3HMOA

Crystal structure of human mps1 catalytic domain in complex with the inhibitor staurosporine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
281
structure length
257
Chain Sequence
ANECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Biophysical and X-ray crystallographic analysis of Mps1 kinase inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 257
sequence length 281
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hmoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hmoA01
3MJ2A 3OT8A 3IECA 3HV3A 4XOYA 3NSZA 3QQLA 4QT1A 2R9SA 4KS7A 2C0TA 5LWNA 3O17A 4RIWA 1CM8A 3LM5A 3QGYA 4G3GA 4GT5A 3TNHA 2A1AB 5CT7A 4O96A 4QTCA 3E93A 1OBGA 4RMZA 4YZ9A 4BRXA 2Z7QA 3UIXA 4AE9A 4R7BA 2PY3A 4CT1A 4GW8A 2B52A 4BCJA 1PKDA 1HCKA 4RWLA 4YC3A 4D9TA 5GINE 2ZOQA 4GFGA 4L7FA 5FGKA 2ZV8A 3JY0A 2VRXA 1H1QA 5D12A 1RQQA 4ZXTA 4GU9A 2VTJA 2FB8A 1SYKA 4YJRA 4AT5A 2E2BA 3ODZX 4I24A 5A4TA 4MEDA 2PPQA 4ID7A 3IOKA 3QA8A 1MUOA 4RBLA 1Y8YA 2Q0NA 2VTAA 4APPA 4QQTA 1GJOA 3V51A 1LR4A 2UZOA 4AA5A 2IZTA 1YWRA 3CGFA 5HVYA 3LJ2A 2YERA 4YHFA 4DBNA 5KO1A 3E62A 1KWPA 3DQWA 3W10A 2OK1A 4S30A 3ZC5A 3OG7A 4FNXA 3DB6A 3FMEA 4QP1A 3EL8A 4I20A 4OBPA 5E1EA 1PYXA 5DVRA 3TZ7A 2GHLA 4M68A 3DY7A 3ZSIA 4BDJA 3ZZWA 3IW4A 2WZJA 2R2PA 3FLSA 4IVBA 4C61A 3MIYA 3G5DA 2VTQA 1UKIA 1U5RA 3SRVA 5A54A 3GI3A 2HZIA 1KOBA 2F4JA 4AWIA 3HDNA 3GEQA 3BHYA 2GNLA 3BV2A 4EYMA 5IDNA 4FICA 5HLWA 1O6LA 2W05A 3F9NA 4IZAA 3U51A 5L8JA 4TL0A 4QP4A 2OJ9A 3D2IA 3D5UA 5HTCA 3B8QA 3DNEA 1RDQE 5AP5A 2WTWA 2ITPA 5CI6A 3KY2A 3KKVA 1WVYA 3F5PA 4XG2A 5DR6A 5DYJA 4A9UA 1YI4A 3ETAA 2UW3A 3DKGA 3DQXA 3MFUA 3TUBA 1J7UA 4FV8A 2VGPA 2XNBA 4MD9E 3E7OA 4XX9A 2ONLA 4F0GA 2C6TA 1WZYA 2C3JA 3P08A 5EM6A 3BHTA 2CJMA 4X3JA 3RWQA 5EW9A 3R1NA 4L43A 2CKEA 3KRXA 3MPMA 2BRGA 3FLZA 2IW8A 2W5HA 3H10A 1B39A 3DKCA 4E4LA 1LEZA 2WMXA 4EH4A 5KMNA 1YI3A 4GYGA 3PJ3A 3MSSA 2C5OA 2QLQA 2ITTA 4B8MA 4M0ZA 1KSWA 1FOTA 3BU6A 5K3YA 3L9LA 4JR3A 4O0VA 4EOPA 4BWXA 5DWRA 1H25A 4FKPA 1FVTA 3K3JA 3QHRA 1OPLA 3H9FA 5FM2A 2CNUA 4FK6A 2OFUA 2YIYA 4RGJA 3CLYA 3VBVA 2CCHA 5LQFA 2VX1A 5D41A 5CI7A 3MA3A 2QG7A 5BMMA 2C6MA 3ZO2A 5J95A 4IACA 4LUDA 4Z7HA 3DV3A 3D94A 4LG4A 2WEIA 3OC1A 4ZAUA 4GIHA 5HIBA 5CEQA 4MAOA 4GUBA 3QUPA 3TKHA 4EWHA 5F20A 3QXPA 2JIVA 4FT9A 2JKQA 4OR5A 4XBRA 5EH0A 2XCKA 4QP8A 5H3QA 4OUCA 4KIOA 2YIQA 2UUEA 2R3MA 2UZBA 1NY3A 4HVDA 4HJOA 4J7BA 3SOAA 1OKWA 3O8UA 3DNDA 4H3QA 2VNWA 4O38A 3NUNA 3HMNA 2QD9A 4JNWA 4KRDA 4LOQA 4XCUA 5BVKA 2GS6A 4UEUA 4ZS0A 3K54A 3RTPA 4RVLA 3PJ2A 3QZIA 4BZOA 3Q53A 3ORTA 3VS4A 5LMKA 3OHTA 3G6GA 3BPRA 4E8AA 5C26A 3W2OA 5C8NA 3D7ZA 4PPBA 5KUPA 4CZTA 3DJ6A 3ZS5A 3VNTA 1QPDA 2I0HA 3NVKI 4JI9A 3UBDA 2CGXA 3V01A 4A9RA 4D2PA 1REJA 1R39A 5HNBA 5AP4A 5I9VA 5AR4A 2PUNA 4GEOA 5ANDA 5TF9A 3W16A 4U41A 3OVVA 4RWJA 4WRSA 3UO6A 5CQWA 2GQSA 3HLLA 2HW6A 3QTRA 2ITVA 4GCJA 1ATPE 2WIPA 2ITXA 4CVAA 2FSOX 2OJJA 4FGBA 3QD2B 3VVHA 5CEOA 5HORA 3DK7A 3R28A 3LMGA 3RGFA 5M44A 3BKBA 3PIYA 4O7TA 4Z9LA 1UV5A 1R1WA 1HOWA 3PJ1A 3CKWA 4BF2A 3KC3A 2PE1A 1XQZA 4G6LA 4CFVA 3QTZA 1FVVA 2O2UA 3O8TA 1XH6A 5K0XA 4TWOA 5E7RA 5DH3A 4CRSA 5CSVA 5HICA 2W0JA 3UOKA 3ORIA 2XNGA 3VS6A 2I0EA 3NUSA 5KBQA 4A9YA 3RALA 4IWOA 3ZEPA 4JR7A 4Q9ZA 5HO7A 4F7LA 3CIKA 5EW8A 5E92A 5IMEA 1KOAA 4NJ3A 2F57A 4TWNA 3HAMA 3P78A 4BBMA 4F9AA 5JGAA 2R3OA 3BYMA 4ZTRA 2BVAA 3EH9A 4AW1A 4O0SA 1XH4A 3JVSA 4CG9A 5HQ0A 5K5NA 3KMWA 4FIHA 4O7SA 4IB5A 4S31A 2ITOA 2GDOA 2UW4A 2VO6A 3UMXA 3A7JA 3IKAA 4F9BA 3MFSA 1JKSA 3OY3A 5AA8A 5BUEA 5AP1A 5IUHA 3BRBA 4GFMA 4O6EA 3PE1A 4FOCA 4YLKA 3FXZA 3TL8A 3VW6A 4DGOA 1IRKA 1BMKA 4GKIA 1P5EA 5H8GA 5AUVA 1JNKA 4N0SA 5E90A 1XWSA 3S0OA 1MRYA 4IJPA 1STCE 4MXCA 2IVSA 3F7ZA 4JBOA 2RGPA 3C5UA 3DKOA 5CAVA 2BCJA 4JBPA 2J0LA 3DFAA 3FQEA 2CKPA 3OTUA 2H9VA 3A4OX 1H26A 3PP1A 3K5VA 3Q4UA 4D9UA 4U42A 1IR3A 3QTWA 3KVXA 3LM0A 1A9UA 2J0MB 2C3LA 3EQPA 4NK9A 4E6AA 3AG9A 4G5JA 3E5AA 4EUTA 4E4MA 4IZ5A 2WO6A 4V0GA 5HE0A 4JQEA 4OTFA 2WEVA 1Q8UA 2R64A 4J71A 4EK3A 3CC6A 2QR8A 3KMUA 3MWUA 5BMSA 2E9UA 2GHMA 2W06A 3TTJA 2WQNA 4TYJA 3OZ6A 1OL7A 3I0QA 4XLIA 2PMNX 3PDTA 4WSYA 4E5BA 1ZYCA 4CCBA 2BKZA 3KXHA 2Z7LA 4N57A 4GVJA 3DBFA 4HOKA 4Y5QA 5FLFA 3E8NA 3LQ8A 4I92A 5DRBA 4A4OA 4CG8A 1PXKA 1ZOEA 2YN8A 3ITZA 4RFMA 4FE2A 3VHEA 2LGCA 5F4NA 3C13A 4FV7A 4QTAA 2BFYA 1OUKA 3EMGA 1APME 2R4BA 3HGKA 3PRFA 4RVKA 4DH7A 4RX9A 3QLGA 4O0YA 5J5SA 4P7EA 1H00A 2ITYA 5AR2A 4FTNA 4FEXA 5EDRA 4TYIA 3ENHA 4X3FC 5HU9A 4UMRA 2YEXA 2A0CX 3R2BA 4M15A 4UY9A 4RJ3A 4XH6A 4FVPA 4B9DA 4C37A 4WOVA 5CZIA 2WTVA 1H0VA 4FTUA 4AA0A 2BIKB 1ERKA 5E8YA 3AC1A 2PZPA 3FHRA 4OTRA 1ZAOA 1S9JA 3R8UA 4Y73A 4DG2E 4QMZA 4L42A 3JPVA 2JIIA 2BTRA 1RE8A 1XHAA 2HXLA 2JAVA 3EFLA 3OWKA 4I22A 4JX3A 4O91A 3GVUA 4G34A 3NCGA 3A4PA 3NUPA 3Q4TA 5B2KA 3FI3A 4IAFA 4DG0E 1Q3DA 4WKQA 3E8DA 3SGCA 1ZOHA 4F1MA 5L2SA 2BAKA 4XBUA 5AR8A 4OAUC 4HNIA 4UALA 5FDXA 3R7OA 4E73A 3JR1A 5CVHA 3QZGA 2KTYA 4R3RA 4KA3A 4RJ7A 5CVGA 3L8SA 4EH6A 2Y0AA 2CHLA 4AZEA 5IA1A 4R3PA 3BLRA 4JG8A 4C35A 2W1GA 3Q60A 1OITA 4YJTA 3Q9XA 1UWJA 2Q83A 1GIJA 2WFYA 1V0OA 3P79A 2ZV9A 3IW7A 