3HKZN

The x-ray crystal structure of rna polymerase from archaea
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
64
structure length
64
Chain Sequence
b'MLIPIRCFTCGSLIADKWQSFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHVDIINEVIHYTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 12
structure length 64
sequence length 64
chains with identical sequence W
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hkzN00
3GTOJ 3G1MA 4DYRA 5M5YJ 2YS9A 1MSEC 2COBA 3I4MJ 2M8GX 5F0CA 2VKEA 3HB9A 1JKQC 1MBHA 4AC0A 3A03A 1X58A 2L0KA 4MIMA 2DMUA 4XRSA 3S1RJ 1RESA 4A3FJ 1JKRC 1QVUA 1UHSA 2HI3A 1DU0A 3S1MJ 4MFDA 1T56A 4FISA 3O8HA 5E3MA 3RZOJ 1T33A 4FCYA 4W1UA 1B8IB 1O4XA 2O7OA 2R5ZA 4IHYA 2EZHA 4IHXA 2LD5A 2XPUA 3ZQIA 2ECBA 2KDZA 2NOGA 2Y2ZA 2O9LA 4BY7J 3JRHA 1BW5A 2DA4A 2TCTA 2R5ZB 4A3IJ 2NS7A 2LP0A 2W48A 3DCFA 1WI3A 2LR8A 1JKPC 4FE4A 5K7ZA 3LNQA 5K7HA 3BR1A 3BT9A 1TC3C 2B63J 2WAQN 1LFBA 1HF0A 2DMTA 2MGQA 3FK6A 3WHCA 1IG7A 1R9TJ 1MSFC 5DTDA 3IH3A 4MO7A 3CDLA 4IHWA 4BY1J 2CUFA 3IH2A 2DN0A 2EZKA 1OCPA 2JA5J 3S15J 1HDPA 5EZHA 1YRNA 1UG2A 3S16J 3ZQGA 3QPLA 2Y9YA 2GLOA 2GBYA 2QF7A 4NDLA 1Q1VA 1YRNB 3DEWA 4BBSJ 1ORKA 4FTHA 2R92J 2HOSA 1FTZA 1NK3P 1TWGJ 3BG9A 2NVYJ 4MLOA 4FE7A 3BR2A 5JLWA 3BR3A 5FJ8J 4C2MJ 1ENHA 3LSPA 4GFBA 2LY9A 3HGGA 1FIAA 3QPSA 1APLC 2YUSA 3HKZN 3LSJA 1HCRA 1JKOC 4JP0A 3O8GA 1QVTA 1H89C 4I76A 2XPVA 1U8BA 3G1LA 2DTZA 2HQ5A 4XICA 4D7MA 1ITYA 5M5XJ 1VF9A 3HEFA 2ME0A 2DA5A 4W97A 2M0CA 4M3BA 3E7LA 1MBEA 1P7JA 2JK3A 1ETVA 2K9QA 5IP9J 2R7ZJ 3BTJA 4AYBN 4RBOA 3HOWJ 3HGYA 1Z0XA 2AHQA 3SFIA 3TW7A 1A5JA 5F04A 2MSYA 2EBIA 1CQTA 4BXXJ 4A3KJ 2TRTA 3G1OA 3H0GJ 1WPKA 5F27A 2I10A 3HOVJ 3BTIA 4DYCA 1ZQ3P 3Q0UA 5EG0A 4A3DJ 4X6AJ 4JYKA 3GTPJ 2XPWA 3CCYA 2E2IJ 4XIDA 2EZLA 4L5EA 5EG0B 4D5FA 5IYDJ 2AO9A 5EYRA 1ZKGA 3GTKJ 1HLVA 3NARA 3A01A 2DMPA 3ZQCA 4UUSB 3JRIA 2Y30A 3RZDJ 3GTGJ 2OF7A 1U9NA 1MBGA 4XRSG 1IDZA 3A01B 3HOYJ 3GTQJ 2VPRA 3BTLA 5FKMA 3JRFA 3MN2A 2VUMJ 1GT0C 3OSFA 2JMWA 1E3OC 5C44J 1BL0A 2FD5A 2CU7A 2QCOA 1XS9A 5E3OA 3M4OJ 2VI6A 1WH7A 2LFBA 2L7ZA 1JTXA 5EDNA 1JJ6C 3BG5A 3BQZA 4M3GA 4M3DA 5EZGA 5FLMJ 4QTRA 2H1KA 1ZTRA 2E2HJ 1S7EA 2M9HA 5F0FA 2WV1A 5FKNA 3OOUA 1TWAJ 1IV6A 4A93J 4J19A 4C3JJ 1NK2P 2CQXA 3PO3J 2IBDA 2P81A 5EGOA 1U9OA 1MH4A 1WH5A 2PMZN 2K9SA 2LLKA 4V2FA 1ETKA 1GV2A 5F1JA 5K7FA 5EGOB 2HXOA 2NS8A 2Y0SN 2XGCA 4A3MJ 1ZR4A 4D5CA 3HOXJ 2DA7A 2LK2A 1ETQA 1X2NA 2ME6A 4IHVA 3L1PA 3F0CA 5E3LA 1JUPA 1MH3A 1F36A 5F08A 5BNGA 1I3QJ 3BG3A 4M3FA 4A3JJ 2JA8J 1JGGA 2NVQJ 5IPAA 1F43A 2CRGA 1LFUP 3S1QJ 1TWCJ 3K2AA 1NTCA 1IUFA 3HOUJ 4JX5A 3H3VK 3S2DJ 2EZIA 2Y9ZA 1GUUA 3GTMJ 1JUMA 5IP7J 2HDDA 2JJ7A 4A3GJ 4IEJA 4A3BJ 3W6VA 1Y1WJ 5IYBJ 2YU9J 1TWFJ 2RAEA 4AUXA 4DYQA 2EQRA 3K7AJ 3TP0A 9ANTA 5IP6A 3B6CA 1UMQA 2XB5A 3JRDA 2E2JJ 1ETOA 1JJ8C 2MG4A 1MBJA 3HDDA 1D5YA 3WHBA 1K83J 2E19A 2HXIA 2G0EA 2FJ1A 2K9NA 2ID3A 1HOMA 2DA6A 4QIWN 1X2MA 4A3LJ 1P7IA 3BR6A 3TP3A 2L7MP 2JA7J 1W0TA 1G2HA 1LE8A 2LTPA 2X9DA 1FTTA 4I6ZA 3S17J 1AKHA 1LE8B 5GPAA 3FKIJ 4G12A 4A3EJ 3CMYA 2FX0A 2GM4A 2R0QC 2D5VA 3Q3SA 2JA6J 5JLXA 2HOAA 5M5WJ 4Y52J 2XGEA 1BW6A 1MNMC 4UUTA 1VFCA 1ETWA 3UKGA 2VKVA 2DA1A 4XK4A 1VNDA 3IV5A 2FQ4A 2JWTA 5HODA 1DU6A 1FIPA 2CQQA 2EH3A 2HOTA 5F0HA 3MVPA 4LOCA 3CQZJ 1A6IA 3I4NJ 1U78A 2KT0A 2M2EA 2K40A 2ID6A 2L9RA 4C3IJ 3S14J 3Q0VA 4B3AA 3LSGA 3OSGA 2X48A 4DZPA 1IRZA 5IOYA 4XRMA 1QPIA 1GVDA 5J1UA 3ZQLA 2XB0X 1Y1VJ 4V2GA 1K61A 3TW6A 5GP9A 1I50J 1QRYA 4ABZA 1ETXA 3JRAA 2IEKA 1GDTA 1XC5A 3BR5A 2M34A 5IYCJ 1GV5A 3HBLA 4X1EA 1JUSA 5EEAA 4D7NA 1IJWC 3Q0WA 1B8IA 1EF4A 3BQYA 2H8RA 5GPCA 2IAIA 2LVSA 3SJMA 3A02A 1SANA 4S0HB 2ECCA 3RQIA 2DA2A 5J1YA 1SFOJ 5E3NA 1MBFA 1ZR2A 1AU7A 4M3EA 4BBRJ 1JT6A 1AHDP 2XRLA 2E1OA 1H88C 1HDDC 5C4JJ 1TWHJ 5FLVA 3JR9A 4A3CJ 2DA3A 1RR7A 1WGXA 4MFEA 4B4CA 5FKOA 2HYJA 5DS9A 3LOCA 1BA5A 3JRCA 1ZK8A 2L7FP 2NVTJ 5M3MJ 1IGNA 3S1NJ 2JN6A 2X6OA 2DMQA 5M3FJ 3ZQFA 3RKQA 4RDUA 3JREA 4CYCA 5FKKA 4HNVA 3JRBA 3IH4A 2MW8A 1RKWA 5IOZA 3ZOBA 1FJLA 4CYCB 2XSDC 2CJJA 1JT0A 3OIOA 4M6VA 5J3LA 3BTCA 1RETA 4DZJA 1ETYA 2NVXJ 2ELKA 1IC8A 1OFCX 1OJLA 4QSHA 3SDGA 3ZQHA 2O8KA 3HOZJ 2ZB9A 3C2BA 2R93J 4B1RA 2OPTA 1JTYA 3TEDA 3BR0A 4A69C 4EEFG 1ZGWA 4DW6A 2WB1N 3FISA 4C3HJ 2LKXA 3S2HJ 2Y31A 3HM5A 1W0UA 3D1NI 1B72A 5J1RA 3JRGA 3B6AA 1OCTC 3FK7A 3LSRA 4JX6A 5EF6A 3PM1A 1B72B 1WCMJ 3FIWA 1BJZA 3VPRA 2R5YA 1AKHB 5C4XJ 3NAUA 4Y7NJ 1H8AC 1IDYA 2R5YB 1Z77A 1PUFA 3PO2J 2CUEA 1POGA 4JX4A 2DMNA 1MBKA 3MKLA 1XG1A 1RPWA 4BKXA 1VI0A 1PUFB 2DJNA 3GTLJ 3GBGA 2XGDA 1FEXA 3M3YJ 3QQAA 2N8GA 5C3EJ 1RKTA 5FKLA 4UUSA 1I6HJ 3GTJJ
chains in the Genus database with same CATH superfamily
4DYRA 4RB2C 1V3FA 2OZ6A 2COBA 4L9TA 2CW7A 4HRIA 5HLIA 3BDDA 2FBHA 2DOFA 1X1BA 2E34A 2ZMEC 3GLLA 4Y15A 2FOWA 1UHWA 3V42A 1YS7A 3OYAA 1X58A 1VQ5I 3K10A 3QWLA 2J5OA 5ICCA 2RQPA 2XV4S 1QVUA 3F6VA 2LBFB 4KFCA 2O3FA 3KZZA 2BHYA 4FISA 4CICA 2XHKA 2D1HA 5KVRA 3RZOJ 2HR3A 5DD8A 2XVCA 3MEXA 4FHTA 1T33A 4S04A 5LD2C 2BYVE 1WJDA 5LEJA 2MBFA 3VYSB 4LG0B 4IHYA 3RYPA 3OYCA 2LD5A 3ZQIA 4HZFA 2IVMA 4M6YA 2O9LA 3CDIA 2Z16A 4R8HA 3HTSB 1Y0NA 3C3WA 3D5SC 2R5ZB 2E60A 2EWNA 2QQ8A 4A3IJ 2NS7A 2W48A 1I1SA 3DCFA 2W25A 4YEJA 1JKPC 1Z3XA 3R0JA 4FE4A 1W1WE 2BY3A 2RGVA 3I9V2 3K1MA 5K7ZA 2B9SA 4HOBA 3CMAI 1LPQA 4II3A 4O5VA 3AG1H 4NUBA 3E5XA 3K1NA 4Z6YA 1OCCH 4RM3A 3ERMA 3ISPA 1R9TJ 1J09A 4HQMA 3JW4A 2WAFA 3VYRB 3CCQI 2QENA 3IH2A 3DU5A 4LIVA 3U21A 2DLLA 4LJZF 3J81K 2Y0SA 3FMSA 4DIQA 1NG6A 1OKRA 5LFAA 2HQAA 2CQNA 4BE1A 4YFXF 2R7OA 1KZHA 2P0WA 2K4BA 4BBSJ 3DEWA 3QP6A 4MHGA 5B66C 3WG7H 1TWGJ 3NWSA 3I0TA 2BY0A 4FE7A 2D45A 2KIMA 4GFBA 1VQ8I 5FRMA 5ILUA 1QU3A 3DPLC 1FIAA 3E97A 3MWMA 2L9NA 2YUSA 3V7SA 4JP0A 3QAHA 4ESBA 1J0RA 4XOPA 3TGNA 4MNUA 3BJOA 3W6KB 3DBHB 2DDBA 3BJ6A 1OISA 3K9TA 2HQ5A 3CJQB 3ZCOA 3T5XA 4UY8I 3M7GA 4HPQA 4W97A 3NEUA 1J2XA 3LA3A 4F91B 2DU9A 2KMUA 4K2EA 5A2QZ 1XDSA 2HDWA 5IP9J 2R7ZJ 4N9IA 5KK1A 3WG9A 1TQPA 3HOWJ 4BJ5C 2MLKA 3SFIA 2Y75A 5F04A 2CQKA 2KZVA 3HC7A 4E7ZA 3HOVJ 4BU2A 1DP3A 4DYCA 2UXXA 5HS7A 3LWFA 1TNTA 1OPCA 4JYKA 1T08B 4ENJA 3S3NA 4UUVA 1QQIA 4PCQA 4Y33A 2UUZA 2EZLA 2W84A 3OYDA 3R6SA 4R1HA 1A36A 1Y8RB 2R7XA 1ZKGA 1U2WA 3FXUA 3GTKJ 1XGNA 3ZRGA 3E6BA 3GX4X 4UUSB 1FOWA 3RZDJ 1J59A 3DTKA 3VYUB 2VBWA 4BJ6C 3GTQJ 3KFWX 1K4TA 2VPRA 3GWZA 1FOYA 1TT5B 2L3DA 3ECHA 4KYWA 4BL0B 3CUQA 3OYLA 2JMWA 2Q0OA 4E7KA 2VXZA 1E3OC 3RJPA 2H94A 2EILH 2FD5A 4GGGA 1SVOA 5FLXK 2FMYA 2DPUA 3BCBA 2P5KA 1Y6IA 2R7DA 3M4OJ 2Z5UA 4I99C 3ZQ7A 1OQYA 1PDNC 3T0YA 2VKDA 1JJ6C 3K2ZA 2KDOA 4C30A 3L2QA 2V1NA 4M3GA 4M3DA 1FYLA 4L0YB 2DI3A 3HTUA 3DV8A 4JOMA 5CYVA 5FKNA 1MMDA 5CKTA 2ZC2A 4C3JJ 1NK2P 3PO3J 5EGOA 1R5GA 1DQUA 1U9OA 2FBKA 2R7WA 1U8RA 3KLNA 2IPQX 2EA4A 2LLKA 1HBXG 3K4BA 3ZMTA 1MDMB 1U5TB 1WHUA 2ISYA 5F1JA 2Y0MA 2OZUA 4KT5C 2HXOA 4KN4X 2GXAA 3K4LA 2P6SA 2XGCA 5K5RA 2JUGA 2LC2A 4M71A 5J8CA 3IAS2 2ME6A 1ETQA 3TQNA 4CCKA 4IHVA 4CCLA 1Z05A 4HX7A 2ZXHA 1V55H 2GA1A 2LG4A 5F08A 1D0XA 3U9GA 4HEA2 2OBPA 2WV0A 1I3QJ 1CGPA 2OCCH 3J7YJ 4EQQA 5B5EC 5FGMA 2Z9OA 1DUXC 1JGGA 3W2VA 1XSDA 2G7HA 3P9KA 3JCUC 1K4SA 1KU9A 3V4GA 3HOUJ 2K5CA 3GFMA 1YYVA 3S2DJ 5CVJA 1PP8F 3QYFA 3OYHA 2EZIA 2OJED 1FNNA 4QWQA 1GUUA 3GTMJ 1G3YA 1JUMA 5IP7J 1ZLJA 4HDUA 2JJ7A 2NOJB 3SDBA 4PK4A 4A3BJ 2HKXA 1Y1WJ 4EJUA 2ZJQF 4RAZA 3DWLE 2QBYA 4MQ9F 4AUXA 3GW2A 1SC7A 3K7AJ 9ANTA 3KP5A 4M6XA 5D5WB 3CCSI 4G8XA 3KZYA 3F72A 3PFYA 3HUGB 1BR2A 4LFUA 1MIJA 2FRHA 1D1CA 2HTJA 1K78B 1ULYA 2FNAA 4FT8A 4NC6A 2G0EA 3AKZA 4N4NB 2PMUA 3FKJA 3VFZA 4CZCA 4QIWN 3TP3A 4H4KC 2L7MP 4OWRB 1LE8A 3HKZA 2X9DA 3FBIB 1ON2A 2PG4A 1T2KA 3BOQA 2CV0A 3VDXA 3S17J 1U0JA 2HPIA 1AKHA 3JAMZ 3K6GA 3ZN0A 2ZBKA 1G3TA 2GM4A 2HNHA 1FBUA 1B1BA 3HPHA 3DEUA 2VJIA 5AIPA 3HRSA 2HOAA 4Y52J 5J4VA 1A6QA 5LGUA 1PP7U 5D6FA 1ETWA 1D0ZA 4LLGF 4MEYF 1C0WA 3DF8A 4E70A 5LRRA 1VQ9I 3FM5A 1QZZA 4ESJA 2GQQA 1VNDA 3H9JA 4XK4A 2FQ4A 4M9XA 3NWTA 2FUG2 4KITB 3CQZJ 2D1VA 5L3EA 2ZXIA 2R7UA 4UB6C 3LSGA 3OSGA 4XKVA 1U5TC 2XKOA 2QWWA 2X48A 3I4PA 2A69F 3V8JA 2LDUA 5IOYA 1KGSA 4XRMA 1QPIA 1GVDA 1BN5A 4JK1X 2QGUA 3TW6A 1F5TA 3K4KA 1QRYA 3OYBA 1YO5C 2KIFA 4CHUA 1ZYRF 1LKXA 1TW2A 1SVMA 4LK1F 2G7UA 1JUSA 3LSHA 3UNGC 1X1AA 2OQRA 3CF2A 1EF4A 4ZTJA 4Q4ZF 5GPCA 4IPAA 3FXQA 1HSTA 1BIBA 2O5RA 1S5LC 3HOSA 1G6NA 1XGMA 3BPVA 3S3MA 1FYKA 2ZXWH 4ZYAA 3F8BA 3HYIA 2VT3A 1YQAA 4BBRJ 2XRLA 1VQ7I 2KKOA 1FWZA 2E1OA 1HDDC 2A68F 2CQ7A 2E7XA 2V9KA 4BH9A 1SFEA 2DA3A 1P2FA 3C1DA 1WGXA 5DUIA 2Z2SB 4UV8A 2M87A 3HSRA 3F22A 2K27A 2MH9A 2K7LA 4PJNA 1B9NA 3JRCA 4ZYEA 1R1VA 1ZK8A 2L7FP 2VKHA 2X6WA 5ICEA 5M3MJ 3JTHA 2X6OA 2BW3B 3E6DA 2RVCA 1W36C 1AWCA 1IXRC 4B8XA 4RDUA 1X1PA 3AG4H 1WVRA 1ZGJA 3JRBA 