3HN4A

Crystal structure of the nk2 fragment (28-289) of human hepatocyte growth factor/scatter factor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
256
structure length
256
Chain Sequence
KRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGEGESYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTANGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Structural basis for agonism and antagonism of hepatocyte growth factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 63
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 3hn4A02
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 3hn4A03
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 3hn4A01
5EODA 1NK1A 1I71A 3E6PL 1PK4A 5CS9A 3U73A 1B2IA 1HKYA 1HPJA 4O03A 1NL1A 4HZHA 5EOKA 2YIPA 3ZWZA 4APMA 5CT3A 2PK4A 5HPGA 4Z0DA 2K51A 4BVCA 2FEBA 2L0SA 3MKPA 2J8LA 4KIVA 2I9AA 3NXPA 1NL2A 1PK2A 1PMKA 2DOIA 2YIOA 4BV5A 2HGFA 4BVDA 5CP9A 2K13X 2Q8BA 1Z40A 3HMTA 2LL3A 1HPKA 4Z0FA 1GP9A 1KI0A 4IUAA 2F83A 1CEAA 3HMRA 4A5TS 2QJ2A 1CEBA 1I5KA 2HPPP 2KJ4A 1JFNA 5CS5A 5CT1A 4UAOA 3K65A 1GMNA 2J8JA 4APLA 3HN4A 3HMSA 4R1CA 2X2ZA 1GMOA 1BHTA 2Z8WA 3BT1A 2Z8VA 1TPKA 2K4RA 3KIVA 1PMLA 2PF2A 4NZQA 5I25A 2PF1A 4Z0EA 2HPQP 3ZLEA 2I9BA 5CT2A 4UV6A 2KNFA 2QJ4A 2LL4M 2Y8RA 1KIVA 2SPTA 2YILA 3SRJA 4BVVA 4CIKA 1URKA 5CS3A 4BV7A 1YXEA 5CSQA 2FD6A 1A0HA 4D3CA 3SP8A 2Q8AA 1PKRA 5COEA 4Z09A 1I8NA 4R1BA 1KDUA 1W81A 3SRIA 3LAQA 5CS1A 4R1AA 4R19A 4BVWA 1W8KA 3BT2A 1KRNA 4DURA 2DOHX
chains in the Genus database with same CATH superfamily
5EODA 1NK1A 1I71A 3E6PL 1PK4A 5CS9A 3U73A 1B2IA 1HKYA 1HPJA 4O03A 1NL1A 4HZHA 5EOKA 2YIPA 3ZWZA 4APMA 5CT3A 2PK4A 5HPGA 4Z0DA 2K51A 4BVCA 2FEBA 2L0SA 3MKPA 2J8LA 4KIVA 2I9AA 3NXPA 1NL2A 1PK2A 1PMKA 2DOIA 2YIOA 4BV5A 2HGFA 4BVDA 5CP9A 2K13X 2Q8BA 1Z40A 3HMTA 2LL3A 1HPKA 2KL5A 4Z0FA 1GP9A 1KI0A 4IUAA 2F83A 1CEAA 3HMRA 4A5TS 2QJ2A 1CEBA 1I5KA 2HPPP 2KJ4A 1JFNA 5CS5A 5CT1A 4UAOA 3K65A 1GMNA 2J8JA 4APLA 3HN4A 3HMSA 4R1CA 2X2ZA 1GMOA 1BHTA 2Z8WA 3BT1A 2Z8VA 1TPKA 2K4RA 4YIVA 3KIVA 1PMLA 2PF2A 4NZQA 5I25A 2PF1A 4Z0EA 2HPQP 3ZLEA 2I9BA 5CT2A 4UV6A 2KNFA 2QJ4A 2LL4M 2Y8RA 1KIVA 2SPTA 2YILA 3SRJA 4BVVA 4CIKA 1URKA 5CS3A 4BV7A 1YXEA 5CSQA 2FD6A 1A0HA 4D3CA 3SP8A 2Q8AA 1PKRA 5COEA 4Z09A 1I8NA 4R1BA 1KDUA 1W81A 3SRIA 3LAQA 5CS1A 4R1AA 4YIZA 4R19A 4BVWA 1W8KA 3BT2A 1KRNA 4DURA 2DOHX
