A;  3G1L A;  2R7Z J;  3LNQ A;  4XLF A;  1TL8 A;  1RC9 A;  2K9L A;  3H5A A;  2XRN A;  3BT9 A;  1VQM I;  1QQI A;  3GTM J;  3O3K A;  3K69 A;  2QYO A;  3OSF A;  3ASN H;  4DW6 A;  4M72 A;  2LYC A;  2Y48 A;  2QSH X;  2HZT A;  4XOR A;  1EF4 A;  1A04 A;  1G3W A;  2NVY J;  4BHB A;  1V4R A;  4HV6 A;  2EA2 A;  2IT0 A;  4RDU A;  4A69 C;  5BOX A;  2E7W A;  3LSI A;  3E6B A;  3J7A Y;  3VEP A;  4IRH A;  3Q3S A;  3BG3 A;  5DCF A;  2RN7 A;  2W00 A;  4KMU X;  1J5Y A;  3Q5F A;  3U21 A;  3OIQ A;  3HRS A;  4NDL A;  4Y52 J;  2STT A;  3W6V A;  3IKV A;  4IZZ A;  1FOX A;  1EH7 A;  1OJL A;  4HX4 A;  1GLN A;  2QSF X;  3CES A;  1U8R A;  4A6D A;  4BXF A;  3HIF A;  2ZJ2 A;  1YIT I;  4M73 A;  3JAM K;  2LY2 A;  4JYK A;  3MQ0 A;  3COA C;  1STZ A;  2KIU A;  4GFB A;  1PP7 U;  4A3G J;  1MBK A;  2VQL A;  5ILV A;  4ZJZ A;  3E0J B;  3L7W A;  1YIO A;  3J7Y J;  3QYF A;  5CJ9 A;  1RR8 C;  2EB7 A;  3AG2 H;  1MIJ A;  4BAC A;  3I0T A;  4IQJ A;  5EEH A;  4EM0 B;  4LD5 A;  4A0Z A;  4Q5S F;  2BHY A;  3D5S C;  2JRT A;  3BJO A;  5AIP A;  2H27 A;  2P4W A;  2HPM A;  4Z6Y A;  3HOZ J;  2VKV A;  5EEG A;  1IXC A;  2FQ3 A;  2LRE A;  3FXO A;  3S93 A;  5E8I A;  1JTX A;  4Y3O A;  4D5F A;  2NS7 A;  3OYI A;  1I6X A;  3HGG A;  2DFH A;  4LK1 F;  3DBL B;  4ON0 A;  3JW4 A;  1B9N A;  5LLQ A;  1YJ9 I;  3HC7 A;  4B3A A;  3E5U A;  2ME6 A;  2KHM A;  4HLY A;  1WJB A;  1W5T A;  2Q0O A;  1XDU A;  1U0J A;  1X1A A;  4ZTJ A;  1BN5 A;  2Y30 A;  5HDK A;  3I4P A;  3VDX A;  2DU9 A;  2LBF B;  4MQV A;  1IO2 A;  4UV8 A;  3ABL H;  3ONQ A;  3TOA A;  1FSE A;  2RC4 A;  3ZQH A;  4ENM A;  3OYB A;  2PBI A;  1Z6T A;  2QQA A;  2ZFW A;  2HDW A;  3REO A;  1VTN C;  2IA0 A;  2JA8 J;  2ETH A;  3SYT A;  3MWM A;  2FOK A;  2P8T A;  4XON A;  1HCR A;  3SJM A;  3FMQ A;  1IAW A;  2VOP A;  2Z2S B;  5AIQ A;  2CV1 A;  1WFX A;  1XS9 A;  2K40 A;  3S3N A;  4BGD A;  4RAF A;  2Y9Z A;  1G6N A;  4CZC A;  3V7C A;  1YI2 I;  1CF7 B;  4QPO A;  4NBQ A;  5K5Q A;  1I3A A;  1I50 J;  3EDP A;  4DZJ A;  1YS6 A;  4BEH A;  3OYE A;  1R22 A;  2WAF A;  3G2B A;  1TC3 C;  2FRH A;  5CVR A;  2W57 A;  4PJM A;  4YII A;  4BDZ A;  2XAQ A;  1Q1V A;  2G0E A;  3SHF A;  2QEX I;  2W24 A;  2K85 A;  5IOZ A;  3KP2 A;  1NTC A;  3AFH A;  1OCT C;  5CPR B;  2M7A A;  5IP9 J;  1APL C;  2CQN A;  4IL6 C;  2DT6 A;  4ZYG A;  3BTL A;  2HNH A;  3F8B A;  1ETY A;  5LHH A;  4DZP A;  2EH3 A;  1LDK B;  2KIM A;  2MG4 A;  3GUD A;  2NYX A;  5EGO B;  3RYP A;  3HPG A;  1PUF B;  2EFW A;  3BY6 A;  4HNU A;  1FC3 A;  1QZZ A;  2ELH A;  4CCN A;  3CP2 A;  2L02 A;  1UFM A;  3LWF A;  2F5V A;  5IP7 J;  1XCB A;  4KUM A;  4FQG A;  2LY1 A;  1VFC A;  2NS0 A;  2EWN A;  2J5P A;  2L7Z A;  4Q47 A;  4JX5 A;  3OYL A;  3SDB A;  2KFD A;  1K6Y A;  4DGW B;  2H1L A;  3UNG C;  5C4J J;  1ZGW A;  1O3Q A;  4NC7 A;  5GPA A;  5CVV A;  3RQI A;  1WPK A;  4F52 A;  2HKO A;  3ERM A;  2ZC2 A;  5FRO A;  2W25 A;  3H9J A;  4EAT A;  2JJ7 A;  1KU7 A;  3RZO J;  3V42 A;  1VQ7 I;  1JHH A;  2MD0 A;  1D3Y A;  3L2W A;  1RKW A;  2D1H A;  2L4M A;  4U7B A;  3U9G A;  1IF1 A;  3SZG A;  4RB2 C;  2XGC A;  1YW8 A;  3DBH B;  1UB9 A;  2F5D A;  4C9Y A;  3A1Y A;  4EGZ A;  3CUQ C;  3MZ8 A;  1SD6 A;  1R1V A;  1UG0 A;  3OIO A;  2DJI A;  2FSW A;  2H94 A;  4XBF A;  1D1C A;  4HQE A;  4XLH A;  3PL8 A;  3TW7 A;  1WH7 A;  1X3U A;  1BOA A;  2NVQ J;  4J01 A;  3Q0V A;  3V8L A;  1TWF J;  1EJ9 A;  5H20 A;  3H36 A;  3ZQI A;  1GXP A;  4M9Z A;  3FZV A;  3FIW A;  1MBE A;  2A05 A;  3ZR8 X;  4ANJ A;  1IDY A;  4DOZ A;  5EEA A;  2ZME A;  3P7N A;  4XMY A;  2E1O A;  2CW7 A;  5J47 A;  4N4O B;  1FSH A;  1TWC J;  2L01 A;  2TCT A;  3F6V A;  1YYV A;  4F55 A;  1R5I D;  1S5L C;  4RMN A;  4EGY A;  4I09 A;  5DD4 A;  1YLF A;  2HKX A;  3G73 A;  2MSY A;  3G1M A;  2BE5 F;  3DPU A;  1KYZ A;  1FYM A;  1KZH A;  5L3E A;  2CUJ A;  3DP7 A;  5ILU A;  3ECH A;  4ZYA A;  2Z16 A;  5TRD A;  5HDG A;  1RRJ A;  