5E8IA 3ROUA 2F48A 2EINH 3TDUC 4YFKF 3ZOBA 4CYCB 1LFPA 1LB2A 3OIOA 4U0YA 2OV7A 5J3LA 2PFBA 1RETA 1XGSA 3VSKA 2RN7A 1X3WB 1VQNI 2ELKA 1IC8A 3PQKA 4G9YA 1WJBA 3SDGA 2XAUA 2DAOA 2ZB9A 3HOZJ 2OPTA 3IAM2 3S3OA 3BR0A 2RQQA 1OLTA 3FXOA 4JQFA 1V4RA 4ZYGA 1O57A 1ZGWA 1JHHA 2A5YB 3F8FA 2HVQA 1DGWY 4PJJA 4C3HJ 4PGGA 4F92B 3CZ6A 4WXCA 4EGZA 1OCTC 3FK7A 3J81Z 1LJ9A 1UFMA 3LSRA 1ZELA 5FRNA 3PM1A 2XUBA 2R5YA 3BG7A 1SFKA 4XLFA 1LDKB 1MJBA 3OS0A 5C4XJ 2CMPA 2RDPA 1TT0A 4XLCA 4Y7NJ 1Z7UA 2H6BA 2XRNA 3DQVC 5L3FA 3SZGA 1PUFA 2LF7A 3ZGKA 2JSCA 3PO2J 4Y4RA 1ON1A 1O7LA 3FXMA 4MTDA 2Z99A 5ILVA 1RR8C 2BV6A 4L5JA 5BPIA 3OYMA 1ACIA 5HDGA 4H0EA 5E79C 1RPWA 4BKXA 1VI0A 3FF5A 4L5IA 1USTA 2GWRA 4FETA 1T98A 1FEXA 1UZCA 3ECOA 2I5UA 2X6XA 1RKTA 2K9LA 5B1AH 4OIPF 4I0BA 4ZDLA 4UUSA 3GTJJ 3GTOJ 3G1MA 5M5YJ 3RKXA 2IJLA 3B02A 3KYDB 2YS9A 2A6HF 4FASD 4II2A 3L2WA 4RGUA 3UR3C 5CVIA 2OTJI 1KONA 1IN8A 2VKEA 3HB9A 5L3DA 4HX4A 1JKQC 3WTUC 3HIFA 1I5ZA 1TP4A 1S7AA 1Y56A 4YFNF 4L9JA 2XAGA 4IVNA 1KQ9A 2FEZA 2Z3YA 3GLXA 3S1MJ 4MFDA 5D5VB 5E3MA 2B7EA 4J01A 5FFZA 3KP3A 2A61A 3KP4A 1XN7A 1X3UA 3F8NA 4W1UA 4UV9A 2R3SA 2O7OA 1O4XA 1B8IB 2ELHA 4P55A 2XPUA 1SD7A 4RS8A 2KDZA 3AFHA 2NOGA 2O6GE 2UWMA 4BGDA 2DA4A 3RCOA 2TCTA 1IRXA 2DJIA 2ZNYA 2OCEA 3TDZC 5FROA 1P6RA 3FXLA 1FT9A 2XC7A 4XBFA 1ZRFA 3BT9A 3BWGA 4NBQA 2B63J 5DM7F 2Q2EA 3I53A 1IF1A 1IG7A 1W7PD 2ZNZA 1XCVA 4MO7A 3CDLA 4RA2A 2LOOA 1CF7B 3SXYA 2EZKA 3HSFA 4O6JA 2PEXA 4LLLA 2V26A 5EZHA 2L9VA 1YRNA 1R22A 3VWBA 5FLXZ 2DOEA 2L5QA 3RKWA 4A12A 1UB9A 2VONA 2CYYA 1Q1VA 2R92J 2HOSA 1NK3P 1HKSA 4MLOA 2NVUB 2EIKH 1D3YA 3F8CA 2XSJC 1OCOH 1ONVA 2F5EA 3V7RA 4EJOA 5FB2A 1WRJA 2VE9A 2E35A 3OR1C 3HKZN 3LSJA 1WZ2A 3EUHC 2DW4A 5LGTA 4DOZA 2GZWA 4I76A 2DFFA 4HYEA 5HDNA 2M1BA 3HUGA 1YJ9I 2XPVA 1D8JA 1U8BA 1J7KA 2DTZA 1D1AA 4A2UA 4RB3C 3HEFA 2DT6A 4FX0A 2ME0A 1B6AA 2DA5A 4BQOA 2JZYA 2F4OB 3H9QA 5D4SA 4OIQF 2ZSIB 2QSFX 1P7JA 2JK3A 2K9QA 2KHMA 4RBOA 1BOAA 2LYCA 2IA0A 4OIRF 2AHQA 4YELA 4BS9A 2VL8A 1A5JA 1ZGAA 2EBIA 5HS9A 4I0AA 1H0MA 4BXXJ 5LHIA 4GCVA 1YOVB 4A3KJ 1YHQI 4WK8F 2F2EA 1O3QA 1WPKA 2DCEA 2VASA 1Z91A 1LQ1A 2HYGD 5LHHA 2KFDA 4U88A 3Q0UA 1KQ8A 3ERED 3K0LA 4HV6A 4A3DJ 3GTPJ 1Z6RA 3MQ0A 5CVRA 3GEZA 4BUPA 4RLQA 4L5EA 3CDHA 4Y17A 1EH7A 5EG0B 2XF6A 4D5FA 5IYDJ 1HLVA 3A01A 1JI8A 4IRIA 1S6LA 1MZBA 2X6YA 3LA2A 4M74A 3JRIA 2Y30A 2M5WA 5CVUA 2FNPA 1U9NA 4XORA 1IAWA 1IDZA 3AAFA 4BDZA 1KU3A 3MN2A 2VUMJ 4BJTA 1IUYA 3OSFA 4OAYA 3WTYC 2DK8A 3ZN1A 1DP7P 4RAYA 1BL0A 5H6QA 2QCOA 2XIGA 2YX4A 2BEOA 1XS9A 3CC2I 1BIAA 4XQFA 5E3OA 2P5LC 2MFZA 2WADA 3TO9A 1LVAA 4G94A 2PMHA 2DFIA 4XONA 2R7FA 5EDNA 2CV2A 1ZTRA 4U0VA 2M9HA 1YJWI 2WV1A 3GXOA 5J40A 5FFXA 3OOUA 1TWAJ 3GO5A 4IOCF 1IV6A 4J19A 1X3ZB 4XR6A 2FU4A 4EJTA 3OOPA 2PMZN 1X4PA 4KMFA 1FOXA 4V2FA 5CQGA 2JQ7A 1GV2A 3H5NA 2WWYA 4XLPF 5K5QA 4UVCA 1ZR4A 4LITA 3HOXJ 5IT9K 2MD0A 1OR7C 2DA7A 4CYDA 3DKXA 1B4AA 3L1PA 3F0CA 2AXLA 3G2BA 4EMSA 3CCVI 1MH3A 3CCMI 1F36A 2E1NA 2W00A 3ASNH 2VN2A 1YW9A 2NNYA 4N9HA 2LKPA 3IWFA 4ASNA 4KISA 5D6EA 4M3FA 2HVSA 1ZHFA 2FSWA 1ZG1A 2NVQJ 1VQMI 4EV0A 5TGTA 2CRGA 3D0SA 4PFOA 5EJCA 3S1QJ 2CO5A 3QPHA 2ZO4A 2LF8A 1T0FC 4KIFA 2YPRA 4U0WA 2VLAA 2BW3A 4JX5A 3MMYB 1TQIA 2WAQA 1XPXA 3A2KA 1TNSA 1OMIA 2PQ8A 3LSTA 3J80K 1XB4A 1YITI 1V5FA 2CW0F 4F3QA 4XKCA 3K1PA 3GVAA 2MC3A 2M4GA 3ZPLA 2PN6A 2QYOA 1N25A 5IYBJ 3GCMA 2YU9J 4KIGA 3WTVC 1QGPA 4XLNF 4BHCA 2AXTC 4B09A 2EQRA 1E0EA 3TP0A 1RIOH 4CH7A 1UMQA 4LG3A 4LMYA 2E2JJ 1ETOA 2FOKA 4A0ZA 1QHHD 3HDDA 3CMEI 1TZLA 2A5WA 2K02A 1D5YA 1P4WA 6PAXA 1K83J 2E1MB 2E19A 2HXIA 2FJ1A 2K9NA 1D8KA 1JHFA 2DFHA 1YTYA 2CSOA 2PJRB 3PIOF 1X2MA 1RI7A 4E7JA 1QZEA 4EJWA 1G2HA 1R5HA 4PJ0C 2B0LA 3ULQB 1ZREA 3JSPA 2M30A 2E5NA 2ZFUA 3A4CA 3FKIJ 2DXIA 3PSIA 3J7AY 3CMYA 2FX0A 3M9AA 1LEAA 1XMKA 5F6FA 4BNCA 1TTYA 2DK5A 1YX3A 3EUHA 2VC1A 2JA6J 3DKYA 2M3AA 2QM3A 3H9GA 5JLXA 3K4MA 3U1DA 1VZ0A 4UHTA 3I59A 1VQKI 2XGEA 3DBRB 1YX5A 4WX9A 3TL4X 2UZKA 2EJRA 1MMGA 1EV7A 4HA8A 2WTEA 4AM3A 1RZ4A 2IA1A 2JWTA 5HODA 3L2VA 4XLEA 3MVPA 5F0HA 4KNYA 3IKTA 3I4NJ 1BI3A 4CA0A 5ERIA 3T8TA 2KPMA 2A05A 2ID6A 4C3IJ 4BE0A 4ZTFA 4E7HA 2P7CB 2R7RA 2EFNA 4MQVA 3MFKA 1YIOA 2VQCA 1YLFA 1IRZA 3KP7A 5DM6F 3ZQLA 3VOEA 5CLSA 4AD9A 2IS6A 2XB0X 4KICA 1Y1VJ 4LIUA 4L0ZB 2DBBA 3QOEA 3ZP5A 2BY2A 5DCMB 1YJNI 3EETA 2ZXJA 3PSFA 4X1EA 1PJRA 1R4MB 3MKZA 1ZRDA 1QA6A 5IT3A 1O7FA 3WTSC 2QUFA 1B8IA 1R5ID 3EUAA 4CCJA 4DGWB 1XGOA 3BQYA 5LHGA 2OTLI 1ZG5A 4RAGA 1SD5A 1W7PB 3PNYA 2UV1A 2ZMEA 3H1CA 1K79A 2H8RA 2K3PA 2IAIA 2LVSA 3OIPA 3T1BA 2WBMA 1GHCA 3FXRA 5JI6A 2E5ZA 2XROA 2ECCA 4FQGA 4RB0A 4EVIA 4BHBA 2DA2A 5J1YA 2BVLA 1ZR2A 4M3EA 3V8LA 2CV1A 3BJAA 2LREA 5HS8A 5K1YA 3HL2A 4ZDOA 3CP8A 1D1BA 4P1WA 4RB1A 4HSTA 1QBJA 3JR9A 1VQ6I 1G4DA 3RSNA 4A3CJ 2R7TA 4CSWA 1SFXA 3ZMSA 4I09A 1RR7A 4HSRA 1CF7A 1MKMA 4MFEA 3WE2A 4AVPA 3COAC 4B4CA 5FKOA 2KIQA 3C7JA 3GZ6A 2W1OA 3RTRA 3LOCA 2E1MC 1Y0UA 2I8DA 4FX4A 1IGNA 2JN6A 3BY6A 3FBNB 3BZCA 3ZQFA 1SD6A 1E17A 1G59A 3LL7A 3NQOA 4L18B 2Z33A 4XLHA 1JGSA 3A1YA 5LLQA 1RKWA 4BAYA 2ZKZA 3SEQA 2W57A 1A35A 2CJJA 4L9NA 4BQNA 1JT0A 4M6VA 2HVRA 5LBQA 5KAFC 4DZJA 3VEPA 1KU7A 2NVXJ 1IN7A 1S3JA 3HG9A 3W2WA 4QSHA 3E6CC 2FMLA 3ZQHA 4I98B 3WTZA 5CQEA 4Y13A 3C2BA 4B1RA 2DO7A 2M7AA 2P8TA 4A69C 4HF2A 3HSEA 3N4MA 2X51A 2R4GA 1P4XA 2GOMA 3S2HJ 2C6YA 2MD5A 3OMYA 5JHUA 2RC4A 1B72A 5J1RA 1I1GA 2RKHA 3B6AA 3DP7A 1JXSA 1IN4A 1VQLI 5EF6A 3CMMA 3PJRA 3R0AA 1WCMJ 2IGKA 1E3PA 2ZJRF 1N78A 3IRQA 4ZZDA 2HS5A 1OYWA 2L01A 4E6KG 2MH2A 1Z77A 1ZH5A 3BZKA 2L2OA 2WY7Q 4WCGA 1BI0A 1POGA 4JX4A 3ZR8X 1O3RA 4ETSA 2DMNA 3X2QH 3MKLA 4PSWA 2HU9A 1Z9CA 4M73A 2VIXA 4GXOA 1O3TA 2V1UA 2ICWG 3GTLJ 3ASOH 1E3HA 2XGDA 3B73A 3QQAA 2N8GA 2NXNB 2P4WA 4RM2A 4IQ4A 2CUJA 4MEXF 5DEQA 3AG2H 2P6TA 2LY2A 1MSEC 2EIMH 3I4MJ 2M8GX 1JE8A 1M1EB 2X0LA 4CXFA 2BVMA 3FXKA 2K9MA 2E1CA 3OIQA 2E36A 4AC0A 2LBFA 3A03A 2L0KA 5TRDA 1O3SA 4ZYDA 1RESA 2HI3A 1DU0A 4XOTA 3F3XA 1T56A 2RNGA 4OOIA 3O8HA 4IL6C 4LG0A 2V6EA 1J9IA 4UXNA 1FX7A 3I5UA 4FCYA 3QP5A 1SD4A 2R5ZA 4PJLA 3KETA 3G4SI 2EZHA 4IHXA 5D8KB 1W5SA 3J7AO 2ECBA 4I02A 2HGCA 4ZC3A 3DPTA 4BY7J 4CCMA 3R4KA 3CLQA 4LK0F 5B3SH 2LP0A 1TBXA 2XF5A 5JVGF 2JVHA 4HW0A 2L4AA 1WI3A 1ZAOA 2STWA 3CJRB 4XLAA 4KT6A 2HZTA 2GAUA 3IP4B 4KJZA 2LMDA 3LFUA 5K7HA 2KISA 3BR1A 4N0BA 2EPFA 1TC3C 3CCJI 4ON0A 2WAQN 1LFBA 4U7BA 3SFZA 2DMTA 2X4HA 2NS0A 3WHCA 1IV8A 5GTIC 2AS5F 4XMYA 1MSFC 2PMZA 4BY1J 1D5VA 3CO6C 3VB2A 4EM1A 2DN0A 3DEEA 4OIOF 1VQ4I 2LY1A 2A07F 1HDPA 2V9VA 3REOA 1FP2A 3ZMDA 3CD6I 4ANJA 1UG2A 3ZQGA 4EM2A 4RGXA 4XSZF 1HKQA 5J6XA 3QPLA 2Y9YA 3G73A 2QF7A 1K6YA 4NDLA 3WU2C 5E17F 1ORKA 1SAXA 1KYWA 3CO7C 4FTHA 1E2XA 1FTZA 2PX9A 2F4MB 1IRFA 2FF4A 4HDVA 2NVYJ 3H0DA 2DQLA 3ABKH 2YSRA 2ZJ2A 1ENHA 4I01A 5FJ8J 3LSPA 3S93A 1LEBA 2LY9A 4A5MA 4HQEA 3CC4I 1APLC 3OV8A 4YG2F 2CWEA 3O8GA 1QVTA 2VB6A 3O2PE 1H89C 5HNFA 3WU1B 2UXNA 4PGHA 1HW1A 5TISC 1D0YA 3G1LA 4XICA 2V9PA 3K4NA 3VODA 4M3BA 5BPDA 4R79A 5HLTA 1R6RA 1MBEA 1P9QC 1ETVA 3BTJA 4AYBN 3HGYA 2IGMA 1WJAA 3LSIA 3QODA 3H0GJ 3ABLH 1IN6A 1XMXA 2V1DA 2M4KA 3OYGA 1WWXA 3BTIA 3GF2A 3J80Z 1BOBA 5E8GA 3PFIA 4XKBA 1GXQA 2F5CA 4E7IA 1VTNC 2K3FA 4X6AJ 5GTHC 1UHMA 3WGGA 3ZXSA 3CCYA 1LUJB 3GFJA 4XIDA 1S29A 4YIIA 3CCEI 1WJCA 2VT2A 2L7KA 2AO9A 5EYRA 2XASA 1STZA 1UJ8A 3RPUA 1R1TA 3KYCB 4HG2A 1FPQA 4AWXB 3ZQCA 1KQ0A 4B3XA 2DPDA 4PUSA 1X1CA 3E6MA 2W85A 1BBYA 1MBGA 4XRSG 1AOYA 2DFEA 3H5RA 3BTLA 2M45A 1VQPI 3JRFA 2DQRA 1WKMA 1GT0C 5J8FA 1G8XA 1QNTA 2KRCA 3ELKA 3U2RA 3K70D 4Q5SF 1S9HA 3OYKA 3EQLF 3G3ZA 3WGIA 1QPMA 5H2FC 1XX5A 1AA7A 1EA3A 2VI6A 4C2TA 4RAFA 2STTA 1ZG3A 2JRTA 2F6CA 2LFBA 1JTXA 5CJ9A 3O3KA 2LH9A 2GIVA 3BQZA 5EZGA 4QTRA 2H1KA 2ISZA 1R71A 2JPBA 5F0FA 1WQ2A 1WSUA 4A93J 4A6EA 1MDMA 1U5TA 2IA2A 2P81A 2MA3A 2DTRA 2QSGX 2QKLB 3S2WA 2K9SA 5J4YA 4DQ2A 1ETKA 3IUOA 5EGOB 3A0HC 3KIOA 2L9SA 2NS8A 2VOOA 5H6RA 4A3MJ 2PJPA 1XMAA 2ADUA 2BHZA 3CUOA 2EV5A 4EJVA 1TW3A 4BE2A 2R7QA 5L3BA 2XF7A 2CG4A 2XDVA 1W4MA 4Q48A 3BG3A 3EPZA 2VOPA 3FHZA 3RYRA 2X85A 2JA8J 1IZ1A 3EUKL 1HQCA 5IPAA 5IY5H 1TWCJ 3K2AA 1IUFA 1FLIA 1WJFA 1N75A 3M1EA 3CCLI 2Y9ZA 2QVOA 2FQ3A 3DPUA 2IXSA 1TL8A 1RC9A 2HDDA 1IN5A 4IEJA 2R7SA 1V5GA 3W6VA 3L9FA 2RAEA 4OMZA 3QU6A 1ZARA 1T95A 1WI9A 1TLHB 3BPXA 3FMRA 5DUKA 5EEGA 5IP6A 2V1XA 1REPC 3BP8A 1WFXA 4BQQA 1K78A 2XB5A 3JRDA 2QBYB 1JJ8C 2MG4A 1MBJA 3PIPF 1S72I 2HKOA 1A31A 1FZPB 2KZGA 3WHBA 3F23A 1Y8QB 3F21A 2J5PA 2PI0A 2ID3A 3IHUA 3HPGA 4ESFA 3PQJA 1P7IA 3BR6A 1GXPA 3WGHA 1G3WA 4DJAA 1GLNA 3LA7A 4I6ZA 4ZJZA 3W2AA 2BY1A 2IT0A 3OYEA 5DDGA 1LE8B 5GPAA 4G12A 4A3EJ 3OYIA 3P7NA 3OY9A 2JUCA 5FD5A 2R0QC 1PUEE 3GFLA 3MKWB 2D5VA 4HNTA 3E5UA 1SFUA 2VQHA 3TKYA 3QRFF 4XKWA 