3HM2A

Crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
172
structure length
171
Chain Sequence
GQLTKQHVRALAISALAPKPHETLWDIGGGSGSIAIEWLRSTPQTTAVCFEISEERRERILSNAINLGVSDRIAVQQGAPRAFDDVPDNPDVIFIGGLTAPGVFAAAWKRLPVGGRLVANAVTVESEQMLWALRKQFGGTISSFAISHEHTVGSFITMKPALPVHQWTVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Precorrin-6Y C5,15-Methyltransferase Targeted Domain from Corynebacterium diphtheriae
rcsb
source organism Corynebacterium diphtheriae
molecule tags Transferase
molecule keywords precorrin-6Y C5,15-methyltransferase
total genus 41
structure length 171
sequence length 172
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hm2A00
3BWYA 3EVAA 3I9FA 5MHTA 1RI1A 5ICGA 3TLJA 3M33A 1BHJA 1O9GA 3CVOA 3RIEA 4CKCA 2CWWA 3KPVA 4QQNA 3JWJA 3UJDA 4PYLA 4ER3A 5ICEA 1X1CA 2BZGA 2PV0A 4M37A 2FCAA 2IFTA 3LCUA 3BGVA 1AQIA 3C6KA 4E70A 5K01A 5ICFA 4YMGA 5CVJA 2H00A 1SG9A 2YVLA 1AF7A 5DM1A 4C08A 2ONZA 4PYQA 3OU2A 2A14A 2YX1A 2C7OA 3FRHA 4QDKA 1ZG3A 2ZZNA 1WY7A 2YUIA 3C3PA 2ZW9A 3HCEA 2I9KA 3B7PA 4M7RA 1Q0TA 2AOUA 2AOVA 2JH8A 3CJRA 2BR5A 3K6RA 2EFJA 5KQSA 4QVGA 2JJQA 3G2QA 1JG3A 3OZRA 3E23A 4ISCA 4PYIA 4OQDA 3UJ6A 1KR5A 2Z6QA 2OZVA 3KPWA 4JXJA 5K0LA 3MTIA 2O0LA 1O54A 3LPMA 2G72A 3CJTA 5C1IA 5E9WA 5DTMA 3KPYA 3UJ7A 1FP2A 1WG8A 5BP7A 2Y1WA 5FULA 5K09A 2JHAA 1VQ1A 2AOTB 3EVZA 1RJFA 4ZTBA 2GA9A 2PT6A 4RVDA 5HOQA 1G38A 1WZNA 2ZBRA 4HSGA 4QVKA 1VP9A 3LHDA 3DH0A 3A7EA 2AOTA 3B3GA 1MHTA 4U7TB 2B2CA 3G7UA 1O9HA 3A25A 2ZWAA 4P58A 4CKEA 2PJDA 4C03A 1Y8CA 2PSSA 3AXSA 3EVBA 5FUBA 2FPOA 2DULA 4DF3A 3KR9A 2GAFA 4K6MA 4DMGA 2GS9A 4HGZA 1SVUA 1OR8A 3E05A 1EG2A 4RSRA 2XYRA 3KR2A 4HTFB 5EHIA 5C0OE 1XCJA 2OO3A 4CKBA 3GU3A 4BLWA 4E2ZA 3BT7A 2IGTA 2IP2A 2V74B 3P9KA 3TM5A 4F86A 2AVNA 2PT9A 1XDSA 4LG1A 5CVVA 2PX4A 5EOVA 3RW9A 1N2XA 2YTZA 4X61A 3EEOA 3G5LA 5E9QA 2FHPA 1AQJA 2AN5A 4BLUA 3FTDA 2ZWVA 3G2MA 3R0QA 3OE5A 1XTPA 3BGDA 1JG2A 3CKKA 4CTJA 4DM3A 4V0RA 4M36A 3PFHA 3TMAA 3V97A 4LWPA 1RJEA 3ELDA 5K8VA 1G55A 4OA8A 1P39A 3IV6A 1MJFA 3OZSA 2YXLA 2ZCJA 2BR3A 1PRYA 3UFBA 2OPBA 2YQZA 1INLA 3OFJA 4GUAA 2PBFA 5D1NA 1XVAA 3HCBA 4IWNA 1HMYA 3C0KA 3KQTA 4R8RA 2VZ9A 3WSTA 4RTOA 3SGLA 5M5BA 5DSXA 1P1CA 3DLCA 3OU6A 2G1PA 1X19A 3EEYA 3P2IA 1RI5A 4M38A 5FCDA 2VDUE 3DULA 1L3CA 3LCCA 2OB1A 3KQPA 4KW7A 4DCMA 3IHTA 3PVCA 4F84A 1IXKA 5EGSA 3VSEA 5IKMA 2P7IA 4C04A 3E7PA 4AZVA 4B17A 3HCCA 3BWBA 4QPNA 3GCZA 2OKCA 5T64A 3JWGA 2PWPA 3O31A 1JTEA 3Q7EA 5FQOA 5CCXA 2XBMA 3G8AA 3LSTA 3IYLW 4E33A 3EVGA 3HM2A 4YV2A 5CD1A 4FSXA 4BY9E 1ZKDA 2CKDA 1SUSA 2BR4A 4NECA 2BM9A 3PB3A 1M6YA 5EZQA 4EVIA 3FPHA 4DKJA 3SSMA 5EEGA 1IM8A 3SVZA 1YF3A 2AN3A 3MB5A 3EVCA 3P2KA 3P9IA 4R8SA 2AOWA 3UA4A 1FP1D 1V39A 2H1RA 5EMLA 5CVEA 3TKYA 3HA5A 4PYOA 3DUWA 3CBGA 1R00A 2HMYB 3FUWA 4X41A 3TQSA 1JSXA 2XVMA 3EPPA 3EVEA 5DTQA 1L1EA 4X63A 2NP7A 2PLWA 1XCLA 4KIFA 3SX0A 2JG3A 3BXOA 3Q87B 4C06A 3GRVA 3ORHA 1B42A 5E1DA 3UJCA 1PJZA 2UYHA 4FZVA 1JSZA 3P97A 4GOLD 5FHQA 2QRVA 4FS8A 3M6UA 4U7PB 3R24A 1G8SA 2ZZKA 5DM2A 5DX0A 5K0GA 4DA4A 2C7QA 4ATNA 3KHKA 2O05A 3G89A 3HVHA 3T0IA 1JQEA 1L3IA 1KIAA 4YMHA 4E2YA 3ER9A 1NV8A 5CUQA 2EJUA 3DTNA 3G2OA 1FPQA 3CJQA 1XJ5A 3OU7A 2OXTA 4EKIA 3T7RA 1TW2A 2PX2A 2PY6A 5LSAA 1VL5A 2B25A 5DSTA 3FTEA 5FHRA 1Z3CA 4RTSA 5E1MA 3TM4A 3DLIA 3KPUA 2PWYA 4GOMD 3P9CA 3FYCA 5DRYA 2VDVE 2PXCA 4OX9Y 1P1BA 1NV9A 3CGGA 5FADA 3M4XA 4PGHA 4WVLA 4FT2A 4GF5A 5EKXA 5DM4A 3LKDA 2ADMA 3DXYA 1EJ0A 3MGGA 5CM2Z 4HGYA 5E2AA 1BKYA 3AY0A 3I58A 4PYNA 3THRA 1XDUA 3UJ8A 4E2XA 1DCTA 4RTRA 5G02A 5LQKA 1JG4A 3GGDA 3BGIA 3FUXA 1KPGA 3F4KA 3SSNA 2ZIEA 2UZ4A 4RTJA 2OY0A 2ZLBA 3A7DA 3B3JA 5KVAA 3GO4A 1KHHA 4O29A 1RI2A 5EZSA 4FT4A 4GOOD 5KQRA 5CVUA 1DUSA 5GM2A 2P40A 3DXXA 3FTCA 3KKZA 3TFWA 5EQJB 2UYCA 1YFJA 2IBTA 2P35A 3D2LA 3KQYA 4EKGA 1L3BA 5T67A 3LDGA 3GIWA 4FGZA 2G71A 4OBXA 5K0NA 5GOZA 3HCFA 5BXYA 1D2HA 4RVHA 4IV8A 3OFKA 2KW5A 4PYKA 4GC5A 4P7FA 2ZTHA 5F2NA 4QQKA 2XVAA 5U4XA 2ZBQA 5KYGA 2ZFUA 3CC8A 4OBWA 5EPEA 3TKAA 3FUTA 3PX2A 5JUWA 2H11A 3NDJA 3FYDA 3MQ2A 3B5IA 3JWIA 2Q41A 3PFGA 2QM3A 5DXJA 1JTFA 4CTKA 2EX4A 4PIPA 3G2PA 4C07A 2DPMA 2O57A 1SQFA 2QRVB 3HCDA 1JR4A 2WA2A 4HC4A 3NVKI 3UZUA 4PINA 1EQAA 2AR0A 1EIZA 1YZHA 3LECA 3SM3A 4E31A 3S68A 2NNWB 1NKVA 5FWDA 3ME5A 2ZIGA 1Q0SA 1XDZA 3REOA 4A6EA 4E30A 5E9JA 1ORIA 2EJTA 3GRUA 5K0FA 1IY9A 3M6XA 1YFLA 1T43A 5JR3A 2E5WA 2NP6A 2PX8A 1NBIA 4GBED 5GP1A 2FRXA 10MHA 5DX1A 3UWPA 1SUIA 5EMKA 4AUKA 2B78A 3HA7A 5EIFA 5GM1A 3E8SA 4Z2YA 4EMSA 3UBTA 1U2ZA 1WXWA 1YUBA 5LQAA 1X1DA 3GNLA 4ER7A 4YV1A 1R74A 3FPEA 1VIDA 3GXOA 3M70A 1KPHA 4P7KA 3KQMA 1VPTA 2FK8A 3ID6C 5K0JA 3BWCA 2CMGA 7MHTA 1R18A 2HV9A 3FPJA 5DWQA 1QAMA 1FJXA 2AS0A 2I6GA 2ZIFA 1VE3A 2GLUA 3LBYA 2Z6UA 3KU1A 3PTAA 3DR5A 1ZGAA 2R6ZA 5KS2A 2OYRA 2I62A 3R3HA 5LQJA 3GJYA 3LX6A 3O7WA 3R9XB 1UWVA 3BWMA 3FTFA 5ERGB 3SSOA 2P8JA 3HVIA 3LDFA 1KP9A 2NYUA 4X1OA 5DRTA 1NT2A 3GRZA 4XUCA 5IH3A 1I1NA 1I9GA 4UOEA 2GB4A 3P9NA 5DX8A 4G56A 1G6Q1 5FQNA 1NW8A 4RTMA 4GOND 4PYJA 3GRRA 4ER5A 3DOUA 3O4FA 2YXEA 1F38A 2ZSUA 3NJRA 1H1DA 4RTNA 3I53A 1L9KA 3NDIA 5CCBA 4C05A 2K4MA 1R8YA 