3HMSA

Crystal crystal structure of the n-terminal fragment (28-126) of the human hepatocyte growth factor/scatter factor, orthorhombic crystal form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
91
structure length
91
Chain Sequence
RNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Structural basis for agonism and antagonism of hepatocyte growth factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 26
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3hmsA00
4R19A 1W8KA 2YIOA 4UAOA 5CS9A 5COEA 4APMA 3ZWZA 2J8LA 3MKPA 2HGFA 3HMRA 2F83A 1I8NA 2YILA 2Z8WA 5CT1A 5CSQA 1YXEA 4Z09A 2J8JA 3SRIA 5CP9A 4R1CA 1W81A 1GMNA 2Q8BA 4Z0DA 2Q8AA 4UV6A 3HN4A 2Z8VA 2QJ2A 5CT3A 2LL4M 2QJ4A 5CT2A 5EODA 3SRJA 1GMOA 4APLA 4DURA 4R1BA 1Z40A 5CS1A 1GP9A 5EOKA 4Z0EA 3HMTA 3ZLEA 2K13X 2LL3A 3SP8A 2Y8RA 3HMSA 2X2ZA 1NK1A 2YIPA 5CS5A 4A5TS 4R1AA 5CS3A 1BHTA 1HKYA 5I25A 4Z0FA 4IUAA
chains in the Genus database with same CATH superfamily
4R19A 1W8KA 2YIOA 4UAOA 5CS9A 5COEA 4APMA 3ZWZA 2J8LA 3MKPA 2HGFA 3HMRA 2F83A 1I8NA 2YILA 2Z8WA 4YIVA 5CT1A 5CSQA 1YXEA 4Z09A 2J8JA 3SRIA 5CP9A 4R1CA 1W81A 1GMNA 2Q8BA 4Z0DA 2Q8AA 4UV6A 3HN4A 2Z8VA 2QJ2A 5CT3A 2LL4M 2QJ4A 5CT2A 5EODA 3SRJA 1GMOA 4APLA 4DURA 4YIZA 4R1BA 1Z40A 5CS1A 1GP9A 5EOKA 4Z0EA 3HMTA 3ZLEA 2K13X 2LL3A 3SP8A 2Y8RA 3HMSA 2X2ZA 1NK1A 2YIPA 5CS5A 4A5TS 4R1AA 5CS3A 1BHTA 1HKYA 5I25A 2KL5A 4Z0FA 4IUAA
chains in the Genus database with same CATH topology
4R19A 1W8KA 2YIOA 4UAOA 5CS9A 5COEA 4APMA 3ZWZA 2J8LA 3MKPA 2HGFA 3HMRA 2F83A 1I8NA 2YILA 2Z8WA 4YIVA 5CT1A 5CSQA 1YXEA 4Z09A 2J8JA 3SRIA 5CP9A 4R1CA 1W81A 1GMNA 2Q8BA 4Z0DA 2Q8AA 4UV6A 3HN4A 2Z8VA 2QJ2A 5CT3A 2LL4M 2QJ4A 5CT2A 5EODA 3SRJA 1GMOA 4APLA 4DURA 4YIZA 4R1BA 1Z40A 5CS1A 1GP9A 5EOKA 4Z0EA 3HMTA 3ZLEA 2K13X 2LL3A 3SP8A 2Y8RA 3HMSA 2X2ZA 1NK1A 2YIPA 5CS5A 4A5TS 4R1AA 5CS3A 1BHTA 1HKYA 5I25A 2KL5A 4Z0FA 4IUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R19 A;  1W8K A;  2YIO A;  4UAO A;  5CS9 A;  5COE A;  4APM A;  3ZWZ A;  2J8L A;  3MKP A;  2HGF A;  3HMR A;  2F83 A;  1I8N A;  2YIL A;  2Z8W A;  5CT1 A;  5CSQ A;  1YXE A;  4Z09 A;  2J8J A;  3SRI A;  5CP9 A;  4R1C A;  1W81 A;  1GMN A;  2Q8B A;  4Z0D A;  2Q8A A;  4UV6 A;  3HN4 A;  2Z8V A;  2QJ2 A;  5CT3 A;  2LL4 M;  2QJ4 A;  5CT2 A;  5EOD A;  3SRJ A;  1GMO A;  4APL A;  4DUR A;  4R1B A;  1Z40 A;  5CS1 A;  1GP9 A;  5EOK A;  4Z0E A;  3HMT A;  3ZLE A;  2K13 X;  2LL3 A;  3SP8 A;  2Y8R A;  3HMS A;  2X2Z A;  1NK1 A;  2YIP A;  5CS5 A;  4A5T S;  4R1A A;  5CS3 A;  1BHT A;  1HKY A;  5I25 A;  4Z0F A;  4IUA A; 
#chains in the Genus database with same CATH topology
 4R19 A;  1W8K A;  2YIO A;  4UAO A;  5CS9 A;  5COE A;  4APM A;  3ZWZ A;  2J8L A;  3MKP A;  2HGF A;  3HMR A;  2F83 A;  1I8N A;  2YIL A;  2Z8W A;  4YIV A;  5CT1 A;  5CSQ A;  1YXE A;  4Z09 A;  2J8J A;  3SRI A;  5CP9 A;  4R1C A;  1W81 A;  1GMN A;  2Q8B A;  4Z0D A;  2Q8A A;  4UV6 A;  3HN4 A;  2Z8V A;  2QJ2 A;  5CT3 A;  2LL4 M;  2QJ4 A;  5CT2 A;  5EOD A;  3SRJ A;  1GMO A;  4APL A;  4DUR A;  4YIZ A;  4R1B A;  1Z40 A;  5CS1 A;  1GP9 A;  5EOK A;  4Z0E A;  3HMT A;  3ZLE A;  2K13 X;  2LL3 A;  3SP8 A;  2Y8R A;  3HMS A;  2X2Z A;  1NK1 A;  2YIP A;  5CS5 A;  4A5T S;  4R1A A;  5CS3 A;  1BHT A;  1HKY A;  5I25 A;  2KL5 A;  4Z0F A;  4IUA A; 
#chains in the Genus database with same CATH homology
 4R19 A;  1W8K A;  2YIO A;  4UAO A;  5CS9 A;  5COE A;  4APM A;  3ZWZ A;  2J8L A;  3MKP A;  2HGF A;  3HMR A;  2F83 A;  1I8N A;  2YIL A;  2Z8W A;  4YIV A;  5CT1 A;  5CSQ A;  1YXE A;  4Z09 A;  2J8J A;  3SRI A;  5CP9 A;  4R1C A;  1W81 A;  1GMN A;  2Q8B A;  4Z0D A;  2Q8A A;  4UV6 A;  3HN4 A;  2Z8V A;  2QJ2 A;  5CT3 A;  2LL4 M;  2QJ4 A;  5CT2 A;  5EOD A;  3SRJ A;  1GMO A;  4APL A;  4DUR A;  4YIZ A;  4R1B A;  1Z40 A;  5CS1 A;  1GP9 A;  5EOK A;  4Z0E A;  3HMT A;  3ZLE A;  2K13 X;  2LL3 A;  3SP8 A;  2Y8R A;  3HMS A;  2X2Z A;  1NK1 A;  2YIP A;  5CS5 A;  4A5T S;  4R1A A;  5CS3 A;  1BHT A;  1HKY A;  5I25 A;  2KL5 A;  4Z0F A;  4IUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...