1SMYF 5JVTA 4KA4A 1BW6A 4BQAA 1MNMC 1VFCA 2F5DA 5HDKA 3MZHA 2YX7A 5E1XA 2A6TA 2VKVA 2DA1A 1RUOA 2LSOA 3MAJA 2L4MA 2EH3A 3QOPA 4LOCA 1U78A 3LAPA 1IXSB 2X1DA 3Q0VA 3T8RA 2KRFA 2KP6A 2M0MA 3N97A 2DT7B 5J1UA 3DU6A 3HZJA 4C9YA 4AIKA 2COMA 1K61A 5GP9A 1I50J 3M8FA 2DODA 1I27A 4RLFA 4ABZA 4ENKA 1MMSA 5TJJA 2IEKA 1S7OA 3H35A 1KU2A 3BR5A 2IS2A 2M34A 3FZVA 1Q1HA 4PSXA 1EJ9A 5EEAA 5GAHJ 4D7NA 1IJWC 1DGRM 2FA5A 3RQ4A 1RRJA 1R36A 2GA2A 4J00A 2O61A 4ENNA 4MTEA 2EV0A 4D9JA 3KYLA 1YIJI 2W24A 2CFXA 3BCAA 3FWEA 4WXHA 3LMMA 5H20A 3SJMA 5KCMA 1MMAA 2G9WA 3A02A 2GXBA 1SFOJ 5E3NA 2CGPA 2Y48A 4HLXA 1R7JA 3H3ZA 1AHDP 4LD5A 4G7OF 3IWZA 3TO7A 4D0PA 1H88C 3DLLF 5FLVA 3DKWA 5E20A 4AVZA 2EV6A 3TOBA 4A5NA 4E4HA 4D1QA 4BDYA 2L02A 4IO9F 3HRTA 4IHSA 1FYMA 2ETHA 2HYJA 5DS9A 3GZ5A 3RKYA 4IF4A 2QKMB 3F9KA 2CS3A 3LQRA 3LAJA 2Z1DA 1EH8A 2W82A 1NG7A 2DYSH 4F55A 3OWTA 3KCCA 1F9NA 2VBZA 3CP2A 3F6OA 5M3FJ 3ML6A 3JREA 4CYCA 5FKKA 4HNVA 1OCRH 4CO8A 1XCBA 1Z21A 3L2RA 3TOAA 3E3VA 3KEQA 2FXAA 1FJLA 2H6CA 3RI4A 3EYYA 1HKTA 2CFOA 2D2WA 3WE3A 2MYSA 4BEHB 3BTCA 4G6TB 1ETYA 3GUDA 3H36A 3V8KA 2QQBA 1OYYA 2O8KA 2R93J 2JVGA 3BLYA 1JTYA 4GYGA 4MGRA 1IW7F 2H09A 3L00A 4EEFG 2IRFG 5ICGA 3FISA 5KNLA 2Y31A 1R1UA 2IW5A 1L0OC 4NHJA 3JRGA 1R00A 4HV5A 2XAFA 1FY7A 3KX2A 2EFQA 5HVQC 1UCRA 4HF1A 3GZNB 3O6BB 2QLZA 1BM9A 4QPQA 4ZZLA 2BE5F 1YW7A 2ESHA 3G71I 1W5CC 3NAUA 3RIRA 3KPHA 4KMUX 1WJEA 2R5YB 5EEHA 2F5FA 3K4JA 4AYBA 1YI2I 2CUZA 2ELJA 1HA8A 1IXCA 2ZJPF 1T38A 3K4CA 4IHTA 1PUFB 2DJNA 3WTTC 1DPUA 2VPLA 5LGNA 4CCNA 3GBGA 2JA2A 3FX3A 4HBLA 3WTXC 3RPQA 2ZCWA 4ZDPA 3OS2A 5FKLA 4BYYA 1BC7C 1I6HJ 3WTWC 1QO0D 4F52A 2KL4A 2QA4I 2A3SA 2RV8A 5F0CA 1R58A 4WWCA 4NC8A 4IRGA 4GDFA 1MBHA 3OYJA 1WJ5A 3IKVA 2VJ4A 1FSHA 3ZMZA 2Q8KA 3WODF 4MIMA 2DMUA 4XRSA 3TO6A 3S1RJ 4A3FJ 2LKSA 2Y69H 1UHSA 3CJNA 4Y3OA 4CUGA 1JKRC 1RNLA 4NQWB 1PVEA 2O0YA 3DFGA 4I2OA 3V7CA 1ZRCA 3IL2A 1SVLA 3AL0B 4O3MA 1HW2A 5ICFA 3OYFA 2Y2ZA 2KJCA 4QPOA 2HYFA 3MZYA 2EFWA 3CC7I 3JRHA 1BW5A 5E18F 3SYTA 5J47A 2LR8A 1YS6A 3HOTA 3LNQA 4P96A 1YE9A 4L9VA 1UELB 3L09A 1HF0A 3SZPA 4EATA 2MGQA 3FK6A 2EK5A 1YW8A 4DBQA 4PFPA 4IHWA 5DTDA 3IH3A 5CVVA 2TDXA 2CUFA 2O03A 3TMOA 2Q2EB 4E7SA 4C2UA 2JPCA 3K69A 4BACA 2HEOA 1OCPA 4A0YA 2JA5J 3GFIA 2PLYA 3S15J 4G7HF 1MW7A 2GOXB 3HHGA 1U6GA 2OC6A 2JRMA 2NAZA 3S16J 3ABMH 4OMYA 2BXYA 4I7HA 2VODA 2KQRA 2ACJA 2GLOA 1J5YA 1F1ZA 1OYIA 1MNDA 2GBYA 2KIUA 5GAEJ 1X19A 1YRNB 2QSHX 2GIZA 3BG9A 4P9FA 1OR7A 1BR1A 4IKFA 1MMNA 2DYRH 3BR2A 5JLWA 4YIRX 2MC4A 3BR3A 4C2MJ 1FC3A 3ESWB 1LVKA 1ZN2A 4IXAA 1Z7LA 2HTSA 2X1EA 3HGGA 3I54A 3P9IA 3QPSA 3PUFA 5BOXA 3CCRI 1HCRA 3I3LA 1JKOC 1H9GA 1FBQA 3CJTB 3KE2A 1FBSA 5D5UB 4S05A 4ENMA 1Y39A 4B44A 2VBYA 2IGNA 5AONA 5BMZA 1T0FA 2OUMA 4D7MA 4M72A 5M5XJ 1VF9A 3K70C 3C2HA 1ITYA 2EA2A 3EDPA 3QYEA 4GYIA 2M0CA 2XKPA 1NHAA 3ABTA 1Z3YA 5ILSA 3QYBA 4PJMA 4YIFA 3E7LA 2V7FA 1MGTA 1Z6TA 4G6QA 1IRGA 5F64A 2DDAA 1Z0XA 4ZYHA 3TW7A 2X1CA 4F93B 2MSYA 1R49A 1J75A 1CQTA 1IO2A 2WY8Q 2V6CA 3E0JB 2TRTA 3G1OA 2BOLA 4LLNA 2V79A 5F27A 1YG2A 4UNOA 2I10A 3DXJF 1ZQ3P 2WB1A 5GAGJ 1SEUA 2EB7A 2IS1A 5EG0A 1BI2A 4IRHA 4WXDA 1HC8A 2XPWA 4AU7A 2E2IJ 4B43A 4AIJA 3EYIA 3BC8A 1ODDA 2XAJA 2QQAA 1LDJA 1R23A 1FOKA 2LNBA 3ZMVA 3AL0C 1LNWA 3E5QA 3LSKA 2EFPA 3NARA 1TQMA 4LB5A 2DMPA 2K85A 3DBLB 5JHFA 2PBIA 2CW8A 3GTGJ 2OU2A 2OF7A 3A01B 3HOYJ 3R61A 2R7VA 4BXUA 5FKMA 3MKYB 2M8EA 1YFHA 2VBXA 3FHNA 2RREA 2NYXA 1HW5A 2KJBA 5JFRA 5C44J 2CU7A 2FE3A 4RGRA 4U7DA 3KZIC 3KP2A 3L2UA 3MD2A 2MLGA 1DPRA 4E7LA 1XSXA 1QZYA 3CTAA 4KN7X 1WH7A 2L7ZA 3BG6A 3BG5A 2O8XA 2VJ5A 4NB5A 5FLMJ 2K4JA 5L3GA 5FD6A 3J7ZI 1S7EA 2E2HJ 2OD5A 3F8MA 3C18A 5B1BH 2FBIA 3P5JA 3C2GA 2CQXA 1I3AA 4Z2YA 2IBDA 2YU3A 3I71A 4UVAA 4OINF 1MH4A 1WH5A 4RGSA 3I56I 5F1RA 5K7FA 5D8LB 2Y0SN 2EFOA 3DTIA 4D5CA 2P5VA 2IGOA 2LK2A 2W4SA 1X2NA 1EKEA 2HOEA 3HRUA 3FM3A 5D4RA 2EIJH 5L3CA 4IZZA 1T39A 2DOAA 5E3LA 1JUPA 2F4IA 4HLYA 2JSPA 3CLOA 5BNGA 5A2QK 1B59A 4UVBA 2ESNA 1Z67A 5E1ZB 4YRVA 2L54A 5JR3A 4A3JJ 3LSMA 1NH3A 4B48A 4HF0A 5HOOA 2VQLA 1F43A 3HHHA 3Q9SA 1LFUP 1NTCA 4IOAF 2VE8A 3OS1A 2CH0A 3P9CA 3Q5FA 3LQQA 3H3VK 4EGYA 3QU3A 3SQNA 2E7WA 3RDIA 3JTGA 4A3GJ 1T6SA 3OYNA 2BXZA 1H9TA 1TWFJ 2QEXI 1DDNA 4BEHA 4DYQA 2XAHA 5LEKA 4PZJA 4RMNA 5BQTA 3GMEA 3B6CA 5IT9Z 3DLAA 5BS6A 3OL3A 3L7WA 3M1CA 5KHDA 5CPRB 5HLHA 2PJRA 4XN0A 5D5XB 3IRRA 4CZZA 2BZTA 1BJAA 2ZFWA 1OCZH 3PNVA 1HOMA 1BI1A 2DA6A 3IC7A 4KUMA 2NNNA 2OA4A 2HFHA 4A3LJ 4CCOA 2W7NA 2JA7J 1W0TA 3HJEA 1XDUA 3I58A 1ZLKA 4NNJA 5HNHA 2RNJA 3R60A 2LTPA 1FTTA 3KEYA 4B47A 1FMVA 2XGXA 1RUNA 3PUBA 1X1DA 3QPTA 4P9UA 4IJAA 2MABA 3FXJA 4LB6B 3S8PA 3Q3SA 2OQGA 2V4JC 3SHFA 5M5WJ 1V5EA 3OL4A 4UUTA 2NRAC 2VQGA 3MZ8A 3PL8A 1XTAA 3UKGA 4Q47A 4XSXF 3IV5A 3I59B 4V19K 2H27A 1DU6A 4UB8C 4HAMA 1FIPA 2CQQA 1W5TA 2HOTA 2HWVA 2IP2A 1K7AA 1A6IA 4EM0B 2WAEA 2KT0A 2M2EA 2K40A 2L9RA 5KAIC 3ZQQA 3S14J 4B3AA 1V54H 2F5VA 3GYHX 3MCZA 4XL9A 1HXDA 3FMQA 4KIBA 4DZPA 4ZH4F 2IS4A 5DCMA 3CUQB 2K86A 3I55I 5K5OA 1SMTA 2A6EF 4V2GA 1FSEA 5DD4A 1P92A 5FO5A 1USSA 4G6DA 1ETXA 3FDYA 3JRAA 4AIHA 1GDTA 1XC5A 3SZTA 4NQWA 2KRHA 5IYCJ 1GV5A 3HBLA 5ED4A 3RPUD 1I6XA 3KLOA 4CGZA 1W7PA 3Q0WA 2Q1ZB 4JBAA 4G7ZF 4AIDA 1KYZA 4CDGA 1MD0A 1B9MA 4F7ZA 2ZSHB 3KP6A 1XD7A 1F4KA 1UAAA 3PNTA 3LFKA 4A0XA 2H1LA 5HLGA 4TV7A 1SANA 3M8EA 2HZDA 4U87A 4XNFA 4S0HB 3HRMA 2ZMEB 2HPMA 4N4OB 3RQIA 5DV5A 2AQEA 3A0BC 1G3SA 1MBFA 4QLCU 1QHGA 1AU7A 2WC2A 3H92A 3E1SA 1JT6A 4XRFA 1MJAA 2E71A 2JTVA 5C4JJ 1TWHJ 2BGCA 1GVJA 3KEOA 3G6EI 2VC0A 1PYVA 5AIQA 1BA5A 4XN3A 1MNEA 2KLOA 2NVTJ 4BHPA 1X4OA 4HNUA 2WA0A 1EH6A 1I39A 3S1NJ 2GXGA 1KA8A 3JAMK 4HX8A 3S32A 4P5OA 2DMQA 1N77A 4OU0A 5E1WA 3BROA 3AG3H 3RKQA 1A04A 3N05A 4M9SA 3JSOA 3W3CA 2QZ8A 2MW8A 3IH4A 2JT1A 5IOZA 3ABUA 4KDPA 4DBRA 1ERDA 3W6JB 2HQNA 2XSDC 3CESA 3VYTB 3D5LA 2LRDA 3H3UA 2QQ9A 3CCUI 3H5AA 3WU0A 3I64A 1LDDA 3ONQA 1OFCX 1OJLA 3D5RC 4DNCA 3TBIA 1UG0A 2H8WA 3TEDA 4A6DA 2DT5A 1U3EM 3SEZA 1MJ9A 2YR2A 1S8NA 4NC7A 4BXFA 2P7VB 4DW6A 5GADJ 2AQFA 1XSVA 2WB1N 3VSLA 2LKXA 4LGWA 1K6OA 4WF2A 5LRSA 3HM5A 3L2CA 1W0UA 3D1NI 2HQRA 1FP1D 1BR4A 3ZMUA 3OR2C 4XM3A 4IX7A 4JX6A 1BC8C 1SAUA 1R4NB 3M07A 1B72B 3FIWA 3VPRA 1BJZA 2OAZA 1AKHB 3DTEA 3CUQC 2BBYA 2HDCA 2VJJA 3U1KA 1T8IA 2XAQA 5DCFA 2VXDA 2M7BA 1IDYA 1H8AC 4PDKA 4X0GA 4GO1A 1P4AA 2CUEA 1FMWA 1W36D 1L3LA 3BZ6A 4M9ZA 1MBKA 1XG1A 3NRVA 1Z1DA 4GRIA 1HSJA 4OAZA 3M8JA 4ITVA 3Q9VA 3CF5F 4IQJA 3M3YJ 5DYMA 5C3EJ 3HXLA 1VQOI
chains in the Genus database with same CATH topology
3GTOJ 3G1MA 4DYRA 5M5YJ 2YS9A 1MSEC 2COBA 3I4MJ 2M8GX 5F0CA 2VKEA 3HB9A 1JKQC 1MBHA 4AC0A 3A03A 1X58A 2L0KA 4MIMA 2DMUA 4XRSA 3S1RJ 1RESA 4A3FJ 1JKRC 1QVUA 1UHSA 2HI3A 1DU0A 3S1MJ 4MFDA 1T56A 4FISA 3O8HA 5E3MA 3RZOJ 1T33A 4FCYA 4W1UA 1B8IB 1O4XA 2O7OA 2R5ZA 4IHYA 2EZHA 4IHXA 2LD5A 2XPUA 3ZQIA 2ECBA 2KDZA 2NOGA 2Y2ZA 2O9LA 4BY7J 3JRHA 1BW5A 2DA4A 2TCTA 2R5ZB 4A3IJ 2NS7A 2LP0A 2W48A 3DCFA 1WI3A 2LR8A 1JKPC 4FE4A 5K7ZA 3LNQA 5K7HA 3BR1A 3BT9A 1TC3C 2B63J 2WAQN 1LFBA 1HF0A 2DMTA 2MGQA 3FK6A 3WHCA 1IG7A 1R9TJ 1MSFC 5DTDA 3IH3A 4MO7A 3CDLA 4IHWA 4BY1J 2CUFA 3IH2A 2DN0A 2EZKA 1OCPA 2JA5J 3S15J 1HDPA 5EZHA 1YRNA 1UG2A 3S16J 3ZQGA 3QPLA 2Y9YA 2GLOA 2GBYA 2QF7A 4NDLA 1Q1VA 1YRNB 3DEWA 4BBSJ 1ORKA 4FTHA 2R92J 2HOSA 1FTZA 1NK3P 1TWGJ 3BG9A 2NVYJ 4MLOA 4FE7A 3BR2A 5JLWA 3BR3A 5FJ8J 4C2MJ 1ENHA 3LSPA 4GFBA 2LY9A 3HGGA 1FIAA 3QPSA 1APLC 2YUSA 3HKZN 3LSJA 1HCRA 1JKOC 4JP0A 3O8GA 1QVTA 1H89C 4I76A 2XPVA 1U8BA 3G1LA 2DTZA 2HQ5A 4XICA 4D7MA 1ITYA 5M5XJ 1VF9A 3HEFA 2ME0A 2DA5A 4W97A 2M0CA 4M3BA 3E7LA 1MBEA 1P7JA 2JK3A 1ETVA 2K9QA 5IP9J 2R7ZJ 3BTJA 4AYBN 4RBOA 3HOWJ 3HGYA 1Z0XA 2AHQA 3SFIA 3TW7A 1A5JA 5F04A 2MSYA 2EBIA 1CQTA 4BXXJ 4A3KJ 2TRTA 3G1OA 3H0GJ 1WPKA 5F27A 2I10A 3HOVJ 3BTIA 4DYCA 1ZQ3P 3Q0UA 5EG0A 4A3DJ 4X6AJ 4JYKA 3GTPJ 2XPWA 3CCYA 2E2IJ 4XIDA 2EZLA 4L5EA 5EG0B 4D5FA 5IYDJ 2AO9A 5EYRA 1ZKGA 3GTKJ 1HLVA 3NARA 3A01A 2DMPA 3ZQCA 4UUSB 3JRIA 2Y30A 3RZDJ 3GTGJ 2OF7A 1U9NA 1MBGA 4XRSG 1IDZA 3A01B 3HOYJ 3GTQJ 2VPRA 3BTLA 5FKMA 3JRFA 3MN2A 2VUMJ 1GT0C 3OSFA 2JMWA 1E3OC 5C44J 1BL0A 2FD5A 2CU7A 2QCOA 1XS9A 5E3OA 3M4OJ 2VI6A 1WH7A 2LFBA 2L7ZA 1JTXA 5EDNA 1JJ6C 3BG5A 3BQZA 4M3GA 4M3DA 5EZGA 5FLMJ 4QTRA 2H1KA 1ZTRA 2E2HJ 1S7EA 2M9HA 5F0FA 2WV1A 5FKNA 3OOUA 1TWAJ 1IV6A 4A93J 4J19A 4C3JJ 1NK2P 2CQXA 3PO3J 2IBDA 2P81A 5EGOA 1U9OA 1MH4A 1WH5A 2PMZN 2K9SA 2LLKA 4V2FA 1ETKA 1GV2A 5F1JA 5K7FA 5EGOB 2HXOA 2NS8A 2Y0SN 2XGCA 4A3MJ 1ZR4A 4D5CA 3HOXJ 2DA7A 2LK2A 1ETQA 1X2NA 2ME6A 4IHVA 3L1PA 3F0CA 5E3LA 1JUPA 1MH3A 1F36A 5F08A 5BNGA 1I3QJ 3BG3A 4M3FA 4A3JJ 2JA8J 1JGGA 2NVQJ 5IPAA 1F43A 2CRGA 1LFUP 3S1QJ 1TWCJ 3K2AA 1NTCA 1IUFA 3HOUJ 4JX5A 