3HNRA 5HIMA 4E32A 2EG5A 3MERA 3NWBA 4QTUB 5LQCA 1SQGA 2WK1A 2IH2A 3A26A 4PWYA 2AOUB 3I5UA 2GH1A 5K05A 4KDCA 2JH9A 2P1DA 1DL5A 2P3OA 2PKWA 3VC2A 2WA1A 4A6DA 3QV2A 1RJDA 2IPXA 4MQ4A 3MAGA 4R6WA 5FA8A 4PNEA 3EGIA 4V0QA 5DT2A 5EIWA 3MCZA 5B1SA 5FA5A 1BOOA 4GQBA 5E2BA 2JHCA 5E8JA 3ELUA 5P8WA 1P91A 2OBFA 3HVKA 3LDUA 2O07A 2N47A 2NXNA 2UYQA 2ZULA 4KDRA 2B3TA 2PXXA 3A27A 2Y1XA 2R3SA 5DLYA 5EEHA 5E1OA 3P2EA 1UIRA 4PGGA 2NXJA 3OE4A 1UFKA 5ICCA 4RYLA 4KIGA 4YUYA 3FUVA 2CL5A 4LECA 5GWXA 4BP3A 2LD4A 3AWIA 3EMDA 4DZRA 3SMQA 1KPIA 4XCXA 3FPGA 3ELYA 3M6WA 2ESRA 4KWCA 5HEKA 3OZTA 1VP3A 5F2KA 3THSA 5LQUA 4R6XA 3HEMA 2YXDA 3LKZA 3LL7A 5LQNA 4RTLA 1YB2A 3NWEA 1ZQ9A 1X1AA 4R05A 1QANA 4KVZA 3HVJA 2VDWA 3GDHA 4PCAA 2O06A 2ZZMA 5DM0A 5HFJA 2ZBPA 4RWZA 2QYOA 1TW3A 3HP7A 3BZBA 3LCVB 1R8XA 3UJ9A 4AZWA 4LWOA 3G5TA 3UJBA 3B89A 4RTQA 1EJ6A 2ONYA 1BC5A 2P7HA 3KPJA 5HIIA 4CXMA 4OQEA 1AV6A 3A4TA 1G8AA 1RJGA 4MTLA 2CMHA 5LQRA 1KYWA 3LGAA 4EQZA 1QYRA 3JWHA 5DTRA 2HWKA 3PS9A 3MCTA 2IBSA 4QPPA 1YZ3A 4RVGA 3FPFA 1RI3A 1EAMA 2PGXA 4XUEA 5CVDA 3T7SA 4F85A 1D2CA 4YUXA 3TRKA 5K0BA 3ERCA 2JHPA 2VS1A 3NTVA 5D1HA 5GIPE 1ZHFA 4QTTB 2HTEA 2AN4A 1JQ3A 2B9EA 2P3QA 2PXAA 4IKPA 4IV0A 5DPMA 4YUVA 8MHTA 3U81A 2QY6A 1FBNA 3I64A 1KXZA 1NE2A 2YR0A 2BM8A 3BUSA 3KQWA 4HG2A 5K03A 2F8LA 4QDJA 4HTFA 3EVDA 3EVFA 4RTKA 2IH5A 3KQQA 5EVJA 3HA3A 1NBHA 3DP7A 3KQOA 3SXJA 5K0EA 2P41A 2BH2A 3KR0A 4BP1A 4ER0A 3PX3A 2NXCA 4PONA 5FWAA 3GWZA 3QOXA 4KRGA 5K0CA 3DMGA 5GIOE 5T6BA 1KYZA 4PIMA 5H02A 1QZZA 2GPYA 1RI4A 1I4WA 1TPYA 3MTEA 4P7JA 3TR6A 4X60A 2IIPA 3FZGA 2HR1A 1G60A 4MIKA 3DMFA 1D2GA 5F2OA 3AJDA 5HIJA 3RODA 3TOSA 4DCGA 4E2WA 5EC8A 3P8ZA 3EGVA 4Y2HA 2FK7A 4POOA 3NMUF 4ER6A 4C4AA 4CWAA 1R6AA 3OCJA 4GC9A 4MWZA 1SKMA 3MHTA 5DXAA 3B3FA 5CIYA 1WXXA 3M6VA 4AX8A 4H0NA 3UA3A 3DMHA 5EMMA 3NW9A 5E1BA 1N7JA 5FTWA 2C7RA 3PT9A 5C9ZA 2I7CA 4HRAA 1M6EX 3C6MA 3EMBA 1VLMA 4AZSA 3CCFA 4FR0A 3ELWA 3T7TA 3FRIA 2UYOA 4RX1A 4XUDA 4YUZA 5BW5A 1N7IA 1NW5A 3QOWA 3FUUA 1WS6A 2QE6A 4MHTA 1ZGJA 2IDJA 3AXTA 3K0BA 3OPNA 2G8NA 3NVMB 1M0EA 5EG5A 1QAOA 3GRYA 3VYWA 2V7EA 3R6TA 3ER8A 4P7GA 2ORED 1NW6A 2Z6AA 4HH4A 1F3LA 2OB2A 1XXLA 2G70A 2VP3A 5E8RA 1NW7A 1JG1A 1ORHA 5LR6A 2AZTA 3L8DA 5HIKA 4PCLA 5BW4A 4L7VA 2PVCA 4RV9A 4BLVA 2NXEA 4AZTA 3UJAA 1VBFA 2AVDA 3H2BA 5GINE 2FYTA 2IDKA 4GEKA 3LBFA 3KR1A 3P71T 1X1BA 3BKXA 3G88A 3IEIA 5HILA 5EKUA 4YV0A 3HTXA 3HCAA 5HZMA 3C3YA 4RVFA 1JQDA 2AOXA 3G8BA 4WXHA 1HNNA 1QAQA 2IH4A 3DXZA 4OA5A 3EGEA 4YUWA 3SR4A 2ERCA 4PYMA 3KQVA 3ANXA 2C7PA 3KQSA 3PLAE 4FSDA 2PX5A 2HNKA 4FP9A 2ZVJA 3VC1A 3X0DA 4EK9A 3TPZA 4RTPA 4DQ0A 4Y30A 9MHTA 1NW3A 5EMJA 2P3LA 2XYQA 3BKWA 2XYVA 3V8VA 5EHGA
chains in the Genus database with same CATH superfamily
4AXBA 4IGKA 4KMRA 2KE5A 5G1PA 3C45A 5HM8A 3QVTA 2A3RA 3QKSA 1GVNB 2VSQA 3KHSA 3LHFA 4LXXA 5ALPA 1PJCA 3VO8A 1FDTA 2FCAA 4LJ7A 5JCXA 4MDEA 2NX2A 1AQIA 1F4VA 2PO7A 3V4VB 2J0QA 2O19A 1GXSB 5KQMA 3PFBA 1YVPA 4BVBA 4BNHA 5J2TB 3H11B 1F4PA 1KVSA 2OWEA 3AHJA 4QDXA 4Y2UA 4Y2YA 4WZZA 3H1FA 4OYRA 5I6DA 2YX1A 4RK5A 4FJ0A 4JLMA 4UZFA 4X20B 1TAHA 4FJ2A 2H9IA 4Y2SA 4UW9A 1AXEA 3C3PA 3CUKA 3GLSA 4H16A 5EXEA 4EH1A 3T15A 2CNOA 3TI9A 4H3HB 2QRKA 2DTDA 1VSQA 5J9FA 4BQIA 3ZYCA 5DCYA 3CZ9A 1EDZA 1CQPA 1YHZA 1HYQA 1NN0A 1NRXA 5CIWA 3WIDA 5HGXA 4DBLC 1S2MA 2RB4A 3HJUA 3UJ6A 1XAIA 5G3ZA 4E08A 1ZNXA 1U8TA 4JXJA 3QEMA 3QVGA 4MPTA 2FEWB 4WNAB 3DBHA 1DARA 1F4LA 1ZN9A 5D3MB 2O3TA 2GN6A 1KS2A 2V0CA 1QGDA 4MEAA 3CVWA 4YV7A 2ECPA 4C20A 4F46A 4HNVA 4I1PA 1PZFA 1WW2A 1A0OA 1CJTC 4QPJC 2DFVA 1VSUA 3DQPA 1FYEA 5AVSA 5PGMA 4N12A 1XJCA 4YC7A 4X1YA 1GPBA 3V2HA 1FB5A 4C4PA 5HJ5A 4ZI7F 1CZRA 3T1QA 4P58A 3RHSA 4YRTA 3P2JA 3NLLA 4L8WB 3A6JA 2X0IA 3ABRB 3B6IA 5CHYA 2MT9A 4N0QA 3OHMA 4NZZA 5CURA 1VB5A 3U39A 3L6EA 1DKNA 3HM9A 2IYLD 2GS9A 3EHDA 4PG6A 4PE5B 1EFRD 3M5DA 3E48A 4PLGA 5FUYA 2QGNA 5DYIA 3GZTB 2ECKA 3NNDA 3CUTA 3L0SA 3SNKA 1HQYE 2ONKA 2BUCA 1N6KA 2ID4A 2YXBA 3T7KA 1E3WB 2XRZA 1VGRA 1MB4A 1U8UA 1O1YA 4H08A 1MLDA 4I08A 4IHKA 1HT0A 1NN3A 2GRAA 2R68A 3UUGA 3K9HA 4X61A 1J2TA 2NU7B 5K3CA 4KR9A 2O8EA 1L4LA 1T4BA 2GT1A 1R6DA 3LHKA 1Z2PX 4F7WA 3JQ6A 3CKKA 3CYFA 4DT1B 2Q1YA 3E9QA 3JXEA 1W29A 4U2CA 3KBBA 3UANA 2VXYA 4IQGA 4ID3A 4QU0A 3BRWD 2H31A 3JVDA 1JWBB 1LK0A 3RIMA 2BEUA 5REQB 4IOJA 1Y33E 6YASA 3E81A 1L5FA 3W5DA 3I5XA 1JFVA 2Z4TA 4CN9A 1LQUA 4CEHB 1EWVA 5JO9A 5CFNA 2EKDA 2DUMA 4NXNB 5JNSA 3RRMA 1F9AA 3RJ9A 3T52A 2FP4A 3DLCA 2XBUA 1E5LA 3TJMA 1OT5A 2Y6UA 3CCBA 1J2YA 5JYDA 3TFOA 4QREA 1ZVVA 4DCMA 1MNAA 1QONA 1GGFA 2REXB 1XCPA 1UFVA 4FQ5A 4R1UA 2H6EA 1CF9A 4HX5A 1UCFA 5HUQA 3HR8A 4LYEA 3TE7A 1WR8A 4P3NA 5JJCA 1QGUB 3FOWA 3N87A 3HB9A 2DPYA 2ZJFA 3CONA 1EP3B 2EC5A 3ENKA 1RLIA 4J91A 5EP3A 3VKHA 1CULC 1F0YA 5LDGA 2PSDA 4CIAA 3DYIA 5GONB 1VHTA 4P5DA 1O3YA 1U0JA 1UAYA 2HD4A 1M6YA 2PRKA 3MWYW 3FPHA 2EL9A 3NNNA 5EIXA 3LZCA 2CHGA 2Z5GA 2BEWA 1GZ3A 2YFKA 3I2HA 2OXRA 5L51A 1BU5A 3AUXA 3HDJA 4JL6A 5EJAA 4NBTA 1BNCA 4X84A 4QFDA 2B2NA 1JSXA 3TW8B 5CFPA 1O8CA 2UVPA 5IXJA 1L1EA 1C0EA 1CUBA 1SA0A 3O2JA 4JJ8A 4UUOA 1DIBA 2ANCA 3GRVA 3QPUA 4L6AA 4ZALA 1KJWA 