3D9VA 4CCUA 4AW5A 4QTBA 2VO3A 1YVJA 1H01A 3GXLA 4WUAA 2YCFA 2YA9A 4UYAA 4NW6A 5A9UA 5J5TA 1PMVA 3L9MA 1XBCA 4NTSA 5E8ZA 1OGUA 2ETKA 5JRQA 4AZWA 4AT4A 4KABA 2W9FB 2WQMA 2ZM1A 3CKXA 5FTGA 5IA0A 4C36A 2J6MA 4KIQA 3H3CA 4XYFA 2C5YA 2DUVA 2XMYA 2R3HA 4WG4A 3RMFA 3HEGA 5IQDA 4D2WA 3Q5ZA 4I6QA 3UP7A 2C6DA 4C3RA 2QOQA 3CD8A 3NX8A 4FSQA 3DTCA 4RJ8A 3TG1A 2FGIA 4WRGA 4EOSA 3LMIA 4E93A 2X9EA 3RI1A 2YZLA 2QURA 5EHYA 5AAEA 5IQBA 5DRDA 4E20A 3A7HA 4DBXA 3RCDA 5I4NA 3TV4A 2JDOA 4AS0A 4M7IA 4FKJA 3ZDUA 2OXYA 3R7GA 5AIRA 4FGRA 3SW4A 3VBTA 2OIDA 3EKKA 4FKTA 3COHA 4PDSA 2JKKA 2UZNA 5GZ9A 4DH1A 3QGWA 4BZNA 1PF8A 4CXAA 3PIXA 2JDRA 3BGZA 3GUBA 3D0EA 3NS9A 2OZAA 3F5XA 3LCDA 4LMUA 2OIQA 3O2MA 4I6FA 3HYHA 3EQFA 2DWBA 4OTQA 2PE2A 2JD5A 3TKUA 5FUTA 3HKOA 2HW7A 4Y5HA 4DA5A 3V3VA 5AAGA 3GU6A 4RX7A 2VO7A 2XB7A 1Q3WA 1P2AA 2YACA 3R1YA 4ITJA 1P4OA 2C5NA 3UQFA 2ZDUA 3DPKA 3LFQA 4C38A 5M4CA 3ODYX 4FSTA 4A4LA 3BCEA 2B54A 3UIBA 3TZ8A 4DE4A 2CLQA 5GNKA 3G15A 3OCSA 3UC4A 3HX4A 2C3IB 3BBWA 3OT3A 3KRJA 3PIZA 3Q9ZA 4EC9A 3F7WA 5CF6A 4EH8A 3R63A 3RPVA 2XJ1A 4BDHA 3TDWA 4TKSA 4FTKA 2GNJA 4Y83A 4BCHA 3R1QA 4EQCA 4BVUA 2UZUE 4CZUA 3UQCA 3ROCA 3OUKA 4DFNA 2YLFA 3OW3A 4V01A 4ZSJA 3OOMA 1G8SA 3KGAA 3D2KA 4JX7A 2A4LA 1IA9A 4YHJA 4B6LA 1OM1A 3NAXA 4I5HA 3LFBA 4J97A 1PRYA 4FEVA 4USDA 2OGVA 4FF8A 4LGHA 4N6YA 3N4TA 3CSVA 1H24A 1ZMWA 1OVEA 1PXPA 2REIA 4RC4A 4AZTA 1DAWA 2QVSE 3OXZA 4FKRA 3D83A 3R21A 3EZVA 3TCPA 3TUDA 5EM7A 1R78A 2PWLA 2XK7A 2ZMCA 2YM8A 4K6ZA 2XNOA 4C58A 4DFZE 3R7VA 4EK5A 4EUUA 4HVHA 4HYUA 4KS8A 3FLYA 3ZXZA 1OPKA 2V55A 3FBVA 1F5QA 3W2CA 1OZ1A 4X2GA 3SVVA 2IVTA 4G5PA 1W0XC 1Y91A 2CN5A 3TNIA 4QYYA 3ULZA 3OW4A 3G33A 3G90X 4MWHA 4RQKA 4YLJA 1XJDA 2C69A 5L8KA 3DXNA 2OU7A 1CMKE 2C6LA 3P4KA 4JVGA 4BCKA 4CFXA 5IPJA 2PVKA 3NNXA 4Z55A 5J9ZA 2UVXA 3A99A 5FRIA 1PXNA 4BYJA 2PZ5A 4QYEA 2BZJA 4ENXA 2E9PA 4QQ5A 4BIDA 2VWBA 5EK7A 4NM5A 1GIIA 4D4SA 3O8PA 2VWXA 2VWUA 2QOLA 3QX4A 4EYJA 4S2ZA 3PA5A 2FYSA 4M69B 4GV1A 4ZMFA 2H6DA 2ZYBA 3G0EA 3EN9A 3PY1A 3MA6A 3FV8A 4FKGA 3DK3A 5IA3A 3MYGA 1YHVA 1Q61A 2HWPA 1CKIA 3NCZA 2GNGA 4FSWA 4ZTNA 3VHKA 4BDBA 4L00A 4D2TA 2P3GX 4E1ZA 5CAPA 3KA0A 2WELA 4JRNA 3RAHA 2PL0A 1O9UA 3IG7A 3ZXTA 4FEUA 3ZSHA 4GG5A 4PY1A 3WZEA 3PPZA 3U6IA 4TWCA 3FXWA 3PPJA 4EHZA 2CN8A 2Z2WA 3ANRA 3MGYA 3P86A 3R02A 3I6WA 4KWPA 4RJ6A 4IB0A 4TRLA 5DLSA 1W7HA 1R3CA 2C1AA 2Y4IB 3KEXA 5J8IA 3VS5A 4BTJA 1PMEA 3CPCA 3O51A 4AN2A 1LUFA 2HCKA 5HLNA 3QLFA 4II5A 3JXWA 3HRBA 4D1SA 2ZJWA 4Q5HA 5HNGA 5J79A 4XV9A 3ORKA 3QFVA 4QTDA 3RZFA 1LP4A 4I21A 5AV2A 4IVAA 4RVTA 4JDJA 4EOKA 1YQJA 3DAEA 1YWNA 2HENA 2WMUA 3I0OA 4PMMA 4L8MA 5DEYA 3SQQA 4PMPA 5LVNA 4QMLA 4R1VA 5CU4A 4ZP5A 3A7FA 5JFVA 2I0VA 4BCQA 3ZFMA 3RAIA 3F3VA 3TNQB 3A8XA 3QXOA 2VTSA 3MVMA 4UMQA 1OIYA 4CFNA 4IAZA 3VUDA 4RFZA 3GCQA 5ETCA 5KMJA 5T6KA 3VBQA 2R0UA 4UZHA 3I79A 4LRJA 4O2PA 4ANBA 3DLSA 3EB0A 5EM8A 3P0MA 5KZ0A 3VF9A 5AWMA 4ZSAA 3P23A 3Q3BA 4N70A 4LOOA 4IB3A 2X0GA 2PVRA 4NSTA 4NZWB 5T3QA 2CKQA 3MH0A 4ASDA 3OEZA 5C01A 2ZAZA 4IW0A 3SX9A 4O0RA 2ZDTA 4MWIA 1Q24A 4IBMA 5AA9A 3PWYA 4OGRA 5CSHA 3MB6A 5DGZA 1E1XA 4RIXA 5TKDA 2RIOA 3M1SA 4YZMA 3RNYA 4DAWA 3D4QA 2V62A 3QBNA 5BNJA 3LHJA 3R30A 5GHVA 4D5HA 4U45A 4WNPA 1WVXA 3TN8A 2XNPA 5EKNA 4HPUE 3LMHA 1JVPP 4ZTQA 3U87A 1FINA 4L44A 3NZ0A 2WOUA 3Q2MA 2C6IA 3ZC6A 3HV4A 3Q9WA 4IX4A 5FM3A 5AUUA 5TE0A 2Q0BA 4IX6A 4MHAA 4FSZA 1W83A 2OI4X 5CLPA 4CLJA 3PVGA 4AFJA 3BYSA 3QQUA 2EB3A 4IZYA 5EYKA 3VUGA 5DIAA 1TQMA 4DFBA 4FV6A 4XMOA 2ITWA 5KMMA 1BL7A 3POOA 4FYNA 5DPVA 2R5TA 4LV5A 3F88A 3QQHA 2ACXA 1ZXEA 4I93A 2XKDA 4K11A 4C57A 3UZRA 5DT4A 4YR8A 5CU3A 3LFNA 5ICPA 1Q5KA 2OG8A 1H1WA 3ACKA 3PP0A 4PWNA 3FSFA 1TQPA 5GJGA 4C4IA 2W4JA 2OW3A 4CQGA 3UDBA 1W98A 3AXWA 3R9HA 2QI8A 5FXSA 4EL9A 4HGEA 4F9YA 3ZFYA 1V0BA 4FR4A 4YHTA 3LQ3A 4BHNA 4GRBA 4J95A 4IFGA 5B0XA 5CAOA 4EC8A 3FLQA 4W9WA 4U79A 3UNKA 4F4PA 4TNDA 5DE2A 3QWKA 5HIDA 3ZOSA 3QQJA 4A9SA 1FGIA 1UU9A 1E1VA 4B99A 2VWWA 4L67A 4QYHA 3QRIA 5LOHA 2R3FA 3ORLA 3R01A 3EWHA 4NIFB 4MQ2A 4LYNA 5C4LA 3UGCA 4I5MA 2CNQA 3ZMMA 1IG1A 4L3LA 5M53A 3ATTA 5C4KA 1DM2A 3DCVA 3PA3A 4FV0A 2JBPA 4ZEGA 2XA4A 3PLSA 4U0IA 3A2CA 2PVHA 2YAAA 4QMTA 2NRYA 3PTGA 1YXUA 1AQ1A 1PMUA 2EXMA 3ELJA 4NKAA 4D2RA 4JAIA 4RJ4A 4LL5A 1JQHA 3RPOA 3UZTA 2OWBA 5HCYA 2XZSA 5IA5A 2XKFA 3AD4A 2HZ0A 4AOTA 2OIBA 5G1XA 5K9IA 4PDYA 4H3BA 2WGJA 2C6OA 2WXVA 5CEPA 2PE0A 2J4ZA 5HD4A 2RFNA 3BELA 5M55A 3UVRA 3A61A 4YC6A 2QHNA 4DH3A 2BUJA 3LLTA 5DMZA 4KB8A 4P2KA 5L2IA 4BR3A 3MY1A 3I6UA 5CSWA 1FBNA 2QQ7A 3RPYA 2ERKA 2G15A 3QCQA 1J1CA 2B0QA 3LFDA 1CSNA 4Y72A 1I09A 4D1XA 5A4QA 1UNGA 1WMKA 4FTMA 3V5QA 5LMBA 2PK9A 3EQBA 3TV6A 3EIDA 3FY0A 2O3PA 1ZMVA 1OUYA 3LVPA 4FG8A 5HBHA 4ZSEA 2BIYA 2YHVA 4JXFA 1F3MC 2O63A 5D7AA 4QMVA 4HYHA 3MB7A 1CKPA 2XIYA 5FG8A 4BN1A 2XYNA 5DR9A 2J9MA 4BBFA 3M2WA 3PY0A 4B0GA 2QO2A 4KUJA 4YTFA 4M8TA 3IONA 4L3JA 5AX3A 4PMSA 2FA2A 2EU9A 4JIAA 1XO2B 2BTSA 5EOBA 2VTOA 4FZAB 5K4IA 3I5ZA 5ANKA 5I9YA 3GU5A 4RA5A 3UVQA 3FZ1A 3AT2A 2PTKA 3QCYA 5JQ5A 4IADA 4DEGA 1OL6A 3GC0A 4HVIA 2J7TA 4GG7A 2NNWB 2BILB 3PVUA 4NFNA 3HA6A 