4A3L J;  2M8E A;  5LRR A;  2L0K A;  3CP8 A;  1H89 C;  3OYG A;  4GYI A;  1W36 C;  2Z9O A;  2IGO A;  4AM3 A;  1W5C C;  5HS8 A;  2GOM A;  2FBK A;  4FET A;  1QBJ A;  2LF7 A;  1B9M A;  3CC2 I;  3L1P A;  2KJB A;  3DXJ F;  2DTZ A;  4W97 A;  1N75 A;  2WB1 N;  3CCY A;  1J75 A;  2IP2 A;  3BR0 A;  3QPT A;  5D8K B;  2X1E A;  5IYC J;  2WV1 A;  2L3D A;  1BL0 A;  4AUX A;  3U1D A;  1E3O C;  3KP6 A;  1Z67 A;  1K78 B;  2XRO A;  4HV5 A;  2PMZ N;  3W2A A;  2QQ9 A;  1CF7 A;  3AKZ A;  5GAE J;  3PUB A;  5BPI A;  3AG3 H;  1DGW Y;  4NQW A;  1PJR A;  3QAH A;  2ZXH A;  4XKB A;  5K7Z A;  2H09 A;  4X6A J;  2VUM J;  3GW2 A;  3VYR B;  3L2Q A;  5FKL A;  3H0D A;  2PFB A;  1JE8 A;  3KP3 A;  1JT6 A;  2E1C A;  3E1S A;  3BPV A;  4A3C J;  5EDN A;  2K9Q A;  1FBS A;  4IHW A;  4JK1 X;  2RNJ A;  2IGK A;  3MZH A;  1L3L A;  4II2 A;  1W5S A;  1XG1 A;  1ZG3 A;  1ETX A;  2R7O A;  4JOM A;  4XLN F;  1MH4 A;  1VF9 A;  3E5X A;  1BC7 C;  1ZR4 A;  3JRG A;  4XQF A;  5DM6 F;  1FTZ A;  2FA5 A;  3CQZ J;  4UHT A;  2W7N A;  2LOO A;  3PIO F;  4G94 A;  3OOU A;  1U9N A;  4OMY A;  4EVI A;  1RI7 A;  5B66 C;  5D6E A;  2P7V B;  4BS9 A;  1JGS A;  1X1P A;  5K5O A;  4LJZ F;  3PSF A;  1YHQ I;  3IKT A;  4QSH A;  4MLO A;  4NUB A;  3OS0 A;  4ZDL A;  1U9O A;  2XF6 A;  4A3D J;  2HVQ A;  3BOQ A;  3WGG A;  3K1P A;  5CYV A;  1T6S A;  2WA0 A;  3GTQ J;  3BJ6 A;  3RKY A;  4BXX J;  1ON2 A;  2JUC A;  4AIJ A;  3RPU D;  4BBR J;  2DI3 A;  1ONV A;  4EJU A;  4YRV A;  5FLV A;  4PGG A;  3V7S A;  3KZI C;  3ZGK A;  2H8R A;  4OIN F;  3EYY A;  3GBG A;  2JTV A;  1HSJ A;  1PUF A;  2A61 A;  2DBB A;  3NWT A;  1ETQ A;  3BG5 A;  3MKL A;  2XVC A;  1F5T A;  2WAQ N;  3RYR A;  3WTZ A;  1K4T A;  1TNS A;  1X2M A;  2VJ5 A;  5E20 A;  5J1U A;  3QOP A;  2LSO A;  5DV5 A;  4C30 A;  5H6R A;  2QWW A;  2NOG A;  2AS5 F;  4PJL A;  1ZRC A;  2CYY A;  5IY5 H;  1H88 C;  4H4K C;  2ZO4 A;  5IOY A;  3M07 A;  3LSR A;  1TW3 A;  2P5K A;  2BV6 A;  3OYJ A;  3OL4 A;  3CC7 I;  3FK6 A;  3ABT A;  2XV4 S;  2B7E A;  1MMN A;  2IW5 A;  2HR3 A;  3JSP A;  3CDL A;  1LVK A;  4PCQ A;  1JXS A;  2KZV A;  2DCE A;  1RNL A;  1ZHF A;  4RA2 A;  4J00 A;  1Z91 A;  3OYK A;  3I64 A;  4EJT A;  3GZN B;  4KIB A;  4XOP A;  1N78 A;  3HRM A;  1L0O C;  2XAS A;  2VAS A;  5KAI C;  3OYN A;  3BPX A;  4IHT A;  1ZLJ A;  2PJR B;  2WBM A;  5FLX Z;  2IJL A;  2HYG D;  4XLC A;  4UY8 I;  4EJO A;  2OD5 A;  2VN2 A;  4E7H A;  2DXI A;  4KJZ A;  5TJJ A;  4HNT A;  2Y9Y A;  3MZY A;  1R00 A;  1G8X A;  3BCA A;  2OV7 A;  1FIA A;  2AXL A;  3EPZ A;  5M3M J;  4MTD A;  4ZDO A;  3RSN A;  4PSW A;  2VE8 A;  4HF0 A;  2EZH A;  2XIG A;  4XSZ F;  2B63 J;  5FFX A;  3UR3 C;  3MEX A;  4CCJ A;  5GP9 A;  2R7U A;  3WTU C;  3ZMU A;  1P4X A;  1YFH A;  4F92 B;  1P92 A;  3GTG J;  1P6R A;  1WZ2 A;  5BPD A;  3DLL F;  4V2G A;  4CO8 A;  2HQA A;  4LG0 B;  3CCQ I;  2VOD A;  4EMS A;  5L3G A;  2HWV A;  3BR2 A;  1G59 A;  4J19 A;  5CVI A;  1MMD A;  2CUE A;  4ZYE A;  2N8G A;  2EA4 A;  2ZFU A;  2NNY A;  1R5H A;  3S17 J;  1E3P A;  1YX3 A;  1WJA A;  4HOB A;  2VQG A;  2AQF A;  3OR2 C;  4HNV A;  5JHU A;  2L7M P;  1ZG5 A;  4CUG A;  1Z1D A;  1K79 A;  1WJF A;  4FCY A;  2UZK A;  3CUO A;  1ZG1 A;  1OCP A;  2XRL A;  2OCC H;  3E6C C;  4M3E A;  2CO5 A;  2LVS A;  1SVM A;  1UEL B;  4BL0 B;  1IZ1 A;  1FPQ A;  3QPS A;  2B9S A;  1RUN A;  1MJ9 A;  2XAG A;  1I1S A;  4CYC A;  2RQP A;  3LMM A;  2HTJ A;  1QZE A;  4WXC A;  4IHX A;  4DBQ A;  4N9H A;  1TNT A;  3HXL A;  1IRG A;  2VJ4 A;  3X2Q H;  4N9I A;  4P9F A;  1S7E A;  2DA3 A;  1DUX C;  2JPB A;  2NOJ B;  5AON A;  4XL9 A;  1BW6 A;  5JHF A;  4PFP A;  3WG9 A;  2AQE A;  2OQG A;  4IPA A;  2CG4 A;  2ZME C;  3CJR B;  3ASO H;  3N4M A;  1ZTR A;  1T56 A;  1HDD C;  5B5E C;  2P5V A;  2XSJ C;  2ZXI A;  4B44 A;  2K5C A;  1BI1 A;  3LQQ A;  3M1E A;  5FKN A;  1LPQ A;  2RRE A;  4IHY A;  3LST A;  2FOW A;  2HXO A;  3F0C A;  1YRN A;  