3H3VK 3S2DJ 2EZIA 2Y9ZA 1GUUA 3GTMJ 1JUMA 5IP7J 2HDDA 2JJ7A 4A3GJ 4IEJA 4A3BJ 3W6VA 1Y1WJ 5IYBJ 2YU9J 1TWFJ 2RAEA 4AUXA 4DYQA 2EQRA 3K7AJ 3TP0A 9ANTA 5IP6A 3B6CA 1UMQA 2XB5A 3JRDA 2E2JJ 1ETOA 1JJ8C 2MG4A 1MBJA 3HDDA 1D5YA 3WHBA 1K83J 2E19A 2HXIA 2G0EA 2FJ1A 2K9NA 2ID3A 1HOMA 2DA6A 4QIWN 1X2MA 4A3LJ 1P7IA 3BR6A 3TP3A 2L7MP 2JA7J 1W0TA 1G2HA 1LE8A 2LTPA 2X9DA 1FTTA 4I6ZA 3S17J 1AKHA 1LE8B 5GPAA 3FKIJ 4G12A 4A3EJ 3CMYA 2FX0A 2GM4A 2R0QC 2D5VA 3Q3SA 2JA6J 5JLXA 2HOAA 5M5WJ 4Y52J 2XGEA 1BW6A 1MNMC 4UUTA 1VFCA 1ETWA 3UKGA 2VKVA 2DA1A 4XK4A 1VNDA 3IV5A 2FQ4A 2JWTA 5HODA 1DU6A 1FIPA 2CQQA 2EH3A 2HOTA 5F0HA 3MVPA 4LOCA 3CQZJ 1A6IA 3I4NJ 1U78A 2KT0A 2M2EA 2K40A 2ID6A 2L9RA 4C3IJ 3S14J 3Q0VA 4B3AA 3LSGA 3OSGA 2X48A 4DZPA 1IRZA 5IOYA 4XRMA 1QPIA 1GVDA 5J1UA 3ZQLA 2XB0X 1Y1VJ 4V2GA 1K61A 3TW6A 5GP9A 1I50J 1QRYA 4ABZA 1ETXA 3JRAA 2IEKA 1GDTA 1XC5A 3BR5A 2M34A 5IYCJ 1GV5A 3HBLA 4X1EA 1JUSA 5EEAA 4D7NA 1IJWC 3Q0WA 1B8IA 1EF4A 3BQYA 2H8RA 5GPCA 2IAIA 2LVSA 3SJMA 3A02A 1SANA 4S0HB 2ECCA 3RQIA 2DA2A 5J1YA 1SFOJ 5E3NA 1MBFA 1ZR2A 1AU7A 4M3EA 4BBRJ 1JT6A 1AHDP 2XRLA 2E1OA 1H88C 1HDDC 5C4JJ 1TWHJ 5FLVA 3JR9A 4A3CJ 2DA3A 1RR7A 1WGXA 4MFEA 4B4CA 5FKOA 2HYJA 5DS9A 3LOCA 1BA5A 3JRCA 1ZK8A 2L7FP 2NVTJ 5M3MJ 1IGNA 3S1NJ 2JN6A 2X6OA 2DMQA 5M3FJ 3ZQFA 3RKQA 4RDUA 3JREA 4CYCA 5FKKA 4HNVA 3JRBA 3IH4A 2MW8A 1RKWA 5IOZA 3ZOBA 1FJLA 4CYCB 2XSDC 2CJJA 1JT0A 3OIOA 4M6VA 5J3LA 3BTCA 1RETA 4DZJA 1ETYA 2NVXJ 2ELKA 1IC8A 1OFCX 1OJLA 4QSHA 3SDGA 3ZQHA 2O8KA 3HOZJ 2ZB9A 3C2BA 2R93J 4B1RA 2OPTA 1JTYA 3TEDA 3BR0A 4A69C 4EEFG 1ZGWA 4DW6A 2WB1N 3FISA 4C3HJ 2LKXA 3S2HJ 2Y31A 3HM5A 1W0UA 3D1NI 1B72A 5J1RA 3JRGA 3B6AA 1OCTC 3FK7A 3LSRA 4JX6A 5EF6A 3PM1A 1B72B 1WCMJ 3FIWA 1BJZA 3VPRA 2R5YA 1AKHB 5C4XJ 3NAUA 4Y7NJ 1H8AC 1IDYA 2R5YB 1Z77A 1PUFA 3PO2J 2CUEA 1POGA 4JX4A 2DMNA 1MBKA 3MKLA 1XG1A 1RPWA 4BKXA 1VI0A 1PUFB 2DJNA 3GTLJ 3GBGA 2XGDA 1FEXA 3M3YJ 3QQAA 2N8GA 5C3EJ 1RKTA 5FKLA 4UUSA 1I6HJ 3GTJJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO J;  3G1M A;  4DYR A;  5M5Y J;  2YS9 A;  1MSE C;  2COB A;  3I4M J;  2M8G X;  5F0C A;  2VKE A;  3HB9 A;  1JKQ C;  1MBH A;  4AC0 A;  3A03 A;  1X58 A;  2L0K A;  4MIM A;  2DMU A;  4XRS A;  3S1R J;  1RES A;  4A3F J;  1JKR C;  1QVU A;  1UHS A;  2HI3 A;  1DU0 A;  3S1M J;  4MFD A;  1T56 A;  4FIS A;  3O8H A;  5E3M A;  3RZO J;  1T33 A;  4FCY A;  4W1U A;  1B8I B;  1O4X A;  2O7O A;  2R5Z A;  4IHY A;  2EZH A;  4IHX A;  2LD5 A;  2XPU A;  3ZQI A;  2ECB A;  2KDZ A;  2NOG A;  2Y2Z A;  2O9L A;  4BY7 J;  3JRH A;  1BW5 A;  2DA4 A;  2TCT A;  2R5Z B;  4A3I J;  2NS7 A;  2LP0 A;  2W48 A;  3DCF A;  1WI3 A;  2LR8 A;  1JKP C;  4FE4 A;  5K7Z A;  3LNQ A;  5K7H A;  3BR1 A;  3BT9 A;  1TC3 C;  2B63 J;  2WAQ N;  1LFB A;  1HF0 A;  2DMT A;  2MGQ A;  3FK6 A;  3WHC A;  1IG7 A;  1R9T J;  1MSF C;  5DTD A;  3IH3 A;  4MO7 A;  3CDL A;  4IHW A;  4BY1 J;  2CUF A;  3IH2 A;  2DN0 A;  2EZK A;  1OCP A;  2JA5 J;  3S15 J;  1HDP A;  5EZH A;  1YRN A;  1UG2 A;  3S16 J;  3ZQG A;  3QPL A;  2Y9Y A;  2GLO A;  2GBY A;  2QF7 A;  4NDL A;  1Q1V A;  1YRN B;  3DEW A;  4BBS J;  1ORK A;  4FTH A;  2R92 J;  2HOS A;  1FTZ A;  1NK3 P;  1TWG J;  3BG9 A;  2NVY J;  4MLO A;  4FE7 A;  3BR2 A;  5JLW A;  3BR3 A;  5FJ8 J;  4C2M J;  1ENH A;  3LSP A;  4GFB A;  2LY9 A;  3HGG A;  1FIA A;  3QPS A;  1APL C;  2YUS A;  3HKZ N;  3LSJ A;  1HCR A;  1JKO C;  4JP0 A;  3O8G A;  1QVT A;  1H89 C;  4I76 A;  2XPV A;  1U8B A;  3G1L A;  2DTZ A;  2HQ5 A;  4XIC A;  4D7M A;  1ITY A;  5M5X J;  1VF9 A;  3HEF A;  2ME0 A;  2DA5 A;  4W97 A;  2M0C A;  4M3B A;  3E7L A;  1MBE A;  1P7J A;  2JK3 A;  1ETV A;  2K9Q A;  5IP9 J;  2R7Z J;  3BTJ A;  4AYB N;  4RBO A;  3HOW J;  3HGY A;  1Z0X A;  2AHQ A;  3SFI A;  3TW7 A;  1A5J A;  5F04 A;  2MSY A;  2EBI A;  1CQT A;  4BXX J;  4A3K J;  2TRT A;  3G1O A;  3H0G J;  1WPK A;  5F27 A;  2I10 A;  3HOV J;  3BTI A;  4DYC A;  1ZQ3 P;  3Q0U A;  5EG0 A;  4A3D J;  4X6A J;  4JYK A;  3GTP J;  2XPW A;  3CCY A;  2E2I J;  4XID A;  2EZL A;  4L5E A;  5EG0 B;  4D5F A;  5IYD J;  2AO9 A;  5EYR A;  1ZKG A;  3GTK J;  1HLV A;  3NAR A;  3A01 A;  2DMP A;  3ZQC A;  4UUS B;  3JRI A;  2Y30 A;  3RZD J;  3GTG J;  2OF7 A;  1U9N A;  1MBG A;  4XRS G;  1IDZ A;  3A01 B;  3HOY J;  3GTQ J;  2VPR A;  3BTL A;  5FKM A;  3JRF A;  3MN2 A;  2VUM J;  1GT0 C;  3OSF A;  2JMW A;  1E3O C;  5C44 J;  1BL0 A;  2FD5 A;  2CU7 A;  2QCO A;  1XS9 A;  5E3O A;  3M4O J;  2VI6 A;  1WH7 A;  2LFB A;  2L7Z A;  1JTX A;  5EDN A;  1JJ6 C;  3BG5 A;  3BQZ A;  4M3G A;  4M3D A;  5EZG A;  5FLM J;  4QTR A;  2H1K A;  1ZTR A;  2E2H J;  1S7E A;  2M9H A;  5F0F A;  2WV1 A;  5FKN A;  3OOU A;  1TWA J;  1IV6 A;  4A93 J;  4J19 A;  4C3J J;  1NK2 P;  2CQX A;  3PO3 J;  2IBD A;  2P81 A;  5EGO A;  1U9O A;  1MH4 A;  1WH5 A;  2PMZ N;  2K9S A;  2LLK A;  4V2F A;  1ETK A;  1GV2 A;  5F1J A;  5K7F A;  5EGO B;  2HXO A;  2NS8 A;  2Y0S N;  2XGC A;  4A3M J;  1ZR4 A;  4D5C A;  3HOX J;  2DA7 A;  2LK2 A;  1ETQ A;  1X2N A;  2ME6 A;  4IHV A;  3L1P A;  3F0C A;  5E3L A;  1JUP A;  1MH3 A;  1F36 A;  5F08 A;  5BNG A;  1I3Q J;  3BG3 A;  4M3F A;  4A3J J;  2JA8 J;  1JGG A;  2NVQ J;  5IPA A;  1F43 A;  2CRG A;  1LFU P;  3S1Q J;  1TWC J;  3K2A A;  1NTC A;  1IUF A;  3HOU J;  4JX5 A;  3H3V K;  3S2D J;  2EZI A;  2Y9Z A;  1GUU A;  3GTM J;  1JUM A;  5IP7 J;  2HDD A;  2JJ7 A;  4A3G J;  4IEJ A;  4A3B J;  3W6V A;  1Y1W J;  5IYB J;  2YU9 J;  1TWF J;  2RAE A;  4AUX A;  4DYQ A;  2EQR A;  3K7A J;  3TP0 A;  9ANT A;  5IP6 A;  3B6C A;  1UMQ A;  2XB5 A;  3JRD A;  2E2J J;  1ETO A;  1JJ8 C;  2MG4 A;  1MBJ A;  3HDD A;  1D5Y A;  3WHB A;  1K83 J;  2E19 A;  2HXI A;  2G0E A;  2FJ1 A;  2K9N A;  2ID3 A;  1HOM A;  2DA6 A;  4QIW N;  1X2M A;  4A3L J;  1P7I A;  3BR6 A;  3TP3 A;  2L7M P;  2JA7 J;  1W0T A;  1G2H A;  1LE8 A;  2LTP A;  2X9D A;  1FTT A;  4I6Z A;  3S17 J;  1AKH A;  1LE8 B;  5GPA A;  3FKI J;  4G12 A;  4A3E J;  3CMY A;  2FX0 A;  2GM4 A;  2R0Q C;  2D5V A;  3Q3S A;  2JA6 J;  5JLX A;  2HOA A;  5M5W J;  4Y52 J;  2XGE A;  1BW6 A;  1MNM C;  4UUT A;  1VFC A;  1ETW A;  3UKG A;  2VKV A;  2DA1 A;  4XK4 A;  1VND A;  3IV5 A;  2FQ4 A;  2JWT A;  5HOD A;  1DU6 A;  1FIP A;  2CQQ A;  2EH3 A;  2HOT A;  5F0H A;  3MVP A;  4LOC A;  3CQZ J;  1A6I A;  3I4N J;  1U78 A;  2KT0 A;  2M2E A;  2K40 A;  2ID6 A;  2L9R A;  4C3I J;  3S14 J;  3Q0V A;  4B3A A;  3LSG A;  3OSG A;  2X48 A;  4DZP A;  1IRZ A;  5IOY A;  4XRM A;  1QPI A;  1GVD A;  5J1U A;  3ZQL A;  2XB0 X;  1Y1V J;  4V2G A;  1K61 A;  3TW6 A;  5GP9 A;  1I50 J;  1QRY A;  4ABZ A;  1ETX A;  3JRA A;  2IEK A;  1GDT A;  1XC5 A;  3BR5 A;  2M34 A;  5IYC J;  1GV5 A;  3HBL A;  4X1E A;  1JUS A;  5EEA A;  4D7N A;  1IJW C;  3Q0W A;  1B8I A;  1EF4 A;  3BQY A;  2H8R A;  5GPC A;  2IAI A;  2LVS A;  3SJM A;  3A02 A;  1SAN A;  4S0H B;  2ECC A;  3RQI A;  2DA2 A;  5J1Y A;  1SFO J;  5E3N A;  1MBF A;  1ZR2 A;  1AU7 A;  4M3E A;  4BBR J;  1JT6 A;  1AHD P;  2XRL A;  2E1O A;  1H88 C;  1HDD C;  5C4J J;  1TWH J;  5FLV A;  3JR9 A;  4A3C J;  2DA3 A;  1RR7 A;  1WGX A;  4MFE A;  4B4C A;  5FKO A;  2HYJ A;  5DS9 A;  3LOC A;  1BA5 A;  3JRC A;  1ZK8 A;  2L7F P;  2NVT J;  5M3M J;  1IGN A;  3S1N J;  2JN6 A;  2X6O A;  2DMQ A;  5M3F J;  3ZQF A;  3RKQ A;  4RDU A;  3JRE A;  4CYC A;  5FKK A;  4HNV A;  3JRB A;  3IH4 A;  2MW8 A;  1RKW A;  5IOZ A;  3ZOB A;  1FJL A;  4CYC B;  2XSD C;  2CJJ A;  1JT0 A;  3OIO A;  4M6V A;  5J3L A;  3BTC A;  1RET A;  4DZJ A;  1ETY A;  2NVX J;  2ELK A;  1IC8 A;  1OFC X;  1OJL A;  4QSH A;  3SDG A;  3ZQH A;  2O8K A;  3HOZ J;  2ZB9 A;  3C2B A;  2R93 J;  4B1R A;  2OPT A;  1JTY A;  3TED A;  3BR0 A;  4A69 C;  4EEF G;  1ZGW A;  4DW6 A;  2WB1 N;  3FIS A;  4C3H J;  2LKX A;  3S2H J;  2Y31 A;  3HM5 A;  1W0U A;  3D1N I;  1B72 A;  5J1R A;  3JRG A;  3B6A A;  1OCT C;  3FK7 A;  3LSR A;  4JX6 A;  5EF6 A;  3PM1 A;  1B72 B;  1WCM J;  3FIW A;  1BJZ A;  3VPR A;  2R5Y A;  1AKH B;  5C4X J;  3NAU A;  4Y7N J;  1H8A C;  1IDY A;  2R5Y B;  1Z77 A;  1PUF A;  3PO2 J;  2CUE A;  1POG A;  4JX4 A;  2DMN A;  1MBK A;  3MKL A;  1XG1 A;  1RPW A;  4BKX A;  1VI0 A;  1PUF B;  2DJN A;  3GTL J;  3GBG A;  2XGD A;  1FEX A;  3M3Y J;  3QQA A;  2N8G A;  5C3E J;  1RKT A;  5FKL A;  4UUS A;  1I6H J;  3GTJ J; 
#chains in the Genus database with same CATH topology
