3HN6A

Crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
271
structure length
271
Chain Sequence
PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Glucosamine-6-phosphate deaminase from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Isomerase
molecule keywords Glucosamine-6-phosphate deaminase
total genus 90
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hn6A00
1O8BA 3CH7A 3ENQA 2RI1A 2RI0A 4IO1A 4GMKA 3KWMA 3LWDA 4L4ZA 4X84A 1DEAA 1HORA 3ENWA 3OC6A 3ICOA 4GO1A 4L5JA 1LKZA 4R9NA 3U7JA 1UJ5A 2GNPA 3BXGA 3BXHA 1UJ6A 3NZEA 4NMLA 2WU1A 2O0MA 4OQQA 1Y89A 2W48A 1FRZA 3BXFA 3BXEA 3ENVA 3HHEA 1VL1A 2R5FA 3E15A 4M8LA 1NE7A 1FS5A 1LK5A 3LHIA 1M0SA 4TM7A 2BKVA 1UJ4A 3NWPA 4OQPA 1CD5A 3EB9A 4L5IA 4L50A 2OKGA 3E7FA 1HOTA 3KV1A 3TX2A 3EFBA 4R7TA 3L7OA 3CSSA 1LK7A 2J0EA 3HN6A 5HJ5A 1FS6A 4L51A 1FQOA 1KS2A 2BKXA 1FSFA 1XTZA 4L4YA 3UW1A 1JT9A 4TM8A 1PBTA 3IXQA 2F8MA
chains in the Genus database with same CATH superfamily
4RVCA 2FFQA 5AM2A 2EKQA 1QRSA 3WJ7A 1WVMA 1IVNA 2QENA 4IEFB 5KPJA 1X9HA 5IHXA 3VOAA 1VQ1A 3H5AA 5JJKA 3LCUA 4RF4A 3COPA 1LRKA 2QXUA 3O7WA 3UJDA 1Y89A 4JJ4A 2QE7A 4KC0A 3JXEA 3AKDA 1JBKA 1FDVA 4W7HA 4ZMBA 2X6TA 2IYOA 4LE2A 3WICA 2EFDB 4UREA 1PYGA 1E8MA 3SHOA 3J81A 1PWEA 3PXDA 1G1MA 2C0PA 3ZK9A 1Y6FA 2W0SA 4YCJA 2WEKA 5CAEA 4CTNA 1A9PA 1WW3A 5B7NA 3ZCUA 4C7VA 4ZD6A 4IIVA 2V0NA 4JB0A 2WZBA 4KUGA 1T2EA 2QJFA 4QD3A 4RTQA 1V9SA 1ZSYA 2WSYB 3OJEA 4OOEA 3W6NA 3LLUA 2QGNA 3LUGA 1ULHA 1X0VA 2X8BA 4U2GA 5LZ7A 3B5IA 4XGNA 1P60A 4DPLA 3ZHXA 3UAVA 1DMSA 1KO1A 1QVAA 1TI7A 2ZRMA 3AERB 3RSQA 3DDOA 5FUXA 1I6KA 2C4VA 4WNYA 3UXYA 3DE1X 2PUDA 4AYXA 2QTBA 2Y1DA 4AT1A 3DW3X 3CT6A 3CN7A 3WB9A 4BKRA 2C0CA 5CEFA 1N7IA 1JIXA 3FTDA 4WOCA 2I29A 4RH0A 1KEKA 1ENYA 2I55A 3NU1A 4LDRA 4NR0A 4CF5A 4AY6A 3HVUA 1GSOA 5IN4A 1KEEA 5F77A 3N0RA 3P9QA 2C2YA 3DMRA 2J9ZB 3NKFA 4OHOA 5C35A 3G82C 5JQGA 5J2TB 4XSVA 3KSUA 4C7JA 2GAOA 3ED5A 4IOKA 1A95A 1LS1A 1JYFA 2H0QA 2ZK7A 3N5KA 4HEJA 1LWOA 2WM9B 4WNCA 1NXWA 2CC2A 3NT5A 1X14A 4N47A 4NG5A 2HLDA 2XMQA 3UMGA 5IBCA 1EDOA 2HJSA 1T3GA 5J5AA 3MRSA 1QBKC 2O48X 3ADPA 4Y2SA 1UXKA 1IMOA 4QASA 3BWMA 1Z4QA 3LWNA 3GJ4A 1HSOA 2GN6A 1DHRA 