1OLSB 4CETA 1T4GA 1FXWA 1CUVA 1U7WA 3DQZA 3Q1LA 2DMRA 3P0HA 4J0EA 5E7MA 4BXOA 1Q44A 2CLSA 2IHVA 3FHJA 1NQWA 3H13A 3H5AA 1YE8A 2ZZKA 3FSEA 1HYBA 2L18A 3GP5A 3I12A 4OHMA 5EXDA 3T5GA 4BVAA 1JEDA 2ZYAA 2O05A 4ZA2A 4RIEA 3WGTA 3OA0A 3BFKA 1KI4A 1CS4C 1FNBA 2DC1A 3G79A 1W0JA 5IMBA 1YJBA 4X7BA 2Q3CA 4PQYA 3G2OA 4KQJA 4LCEA 4XVHA 3HY4A 4HMOA 1Z34A 4E1AA 3QG1A 5M34A 3TR0A 3E70C 3C85A 3CRVA 3HMQA 4DC9A 1L5GB 3AY3A 2QPTA 5EE3A 1EFPA 2Q6VA 2WUDA 3OTWA 1DC6A 3IIKA 4QDOA 5G4KB 3WQBA 2LR0A 2YBEA 1GV1A 1M1NA 4FW9A 4AS3A 3E5NA 1IIRA 5DBOA 5E6UB 3VDQA 4BNXA 3GGGA 3HGQA 3PJDA 2DUUA 4RPKA 4XW2A 2C5SA 2ENUA 3RC9A 3V8EA 3FWYA 1JG6A 1X92A 1XHLA 3AEYA 3QPDA 3D3QA 1KOLA 2G5CA 1IXSB 1KYYA 2LDBA 3D2BA 5HWSA 3C1TA 3EIOA 4O29A 2IC5A 4FCCA 1PJRA 4FT4A 4TV8B 4IXNA 4ZJZA 5B7PA 1GG2A 1JA9A 1FA9A 1M75A 1ISPA 4DR7B 4EGSA 4LXGA 4NR0A 4RLFA 5DW0A 5AVWA 2BDTA 3A9RA 2R2GA 3BXHA 1MCZA 3EIWA 3KQYA 3NB0A 1GILA 4LZLA 3HNOA 4HBZA 5HNKA 2EWVA 3N28A 1PO7A 3D6TB 4FGZA 1ONBA 4BKMA 2ZE5A 4J1SA 2TMKA 4R2JA 3EQZA 3C3JA 3OQPA 4INPA 5J2TF 5BXYA 3OQMA 5DOVA 1TGVA 3TTWA 4JYZA 4CUKA 3QKIA 3H6KA 3HXQA 3OIYA 2ZB3A 1T36B 1I32A 2HOQA 4N5NA 4OMCA 4KOEC 4KR3A 4HN9A 5LLSA 5KYGA 1TUEA 1Z0ZA 1BIFA 3TRDA 4BLRA 1ZRSA 3P4XA 2J6BA 3Q3GE 3MTGA 4WY8A 1ULZA 1ZH6A 3BL5A 1BTOA 3U1BA 2ZIAA 4YCNA 4R2HA 4WN3A 2JBHA 3MILA 5KCMA 2QRVB 4BVEA 4D9HA 3OD1A 3AB7A 5FPPA 5A0VA 3ZV3A 1FVHA 4OV6B 2O3UA 2C54A 2FP4B 3GIDA 3PNVA 5ES3A 5B7NA 5KYUB 1I9CA 3U4DA 1HE4A 4FI3F 1U31A 3BXZA 3G1WA 1PV1A 1RHQA 2JI4A 4R7TA 5ALWA 5G1OA 4KOAA 4A6EA 5E9JA 3PPIA 3M6XA 5DBFA 4HLDA 3S28A 5JEEA 2AC7A 4AECA 4HYQA 5GP1A 5EXSA 4EY8A 1LNZA 4Y6SA 1C0KA 1Z0IA 4LVCA 4EB6B 2YIDA 4LF9B 2ECOA 1EUDB 3E8SA 3H3FA 4NOMA 3W5IA 3SN6A 1JBKA 2AFIE 3NDBB 3PXXA 5D6NA 4BGIA 3O2NA 2OORA 3VSAA 3PC6A 1RAGA 2P9ZA 2CDRA 4OXIA 4DDWA 1LW6E 1XMIA 2W6ID 1XF9A 1J49A 3PLNA 2H4YA 2ORIA 4G26A 5CFQA 1Z4IA 2ZPAA 2JLQA 2OCYC 4OIFA 4X95A 2GLUA 4N01A 2OYSA 2ZQZA 4ZQIA 4AJ2A 3OEHD 3K9BA 2WI8A 4LY6A 4DLTA 2R6ZA 4E15A 2PL5A 2R6GA 2ICAA 1H2YA 1TAGA 2EBUA 2IT1A 2NACA 3LLMA 3TNYA 5I7SA 1EFHA 3G49A 5ADUS 4H4EA 2RJOA 1BJTA 4A15A 4GS5A 3ZOKA 4JJFA 2NYUA 4A91A 2ZRKA 1WV1A 2IOFA 2RGAA 4C2BA 4TV9F 1MRSA 3UV3A 3ZDFA 1H2ZA 2OG1A 3G3EA 4G56A 4ZCMA 2O0JA 1U2PA 2QMYA 4N1AA 4Q4DA 3WO1A 2V3VA 1B8PA 1XAHA 1UZMA 4LHWA 4XYLA 1FY2A 2IYYA 1Z0UA 1JXAA 3OE7D 3OOWA 2FSVA 2EW1A 5CFOA 5EHXA 4R8MA 3WYDA 1DV1A 2OA0A 5BWMA 3KKPA 1SUCA 3WLIA 3KSRA 1MB0A 3P1JA 3MERA 3WGUA 2BMWA 4B7ZA 1OI2A 1QLHA 2X86A 4ZI3A 4ZTZB 3EZFA 2XMDA 1LXCA 4IY1A 4A6DA 3C41J 3FZYA 3MIIA 4UVIA 1CEQA 2QVBA 3BZUA 2IITA 1CDEA 3KDAA 3KKKA 1IBRA 4V0QA 3S29A 1FEZA 3BMOA 3EPHA 1YMQA 1Q15A 4MR8B 4DV3B 2GZHA 2BFEB 4IH9A 1HRDA 1WHTA 1QYDA 1YDFA 3Q2IA 4MR7B 3BSFA 2PWBA 4UXHA 5A71A 4IGEA 5E4TA 3VR4A 1ZI9A 4EY5A 2B3TA 2MYPA 2PXXA 2KQUA 2UZ3A 3C3MA 4XI9A 1O4WA 3WGMA 5SZKB 4JNKA 1AKWA 1NVVR 3FDFA 2BFEA 3E1KA 3GCGA 2G77B 4MUEA 1LDEA 4RYLA 4KIGA 4HXYA 2CUNA 2C9CA 1CS0B 1YONA 1FDUA 3DPUA 3SMQA 4BNIA 1DLJA 1J23A 2E85A 2H3HA 1FQJA 1XL1A 3ELYA 1XZJA 1BO6A 4KWCA 3NBAA 4EY7A 3SNHA 1JUDA 1WY5A 3H9QA 3JD4A 3QYFA 5HDQA 2IW1A 3UB3A 1U0TA 3DOEA 4LYYA 4LMPA 4OFZA 1PNRA 3SLGA 2X76A 4ZANA 1LSOA 1A5TA 2CNDA 3KUCA 3QBDA 4PZCA 4YMWA 1ULTA 1USGA 4W8GA 4G63A 1QRDA 2VLBA 1GITA 5GONA 4JLBA 2C98A 2BJHA 3C16C 1SBQA 4D81A 1PF7E 2X3UA 1OBCA 1BE1A 1SUBA 1USVA 1G8PA 5LA6F 3EA4A 4GP6A 2WTBA 1Y9ZA 2W7TA 2X0DA 2W70A 3RPEA 2QD1A 1YZGA 2BC9A 1NQTA 3GR6A 4EITA 4DMCA 4P36A 4B8WA 2OXFA 2PMEA 3K0HA 1V8FA 1V47A 4KGVA 4M0KA 2PIDA 1TM7E 1YZ3A 4RVGA 4QYSA 1GFZA 2FQWA 1WXHA 4EYGA 3LLCA 2CXNA 3AUTA 2JHPA 3B1JA 4FUTA 3EF3A 1W96A 1QFXA 1X94A 4LHVA 5ITVA 4LBYA 3DJFA 2F8SA 4BNMA 3SQNA 1OZFA 1ESDA 3JQGB 4IKPA 4LE1A 4PRKA 4E31A 3E84A 3IAM6 4BIIA 1VPWA 4MYUA 4HB4A 1XQ6A 2D2XA 1B3BA 1UFQA 4BLOA 4B83A 1NJSA 3I64A 5PNTA 4BNLA 3U49A 2XKJE 1HE5A 3M9LA 3JX9A 3KT8A 1IQPA 1E20A 2VZ0A 3V33A 1LLUA 1TX4B 2J7PD 1SO8A 3KQQA 2AI2A 4X20A 4GZMA 4CRWB 4BFUA 1CHDA 1RU3A 2A9OA 2AFHE 2XYHA 3CKLA 2BV3A 2DPGA 2V7WA 2ZWIA 4LJKA 2VH2A 5BSWA 2P0AA 3C70A 3GWZA 2IDMA 3ZD9A 5FWXA 1IL0A 2G40A 5H02A 1AXGA 2JEYA 1P4HA 4ZAFA 1JI3A 1Y1SA 4EJMA 1JEYA 4YT2A 4HEJA 3TIGA 6AT1A 4B47A 4Z3OA 1UOEA 4MQ5A 1M0WA 1DAGA 4HK4A 4Z9FA 4ZRNA 2F3QA 5F2OA 2DF8A 4B74A 2V4ZA 3ESYA 4RFSA 2YDXA 3LQYA 3A1UA 3FAZA 4BN4A 3FI0A 5L6LB 1EM6A 3OCJA 1KBQA 3NUZA 3GRAA 1JLKA 2O5RA 2CDCA 2DSNA 4D1YA 3LF2A 1XDBA 4JUFA 2ZTUA 5AJWA 3VJRA 5BVHA 2WG0A 5AVUA 2XR1A 5E6SA 4C7KA 4B3XA 3ETNA 2RAUA 1M6HA 3M3PA 3IAM1 4DQVA 3Q10A 3MTDA 1EZ4A 3N1UA 2PEZA 4QTZA 3CF4A 2C8KA 3EQ7A 1YR9A 3M2PA 1GAWA 5GAJA 1BDIA 1PEDA 4RX1A 1SULA 2MSNA 3FUUA 4LF7B 2G1JA 1J00A 4KR0A 1DOAA 2DBRA 3NVMB 3ESZA 2XGOA 2YZ7A 2IHUA 2FN7A 3W04A 2ZWPA 4MVJG 1EP2B 3B6JA 3EUAA 2ZM6B 1KC1A 1UP6A 2FQ1A 2R7AA 3N70A 3KX2A 4HDRB 1WW8A 2VP3A 4LJAA 4BKOA 2C2KA 1JJ7A 1QGOA 1BFUA 2Y2UA 3CNOA 2IXAA 1VCIA 5C8DA 3KSMA 3UT5B 1JT2A 5GZ1A 1A2KC 4IGIA 4DQLA 4DGQA 1KVRA 4XPIB 3GI1A 1OREA 3KJNA 4HWPA 2I4LA 1G7TA 4JBWA 4B3HA 3KR1A 3T9DA 1J7KA 3ANSA 3HCAA 4L1KA 2XOKD 1RXSA 2CVHA 2F9LA 2YWFA 3IE0A 4AFNA 4PPQA 3UEOA 4IIYA 1IPEA 3DZDA 3KQVA 4LTDA 3ANXA 