3JAM Z;  1XMK A;  5LBQ A;  3KLN A;  2GLO A;  4IO9 F;  4BE0 A;  5J8F A;  1DPR A;  2M87 A;  2OCE A;  2IVM A;  3C2H A;  4ZTF A;  3RDI A;  2MD5 A;  1XGM A;  3KEY A;  4XRS G;  1RUO A;  3CF5 F;  1XSX A;  5B3S H;  3I59 B;  5DDG A;  2DOD A;  3B6A A;  2OPT A;  5KCM A;  3TP3 A;  3HKZ A;  3VOE A;  2R93 J;  5H6Q A;  1OPC A;  4KT5 C;  1CQT A;  4L0Z B;  4BYY A;  3TGN A;  2EZL A;  2Y69 H;  4L5J A;  1QO0 D;  5TIS C;  3LA2 A;  1AOY A;  1LFB A;  3OWT A;  1X3W B;  1LEA A;  2ZSH B;  2DFF A;  1OYW A;  3GME A;  3LFU A;  2DN0 A;  5E3N A;  1LJ9 A;  3R60 A;  3CO6 C;  2X85 A;  2EV0 A;  2V1X A;  1KYW A;  3ZXS A;  2R5Y A;  3OYM A;  2E5Z A;  1T98 A;  2LG4 A;  4DJA A;  3B6C A;  3H5N A;  4HG2 A;  5JFR A;  2MA3 A;  2GA2 A;  2COB A;  2VLA A;  4R79 A;  3CCS I;  4OU0 A;  4Z2Y A;  2LBF A;  2IS2 A;  4IOC F;  1AKH B;  2VXD A;  2ZKZ A;  1Z77 A;  2BY2 A;  3VYT B;  2UV1 A;  5D5V B;  2KT0 A;  3ZPL A;  3BZK A;  1LDD A;  4HDV A;  1BR4 A;  5IPA A;  1GV5 A;  1UG2 A;  1LNW A;  3VYU B;  4A0Y A;  3RKQ A;  3M9A A;  5HNF A;  3JRI A;  3OY9 A;  3IWF A;  3Q0W A;  4IQ4 A;  4RAY A;  1FEX A;  2ISY A;  4YIF A;  3BWG A;  1SMY F;  3M7G A;  1R36 A;  1HBX G;  1IUF A;  2WAE A;  3FMS A;  2K86 A;  5DCM B;  1K4S A;  3H0G J;  1IN5 A;  4IRG A;  4U7D A;  1NG7 A;  5F6F A;  5CQG A;  3GYH X;  1J0R A;  2L54 A;  2VKE A;  2DA2 A;  4AID A;  2VL8 A;  4AWX B;  2Z99 A;  4BY7 J;  3I3L A;  5KHD A;  4XKW A;  2EFQ A;  4DNC A;  1W7P B;  4CYD A;  2A5W A;  3MCZ A;  1ZK8 A;  4KA4 A;  4I99 C;  4M3G A;  5IYB J;  4Q4Z F;  4LB5 A;  5LHI A;  2LKS A;  4UNO A;  4KFC A;  2M2E A;  2KZG A;  4I7H A;  1B6A A;  3WTX C;  4AYB A;  1EV7 A;  4EM1 A;  1XGN A;  4MNU A;  5JLX A;  1HQC A;  4AD9 A;  2Q2E B;  2X0L A;  1GXQ A;  3ERE D;  2OF7 A;  2ZJQ F;  3MFK A;  5B1B H;  5J3L A;  4LMY A;  4MFD A;  1VQO I;  3S32 A;  1ERD A;  1GUU A;  4I02 A;  4M3D A;  3W3C A;  4KYW A;  2L4A A;  2KP6 A;  2QQB A;  2D5V A;  2CMP A;  1KQ9 A;  4G6D A;  3KLO A;  4ENJ A;  4WXH A;  2MGQ A;  1FIP A;  5J4Y A;  1RZ4 A;  2OZU A;  3R4K A;  3CDI A;  2IS4 A;  3Q9S A;  4YIR X;  5IYD J;  3QPL A;  5M5Y J;  3VB2 A;  4A3F J;  2FU4 A;  4OAZ A;  4B48 A;  1JUP A;  1MZB A;  3T1B A;  1Q1H A;  4BQO A;  5DD8 A;  4AIH A;  3QQA A;  1A6I A;  4NHJ A;  2Z1D A;  3QP5 A;  3H3U A;  3DLA A;  4ESB A;  2CU7 A;  5JI6 A;  1Z0X A;  1BBY A;  2UXX A;  4HX7 A;  1F36 A;  2L9R A;  3V8J A;  1K6O A;  1ZYR F;  2M4G A;  5L3D A;  4NB5 A;  1HC8 A;  5E79 C;  2FD5 A;  2DJN A;  1D0X A;  2QZ8 A;  1ETW A;  4LK0 F;  3GXO A;  3IHU A;  5HOO A;  1H9G A;  3K70 C;  2QCO A;  1ZR2 A;  1MSF C;  1MBH A;  2DAO A;  5LD2 C;  2E5N A;  4HF2 A;  4L18 B;  2W1O A;  3S1M J;  2EIL H;  1V5G A;  5KVR A;  1QNT A;  1OCC H;  1R23 A;  4GGG A;  4YFK F;  3NWS A;  3OYA A;  3ISP A;  2VC0 A;  4A5N A;  4I6Z A;  3DEE A;  2NVT J;  3KP7 A;  1V5F A;  1ZGA A;  2CS3 A;  2Z3Y A;  2W84 A;  3LA3 A;  2HS5 A;  3SDG A;  2LK2 A;  1SD4 A;  2GOX B;  1K61 A;  2P81 A;  2O8K A;  3DFG A;  5H2F C;  3GTK J;  3WTW C;  5J1R A;  4CA0 A;  2CQ7 A;  4Y13 A;  1QZY A;  1XDS A;  2O03 A;  2E71 A;  3B73 A;  1H9T A;  1SFE A;  2YS9 A;  4F93 B;  2H6C A;  3OL3 A;  4PZJ A;  5K7H A;  3MVP A;  2DLL A;  3KYC B;  3BZ6 A;  3IUO A;  2H1K A;  2KRF A;  5E3L A;  5BNG A;  2PJR A;  3DTE A;  4M3B A;  4QIW N;  3SFI A;  3GTP J;  1LDJ A;  4RAG A;  4XID A;  3GFI A;  5J40 A;  4OOI A;  5DM7 F;  2XKO A;  1T95 A;  1B59 A;  2JK3 A;  2ZXW H;  3PO2 J;  2A3S A;  3C7J A;  4EM2 A;  1HDP A;  3W6K B;  5GAD J;  4XN3 A;  3OSG A;  3FXR A;  4UUS B;  2OTJ I;  2L7F P;  3TQN A;  1FY7 A;  3PQK A;  4CSW A;  1FT9 A;  1A6Q A;  2X6X A;  1LE8 B;  1VI0 A;  1BR1 A;  4KIT B;  3T8R A;  3FXQ A;  4M9X A;  3HHG A;  4ASN A;  4BQQ A;  1LFU P;  2RGV A;  4PK4 A;  4BAY A;  4JQF A;  4KIC A;  3HB9 A;  3OIP A;  3MKZ A;  3CMY A;  2VE9 A;  3KCC A;  3M4O J;  3F22 A;  4IF4 A;  1W1W E;  4A3B J;  4O3M A;  5FFZ A;  2PG4 A;  3I5U A;  1WJ5 A;  1WWX