2ZYWX 3QYFA 4E5VA 4FOPA 1OA1A 3OX4A 4QSMA 3K2IA 5EKDA 2OO3A 2E0IA 1TKRA 4GMDA 3TIIA 1G8FA 1WF3A 4EFDA 2HIAA 2NGRA 4Q4AA 4ARIA 3TH5A 1U04A 2VDVE 2GOYA 3AFNA 3VR5A 3DBLB 3JV7A 3GD5A 4BFLA 4UPEA 5JT1A 4KXMA 1J4AA 3BB4A 3ENKA 4C7KA 4ROTA 2VT6A 4EM6A 4EY7A 2F3SA 4IF6A 3ZY3A 1U90A 4GD3Q 1EUZA 2XGJA 4AMVA 3EQZA 3N8KA 3Q8WA 1RYNA 2YOFA 2FWMX 2JW5A 2ZT6A 2V9PA 4WOPA 4LNUB 2GA9A 4R2MA 1DBPA 3VVBA 1HDRA 2ZUCA 1WXFA 1LW6E 1YZYA 1OXMA 2OORC 4HRVA 5CJ2A 4QGFA 3Q5DA 5MN6A 3UGJA 5CXSA 2FWPA 1PU2A 1THGA 1ISHA 1OFUX 4D0NA 2BGKA 3DT6A 4EQ6A 1N2GA 1Q91A 4OHWA 5I4BA 1VPLA 5E7JA 3Q8KA 2CLHB 3BGSA 1DDGA 2QHXA 5D7BA 3G89A 4LDPA 2PSJA 2JCBA 3USES 3A32A 4LMRA 2HXSA 1KI6B 3JR7A 4RPCA 4UE3S 2GZ2A 1SXHA 4TYMA 2W70A 4URUR 1JYEA 1GWNA 4CMIA 4DJ5X 1BHSA 1G20B 4N65A 1YIOA 3G9UA 3I72A 3LC0A 1UOQA 1A9SA 1MNQA 4ZVNA 2HDNB 3G79A 4GC5A 3SQNA 3N5CA 1T5BA 4CW7A 1HGXA 3ESZA 3FDZA 3U37A 4GXNA 3RUAA 3UN1A 3NG1A 4AUKA 1O94A 1PL0A 4PRZA 3V8PA 2ON6A 2EYQA 2XMDA 4TV9F 2FFHA 2ASVA 2MMGA 3ZVNA 3MGCA 1RWOA 1YTLA 1YE8A 5CMLA 1BHQ1 3AQ4A 1ZISA 2K5UA 1FYDA 3A6DA 1URPA 4YPVA 2QPLA 1BMTA 2WFAA 4Q82A 5L45A 1K88A 2FXVA 3QWFA 4OQFA 1FNMA 1JA0A 5C81A 3BWXA 4MQEB 3KBOA 1UJ4A 2PFSA 4IR7A 4BZWA 2PG3A 1Y5RA 3DBVO 2IC5A 3OTGA 1Y34E 3D6JA 4IOMA 3URMA 1VG1A 3T5PA 3I5XA 4E70A 3TGWA 5ALYA 3N2KA 3DDWA 1KSJA 3UW3A 1TCVA 1BHJA 3SX0A 5G4KA 3G8CA 5CBPA 4AP6A 3T5CA 4X8MA 1DTWA 3LOUA 4IWNA 2PNJA 3X1DA 4DIDA 2VH2A 4WIAA 2QSYA 1NOIA 5I8ZA 2BFBA 1U0EA 1VYVA 2B4QA 3MWDA 5TQ0A 5K51A 1NBOA 6PFKA 4P4UA 1G59A 1NUPA 1W8DA 2EJCA 4OAQA 1JFFA 3FNRA 5FOVA 2CLMB 1I1QB 3W8RA 2O07A 4IIJF 4FW9A 1ZK1A 4TM7A 5BORA 2P4EA 4TYPA 5KUTA 4Q9AA 4H7PA 4XA8A 2A30A 3NVMB 4EARA 1NR7A 2ZBGA 1U7XA 1GITA 1HDXA 1MDBA 2CFSA 3O5AA 1JB9A 4I5GA 1F51E 1R0ZA 3U4GA 3U39A 4DSOA 1R5NA 2I62A 3UV3A 1M1XB 3FNHA 1HYQA 4AZVA 2ZPTX 1CZLA 4TPKA 4GRAA 5AHRA 1U9IC 2DH5A 2FFJA 3C2QA 2MJLA 1F1BA 4NV1A 4DE5A 4A8PA 4L72A 1UFOA 1GYPA 5FWXA 4F1JA 2WF6A 3UWOA 1E5VA 2A5GA 2EJUA 2HV8A 3PK0A 5BY2A 1U63A 3N70A 1JXOA 4U7TB 5F5LA 5F73A 4BFYA 2BEUB 1UBSB 2F4NA 2GYVA 2Q4OA 2PUJA 2RG1A 3CB4A 2AOTB 4X8LA 3WKCA 4DSAA 1SM4A 4X97A 4Q9KA 1GL3A 3EY4A 1O2DA 3IQXA 4OM7A 3REQA 5C7IO 2VSYA 4RETA 1PR2A 