2G2HA 4KD1A 3V5JA 4JBVA 5F9EA 3GT8A 4D5KA 4W4XA 5AIKA 2FH9A 2W1ZA 1P14A 3CS9A 3MN3A 2QOIA 5EFQA 4R7HA 5HHWA 1WBTA 4IC8A 4BKYA 3TWJA 3FDNA 3H30A 5A6NA 4DFXE 3L1SA 3EJ1A 2VNYA 4U9AA 3AMYA 2ITQA 3GNIB 2J5FA 2O65A 4HGLA 4QP6A 5FWKK 3RZBA 5M08A 1W8CA 4FTRA 3DBEA 4R7IA 4QMXA 2OLCA 2A27A 4W8EA 2XBJA 3ZDIA 4DGNA 2HOGA 3EFKA 3BEGA 3DBCA 3DB8A 3ORZA 3ULIA 2P33A 1PXOA 3EN5A 2WNTA 1M2PA 2XNNA 3LOKA 5HG7A 2X8IA 3WE4A 4DCEA 1UVRA 5HO8A 3DJ5A 3EQDA 2OFVA 5AUWA 2GNFA 2QOHA 3NRMA 4RQVA 4R8QA 2OH4A 3SAYA 1UNLA 3W33A 1KE9A 2WTJA 5HG9A 4EHGA 2R3IA 5ACKA 2I6LA 2YCSA 5A14A 5E91A 4UXLA 5HKMA 4GSBA 3WF5A 4WSQA 4UX9A 4R77A 3PY3A 4V05A 4MNFA 5L6WL 4DH8A 5A4LA 5HTBA 3WOWA 3N9XA 4OBOA 3IW5A 2VU3A 3O96A 4LUEA 5E8XA 2BKKA 3FI8A 3IQ7A 3UOLA 1JKLA 3HV6A 4GS6A 4UZDA 4FTCA 3OROA 4H3PA 3EYHA 4FIIA 4LRMA 4M0YA 2YJSA 4QO9A 3VBXA 2YM3A 4MK0A 3QTQA 4EK6A 4ZK5A 3MPAA 2W99B 3IDCA 4M69A 3CTHA 3KCFA 1Q8ZA 1WBVA 5F95A 3LFFA 4IDVA 4DT8A 3IW6A 4O0XA 2B9FA 4L52A 4RWIA 5AUZA 4D4YA 5BX0A 4TTHB 5J9YA 4JJRA 1J7IA 4KIKA 2PVYA 3DT1A 4MH7A 4D4VA 2DQ7X 2WIHA 5ANIA 2XF0A 2QODA 2YAKA 3BU3A 3RAKA 2QONA 1Z57A 2XEYA 5EI6A 4EONA 4K8AA 3SD0A 3BIZA 2CSNA 4FT7A 4IANA 3HVCA 5IH5A 4PUZA 4A06A 4C4FA 3LKMA 2JFMA 4R1YA 4ZOGA 4ACDA 1SZMA 4E4NA 3NVMB 4DFUA 1JLUE 2V22A 4YURA 4WNMA 3PA4A 4FI1A 3WZDA 4MVFA 1MQ4A 4ASEA 1YRPA 4DFLA 5AV0A 3FE3A 3CTQA 3MW1A 3RBWA 2PVLA 4FKUA 2UZLA 5HZNA 4CKRA 3ATSA 4FEQA 4XG4A 1A48A 2I40A 4KBAA 3JY9A 4BDDA 1SMHA 4H36A 4IWPA 3QZHA 5CEKA 3UVPA 3UJGA 5JK3A 1PHKA 1UNHA 1VJYA 2VGOA 4YO6A 1OKVA 4I6HA 3WYXA 4BI0A 3D7TB 2YM4A 2QHMA 4CYJA 5IUGA 4XG7A 4FTQA 3FKNA 5HE2A 1DI8A 1DAYA 2OXDA 5CAUA 1L8TA 4ALWA 3NYVA 5BPYA 3ZRLA 3SG9A 2BFXA 3LFSA 3NUXA 4YSMA 5I9UA 4K33A 4O0WA 3A7IA 2RG5A 1JSTA 2IJMA 5LWMA 1BLXA 4QMUA 4FNWA 4ACGA 5FP6A 3W8LA 4YO4A 5GJDA 3NYOA 5FQDC 4CD0A 3W2RA 4LGGA 3ZEWA 2I0YA 4FA2A 4KKEA 5LMKC 2OKRA 2IW9A 2QLUA 1FQ1B 3GOPA 3DBQA 2X7FA 3NYNA 3PXZA 4JAJA 4MD8E 5T68A 2PUIA 2OF4A 2XK4A 2J2IB 4K2RA 2R3KA 2YWPA 2XJ2A 3PLAE 4RSSA 1IEPA 2BALA 5JZJA 1FVRA 4I23A 2IVUA 3CE3A 5J9LA 5H8BA 4EQMA 3JS2A 5HNIX 5KHWA 3KN6A 4JDKA 4RZVA 5HESA 5CQUA 3N4UA 3R00A 2OO8X 4TYHB 4WHZA 2UVZA 3T8OA 4DTKA 4RX8A 4E3CA 5L2WA 4FL2A 4DLJA 2ZVAA 1WBWA 4KRCA 4YGAA 1GZ8A 2CCIA 2O5KA 2W5AA 2BAJA 3KMMA 5CNOA 5EDPA 5BUIA 3QQGA 3PVBA 5KE0A 1PJKA 3HP5A 2WQEA 2H96A 4QP7A 4IDTA 5M56A 4AACA 1VYZA 4M67A 3UP2A 3FZRA 4UMUA 5CTPA 2BR1A 4MCVA 4JT3A 2QOOA 2XNEA 3V5TA 3WIKA 3I60A 5LXMA 3DJ7A 1W84A 3GU8A 2XKCA 2XRUA 3NDMA 1Z9XA 4X2FA 1BI8A 2C5VA 3QRJA 4YJUA 3R9DA 1DS5A 3R71A 4YJSA 4F6WA 2P2HA 4OTGA 4RVMA 3FC2A 1DI9A 1ZYSA 1YXTA 2B53A 1UU7A 3I7BA 4O0TA 1H8FA 3SOCA 4Y46A 4ANNA 5HX8A 4HGTA 4CFMA 2GQGA 3FL4A 3KB7A 3MY0A 1O6KA 4U6RA 4DTAA 3FL5A 5BVFA 4G16A 1ZLTA 3GCVA 1XH5A 3H9OA 4WBOA 4XS2A 4LRKA 4ZY6A 5LCKA 3SXRA 3UYTA 4ASXA 4NIFA 4QMPA 3IO7A 3LPBA 4ZZNA 2YZAA 4DYMA 5LJJA 4ZS4A 3GENA 3KVWA 2RF9A 4NWMA 4U97A 4WO5A 2R7IA 4XP2A 4AW2A 2ZMDA 3FMJA 4E5WA 1ZZ2A 3GCSA 4BKZA 3MESA 2WMQA 3RJCA 3R22A 1Y6BA 2JIUA 3E8EA 4GJ2A 4I4FA 4FYOA 4J98A 4AFEA 3L9PA 5EW3A 3WARA 4HCTA 3NUAA 2VTMA 1J1BA 2DYLA 1TVOA 2YFXA 4K18A 2BROA 4QMYA 4PL4A 3RPRA 3UYSA 5CASA 3IW8A 3ZBXA 4IH8A 3RVGA 1JPAA 1MRUA 3EL7A 3TV7A 2X7GA 3ZONA 3UC3A 3E3BX 3UIMA 5KMIA 3EN7A 5KNJA 2C0OA 3EOCA 1NA7A 4G31A 3MFTA 1ZYLA 5FXRA 5L6OA 3R7UA 1GOLA 4J52A 2UW9A 4Q5EA 1G5SA 4L3PA 5GIOE 3LJ1A 3Q9YA 2PMLX 1KE5A 2HWOA 3R9NA 4AN9A 4O1OA 4F09A 4NEUA 3HV5A 4RFYA 4AOIA 1REKA 4G3CA 1UKHA 3BZ3A 3C4EA 3JVRA 4L68A 3ZO1A 4EZ3A 3BEAA 4EJNA 3R2YA 3P5KA 3RAWA 2YM6A 2WTCA 4TN6A 4YPSA 5AAFA 2PUPA 1XBBA 4M97A 3RHXA 4BIEA 2R3JA 3Q96A 4FNYA 4R3CA 1WBPA 2UW8A 4PX6A 3TTIA 2VD5A 4PF4A 4Z7GA 4HW7A 2C3KA 2P2IA 5M09A 5AMNA 5C9CA 3S1HA 5BQ0A 3VS3A 2UZTA 2Z7RA 4X2KA 4YJNA 5A4EA 4XG3A 5ANGA 3WILA 3H9RA 3GC7A 3Q32A 3UTOA 2X2LA 3RP9A 5IISA 3NYXA 3A62A 3BYVA 3TIZA 2BZHB 3MVLA 4OTIA 3D14A 3LCSA 1Y8GA 4P90A 2RSVA 2Y9QA 4K9YA 4DGLC 4UN0C 2GMXA 2WU7A 3LZBA 4MQ1A 1JBPE 4QP3A 4XV2A 1H1PA 4CYIA 5IEXA 4NH1A 5JGBA 5BUJA 3CQEA 2FSMX 3KULB 3QTSA 3VO3A 2W4OA 3QC9A 5IUIA 2YM7A 4IMYA 3TI1A 2CLXA 5LVLA 4YBJA 2XVDA 4EOQA 3G51A 5JRSA 3NW5A 2W7XA 4FKWA 3R7IA 2HYYA 1H27A 5C03A 4OTPA 4BI1A 5CXHA 4FNZA 4WNKA 2XKEA 5D11A 4FV2A 3MS9A 3G2FA 3OXTA 4QD6A 2OBJA 4RJ5A 4K0YA 3BWJA 2V5QA 3AMAA 4TNBA 4ZTLA 3C4FA 2C6EA 3UIUA 5IEYA 5HOAA 5A3XA 4QP2A 3CQWA 1OL1A 1IA8A 2C47A 3FI4A 2WHBA 3OS3A 4PRJA 3BHVA 1NXKA 5ANJA 5HE3A 3PG3A 5ACBC 3NNVA 3AGLA 5BVWA 3UZPA 4CTCA 2W1HA 2VWVA 2QKWB 1XH8A 4RG0A 4D55A 2ZB0A 2J5EA 3ZHPC 3CD3A 1SVEA 2G1TA 3EQRA 4AGDA 4M66A 4FC0A 3HMPA 2AUHA 2R3PA 2YJRA 4DTBA 5FTOA 4C62A 1JWHA 2Y8OA 4G6NA 1P4FA 4LM5A 3LW0A 2EVAA 4M13A 4FKQA 4CT2A 4O83A 3SKCA 2VTTA 4FKVA 5EYCA 1IAJA 2PYWA 1OB3A 2YCQA 2JDTA 3MJ1A 3QRKA 4I3ZA 4W4YA 5TT7A 4AW0A 4E5AX 2R7BA 4CMTA 1OKZA 5KHXA 3QTUA 4W9XA 4R5SA 3HNGA 4AGUA 5ETFA 3GU4A 3ZM9A 4ZSLA 2GNHA 4C0TA 3C7QA 2LAVA 3FMMA 5F1ZA 5GIPE 5DG5A 4ANSA 4Q2AA 2ERZE 2Y6MA 5JQ8A 4H58A 4PMTA 1WBNA 3EQCA 3HUCA 4Q9SA 3VIDA 3C5IA 3BGPA 4XRJA 4FIJA 3COIA 5CU0A 4HNFA 3GU7A 2ZM3A 3HECA 3SXFA 4FK3A 3R9OA 3G6HA 4FKLA 4OTDA 4QYGA 3OP5A 