 4DYR A;  4RB2 C;  1V3F A;  2OZ6 A;  2COB A;  4L9T A;  2CW7 A;  4HRI A;  5HLI A;  3BDD A;  2FBH A;  2DOF A;  1X1B A;  2E34 A;  2ZME C;  3GLL A;  4Y15 A;  2FOW A;  1UHW A;  3V42 A;  1YS7 A;  3OYA A;  1X58 A;  1VQ5 I;  3K10 A;  3QWL A;  2J5O A;  5ICC A;  2RQP A;  2XV4 S;  1QVU A;  3F6V A;  2LBF B;  4KFC A;  2O3F A;  3KZZ A;  2BHY A;  4FIS A;  4CIC A;  2XHK A;  2D1H A;  5KVR A;  3RZO J;  2HR3 A;  5DD8 A;  2XVC A;  3MEX A;  4FHT A;  1T33 A;  4S04 A;  5LD2 C;  2BYV E;  1WJD A;  5LEJ A;  2MBF A;  3VYS B;  4LG0 B;  4IHY A;  3RYP A;  3OYC A;  2LD5 A;  3ZQI A;  4HZF A;  2IVM A;  4M6Y A;  2O9L A;  3CDI A;  2Z16 A;  4R8H A;  3HTS B;  1Y0N A;  3C3W A;  3D5S C;  2R5Z B;  2E60 A;  2EWN A;  2QQ8 A;  4A3I J;  2NS7 A;  2W48 A;  1I1S A;  3DCF A;  2W25 A;  4YEJ A;  1JKP C;  1Z3X A;  3R0J A;  4FE4 A;  1W1W E;  2BY3 A;  2RGV A;  3I9V 2;  3K1M A;  5K7Z A;  2B9S A;  4HOB A;  3CMA I;  1LPQ A;  4II3 A;  4O5V A;  3AG1 H;  4NUB A;  3E5X A;  3K1N A;  4Z6Y A;  1OCC H;  4RM3 A;  3ERM A;  3ISP A;  1R9T J;  1J09 A;  4HQM A;  3JW4 A;  2WAF A;  3VYR B;  3CCQ I;  2QEN A;  3IH2 A;  3DU5 A;  4LIV A;  3U21 A;  2DLL A;  4LJZ F;  3J81 K;  2Y0S A;  3FMS A;  4DIQ A;  1NG6 A;  1OKR A;  5LFA A;  2HQA A;  2CQN A;  4BE1 A;  4YFX F;  2R7O A;  1KZH A;  2P0W A;  2K4B A;  4BBS J;  3DEW A;  3QP6 A;  4MHG A;  5B66 C;  3WG7 H;  1TWG J;  3NWS A;  3I0T A;  2BY0 A;  4FE7 A;  2D45 A;  2KIM A;  4GFB A;  1VQ8 I;  5FRM A;  5ILU A;  1QU3 A;  3DPL C;  1FIA A;  3E97 A;  3MWM A;  2L9N A;  2YUS A;  3V7S A;  4JP0 A;  3QAH A;  4ESB A;  1J0R A;  4XOP A;  3TGN A;  4MNU A;  3BJO A;  3W6K B;  3DBH B;  2DDB A;  3BJ6 A;  1OIS A;  3K9T A;  2HQ5 A;  3CJQ B;  3ZCO A;  3T5X A;  4UY8 I;  3M7G A;  4HPQ A;  4W97 A;  3NEU A;  1J2X A;  3LA3 A;  4F91 B;  2DU9 A;  2KMU A;  4K2E A;  5A2Q Z;  1XDS A;  2HDW A;  5IP9 J;  2R7Z J;  4N9I A;  5KK1 A;  3WG9 A;  1TQP A;  3HOW J;  4BJ5 C;  2MLK A;  3SFI A;  2Y75 A;  5F04 A;  2CQK A;  2KZV A;  3HC7 A;  4E7Z A;  3HOV J;  4BU2 A;  1DP3 A;  4DYC A;  2UXX A;  5HS7 A;  3LWF A;  1TNT A;  1OPC A;  4JYK A;  1T08 B;  4ENJ A;  3S3N A;  4UUV A;  1QQI A;  4PCQ A;  4Y33 A;  2UUZ A;  2EZL A;  2W84 A;  3OYD A;  3R6S A;  4R1H A;  1A36 A;  1Y8R B;  2R7X A;  1ZKG A;  1U2W A;  3FXU A;  3GTK J;  1XGN A;  3ZRG A;  3E6B A;  3GX4 X;  4UUS B;  1FOW A;  3RZD J;  1J59 A;  3DTK A;  3VYU B;  2VBW A;  4BJ6 C;  3GTQ J;  3KFW X;  1K4T A;  2VPR A;  3GWZ A;  1FOY A;  1TT5 B;  2L3D A;  3ECH A;  4KYW A;  4BL0 B;  3CUQ A;  3OYL A;  2JMW A;  2Q0O A;  4E7K A;  2VXZ A;  1E3O C;  3RJP A;  2H94 A;  2EIL H;  2FD5 A;  4GGG A;  1SVO A;  5FLX K;  2FMY A;  2DPU A;  3BCB A;  2P5K A;  1Y6I A;  2R7D A;  3M4O J;  2Z5U A;  4I99 C;  3ZQ7 A;  1OQY A;  1PDN C;  3T0Y A;  2VKD A;  1JJ6 C;  3K2Z A;  2KDO A;  4C30 A;  3L2Q A;  2V1N A;  4M3G A;  4M3D A;  1FYL A;  4L0Y B;  2DI3 A;  3HTU A;  3DV8 A;  4JOM A;  5CYV A;  5FKN A;  1MMD A;  5CKT A;  2ZC2 A;  4C3J J;  1NK2 P;  3PO3 J;  5EGO A;  1R5G A;  1DQU A;  1U9O A;  2FBK A;  2R7W A;  1U8R A;  3KLN A;  2IPQ X;  2EA4 A;  2LLK A;  1HBX G;  3K4B A;  3ZMT A;  1MDM B;  1U5T B;  1WHU A;  2ISY A;  5F1J A;  2Y0M A;  2OZU A;  4KT5 C;  2HXO A;  4KN4 X;  2GXA A;  3K4L A;  2P6S A;  2XGC A;  5K5R A;  2JUG A;  2LC2 A;  4M71 A;  5J8C A;  3IAS 2;  2ME6 A;  1ETQ A;  3TQN A;  4CCK A;  4IHV A;  4CCL A;  1Z05 A;  4HX7 A;  2ZXH A;  1V55 H;  2GA1 A;  2LG4 A;  5F08 A;  1D0X A;  3U9G A;  4HEA 2;  2OBP A;  2WV0 A;  1I3Q J;  1CGP A;  2OCC H;  3J7Y J;  4EQQ A;  5B5E C;  5FGM A;  2Z9O A;  1DUX C;  1JGG A;  3W2V A;  1XSD A;  2G7H A;  3P9K A;  3JCU C;  1K4S A;  1KU9 A;  3V4G A;  3HOU J;  2K5C A;  3GFM A;  1YYV A;  3S2D J;  5CVJ A;  1PP8 F;  3QYF A;  3OYH A;  2EZI A;  2OJE D;  1FNN A;  4QWQ A;  1GUU A;  3GTM J;  1G3Y A;  1JUM A;  5IP7 J;  1ZLJ A;  4HDU A;  2JJ7 A;  2NOJ B;  3SDB A;  4PK4 A;  4A3B J;  2HKX A;  1Y1W J;  4EJU A;  2ZJQ F;  4RAZ A;  3DWL E;  2QBY A;  4MQ9 F;  4AUX A;  3GW2 A;  1SC7 A;  3K7A J;  9ANT A;  3KP5 A;  4M6X A;  5D5W B;  3CCS I;  4G8X A;  3KZY A;  3F72 A;  3PFY A;  3HUG B;  1BR2 A;  4LFU A;  1MIJ A;  2FRH A;  1D1C A;  2HTJ A;  1K78 B;  1ULY A;  2FNA A;  4FT8 A;  4NC6 A;  2G0E A;  3AKZ A;  4N4N B;  2PMU A;  3FKJ A;  3VFZ A;  4CZC A;  4QIW N;  3TP3 A;  4H4K C;  2L7M P;  4OWR B;  1LE8 A;  3HKZ A;  2X9D A;  3FBI B;  1ON2 A;  2PG4 A;  1T2K A;  3BOQ A;  2CV0 A;  3VDX A;  3S17 J;  1U0J A;  2HPI A;  1AKH A;  3JAM Z;  3K6G A;  3ZN0 A;  2ZBK A;  1G3T A;  2GM4 A;  2HNH A;  1FBU A;  1B1B A;  3HPH A;  3DEU A;  2VJI A;  5AIP A;  3HRS A;  2HOA A;  4Y52 J;  5J4V A;  1A6Q A;  5LGU A;  1PP7 U;  5D6F A;  1ETW A;  1D0Z A;  4LLG F;  4MEY F;  1C0W A;  3DF8 A;  4E70 A;  5LRR A;  1VQ9 I;  3FM5 A;  1QZZ A;  4ESJ A;  2GQQ A;  1VND A;  3H9J A;  4XK4 A;  2FQ4 A;  4M9X A;  3NWT A;  2FUG 2;  4KIT B;  3CQZ J;  2D1V A;  5L3E A;  2ZXI A;  2R7U A;  4UB6 C;  3LSG A;  3OSG A;  4XKV A;  1U5T C;  2XKO A;  2QWW A;  2X48 A;  3I4P A;  2A69 F;  3V8J A;  2LDU A;  5IOY A;  1KGS A;  4XRM A;  1QPI A;  1GVD A;  1BN5 A;  4JK1 X;  2QGU A;  3TW6 A;  1F5T A;  3K4K A;  1QRY A;  3OYB A;  1YO5 C;  2KIF A;  4CHU A;  1ZYR F;  1LKX A;  1TW2 A;  1SVM A;  4LK1 F;  2G7U A;  1JUS A;  3LSH A;  3UNG C;  1X1A A;  2OQR A;  3CF2 A;  1EF4 A;  4ZTJ A;  4Q4Z F;  5GPC A;  4IPA A;  3FXQ A;  1HST A;  1BIB A;  2O5R A;  1S5L C;  3HOS A;  1G6N A;  1XGM A;  3BPV A;  3S3M A;  1FYK A;  2ZXW H;  4ZYA A;  3F8B A;  3HYI A;  2VT3 A;  1YQA A;  4BBR J;  2XRL A;  1VQ7 I;  2KKO A;  1FWZ A;  2E1O A;  1HDD C;  2A68 F;  2CQ7 A;  2E7X A;  2V9K A;  4BH9 A;  1SFE A;  2DA3 A;  1P2F A;  3C1D A;  1WGX A;  5DUI A;  2Z2S B;  4UV8 A;  2M87 A;  3HSR A;  3F22 A;  2K27 A;  2MH9 A;  2K7L A;  4PJN A;  1B9N A;  3JRC A;  4ZYE A;  1R1V A;  1ZK8 A;  2L7F P;  2VKH A;  2X6W A;  5ICE A;  5M3M J;  3JTH A;  2X6O A;  2BW3 B;  3E6D A;  2RVC A;  1W36 C;  1AWC A;  1IXR C;  4B8X A;  4RDU A;  1X1P A;  3AG4 H;  1WVR A;  1ZGJ A;  3JRB A;  5E8I A;  3ROU A;  2F48 A;  2EIN H;  3TDU C;  4YFK F;  3ZOB A;  4CYC B;  1LFP A;  1LB2 A;  3OIO A;  4U0Y A;  2OV7 A;  5J3L A;  2PFB A;  1RET A;  1XGS A;  3VSK A;  2RN7 A;  1X3W B;  1VQN I;  2ELK A;  1IC8 A;  3PQK A;  4G9Y A;  1WJB A;  3SDG A;  2XAU A;  2DAO A;  2ZB9 A;  3HOZ J;  2OPT A;  3IAM 2;  3S3O A;  3BR0 A;  2RQQ A;  1OLT A;  3FXO A;  4JQF A;  1V4R A;  4ZYG A;  1O57 A;  1ZGW A;  1JHH A;  2A5Y B;  3F8F A;  2HVQ A;  1DGW Y;  4PJJ A;  4C3H J;  4PGG A;  4F92 B;  3CZ6 A;  4WXC A;  4EGZ A;  1OCT C;  3FK7 A;  3J81 Z;  1LJ9 A;  1UFM A;  3LSR A;  1ZEL A;  5FRN A;  3PM1 A;  2XUB A;  2R5Y A;  3BG7 A;  1SFK A;  4XLF A;  1LDK B;  1MJB A;  3OS0 A;  5C4X J;  2CMP A;  2RDP A;  1TT0 A;  4XLC A;  4Y7N J;  1Z7U A;  2H6B A;  2XRN A;  3DQV C;  5L3F A;  3SZG A;  1PUF A;  2LF7 A;  3ZGK A;  2JSC A;  3PO2 J;  4Y4R A;  1ON1 A;  1O7L A;  3FXM A;  4MTD A;  2Z99 A;  5ILV A;  1RR8 C;  2BV6 A;  4L5J A;  5BPI A;  3OYM A;  1ACI A;  5HDG A;  4H0E A;  5E79 C;  1RPW A;  4BKX A;  1VI0 A;  3FF5 A;  4L5I A;  1UST A;  2GWR A;  4FET A;  1T98 A;  1FEX A;  1UZC A;  3ECO A;  2I5U A;  2X6X A;  1RKT A;  2K9L A;  5B1A H;  4OIP F;  4I0B A;  4ZDL A;  4UUS A;  3GTJ J;  3GTO J;  3G1M A;  5M5Y J;  3RKX A;  2IJL A;  3B02 A;  3KYD B;  2YS9 A;  2A6H F;  4FAS D;  4II2 A;  3L2W A;  4RGU A;  3UR3 C;  5CVI A;  2OTJ I;  1KON A;  1IN8 A;  2VKE A;  3HB9 A;  5L3D A;  4HX4 A;  1JKQ C;  3WTU C;  3HIF A;  1I5Z A;  1TP4 A;  1S7A A;  1Y56 A;  4YFN F;  4L9J A;  2XAG A;  4IVN A;  1KQ9 A;  2FEZ A;  2Z3Y A;  3GLX A;  3S1M J;  4MFD A;  5D5V B;  5E3M A;  2B7E A;  4J01 A;  5FFZ A;  3KP3 A;  2A61 A;  3KP4 A;  1XN7 A;  1X3U A;  3F8N A;  4W1U A;  4UV9 A;  2R3S A;  2O7O A;  1O4X A;  1B8I B;  2ELH A;  4P55 A;  2XPU A;  1SD7 A;  4RS8 A;  2KDZ A;  3AFH A;  2NOG A;  2O6G E;  2UWM A;  4BGD A;  2DA4 A;  3RCO A;  2TCT A;  1IRX A;  2DJI A;  2ZNY A;  2OCE A;  3TDZ C;  5FRO A;  1P6R A;  3FXL A;  1FT9 A;  2XC7 A;  4XBF A;  1ZRF A;  3BT9 A;  3BWG A;  4NBQ A;  2B63 J;  5DM7 F;  2Q2E A;  3I53 A;  1IF1 A;  1IG7 A;  1W7P D;  2ZNZ A;  1XCV A;  4MO7 A;  3CDL A;  4RA2 A;  2LOO A;  1CF7 B;  3SXY A;  2EZK A;  3HSF A;  4O6J A;  2PEX A;  4LLL A;  2V26 A;  5EZH A;  2L9V A;  1YRN A;  1R22 A;  3VWB A;  5FLX Z;  2DOE A;  2L5Q A;  3RKW A;  4A12 A;  1UB9 A;  2VON A;  2CYY A;  1Q1V A;  2R92 J;  2HOS A;  1NK3 P;  1HKS A;  4MLO A;  2NVU B;  2EIK H;  1D3Y A;  3F8C A;  2XSJ C;  1OCO H;  1ONV A;  2F5E A;  3V7R A;  4EJO A;  5FB2 A;  1WRJ A;  2VE9 A;  2E35 A;  3OR1 C;  3HKZ N;  3LSJ A;  1WZ2 A;  3EUH C;  2DW4 A;  5LGT A;  4DOZ A;  2GZW A;  4I76 A;  2DFF A;  4HYE A;  5HDN A;  2M1B A;  3HUG A;  1YJ9 I;  2XPV A;  1D8J A;  1U8B A;  1J7K A;  2DTZ A;  1D1A A;  4A2U A;  4RB3 C;  3HEF A;  2DT6 A;  4FX0 A;  2ME0 A;  1B6A A;  2DA5 A;  4BQO A;  2JZY A;  2F4O B;  3H9Q A;  5D4S A;  4OIQ F;  2ZSI B;  2QSF X;  1P7J A;  2JK3 A;  2K9Q A;  2KHM A;  4RBO A;  1BOA A;  2LYC A;  2IA0 A;  4OIR F;  2AHQ A;  4YEL A;  4BS9 A;  2VL8 