3PF9A 1Y63A 1T0BA 3H0KA 4AP5A 2IGBA 5IK2A 3VC1A 4HGRA 3TTUA 1JHAA 1E9EA 3G6WA 1U2DC 4Q7LA 2P27A 1S8OA 4K03A 1AN0A 1VI5A 1KU0A 1NXTA 1FLAA 2HA3A 2XTZA 3GBSA 3GW8A 5K6RA 2NVUA 2A8YA 5FF9A 3JVVA 3BIJA 3EY9A 4AZ0B 1JPJA 1Q0QA 3CEPB 5KYVA 4EO7A 1UK9A 3BXGA 1J24A 3KXPA 4AJ4A 2R6CA 1S8AA 1BDMA 3L7JA 1DTEA 3JY6A 3RTAA 3SK0A 4E70A 5B57C 2E5FA 3KDPA 1PZEA 2FV8A 3ZQ4A 4BNVA 3KZOA 2RH5A 1SRRA 1F8UA 2BL4A 2YVLA 2VTEA 1R0RE 1I7DA 3HDHA 4YUAA 2HBQA 1NF3A 2SHKA 4HAYA 3OU2A 2QI9F 3HNPA 2XJ9A 3FRHA 1OQAA 4PLVA 4QDKA 4EHDA 5ALRA 4EB6A 3NNSA 3OLZA 3KRTA 1QTQA 1EUCA 3BXXA 2JH8A 2VBFA 5IWAB 2V5VA 2J46A 2ZBEA 1PJBA 3RRXA 2C42A 1M2FA 4HGPA 4OAPA 5M29A 1DBRA 1ZIPA 4YJ2A 1GZ6A 1AKYA 3O73A 3MJHA 3AH8A 2JFGA 1WF6A 3JQAB 4QT4A 1YJQA 3QI2A 3TNFA 2M6LA 1CY6A 3D7KA 5IYZB 5C1IA 4IS2A 3C8HA 4COKA 2HK6A 5K09A 2GJSA 1CJCA 4YS6A 4L2IA 5I7HA 3TAUA 1OMOA 1T4CA 5HMMA 4DCCA 3GLGB 4RCYA 4WBNB 3OE7A 1FS4A 1JR3A 1PVVA 3ZV6A 5FLKA 1YZTA 2XCLA 3CPJB 4EKNB 2ZB4A 3ASUA 1IPHA 1L8LA 1SIWA 3MWDB 4LHXA 4YP9A 4A9AA 4Q16A 1Z82A 3N0XA 3WV4A 2ZATA 4LTNA 2VQFB 1QX4A 2EIHA 4OFXA 5FOUA 5T8KC 4DN6A 2DULA 1CY4A 4MSUA 1Y3HA 3ECCA 2WKPA 1UBKS 4L8FA 4R98A 2EVWX 4URFA 4DDMA 1MO2A 1SVUA 4F3CA 1D8AA 1DIOB 4XVCA 4LNUB 4MKFA 3KR2A 4BN0A 4JXXA 5SICE 4DSAA 4D4JA 1A3CA 2A9KA 2H4JA 2IKSA 3EGXA 4HRVA 1N6IA 3TSWA 3A10A 3Q0IA 4RM3A 1JU4A 1ORVA 2PT9A 1RAIA 4LG1A 3IDFA 4MS1A 1UK8A 5HCUA 4KO1S 2BN4A 2HQOA 3M3HA 3OPXA 3A04A 3OC0A 4JDUA 4K9DA 3VAYA 3VVBA 5LM3A 1S2IA 1NXPA 3OF2A 4QUEA 3ZY4A 2GM9A 2QIPA 3F8WA 1KNXA 4UFNA 4YCBA 4B3CA 1DO0A 3F3KA 2ZJAA 4WNCA 1QK4A 1AK9A 4A8JC 2IBMA 1HGXA 4YAOA 1KI8A 3WWYA 3PJGA 2OAQ1 2FG6C 4M8LA 2CJPA 2P5TB 1E5XA 1R4ZA 1YRAA 4YRLA 3TAHA 3X1YA 4QG7A 5EJEA 2IEYA 1T5IA 3PYMA 5F1KA 3OFJA 4DBZA 5JCJD 5D1NA 2DY1A 2QKYA 3GN2A 3PGJA 2QSJA 1BGWA 1L9XA 1D5WA 2WPDD 1KH1A 2XUIA 1X19A 3U3RA 3PHLA 4WIAA 1Z6GA 1TT5A 3NRJA 1TPZA 2ZUFA 2SKCA 2EFCB 2WSSD 4BS9A 1EAYA 3B85A 2P7IA 3B78A 1AKVA 5KAMA 2GTPA 5MFZA 1X7ZB 3IO5A 4EYKA 3D7SA 2BSXA 2I8CA 1WPGA 2ZUWA 5FX2A 3EWIA 5T64A 2PDAA 5EE5B 5H0IA 2PWPA 4I8XA 3SHQA 4PAQA 3UQYS 2IPMA 4TN1A 1T2NA 3I30X 3H2JA 4UE3S 5HF8A 3GLGA 2H29A 2V55B 4EVIA 2AF4C 2Y92A 2BM9A 4EHIA 5FWYB 4B3BA 1G8HA 4Q7JB 1PYGA 4WJZA 2Q9CA 1QDEA 1X9GA 2RGWA 2Y1DA 3P2KA 1WW3A 3FOZA 4YCJA 3GVHA 4KO2S 1G3UA 3GNTA 4PC6A 5JE8A 4AG6A 2OSVA 4UAGA 3DTTA 2XDWA 3IHWA 4HYYA 3DZBA 4MPDA 4PEVA 1P5HA 1WVMA 4FNAA 3FKSA 3GFQA 5HRAA 2YJ5A 3WQHA 5LIPA 1EFAA 5IT4A 3U1TA 4MPPA 5KYYB 3R0ZA 1DINA 1I4OA 1C30A 1X80B 2NTEA 3NI2A 1E0SA 1P2BA 1LPBB 4J9UE 4Q3CA 4XGNA 3ORHA 2RGYA 2HRBA 4O4HB 1OH7A 4G36A 3NR2A 4DSTA 1QF6A 2WTEA 4GOLD 3TDKA 3QU5A 1VRCA 1I24A 1K3UB 4EAQA 4DA4A 5C5CA 1KEZA 3HSYA 1L7AA 1XVTA 4YA6A 1J1IA 1WMAA 2Z43A 2BTEA 5CDTA 4L3VA 3DE6X 2RFLA 3Q2OA 3WB0A 4JEMA 1Z74A 4I1RA 1E3QA 2XVYA 3OO0A 4TL9A 2F62A 3KYCA 1RHKA 3NC0C 1DAHA 1UDWA 3WC4A 5JRJA 4BB0A 3OFSA 4LN1A 4M1SA 4KNWA 2C2WA 4D57A 4BAGA 3OWXA 4OEHA 1UKZA 3N07A 3TECE 1D04A 3I45A 4NFHA 1JDZA 1F2TB 4YJHB 3TM4A 4N5LA 2PWYA 3FSGD 4OX9Y 2PXCA 2XWQA 4JBIA 4KR6A 1G66A 5DBGA 2E5LB 4MVJI 5FADA 1L4HA 2Y1EA 4B6JA 3P9XA 3IOMA 4KVGA 1NJ6A 1XWFA 4AWBA 3PR2B 2O3RA 5HKOA 1FMLA 3UJ8A 1KK2A 1JDBB 2H2GA 2QOEA 5AK6A 1DQPA 2WAXA 2WT4A 4BO9A 1Y6FA 2B8WA 3PRKE 1KPGA 3UPUA 5C31A 3TSZA 3GO4A 4IW3B 3E15A 5CNMA 2HMAA 5EZSA 4DANA 1SC1A 5M5BA 4RHUA 4PTLA 1N2CE 3HPRA 2P40A 3NHBA 3RU9A 3PHGA 2Z8ZA 2GZAA 4ZKEA 3KEFA 1P6XA 3BIXA 4AF7A 1XMSA 1ZDMA 3AVXA 3PC4A 3MWGA 3LCRA 1EK6A 1YR7A 1NYTA 2CHFA 4N0MA 1V16B 4MQUA 1ND6A 1JEEA 1NONA 5FBZA 1U2GC 4OBXA 2H85A 1IONA 2QROA 1T5BA 4Q66C 4RVHA 1N25A 2YMPA 1DC7A 2QV0A 4GWGA 4KQ2A 4U7FA 2B61A 4M8NE 3C39A 4QFCA 5U4XA 5JFTA 2AMVA 2C8JA 2L69A 4LC0A 4RVNA 1U80A 1TZ2A 3KYDB 3NJ4A 4KFRA 4WGGA 3RIXA 3TKAA 4EENA 3B6ZA 4BZPA 4KCGA 2GJ8A 1SCAA 2H11A 4L8GA 1RWOA 4WDQA 3U9SA 3BH7A 4FC7A 3VSDA 2BFWA 2QYTA 1JWLA 4CR8A 3R3UA 1TTTA 4L9SA 3UVEA 4CL3A 2VQ6A 2OG2A 1I3OA 2DOKA 2R5FA 4DDUA 1YOBA 1EA5A 3H86A 4E07A 5F3WB 5CH3A 4A1OA 3AFNA 1DTWA 2NTNA 3GCXA 3C3BA 2ID8A 4FKMA 4B6RA 3L1JA 5H3LA 2HF8A 1PDOA 5CDSA 1SXJB 2GLXA 3ON5A 1K7CA 4KITB 5JZMA 1ZY2A 4A0SA 3LUCA 4HVAA 5DX1A 4TWJA 4YN3A 5CR9A 4RSHA 3BB1A 4J1NA 2GGSA 3J7TA 4CLRA 4JT9A 3E18A 1WXWA 3RK1A 1ZP6A 2DSTA 2O2HA 3A05A 1CUHA 2SCUA 1E6EA 1VLVA 3QWHA 1R74A 2DUWA 3QFCA 5ENZA 4RDIA 1E6LA 1NE7A 3JYLA 2B6NA 1BMQA 2CXQA 2HSGA 5A3VA 2QGFA 4BX3A 5IDQA 3WB1A 3HUEA 2EERA 1CT9A 2JRLA 1IN6A 2QAJA 3E7XA 4X7RA 4I46A 4TRJA 5BN4A 1JQJC 1Q3KA 1U2QA 2FU5C 4YALA 2BF7A 2NM0A 3K30A 1OPXA 3G9TA 1RLMA 4LGYA 3B1WA 4E46A 4H7KA 4II2A 3DO6A 2CLEB 1Y3DE 3ZY5A 5IJWA 5AHRA 1OAOC 2NO6A 1QU2A 1ARZA 3HBLA 3KOMA 3P9NA 3M6IA 1T29A 4KXMA 5A02A 4IIEA 3VC3A 4OJKA 1U8CB 2V9ZA 3L46A 2QDXA 4M98A 4NZ9A 5BQXA 3KLBA 4DNOA 2JB9A 1BCRB 3B9RA 2V6MA 3QLUA 4BBAA 2IOQA 5KMGB 2AHRA 3WRXC 1J9ZA 2BM0A 2HCRA 2H1CA 2K4MA 4LKOA 3SEAA 5IX8A 1K6JA 2O14A 4KQ9A 1HMPA 3VHLB 3O3CA 4AMBA 3ILSA 1NY5A 4NYIR 2KX7A 4WUVA 1Z8FA 1EINA 2O0MA 2VNHA 2GN2A 2WA1A 1E58A 1OYOA 3GAAA 4J1TC 2ONJA 1CEEA 3EGIA 3HCOA 4TZ0A 2PUVA 1PWXA 3HN2A 1XQWA 2BFFB 5A3JA 1IMJA 3IEUA 4DSZA 3VNVA 4EAAA 2C0PA 1G63A 2VA9A 1THMA 