3D15A 4IZ7A 1Q62A 2GNIA 3E8CA 3PXYA 5CZHA 2VZ6A 4FTOA 5HG8A 3VUMA 4HYIA 4E26A 4EH2A 3KK8A 3KXXA 4O86A 3FSKA 2JBOA 5IF1A 2HELA 2GS2A 2QR7A 3PFQA 3QKLA 4Y95A 3WF9A 4F1TA 3BHUA 3VULA 1PXLA 5DI1A 4CMOA 1Z5MA 2UW7A 2X6DA 3GC8A 4ANMA 3DA6A 5AR3A 4O27B 5HCXA 3FXXA 3DS6A 3MDYA 4M12A 2KULA 4D58A 3R6XA 3OXIA 2PVMA 2WAJA 2CMWA 3NW7A 3B8RA 3QUDA 1YXVA 2UVYA 4IX3A 4KNBA 2YITA 3QD0A 4GT3A 4RC2A 5AUTA 4MXXA 4R78A 4NCTA 4C3PA 3BX5A 4W8DA 2Y4PA 3RWPA 1URWA 4JDHA 5HD7A 4YLLA 4EEVA 5JMSA 3N4VA 4FV9A 1M7QA 4CTBA 2VTPA 4QP9A 4MBIA 2XUUA 5K0KA 4QMQA 3TT0A 4BY9E 4EORA 3TM0A 3E87A 3FZPA 2V7OA 1NW1A 4QMOA 2BRMA 4JBQA 3BLQA 4I1ZA 2J51A 3LXNA 3TUCA 1ZARA 4FZ6A 5EM5A 2C5XA 2WOTA 1Q97A 4IAKA 4BZDA 2OSCA 3P7CA 4UWYA 4EQUA 4FZFB 2VO0A 5DOSA 4ENYA 1XH9A 4C4HA 4QNYA 4M84A 1QMZA 3C4CA 4AF3A 5HBJA 3DTWA 3V6RA 2Z02A 5EQEA 2ESMA 4ITHA 5TOZA 4YSJA 1X8BA 2XS0A 4BCFA 4FEWA 4FTTA 3AMBA 2JKMA 4FZ7A 5C8MA 5AUYA 4U7ZA 1UA2A 4NU1A 3VS1A 1CDKA 2HZ4A 4YZNA 4EHVA 5AV1A 3PJCA 2FSTX 4C3FA 4FG9A 3ZYAA 4IAAA 4C8BA 5FP5A 3PWDA 2X2MA 4YPDA 1OIQA 3S00A 5CNNA 1ZZLA 2ZV2A 4PNIA 3PG1A 4BDKA 3BV3A 2BRNA 3GFWA 3KRRA 4O1PA 4XV1A 4O7WA 5EQPA 3N51A 1BYGA 4J96A 3FZTA 5DNRA 4YTIA 1YDTE 4ZTHA 1YHWA 1B38A 3VS2A 4YTCA 5A46A 3KXMA 4UWBA 2RL5A 4FTLA 2QOKA 3QHWA 1H08A 1Q8YA 3KF7A 3O7LD 4HCUA 3F3TA 3DDQA 3VQHA 1ZYJA 3UMWA 3F69A 1LPUA 3PJ8A 3NNWA 1OI9A 2G2IA 3TNPC 2VWIA 3U6HA 4X0MA 3FLNC 4H1MA 3SDJA 2V0DA 3BE9A 4XV3A 3ZZEA 5IQIA 4ORKA 3L9NA 2JKOA 4J8NA 4P5ZA 1M17A 4KSQA 3F5GA 2WMWA 3PRIA 5EHLA 2XRWA 4C34A 5BVNA 4FBXA 4C59A 5C1QB 5J1WA 4GMYA 2YDKA 4AE6A 4O7RA 2XEZA 2IO6A 3KU2A 3KCKA 4JS8A 4BTMA 4F64A 3FC1X 4AZFA 3DDPA 2XP2A 3LJ0A 3R0TA 2HK5A 5CWZA 3CY2A 3NEWA 4HPTE 4TWPA 3POZA 3I4BA 5I9XA 3VW8A 3HA8A 5L2QA 1Q99A 3BYOA 4MKCA 4PV0A 5I9WA 1WAKA 3TXOA 1V1KA 2CGUA 2GU8A 2UW5A 4WIHA 5CF5A 4AG8A 5JT2A 4J99A 2W96B 3LCKA 4GU6A 2X4FA 3C0HA 2OJIA 4G2FA 3ZH8A 2X39A 4PTEA 5HCZA 4BKJA 4DHFA 2I7QA 3HP2A 3ZUVA 1GZNA 4RZWA 1M14A 4QMWA 4A4XA 3FAAA 5LVPA 3OMVA 5BYYA 1BUHA 3CTJA 3QQKA 3MIAA 5ITAA 4C4JA 4K77A 5AFVA 4EH9A 4MXZA 2VTIA 2FSLX 3F2RA 4HCVA 3OEFX 4BDCA 3CBLA 4DT9A 3IDPA 4C4EA 2RFSA 2XK6A 4LFIA 1VZOA 4FSUA 2XYUA 4R6VA 4C4GA 3U4UA 3FMHA 3FEGA 4C7TA 4CGAA 5I5ZA 1M2QA 2NRUA 2QKRA 5L8LA 2JLDA 1YOMA 4FL3A 4MYGA 2WMTA 3LXPA 4AT3A 4X6QC 3W2PA 3MVJA 3G9LX 4I94A 3M42A 2P55A 4WA9A 4ACHA 5IQHA 4WT6A 4BDAA 3QTXA 4O22A 3NNUA 3ZO4A 3HAVA 4IB1A 1G3NA 4D4RA 3K5UA 1VYWA 2XJ0A 3TEIA 4F65A 3FY2A 3C0IA 4LQMA 2VTHA 3TACA 1SNUA 1GY3A 2PU8A 1OMWA 2J50A 3HMMA 4G9CA 4YZDA 4FV4A 4G6OA 5CF8A 1PYEA 2Y7JA 3KULA 4NJDA 3P1AA 3RK5A 4JQ7A 4X3FB 2F7EE 3ZCLA 5I0BA 4IIRA 4OW8A 4GKHA 3NMUF 2NP8A 4BBEA 2BRHA 3CQUA 3S4QA 3CP9A 3MPTA 3GFEA 2PVFA 3OWLA 3OUNB 1RJBA 2FUMA 4L01A 4RWKA 4ZJIA 1H07A 2C6KA 4MTAA 4H05A 3TNWA 4O6LA 4P5QA 4YTHA 4UV0A 3VC4A 4BCNA 4BC6A 2JAMA 3U9CA 5JGDA 5AM6A 4B7TA 4O7YA 2H8HA 3DGKA 5IA4A 2DS1A 4D28A 3ACJA 2A2AA 3CJGA 4YBKA 4AZVA 1YW2A 4EWQA 2GPHA 5IMXA 2OF2A 2WTDA 2OZOA 4NT4A 2PSQA 3QD4A 4FT0A 3KXNA 4YZCA 3RCJA 3TZ9A 2G9XA 4FTIA 3WF6A 3ZTXA 4BI2A 3BE2A 1AD5A 3DU8A 4ZLZA 3QQFA 1OBDA 1JSUA 4EJ7A 1PW2A 2HY0A 4FT5A 4D2VA 5BVDA 5KCVA 2C4GA 1FGKA 2WD1A 2X9FA 5CSPA 3ERKA 2EXCX 5HIEA 3CR0A 3KL8A 3VRZA 2G01A 3R8VA 3W2SA 4C02A 5EQYA 5IQAA 1JKTA 3LIJA 4XNEA 4LOPA 4QRCA 5IA2A 5JSMA 2O0UA 3QCSA 5LMAA 5AP0A 4CLIA 4YJQA 1H1RA 3F3UA 4F7JA 3A60A 3QKMA 2IG7A 1BKXA 4UB7A 4RRVA 3QZFA 4JLCA 4X7QA 4A7CA 1SVGA 2GTMA 5HO6A 5J87A 2BDJA 3ORMA 5JH6A 4EH5A 2QNJA 3V04A 4O0UA 2ITNA 2F7ZE 4M3QA 4QMNA 4IEBA 2JEDA 4BIBA 5IQCA 4GK4A 4IHPA 4NTTA 2F9GA 2AC3A 4BCMA 1BL6A 4LGDA 5IQEA 4QTEA 3HV7A 4L46A 4NKSA 3DZOA 1MRVA 1ZYDA 4JDIA 2XH5A 3HL7A 4FSMA 3KF4A 3F66A 1K3AA 3EQHA 2UV2A 3AOXA 5D7VA 4F6UA 2UZDA 2WB8A 3BGQA 3IPHA 3QF9A 4RIYB 5FEDA 3L8PA 4AXAA 5HLPA 2CKOA 4GIIA 2X8DA 2OICA 3O0GA 2BPMA 4F9CA 5I3OA 4I4EA 3NUYA 3RM6A 5EKOA 5IEVA 1L3RE 3T3UA 2ITZA 3QALE 4DEDA 1OPJA 4KBCA 4MF1A 3C50A 3HZTA 4RLLA 4EHEA 4BHZA 5J1VA 2E9OA 3H0YA 5FBOA 1I44A 2IW6A 3RK9A 4XRLA 1YXSA 3I7CA 3W8QA 3O50A 2VTLA 2B55A 3R7EA 1QPEA 4B4LA 5HGIA 1MP8A 3KK9A 3QYWA 1UU8A 3RNIA 4JG7A 4FKIA 3EN6A 4I0SA 3PXFA 1YHSA 4GL9A 4C2WA 3CCNA 4F63A 3G0FA 1IAHA 4U80A 4AUAA 4OLIA 2Z8CA 3QCXA 4FV1A 3Q6WA 4F9WA 3T9IA 2Z60A 5EYDA 1AGWA 3U9NA 3UG1A 5E4HA 4IJ9A 3AC3A 5CSXA 3F3WA 5FBNC 4FKOA 4DLIA 1K9AA 2HZNA 4UBAA 4A07A 3DXQA 3R8LA 4X6RA 3WF8A 2WMRA 3PVWA 2QG5A 5CU2A 3GQIA 2B4SB 4BYIA 5B7VA 5CXZA 2YDIA 2WTKC 3V5PA 3VF8A 4FODA 4W4WA 2XCHA 4OTWA 4TT7A 4I41A 3AT4A 4F08A 4O7LA 4F7SA 2ONLC 5BVEA 3R9RA 4HGSA 2OZAB 2EWAA 3QL8A 5AUXA 5FTQA 2R3GA 5CY3A 4E6CA 4ALUA 5L2TA 3AQVA 3S3IA 5D1JA 3E3PA 5EYMA 5IG1A 3CEKA 3DAJA 2A19B 3CJFA 3O7LB 4I0RA 1JSVA 3A8WA 4TXCA 5B2LA 1U54B 5KMLA 1V0PA 4U81A 4FUYA 3U54A 3BBTB 1SM2A 3GB2A 2QO9A 3U4WA 2B9IA 2PZRA 4XUFA 4QMSA 4YC8A 2X1NA 4DGMA 4UWCA 2FO0A 2RFEA 4FVQA 3CXWA 3PXRA 1TQIA 4K1BA 3ZLXA 4EZ5A 4ZTMA 2O64A 4ZY4A 4U5JA 1M2RA 5TR6A 4DN5A 3R8PA 3ZM4A 5JFSA 1SVHA 3AT3A 5HVJA 2PHKA 3R8MA 3D5WA 3MH2A 4JRVA 2PZYA 5D10A 3QC4A 4CFFA 2R3RA 4XJ0A 5KMOA 3IS5A 2YM5A 4P4CA 5LCJA 4FL1A 3T3VA 2CPKE 4USFA 2IWIA 