A;  3MD2 A;  4H0E A;  2WAQ A;  2Q8K A;  1IN8 A;  2KMU A;  2M9H A;  4C2U A;  4A3I J;  2D45 A;  4ZH4 F;  4BNC A;  5HLH A;  1OKR A;  1F43 A;  5ICG A;  1X4O A;  2CV2 A;  4EEF G;  1ZAR A;  3IC7 A;  3SZP A;  3H5R A;  1FWZ A;  1ZH5 A;  4MQ9 F;  2QKM B;  2X4H A;  2IS1 A;  3LA7 A;  3DF8 A;  3FIS A;  4BBS J;  3JRC A;  1B4A A;  2COM A;  3HRT A;  1I6H J;  2PMU A;  3D5L A;  2VIX A;  1T33 A;  3P5J A;  4FE4 A;  1JKO C;  4DYR A;  1IN7 A;  1P2F A;  3EUA A;  3FDY A;  1T8I A;  3PNV A;  3K2A A;  3G71 I;  1R5G A;  2WC2 A;  4YFX F;  1BW5 A;  4BKX A;  2E7X A;  2LLK A;  2Y2Z A;  1P4W A;  4I01 A;  2HFH A;  1IV6 A;  3A03 A;  3GTO J;  5LEJ A;  1BIB A;  3JRF A;  3TOB A;  2WTE A;  1FMV A;  2MH2 A;  2IS6 A;  3K9T A;  3EUH C;  3BP8 A;  4L9J A;  3CME I;  1RKT A;  3TO7 A;  3WG7 H;  4XRS A;  1HXD A;  4FTH A;  4I2O A;  4PSX A;  2WY7 Q;  3QP6 A;  3KYL A;  2VJI A;  5E8G A;  1YG2 A;  3HUG A;  3GX4 X;  1MKM A;  2L9V A;  2P5L C;  3GO5 A;  3CCM I;  3EUK L;  4E4H A;  2FXA A;  1RPW A;  2K9N A;  3RKX A;  1MBG A;  3OS1 A;  2HZD A;  3IRR A;  3OS2 A;  2GXA A;  1MGT A;  2VKD A;  3J7A O;  3WU1 B;  2L9S A;  1SFK A;  2I10 A;  5E3O A;  1B8I A;  2YUS A;  3BQZ A;  1HW2 A;  1ZRD A;  3M8E A;  2CUF A;  2HQR A;  3C1D A;  5F08 A;  3HBL A;  3DV8 A;  5GPC A;  2XGD A;  2OUM A;  2HYF A;  2YX4 A;  1JKP C;  2KDZ A;  1LE8 A;  3L00 A;  3LFK A;  2Y31 A;  3FKJ A;  4HW0 A;  1JI8 A;  2J5O A;  3GZ6 A;  5FGM A;  4WCG A;  2ESH A;  1OCZ H;  1WJD A;  3M8J A;  3HRU A;  3QOD A;  3ML6 A;  4UXN A;  2EPF A;  4FIS A;  4MHG A;  2LMD A;  1UAA A;  1G3S A;  2EQR A;  2EIK H;  1B8I B;  4M9S A;  1DU6 A;  2OBP A;  4PDK A;  2MAB A;  3FXL A;  2KL4 A;  3I9V 2;  3CC4 I;  3KZZ A;  5D4S A;  3ZP5 A;  3BCB A;  3BLY A;  3IAS 2;  4F3Q A;  2CRG A;  3QU3 A;  3H3Z A;  3AL0 B;  4BEH B;  1VQ4 I;  3K6G A;  1IDZ A;  2DDB A;  4CCM A;  4E7S A;  3HL2 A;  4EJW A;  5ILS A;  3F8F A;  4LLN A;  1V5E A;  2V9K A;  1NK2 P;  1TT0 A;  2IA2 A;  3KEQ A;  1YW9 A;  2XPV A;  3G3Z A;  3QU6 A;  4XIC A;  3ZMZ A;  1UHW A;  4CCO A;  5GTH C;  1XB4 A;  2ZXJ A;  2VI6 A;  4A3J J;  3S1N J;  3RJP A;  1S9H A;  3HJE A;  1O3R A;  1BI2 A;  1QRY A;  3BTC A;  1G3Y A;  3F23 A;  5D6F A;  4LIU A;  1REP C;  2M34 A;  1ETK A;  3C3W A;  5HLG A;  2F5C A;  4A0X A;  3CJQ B;  4ETS A;  3HOT A;  3K7A J;  2R7F A;  5D5U B;  3S2D J;  1U5T A;  1XN7 A;  3Q0U A;  1SFO J;  1KGS A;  2K4B A;  3ABM H;  3RKW A;  4RB3 C;  1FYK A;  4HST A;  2XC7 A;  4G7O F;  2E1M C;  3A0H C;  3TDZ C;  3M3Y J;  4XRF A;  2JZY A;  4L0Y B;  3BDD A;  2IXS A;  3TP0 A;  5DUI A;  4AVP A;  4CZZ A;  4A3E J;  2C6Y A;  3K4B A;  2H8W A;  1XGO A;  1OYI A;  4ESF A;  3HEF A;  1BA5 A;  3DKX A;  3PIP F;  4TV7 A;  1S6L A;  3DTK A;  3HOU J;  2UUZ A;  3ZCO A;  2M30 A;  2BEO A;  2FX0 A;  1BOB A;  4B43 A;  4B4C A;  1T39 A;  1QA6 A;  2F4M B;  3ZN1 A;  4IRI A;  1ON1 A;  5LFA A;  1P9Q C;  3EQL F;  2M5W A;  2LKX A;  1WI9 A;  2V4J C;  5EJC A;  1V55 H;  1X19 A;  1X1B A;  5K1Y A;  2O7O A;  5JVG F;  1XMX A;  4OIO F;  4OMZ A;  3HOW J;  4BY1 J;  3RZD J;  4IOA F;  4BH9 A;  3DWL E;  3PNY A;  5FD5 A;  2DQL A;  2X6O A;  3C2B A;  3R6S A;  5C3E J;  3F3X A;  1T2K A;  4A2U A;  3HDD A;  3A01 B;  3VOD A;  5GTI C;  2VB6 A;  1DP7 P;  1V3F A;  3DKW A;  3JR9 A;  1XX5 A;  3BG9 A;  3I58 A;  4WXD A;  3ZOB A;  4MEX F;  2JT1 A;  3GEZ A;  5L3F A;  4KIG A;  4KMF A;  1SVO A;  5E3M A;  2RV8 A;  3GLX A;  2YU9 J;  4EV0 A;  1PVE A;  4RS8 A;  3IWZ A;  1VQ9 I;  1GHC A;  3VFZ A;  3OYC A;  2GWR A;  1DQU A;  3O6B B;  1TQI A;  4Y15 A;  3HSF A;  3TO6 A;  3O8G A;  2GA1 A;  2IGM A;  4ZYH A;  2FMY A;  4G6Q A;  5A2Q K;  4KNY A;  2E1N A;  3NRV A;  4FE7 A;  4X1E A;  4G7Z F;  2QUF A;  3FHZ A;  1MND A;  2PMH A;  3FX3 A;  3KIO A;  2NXN B;  3JTH A;  3L2C A;  4XR6 A;  1K7A A;  2R7T A;  5FJ8 J;  4IX7 A;  1BC8 C;  4M71 A;  4O5V A;  2X1D A;  2ELJ A;  2KIQ A;  1Z9C A;  2A07 F;  1J2X A;  1KON