chains in the Genus database with same CATH topology
5EODA 1NK1A 1I71A 3E6PL 1PK4A 5CS9A 3U73A 1B2IA 1HKYA 1HPJA 4O03A 1NL1A 4HZHA 5EOKA 2YIPA 3ZWZA 4APMA 5CT3A 2PK4A 5HPGA 4Z0DA 2K51A 4BVCA 2FEBA 2L0SA 3MKPA 2J8LA 4KIVA 2I9AA 3NXPA 1NL2A 1PK2A 1PMKA 2DOIA 2YIOA 4BV5A 2HGFA 4BVDA 5CP9A 2K13X 2Q8BA 1Z40A 3HMTA 2LL3A 1HPKA 2KL5A 4Z0FA 1GP9A 1KI0A 4IUAA 2F83A 1CEAA 3HMRA 4A5TS 2QJ2A 1CEBA 1I5KA 2HPPP 2KJ4A 1JFNA 5CS5A 5CT1A 4UAOA 3K65A 1GMNA 2J8JA 4APLA 3HN4A 3HMSA 4R1CA 2X2ZA 1GMOA 1BHTA 2Z8WA 3BT1A 2Z8VA 1TPKA 2K4RA 4YIVA 3KIVA 1PMLA 2PF2A 4NZQA 5I25A 2PF1A 4Z0EA 2HPQP 3ZLEA 2I9BA 5CT2A 4UV6A 2KNFA 2QJ4A 2LL4M 2Y8RA 1KIVA 2SPTA 2YILA 3SRJA 4BVVA 4CIKA 1URKA 5CS3A 4BV7A 1YXEA 5CSQA 2FD6A 1A0HA 4D3CA 3SP8A 2Q8AA 1PKRA 5COEA 4Z09A 1I8NA 4R1BA 1KDUA 1W81A 3SRIA 3LAQA 5CS1A 4R1AA 4YIZA 4R19A 4BVWA 1W8KA 3BT2A 1KRNA 4DURA 2DOHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOD A;  1NK1 A;  1I71 A;  3E6P L;  1PK4 A;  5CS9 A;  3U73 A;  1B2I A;  1HKY A;  1HPJ A;  4O03 A;  1NL1 A;  4HZH A;  5EOK A;  2YIP A;  3ZWZ A;  4APM A;  5CT3 A;  2PK4 A;  5HPG A;  4Z0D A;  2K51 A;  4BVC A;  2FEB A;  2L0S A;  3MKP A;  2J8L A;  4KIV A;  2I9A A;  3NXP A;  1NL2 A;  1PK2 A;  1PMK A;  2DOI A;  2YIO A;  4BV5 A;  2HGF A;  4BVD A;  5CP9 A;  2K13 X;  2Q8B A;  1Z40 A;  3HMT A;  2LL3 A;  1HPK A;  4Z0F A;  1GP9 A;  1KI0 A;  4IUA A;  2F83 A;  1CEA A;  3HMR A;  4A5T S;  2QJ2 A;  1CEB A;  1I5K A;  2HPP P;  2KJ4 A;  1JFN A;  5CS5 A;  5CT1 A;  4UAO A;  3K65 A;  1GMN A;  2J8J A;  4APL A;  3HN4 A;  3HMS A;  4R1C A;  2X2Z A;  1GMO A;  1BHT A;  2Z8W A;  3BT1 A;  2Z8V A;  1TPK A;  2K4R A;  3KIV A;  1PML A;  2PF2 A;  4NZQ A;  5I25 A;  2PF1 A;  4Z0E A;  2HPQ P;  3ZLE A;  2I9B A;  5CT2 A;  4UV6 A;  2KNF A;  2QJ4 A;  2LL4 M;  2Y8R A;  1KIV A;  2SPT A;  2YIL A;  3SRJ A;  4BVV A;  4CIK A;  1URK A;  5CS3 A;  4BV7 A;  1YXE A;  5CSQ A;  2FD6 A;  1A0H A;  4D3C A;  3SP8 A;  2Q8A A;  1PKR A;  5COE A;  4Z09 A;  1I8N A;  4R1B A;  1KDU A;  1W81 A;  3SRI A;  3LAQ A;  5CS1 A;  4R1A A;  4R19 A;  4BVW A;  1W8K A;  3BT2 A;  1KRN A;  4DUR A;  2DOH X; 
#chains in the Genus database with same CATH topology