3AIIA 5CG1A 4HYEA 5I3ZA 4S2UA 3MS4A 2WRZA 3BEOA 2IRWA 1OFVA 3NBQA 2HRRA 3OQIB 1FQJA 3AQIA 1QO0D 4D02A 4DL9A 5JZSA 5JAPA 1Y3DE 4WINA 3MF4A 4ABTA 4W82A 4NECA 3PICA 4R2JA 1EG7A 5DIZA 1HE1C 2HHCA 1XVTA 1QPGA 2HQOA 1YDWA 2QF7A 4H15A 2XTMA 3FTPA 1JKFA 1W76A 2E4YA 2XLBA 4L02A 3C3YA 4AFNA 2H1VA 4U0KA 3ADKA 3M49A 5ERXA 2PX5A 2OCAA 5L3ZA 4LYEA 1FVFA 4HWKA 4P3PA 2QTRA 3B82A 3UJCA 3WGUA 2RAVA 3DM5A 3B53X 1YI1A 4FCTA 3W4KA 1TEZA 2WDPA 4FFRA 4DT1B 4KG7A 1J6UA 2O9JA 3KVYA 2VJKA 1RWXA 2DLDA 2Q45A 4MI9A 3QP9A 4JSYA 3DLHA 4DNQA 5U9CA 3WLTA 1JN0A 4EP1A 2R62A 2WJ3A 3CCFA 3N9IA 1P4RA 3H9UA 3F73A 2H17A 1YR7A 2Z0MA 1OX4A 1PEDA 2WJAA 5FIUA 5CT4A 2IV3A 3RR2A 3K1AB 3X44A 1YIAA 4EI2A 2GHRA 4F4DA 1SG0A 1WKVA 5H0IA 4LF6B 1N2HA 3DOIA 3PD1A 5ENDA 4ZWNA 1MC8A 2ZDGA 1SXJA 3GWGA 5EN4A 4BWYA 1QGOA 2ZR0A 1F4LA 1UANA 4K9MA 5CXUA 2IVZA 3NI2A 4UUNA 1R4NA 4XCQA 2QMQA 4BQEA 4KPYA 4JC5A 4KRFA 2A6PA 4MI1A 1I6WA 4EJFA 3O1LA 1BMQA 2QUZA 4N9WA 3QHAA 1KQNA 4BO9A 3OCWA 4RTMA 2MDTA 4Y67A 3ZUGA 3UTDA 4TRJA 4FXPA 4N8EA 5ERYA 3ESYA 3PEVA 1DG9A 3U0VA 4DLUA 4BBZA 5B1YA 1HKUA 1O94D 4TYQA 3ROKA 4DG5A 4WLNA 3PC6A 1BEEA 4AQDA 2I66A 5JZOA 1IFXA 1LLFA 2ODBA 1G3QA 3AEYA 3WKAA 4A7PA 2GK7A 2Q2QA 1XELA 2BGIA 2OSVA 3URKA 5JCZA 1J9GA 1YV9A 2BAGA 3OJOA 1QCZA 3PFGA 5L4LA 1V1MA 5FA5A 1KORA 2J3JA 1XJ0A 1NQOA 2OEPA 1Y1SA 3M3HA 4MEAA 1CEQA 1DI0A 4YMSA 3O2JA 1N6PA 2QN7A 1UBTS 3LA8A 1I0IA 5KNDH 1T8TA 1QYCA 1YKFA 1Y9DA 1SGWA 3FNFA 1JWBB 4IIEA 4OYRA 4LY0A 5JARA 4X64B 4NL4H 2CD9A 2ZUVA 3H8JA 3RF7A 4F9TA 3NAMA 1L5HA 2C95A 2G9NA 1OBHA 2EJBA 3WAGA 4E7OA 3KR2A 1EVIA 4GR5A 2P2ZA 2H2HA 3OZIA 2P9JA 2OM6A 4HPWA 2R8BA 1FYEA 4MI3A 5IW8A 3BTVA 2CUNA 2Q41A 1SA0A 3LRTA 2V7GA 1UPUA 1P0MA 1NW8A 2VDRB 5EIOA 3O8OA 4BHTA 3CTPA 3BF8A 3BXOA 2ZIFA 4ER6A 4O1MA 1JHUA 3TZCA 3NB0A 5HBGA 3PXGA 4B76A 5A5VA 2PVSA 3E5NA 3RUEA 1LPPA 3H04A 1R3DA 4OKSA 1XB2A 1Y4AE 5KOYA 4I5DA 1UR5A 3BTSA 4HDOB 1VLVA 2WF9A 3TPCA 4DNPA 1SVKA 1UIMA 2ETVA 2VSQA 5F1YA 1GSHA 3DEIA 1R64A 4AURA 3NFYA 3K5WA 3C48A 4WTOA 5DHPA 1DE0A 4JUAA 6YASA 3GYGA 5IABA 3ICCA 3Q15C 2XXBA 2ZR7A 2JH9A 3EGWA 4XQ9A 1SRQA 4LY3A 5LU8A 4ZIRB 1DIGA 2P9GA 3L8CA 5H4HA 4ZN6A 1DQZA 2JGLA 4MB6A 2Q9CA 2K6GA 4L8VA 