A;  2IEK A;  3IH3 A;  2ZBK A;  5FKK A;  4II3 A;  2VBX A;  3HPH A;  4D7M A;  3SEQ A;  1VQL I;  3CCJ I;  5ICE A;  2A68 F;  4MO7 A;  4CHU A;  1PP8 F;  3BG7 A;  3KE2 A;  3S1Q J;  2E1M B;  4ZC3 A;  5FLX K;  1D1A A;  1NG6 A;  2PX9 A;  3TL4 X;  2LF8 A;  5C44 J;  3QRF F;  1W7P D;  3CF2 A;  2WAD A;  4BJT A;  4BU2 A;  2MH9 A;  4YFN F;  3S8P A;  3WE2 A;  1G3T A;  3TW6 A;  2ADU A;  1S7O A;  2DA4 A;  4LGW A;  3IL2 A;  2EZI A;  3LSJ A;  1XD7 A;  3BR3 A;  4F7Z A;  1EH6 A;  2ELK A;  4B8X A;  4E7Z A;  3DKY A;  3V4G A;  3GF2 A;  2KRH A;  4XRM A;  3PSI A;  1J9I A;  5F0F A;  4KIF A;  1Y6I A;  3WHC A;  4A12 A;  1J59 A;  2BHZ A;  5CLS A;  4HEA 2;  5CKT A;  4RGU A;  1MSE C;  1C0W A;  4FX0 A;  1R9T J;  4D9J A;  1E17 A;  3K0L A;  5FO5 A;  3MKY B;  4MEY F;  2XKP A;  3M1C A;  2PI0 A;  1MD0 A;  4UVC A;  1UHM A;  5CQE A;  2DOF A;  2DFI A;  2MFZ A;  4UV9 A;  1YIJ I;  3O2P E;  1X4P A;  4CIC A;  4FAS D;  3HGY A;  3ULQ B;  1UZC A;  2W82 A;  1WJE A;  3J81 Z;  1T0F A;  4L5E A;  2CSO A;  2HGC A;  4UB6 C;  2R4G A;  4BJ6 C;  4E7J A;  5FD6 A;  4IVN A;  5M3F J;  3FHN A;  3EYI A;  2XF5 A;  4I0A A;  3SEZ A;  4CXF A;  1JT0 A;  3ELK A;  3TMO A;  1IG7 A;  2EIM H;  1VND A;  1E2X A;  3F6O A;  2BGC A;  4CYC B;  1WVR A;  4X0G A;  3DEW A;  3G1O A;  3L2R A;  2BY3 A;  3A0B C;  4M3F A;  4G12 A;  1ZRE A;  4BJ5 C;  4BE1 A;  2K4J A;  1FX7 A;  1LEB A;  2JSP A;  1TT5 B;  3K4K A;  4P96 A;  4RLF A;  1HW1 A;  2F4I A;  2E35 A;  2QKL B;  5EZG A;  5IT9 K;  2DT7 B;  3RQ4 A;  2XSD C;  2TRT A;  2Y75 A;  1TWH J;  1UST A;  2BXY A;  2JPC A;  3LSK A;  2EV5 A;  2V6C A;  2LTP A;  2ECB A;  2RVC A;  3BJA A;  3Q9V A;  5FKO A;  1T38 A;  2MC4 A;  2K3F A;  3IP4 B;  5DYM A;  1R6R A;  2CFX A;  2Z5U A;  2HEO A;  3CO7 C;  1QVT A;  4NNJ A;  3KEO A;  2K27 A;  5IT3 A;  1XGS A;  3JRD A;  1SFX A;  1X3Z B;  3FK7 A;  5J4V A;  3JSO A;  1ULY A;  3G6E I;  1FJL A;  2X6W A;  2CWE A;  4P55 A;  3RTR A;  2LRD A;  2YU3 A;  1OQY A;  5B1A H;  4RAZ A;  1NK3 P;  2NNN A;  2MBF A;  1LQ1 A;  3B02 A;  2XUB A;  2LNB A;  2KKO A;  3VSK A;  5LHG A;  4XLP F;  4ENN A;  2RQQ A;  4S05 A;  4D7N A;  4CDG A;  3BTJ A;  4DIQ A;  1ENH A;  1YQA A;  3FM3 A;  3H35 A;  2R7W A;  4E7I A;  2A5Y B;  5EG0 A;  5J6X A;  4ZZL A;  2VKH A;  2LP0 A;  4RB0 A;  2KRC A;  1GDT A;  1U5T C;  4AYB N;  5DS9 A;  4HA8 A;  3LL7 A;  4B47 A;  1R4N B;  3A2K A;  1GT0 C;  1TQP A;  5HOD A;  3I71 A;  1R4M B;  3IV5 A;  3ZMD A;  4HYE A;  4I76 A;  3KP5 A;  1HLV A;  3ZQ7 A;  4KT6 A;  1BIA A;  5ICC A;  6PAX A;  2M45 A;  4RM3 A;  3R61 A;  1ZGJ A;  2DMU A;  2QBY A;  2LY9 A;  1IUY A;  1S3J A;  2BZT A;  2KDO A;  3A4C A;  3L2V A;  4BQN A;  5D4R A;  1SAU A;  3QWL A;  2O9L A;  2GIV A;  4ESJ A;  4I0B A;  2JVH A;  2FQ4 A;  4ZZD A;  2PMZ A;  1RES A;  5FB2 A;  3A01 A;  5D5W B;  3H3V K;  2W4S A;  3K4J A;  4UUS A;  3L9F A;  5FLM J;  5GAH J;  1IRX A;  3PO3 J;  1X1D A;  3AG1 H;  4JBA A;  2HVR A;  1LVA A;  2DDA A;  2O8X A;  1VQK I;  3BZC A;  3DU5 A;  3O8H A;  3HZJ A;  4FT8 A;  2R7X A;  4RGX A;  2V1N A;  1DPU A;  1KU2 A;  1Z3X A;  2CW0 F;  4OWR B;  2QBY B;  3GZ5 A;  3F8C A;  5ERI A;  2VBY A;  3WE3 A;  4AC0 A;  2YX7 A;  1ZLK A;  2G7H A;  5HDN A;  2F6C A;  3BG6 A;  5EYR A;  4RGR A;  4BHC A;  3H92 A;  2W85 A;  3WOD F;  1IGN A;  4E70 A;  1R1T A;  2JWT A;  4R8H A;  2M0M A;  1Z7U A;  3LSH A;  3I55 I;  4JX6 A;  4Q48 A;  4CCK A;  1QHH D;  4BE2 A;  4W1U A;  1MJB A;  2BVL A;  1O7L A;  2DA1 A;  3AAF A;  1ACI A;  5EG0 B;  1F4K A;  4FX4 A;  1QGP A;  3RPQ A;  5LGT A;  1E0E A;  3HOY J;  3OR1 C;  2EV6 A;  3CCE I;  1M1E B;  2BW3 A;  1W0U A;  1DU0 A;  2G7U A;  1Z21 A;  4O6J A;  2VBW A;  1WSU A;  2OC6 A;  1GVD A;  3F8N A;  1TLH B;  2GAU A;  2X9D A;  4LG0 A;  1R71 A;  2RKH A;  2H6B A;  1TZL A;  1OIS A;  1AWC A;  1EKE A;  1FOW A;  2K02 A;  2Y0S N;  2BOL A;  2GM4 A;  1OCO H;  1Z6R A;  4P5O A;  3ABU A;  1MNM C;  3AG4 H;  1MMG A;  