3TX2A 4WKPA 3K2EA 1JLLA 1RBQA 2N47A 2Z2YA 4LWQA 3B1ZA 5J43A 3PD7A 3MG9A 3W3AA 4R1SA 5LVAA 1QTIA 2IYZA 2J0EA 2VKTA 5JBNA 1Z0JA 1H5NA 1SD1A 4QA9A 1WOMA 3CIFA 1C8KA 1HG1A 4G9GA 7ADHA 2JCBA 1SHLA 1A8SA 1MAHA 2R6R1 1RPAA 2G76A 3WJ7A 4Y1EA 1HDXA 5HEKA 1NMQA 2KS6A 2MR6A 2VUHB 2YIMA 3PUYA 4QLOA 1SD2A 3FDJA 5DBHX 1KSHA 3QVOA 5A6SB 3QV1A 1I3MA 3DDZX 5MGBA 1Y9EA 2PBRA 3D5QA 1C3VA 1X1AA 1OLSA 3IDOA 1B8VA 2WJYA 3HVJA 3K16A 3PNQA 1FU4A 5B3JC 4UHJA 1E9DA 2IU3A 1OH8A 2PUGA 2YRFA 5IFLA 3M89A 5ADVA 4K5QA 5I7FA 1E1RA 5H70A 1AXRA 1E8MA 1H2FA 1LVHA 4RZUA 2EKPA 1PEKE 1N34B 4NI5A 3AF6A 3G59A 3ZXYA 3L79A 3KD2A 3B1YA 1KSFX 3JSAA 4MS3B 2BKUA 4XA8A 1Z2DA 4GI7A 4K9MA 2HX1A 3WLNA 3QHPA 2J9FA 2PD4A 1GZUA 3R3JA 4Z2AA 4J7AA 3S1SA 4RBNA 2BH9A 3HY3A 1KY3A 1M72A 1UKVY 2HN9A 3S70A 5B4UA 1DCFA 4ITVA 1W47A 4YUXA 5F2NA 1D2CA 4J4HA 4B3TB 2R5WA 2CHEA 2H8KA 2QPAA 1SU6A 4DFDA 4X1KB 3A4MA 1O08A 4NV0A 1RC8A 1EGVB 2MINB 1THZA 1X38A 4JP3A 3SIPA 2YZMA 4XZ3A 4BO8A 4D9JA 4DMFA 5CEJA 1B1AA 3WA7A 1H0HA 3OFND 3DO8A 4KHPB 3EIXA 5IN5A 4O2BB 1KXZA 1RHJA 3HY6A 1DTWB 3T9CA 4F60A 2VRCD 2XCQA 4FW8A 3OCCA 3OJ0A 5JNWA 1TCUA 2GI4A 1DKRA 1NVMB 2RSLA 3FDZB 4RLHA 2EFDB 3CGWA 4BNWA 4C2UA 1QH1A 4C3OB 1DX9A 1ZMXA 1R6VA 3DMYA 3MOIA 4OFBA 3H8JA 1ECCA 1OTHA 4PONA 1KZGB 3A36A 4RVOA 3UWKA 3ZXIA 4X1IA 2P6NA 4B4VA 4M8IA 4PBRA 5JNRA 4ETWA 3LQKA 2JFQA 3A3OA 3OAAA 3S8MA 2WYVA 3WV5A 4WD3A 4EKYA 1WM1A 4TL6A 1PJTA 4MIKA 3IB3A 2BRUC 3BEDA 1USWA 5JARA 1G9SA 4PLWA 2PA0A 2P11A 4D6XA 4M60A 1T8PA 3CSUA 4HFNA 4PPGA 4CNQA 1FUYB 1QV9A 4RH3A 4X6YA 1AB6A 1ZM2A 2QU8A 3G0GA 1KMCA 4CWAA 3HYSA 4MWZA 4EWLA 4LZJA 4TLLB 2EATA 3GLHE 3FPBA 3QVJA 4CLXA 4KLZA 1Q2UA 3FNRA 2MYUA 1SOAA 4MV8A 4C14A 1V9LA 4A03A 4N9QA 1G3RA 5CH5A 5TJHA 1H6BA 2KHZA 3GZ4A 3W06A 3VOSA 1DGQA 3C6MA 4Q01A 5M04A 1L5QA 5CFMA 2IQ5A 5EUMA 3VPDA 1QWSA 3WGLA 2P9HA 1ZGCA 5I8ZA 1Q95A 3V42A 2HHHB 5BN4B 2H48A 4KE8A 4WHMA 3GVCA 4EQ6B 5A3SA 2F00A 2ZDHA 4D8WA 2ETVA 2I3AA 3CLRD 3KUKA 4HQOA 1M0EA 5M3BA 4ALJA 4LKRA 4HDNA 4KXUA 4BMNA 1YV9A 4AX4A 3W1EA 5DLEA 4HH4A 1U0RA 5E8RA 4B79A 1WF3A 3GRCA 3DL7A 3IA2A 3WLOA 4B4UA 4DQDA 3ZD6A 1L6RA 1BKDR 2WHPA 1AURA 1ZM4A 2PVCA 3BHMA 2VOEA 3IP3A 5JSFA 3EARA 4IPTA 3S81A 3FAKA 3NHUA 2B2XA 5EP2A 1AY0A 2AVDA 2HDNB 3ZTTA 1N5OX 4NDNE 2ZSHA 2FLWA 4RZSA 4KE7A 4TS3A 4YV0A 1NBME 5D6OA 1VECA 4JENA 1I2MA 4MJLA 4IGAA 4D80A 3OPYA 2Q3DA 4R69A 4O1MA 1N2CA 1SC4A 3KKLA 2JFFA 2Y0EA 4PYMA 1JYSA 2XYGA 3DTYA 1OI3A 4NNOA 4WKGA 4G6ZA 2Y2VA 1XZDA 5IZ4A 2GSDA 1QIGA 1B6RA 3P20A 4QJ3A 3GP8A 1P4JA 2FWMX 4CKCB 1QU3A 1CR2A 3VU8A 1TF5A 3N6XA 1XRRA 2G0NA 3EEIA 4DLSA 1U81A 4R01A 4R9UC 5F7JA 1JYFA 1UOQA 2JZCA 1WCYA 3I9FA 2ILTA 2QJWA 3RVLA 2AN1A 2ZRIA 1JR6A 3ZHOA 3JWJA 3QXHA 4KXQA 4UU8A 5ICSA 1SAYA 2ZK7A 1P31A 3QU2A 3BS4A 4LDRA 3PQ6A 1GQFA 3JARA 2XSZA 4BU1A 4P54A 4EF5A 3GPLA 4MUGA 4ND8B 1D4AA 3PI7A 4KQWA 4PX3A 3SQLA 1BXGB 1QKKA 5EHZA 1WNFA 5KOIA 1PTJA 3PFWO 5LKAA 3ZJ5A 1DBPA 4PLZA 5HQTA 1EB8A 1TLFA 5CDUA 3BMXA 4WXPA 1UODA 1TE2A 1WY7A 3SJAA 2PGNA 2VLIA 4N5IX 1T5DX 1FMJA 1MOZA 1P2DA 4GDMA 2YBDA 3BD7A 1U3FA 3CJRA 3DNMA 4MVYA 4YJDA 4D9FA 1KZ6A 1P6QA 2DPXA 2IYVA 3H5TA 4EF4A 3CIOA 3GZNB 4GKJB 4QQFA 1DQRA 1WCV1 2A0WA 3M0EA 3OZRA 4OLJA 1E92A 4R84A 4RETA 4P2GA 3N8DA 5CNJA 2QUKA 1BXRA 1KR5A 3RG2A 4A0HA 1SCKA 16PKA 4G5QA 1CQJB 2O0LA 3FSJX 4N7RA 3TGPA 1EXMA 2YWCA 4P8RA 2Q0HA 1X1QA 1ADYA 1W88A 1CG6A 1DIGA 4NAUA 5BO5A 2VZ8A 4HFJA 4RO0A 1E2LA 2QPLA 3QNWA 3HI6A 3HR4A 3PITA 5EPUA 3RD5A 4ZVPA 1HDZA 3K8QA 3SE0A 2EWMA 2C9DA 4WT7A 1I2AA 4R1QA 3THXB 1KK3A 3GN1A 2Y9MB 1SCDA 4QVKA 4RMGA 4HPXB 1A7KA 1ISSA 3ND8A 3O8OA 2GERA 4MUIA 4ZU6X 5IM4A 1OTXA 4TT3D 4PZEA 1G5TA 4P3XA 4TXHA 4G2TA 3DBRA 3BTOA 2W93A 1MO6A 3T95A 3VR5D 3VPXA 5BOSA 3ZDBA 1ECPA 1Y8CA 1NM5A 4IYJA 5B5SA 3LYHA 3KR9A 3TOCA 3MCVA 3NYWA 2XAAA 4K6MA 5EJ8A 1OGJA 3OETA 3U48A 2XYRA 1W4ZA 3GA0A 3UMVA 3LY7A 4INAA 1ZL2A 3SEFA 4MAMA 3WIBA 2OO3A 2YV4A 1J2EA 3D64A 5K3FA 2IGTA 2AFVA 4GZ3A 3BT7A 1M0SA 1WPRA 3FYUB 2BFDA 2CHQA 3STXA 3R7WA 1TUIA 3HJNA 4UVHA 2GXUA 4YI3A 3NGXA 1MENA 3WGZA 2ZRLA 1YHNA 2PUHA 1FRQA 4A2PA 1AQJA 5KSWB 4O0MA 3H5VA 1ZEJA 4X65B 5F77A 3LUFA 2Q6IA 4IHQA 1MT0A 1LPAB 4Q1AA 3LC7O 1K66A 4G4IA 1WTAA 2CL6X 4N7JA 3O38A 1TXGA 3R7WB 2NU7A 3QLTA 3V97A 3W9UA 3OKFA 2BELA 4E88A 5AVQA 4CEJB 2Q1SA 3N2YA 3SZUA 1U1IA 2E1PA 1JHZA 3UFBA 2XKBA 2JGRA 2VTBA 1LFAA 2Q29A 2WF9A 2ZM5A 3Q1KA 3RF7A 1UP7A 1ZOIA 2OHGA 3ET5A 1WP4A 4JR1A 4FN4A 1TVKB 3VU0A 4WACA 1EFVA 4D4MA 4MGEA 1AMOA 3IAAA 1BWSA 1BH6A 1AKTA 2N9UA 3E9RA 3UGQA 5LU8A 1EDEA 4H0CA 4LXTA 4ZVVA 1T2EA 2CFTA 2GJKA 4UHCA 1UXIA 1I6WA 2YL2A 2HSWA 2YQ4A 3CINA 4DRXA 2BHSA 3THWA 1KF0A 1UC4B 5F76A 3IUPA 1N7GA 5IKMA 2HMTA 4OSOA 3MJTA 2G9NA 2QX7A 2DR0A 3G0OA 2OD7A 3EIFA 4RZQA 1PVOA 4EG1A 3NX4A 4IXMA 3RFVA 1E0KA 2G1AA 3V2IA 1Z4MA 3O03A 3LSTA 4FSXA 2UVDA 4XKJA 4MI9A 3T3PB 3CLKA 2GK3A 3K53A 3S5UA 1VGQA 2Q21A 2PBLA 4N3BA 1U7UA 3QG5A 1NBWB 2JATA 2PUEA 1Q0ZA 1FSGA 5AJZA 4ZT6A 2WYHA 4H1UA 2P90A 5BURA 2BMEA 2C61A 3VRHA 3WWCA 5EMLA 4UEKA 1ZR2A 2XGJA 2F1KA 2P1RA 2NUTB 1S1CA 4XEHA 1Y3BE 3PCXA 2AQHA 3MS2A 1QTNA 2IEGA 2PLWA 3VHXB 1R4MB 3CZAA 2VR1A 