2QIOA 5JANA 4LHEA 2FAXA 4NMLA 3A9VA 4RGQA 1ZVMA 2MYNA 3PGKA 2E89A 1E2IA 3R6LA 4DJFC 2J6CA 2UZIR 3ROZA 3IERA 1DO8A 3TX2A 4XVHA 4HLNA 2ONYA 3MLAA 3K9FC 2ZRGA 1B3BA 1JGTA 4X3CA 5AK6A 4GQIA 5E1DA 4D44A 1Z6YA 1YFKA 3HRIA 4BCBA 4PHGA 1T5TA 2J0EA 1ARZA 2R6HA 1JFRA 4N6OA 1AV6A 3UUFA 4ZQCB 1KBOA 3JYQA 5AYVA 4BKQA 1Z2NX 5KAPA 2VS1A 1YOBA 1OGIA 2NZVG 3L4SO 3Q9NA 3V8MA 3X1ZA 5CH8A 5HX7A 3JRXA 4Q4DA 3WLHA 1YMVA 2BHSA 3DTNA 4Q1BA 2QVYX 4IS2A 3DV0A 4AO8A 5JNRA 3HJGA 3TTTA 3D1LA 1ZC3A 2JK1A 1YDGA 3S7ZA 5KVSA 2O2XA 4K3VA 5TQVA 1XPOA 2V7WA 1U02A 3VZBA 4LC1A 2G07A 1VYHA 1XUOA 3L7KA 4FYKA 1E9BA 2DPHA 3T4XA 4JNKA 3DXYA 3PC3A 4I8XA 4BNIA 2G5GX 2ZULA 2IU4A 1GVNB 4CF3A 4EBBA 4YHBA 1ABBA 3K70B 4JT9A 3EJ6A 3QLTA 2HRDA 3MT9A 2W6JA 2EEPA 4U2KA 3OIVA 1E1KA 2QOEA 2VT7A 5BR8B 4MYTA 3UC9A 3N39C 3IQDB 3ORFA 4GMHA 1B15A 1EUDB 1M76A 1ZJ5A 3N28A 1Z5PA 4K2HA 4R3WA 1NW5A 1R9GA 2FG5A 1GT6A 1ACLA 2I80A 1DJOA 3REQB 3OD5A 1S02A 3T3HA 1R0YA 2NZXA 1TO1E 2VZ0A 2YWRA 3VI4B 1P1RA 3ANTA 3FR7A 4B87A 1SOMA 4IFBA 2ONKA 4LGMA 4Y7DA 1X2EA 2MSDB 1LK5A 2WE8A 1H6DA 1XRLA 4WSOA 1X8JA 3EH1A 2ZTVA 3I30X 4BVKA 4M7PA 5IUJC 3DOJA 4AJEA 1SH7A 3KDAA 3ER8A 5JMPA 1XZIA 5DTMA 5P8WA 4XEUA 2IF2A 3V3KA 1GKKA 3H16A 4GEKA 2Q5IA 1OFTA 2J9FA 3RSSA 3AESB 3KAJA 5DYYA 4FGZA 2ZBQA 4PFJA 1N5OX 3WIVA 2WUGA 3AGQA 3E61A 1KDZA 4C08A 4PG6A 3AJEA 2W4MA 2G1PA 4C1NA 4DYDA 1B0AA 1X1TA 2J4FA 2QSZA 2XTAA 1QH8B 3BFPA 1BCRA 4JDPA 3S55A 4D9HA 1KEVA 5IMSA 3D31A 4WZBB 3LDFA 4M0EA 3EISA 1RYMA 4K5QA 4KLAA 4P34A 1CCWA 1UK6A 1ZGZA 3CZQA 3EH2A 3PNBA 1CUWA 4JJGA 3USCS 1E6EA 3WMGA 3CZAA 4PGHA 4RKEA 1G9SA 2OLKA 1FFWA 4TLCA 2HMAA 2IBMA 3D8BA 1MO4A 3R5KA 1TJ5A 4LFCB 4FINA 5FR1A 1DC7A 1T1JA 3N2KB 4JB8A 1FJHA 2ISCA 3D3WA 2WJVA 4M55A 5I5EA 3CLHA 1OU0A 3D5QA 3QNUA 4DIFA 4L5AA 3FWNA 4HNQA 3PEFA 2DUMA 5KSWB 5AW9A 2GJ4A 4Z3DA 3K15A 2BDTA 3EUWA 1JXMA 1ULSA 4FNMA 2LKDA 1DBRA 4KX5A 1NP6A 2Q27A 5DHQA 3BSSA 1RWWA 2JKVA 2YJ5A 2OESA 4MXDA 5FPYA 4HDNB 3IRVA 4X93A 1GIAA 3ROXA 5JNUA 2NQ2C 2XEXA 3VJLA 1OBFO 4PGMA 2BHLA 1VIVA 4C06A 3QVVA 3DTYA 4XGRA 1RM5A 5FQNA 2G08A 4GC9A 2Z2JA 4OJYA 1EXNA 2V45A 3NHKA 3AK4A 1FEZA 1XTKA 1Q50A 2CYBA 3GVHA 1ZN9A 3I8SA 2O5EA 4IUBS 5DRYA 5AXDA 