5CEMA 1PKGA 3NGAA 3VBYA 4F6SA 3QRTA 4EKKA 3ROYA 1XKKA 2ZV7A 1K2PA 1ZMUA 3LCOA 5CAQA 4U3YA 4KBKA 3E92A 4RT7A 3VWAA 5FDPA 5BYZA 4CNHA 4EOMA 4XG6A 4V04A 3FMKA 1W82A 3RM7A 3AD5A 3LFCA 3W2QA 5ANOA 2R0IA 4U3ZA 3PSDA 1JAMA 4FVRA 4S32A 1OIUA 4JG6A 4U40A 4FZDB 4IM2A 2Y4IC 2W1DA 5LVOA 1VEBA 4Z16A 3FLWA 2GQRA 2BMCA 1OECA 2W1FA 5HU3A 1XR1A 5KKRC 3QAME 3DKFA 4EOIA 3COMA 4FT3A 3C1XA 4UYNA 4HVSA 1O6YA 5M06A 1YKRA 3S2PA 5IH6A 2IPXA 4HYSA 4CQEA 5HVKA 2X2KA 3LXLA 5L6PA 2CGWA 4EI4A 3SLSA 3EFWA 5AEPA 3MVHA 4PNKA 2P0CA 1QPJA 4NUSA 4IAIA 4ZJJA 4CFWA 4DEIA 2EB2A 3ORPA 3TJCA 4XG8A 1VR2A 2YISA 3TDVA 5E8SA 4J1RA 2VAGA 2F2UA 3EFJA 2BHEA 5FEQA 5FXQA 3GCUA 3VAPA 2W5BA 4DC2A 1QL6A 4CKIA 1BX6A 2IZRA 3KRLA 4CV9A 2QOCA 4CRLA 4E4XA 3KRWA 5E9EA 4OT6A 4ZZMA 1OKYA 3SV0A 3UODA 1Q41A 5GZAA 4IWQA 3FJQE 4YP8A 1YXXA 3HMIA 1PMNA 4WBBB 3MV5A 4CKJA 5JKGA 3PUPA 4ACCA 4XG9A 4BWKA 4EOLA 3HRCA 4O82A 2QC6A 3UOHA 4AGWA 3FZOA 5CT0A 4IM0A 5DFPA 2UW0A 4JOAA 4DINA 2H34A 1J7LA 5CVFA 4EOOA 4O81A 3GGFA 3SC1A 3RK7A 1R0PA 4ERKA 3BYUA 2I1MA 4AN3A 3ZRKA 4GFOA 4WD5A 2B9JA 4X2NA 5BYLA 5AP7A 4AX8A 5K5XA 3W32A 4GYIA 3MY5A 1GZKA 3DLZA 4X3FA 4XEYA 3P7BA 2X8EA 4FUXA 3RKBA 2UZEA 4QOXA 4UMPA 3OOGA 5HI2A 3EQIA 3WZJA 4GK3A 4KSPA 2G2FA 4OBQA 4EBVA 4F1OA 3DAKA 1YOJA 1EH4A 2WQOA 5KMKA 4D1ZA 2W4KA 4AA4A 4BGGA 4FSNA 5IDPA 2R3NA 4NM7A 2J0JA 1T46A 2WMAA 3UG2A 4FTJA 2AYPA 1NT2A 1T45A 3C51A 3F3ZA 2X81A 3EKNA 4QQCA 4RA4A 4RIXB 2PMIA 3ORNA 3ZLSA 3V5LA 5AP6A 2PVNA 1JOWB 1YDRE 3KXGA 4NFMA 5FEEA 4NL0A 3V8WA 1ZY4A 2VWZA 4IFCA 1RW8A 5I9ZA 4I6BA 2XK9A 4O7ZA 2CDZA 1YDSE 1WCCA 3IDBA 3NW6A 1HCLA 2NO3A 3MI9A 2VX3A 1A06A 2WMVA 4MNEB 3LE6A 4ONAA 3EQGA 3C4XA 4L45A 4XLVA 1PXJA 3AC8A 5EOLA 3UO4A 5KX8A 2VUWA 4EK4A 4BICA 5L4QA 3G9NA 2BZIB 4BGHA 3OWPA 5HEZA 2AC5A 2B7AA 2XNMA 3NUUA 4NM0A 5DN3A 2W17A 5HE1A 1S9IA 4O7NA 4AOJA 1GIHA 4KKGA 4OT5A 1QCFA 4PPAA 5KBRA 5M51A 4R5YA 2OJGA 2WKMA 4U43A 3HUBA 3LXKA 4DFYA 4MD7E 5AX9A 1YWVA 4BDGA 2GS7A 3TIYA 4E6DA 3VUHA 4CZYB 4DEEA 4EK8A 5DHJA 3OCTA 3UNZA 4BDIA 2UZVA 4IE9A 3COKA 3TJDA 4Y8DA 2XIXA 3GP0A 4XP0A 4GVAA 3UNJA 4U8ZA 2CGVA 3PPKA 4FIGA 5AR5A 4B8LA 4FX3A 5EHOA 3CPBA 3ET7A 3Q04A 4DEHA 3F2NA 3K2LA 2IZSA 3S95A 2OXXA 2X6EA 3MTFA 4U44A 5A6OA 3NR9A 2W1IA 4ITIA 3AC5A 3K3IA 3LQ5A 4RIYA 4PQNA 2XIKA 3UPXA 5H2UA 4QQJA 4LL0A 3NPCA 3OBGA 3FZSA 3OFMA 5LVMA 3MH3A 2BZKB 5M57A 1M7NA 3ALOA 1KUTA 4W4VA 5LARA 3IGOA 4EH3A 1H28A 4BTKA 4GT4A 3AC4A 2OJFE 1GAGA 3BU5A 3FHIA 3KQ7A 4RPVA 2HY81 3KN5A 4FG7A 2GFSA 4PP9A 5E8TA 3C4WA 4FSYA 3DZQA 4G3EA 1KE7A 4YJVA 4O2ZA 1URCA 1BI7A 3FI2A 1U59A 1OL5A 3UOJA 5HBEA 2JC6A 3OWJA 2XM9A 4ZY5A 3QKKA 3R7YA 2YWVA 1LEWA 4JL9A 3IGGA 2PZIA 1ZY5A 2GCDA 2VN9A 2WU6A 1H1SA 3D5VA 4RIWB 5F94A 3R73A 4G1WA 3R8ZA 5KZIA 3ZLWA 5I3RA 5IZFA 4GH2A 4ZTSA 2XK8A 4HZSA 3DBDA 4BGQA 3BQCA 4FIFA 4AQCA 3ENMA 1WBSA 3FMDA 2PULA 4CSVA 3VUIA 3GC9A 3RHKA 5HG5A 4HVGA 1ND4A 4ZJVA 4ARKA 3SXSA 3WYYA 5B2MA 3V8TA 4YJOA 3QD3A 3I5NA 3FUPA 4IC7A 5AADA 4PDPA 3V8SA 1IASA 1J3HA 2E9VA 5AP3A 1MQBA 3OBJA 2JDVA 5CF4A 2GHGA 4I5PA 1WVWA 4IVDA 4F0IA 1KV1A 3Q52A 4I0TA 4QPSA 3ZBFA 5DBXA 1WBOA 2R3LA 3FPMA 4F70A 2GFCA 3OY1A 4G3DA 1WFCA 4FTAA 1FPUA 3ANQA 4IX5A 1H0WA 4MXYA 4IXPA 3UE4A 4DH5A 2YDJA 1Y6AA 4PPCA 2IVVA 3TZMA 1U54A 3KFAA 4YZBA 5C8KA 2HXQA 3DOGA 3QX2A 4IAYA 5AM7A 4EBWA 3QWJA 1U46A 2UW6A 2IZUA 4MXOA 2C30A 3VBWA 3VQUA 2HAKA 3OF0A 4BTFA 5IQGA 2BDFA 2YIRA 2W1CA 2YIXA 4WNOA 5CENA 5CEIA 4BDFA 3F2AA 2B9HA 2X7OA 4XOZA 3MH1A 4KIPA 3SRVB 4TZRA 3ZRMA 2F2CB 3QRUA 4DF3A 2ETRA 2VV9A 3WZUA 3NAYA 4IWDA 4BB4A 4BDEA 5JFXA 5IQFA 1JKKA 4MF0A 1GZOA 5E8VA 2YLEA 3W18A 4AU8A 3BHHA 4IQ6A 1KV2A 3L8VA 3FQSA 3UQGA 1XH7A 2O8YA 5M07A 4ZZOA 4GJ3A 2VTRA 3D7TA 2XIZA 3BQRA 3LCTA 4UXQA 4XHKB 3VS0A 3GQLA 3MBLA 4ANOA 4TW9A 2J0KA 5M4FA 2E9NA 2WTKB 2R3QA 2BHHA 5CALA 2PVJA 1XBAA 4LI5A 5JN2A 2C0IA 5CU6A 3WIGA 4G9RA 4D2SA 4YU2A 3PSCA 4LV8A 4NYEA 2WMBA 4ASZA 4PDOA 5D9HA 3H0ZA 4FIEA 4YJPA 4YUQA 4QPAA 4NW5A 4D0XA 2B1PA 2ETMA 4S34A 4L7SA 4CEGA 3VN9A 2J0IA 4DGGA 4N4SA 3TKIA 3QA0A 2F7XE 3FQHA 4EKLA 4FOBA 4F0FA 3A7GA 5C27A 4BWPA 4EZ7A 3LAUA 1FMOE 3CY3A 3E64A 3I81A 4BL1A 2ITUA 2ZM4A 3E63A 3PE2A 4CFUA 1KE8A 4A9TA 1F0QA 4MBLA 4WUNA 4N6ZA 4ACMA 3U8WA 4AZSA 3R04A 4FKSA 3EZRA 4ZLYA 4OAVB 4F99A 3PXQA 1U4DA 4FV3A 4PTGA 2SRCA 4I5CA 1NVSA 4BCPA 3U55A 2JITA 2WTIA 4QMMA 4TYHA 4L6QA 4O7VA 5AR7A 5JFWA 4E6QA 2F49A 3SG8A 3MFRA 4G17A 3DXPA 5CANA 4J8MA 3HRFA 2BRBA 1GNGA 3BI6A 2WQBA 4MX9A 3WBLA 2RKUA 4APCA 2YABA 3EHAA 1FMKA 1PXMA 4D0WA 3BWFA 5M4UA 4L53A 1PY5A 1G8AA 3ID6C 2RG6A 4C33A 3FMNA 3Q4CA 4NCTC 4EOJA 1KE6A 3B2WA 1QPCA 5ANEA 5CYIA 3VJNA 4RIOA 3BLHA 5CS6A 4MXAA 4CMUA 4KIKB 3Q2JA 4F7NA 2GSFA 3PXKA 5DT3A 4RC3A 3QUEA 1NVQA 3AC2A 3IOPA 4XP3A 3O23A 3F82A 1OL2A 5E8WA 3HDMA 4O84A 2W9ZB 3R1SA 3KXZA 3P9JA 2C1BA 1J91A 2X4ZA 5JZNA 3V5WA 4DEBA 5J7HA 3C9WA 3WZKA 4FMQA 3GCPA 3NIZA 3UO5A 3VRYA 3F6XA 3W1FA 4ZLOA 4BCOA 1YOLA 3PSBA 4FV5A 4X21A 1OIRA 2BDWA 2HIWA 4GK2A 2VTNA 2QU5A 4IM3A 5KKRB 4C2VA 3EYGA 3KREA 3E88A 1B6CB 4ERWA 3EN4A 2JGZA 4RX5A 3FMLA 3O71A 3OD6X 1UU3A 3QTIA 4YNEA 5ETIA 3D5XA 4E7WA 3E7VA 2YCRA 4AGCA 