3ZQL A;  1IW7 F;  1BI3 A;  2LKP A;  2DK8 A;  2CQX A;  2DMN A;  1S72 I;  2B0L A;  2QVO A;  5LGN A;  3E7L A;  1OLT A;  2DFE A;  4PFO A;  3S3M A;  2IA1 A;  2VON A;  1U78 A;  2CJJ A;  3GCM A;  4WWC A;  2CV0 A;  2F4O B;  1Z3Y A;  3WU0 A;  2E2J J;  2R7D A;  4UUT A;  1KQ8 A;  3I59 A;  1D8J A;  4P9U A;  2XAF A;  5FKM A;  2M0C A;  2FF4 A;  3RPU A;  2DTR A;  2VPL A;  3KZY A;  1Y0U A;  3E6M A;  2Q1Z B;  4GXO A;  4UVB A;  4B3X A;  4D5C A;  3CUQ A;  2BVM A;  5E1W A;  2ACJ A;  4XK4 A;  1OYY A;  2JVG A;  3CJT B;  1G2H A;  2DMQ A;  3F21 A;  2HQ5 A;  2QSG X;  3HTU A;  2LDU A;  3I4M J;  4A93 J;  2G9W A;  3JRH A;  1U3E M;  2STW A;  2A6H F;  3PFI A;  4QTR A;  1MNE A;  4HAM A;  3ZQC A;  2FNP A;  3BR5 A;  2F5F A;  5EZH A;  1W7P A;  2RDP A;  1XPX A;  2YSR A;  5K7F A;  3HM5 A;  1FNN A;  3F9K A;  4QLC U;  4D1Q A;  2F2E A;  1F1Z A;  1OR7 C;  2DW4 A;  4U87 A;  4OIP F;  2X48 A;  5HVQ C;  1D5V A;  1TBX A;  4HX8 A;  4XN0 A;  5LEK A;  4XOT A;  2JMW A;  5K5R A;  1JJ6 C;  2LC2 A;  3OYH A;  2UWM A;  4OAY A;  2BBY A;  1AU7 A;  1HKS A;  3CCV I;  4S0H B;  2VQH A;  2E2H J;  4UUV A;  1Y8Q B;  2X6Y A;  3K2Z A;  3SFZ A;  2ZME B;  5KAF C;  2DPD A;  5E18 F;  4JP0 A;  2ICW G;  2WB1 A;  1HST A;  5EF6 A;  2NVX J;  5ED4 A;  3M8F A;  2D1V A;  1VQ5 I;  1FZP B;  1MBJ A;  2F5E A;  2EFP A;  1WGX A;  2DMT A;  4PGH A;  4RM2 A;  1P7J A;  3T8T A;  2HVS A;  3WTV C;  3FXJ A;  1IRF A;  3MN2 A;  3W2V A;  1LKX A;  2NS8 A;  3OV8 A;  3FXK A;  4E6K G;  5FRN A;  1ITY A;  4Y4R A;  5D8L B;  2VXZ A;  4LG3 A;  3LOC A;  2W48 A;  5KK1 A;  1BJZ A;  1UMQ A;  4DBR A;  2JA6 J;  5KNL A;  1TQM A;  1IN4 A;  1YS7 A;  5F1R A;  1XSD A;  1O4X A;  2OZ6 A;  2V1U A;  2VPR A;  1TP4 A;  3CLQ A;  1POG A;  2P0W A;  4U0Y A;  1Y1V J;  3VWB A;  4B09 A;  3OMY A;  3K4L A;  5FRM A;  2XF7 A;  4L9T A;  5DEQ A;  5JR3 A;  1RIO H;  2E36 A;  4CGZ A;  1HKT A;  1U2W A;  4U88 A;  1W4M A;  3HSE A;  3LAP A;  1B72 B;  1BR2 A;  2RNG A;  4NQW B;  3OOP A;  3SXY A;  2FEZ A;  2MW8 A;  3MMY B;  4KIS A;  5L3C A;  3W6J B;  2ZCW A;  3LQR A;  3S2H J;  4XLA A;  2AHQ A;  4WK8 F;  4IHV A;  9ANT A;  1TW2 A;  3RCO A;  3BR1 A;  1R1U A;  2OA4 A;  1SMT A;  2GXG A;  2ECC A;  3GFJ A;  3D1N I;  4U0V A;  1JUM A;  3PFY A;  1IN6 A;  1O3S A;  4EQQ A;  2QA4 I;  1GVJ A;  3FXU A;  3E6D A;  5TGT A;  4A6E A;  3S3O A;  3BTI A;  3GTL J;  1S8N A;  3J80 K;  3FF5 A;  2IPQ X;  1S29 A;  2PJP A;  4R1H A;  2VC1 A;  4JX4 A;  5A2Q Z;  2NVU B;  3S1R J;  1AA7 A;  2FUG 2;  4UB8 C;  4KN7 X;  1EA3 A;  2HOE A;  2V26 A;  1J09 A;  2M3A A;  2X1C A;  1LUJ B;  4ZYD A;  1J7K A;  4GCV A;  4C3H J;  2O61 A;  2FJ1 A;  2O3F A;  4M6X A;  1U8B A;  3LSM A;  5F0C A;  2JQ7 A;  2R7Q A;  2E60 A;  2QM3 A;  2R7S A;  1T08 B;  4LLG F;  1IV8 A;  5HNH A;  1IXS B;  1YX5 A;  3T0Y A;  2DOE A;  2RAE A;  2ZJP F;  1MDM B;  2LR8 A;  2QF7 A;  3VSL A;  3G4S I;  1R7J A;  1JHF A;  3HOX J;  2P6S A;  5F64 A;  1IC8 A;  2IGN A;  3QPH A;  1V54 H;  1VZ0 A;  3CDH A;  4PJJ A;  3J7Z I;  2GXB A;  4LFU A;  1F9N A;  2WV0 A;  1A5J A;  4CH7 A;  2MC3 A;  2V6E A;  2PEX A;  1QU3 A;  1YE9 A;  4WF2 A;  2CUZ A;  4Y7N J;  2LFB A;  3WU2 C;  2ID6 A;  3ZRG A;  4BHP A;  1YOV B;  2L7K A;  3V8K A;  1P7I A;  2A6T A;  1JKR C;  2M7B A;  4HZF A;  1SAX A;  1WJC A;  4G8X A;  2XB0 X;  2IAI A;  2JN6 A;  2EFN A;  2K9M A;  5CVJ A;  4RLQ A;  2R5Y B;  1MBF A;  3TDU C;  2XGX A;  4QPQ A;  2O5R A;  2HTS A;  1YJN I;  2M4K A;  4AU7 A;  5J1Y A;  2E19 A;  3OYD A;  3BR6 A;  4AIK A;  4L5I A;  1HOM A;  2BY1 A;  3UKG A;  1VQP I;  5HLT A;  3EUH A;  2DA6 A;  1QPI A;  2L5Q A;  3QYB A;  2OTL I;  1BI0 A;  2OU2 A;  4IEJ A;  1W0T A;  3CLO A;  1WKM A;  1ZEL A;  4NC8 A;  1ZKG A;  3JCU C;  2JA7 J;  3NEU A;  2OJE D;  2O6G E;  2XAJ A;  2VQC A;  1ETV A;  4M6V A;  3K1N A;  3TO9 A;  2A6E F;  5IT9 Z;  1D1B A;  2DMP A;  1OR7 A;  1DGR M;  4HLX A;  3WTT C;  1O57 A;  2FBI A;  3BQY A;  2DOA