2H08A 3B82A 3V6MA 1NDUA 5CXXA 4GNKA 1FTYA 5FDFA 1KAEA 1V7PC 1BH2A 3BRQA 4FMCB 3M1LA 3FYUA 3QUBA 1SKUA 1W0KD 4TRMA 1DSSG 1GPWB 4OL0A 1VIYA 1VFNA 3U5TA 1FVXA 2FW7A 2RHGB 1QIEA 3KHKA 5B4TA 1UDCA 4YCSA 4XWWA 1XRSB 5KYUA 2ATIA 3EC2A 5F3RA 4DQXA 1CPYA 2BP7B 3I1IA 3BREA 1OVGA 1E59A 2WJIA 4IIHA 3KQHA 1D09A 3SEZA 3MINB 1IHDA 1R0WA 2P2ZA 1R0KA 2HSDA 1FFBA 1AZLA 2NZWA 2VIIA 4CFZA 3MJ4A 2NGRA 1ODKA 2P62A 1L7BA 2HBZA 4GX1A 1R9JA 1DE0A 1AA9A 1F3OA 1GL7A 2J9YB 1FYFA 1PW7A 4M54A 5A2GA 4PGHA 3QKWA 4C3ZA 4UC0A 3OP4A 2VPIA 3L7BA 3MF4A 5ESXA 3D8NA 3HC7A 2C4TA 4DRXB 3H9GA 1NF8A 4OY3A 1WQ3A 4Q4JA 3VPFA 3HGMA 1XDUA 1GZVA 1H2RS 1FNNA 1TUGA 2F43B 1NUSA 1JG4A 3S2ZA 2WF5A 3BGIA 1V8PA 3B1VA 4KV9A 4EG6A 2C9ZA 2ZIEA 3RNOA 2ZLBA 3K09A 3PKZA 3V4ZA 5KVAA 5I7EA 2VRWA 3NC1C 3ZLJA 1BX0A 1RZVA 1SUWA 3FTCA 4YFYA 5EFZA 4RKRA 1LV8A 5IG2A 5FPTA 4ZGBA 1SC9A 1H1LA 1AH2A 2M98A 1XE3A 3B48A 3T5AA 4JYBA 3BB3A 1I33A 4IINA 5K3OA 2IVFA 4P08A 3TL6A 4D8UA 2XMQA 3H19A 3BORA 3E3NA 4UU0A 5JW6A 2X0NA 3KG2A 2C5LA 2XQKA 5H80A 4YIKA 1C4XA 2C88A 3IKTA 2NUBA 3QMMA 4JC4A 4UUBA 2MSCB 3EOBI 1MA3A 4HZIA 3DSRA 4JI6B 2PS1A 3V1NA 1YQEA 5EXTA 4UTZA 3PX2A 4PX5A 3MQ2A 2W43A 3IERA 3LX4A 4M86A 2BDUA 1UANA 4MP3A 3VR5H 3GPDG 3MCAA 4PG7A 5FUVA 2EBHX 3EK2A 3MINA 4IIVA 4P4NA 1SQFA 3H2HA 3TLGA 4ZYLA 3NVKI 2O3QA 3RRFA 2DGDA 1R27A 4UHHA 3KKEA 5BWBA 3U4IA 3WNQA 1EWYA 3IRUA 4MR9A 4CPDA 3BIOA 3JVUA 1GL3A 2D0PB 5YASA 1RXWA 4JOBA 1U6KA 3Q7PA 1DWQA 1YFLA 1CB7A 4MMZB 4MVJD 1TLLA 4ZHQF 1LX7A 2OLEA 4EY4A 1XL0A 3E53A 1F48A 3Q9NA 4Y6QA 4PFSA 3BD8A 2PZJA 3CEMA 2PCJA 5AICA 1CY1A 4LF8B 5IRCD 4KIUA 3DFIA 1CUAA 1FK8A 2DFPA 3UTCA 2VAVA 1RBYA 3I6BA 4KI0A 3RSCA 3EZ2A 1V3QE 2LWIA 3CLSC 3PSHA 1ZOOA 3FPJA 2HV9A 4WCFB 1D5CA 5A5GA 1QAMA 2AFHA 4NMXB 4C4TA 4WKNA 4L3WA 2HIMA 1J8DA 1OFVA 4HDKA 2XI4A 4TXLA 1DP4A 5GZ3A 3KU1A 1VG8A 4LMAA 2C9MA 2I62A 3GFTA 3MTQA 1DC5A 3GJYA 3L4BC 2H4WA 4FXOA 4WZAA 5J2UB 3UNXA 2ZUDA 1OF1A 1PU2A 4E12A 4ZZ3A 5DN9A 3EGOA 1CQZA 3LUDA 2X2EA 3JVIA 3VFDA 5E6SB 4QNMA 4B3MB 3ZEIA 5TPZA 1W8IA 3NFYA 2GCIA 1I1NA 1WSWA 2QTGA 3VBEA 5J2UA 1GKYA 4PS0A 1B2RA 1II9A 4DA8A 1Q22A 4LQDA 4PSAA 2IEAA 3AUUA 1A1VA 1QV7A 4GPBA 4J0FA 4R83A 1OTYA 2YVUA 3C5HA 2HAEA 3G85A 3NJRA 4I55B 4YP1A 4RMHA 5CDYA 2IYAA 2OHIA 1YFZA 2D2FA 3AETB 1HZZA 2B82A 3D0OA 1CWUA 3N76A 4IVQA 1FFCA 4KH1A 2EGHA 4QUJA 1NLUA 2Q7OE 3KE8A 1S3IA 1PFYA 2QNIA 4CQMA 3L4JA 1VA5A 2G8LA 2GK6A 2ZS8A 1F06A 2AOUB 1AB5A 3G2JA 3HABA 1WNTA 1E7MA 4A16A 2AI3A 4V0KA 1EGQA 1P1HA 1X8LA 1YUMA 2QIOA 2Z9DA 3FCEA 3MAGA 1I80A 3ASYA 4RF3A 2I78A 2EL7A 3H2YA 3FOAA 1WB9A 2EW8A 1CFZA 3I2GA 3JYQA 1U99A 3SJUA 1CHNA 2WQZA 3W4KA 4DLRA 5P8WA 4JT8A 2V6FA 4AN4A 4B4KA 3LDUA 3U56A 3A14A 4PINA 2ADOA 1EPUA 2ZULA 3M1YA 4GM0A 4R9SA 5E6UA 2JBWA 3EB9A 4ZK6A 2C5BA 1KY2A 3JPWA 1PR9A 4O2AA 4DB2A 4RFSB 4JQZA 1IM2A 5ALUA 5ICCA 4YUYA 4JKIA 1M2WA 3KTOA 4KZPA 1QHXA 3WMGA 2QZ9A 3QOYA 4TKMA 4HQKA 3EDCA 3MTBA 5HSGA 1JEYB 1KAQA 3EXAA 1YKGA 1L5KA 4CQMD 2ATXA 3DBRB 3HS3A 2D0DA 2JPDA 2H4XA 1OLUB 2YXDA 4DM7A 1MW8X 2GXSA 5TC4A 1ZQ9A 2QI9C 4R05A 4N41A 4IVPA 4BFSA 1H4TA 5KREA 1ZVJA 1YDEA 1ZLYA 4L7QA 2IYFA 3HP7A 3WL3A 1EQ2A 1TECE 3O1IC 3DWGA 2ZPUA 3DYBA 1LEHA 2X5OA 2AD1A 3LWDA 4G24A 4LWOA 1Z7EA 3PLRA 1F8XA 3KPJA 2B4YA 2B20A 4M21A 3DHVA 2RGGA 3E5MA 2CMHA 2INGX 3UTDA 1U65A 4B7XA 3AO0B 3FWKA 4PAMA 4BZWA 4QASA 2FUNB 3D4PA 2FPPA 3IKVA 4R5HA 5K8TA 3WBKA 3D0KA 1EZZA 3MCTA 5CAEB 3U4GA 2IBSA 1W2HA 4ME6A 3K5HA 1NXQA 5K6AA 4DWVA 4B7UA 3T5BA 3HU1A 1ZJYA 2IOFK 5GIPE 3EMVA 4I8DA 3WL5A 2I7XA 5JMWA 2Y0CA 3KWMA 2G63A 3UV7A 1H2AS 4XQGA 4FZJA 4IH1A 3RC3A 3A9WA 3D5EA 4EG4A 1NHGA 5EXXA 1XLTA 4R2KA 5DB4A 4QBTA 4A92A 1V5FA 3O2QB 4GPIB 5TQVA 1V95A 2VAWA 3GOQA 4IDFA 2GETA 2YZ2A 3RVPA 3WLRA 3R40A 1WDMA 5E3IA 3SXJA 1C7QA 2I1LA 3JQ9A 3LWZA 4ER0A 3UKDA 4XSGA 2QTLA 1LQTA 4ZEMA 1BQ3A 2FFJA 5GIOE 2FPIB 3PQ7A 3VKFA 2GPYA 2R84A 3KB1A 1L5HA 2TYSB 5C4IA 3QE4A 4X60A 2HR1A 2BGUA 2D8MA 1I36A 3DMFA 2QJOA 1XGKA 1G18A 3TOSA 1ICEA 1QQTA 5EC8A 3VYTB 4J0QA 4MROA 4BEWA 2B7BA 4UNPA 3S1AB 4CU2A 4I5GA 3L5OA 1OSNA 3BMQB 4K8RB 4XGIA 1JFRA 4GC9A 1M1XB 3OLXA 4GW3A 1CD5A 1QVRA 2I1VB 4FYYA 4GMDA 4MWGA 3P9QA 2DCUA 3F6EX 3GBPA 1OB2A 3HCRA 5D84A 1DRJA 5DKFA 5M2QA 1YI1A 1M7HA 2JAWA 2WWGA 3EIHA 5HR5A 1TCAA 2X0JA 3ZTWA 3DE7X 1YULA 4IYRA 2PTGA 1QE0A 4WASA 3V2GA 4GUDA 3HB1A 5KTMA 1ISRA 3KT6A 4F45A 1L5ZA 1U3DA 1W4LA 4JL8A 4O25A 3WZ2A 2D5BA 4EMTA 3PUJA 2ZUSA 3BBPA 3DDHA 4NDAA 3NATA 1PBNA 1Y3CE 4ZAVA 3F49S 4I4NA 1AGRA 1UPAA 3QVMA 1G8FA 2ZAYA 1S7GA 2BMVA 4NTZA 4RSGA 1NW7A 1U8ZA 4TWBA 5CX1A 3SHTA 1NBEA 3OFNA 4PCLA 4BUZA 1V43A 2XDQB 1UINA 3RTGA 4EO4A 4UFPA 2QLFA 3ITKA 4P98A 4IMRA 2I4OA 2IDKA 5C5EA 3M4NA 1HH4A 4G37A 2E21A 3GPIA 1Y6GA 4RD1A 1MXFA 4YRPA 2HJRA 1JQDA 2AOXA 2GYWA 3G8BA 5KNLA 1EB9A 4BLTA 1BMDA 2P2GA 3K31A 1ZNYA 3LPAA 1I3NA 4MJ7A 4QU5A 2XUAA 2XZDA 4HDSA 5ESWA 1YVEI 1X42A 3SR4A 4DV4B 1Z2OX 3CHYA 3EH1A 1U2EA 1XF1A 4UVEA 5IVHA 1MRNA 4EK9A 2ZVJA 3OJFA 4RK4A 2AQKA 1E4YA 2EBFX 2AQIA 3CH4B 2OUKA 4JEIA 3VXKA 4B3SB 2C04A 4ENTA 3DMDA 2XYQA 3G9UA 1Z18A 1E1RD 3Q7SA 1KVUA 4LDZA 4M6WA 3ROMA 3SQOA 5B53A 4CFYA 2VK4A 2OE2A 