4X2JA 1ZRZA 2BAQA 4YMJA 4WG5A 3VUKA 5L3AA 3Q4ZA 4BFMA 4UMTA 3B2TA 2QO7A 4HZRA 5G6VA 2RFDA 4GUEA 3OTVA 3WF7A 4TPTA 5GJFA 5DA3A 5IU2A 4ANLA 1YI6A 3ALNA 1H4LA 4M14A 4J53A 3JYAA 3C0GA 3F5UA 5E8UA 2XIRA 3CGOA 2XBAA 5IH4A 3I1AA 3Q6UA 3AGMA 2V7AA 3Q5IA 5CX9A 3MTLA 4YNOA 2OH0E 5TO8A 4WG3A 1Q8TA 3ZU7A 2EUFB 5HX6A 4L9IA 4H39A 4QNAA 2EXEA 4MBJA 4ANQA 5E1SA 3FPQA 4CV8A 3RINA 4USEA 4EH7A 3ZUUA 2PMOX 3QYZA 5AV4A 3NLBA 5AJQA 3LLAA 3L8XA 4FSRA 5DEWA 2QOFA 4NM3A 5AV3A 2P4IA 3RPSA 4MNEA 1ZWSA 3V6SA 2GTNA 1R0EA 4O21A 4DG3E 4DITA 4QYFA 5DT0A 4PP7A 2CNVA 2UZWE 3FKOA 4S33A 1M52A 3ZSGA 5IKWA 4BCIA 5ETAA 4KKHA 3DFCB 3R83A 4Y85A 3REPA 5J7BA 1Y57A 2IN6A 3ZO3A 3T9TA 2YIWA 3SW7A 3GBZA 3VJOA 3LFAA 5BVOA 1E9HA 5FD2A 4IVCA 4DEAA 1U5QA 3W55A 4H1JA 2QCSA 3JUHA 3NWWA 5AP2A 5EI2A 3WE8A 3GOKA 4Z3VA 3ZUTA 3II5A 1CTPE 5H8EA 1UWHA 4JQ8A 2XK3A 4KAOA 4PTCA 4TYGA 3OCGA 4LMNA 3UPZA 2NPQA 4ZIMA 3ZFXA 1ZOGA 3VUTA 5HTIA 3C4ZA 3SHEA 5EG3A 2ZB1A 4BCGA 3PYYA 3SA0A 5EDQA 3PZHA 4PL5A 3QU0A 2VX0A 2JFLA 4OTHA 2Y6OA 3ORXA 4V0GB 3OCBA 2XM8A 3H4JA 3FYJX 3LFEA 4KINA 3THBA 2Z7SA 2QU6A 2WMSA 2J90A 2FVDA 5A4CA 3F61A 3AD6A 4PL3A 3IK3A 2QOBA 5JEBA 2JDSA 4TYEA 3P7AA 5EI8A 4ZSGA 5H9BA 3HMOA 4TY1A 4AAAA 4ALVA 1Q8WA 4DCAA 2VWYA 3ZLYA 5GZ8A 3NIEA 1TKIA 4G3FA 1NVRA 1Q4LA 3DK6A 3M11A 4JIKA 3PZEA 4ZMEA 3VS7A 3WI6A 1CKJA 3FYKX 3U6JA 4QPMA 3FWQA 2WPAA 1PXIA 2PUUA 3FKLA 5DR2A 2C68A 5K4JA 4RLKA 5M4IA 1SNXA 4AP7A 2W1EA
chains in the Genus database with same CATH superfamily
3MJ2A 3OT8A 3IECA 3HV3A 4XOYA 3NSZA 3QQLA 4QT1A 2R9SA 4KS7A 2C0TA 5LWNA 3O17A 4RIWA 1CM8A 3LM5A 3QGYA 4G3GA 4GT5A 3TNHA 2A1AB 5CT7A 4O96A 4QTCA 3E93A 1OBGA 4RMZA 4YZ9A 4BRXA 2Z7QA 3UIXA 4AE9A 4R7BA 2PY3A 4CT1A 4GW8A 2B52A 4BCJA 1PKDA 1HCKA 4RWLA 4YC3A 4D9TA 5GINE 2ZOQA 4GFGA 4L7FA 5FGKA 2ZV8A 3JY0A 2VRXA 1H1QA 5D12A 1RQQA 4ZXTA 4GU9A 2VTJA 2FB8A 1SYKA 4YJRA 4AT5A 2E2BA 3ODZX 4I24A 5A4TA 4MEDA 2PPQA 4ID7A 3IOKA 3QA8A 1MUOA 4RBLA 1Y8YA 2Q0NA 2VTAA 4APPA 2XANA 4QQTA 1GJOA 3V51A 1LR4A 2UZOA 4AA5A 2IZTA 1YWRA 3CGFA 5HVYA 3LJ2A 2YERA 4YHFA 4DBNA 5KO1A 3E62A 1KWPA 3DQWA 3W10A 2OK1A 4S30A 3ZC5A 3OG7A 4FNXA 3DB6A 3FMEA 4QP1A 3EL8A 4I20A 4OBPA 5E1EA 1PYXA 5DVRA 3TZ7A 2GHLA 4M68A 3DY7A 3ZSIA 4BDJA 3ZZWA 3IW4A 2WZJA 2R2PA 3FLSA 4IVBA 4C61A 3MIYA 3G5DA 2VTQA 1UKIA 1U5RA 3SRVA 5A54A 3GI3A 2HZIA 1KOBA 2F4JA 4AWIA 3HDNA 3GEQA 3BHYA 2GNLA 3BV2A 4EYMA 5IDNA 4FICA 5HLWA 1O6LA 2W05A 3F9NA 4IZAA 3U51A 5L8JA 4TL0A 4QP4A 2OJ9A 3D2IA 3D5UA 5HTCA 3B8QA 3DNEA 1RDQE 5AP5A 2WTWA 2ITPA 5CI6A 3KY2A 3KKVA 1WVYA 3F5PA 4XG2A 5DR6A 5DYJA 4A9UA 1YI4A 3ETAA 2UW3A 3DKGA 3DQXA 3MFUA 3TUBA 1J7UA 4FV8A 2VGPA 2XNBA 4MD9E 3E7OA 4XX9A 2ONLA 4F0GA 2C6TA 1WZYA 2C3JA 3P08A 5EM6A 3BHTA 2CJMA 4X3JA 3RWQA 5EW9A 3R1NA 4L43A 2CKEA 3KRXA 3MPMA 2BRGA 3FLZA 2IW8A 2W5HA 3H10A 1B39A 2X0PA 3DKCA 1LEZA 2WMXA 4E4LA 4EH4A 1YI3A 5KMNA 4GYGA 3PJ3A 3MSSA 2C5OA 2QLQA 2ITTA 4B8MA 4M0ZA 1KSWA 1FOTA 3BU6A 5K3YA 1ST4A 3L9LA 4JR3A 4O0VA 4EOPA 4BWXA 5DWRA 1H25A 4FKPA 1FVTA 3K3JA 3QHRA 1OPLA 3H9FA 5FM2A 2CNUA 4FK6A 2OFUA 2YIYA 4RGJA 3CLYA 3VBVA 2CCHA 5LQFA 2VX1A 5D41A 5CI7A 3MA3A 2QG7A 5BMMA 2C6MA 3ZO2A 5J95A 4IACA 4LUDA 4Z7HA 3DV3A 3D94A 4LG4A 2WEIA 3OC1A 4ZAUA 4GIHA 5HIBA 5CEQA 4MAOA 4GUBA 3QUPA 3TKHA 4EWHA 5F20A 3QXPA 2JIVA 4FT9A 2JKQA 4OR5A 4XBRA 5EH0A 2XCKA 4QP8A 5H3QA 4OUCA 4KIOA 2YIQA 2UUEA 2R3MA 2UZBA 1NY3A 4HVDA 4HJOA 4J7BA 3SOAA 1OKWA 3O8UA 3DNDA 4H3QA 2VNWA 4O38A 3NUNA 3HMNA 2QD9A 4JNWA 4KRDA 4LOQA 4XCUA 5BVKA 2XALA 2GS6A 4UEUA 4ZS0A 3K54A 3RTPA 4RVLA 3PJ2A 3QZIA 4BZOA 3Q53A 3ORTA 3VS4A 5LMKA 3AKKA 3OHTA 3G6GA 3BPRA 4E8AA 3O5AA 5C26A 3W2OA 5C8NA 3D7ZA 4PPBA 5KUPA 4CZTA 3DJ6A 3ZS5A 3VNTA 1QPDA 2I0HA 3NVKI 4JI9A 3UBDA 2CGXA 3V01A 4A9RA 4D2PA 1REJA 1R39A 5HNBA 5AP4A 5I9VA 5AR4A 2PUNA 4GEOA 5ANDA 5TF9A 3W16A 4U41A 3OVVA 4RWJA 4WRSA 3UO6A 5CQWA 2GQSA 3HLLA 2HW6A 3QTRA 2ITVA 4GCJA 1ATPE 2WIPA 2ITXA 4O4BB 4CVAA 2FSOX 2OJJA 4FGBA 3QD2B 3VVHA 5CEOA 5HORA 3DK7A 3R28A 3LMGA 3RGFA 5M44A 3BKBA 3PIYA 4O7TA 4Z9LA 1UV5A 1R1WA 1HOWA 3PJ1A 3CKWA 4BF2A 3KC3A 2PE1A 1XQZA 4G6LA 4CFVA 3QTZA 1FVVA 2O2UA 3O8TA 1XH6A 5K0XA 4TWOA 5E7RA 5DH3A 4CRSA 5CSVA 5HICA 2W0JA 3UOKA 3ORIA 2XNGA 3VS6A 2I0EA 3NUSA 5KBQA 4A9YA 3RALA 4IWOA 3ZEPA 4JR7A 4Q9ZA 5HO7A 4F7LA 3CIKA 5EW8A 5E92A 5IMEA 1KOAA 4NJ3A 2F57A 4TWNA 3HAMA 3P78A 4BBMA 4F9AA 5JGAA 2R3OA 3BYMA 4ZTRA 2BVAA 3EH9A 4AW1A 4O0SA 1XH4A 3JVSA 4CG9A 5HQ0A 5K5NA 3KMWA 4FIHA 4O7SA 4IB5A 4S31A 2ITOA 2GDOA 2UW4A 2VO6A 3UMXA 3A7JA 3IKAA 4F9BA 4QEBA 3MFSA 1JKSA 3OY3A 5AA8A 5BUEA 5AP1A 5IUHA 3BRBA 4GFMA 4O6EA 3PE1A 4FOCA 4YLKA 3FXZA 3TL8A 3VW6A 4DGOA 1IRKA 1BMKA 4GKIA 1P5EA 5H8GA 5AUVA 1JNKA 4N0SA 5E90A 1XWSA 3S0OA 1MRYA 4IJPA 1STCE 4MXCA 2IVSA 3F7ZA 4JBOA 2RGPA 3C5UA 3DKOA 5CAVA 2BCJA 4JBPA 2J0LA 3DFAA 3FQEA 4O4DA 2CKPA 3OTUA 2H9VA 3A4OX 1H26A 3PP1A 3K5VA 3Q4UA 4D9UA 4U42A 1IR3A 3QTWA 3KVXA 3LM0A 1A9UA 2J0MB 2C3LA 3EQPA 4NK9A 4E6AA 3AG9A 4G5JA 3E5AA 4EUTA 4E4MA 4IZ5A 2WO6A 4V0GA 5HE0A 4JQEA 4OTFA 2WEVA 1Q8UA 2R64A 4J71A 4EK3A 3CC6A 2QR8A 3KMUA 3MWUA 5BMSA 2E9UA 2GHMA 2W06A 3TTJA 1VLRA 