4FYIA 4ZP1A 2NAPA 1GTVA 2BGRA 1L1FA 5B36A 3SIXA 3M1AA 4UKDA 4WHMA 3JQFA 4K03A 3L06A 4R1PA 4IQ8A 4CI0B 1S0UA 2XMCA 4A1FA 3QEJA 1JG4A 1JPVA 1L5ZA 1JLHA 4UAVA 1BKSB 3EXEA 2R00C 5F1OA 1JIUA 1P1CA 2WICA 1GN8A 2D62A 2OHFA 3GOHA 4TLEA 3K30A 2GILA 5DCUA 4DMRA 2XYQA 1TU3A 4HAVA 3RREA 4FX5A 2HMVA 2V9CA 2DR3A 3LFTA 4WPGA 5EZYA 3UG6A 3B1FA 2C2XA 3L5OA 4H3SA 4PBTA 3TOZA 1PJCA 4U02A 1XDSA 2F3UA 3B5JA 3GARA 4Q1FA 2IWRA 3ADCA 1KI2A 1EFHA 3L4JA 5D6OA 1N8SA 3QPWA 2R8YA 5SV2A 4LF7B 3UHFA 3AT1A 4V3BA 2Z98A 3IP5A 3ESBA 1A5SB 3AVTA 2LD4A 5A5FA 1ZCZA 2DLCX 3D8RA 3RADC 3DOHA 4UEWA 3RYFA 3LY9A 1OTHA 4CL2A 5LP1A 3OEHD 4JZKA 5JHGB 2G36A 2Z1DA 4ZEMA 1RXUA 5FJIA 3ZQJA 3MJSA 2D5CA 3TSAA 4HDCA 3O8RA 2WD7A 4W1SA 5H68A 4UEQA 2NT3A 3IDAA 2ZSIA 3ZD7A 4L0DA 1YFZA 3EBPA 3G2HA 1IDN1 4S1OA 5LQCA 2WM8A 1CY6A 1RPTA 2JAXA 1R7RA 4BXOB 4G1BA 5GZ3A 1ZH2A 4TLLB 5EPOA 3WK5A 3SZMA 3VC7A 4Q24A 3AHFA 4DV3B 4LPSA 3EUEA 2QG6A 5JQGB 3HV0A 2DHEA 3H1BA 4F4CA 3RVOA 2Y4NA 1RTKA 1NWCA 2ZDQA 3TG8A 4GSLA 8OHMA 2QY9A 3HUEA 1L3IA 1CP3A 4A8HA 2VHWA 1A8SA 3BSFA 2RE8A 2CWDA 3UXHA 1WWKA 3QXHA 4OHCA 5GVRA 1FVXA 4IXWA 4E3WA 4Q03A 4E5MA 1E7MA 1TU0A 2HO5A 4GNKA 3D9QX 3EZ7A 3AINA 1M7HA 5K0NA 2BGJA 2FEKA 2AQKA 2IDKA 4IJ5A 4WK6A 3RQIA 3ICOA 3AONB 3Q3HA 4F84A 1W36B 4MOWA 4HTFA 4I7EA 1RKQA 1L4HA 5FPSA 2C2WA 2DEUA 4R0NA 1EIWA 1CS4C 5JE8A 3IIKA 3O91A 2HSZA 1EGVB 5EIBD 3E15A 1WSDA 4PHTA 3CZRA 1L5HB 4KNVA 5FV7A 1KERA 4TWJA 2ZXUA 3UCFA 4L3OA 3P9ZA 4UTRA 1U7TA 4ARUA 1EVZA 3I4CA 3K4QA 2C7OA 3O82A 1UOOA 4KR0A 2V7QA 4FEGA 1LK7A 3CO0S 2FUNB 2JLCA 4D97A 2CW5A 1RXVA 2RD2A 2O19A 4M0MA 3UJAA 1GNTA 3N05A 3OZGA 4KQEA 4KWTA 3U5ZB 4EUSA 1M6YA 3N2GA 1RT9A 4JSRA 4WXEA 3RIGA 3ZWPA 4OQXA 1F8XA 2WYHA 1IIRA 3B9QA 3NHPA 4S0XA 3VZPA 2CVPA 1W48A 1QHHA 3SGLA 2EQAA 2DGDA 1W4AA 5LLTA 2CMFA 4K3UA 3HCBA 1Z5WA 4DV0B 1VPDA 1NJFA 2GCEA 1GQYA 1P4SA 2GAIA 2C9CA 4ZHQA 3FSRA 2C20A 5E4JA 3EIFA 3FOAA 1SXIA 4I36A 5CM2Z 2J08A 3RI3A 3T0GA 1G3MA 1Z7BA 2IYUA 5J58A 1PG2A 3FCYA 4LF9B 3LCRA 2FQ1A 1WXQA 1GARA 3IAM1 1JR3A 1X38A 3LL4A 3OHMA 3QLVA 4L4YA 4A1OA 3I1IA 1ZUHA 2WTBA 4L7QA 3QOWA 3B85A 2LIPA 2WG0A 3JQAB 1CS0B 3FUXA 4V3CA 2VPZA 3SI7A 2Q1YA 3FUVA 3GGPA 3V1NA 3RTCA 4U3JB 