2WFLB 3BTSA 3EAGA 3EQ2A 5HQ3A 3E9DA 5JQGB 4Y8VA 1KDRA 2P91A 1SN7A 2NVUB 1JKFA 3S2IA 4DV1B 1G5PA 4NP6A 2VHTA 4B76A 4G8BA 5LIRA 1ZD9A 4LXUA 3SKYA 1PS9A 3UW1A 1VG1A 3A9CA 1X39A 1VGVA 3L0ZA 1EEXB 1RNLA 1ISFA 3X1ZA 1RQGA 5LP6A 3L4EA 2AI1A 3GUYA 2ZW9A 3GJZA 4DWWA 1QRAA 1A2BA 1W5TA 1QOQB 1M2GA 4TTSA 2AOVA 3ENQA 2O7NA 2ZYDA 4FHEA 4PYRA 3ZY2A 2BVNA 1Q1NA 1GSAA 1KY5A 3HA2A 4OKNA 5JAZA 3R3YA 3E23A 1P9OA 1VKNA 2BEWB 2Z57A 2YHAA 4ESVA 2BHNA 2Q5FA 5FLYA 4HWKA 3QEJA 3KYBA 4FFOA 3IAS1 1MF7A 4R41A 2NZ2A 4QGSA 5E9WA 4KMOA 1PX2A 5BP7A 1USUA 4K8OA 2GHIA 3GMIA 3LT4A 1MAAA 3KU4A 1Q16A 2QVCA 4S0ZA 1C8BA 4UZEA 3K1JA 3UCFA 1OAOA 4YJ2F 5ECWA 3O95A 3H18A 5GY7A 1LLFA 1YDHA 3L1VA 4C0XA 3ZGYA 4CG3A 2ZRJA 2HGSA 4JBHA 2RCNA 2SBTA 4HQNA 1RXUA 2EHJA 4BTLA 1K86A 4U2GA 3WQSB 4XX0A 5JECA 1UKYA 3Q4GA 4S1TA 3AEQA 5DF1A 3TZLA 2EFHB 3FYUC 2I91A 2HI0A 5JNVA 1W25A 2JCGA 2DLDA 1NNI1 1JT9A 4M6WB 4L08A 4WLNA 1M34A 2Y0DA 3PQ3A 3BHJA 2YCBA 3JW8A 3A4IA 5ALGA 3VX4A 1R8SA 1P2VA 1A9XB 4KX5A 3X3HA 4MP6A 1BMFA 3WKDA 3OCUA 1HQKA 1ZVKA 1YK1A 4Q7MB 2N3ZA 3N2NA 3DZGA 3OCWA 1TZMA 5IMSA 1XAGA 1YRQA 2P1ZA 3F3MA 3S2SA 4M1WA 3O8QA 2XRMA 3NKLA 1I1OA 2VN8A 4IBOA 2I4NA 3EEOA 4KQIA 2FHPA 5E9QA 2ZROA 3R0QA 5K4HA 5A1TA 3BGDA 5A4KA 3DBOB 4EUSA 2YMLA 4NJMA 1FMCA 3RIHA 4HAXA 1DMSA 1NZFA 4ZRMA 3OJOA 3EF1A 5CB4A 5LYYA 2XLBA 2QG9A 3KB8A 3WK4A 5ALXA 3PEFA 1MGOA 1LTQA 5DO9A 3RKSA 4XFKA 4M7PA 1OXUA 2IQIA 3MXOA 3LT1A 1U0HC 3DAGA 1O96B 3H5RA 4RF5A 2VUSA 1JR2A 1E0DA 4LZPA 2C95A 3OZWA 1ZD4A 1PZHA 3TOVA 2B1JA 1W85B 2YYYA 4IF6A 2H92A 4NZNA 1PQPA 4PHFA 1L8QA 3SGLA 4JBXA 3W7VA 1XMQB 4D25A 4ZYYA 1ELOA 3AZQA 5IF9A 1RZRD 1T2DA 3SF8A 2W0SA 3KHTA 2VDRB 5JMTA 3AM1A 4ESOA 1QH8A 8ABPA 2WW8A 2BFCA 3KZMA 2AT1A 1GZSA 2JGAA 5D5HA 4HPJB 3SZGA 4PBTA 5KX5F 2RD2A 3L40A 4PTZA 3B5JA 3ZWCA 3ITDA 5CCXA 1DO2A 2HIAA 2WVHA 3JWGA 4KXFB 1KOFA 1JAHA 3G8AA 3SICE 5KYKA 2O4UX 3FBTA 3WNCA 2FR8A 4IL5A 4AL4A 4CM8B 1ZKDA 4A27A 1DKLA 3PB3A 5F9MA 4OB6A 7REQA 1J42A 3P9YA 1KMIY 3O8CA 1QIIA 3FHOA 1IEWA 5KIAA 4PSVA 3CNBA 4EI9A 2QNBA 4MS3A 4O3MA 2VHYA 2H4ZA 1MVNA 3W6PA 1KTVA 2XNDA 4TTPA 4GYJA 4FYKA 3DBVO 1JJIA 3TQSA 1N3LA 3EPPA 3EVEA 3PJFA 4MVJF 5DGHA 4IUYA 5JIBA 4ZQBA 1KGSA 1DBQA 2A1TR 2CXRA 4K0RA 4G0PA 5BQPA 3U0BA 5E1DA 3HL0A 3MJVA 1NSFA 1VE9A 5LA6A 2VDOB 2GESA 3CPHA 2HK9A 3H8VA 3LS2A 5KYYA 4R7GA 3OOSA 5I8PA 4XLZA 4N39A 2B69A 5EXPA 3AU9A 3BERA 3R24A 2W2NA 1Z2CA 3FYTA 4OBBA 3FB1A 4Y9DA 3KYCB 1XDDA 1XEXA 2IPAB 1F1JA 3HVHA 3IDSA 1GT91 2CFSA 3K7EA 4NONA 1YACA 2C4KA 4DSUA 5KSOA 3GEDA 1CZHA 2VJYA 2O2YA 5I3ZA 1CEXA 4YMUA 5JNUA 3PE4A 2F67A 5K4AA 1YA4A 2G28A 2HYDA 2R47A 3VX3A 1FP7A 5I9BA 3VNBA 2QE7A 3OPYB 1YZUA 2HPAA 3E3MA 1DRVA 5FUXA 1GU7A 2JGDA 3EFBA 4MI1A 3FJYA 4GPZA 4Q47A 3IMEA 4FS3A 3OQVA 3S1LA 3V4OA 3VAZA 3GFSA 1U7PA 1P2FA 4BQFA 4DQKA 1RXYA 1X77A 2QYSA 3DLIA 3SOPA 2B92A 1M10A 3BRWA 3QA3E 5FI0B 3BK1A 3ZCVA 4I9FA 4EDFA 3CGGA 1QRUA 3WSWA 3O9ZA 4OOFA 1FFHA 4LJ8A 3FMPB 1IM5A 3I05A 3IOYA 5DHRA 2E9SA 2VSFA 2ORWA 3ESQA 2FPKA 4QARA 3GGDA 3DDOA 1WPXA 1Y3FE 4I5DA 3HJCA 2BMAA 4KGDA 4KIWA 4LDAA 1WZEA 5G40A 4AUEA 3WJ2A 2PQ6A 4OQMA 4C6RA 1CU1A 5A7FA 5KQRA 2PZAA 2J1LA 3EEQA 1HV8A 5GM2A 1AKQA 2CLLB 3I42A 1A82A 2W2QA 5KHLB 5TXGA 2NSHA 3AZPA 4I1UA 4JC8A 4RY9A 4S24A 5ESDA 2AN9A 1Y7TA 3USES 5IJZA 2IZ1A 3FNIA 2P35A 3SBOA 2UYCA 1YFJA 3O8QB 3QTBA 5BMVF 3GIWA 4NJOA 1CNEA 1CR6A 1JKXA 4JWTA 4D99A 1FBTA 5KNDH 3K1AA 2DUJA 1TA9A 4ZEOA 2CL7X 1ZW1A 3BRCA 3GV0A 4PYKA 4EW2A 1DFIA 4KN5A 2ERXA 4F6CA 4KQ6A 2ZBQA 4QQ8A 1CS0A 3TI7A 4D3XA 2CEAA 3ZDCA 3NDPA 2O7RA 4LRYA 3QE0A 1T9KA 1E1KA 4X3PA 3NDJA 3FYDA 4XIGS 3JWIA 1W87A 2VPXA 5IEBA 3U6KA 5HOEA 2BI8A 1IN4A 4R1NA 4ARCA 1ESNA 5J58A 4IEIA 1GAJA 2DPMA 2PAFA 3UH1A 3OQOA 3ADCA 4IIBA 4URHA 1GUYA 2LP4Y 3SYMA 3UZUA 1JQKA 4P38A 2VNIA 2I6QA 2QLMA 2B34A 4RVCA 3MWJA 1TZBA 4MK4A 5DGTA 1SHTX 4K9KA 1NUHA 1DWUA 1J2UA 4O02B 3PFKA 3MRVA 4IXDA 2YCLA 4JU8A 3I61A 3SWWA 2AL7A 4UBJA 4EYSA 2E5WA 4YRKA 2PX8A 2R6FA 3D3WB 3UAYA 3USZA 4NU8X 5B6IA 4JVOA 3WYCA 4Y67A 3T3OA 3BE8A 4OHVA 2HFJA 4H35A 4Q15A 4P0QB 1W36B 2GN9A 2ACEA 2YWDA 1CF2O 1VG9B 1Z73A 5JSYA 4F38A 5LLTA 4PZYA 1L8OA 4NOLA 5A4DA 3I2JA 2CLCX 2JANA 2V7BA 4QHSA 2HA7A 4GQAA 1YRWA 2HIGA 1GPKA 1IZ8A 3WIOA 1HI9A 1GKKA 1SVLA 1ZN7A 1NYLA 3QTLA 4YYEA 2ZIFA 1MX9A 3BQ9A 3KCNA 2WPNA 3QPAA 3GELA 4GRAA 1YO6A 5J5AA 3PXAA 1QIMA 4JU9A 3DPSA 5DISB 2ARKA 2AX3A 2DRIA 2PM8A 5AW8A 4HDNB 4P2BA 1ZPDA 2FW8A 1UWVA 2CK3D 2FN9A 3K70B 3R9XB 1ONNA 1JVNA 3EDYA 1RKUA 1XIVA 4Z4EA 4OH1A 2NO1A 3C1UA 1M1YA 1JE1A 4II3A 1K88A 3D2AA 4V38A 2AV6A 3ZD7A 1KDTA 3FNFA 4TT3A 2C84A 1G42A 1G6Q1 1UFOA 1NUPA 4US0R 3NHJA 3AKZA 1UKEA 2ODEA 3LG2A 1DCKA 2JHGA 3OPYI 3NKFA 3ZLUA 1N1DA 4JN6B 2V4MA 2HQ1A 5DGDA 4B2IA 4DREA 4CIYA 1WUIS 5KQGA 1YBVA 4J2TA 4BO5A 2J3LA 4URZR 1MAVA 5DNDA 1U2SA 3PF8A 4PWYA 4QUDA 1KI2A 4JDPA 5DIZA 2VQ3A 5TB5A 4D92A 3IT1A 1YQGA 1D2MA 3ADKA 4X9XA 1DVRA 1JIQA 1P7VA 1Y7LA 2H7CA 1Q7EA 4JEHA 5DT2A 4F92B 3UGJA 4Z49A 4Z4GA 2NSJA 2IUTA 4ZI2A 5CT8A 4N47A 2G7MC 1JEAA 3BWDD 4DM4A 1SB8A 1ZFNA 3ZU2A 4AZ3B 5J1SB 5LOVF 2WHEA 3IVMA 4JB8A 4WH0A 2OBFA 1HQCA 2O07A 4YK7A 3L8FA 3ZNOA 1P9NA 