2WQNA 4TYJA 3OZ6A 1OL7A 3I0QA 4XLIA 2PMNX 3PDTA 4WSYA 4E5BA 1ZYCA 4CCBA 2BKZA 3KXHA 2Z7LA 4N57A 4GVJA 3DBFA 4HOKA 4Y5QA 5FLFA 3E8NA 3LQ8A 4I92A 5DRBA 4A4OA 4CG8A 1PXKA 1ZOEA 2YN8A 3ITZA 4RFMA 4FE2A 3PFYA 3VHEA 2LGCA 5F4NA 3C13A 4FV7A 4QTAA 2BFYA 1OUKA 3EMGA 1APME 2R4BA 3HGKA 3PRFA 4RVKA 4DH7A 4RX9A 3QLGA 4O0YA 5J5SA 4P7EA 1H00A 2ITYA 5AR2A 4FTNA 4FEXA 5EDRA 4TYIA 3ENHA 4X3FC 5HU9A 4UMRA 2YEXA 2A0CX 3R2BA 4M15A 4UY9A 4RJ3A 4XH6A 4FVPA 4B9DA 4C37A 4WOVA 5CZIA 2WTVA 1H0VA 4FTUA 4AA0A 2BIKB 1G8KA 1ERKA 5E8YA 3AC1A 2PZPA 3FHRA 4OTRA 1ZAOA 1S9JA 3R8UA 4Y73A 4DG2E 4QMZA 4L42A 3JPVA 4AXEA 2JIIA 2BTRA 1RE8A 1XHAA 2HXLA 2JAVA 3EFLA 3OWKA 4I22A 4JX3A 4O91A 3GVUA 4G34A 3NCGA 3A4PA 3NUPA 3Q4TA 5B2KA 3FI3A 4IAFA 4DG0E 1Q3DA 4WKQA 3E8DA 3SGCA 1ZOHA 4F1MA 4O4CA 5L2SA 2BAKA 4XBUA 5AR8A 4OAUC 4HNIA 4UALA 5FDXA 3R7OA 2XAMA 4E73A 3JR1A 5CVHA 3QZGA 2KTYA 4R3RA 4KA3A 2XARA 4RJ7A 5CVGA 3L8SA 4EH6A 2Y0AA 2CHLA 4AZEA 5IA1A 4R3PA 3BLRA 4JG8A 4C35A 2W1GA 3Q60A 1OITA 4YJTA 3Q9XA 1UWJA 2Q83A 1GIJA 2WFYA 1V0OA 3P79A 2ZV9A 3IW7A 3D9VA 4CCUA 4AW5A 4QTBA 2VO3A 1YVJA 1H01A 3GXLA 4WUAA 2YCFA 2YA9A 4UYAA 4NW6A 5A9UA 5J5TA 1PMVA 3L9MA 1XBCA 4NTSA 5E8ZA 1OGUA 2ETKA 5JRQA 4AZWA 4AT4A 4KABA 2W9FB 2WQMA 2ZM1A 3CKXA 5FTGA 5IA0A 4C36A 2J6MA 4KIQA 3H3CA 4XYFA 2C5YA 2DUVA 2XMYA 2R3HA 4WG4A 3RMFA 3HEGA 5IQDA 4D2WA 3Q5ZA 4I6QA 3UP7A 2C6DA 4C3RA 2QOQA 3CD8A 3NX8A 4FSQA 3DTCA 4RJ8A 3TG1A 2FGIA 4WRGA 4EOSA 3LMIA 3W0OA 4E93A 2X9EA 3RI1A 2YZLA 2QURA 5EHYA 5AAEA 5IQBA 5DRDA 4E20A 3A7HA 4DBXA 3RCDA 5I4NA 3TV4A 2JDOA 4AS0A 4M7IA 4FKJA 3ZDUA 2OXYA 3R7GA 5AIRA 4FGRA 3SW4A 3VBTA 2OIDA 3EKKA 4FKTA 3COHA 4PDSA 2JKKA 2UZNA 5GZ9A 4DH1A 3QGWA 4BZNA 1PF8A 4CXAA 3PIXA 2JDRA 3BGZA 3GUBA 3D0EA 3NS9A 2OZAA 3F5XA 3LCDA 3BLAA 4LMUA 2OIQA 3O2MA 4I6FA 3UDTA 3HYHA 3EQFA 2DWBA 4OTQA 2PE2A 5BV3A 2JD5A 3TKUA 5FUTA 3HKOA 2HW7A 4Y5HA 4DA5A 3V3VA 5AAGA 3GU6A 4RX7A 2VO7A 2XB7A 1Q3WA 1P2AA 2YACA 3R1YA 4ITJA 1P4OA 2C5NA 3UQFA 2ZDUA 3DPKA 3LFQA 4C38A 5M4CA 3ODYX 4FSTA 4A4LA 3BCEA 2B54A 3UIBA 2IEWA 3TZ8A 4DE4A 2CLQA 5GNKA 3G15A 3OCSA 3UC4A 3HX4A 2C3IB 3BBWA 3OT3A 3KRJA 3PIZA 3Q9ZA 4EC9A 3F7WA 5CF6A 4EH8A 3R63A 3RPVA 2XJ1A 4BDHA 3TDWA 4TKSA 4FTKA 2GNJA 4Y83A 4BCHA 3R1QA 4EQCA 4BVUA 2UZUE 4CZUA 3UQCA 3ROCA 3OUKA 4DFNA 2YLFA 3OW3A 4V01A 4ZSJA 3OOMA 1G8SA 3W0RA 3KGAA 3D2KA 4JX7A 2A4LA 1IA9A 4YHJA 4B6LA 1OM1A 3NAXA 4I5HA 3LFBA 4J97A 1PRYA 4FEVA 4USDA 2OGVA 4FF8A 4LGHA 4N6YA 3N4TA 3CSVA 1H24A 1ZMWA 1OVEA 1PXPA 2REIA 4RC4A 4AZTA 1DAWA 2QVSE 3OXZA 4FKRA 4MUQA 3D83A 3R21A 3EZVA 3TCPA 3TUDA 5EM7A 1R78A 2PWLA 2XK7A 2ZMCA 2YM8A 4K6ZA 2XNOA 4C58A 4DFZE 3R7VA 4EK5A 4EUUA 4HVHA 4HYUA 4AXDA 4KS8A 3FLYA 3ZXZA 1OPKA 2V55A 3FBVA 1F5QA 3W2CA 1OZ1A 4X2GA 3SVVA 2IVTA 4G5PA 1W0XC 1Y91A 2CN5A 3TNIA 4QYYA 3ULZA 3OW4A 3G33A 3G90X 4MWHA 4RQKA 4YLJA 1XJDA 2C69A 5L8KA 3DXNA 2OU7A 1CMKE 2C6LA 3P4KA 4JVGA 4BCKA 4CFXA 5IPJA 2PVKA 3NNXA 4Z55A 5J9ZA 2UVXA 3A99A 5FRIA 1PXNA 4BYJA 2PZ5A 4QYEA 2BZJA 4ENXA 2E9PA 4QQ5A 4BIDA 2VWBA 5EK7A 4NM5A 1GIIA 4D4SA 3O8PA 2VWXA 2VWUA 2QOLA 3QX4A 4EYJA 4S2ZA 3PA5A 2FYSA 4M69B 4GV1A 4ZMFA 2H6DA 2ZYBA 3G0EA 3EN9A 3PY1A 3MA6A 3FV8A 4FKGA 3DK3A 5IA3A 3MYGA 1YHVA 1Q61A 2HWPA 1CKIA 3NCZA 2GNGA 4FSWA 4ZTNA 3VHKA 4BDBA 4L00A 4D2TA 2P3GX 4E1ZA 5CAPA 3KA0A 2WELA 4JRNA 3RAHA 2PL0A 1O9UA 3IG7A 3ZXTA 4FEUA 3ZSHA 4GG5A 4PY1A 3WZEA 3PPZA 3U6IA 4TWCA 3FXWA 3PPJA 4EHZA 2CN8A 2Z2WA 3ANRA 3MGYA 3P86A 3R02A 3I6WA 4KWPA 4RJ6A 4IB0A 4TRLA 5DLSA 1W7HA 1R3CA 2C1AA 2Y4IB 3KEXA 5J8IA 3VS5A 4BTJA 1PMEA 3CPCA 3O51A 4AN2A 1LUFA 2HCKA 5HLNA 3QLFA 4II5A 3JXWA 3HRBA 4D1SA 2ZJWA 4Q5HA 5HNGA 5J79A 4XV9A 3ORKA 3QFVA 4QTDA 3TYKA 3RZFA 1LP4A 4I21A 5AV2A 4IVAA 4RVTA 4JDJA 4EOKA 1YQJA 3DAEA 1YWNA 2HENA 2WMUA 3I0OA 4PMMA 4L8MA 5DEYA 3SQQA 4PMPA 5LVNA 4QMLA 4R1VA 5CU4A 4ZP5A 3A7FA 5JFVA 2I0VA 4BCQA 3ZFMA 3RAIA 3F3VA 3TNQB 3A8XA 3QXOA 2VTSA 3MVMA 4UMQA 1OIYA 4CFNA 4IAZA 3VUDA 4RFZA 3GCQA 5ETCA 5KMJA 5T6KA 3VBQA 2R0UA 4UZHA 3I79A 4LRJA 4O2PA 4ANBA 3DLSA 3EB0A 5EM8A 3P0MA 5KZ0A 3VF9A 5AWMA 4ZSAA 3P23A 3Q3BA 4N70A 4LOOA 4IB3A 2X0GA 2PVRA 4NSTA 4NZWB 5T3QA 2CKQA 3MH0A 4ASDA 3OEZA 5C01A 2ZAZA 4IW0A 3SX9A 4O0RA 2ZDTA 4MWIA 1Q24A 4IBMA 5AA9A 3PWYA 4OGRA 5CSHA 3MB6A 5DGZA 1E1XA 4RIXA 5TKDA 2RIOA 3M1SA 4YZMA 3RNYA 4DAWA 3D4QA 2V62A 3QBNA 5BNJA 3LHJA 3R30A 5GHVA 4D5HA 4U45A 4WNPA 1WVXA 3TN8A 2XNPA 5EKNA 4HPUE 3LMHA 1JVPP 4ZTQA 3U87A 1FINA 4L44A 3NZ0A 2WOUA 3Q2MA 2C6IA 3ZC6A 3HV4A 3Q9WA 4IX4A 5FM3A 5AUUA 5TE0A 2Q0BA 4IX6A 4MHAA 4FSZA 1W83A 2OI4X 5CLPA 4CLJA 3P5JC 3PVGA 4AFJA 3BYSA 3QQUA 2EB3A 4IZYA 5EYKA 3VUGA 5DIAA 1TQMA 4DFBA 4FV6A 4XMOA 2ITWA 5KMMA 1BL7A 3POOA 4FYNA 5DPVA 2R5TA 4LV5A 3F88A 3QQHA 2ACXA 1ZXEA 4I93A 2XKDA 4K11A 4C57A 3UZRA 5DT4A 4YR8A 5CU3A 3LFNA 5ICPA 1Q5KA 2OG8A 1H1WA 3ACKA 3PP0A 4PWNA 3FSFA 1TQPA 5GJGA 4C4IA 2W4JA 2OW3A 4CQGA 3UDBA 1W98A 3AXWA 3R9HA 2QI8A 5FXSA 4EL9A 4HGEA 4F9YA 3ZFYA 1V0BA 4FR4A 4YHTA 3LQ3A 4BHNA 4GRBA 4J95A 4IFGA 5B0XA 5CAOA 4EC8A 3FLQA 4W9WA 4U79A 3UNKA 4F4PA 4TNDA 5DE2A 3QWKA 5HIDA 3ZOSA 3QQJA 4A9SA 1FGIA 1UU9A 1E1VA 4B99A 