A;  1A5J A;  1ZGA A;  2EBI A;  5HS9 A;  4I0A A;  1H0M A;  4BXX J;  5LHI A;  4GCV A;  1YOV B;  4A3K J;  1YHQ I;  4WK8 F;  2F2E A;  1O3Q A;  1WPK A;  2DCE A;  2VAS A;  1Z91 A;  1LQ1 A;  2HYG D;  5LHH A;  2KFD A;  4U88 A;  3Q0U A;  1KQ8 A;  3ERE D;  3K0L A;  4HV6 A;  4A3D J;  3GTP J;  1Z6R A;  3MQ0 A;  5CVR A;  3GEZ A;  4BUP A;  4RLQ A;  4L5E A;  3CDH A;  4Y17 A;  1EH7 A;  5EG0 B;  2XF6 A;  4D5F A;  5IYD J;  1HLV A;  3A01 A;  1JI8 A;  4IRI A;  1S6L A;  1MZB A;  2X6Y A;  3LA2 A;  4M74 A;  3JRI A;  2Y30 A;  2M5W A;  5CVU A;  2FNP A;  1U9N A;  4XOR A;  1IAW A;  1IDZ A;  3AAF A;  4BDZ A;  1KU3 A;  3MN2 A;  2VUM J;  4BJT A;  1IUY A;  3OSF A;  4OAY A;  3WTY C;  2DK8 A;  3ZN1 A;  1DP7 P;  4RAY A;  1BL0 A;  5H6Q A;  2QCO A;  2XIG A;  2YX4 A;  2BEO A;  1XS9 A;  3CC2 I;  1BIA A;  4XQF A;  5E3O A;  2P5L C;  2MFZ A;  2WAD A;  3TO9 A;  1LVA A;  4G94 A;  2PMH A;  2DFI A;  4XON A;  2R7F A;  5EDN A;  2CV2 A;  1ZTR A;  4U0V A;  2M9H A;  1YJW I;  2WV1 A;  3GXO A;  5J40 A;  5FFX A;  3OOU A;  1TWA J;  3GO5 A;  4IOC F;  1IV6 A;  4J19 A;  1X3Z B;  4XR6 A;  2FU4 A;  4EJT A;  3OOP A;  2PMZ N;  1X4P A;  4KMF A;  1FOX A;  4V2F A;  5CQG A;  2JQ7 A;  1GV2 A;  3H5N A;  2WWY A;  4XLP F;  5K5Q A;  4UVC A;  1ZR4 A;  4LIT A;  3HOX J;  5IT9 K;  2MD0 A;  1OR7 C;  2DA7 A;  4CYD A;  3DKX A;  1B4A A;  3L1P A;  3F0C A;  2AXL A;  3G2B A;  4EMS A;  3CCV I;  1MH3 A;  3CCM I;  1F36 A;  2E1N A;  2W00 A;  3ASN H;  2VN2 A;  1YW9 A;  2NNY A;  4N9H A;  2LKP A;  3IWF A;  4ASN A;  4KIS A;  5D6E A;  4M3F A;  2HVS A;  1ZHF A;  2FSW A;  1ZG1 A;  2NVQ J;  1VQM I;  4EV0 A;  5TGT A;  2CRG A;  3D0S A;  4PFO A;  5EJC A;  3S1Q J;  2CO5 A;  3QPH A;  2ZO4 A;  2LF8 A;  1T0F C;  4KIF A;  2YPR A;  4U0W A;  2VLA A;  2BW3 A;  4JX5 A;  3MMY B;  1TQI A;  2WAQ A;  1XPX A;  3A2K A;  1TNS A;  1OMI A;  2PQ8 A;  3LST A;  3J80 K;  1XB4 A;  1YIT I;  1V5F A;  2CW0 F;  4F3Q A;  4XKC A;  3K1P A;  3GVA A;  2MC3 A;  2M4G A;  3ZPL A;  2PN6 A;  2QYO A;  1N25 A;  5IYB J;  3GCM A;  2YU9 J;  4KIG A;  3WTV C;  1QGP A;  4XLN F;  4BHC A;  2AXT C;  4B09 A;  2EQR A;  1E0E A;  3TP0 A;  1RIO H;  4CH7 A;  1UMQ A;  4LG3 A;  4LMY A;  2E2J J;  1ETO A;  2FOK A;  4A0Z A;  1QHH D;  3HDD A;  3CME I;  1TZL A;  2A5W A;  2K02 A;  1D5Y A;  1P4W A;  6PAX A;  1K83 J;  2E1M B;  2E19 A;  2HXI A;  2FJ1 A;  2K9N A;  1D8K A;  1JHF A;  2DFH A;  1YTY A;  2CSO A;  2PJR B;  3PIO F;  1X2M A;  1RI7 A;  4E7J A;  1QZE A;  4EJW A;  1G2H A;  1R5H A;  4PJ0 C;  2B0L A;  3ULQ B;  1ZRE A;  3JSP A;  2M30 A;  2E5N A;  2ZFU A;  3A4C A;  3FKI J;  2DXI A;  3PSI A;  3J7A Y;  3CMY A;  2FX0 A;  3M9A A;  1LEA A;  1XMK A;  5F6F A;  4BNC A;  1TTY A;  2DK5 A;  1YX3 A;  3EUH A;  2VC1 A;  2JA6 J;  3DKY A;  2M3A A;  2QM3 A;  3H9G A;  5JLX A;  3K4M A;  3U1D A;  1VZ0 A;  4UHT A;  3I59 A;  1VQK I;  2XGE A;  3DBR B;  1YX5 A;  4WX9 A;  3TL4 X;  2UZK A;  2EJR A;  1MMG A;  1EV7 A;  4HA8 A;  2WTE A;  4AM3 A;  1RZ4 A;  2IA1 A;  2JWT A;  5HOD A;  3L2V A;  4XLE A;  3MVP A;  5F0H A;  4KNY A;  3IKT A;  3I4N J;  1BI3 A;  4CA0 A;  5ERI A;  3T8T A;  2KPM A;  2A05 A;  2ID6 A;  4C3I J;  4BE0 A;  4ZTF A;  4E7H A;  2P7C B;  2R7R A;  2EFN A;  4MQV A;  3MFK A;  1YIO A;  2VQC A;  1YLF A;  1IRZ A;  3KP7 A;  5DM6 F;  3ZQL A;  3VOE A;  5CLS A;  4AD9 A;  2IS6 A;  2XB0 X;  4KIC A;  1Y1V J;  4LIU A;  4L0Z B;  2DBB A;  3QOE A;  3ZP5 A;  2BY2 A;  5DCM B;  1YJN I;  3EET A;  2ZXJ A;  3PSF A;  4X1E A;  1PJR A;  1R4M B;  3MKZ A;  1ZRD A;  1QA6 A;  5IT3 A;  1O7F A;  3WTS C;  2QUF A;  1B8I A;  1R5I D;  3EUA A;  4CCJ A;  4DGW B;  1XGO A;  3BQY A;  5LHG A;  2OTL I;  1ZG5 A;  4RAG A;  1SD5 A;  1W7P B;  3PNY A;  2UV1 A;  2ZME A;  3H1C A;  1K79 A;  2H8R A;  2K3P A;  2IAI A;  2LVS A;  3OIP A;  3T1B A;  2WBM A;  1GHC A;  3FXR A;  5JI6 A;  2E5Z A;  2XRO A;  2ECC A;  4FQG A;  4RB0 A;  4EVI A;  4BHB A;  2DA2 A;  5J1Y A;  2BVL A;  1ZR2 A;  4M3E A;  3V8L A;  2CV1 A;  3BJA A;  2LRE A;  5HS8 A;  5K1Y A;  3HL2 A;  4ZDO A;  3CP8 A;  1D1B A;  4P1W A;  4RB1 A;  4HST A;  1QBJ A;  3JR9 A;  1VQ6 I;  1G4D A;  3RSN A;  4A3C J;  2R7T A;  4CSW A;  1SFX A;  3ZMS A;  4I09 A;  1RR7 A;  4HSR A;  1CF7 A;  1MKM A;  4MFE A;  3WE2 A;  4AVP A;  3COA C;  4B4C A;  5FKO A;  2KIQ A;  3C7J A;  3GZ6 A;  2W1O A;  3RTR A;  3LOC A;  2E1M C;  1Y0U A;  2I8D A;  4FX4 A;  1IGN A;  2JN6 A;  3BY6 A;  3FBN B;  3BZC A;  3ZQF A;  1SD6 A;  1E17 A;  1G59 A;  3LL7 A;  3NQO A;  4L18 B;  2Z33 A;  4XLH A;  1JGS A;  3A1Y A;  5LLQ A;  1RKW A;  4BAY A;  2ZKZ A;  3SEQ A;  2W57 A;  1A35 A;  2CJJ A;  4L9N A;  4BQN A;  1JT0 A;  4M6V A;  2HVR A;  5LBQ A;  5KAF C;  4DZJ A;  3VEP A;  1KU7 A;  2NVX J;  1IN7 A;  1S3J A;  3HG9 A;  3W2W A;  4QSH A;  3E6C C;  2FML A;  3ZQH A;  4I98 B;  3WTZ A;  5CQE A;  4Y13 A;  3C2B A;  4B1R A;  2DO7 A;  2M7A A;  2P8T A;  4A69 C;  4HF2 A;  3HSE A;  3N4M A;  2X51 A;  2R4G A;  1P4X A;  2GOM A;  3S2H J;  2C6Y A;  2MD5 A;  3OMY A;  5JHU A;  2RC4 A;  1B72 A;  5J1R A;  1I1G A;  2RKH A;  3B6A A;  3DP7 A;  1JXS A;  1IN4 A;  1VQL I;  5EF6 A;  3CMM A;  3PJR A;  3R0A A;  1WCM J;  2IGK A;  1E3P A;  2ZJR F;  1N78 A;  3IRQ A;  4ZZD A;  2HS5 A;  1OYW A;  2L01 A;  4E6K G;  2MH2 A;  1Z77 A;  1ZH5 A;  3BZK A;  2L2O A;  2WY7 Q;  4WCG A;  1BI0 A;  1POG A;  4JX4 A;  3ZR8 X;  1O3R A;  4ETS A;  2DMN A;  3X2Q H;  3MKL A;  4PSW A;  2HU9 A;  1Z9C A;  4M73 A;  2VIX A;  4GXO A;  1O3T A;  2V1U A;  2ICW G;  3GTL J;  3ASO H;  1E3H A;  2XGD A;  3B73 A;  3QQA A;  2N8G A;  2NXN B;  2P4W A;  4RM2 A;  4IQ4 A;  2CUJ A;  4MEX F;  5DEQ A;  3AG2 H;  2P6T A;  2LY2 A;  1MSE C;  2EIM H;  3I4M J;  2M8G X;  1JE8 A;  1M1E B;  2X0L A;  4CXF A;  2BVM A;  3FXK A;  2K9M A;  2E1C A;  3OIQ A;  2E36 A;  4AC0 A;  2LBF A;  3A03 A;  2L0K A;  5TRD A;  1O3S A;  4ZYD A;  1RES A;  2HI3 A;  1DU0 A;  4XOT A;  3F3X A;  1T56 A;  2RNG A;  4OOI A;  3O8H A;  4IL6 C;  4LG0 A;  2V6E A;  1J9I A;  4UXN A;  1FX7 A;  3I5U A;  4FCY A;  3QP5 A;  1SD4 A;  2R5Z A;  4PJL A;  3KET A;  3G4S I;  2EZH A;  4IHX A;  5D8K B;  1W5S A;  3J7A O;  2ECB A;  4I02 A;  2HGC A;  4ZC3 A;  3DPT A;  4BY7 J;  4CCM A;  3R4K A;  3CLQ A;  4LK0 F;  5B3S H;  2LP0 A;  1TBX A;  2XF5 A;  5JVG F;  2JVH A;  4HW0 A;  2L4A A;  1WI3 A;  1ZAO A;  2STW A;  3CJR B;  4XLA A;  4KT6 A;  2HZT A;  2GAU A;  3IP4 B;  4KJZ A;  2LMD A;  3LFU A;  5K7H A;  2KIS A;  3BR1 A;  4N0B A;  2EPF A;  1TC3 C;  3CCJ I;  4ON0 A;  2WAQ N;  1LFB A;  4U7B A;  3SFZ A;  2DMT A;  2X4H A;  2NS0 A;  3WHC A;  1IV8 A;  5GTI C;  2AS5 F;  4XMY A;  1MSF C;  2PMZ A;  4BY1 J;  1D5V A;  3CO6 C;  3VB2 A;  4EM1 A;  2DN0 A;  3DEE A;  4OIO F;  1VQ4 I;  2LY1 A;  2A07 F;  1HDP A;  2V9V A;  3REO A;  1FP2 A;  3ZMD A;  3CD6 I;  4ANJ A;  1UG2 A;  3ZQG A;  4EM2 A;  4RGX A;  4XSZ F;  1HKQ A;  5J6X A;  3QPL A;  2Y9Y A;  3G73 A;  2QF7 A;  1K6Y A;  4NDL A;  3WU2 C;  5E17 F;  1ORK A;  1SAX A;  1KYW A;  3CO7 C;  4FTH A;  1E2X A;  1FTZ A;  2PX9 A;  2F4M B;  1IRF A;  2FF4 A;  4HDV A;  2NVY J;  3H0D A;  2DQL A;  3ABK H;  2YSR A;  2ZJ2 A;  1ENH A;  4I01 A;  5FJ8 J;  3LSP A;  3S93 A;  1LEB A;  2LY9 A;  4A5M A;  4HQE A;  3CC4 I;  1APL C;  3OV8 A;  4YG2 F;  2CWE A;  3O8G A;  1QVT A;  2VB6 A;  3O2P E;  1H89 C;  5HNF A;  3WU1 B;  2UXN A;  4PGH A;  1HW1 A;  5TIS C;  1D0Y A;  3G1L A;  4XIC A;  2V9P A;  3K4N A;  3VOD A;  4M3B A;  5BPD A;  4R79 A;  5HLT A;  1R6R A;  1MBE A;  1P9Q C;  1ETV A;  3BTJ A;  4AYB N;  3HGY A;  2IGM A;  1WJA A;  3LSI A;  3QOD A;  3H0G J;  3ABL H;  1IN6 A;  1XMX A;  2V1D A;  2M4K A;  3OYG A;  1WWX A;  3BTI A;  3GF2 A;  3J80 Z;  1BOB A;  5E8G A;  3PFI A;  4XKB A;  1GXQ A;  2F5C A;  4E7I A;  1VTN C;  2K3F A;  4X6A J;  5GTH C;  1UHM A;  3WGG A;  3ZXS A;  3CCY A;  1LUJ B;  3GFJ A;  4XID A;  1S29 A;  4YII A;  3CCE I;  1WJC A;  2VT2 A;  2L7K A;  2AO9 A;  5EYR A;  2XAS A;  1STZ A;  1UJ8 A;  3RPU A;  1R1T A;  3KYC B;  4HG2 A;  1FPQ A;  4AWX B;  3ZQC A;  1KQ0 A;  4B3X A;  2DPD A;  4PUS A;  1X1C A;  3E6M A;  2W85 A;  1BBY A;  1MBG A;  4XRS G;  1AOY A;  2DFE A;  3H5R A;  3BTL A;  2M45 A;  1VQP I;  3JRF A;  2DQR A;  1WKM A;  1GT0 C;  5J8F A;  1G8X A;  1QNT A;  2KRC A;  3ELK A;  3U2R A;  3K70 D;  4Q5S F;  1S9H A;  3OYK A;  3EQL F;  3G3Z A;  3WGI A;  1QPM A;  5H2F C;  1XX5 A;  1AA7 A;  1EA3 A;  2VI6 A;  4C2T A;  4RAF A;  2STT A;  1ZG3 A;  2JRT A;  2F6C A;  2LFB A;  1JTX A;  5CJ9 A;  3O3K A;  2LH9 A;  2GIV A;  3BQZ A;  5EZG A;  4QTR A;  2H1K A;  2ISZ A;  1R71 A;  2JPB A;  5F0F A;  1WQ2 A;  1WSU A;  4A93 J;  4A6E A;  1MDM A;  1U5T A;  2IA2 A;  2P81 A;  2MA3 A;  2DTR A;  2QSG X;  2QKL B;  3S2W A;  2K9S A;  5J4Y A;  