2IY7A 1UAYA 1F9EA 4DZRA 4EF6A 1R6AA 4AN4A 5FOWA 1S89A 1IZ8A 1ADGA 4UNQA 4DSUA 4PZZA 3EC7A 1W6UA 4IMRA 5AKIA 4EY3A 3OLWA 5FBWB 5FF9A 4AQ7A 4FR0A 2O6LA 1Z17A 4EJ6A 2B7CA 1BQ3A 2A9VA 3BILA 5I8WA 4MV8A 3T9CA 4HH0A 2B2XA 2XB2A 4F4HA 5K0SA 2H6EA 2Q6OA 1NYRA 1GD1O 3S44A 2Q3CA 3U4CA 4DDMA 1XRMA 2WSBA 3L7DA 2NTJA 1Z2OX 2Q1WA 4HNVA 1Z82A 2EKPA 4IIBA 4PZPA 4CLOB 2FQQA 4FQ8A 3Q72A 3PQDA 2W2LA 4GM4A 3BTUA 3P2MA 4LG1A 1Y6QA 3M6XA 1GTSA 1GP2A 2CMKA 3C1TA 1NURA 2F43A 3FDIA 3PJDA 4QA9A 4DADA 1XPJA 2IZ0A 2NP6A 1XWIA 1CZKA 5FEUA 4PX3A 4RJLA 2WB2A 1RZVA 2YNMC 3D8UA 3LKZA 4PG4A 1E9VA 1Y37A 3G2LA 1XQ9A 1U9JA 1KY4A 4M0DA 4PPQA 1QIIA 1ADCA 1IJEA 4L6AA 5AOVA 3UHAA 5I01A 5K3FA 4CMKA 2G72A 4QTYA 4YUZA 4U7HA 2IU3A 2BFAA 2BEUA 4KACA 4UUQA 1E5XA 2NO6A 2ZW9A 5C53B 2F1OA 2ZE8A 2IKQA 2QRHA 2DR2A 4Z0HO 3ZY6A 3H3JA 2GB4A 2HA0A 1Z9BA 1T29A 4GKAA 4V0NA 2P9TA 4B6SA 1JHQA 5DV9A 2R1ZA 4NG4A 2DQZA 4L4ZA 1NHGA 4QEZA 3FF1A 4N7JA 4ND8B 1I3CA 3KZCA 4YAUA 4GLOA 4INAA 4BLWA 1WCIA 2VF2A 1BD3A 1BMDA 2G8LA 3O9MA 1ES9A 4S1WA 4TSRA 4EEZA 1QHYA 3QI7A 4UNPA 5JPCA 3S2GA 5SZIA 2ZIUB 1OXBB 1PQUA 1Y5LA 3PQEA 3QU4A 2BFFB 2WSSD 1NMZA 4FEEA 3RD5A 4KN5A 3N58A 2YWBA 1CRQA 3GLHB 3PGMA 5DCLA 5EIAA 4EYEA 3V1MA 1OHHA 1CJKC 2OO7A 4FU0A 2CB0A 1RBYA 1YZQA 1ZXLA 4QDZA 4YRRA 3NRCA 2FRVA 4HCJA 1CR0A 3JVUA 4CMJA 1DEOA 1R16A 3WNVA 2FJ0A 1OVGA 2OZEA 3GCDA 5K0BA 2CZQA 1Q0LA 1E3EA 1HYBA 1HI9A 1N6KA 2JI6A 2XX3A 4U8GA 3C6BA 5ANRB 1Y6ZA 2QTAA 2H2FA 2W8BA 3KZVA 1L1EA 3ORYA 1XTPA 4CF4A 3PT5A 3ZR4B 5CPBA 1T1SA 5A3JA 3I2FA 3IKLA 4FYXA 2ODWA 1FW8A 2JJ2A 5GP1A 3K4PA 4BV3A 2C5LA 4OU5A 4DY4A 3KFVA 5LJLA 2E4XA 1Y81A 3DXZA 3KYDB 4MUBA 1YBHA 4FJ2A 2B4KA 1EMDA 3AFOA 3NKLA 3LQFA 3GEDA 2PAAA 3OKAA 1ZH8A 2CE2X 2WUEA 3AY0A 2M9MA 2NU6B 2PZAA 3KKLA 3V4OA 2POCA 3OM0A 4H08A 4QJBA 5E0OA 5LA6B 4E5PA 1SWVA 1J0CA 4HTAA 3D2LA 2PH3A 2UAGA 3MT7A 4EX6A 1VKRA 3F7MA 1E64A 3AUFA 2I4MA 1FFDA 2P4SA 3TXAA 4LWPA 5EXEA 3T1OA 3L8YA 5AJWA 2G0TA 1U0TA 1JAYA 1GUYA 3DGEC 3TVTA 5LVAA 3VOTA 4RHCA 5EJFA 4J0GA 2X1HA 5A2GA 1E9SA 3JYLA 2AE2A 2AW3A 1NQXA 3R5XA 2BSAA 4KYUA 5JS8A 5BV8A 4I5FA 3OTQA 1BE0A 1CWUA 4RZXA 1OT3A 1EP2B 1XVIA 4CIBA 4PFQA 3PTLA 1BDBA 2BMJA 1RJEA 3H87A 4R8KA 