2VWWA 4L67A 4QYHA 3QRIA 5LOHA 2R3FA 3ORLA 3R01A 3EWHA 4NIFB 4MQ2A 4LYNA 5C4LA 3UGCA 4I5MA 2CNQA 3ZMMA 1IG1A 4L3LA 5M53A 3ATTA 5C4KA 1DM2A 3DCVA 3PA3A 4FV0A 2JBPA 4ZEGA 2XA4A 3PLSA 4U0IA 3A2CA 2PVHA 2YAAA 4QMTA 2NRYA 3PTGA 1YXUA 1AQ1A 1PMUA 2EXMA 3ELJA 4NKAA 4D2RA 4JAIA 4RJ4A 4LL5A 1JQHA 3RPOA 3UZTA 2OWBA 5HCYA 2XZSA 5IA5A 2XKFA 3AD4A 2HZ0A 4AOTA 2OIBA 5G1XA 5K9IA 4PDYA 4H3BA 2WGJA 2C6OA 2WXVA 5CEPA 2PE0A 2J4ZA 5HD4A 1XMLA 2RFNA 3BELA 5M55A 3UVRA 3A61A 4YC6A 2QHNA 4DH3A 2BUJA 3LLTA 5DMZA 4KB8A 4P2KA 5L2IA 4BR3A 3MY1A 2X0OA 3I6UA 5CSWA 1FBNA 2QQ7A 3RPYA 2ERKA 2G15A 3QCQA 1J1CA 2B0QA 3LFDA 1CSNA 4Y72A 1I09A 4D1XA 5A4QA 1UNGA 1WMKA 4FTMA 3V5QA 5LMBA 2PK9A 3EQBA 3TV6A 3EIDA 3FY0A 2O3PA 1ZMVA 1OUYA 3LVPA 4FG8A 5HBHA 4ZSEA 2BIYA 2YHVA 4JXFA 1F3MC 2O63A 5D7AA 4QMVA 4HYHA 3MB7A 1CKPA 2XIYA 5FG8A 4BN1A 2XYNA 5DR9A 2J9MA 4BBFA 3M2WA 3PY0A 4B0GA 2QO2A 4KUJA 4YTFA 4M8TA 3IONA 4L3JA 5AX3A 4PMSA 2FA2A 2EU9A 4JIAA 1XO2B 2BTSA 5EOBA 2VTOA 4FZAB 5K4IA 3I5ZA 5ANKA 5I9YA 3GU5A 4RA5A 3UVQA 3FZ1A 3AT2A 2PTKA 3QCYA 5JQ5A 4IADA 4DEGA 1OL6A 3GC0A 4HVIA 2J7TA 4GG7A 2NNWB 2BILB 3PVUA 4NFNA 3HA6A 2G2HA 1XMMA 4KD1A 3V5JA 4JBVA 5F9EA 3GT8A 4D5KA 4W4XA 5AIKA 2FH9A 2W1ZA 1P14A 3CS9A 3MN3A 2QOIA 5EFQA 4R7HA 5HHWA 1WBTA 4IC8A 4BKYA 3TWJA 3FDNA 3VONA 3H30A 5A6NA 4DFXE 3L1SA 3EJ1A 2VNYA 4U9AA 3AMYA 2ITQA 3GNIB 2J5FA 2O65A 4HGLA 4QP6A 5FWKK 3RZBA 5M08A 1W8CA 4FTRA 3DBEA 4R7IA 4QMXA 2OLCA 2A27A 4W8EA 2XBJA 3ZDIA 4DGNA 2HOGA 3EFKA 3BEGA 3DBCA 3DB8A 3ORZA 3ULIA 2P33A 1PXOA 3EN5A 2WNTA 1M2PA 2XNNA 3LOKA 5HG7A 2X8IA 3WE4A 4DCEA 1UVRA 5HO8A 3DJ5A 3EQDA 2OFVA 5AUWA 2GNFA 2QOHA 3NRMA 4RQVA 4R8QA 2OH4A 3SAYA 1UNLA 3W33A 1KE9A 2WTJA 5HG9A 4EHGA 2R3IA 5ACKA 2I6LA 2YCSA 5A14A 5E91A 4DHIB 4UXLA 5HKMA 4GSBA 3WF5A 4WSQA 4UX9A 4R77A 3PY3A 4V05A 4MNFA 5L6WL 4DH8A 5A4LA 5HTBA 3WOWA 3N9XA 4OBOA 2A98A 3IW5A 2VU3A 3O96A 4LUEA 5E8XA 2AEGA 2BKKA 3FI8A 3IQ7A 3UOLA 1JKLA 3HV6A 4GS6A 4UZDA 4EH2A 4FTCA 3OROA 4H3PA 3EYHA 4FIIA 4LRMA 4M0YA 2YJSA 4QO9A 3VBXA 2YM3A 4MK0A 3QTQA 4EK6A 4ZK5A 3MPAA 2W99B 3IDCA 4M69A 3CTHA 3KCFA 1Q8ZA 1WBVA 5F95A 3LFFA 4IDVA 4DT8A 3IW6A 4O0XA 2B9FA 4L52A 4RWIA 5AUZA 4D4YA 5BX0A 4TTHB 5J9YA 4JJRA 1J7IA 4KIKA 2PVYA 3DT1A 4MH7A 4D4VA 2DQ7X 2WIHA 5ANIA 2XF0A 2QODA 2YAKA 3BU3A 3RAKA 2QONA 1Z57A 2XEYA 5EI6A 4EONA 4K8AA 3SD0A 3BIZA 2CSNA 4FT7A 4IANA 3HVCA 5IH5A 4PUZA 4A06A 4C4FA 3LKMA 2JFMA 4R1YA 4ZOGA 4ACDA 1SZMA 4E4NA 3NVMB 4DFUA 1JLUE 2V22A 4YURA 4WNMA 3PA4A 4FI1A 3WZDA 4MVFA 1MQ4A 4ASEA 1YRPA 4DFLA 5AV0A 3FE3A 3CTQA 3MW1A 3RBWA 2PVLA 4FKUA 2UZLA 5HZNA 4CKRA 3ATSA 4FEQA 4XG4A 1A48A 2I40A 4KBAA 3JY9A 4BDDA 1SMHA 4H36A 4IWPA 3QZHA 5CEKA 3UVPA 3UJGA 5JK3A 1PHKA 1UNHA 1VJYA 2VGOA 4YO6A 1OKVA 4I6HA 3WYXA 4BI0A 3D7TB 2YM4A 2QHMA 4CYJA 5IUGA 4XG7A 4FTQA 3FKNA 5HE2A 1DI8A 1DAYA 2OXDA 5CAUA 1L8TA 4DDIA 4ALWA 3NYVA 5BPYA 3ZRLA 4LDTA 2BFXA 3LFSA 3NUXA 4YSMA 5I9UA 3SG9A 4K33A 4O0WA 3W0PA 3A7IA 2RG5A 1JSTA 2IJMA 5LWMA 1BLXA 4QMUA 4FNWA 4ACGA 5FP6A 3W8LA 4YO4A 5GJDA 3NYOA 5FQDC 4CD0A 3W2RA 2XAOA 4LGGA 3ZEWA 2I0YA 4FA2A 4KKEA 5LMKC 2OKRA 2IW9A 2QLUA 1FQ1B 3GOPA 3DBQA 2X7FA 3NYNA 3PXZA 4JAJA 4MD8E 5T68A 2PUIA 2OF4A 2XK4A 4AXCA 2J2IB 4K2RA 2R3KA 2YWPA 2XJ2A 3PLAE 4RSSA 1IEPA 2BALA 5JZJA 1FVRA 4I23A 2IVUA 3CE3A 5J9LA 5H8BA 4EQMA 3JS2A 5HNIX 5KHWA 3KN6A 4JDKA 4RZVA 5HESA 5CQUA 3N4UA 4BJJB 3R00A 2OO8X 4TYHB 4WHZA 2UVZA 3T8OA 4DTKA 4RX8A 4E3CA 5L2WA 4FL2A 4DLJA 2ZVAA 1WBWA 4KRCA 4YGAA 1GZ8A 2CCIA 2O5KA 2W5AA 2BAJA 3KMMA 5CNOA 5EDPA 5BUIA 3QQGA 3PVBA 5KE0A 1PJKA 3HP5A 2WQEA 2H96A 4QP7A 4IDTA 5M56A 4AACA 1VYZA 4M67A 3UP2A 3FZRA 4UMUA 5CTPA 2BR1A 4MCVA 4JT3A 2QOOA 2XNEA 3V5TA 3WIKA 3I60A 5LXMA 3DJ7A 1W84A 3GU8A 2XKCA 2XRUA 3NDMA 1Z9XA 4X2FA 1BI8A 2C5VA 2X0QA 3QRJA 4YJUA 1DS5A 3R71A 3R9DA 4YJSA 4F6WA 2P2HA 4OTGA 4RVMA 3FC2A 1DI9A 1ZYSA 1YXTA 2B53A 1UU7A 3I7BA 4O0TA 1H8FA 3SOCA 4Y46A 4ANNA 5HX8A 4HGTA 4CFMA 2GQGA 3FL4A 3KB7A 3MY0A 1O6KA 4U6RA 1OGYA 4DTAA 3FL5A 5BVFA 4G16A 1ZLTA 3GCVA 1XH5A 3H9OA 4WBOA 4XS2A 4LRKA 4ZY6A 5LCKA 3SXRA 3UYTA 4ASXA 4NIFA 4QMPA 3IO7A 3LPBA 4ZZNA 2YZAA 4DYMA 5LJJA 4ZS4A 3GENA 3KVWA 2RF9A 4NWMA 4U97A 4WO5A 2R7IA 4XP2A 4AW2A 2ZMDA 3FMJA 4E5WA 1ZZ2A 3GCSA 4BKZA 3MESA 2WMQA 3RJCA 3R22A 1Y6BA 2JIUA 3E8EA 4GJ2A 4I4FA 4FYOA 4J98A 4AFEA 3L9PA 5EW3A 3WARA 4HCTA 3NUAA 2VTMA 1J1BA 2DYLA 1TVOA 2YFXA 4K18A 2BROA 4QMYA 4PL4A 3RPRA 3UYSA 5CASA 3IW8A 3ZBXA 4IH8A 3RVGA 1JPAA 1MRUA 3EL7A 3TV7A 2X7GA 3ZONA 3UC3A 3E3BX 3UIMA 5KMIA 3EN7A 5KNJA 2C0OA 3EOCA 1NA7A 4G31A 3MFTA 1ZYLA 5FXRA 5L6OA 3R7UA 1GOLA 4J52A 2UW9A 4Q5EA 1G5SA 4L3PA 5GIOE 3LJ1A 3Q9YA 2PMLX 1KE5A 2HWOA 3R9NA 4AN9A 4O1OA 4F09A 4NEUA 3HV5A 4RFYA 4AOIA 1REKA 4G3CA 1UKHA 3BZ3A 3C4EA 3JVRA 4L68A 3ZO1A 4EZ3A 3BEAA 4EJNA 3R2YA 3P5KA 3RAWA 2YM6A 2WTCA 4TN6A 4YPSA 5AAFA 2PUPA 1XBBA 4M97A 3RHXA 4BIEA 2R3JA 3Q96A 4FNYA 4R3CA 1WBPA 2UW8A 4PX6A 3TTIA 2VD5A 4PF4A 4Z7GA 4HW7A 2C3KA 2P2IA 5M09A 5AMNA 5C9CA 3S1HA 5BQ0A 3VS3A 2UZTA 2Z7RA 4X2KA 4YJNA 5A4EA 4XG3A 5ANGA 3WILA 3H9RA 3GC7A 3Q32A 3UTOA 2X2LA 3RP9A 5IISA 3NYXA 3A62A 3BYVA 3TIZA 2BZHB 3MVLA