4DQ2 A;  1ETK A;  3IUO A;  5EGO B;  3A0H C;  3KIO A;  2L9S A;  2NS8 A;  2VOO A;  5H6R A;  4A3M J;  2PJP A;  1XMA A;  2ADU A;  2BHZ A;  3CUO A;  2EV5 A;  4EJV A;  1TW3 A;  4BE2 A;  2R7Q A;  5L3B A;  2XF7 A;  2CG4 A;  2XDV A;  1W4M A;  4Q48 A;  3BG3 A;  3EPZ A;  2VOP A;  3FHZ A;  3RYR A;  2X85 A;  2JA8 J;  1IZ1 A;  3EUK L;  1HQC A;  5IPA A;  5IY5 H;  1TWC J;  3K2A A;  1IUF A;  1FLI A;  1WJF A;  1N75 A;  3M1E A;  3CCL I;  2Y9Z A;  2QVO A;  2FQ3 A;  3DPU A;  2IXS A;  1TL8 A;  1RC9 A;  2HDD A;  1IN5 A;  4IEJ A;  2R7S A;  1V5G A;  3W6V A;  3L9F A;  2RAE A;  4OMZ A;  3QU6 A;  1ZAR A;  1T95 A;  1WI9 A;  1TLH B;  3BPX A;  3FMR A;  5DUK A;  5EEG A;  5IP6 A;  2V1X A;  1REP C;  3BP8 A;  1WFX A;  4BQQ A;  1K78 A;  2XB5 A;  3JRD A;  2QBY B;  1JJ8 C;  2MG4 A;  1MBJ A;  3PIP F;  1S72 I;  2HKO A;  1A31 A;  1FZP B;  2KZG A;  3WHB A;  3F23 A;  1Y8Q B;  3F21 A;  2J5P A;  2PI0 A;  2ID3 A;  3IHU A;  3HPG A;  4ESF A;  3PQJ A;  1P7I A;  3BR6 A;  1GXP A;  3WGH A;  1G3W A;  4DJA A;  1GLN A;  3LA7 A;  4I6Z A;  4ZJZ A;  3W2A A;  2BY1 A;  2IT0 A;  3OYE A;  5DDG A;  1LE8 B;  5GPA A;  4G12 A;  4A3E J;  3OYI A;  3P7N A;  3OY9 A;  2JUC A;  5FD5 A;  2R0Q C;  1PUE E;  3GFL A;  3MKW B;  2D5V A;  4HNT A;  3E5U A;  1SFU A;  2VQH A;  3TKY A;  3QRF F;  4XKW A;  1SMY F;  5JVT A;  4KA4 A;  1BW6 A;  4BQA A;  1MNM C;  1VFC A;  2F5D A;  5HDK A;  3MZH A;  2YX7 A;  5E1X A;  2A6T A;  2VKV A;  2DA1 A;  1RUO A;  2LSO A;  3MAJ A;  2L4M A;  2EH3 A;  3QOP A;  4LOC A;  1U78 A;  3LAP A;  1IXS B;  2X1D A;  3Q0V A;  3T8R A;  2KRF A;  2KP6 A;  2M0M A;  3N97 A;  2DT7 B;  5J1U A;  3DU6 A;  3HZJ A;  4C9Y A;  4AIK A;  2COM A;  1K61 A;  5GP9 A;  1I50 J;  3M8F A;  2DOD A;  1I27 A;  4RLF A;  4ABZ A;  4ENK A;  1MMS A;  5TJJ A;  2IEK A;  1S7O A;  3H35 A;  1KU2 A;  3BR5 A;  2IS2 A;  2M34 A;  3FZV A;  1Q1H A;  4PSX A;  1EJ9 A;  5EEA A;  5GAH J;  4D7N A;  1IJW C;  1DGR M;  2FA5 A;  3RQ4 A;  1RRJ A;  1R36 A;  2GA2 A;  4J00 A;  2O61 A;  4ENN A;  4MTE A;  2EV0 A;  4D9J A;  3KYL A;  1YIJ I;  2W24 A;  2CFX A;  3BCA A;  3FWE A;  4WXH A;  3LMM A;  5H20 A;  3SJM A;  5KCM A;  1MMA A;  2G9W A;  3A02 A;  2GXB A;  1SFO J;  5E3N A;  2CGP A;  2Y48 A;  4HLX A;  1R7J A;  3H3Z A;  1AHD P;  4LD5 A;  4G7O F;  3IWZ A;  3TO7 A;  4D0P A;  1H88 C;  3DLL F;  5FLV A;  3DKW A;  5E20 A;  4AVZ A;  2EV6 A;  3TOB A;  4A5N A;  4E4H A;  4D1Q A;  4BDY A;  2L02 A;  4IO9 F;  3HRT A;  4IHS A;  1FYM A;  2ETH A;  2HYJ A;  5DS9 A;  3GZ5 A;  3RKY A;  4IF4 A;  2QKM B;  3F9K A;  2CS3 A;  3LQR A;  3LAJ A;  2Z1D A;  1EH8 A;  2W82 A;  1NG7 A;  2DYS H;  4F55 A;  3OWT A;  3KCC A;  1F9N A;  2VBZ A;  3CP2 A;  3F6O A;  5M3F J;  3ML6 A;  3JRE A;  4CYC A;  5FKK A;  4HNV A;  1OCR H;  4CO8 A;  1XCB A;  1Z21 A;  3L2R A;  3TOA A;  3E3V A;  3KEQ A;  2FXA A;  1FJL A;  2H6C A;  3RI4 A;  3EYY A;  1HKT A;  2CFO A;  2D2W A;  3WE3 A;  2MYS A;  4BEH B;  3BTC A;  4G6T B;  1ETY A;  3GUD A;  3H36 A;  3V8K A;  2QQB A;  1OYY A;  2O8K A;  2R93 J;  2JVG A;  3BLY A;  1JTY A;  4GYG A;  4MGR A;  1IW7 F;  2H09 A;  3L00 A;  4EEF G;  2IRF G;  5ICG A;  3FIS A;  5KNL A;  2Y31 A;  1R1U A;  2IW5 A;  1L0O C;  4NHJ A;  3JRG A;  1R00 A;  4HV5 A;  2XAF A;  1FY7 A;  3KX2 A;  2EFQ A;  5HVQ C;  1UCR A;  4HF1 A;  3GZN B;  3O6B B;  2QLZ A;  1BM9 A;  4QPQ A;  4ZZL A;  2BE5 F;  1YW7 A;  2ESH A;  3G71 I;  1W5C C;  3NAU A;  3RIR A;  3KPH A;  4KMU X;  1WJE A;  2R5Y B;  5EEH A;  2F5F A;  3K4J A;  4AYB A;  1YI2 I;  2CUZ A;  2ELJ A;  1HA8 A;  1IXC A;  2ZJP F;  1T38 A;  3K4C A;  4IHT A;  1PUF B;  2DJN A;  3WTT C;  1DPU A;  2VPL A;  5LGN A;  4CCN A;  3GBG A;  2JA2 A;  3FX3 A;  4HBL A;  3WTX C;  3RPQ A;  2ZCW A;  4ZDP A;  3OS2 A;  5FKL A;  4BYY A;  1BC7 C;  1I6H J;  3WTW C;  1QO0 D;  4F52 A;  2KL4 A;  2QA4 I;  2A3S A;  2RV8 A;  5F0C A;  1R58 A;  4WWC A;  4NC8 A;  4IRG A;  4GDF A;  1MBH A;  3OYJ A;  1WJ5 A;  3IKV A;  2VJ4 A;  1FSH A;  3ZMZ A;  2Q8K A;  3WOD F;  4MIM A;  2DMU A;  4XRS A;  3TO6 A;  3S1R J;  4A3F J;  2LKS A;  2Y69 H;  1UHS A;  3CJN A;  4Y3O A;  4CUG A;  1JKR C;  1RNL A;  4NQW B;  1PVE A;  2O0Y A;  3DFG A;  4I2O A;  3V7C A;  1ZRC A;  3IL2 A;  1SVL A;  3AL0 B;  4O3M A;  1HW2 A;  5ICF A;  3OYF A;  2Y2Z A;  2KJC A;  4QPO A;  2HYF A;  3MZY A;  2EFW A;  3CC7 I;  3JRH A;  1BW5 A;  5E18 F;  3SYT A;  5J47 A;  2LR8 A;  1YS6 A;  3HOT A;  3LNQ A;  4P96 A;  1YE9 A;  4L9V A;  1UEL B;  3L09 A;  1HF0 A;  3SZP A;  4EAT A;  2MGQ A;  3FK6 A;  2EK5 A;  1YW8 A;  4DBQ A;  4PFP A;  4IHW A;  5DTD A;  3IH3 A;  5CVV A;  2TDX A;  2CUF A;  2O03 A;  3TMO A;  2Q2E B;  4E7S A;  4C2U A;  2JPC A;  3K69 A;  4BAC A;  2HEO A;  1OCP A;  4A0Y A;  2JA5 J;  3GFI A;  2PLY A;  3S15 J;  4G7H F;  1MW7 A;  2GOX B;  3HHG A;  1U6G A;  2OC6 A;  2JRM A;  2NAZ A;  3S16 J;  3ABM H;  4OMY A;  2BXY A;  4I7H A;  2VOD A;  2KQR A;  2ACJ A;  2GLO A;  1J5Y A;  1F1Z A;  1OYI A;  1MND A;  2GBY A;  2KIU A;  5GAE J;  1X19 A;  1YRN B;  2QSH X;  2GIZ A;  3BG9 A;  4P9F A;  1OR7 A;  1BR1 A;  4IKF A;  1MMN A;  2DYR H;  3BR2 A;  5JLW A;  4YIR X;  2MC4 A;  3BR3 A;  4C2M J;  1FC3 A;  3ESW B;  1LVK A;  1ZN2 A;  4IXA A;  1Z7L A;  2HTS A;  2X1E A;  3HGG A;  3I54 A;  3P9I A;  3QPS A;  3PUF A;  5BOX A;  3CCR I;  1HCR A;  3I3L A;  1JKO C;  1H9G A;  1FBQ A;  3CJT B;  3KE2 A;  1FBS A;  5D5U B;  4S05 A;  4ENM A;  1Y39 A;  4B44 A;  2VBY A;  2IGN A;  5AON A;  5BMZ A;  1T0F A;  2OUM A;  4D7M A;  4M72 A;  5M5X J;  1VF9 A;  3K70 C;  3C2H A;  1ITY A;  2EA2 A;  3EDP A;  3QYE A;  4GYI A;  2M0C A;  2XKP A;  1NHA A;  3ABT A;  1Z3Y A;  5ILS A;  3QYB A;  4PJM A;  4YIF A;  3E7L A;  2V7F A;  1MGT A;  1Z6T A;  4G6Q A;  1IRG A;  5F64 A;  2DDA A;  1Z0X A;  4ZYH A;  3TW7 A;  2X1C A;  4F93 B;  2MSY A;  1R49 A;  1J75 A;  1CQT A;  1IO2 A;  2WY8 Q;  2V6C A;  3E0J B;  2TRT A;  3G1O A;  2BOL A;  4LLN A;  2V79 A;  5F27 A;  1YG2 A;  4UNO A;  2I10 A;  3DXJ F;  1ZQ3 P;  2WB1 A;  5GAG J;  1SEU A;  2EB7 A;  2IS1 A;  5EG0 A;  1BI2 A;  4IRH A;  4WXD A;  1HC8 A;  2XPW A;  4AU7 A;  2E2I J;  4B43 A;  4AIJ A;  3EYI A;  3BC8 A;  1ODD A;  2XAJ A;  2QQA A;  1LDJ A;  1R23 A;  1FOK A;  2LNB A;  3ZMV A;  3AL0 C;  1LNW A;  3E5Q A;  3LSK A;  2EFP A;  3NAR A;  1TQM A;  4LB5 A;  2DMP A;  2K85 A;  3DBL B;  5JHF A;  2PBI A;  2CW8 A;  3GTG J;  2OU2 A;  2OF7 A;  3A01 B;  3HOY J;  3R61 A;  2R7V A;  4BXU A;  5FKM A;  3MKY B;  2M8E A;  1YFH A;  2VBX A;  3FHN A;  2RRE A;  2NYX A;  1HW5 A;  2KJB A;  5JFR A;  5C44 J;  2CU7 A;  2FE3 A;  4RGR A;  4U7D A;  3KZI C;  3KP2 A;  3L2U A;  3MD2 A;  2MLG A;  1DPR A;  4E7L A;  1XSX A;  1QZY A;  3CTA A;  4KN7 X;  1WH7 A;  2L7Z A;  3BG6 A;  3BG5 A;  2O8X A;  2VJ5 A;  4NB5 A;  5FLM J;  2K4J A;  5L3G A;  5FD6 A;  3J7Z I;  1S7E A;  2E2H J;  2OD5 A;  3F8M A;  3C18 A;  5B1B H;  2FBI A;  3P5J A;  3C2G A;  2CQX A;  1I3A A;  4Z2Y A;  2IBD A;  2YU3 A;  3I71 A;  4UVA A;  4OIN F;  1MH4 A;  1WH5 A;  4RGS A;  3I56 I;  5F1R A;  5K7F A;  5D8L B;  2Y0S N;  2EFO A;  3DTI A;  4D5C A;  2P5V A;  2IGO A;  2LK2 A;  2W4S A;  1X2N A;  1EKE A;  2HOE A;  3HRU A;  3FM3 A;  5D4R A;  2EIJ H;  5L3C A;  4IZZ A;  1T39 A;  2DOA A;  5E3L A;  1JUP A;  2F4I A;  4HLY A;  2JSP A;  3CLO A;  5BNG A;  5A2Q K;  1B59 A;  4UVB A;  2ESN A;  1Z67 A;  5E1Z B;  4YRV A;  2L54 A;  5JR3 A;  4A3J J;  3LSM A;  1NH3 A;  4B48 A;  4HF0 A;  5HOO A;  2VQL A;  1F43 A;  3HHH A;  3Q9S A;  1LFU P;  1NTC A;  4IOA F;  2VE8 A;  3OS1 A;  2CH0 A;  3P9C A;  3Q5F A;  3LQQ A;  3H3V K;  4EGY A;  3QU3 A;  3SQN A;  2E7W A;  3RDI A;  3JTG A;  4A3G J;  1T6S A;  3OYN A;  2BXZ A;  1H9T A;  1TWF J;  2QEX I;  1DDN A;  4BEH A;  4DYQ A;  2XAH A;  5LEK A;  4PZJ A;  4RMN A;  5BQT A;  3GME A;  3B6C A;  5IT9 Z;  3DLA A;  5BS6 A;  3OL3 A;  3L7W A;  3M1C A;  5KHD A;  5CPR B;  5HLH A;  2PJR A;  4XN0 A;  5D5X B;  3IRR A;  4CZZ A;  2BZT A;  1BJA A;  2ZFW A;  1OCZ H;  3PNV A;  1HOM A;  1BI1 A;  2DA6 A;  3IC7 A;  4KUM A;  2NNN A;  2OA4 A;  2HFH A;  4A3L J;  4CCO A;  2W7N A;  2JA7 J;  1W0T A;  3HJE A;  1XDU A;  3I58 A;  1ZLK A;  4NNJ A;  5HNH A;  2RNJ A;  3R60 A;  2LTP A;  1FTT A;  3KEY A;  4B47 A;  1FMV A;  2XGX A;  1RUN A;  3PUB A;  1X1D A;  3QPT A;  4P9U A;  4IJA A;  2MAB A;  3FXJ A;  4LB6 B;  3S8P A;  3Q3S A;  2OQG A;  2V4J C;  3SHF A;  5M5W J;  1V5E A;  3OL4 A;  4UUT A;  2NRA C;  2VQG A;  3MZ8 A;  3PL8 A;  1XTA A;  3UKG A;  4Q47 A;  4XSX F;  3IV5 A;  3I59 B;  4V19 K;  2H27 A;  1DU6 A;  4UB8 C;  4HAM A;  1FIP A;  2CQQ A;  1W5T A;  2HOT A;  2HWV A;  2IP2 A;  1K7A A;  1A6I A;  4EM0 B;  2WAE A;  2KT0 A;  2M2E A;  2K40 A;  2L9R A;  5KAI C;  3ZQQ A;  3S14 J;  4B3A A;  1V54 