A;  4D0P A;  4RBO A;  3C18 A;  1NHA A;  3DQV C;  1ZRF A;  3PQJ A;  3GWZ A;  3RIR A;  1FYL A;  2FNA A;  3T5X A;  1MDM A;  1YTY A;  1YO5 C;  1PYV A;  1IJW C;  3PM1 A;  2D2W A;  1K78 A;  3A02 A;  3IAM 2;  1DP3 A;  4XKV A;  2R7R A;  4C3I J;  1Y8R B;  3NAU A;  1D5Y A;  4XKC A;  2M1B A;  4M6Y A;  1KU9 A;  2X51 A;  4ENK A;  1FOK A;  5EGO A;  1E3H A;  1WI3 A;  3F72 A;  3JRB A;  3MKW B;  1X58 A;  3HYI A;  1LB2 A;  1S7A A;  2FBH A;  3KET A;  4BQA A;  2QLZ A;  3H9G A;  4XNF A;  1D0Z A;  2HDD A;  1IRZ A;  1PDN C;  2P6T A;  3QYE A;  2XAU A;  3E97 A;  3HTS B;  1TTY A;  1Y0N A;  3S15 J;  2P7C B;  1R49 A;  3GTJ J;  4QWQ A;  3KX2 A;  5IP6 A;  2EBI A;  2DYR H;  2IBD A;  3ECO A;  1X1C A;  2EK5 A;  3HSR A;  2MYS A;  1UCR A;  1H8A C;  2NRA C;  1WCM J;  1SFU A;  1HF0 A;  3IH4 A;  3S14 J;  1X2N A;  4M74 A;  3HUG B;  1AHD P;  1I39 A;  2R92 J;  4IJA A;  1PUE E;  3HHH A;  3JTG A;  2TDX A;  2V9V A;  1A31 A;  1FP1 D;  3H1C A;  5L3B A;  4A5M A;  1USS A;  1KA8 A;  2Z33 A;  2BXZ A;  3V7R A;  1B72 A;  2EZK A;  5F1J A;  4N0B A;  2PLY A;  2R3S A;  3P9C A;  1OMI A;  1Y39 A;  3ZQF A;  4LLL A;  1Y56 A;  5DTD A;  2EIJ H;  2MLK A;  2R0Q C;  4EJV A;  1U6G A;  2YPR A;  3FBI B;  5E1Z B;  3K1M A;  1AKH A;  5BS6 A;  1H0M A;  5BQT A;  1HW5 A;  3S2W A;  2YR2 A;  3ZN0 A;  1XTA A;  5F27 A;  5CVU A;  1Y1W J;  2ZSI B;  3KFW X;  1QPM A;  2ZJR F;  1WRJ A;  3E3V A;  3PUF A;  4HSR A;  4XLE A;  1UHS A;  1WHU A;  4A3K J;  3LSP A;  3GFL A;  3U2R A; 
#chains in the Genus database with same CATH homology
 3FIW A;  4A3M J;  1MBE A;  2YS9 A;  1GT0 C;  1IDY A;  5EEA A;  3DCF A;  4MIM A;  2XGE A;  3TED A;  5K7H A;  3MVP A;  5HOD A;  3IV5 A;  2E1O A;  4I76 A;  2R5Z A;  1HLV A;  2H1K A;  1TWC J;  5E3L A;  2TCT A;  5BNG A;  3NAR A;  1ETO A;  4M3B A;  4QIW N;  3SFI A;  3GTP J;  4XID A;  2DMU A;  2LY9 A;  2MSY A;  3G1M A;  3LSG A;  2JK3 A;  3PO2 J;  1OFC X;  1HDP A;  2AO9 A;  3OSG A;  2DA5 A;  4UUS B;  2O9L A;  2L7F P;  4A3L J;  1JUS A;  2FQ4 A;  2L0K A;  1LE8 B;  3A01 A;  1RES A;  1VI0 A;  4V2F A;  1H89 C;  3H3V K;  4UUS A;  1LFU P;  5F0H A;  5FLM J;  3PO3 J;  4DYC A;  3HB9 A;  3L1P A;  3CMY A;  3O8H A;  2DTZ A;  4W97 A;  3M4O J;  2CQQ A;  1QVU A;  2WB1 N;  3CCY A;  4ABZ A;  3BR0 A;  4A3B J;  2HOS A;  5IYC J;  2WV1 A;  1BL0 A;  4AUX A;  2M8G X;  4AC0 A;  1E3O C;  2GBY A;  5M5W J;  2PMZ N;  5EYR A;  3JRE A;  2XPU A;  1IGN A;  5JLW A;  2M9H A;  1ORK A;  4A3I J;  2JWT A;  2DA7 A;  1F43 A;  5K7Z A;  4X6A J;  2VUM J;  3VPR A;  4JX6 A;  4EEF G;  5FKL A;  2R5Z B;  1JT6 A;  4W1U A;  2DA1 A;  4A3C J;  5EG0 B;  3FIS A;  5EDN A;  2K9Q A;  4IHW A;  2ZB9 A;  3HOY J;  4BBS J;  3JRC A;  1I6H J;  1W0U A;  1XG1 A;  1DU0 A;  3ZQG A;  2HOT A;  1ETX A;  1MH4 A;  1T33 A;  1VF9 A;  4FE4 A;  1JKO C;  1GVD A;  1ZR4 A;  2X9D A;  4DYR A;  1MH3 A;  3JRG A;  1FTZ A;  1JJ8 C;  3CQZ J;  5DS9 A;  2Y0S N;  2GM4 A;  1WH5 A;  3K2A A;  3OOU A;  1MNM C;  1U9N A;  3ZQL A;  3FKI J;  2HXI A;  2HYJ A;  4BKX A;  1BW5 A;  2LLK A;  2Y2Z A;  1SAN A;  1IV6 A;  3A03 A;  3GTO J;  4QSH A;  2DMN A;  2CQX A;  3HKZ N;  4MLO A;  3JRF A;  3E7L A;  1TWG J;  1U9O A;  3HOV J;  4A3D J;  1U78 A;  2CJJ A;  1RKT A;  4XRS A;  4FTH A;  2E2I J;  2JA5 J;  4MFE A;  2E2J J;  4UUT A;  5C4X J;  3GTQ J;  2ME0 A;  5FKM A;  2M0C A;  4B1R A;  4BXX J;  1RPW A;  1YRN B;  2K9N A;  3IH2 A;  4BBR J;  4D5C A;  1MBG A;  5FLV A;  4XK4 A;  2H8R A;  1G2H A;  2DMQ A;  3GBG A;  1K83 J;  1PUF A;  5E3O A;  2I10 A;  1ETQ A;  3BG5 A;  2YUS A;  3BQZ A;  2HQ5 A;  3MKL A;  1B8I A;  2WAQ N;  2HI3 A;  3I4M J;  2CUF A;  5F08 A;  1X2M A;  3HBL A;  5J1U A;  4A93 J;  5M5X J;  5GPC A;  2XGD A;  3JRH A;  5F04 A;  1LE8 A;  1JKP C;  2KDZ A;  2Y31 A;  4QTR A;  2NOG A;  3S16 J;  1I3Q J;  3I4N J;  1XC5 A;  2ID3 A;  3ZQC A;  1H88 C;  3BR5 A;  3LSR A;  5IOY A;  5EZH A;  5K7F A;  3HM5 A;  4LOC A;  3FK6 