 5EOD A;  1NK1 A;  1I71 A;  3E6P L;  1PK4 A;  5CS9 A;  3U73 A;  1B2I A;  1HKY A;  1HPJ A;  4O03 A;  1NL1 A;  4HZH A;  5EOK A;  2YIP A;  3ZWZ A;  4APM A;  5CT3 A;  2PK4 A;  5HPG A;  4Z0D A;  2K51 A;  4BVC A;  2FEB A;  2L0S A;  3MKP A;  2J8L A;  4KIV A;  2I9A A;  3NXP A;  1NL2 A;  1PK2 A;  1PMK A;  2DOI A;  2YIO A;  4BV5 A;  2HGF A;  4BVD A;  5CP9 A;  2K13 X;  2Q8B A;  1Z40 A;  3HMT A;  2LL3 A;  1HPK A;  2KL5 A;  4Z0F A;  1GP9 A;  1KI0 A;  4IUA A;  2F83 A;  1CEA A;  3HMR A;  4A5T S;  2QJ2 A;  1CEB A;  1I5K A;  2HPP P;  2KJ4 A;  1JFN A;  5CS5 A;  5CT1 A;  4UAO A;  3K65 A;  1GMN A;  2J8J A;  4APL A;  3HN4 A;  3HMS A;  4R1C A;  2X2Z A;  1GMO A;  1BHT A;  2Z8W A;  3BT1 A;  2Z8V A;  1TPK A;  2K4R A;  4YIV A;  3KIV A;  1PML A;  2PF2 A;  4NZQ A;  5I25 A;  2PF1 A;  4Z0E A;  2HPQ P;  3ZLE A;  2I9B A;  5CT2 A;  4UV6 A;  2KNF A;  2QJ4 A;  2LL4 M;  2Y8R A;  1KIV A;  2SPT A;  2YIL A;  3SRJ A;  4BVV A;  4CIK A;  1URK A;  5CS3 A;  4BV7 A;  1YXE A;  5CSQ A;  2FD6 A;  1A0H A;  4D3C A;  3SP8 A;  2Q8A A;  1PKR A;  5COE A;  4Z09 A;  1I8N A;  4R1B A;  1KDU A;  1W81 A;  3SRI A;  3LAQ A;  5CS1 A;  4R1A A;  4YIZ A;  4R19 A;  4BVW A;  1W8K A;  3BT2 A;  1KRN A;  4DUR A;  2DOH X; 
#chains in the Genus database with same CATH homology
 5EOD A;  1NK1 A;  1I71 A;  3E6P L;  1PK4 A;  5CS9 A;  3U73 A;  1B2I A;  1HKY A;  1HPJ A;  4O03 A;  1NL1 A;  4HZH A;  5EOK A;  2YIP A;  3ZWZ A;  4APM A;  5CT3 A;  2PK4 A;  5HPG A;  4Z0D A;  2K51 A;  4BVC A;  2FEB A;  2L0S A;  3MKP A;  2J8L A;  4KIV A;  2I9A A;  3NXP A;  1NL2 A;  1PK2 A;  1PMK A;  2DOI A;  2YIO A;  4BV5 A;  2HGF A;  4BVD A;  5CP9 A;  2K13 X;  2Q8B A;  1Z40 A;  3HMT A;  2LL3 A;  1HPK A;  2KL5 A;  4Z0F A;  1GP9 A;  1KI0 A;  4IUA A;  2F83 A;  1CEA A;  3HMR A;  4A5T S;  2QJ2 A;  1CEB A;  1I5K A;  2HPP P;  2KJ4 A;  1JFN A;  5CS5 A;  5CT1 A;  4UAO A;  3K65 A;  1GMN A;  2J8J A;  4APL A;  3HN4 A;  3HMS A;  4R1C A;  2X2Z A;  1GMO A;  1BHT A;  2Z8W A;  3BT1 A;  2Z8V A;  1TPK A;  2K4R A;  4YIV A;  3KIV A;  1PML A;  2PF2 A;  4NZQ A;  5I25 A;  2PF1 A;  4Z0E A;  2HPQ P;  3ZLE A;  2I9B A;  5CT2 A;  4UV6 A;  2KNF A;  2QJ4 A;  2LL4 M;  2Y8R A;  1KIV A;  2SPT A;  2YIL A;  3SRJ A;  4BVV A;  4CIK A;  1URK A;  5CS3 A;  4BV7 A;  1YXE A;  5CSQ A;  2FD6 A;  1A0H A;  4D3C A;  3SP8 A;  2Q8A A;  1PKR A;  5COE A;  4Z09 A;  1I8N A;  4R1B A;  1KDU A;  1W81 A;  3SRI A;  3LAQ A;  5CS1 A;  4R1A A;  4YIZ A;  4R19 A;  4BVW A;  1W8K A;  3BT2 A;  1KRN A;  4DUR A;  2DOH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...