H;  2F5V A;  3GYH X;  3MCZ A;  4XL9 A;  1HXD A;  3FMQ A;  4KIB A;  4DZP A;  4ZH4 F;  2IS4 A;  5DCM A;  3CUQ B;  2K86 A;  3I55 I;  5K5O A;  1SMT A;  2A6E F;  4V2G A;  1FSE A;  5DD4 A;  1P92 A;  5FO5 A;  1USS A;  4G6D A;  1ETX A;  3FDY A;  3JRA A;  4AIH A;  1GDT A;  1XC5 A;  3SZT A;  4NQW A;  2KRH A;  5IYC J;  1GV5 A;  3HBL A;  5ED4 A;  3RPU D;  1I6X A;  3KLO A;  4CGZ A;  1W7P A;  3Q0W A;  2Q1Z B;  4JBA A;  4G7Z F;  4AID A;  1KYZ A;  4CDG A;  1MD0 A;  1B9M A;  4F7Z A;  2ZSH B;  3KP6 A;  1XD7 A;  1F4K A;  1UAA A;  3PNT A;  3LFK A;  4A0X A;  2H1L A;  5HLG A;  4TV7 A;  1SAN A;  3M8E A;  2HZD A;  4U87 A;  4XNF A;  4S0H B;  3HRM A;  2ZME B;  2HPM A;  4N4O B;  3RQI A;  5DV5 A;  2AQE A;  3A0B C;  1G3S A;  1MBF A;  4QLC U;  1QHG A;  1AU7 A;  2WC2 A;  3H92 A;  3E1S A;  1JT6 A;  4XRF A;  1MJA A;  2E71 A;  2JTV A;  5C4J J;  1TWH J;  2BGC A;  1GVJ A;  3KEO A;  3G6E I;  2VC0 A;  1PYV A;  5AIQ A;  1BA5 A;  4XN3 A;  1MNE A;  2KLO A;  2NVT J;  4BHP A;  1X4O A;  4HNU A;  2WA0 A;  1EH6 A;  1I39 A;  3S1N J;  2GXG A;  1KA8 A;  3JAM K;  4HX8 A;  3S32 A;  4P5O A;  2DMQ A;  1N77 A;  4OU0 A;  5E1W A;  3BRO A;  3AG3 H;  3RKQ A;  1A04 A;  3N05 A;  4M9S A;  3JSO A;  3W3C A;  2QZ8 A;  2MW8 A;  3IH4 A;  2JT1 A;  5IOZ A;  3ABU A;  4KDP A;  4DBR A;  1ERD A;  3W6J B;  2HQN A;  2XSD C;  3CES A;  3VYT B;  3D5L A;  2LRD A;  3H3U A;  2QQ9 A;  3CCU I;  3H5A A;  3WU0 A;  3I64 A;  1LDD A;  3ONQ A;  1OFC X;  1OJL A;  3D5R C;  4DNC A;  3TBI A;  1UG0 A;  2H8W A;  3TED A;  4A6D A;  2DT5 A;  1U3E M;  3SEZ A;  1MJ9 A;  2YR2 A;  1S8N A;  4NC7 A;  4BXF A;  2P7V B;  4DW6 A;  5GAD J;  2AQF A;  1XSV A;  2WB1 N;  3VSL A;  2LKX A;  4LGW A;  1K6O A;  4WF2 A;  5LRS A;  3HM5 A;  3L2C A;  1W0U A;  3D1N I;  2HQR A;  1FP1 D;  1BR4 A;  3ZMU A;  3OR2 C;  4XM3 A;  4IX7 A;  4JX6 A;  1BC8 C;  1SAU A;  1R4N B;  3M07 A;  1B72 B;  3FIW A;  3VPR A;  1BJZ A;  2OAZ A;  1AKH B;  3DTE A;  3CUQ C;  2BBY A;  2HDC A;  2VJJ A;  3U1K A;  1T8I A;  2XAQ A;  5DCF A;  2VXD A;  2M7B A;  1IDY A;  1H8A C;  4PDK A;  4X0G A;  4GO1 A;  1P4A A;  2CUE A;  1FMW A;  1W36 D;  1L3L A;  3BZ6 A;  4M9Z A;  1MBK A;  1XG1 A;  3NRV A;  1Z1D A;  4GRI A;  1HSJ A;  4OAZ A;  3M8J A;  4ITV A;  3Q9V A;  3CF5 F;  4IQJ A;  3M3Y J;  5DYM A;  5C3E J;  3HXL A;  1VQO I; 
#chains in the Genus database with same CATH homology
 3GTO J;  3G1M A;  4DYR A;  5M5Y J;  2YS9 A;  1MSE C;  2COB A;  3I4M J;  2M8G X;  5F0C A;  2VKE A;  3HB9 A;  1JKQ C;  1MBH A;  4AC0 A;  3A03 A;  1X58 A;  2L0K A;  4MIM A;  2DMU A;  4XRS A;  3S1R J;  1RES A;  4A3F J;  1JKR C;  1QVU A;  1UHS A;  2HI3 A;  1DU0 A;  3S1M J;  4MFD A;  1T56 A;  4FIS A;  3O8H A;  5E3M A;  3RZO J;  1T33 A;  4FCY A;  4W1U A;  1B8I B;  1O4X A;  2O7O A;  2R5Z A;  4IHY A;  2EZH A;  4IHX A;  2LD5 A;  2XPU A;  3ZQI A;  2ECB A;  2KDZ A;  2NOG A;  2Y2Z A;  2O9L A;  4BY7 J;  3JRH A;  1BW5 A;  2DA4 A;  2TCT A;  2R5Z B;  4A3I J;  2NS7 A;  2LP0 A;  2W48 A;  3DCF A;  1WI3 A;  2LR8 A;  1JKP C;  4FE4 A;  5K7Z A;  3LNQ A;  5K7H A;  3BR1 A;  3BT9 A;  1TC3 C;  2B63 J;  2WAQ N;  1LFB A;  1HF0 A;  2DMT A;  2MGQ A;  3FK6 A;  3WHC A;  1IG7 A;  1R9T J;  1MSF C;  5DTD A;  3IH3 A;  4MO7 A;  3CDL A;  4IHW A;  4BY1 J;  2CUF A;  3IH2 A;  2DN0 A;  2EZK A;  1OCP A;  2JA5 J;  3S15 J;  1HDP A;  5EZH A;  1YRN A;  1UG2 A;  3S16 J;  3ZQG A;  3QPL A;  2Y9Y A;  2GLO A;  2GBY A;  2QF7 A;  4NDL A;  1Q1V A;  1YRN B;  3DEW A;  4BBS J;  1ORK A;  4FTH A;  2R92 J;  2HOS A;  1FTZ A;  1NK3 P;  1TWG J;  3BG9 A;  2NVY J;  4MLO A;  4FE7 A;  3BR2 A;  5JLW A;  3BR3 A;  5FJ8 J;  4C2M J;  1ENH A;  3LSP A;  4GFB A;  2LY9 A;  3HGG A;  1FIA A;  3QPS A;  1APL C;  2YUS A;  3HKZ N;  3LSJ A;  1HCR A;  1JKO C;  4JP0 A;  3O8G A;  1QVT A;  1H89 C;  4I76 A;  2XPV A;  1U8B A;  3G1L A;  2DTZ A;  2HQ5 A;  4XIC A;  4D7M A;  1ITY A;  5M5X J;  1VF9 A;  3HEF A;  2ME0 A;  2DA5 A;  4W97 A;  2M0C A;  4M3B A;  3E7L A;  1MBE A;  1P7J A;  2JK3 A;  1ETV A;  2K9Q A;  5IP9 J;  2R7Z J;  3BTJ A;  4AYB N;  4RBO A;  3HOW J;  3HGY A;  1Z0X A;  2AHQ A;  3SFI A;  3TW7 A;  1A5J A;  5F04 A;  2MSY A;  2EBI A;  1CQT A;  4BXX J;  4A3K J;  2TRT A;  3G1O A;  3H0G J;  1WPK A;  5F27 A;  2I10 A;  3HOV J;  3BTI A;  4DYC A;  1ZQ3 P;  3Q0U A;  5EG0 A;  4A3D J;  4X6A J;  4JYK A;  3GTP J;  2XPW A;  3CCY A;  2E2I J;  4XID A;  2EZL A;  4L5E A;  5EG0 B;  4D5F A;  5IYD J;  2AO9 A;  5EYR A;  1ZKG A;  3GTK J;  1HLV A;  3NAR A;  3A01 A;  2DMP A;  3ZQC A;  4UUS B;  3JRI A;  2Y30 A;  3RZD J;  3GTG J;  2OF7 A;  1U9N A;  1MBG A;  4XRS G;  1IDZ A;  3A01 B;  3HOY J;  3GTQ J;  2VPR A;  3BTL A;  5FKM A;  3JRF A;  3MN2 A;  2VUM J;  1GT0 C;  3OSF A;  2JMW A;  1E3O C;  5C44 J;  1BL0 A;  2FD5 A;  2CU7 A;  2QCO A;  1XS9 A;  5E3O A;  3M4O J;  2VI6 A;  1WH7 A;  2LFB A;  2L7Z A;  1JTX A;  5EDN A;  1JJ6 C;  3BG5 A;  3BQZ A;  4M3G A;  4M3D A;  5EZG A;  5FLM J;  4QTR A;  2H1K A;  1ZTR A;  2E2H J;  1S7E A;  2M9H A;  5F0F A;  2WV1 A;  5FKN A;  3OOU A;  1TWA J;  1IV6 A;  4A93 J;  4J19 A;  4C3J J;  1NK2 P;  2CQX A;  3PO3 J;  2IBD A;  2P81 A;  5EGO A;  1U9O A;  1MH4 A;  1WH5 A;  2PMZ N;  2K9S A;  2LLK A;  4V2F A;  1ETK A;  1GV2 A;  5F1J A;  5K7F A;  5EGO B;  2HXO A;  2NS8 A;  2Y0S N;  2XGC A;  4A3M J;  1ZR4 A;  4D5C A;  3HOX J;  2DA7 A;  2LK2 A;  1ETQ A;  1X2N A;  2ME6 A;  4IHV A;  3L1P A;  3F0C A;  5E3L A;  1JUP A;  1MH3 A;  1F36 A;  5F08 A;  5BNG A;  1I3Q J;  3BG3 A;  4M3F A;  4A3J J;  2JA8 J;  1JGG A;  2NVQ J;  5IPA A;  1F43 A;  2CRG A;  1LFU P;  3S1Q J;  1TWC J;  3K2A A;  1NTC A;  1IUF A;  3HOU J;  4JX5 A;  3H3V K;  3S2D J;  2EZI A;  2Y9Z A;  1GUU A;  3GTM J;  1JUM A;  5IP7 J;  2HDD A;  2JJ7 A;  4A3G J;  4IEJ A;  4A3B J;  3W6V A;  1Y1W J;  5IYB J;  2YU9 J;  1TWF J;  2RAE A;  4AUX A;  4DYQ A;  2EQR A;  3K7A J;  3TP0 A;  9ANT A;  5IP6 A;  3B6C A;  1UMQ A;  2XB5 A;  3JRD A;  2E2J J;  1ETO A;  1JJ8 C;  2MG4 A;  1MBJ A;  3HDD A;  1D5Y A;  3WHB A;  1K83 J;  2E19 A;  2HXI A;  2G0E A;  2FJ1 A;  2K9N A;  2ID3 A;  1HOM A;  2DA6 A;  4QIW N;  1X2M A;  4A3L J;  1P7I A;  3BR6 A;  3TP3 A;  2L7M P;  2JA7 J;  1W0T A;  1G2H A;  1LE8 A;  2LTP A;  2X9D A;  1FTT A;  4I6Z A;  3S17 J;  1AKH A;  1LE8 B;  5GPA A;  3FKI J;  4G12 A;  4A3E J;  3CMY A;  2FX0 A;  2GM4 A;  2R0Q C;  2D5V A;  3Q3S A;  2JA6 J;  5JLX A;  2HOA A;  5M5W J;  4Y52 J;  2XGE A;  1BW6 A;  1MNM C;  4UUT A;  1VFC A;  1ETW A;  3UKG A;  2VKV A;  2DA1 A;  4XK4 A;  1VND A;  3IV5 A;  2FQ4 A;  2JWT A;  5HOD A;  1DU6 A;  1FIP A;  2CQQ A;  2EH3 A;  2HOT A;  5F0H A;  3MVP A;  4LOC A;  3CQZ J;  1A6I A;  3I4N J;  1U78 A;  2KT0 A;  2M2E A;  2K40 A;  2ID6 A;  2L9R A;  4C3I J;  3S14 J;  3Q0V A;  4B3A A;  3LSG A;  3OSG A;  2X48 A;  4DZP A;  1IRZ A;  5IOY A;  4XRM A;  1QPI A;  1GVD A;  5J1U A;  3ZQL A;  2XB0 X;  1Y1V J;  4V2G A;  1K61 A;  3TW6 A;  5GP9 A;  1I50 J;  1QRY A;  4ABZ A;  1ETX A;  3JRA A;  2IEK A;  1GDT A;  1XC5 A;  3BR5 A;  2M34 A;  5IYC J;  1GV5 A;  3HBL A;  4X1E A;  1JUS A;  5EEA A;  4D7N A;  1IJW C;  3Q0W A;  1B8I A;  1EF4 A;  3BQY A;  2H8R A;  5GPC A;  2IAI A;  2LVS A;  3SJM A;  3A02 A;  1SAN A;  4S0H B;  2ECC A;  3RQI A;  2DA2 A;  5J1Y A;  1SFO J;  5E3N A;  1MBF A;  1ZR2 A;  1AU7 A;  4M3E A;  4BBR J;  1JT6 A;  1AHD P;  2XRL A;  2E1O A;  1H88 C;  1HDD C;  5C4J J;  1TWH J;  5FLV A;  3JR9 A;  4A3C J;  2DA3 A;  1RR7 A;  1WGX A;  4MFE A;  4B4C A;  5FKO A;  2HYJ A;  5DS9 A;  3LOC A;  1BA5 A;  3JRC A;  1ZK8 A;  2L7F P;  2NVT J;  5M3M J;  1IGN A;  3S1N J;  2JN6 A;  2X6O A;  2DMQ A;  5M3F J;  3ZQF A;  3RKQ A;  4RDU A;  3JRE A;  4CYC A;  5FKK A;  4HNV A;  3JRB A;  3IH4 A;  2MW8 A;  1RKW A;  5IOZ A;  3ZOB A;  1FJL A;  4CYC B;  2XSD C;  2CJJ A;  1JT0 A;  3OIO A;  4M6V A;  5J3L A;  3BTC A;  1RET A;  4DZJ A;  1ETY A;  2NVX J;  2ELK A;  1IC8 A;  1OFC X;  1OJL A;  4QSH A;  3SDG A;  3ZQH A;  2O8K A;  3HOZ J;  2ZB9 A;  3C2B A;  2R93 J;  4B1R A;  2OPT A;  1JTY A;  3TED A;  3BR0 A;  4A69 C;  4EEF G;  1ZGW A;  4DW6 A;  2WB1 N;  3FIS A;  4C3H J;  2LKX A;  3S2H J;  2Y31 A;  3HM5 A;  1W0U A;  3D1N I;  1B72 A;  5J1R A;  3JRG A;  3B6A A;  1OCT C;  3FK7 A;  3LSR A;  4JX6 A;  5EF6 A;  3PM1 A;  1B72 B;  1WCM J;  3FIW A;  1BJZ A;  3VPR A;  2R5Y A;  1AKH B;  5C4X J;  3NAU A;  4Y7N J;  1H8A C;  1IDY A;  2R5Y B;  1Z77 A;  1PUF A;  3PO2 J;  2CUE A;  1POG A;  4JX4 A;  2DMN A;  1MBK A;  3MKL A;  1XG1 A;  1RPW A;  4BKX A;  1VI0 A;  1PUF B;  2DJN A;  3GTL J;  3GBG A;  2XGD A;  1FEX A;  3M3Y J;  3QQA A;  2N8G A;  5C3E J;  1RKT A;  5FKL A;  4UUS A;  1I6H J;  3GTJ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...