5COBA 3GV0A 3F6YA 3AR7A 1VKNA 2FF7A 5C51B 4FFNA 2HSGA 2YRWA 4V0KA 2MSNA 2C8LA 4J2HA 2FPRA 2GZHA 2OXFA 3AR3A 3MXOA 1CFZA 2A5DA 2OSBA 4UHBA 4ZCMA 1T5HX 1PUJA 4P8RA 1MC1A 5G0SA 2IYRA 5ITWA 4H27A 5TVGA 3VPGA 5IT0A 4F8JA 3D4LA 2EF0A 1R6DA 2VWQA 4OP3A 4NYJQ 4V24A 1RRPA 5AVTA 1L8QA 2NPOA 3K05A 2TRSB 1SB9A 2OBBA 2BTQB 3CVOA 4MWOA 1XO1A 3V8RA 2GO1A 1ISIA 2PRYA 5I4CA 2FZVA 1KJWA 5GOTA 2YJNA 4G5HA 4X90A 2FPKA 2HQBA 1IB0A 4RL6A 1TFUA 5DF1A 4LNUA 4TTVA 3CWQA 3VR5D 5EGSA 1P9LA 2P9FA 3IV6A 2CB9A 4YJFA 1RLUA 2ZRKA 1KR2A 3JALB 1HDGO 4CU5A 1PLJA 2V7BA 3Q8XB 4CZ2A 4F1WA 1JFTA 2B78A 1E92A 4ZI5A 2GCOA 1FNBA 2QVZX 4IGEA 1L3BA 1JS1X 3OJWA 4MUMA 3DBLA 1PE0A 4K6CA 2XQIA 4ITRC 4RZQA 4YP0A 5KTOA 3GLTA 5GOZA 5G53C 4TL9A 1TJYA 4B3JA 1HLDA 2AOVA 5HQTA 3QLUA 2OO5C 4I3HA 4WZBA 4OL9A 3R24A 2A4KA 5A04A 4C4RA 4HQNA 2A3NA 1ZH0A 4FS8A 3HNPA 3ZHVA 3SHWA 2A5LA 2H2IA 1EFCA 4A82A 1XA3A 1WPXA 3I5MA 2H0RA 2Z9CA 2O8EB 4P22A 1XYVA 4MYRA 3T3EA 1TZCA 3BCHA 2YW9A 2XF2A 2XOXA 2ZJ2A 3QVLA 1A2OA 4TUYB 5JEDA 4JB2A 1CUCA 1X13A 4EI8A 2QL7A 2XMGA 4TWRA 3W5BA 2XZLA 1SRRA 2NO5A 2ZJ7A 2D5AA 3R3YA 4A3SA 2C9OA 1AMNA 5H70A 5HUHA 4IJ6A 3MLBA 4KVZA 3UAGA 3PX3A 3WGLA 5GIPE 2LR0A 1PT6A 3OZCA 3R5JA 1S3SA 1VE5A 2H1HA 3ZWQA 1PNRA 4Q7MB 2IH2A 2ZB3A 3SHTA 1Z7GA 1T0HB 3FI0A 2W00A 3UAYA 5C80A 1OJLA 3BTOA 3UA3A 3MYRA 2UZ1A 1QCDA 1V6SA 4CETA 2FGKA 3ZDYB 2HU5A 5J4KA 2G1JA 2IOHA 1NGSA 5BW6B 4NBTA 3CUTA 3FOCA 3IBTA 4ID9A 2JIPA 1E2DA 1P9RA 2I03A 3UK7A 2ZYTX 3RTEA 4CV3A 3TL3A 5C7LO 1SIUA 3L92A 4JLNA 1AKUA 4ZTZB 2BZGA 3W6ZA 5JY1A 2V0GA 1NMEA 4J3JA 1UJ2A 4E4YA 3CKMA 1N5RA 4XW2A 2Y0DA 3DB2A 3VHRA 4I3FA 3RVBA 4XX1A 3D6FA 4FFBB 1XDBA 5KYNA 4N0MA 1Z7WA 4DLSA 4NKRA 2XAUA 2Z5FA 3W8NA 2DMRA 1NKSA 1FJ2A 2A78A 2EKDA 1GFIA 3DMHA 1XZFA 3RBZA 5B3AA 5CW2A 1TO6A 2NT4A 4KQMA 4JJFA 5LR6A 1NLMA 1JDNA 4PCUA 5C8YF 1QF6A 4KLZA 1ODTC 2IXTA 4KGXA 1OY1A 4EFMA 4DIUA 1UK8A 4II7A 2RHGB 2DX7A 3EK2A 2GBLC 4DYHA 2ZJ5A 1ZOIA 4N7BA 2ZANA 3F6RA 4HATA 2NTVA 4UVDA 1WIWA 2C4MA 4GSKA 5MFZA 3NHLA 4RD6A 4EY8A 5DBGA 3JQAD 4A6EA 3QVUA 4F6RB 2VTKA 2C61A 4MQ6A 3RIYA 5FTKA 4HQKA 5JFTA 5ITZA 4JJ8A 5B37A 3UNXA 1TKBA 4ZHQB 5CLIA 1JF8A 4M98A 1H69A 2I3AA 1U3VA 1Y3AA 3FDXA 3G2NA 