4UTPA 2I4IA 5JS6A 1C9KA 5E1OA 3OHPA 1DKUA 4OGGA 1P81A 5AD1A 3G7SA 4TVSA 4XWKA 2F1RA 1C7IA 2I76A 2CL5A 3IIJA 4WE3A 4QTXA 1N5RA 3R3VA 4RQUA 1G2QA 3SS8A 4JELA 4J0HA 1NUAA 2FDRA 4O4IA 4ZD6A 4CFSA 1RZ3A 5F2KA 5BMVA 3LL7A 4FIDA 1GNSA 3Q8KA 2KWIA 4B8YA 2UUPA 1XA3A 3SJBA 4GX5A 4UDNA 2O06A 4MLZA 5JFGA 5FNVF 2LRHA 4E0BA 1C41A 4P32A 2GKGA 2YWRA 2ZB7A 2WUVA 3ZHSA 2V7TA 4C76A 4BBJA 3NEPX 4E11A 1OLOA 1P19A 1AUPA 3AESB 3WMFA 4D5EA 1U4NA 4M7OA 5KCZA 5KTRA 5CA0A 1Z06A 1F2UB 2X40A 1J9GA 4M8KA 1E2EA 2XOKA 3CT4A 3FNQA 3WLTA 2OZKA 3CRRA 4WCFA 3ZCXA 3Q3JB 1O94D 3VU9B 5JC8A 5KB3A 1G16A 3LRXA 3QF4A 3T3IA 2WFMA 5KAPA 5SZJA 4D9BA 1D4FA 1VCNA 2A9FA 1ULSA 1C2TA 3TQOA 2GAOA 2YR0A 4W1QA 4HG2A 5DBEX 1RYHA 4DJDC 2Z8XA 3MZ0A 1PR2A 2LE0A 1BSVA 3ROEA 4AQ7A 1W581 5L40A 3ETJA 4AY5A 1SCIA 4LXYA 2J87A 4L0DA 1IATA 1QYXA 2P0EA 3PX3A 4KRGA 5EA2A 4F2WA 5K0CA 1S2NA 2BGLA 2W8BB 3U7EB 1XKLA 3X2EA 2NVOA 3C3WA 2EZUA 1JQLB 1XRNA 5A5FA 4IDCA 4ZU1X 1LSUA 1JDJA 2GF9A 1GZ4A 4UVGA 4YPFA 3IQGX 3HXTA 4DABA 2NN3C 2H1HA 3F6SA 1OD6A 3P8ZA 1YS6A 3EFEA 2GHQA 4ND6A 2IXTA 3I2FA 4LBWA 1Z5NA 2KB0A 5KSPA 4JJGA 4B81A 5F52A 1W9MA 3VH1A 4AMYA 1ID8A 4G5YA 3TTVA 1BFKA 4GYKA 4WBNA 1ULAA 2WTMA 3OUTA 2JI9A 2DT5A 2ID7A 4QUKA 4DYHA 1PLLA 3DVLA 2D1SA 4PAOA 3KVVA 5EQTA 4DUYB 3IP1A 4AI6A 3VVMA 3A1TA 3U5ZB 4X45A 2QHXA 2EKLA 3JR3A 5FUMA 1DAIA 4RCZA 1OH6A 3MC1A 1RYMA 3OHSX 1ZA2A 4AUNA 3CKYA 1DJQA 1ZI8A 5H7XA 2PD3A 3VNUA 1SQ0A 1GCOA 2P68A 1G3IA 2I29A 1RAFA 2JA1A 1LLDA 1NBOA 2FW0A 2PRJA 2O48X 3GAMA 5EHQA 3TTTA 3ZUPA 3RTDA 5KVSA 1Y3IA 3NJ8A 3L7IA 1JB1A 1MOPA 4LRSB 4MV3A 4QODA 5DEOA 5HUHA 2P2LA 2QL6A 3EDMA 3UJAA 5KJCA 1VBFA 3F78A 3SIXA 5L4SA 1KZ4A 1WKVA 3OWOA 5GINE 3TTYA 5JD5A 1R5BA 2I6TA 1X1BA 4FD2A 2C0QA 3ASVA 2W6OA 3KTFA 5HILA 1CVIA 1G5RA 3BFPA 3IMFA 1CJMA 1R5OA 4F9GA 3FPLA 1U7ZA 3PEVA 3D3NA 1Q0PA 1W34A 4DQUA 1SKBA 5JC1A 3CH6A 4IUDS 5C4MA 1AHIA 1YBFA 2IZOA 4COOA 2CW5A 3I3SR 4F7DA 1WLSA 5FJJA 3OP1A 1T6YA 3KQSA 4PO1A 3RRYA 2AFRA 2XYPA 4G8CA 3GA5A 2X5XA 3ABIA 3JS5A 4RL4A 3PXBA 3PNKA 5BSTA 4CR6A 4D9CA 5BN3B 2CEKA 2BSQA 5KX5A 3INRA 3DHYA 1PNOA 3ITEA 3M49A 1QO0A 1MB9A 3F5QA 1UKAA 3W6OA 4UUQA 2JLRA 2VF8A 3PR3A 1P80A 3BVPA 3CMMA 4GLLA 1BHJA 4RLSA 4U0KA 4DVJA 4P9NA 4AF8A 4CKCA 4XRRA 3MLBA 1TOAA 2RBEA 4I4CA 4JT4A 2ZDQA 4EM6A 1N2IA 1TQ8A 2R62A 1OWLA 4M37A 4DZTA 1EHCA 2IFTA 4JJ7A 4R0VA 4X1KA 1TUBA 3ZE6A 5BN1A 4BV3A 4ZOEA 5AKZA 5HTOA 3DTVB 1Z6XA 3HRIA 4MKXA 1KIMA 2O8FA 1PHPA 2BFBA 5BWOA 3R23A 4OJNA 1JIXA 1ZMOA 1ZXBA 4MAFA 3PC2A 4C4SA 4IX1A 1OWOA 2R85A 1PFGA 1QS0A 3AESA 1NWCA 2RE8A 3ET4A 2V6GA 3FSRA 3PNOA 4FI3C 1JHVA 1UF9A 2AOUA 4KP7A 1PD0A 1OBVA 5KQSA 3ZQJA 2W4MA 4RC9A 4H7DA 1ACMA 1PNQA 4JA0A 3U44A 2XNJA 2OV8A 4RPGA 1P0IA 3FCAA 5FPYA 2FTKE 3E5HA 1GKIA 1FZTA 1I4LD 3II6X 3IAHA 3LYAA 3TYXA 1U2RA 2NAPA 4OQNA 5D5PA 4JQOA 1RYFA 2IXFA 3OZCA 5DTMA 4G65A 1PN3A 1Q2XA 3KPYA 3V8MA 4YAGA 1SEPA 1DX4A 2HJHA 4G1BA 3EJ6A 4NG4A 1X13A 5EJ4A 1L4NA 3KZXA 4MIOA 4FGUA 1U4SA 1AVTA 4CLDA 1ZAYA 3CU5A 4XDHA 3VZBA 1GSHA 3B52X 4MQEA 3RM3A 3RR2A 3NWOA 4ETIA 5KJ6A 1KZ1A 1SCBA 1ZYUA 3MT0A 4NG5A 3LHDA 1P60A 1AZSC 5AKIA 3ZGVA 3F9IA 5IW8A 2J5QA 1TJYA 3W7AA 4CL8A 4KRYA 3CE6A 1G21E 4D0NA 3T7CA 5EN4A 1DBVO 1QHGA 3KL2A 3SDZA 4C03A 4BCDA 2OXEA 3BK7A 3DG9A 2DG2A 3GJXC 6Q21A 2YV1A 2YFYA 1PQWA 4TMYA 4YRDA 1KQGA 4WFIA 1L5RA 1Z2EA 3IAFA 3UK1A 2GPTA 3IPCA 4CQLB 5JAIA 5EHIA 1NYRA 4RJJA 3WK6A 2WUEA 1PYDA 1Y1TA 3H9CA 1PWYE 2WNIA 3UH0A 2CFRA 1TQHA 4EMUA 3MWLA 2WU1A 4RM2A 3OF5A 4WLVA 4F9TA 2VP5A 4FGLA 3E3AA 2YTZA 4LA4A 4W1RA 2HXYA 2FQXA 2B30A 4AD8A 3FTDA 1L7QA 5EZYB 2AJ8A 3OE5A 1XTPA 5CA0F 4W5NA 4YCMA 3JARB 1A9QA 3CWZA 1DG9A 3H99A 1IK4A 4V0RA 2R4TA 1C9NA 4LWPA 1U3UA 1D6NA 1GSOA 2VJBA 4FK8A 5CA1F 3JSXA 1JLMA 1MJFA 2WHXA 1GV0A 3IV6A 1JQAA 2ZCJA 2EAUA 2QW1A 5I7RA 1YS9A 1Z4NA 3BD6A 3M1IA 3QQ5A 9LDBA 1NLZA 2YJGA 2WWXA 2I3DA 1YDGA 1QCDA 3STTA 3UWOA 3K1TA 3LT5A 4HRXA 1QBKC 4M1YA 5A7GA 4CCAA 1HMYA 3C0KA 2IZ7A 3PQ8A 3P5BA 3BA6A 1UBTS 1NXVA 3HCNA 4RTOA 2E4ZA 1T8UA 3G9QA 5BYKA 2G1PA 2J5BA 3I9V6 1T0HB 2H8GA 3H1PA 2XXAA 5TS3A 5BR8B 1NOIA 4PPNA 2ZAMA 3GGOA 3TQTA 3HXOA 5LKRA 4QYWA 3QE9Y 1IXKA 2P9JA 2ZBFA 3AX6A 4MUBA 4ZC8A 1KRWA 1M1NB 4B17A 1P3Y1 3D6HA 2BE7A 3G2LA 4JT2A 5LN1A 2A88A 1C9DB 4QEKA 4U2BA 3L0PA 1TO6A 4RORA 1NW9B 4ZOAA 1JTEA 4TVBA 1GNVA 4OHWA 1RPZA 4FDLA 1SCJA 1M8JA 1N5JA 4RD2A 2CKDA 3MNFA 2KSQA 2WE7A 2FPUA 4WL0A 3BA1A 2ODQA 4G09A 1SKYB 5E4YA 3WKBA 2QD3A 4WUTA 3VMMA 5JVDB 2WD7A 4MQ6A 1Z0KA 3QW4B 4BOYA 1ZQ1A 5E3JA 2A67A 2WV7A 1FP1D 3N8IA 1XCOA 1C8LA 3HO1A 3N0WA 2AXPA 4PYOA 2IX9A 4RDHA 5L3ZA 4M53A 1X8KA 4X41A 3RVRA 4MW2A 3QWBA 3UM9A 3W3AH 2A5GA 5IULC 4O8CA 2RGUA 4TYYA 5JAQA 4D8VA 1V1MA 4F5YA 4KIFA 1C3XA 4EX6A 3QE3A 3QUCA 4MEBA 4PWZA 1FDRA 2HJWA 4OQYA 4Q5IA 3IAUA 4D46A 5CEFA 3TZHA 2CJFA 3DZHA 4RA6A 1Y8RB 4RE5A 2GRUA 5DMHA 1YL5A 3IOCA 1WZ2A 2GJAA 3QXSA 2ISQA 3TLGB 2BHLA 1VE1A 5ESRA 3ZDZB 2VOJA 1UPFA 1E1QA 1LBIA 2DB3A 4QUBA 3DDCA 2V98A 5T4HA 5A5VA 2QTAA 3AGQA 4NV1A 3G89A 4YGXB 1W36D 3JQAD 3NCHA 3FROA 3M83A 3WRYC 4PSDA 5FWNA 1P2GA 2E0IA 3A4NA 2ODTX 2QAIA 1OZGA 4TZKA 1FFDA 1SRQA 3JD1A 3N05A 4GU5A 4JZYA