A;  4FIS A;  1GV2 A;  2EQR A;  3CDL A;  1B8I B;  1FTT A;  2X48 A;  1DU6 A;  1JJ6 C;  4DYQ A;  2JMW A;  1AU7 A;  4S0H B;  2LD5 A;  2E2H J;  2CRG A;  1RET A;  4JP0 A;  1IDZ A;  5EF6 A;  2XPW A;  2NVX J;  1MBJ A;  1RR7 A;  1WGX A;  2DMT A;  2HOA A;  2Y9Y A;  1P7J A;  1NK2 P;  1FIA A;  3MN2 A;  2NS8 A;  5M3M J;  2XPV A;  4XIC A;  1TWA J;  2XB5 A;  1JTY A;  3JRA A;  1ZQ3 P;  1ITY A;  2EZH A;  2VI6 A;  4C3J J;  1JGG A;  4A3J J;  2B63 J;  3S1N J;  1JKQ C;  3WHB A;  3LOC A;  2W48 A;  5GP9 A;  1BJZ A;  1UMQ A;  2JA6 J;  3BTC A;  1QRY A;  2K9S A;  4C2M J;  1O4X A;  3GTG J;  3G1L A;  2R7Z J;  3LNQ A;  2M34 A;  1ETK A;  2VPR A;  4V2G A;  3BT9 A;  1POG A;  1Y1V J;  3BR2 A;  3K7A J;  3GTM J;  4J19 A;  3OSF A;  2CUE A;  3S2D J;  4DW6 A;  3Q0U A;  2N8G A;  1SFO J;  3S17 J;  1EF4 A;  2NVY J;  4HNV A;  1B72 B;  2L7M P;  3M3Y J;  4RDU A;  4A69 C;  3TP0 A;  2MW8 A;  4FCY A;  4A3E J;  3Q3S A;  3BG3 A;  3HEF A;  3S2H J;  1BA5 A;  1OCP A;  9ANT A;  2AHQ A;  2XRL A;  4IHV A;  4M3E A;  2LVS A;  3HOU J;  3BR1 A;  2FX0 A;  4B4C A;  2ECC A;  3D1N I;  3QPS A;  1JUM A;  4NDL A;  4CYC A;  4Y52 J;  2LKX A;  4IHX A;  3W6V A;  3BTI A;  3GTL J;  1S7E A;  2O7O A;  2DA3 A;  1OJL A;  4JX4 A;  3S1R J;  3HOW J;  1BW6 A;  4BY1 J;  3RZD J;  3C2B A;  2X6O A;  4JYK A;  1ZTR A;  5C3E J;  1T56 A;  4C3H J;  4GFB A;  2FJ1 A;  1HDD C;  3HDD A;  1MBK A;  3A01 B;  4A3G J;  1U8B A;  5F0C A;  3JR9 A;  3BG9 A;  5FKN A;  3ZOB A;  4IHY A;  2HXO A;  3F0C A;  5E3M A;  2YU9 J;  1YRN A;  2RAE A;  2LR8 A;  2QF7 A;  3HOZ J;  2GLO A;  3O8G A;  3HOX J;  2VKV A;  1IC8 A;  4FE7 A;  4X1E A;  4XRS G;  1JTX A;  3B6A A;  4D5F A;  1A5J A;  2OPT A;  3TP3 A;  2NS7 A;  2R93 J;  4Y7N J;  1CQT A;  2LFB A;  5FJ8 J;  3HGG A;  2ID6 A;  2EZL A;  1LFB A;  1P7I A;  2IEK A;  3IH3 A;  1JKR C;  5FKK A;  4B3A A;  2DN0 A;  2ME6 A;  4D7M A;  5E3N A;  2XB0 X;  2IAI A;  2JN6 A;  4MO7 A;  2Y30 A;  2R5Y A;  3S1Q J;  2R5Y B;  1MBF A;  3B6C A;  5C44 J;  3ZQH A;  2COB A;  5J1Y A;  2E19 A;  1AKH B;  3TW6 A;  3BR6 A;  2JA8 J;  2DA4 A;  1Z77 A;  2EZI A;  1HOM A;  3LSJ A;  3UKG A;  2KT0 A;  2DA6 A;  3BR3 A;  1QPI A;  5IPA A;  2ELK A;  1HCR A;  1GV5 A;  1UG2 A;  3SJM A;  3RKQ A;  4IEJ A;  1W0T A;  3JRI A;  1ZKG A;  4XRM A;  3Q0W A;  2JA7 J;  1FEX A;  5F0F A;  1XS9 A;  3WHC A;  2K40 A;  1ETV A;  4M6V A;  2Y9Z A;  1MSE C;  1IUF A;  1R9T J;  2DMP A;  1I50 J;  4DZJ A;  3BQY A;  3H0G J;  1TC3 C;  4RBO A;  2VKE A;  2DA2 A;  4BY7 J;  1Q1V A;  3HGY A;  1IJW C;  3PM1 A;  2G0E A;  3A02 A;  5IOZ A;  1NTC A;  1ZK8 A;  4L5E A;  4C3I J;  1OCT C;  4M3G A;  3NAU A;  5IYB J;  1D5Y A;  5IP9 J;  1APL C;  2M2E A;  5JLX A;  3BTL A;  5EGO A;  5M3F J;  1ETY A;  2OF7 A;  1WI3 A;  3JRB A;  1X58 A;  4DZP A;  2EH3 A;  5J3L A;  1JT0 A;  4MFD A;  1IG7 A;  2MG4 A;  1VND A;  2HDD A;  1GUU A;  4M3D A;  5EGO B;  1IRZ A;  4CYC B;  2D5V A;  1PUF B;  3DEW A;  3S15 J;  3G1O A;  3GTJ J;  2MGQ A;  1FIP A;  4M3F A;  4G12 A;  2EBI A;  5IP6 A;  2IBD A;  5IP7 J;  1VFC A;  5IYD J;  3QPL A;  1H8A C;  1WCM J;  5M5Y J;  1HF0 A;  4A3F J;  3IH4 A;  1JUP A;  5EZG A;  2L7Z A;  3S14 J;  4JX5 A;  1X2N A;  3QQA A;  2XSD C;  1A6I A;  2TRT A;  1AHD P;  1TWH J;  2R92 J;  5C4J J;  1ZGW A;  2CU7 A;  2LTP A;  1Z0X A;  2ECB A;  5FKO A;  5GPA A;  1F36 A;  2L9R A;  3RQI A;  1WPK A;  2JJ7 A;  1B72 A;  2EZK A;  5F1J A;  3RZO J;  1QVT A;  2FD5 A;  2DJN A;  1ETW A;  1RKW A;  3ZQF A;  3JRD A;  3FK7 A;  2XGC A;  1FJL A;  5DTD A;  2R0Q C;  2QCO A;  1ZR2 A;  1MSF C;  1MBH A;  1AKH A;  1NK3 P;  3OIO A;  3S1M J;  5F27 A;  1Y1W J;  3TW7 A;  4I6Z A;  2NVT J;  4D7N A;  1WH7 A;  3BTJ A;  1ENH A;  2NVQ J;  3SDG A;  2LK2 A;  1K61 A;  5EG0 A;  3Q0V A;  1UHS A;  1TWF J;  2P81 A;  2LP0 A;  2O8K A;  3GTK J;  3ZQI A;  5J1R A;  3LSP A;  4A3K J;  1GDT A;  4AYB N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...