4JFRA 1VI5A 4R68A 3VR6A 3E9RA 4H1VA 4F3NA 2HX1A 1P6UA 4NFHA 1U8TA 3DMGA 4BQNA 4H3KB 3B1JA 3N6XA 3Q2OA 4Y6OA 5ELLA 4RVFA 2PYZA 2HD4A 1AXGA 2C54A 4BQSA 4TROA 1J0BA 2PT9A 3HKBA 4ND1A 3X1JA 4YJ2B 5L3QB 2QMEA 1RE0A 1WQ3A 1NR1A 3AKCA 4AJKA 1J7KA 2X5OA 2HHHB 2FZEA 1V35A 5AUPB 3GPIA 4GX0A 3C87A 1BRMA 2QZZA 5E2BA 3L8EA 1ULZA 2D00A 4G1VA 4OSOA 1H9BA 3OI7A 4W7SA 4EQZA 3NW9A 1WSAA 1Z26A 4Q19A 1RQ2A 3I8XA 5JCPA 1SZJG 3LC1O 1MHTA 3D0OA 4P7BA 3WLAA 1RLIA 1BGWA 3HKEA 1FC0A 4XQ0A 4YRNA 3G2OA 3EX7C 4FDMA 3ZX4A 4LTMA 4QYIA 5FBLB 2O8EA 1KJJA 1ORWA 3I9NA 4FOTA 3UXEA 4M76B 2XQFA 4OFXA 1HY3A 4YGXB 1R5JA 2X8JB 1FRFS 5LB4A 1A9ZA 2DPLA 1AQUA 1A69A 3AOGA 3ZXXA 3W9BA 2V7XA 1P6QA 3C7KA 4C0LA 3ZUPA 2ENUA 1QOZA 1IYZA 5LQSA 3N6VA 3LWDA 4H7KA 1BX3A 5BR7A 3PFBA 1BH6A 1SC4A 3F8TA 3KUDA 4E1BA 4K9LA 1T9BA 4IBOA 2EW2A 5IM4F 4AWBA 3TK1A 3AWDA 1XTRA 2Z09A 5F35A 1ONBA 1Y1LA 2Z95A 1ZNQO 2ZVJA 1RAGA 2PS1A 2P1RA 2R44A 3AF0A 5KOJA 2Y0PA 2F17A 3H0EA 5JEEA 2YKGA 3VTKA 1H4QA 4YYEA 3PXCX 3T7CA 1XMXA 1YC2A 2RGYA 3JU3A 4YLGA 4LQ4A 4V38A 5IJWA 5KJCA 3AF4A 1XU9A 4JITA 3ABOB 1DRVA 2YDXA 3G8DA 3GMIA 4LJ9A 5E9AA 3OHSX 1TADA 4XWWA 2NU8A 1JHOA 4JH0A 4F5WA 1GT91 2Q2VA 4CIDA 1P3DA 4M9CA 4MV1A 2PR2A 2RB4A 2AX3A 5L51A 1CB7A 1CJCA 5FLYA 1E5TA 3EY9A 1HDEA 2E2WA 2WUVA 4N18A 1FFSA 4Q3KA 1LLQA 4N01A 4ZVOA 3TLBA 2HNAA 4JAVC 4KQJA 3FYHA 2G09A 1KK0A 3HXPA 4N7MA 5F7JA 1MX9A 4FZJA 2H51A 4KV7A 3RFCA 3SFTA 3B5EA 4NYJR 1S9HA 4LZOA 1BU5A 1CJVC 2WIBA 3GX1A 4ZOLB 5E38A 3EW9A 4JLKA 4QQKA 2PX4A 1ZK4A 3OWHA 3G2KA 3PLNA 5J43A 4FMCB 1XKQA 4IDGA 4DFDA 5ESRA 2ZFUA 4ZAYA 4QDJA 1DKNA 2IVFA 3TFWA 3Q7RA 3BQNB 1L1QA 2ZSDA 3MPUA 4TKUA 4QUGA 3SR0A 3ZTWA 1SD5A 1U3DA 5TS3A 3TYXA 2FSFA 3OZAA 3QXJA 3DAHA 3CCBA 3G1TA 1W75A 2Z8ZA 4I2NA 3HYCA 2PGDA 1I80A 3ZZ1A 4DZTA 2LVBA 1XD2B 2XD4A 2R11A 3OJFA 1ITZA 3C3MA 3CF6R 4LOKA 4BNMA 2QWXA 1EP3B 2EXXA 4ZK2A 1GCOA 3GDWA 1VLHA 1N2BA 2H7VA 3H84A 1LSOA 1E1QA 3TSOA 3U09A 1C4WA 3DD1A 5BYBA 2DR0A 2D3TA 4P7KA 4B75A 5IT4A 3UHJA 4UD6A 1IB6A 2GCPA 3GNSA 4NOMA 4X20A 3CVVA 2Y1FA 4XIJA 3ZHYA 5CH3A 4MVJI 3NBAA 3IOMA 3MTIA 3ZZ0A 3LZCA 1M2OB 2JD1A 2VHEA 3ICVA 4O2RA 3S4YA 3ZI4A 4MICA 4AJLA 2G67A 2XDQA 3FHCB 5I9SA 3UV7A 5G02A 5DM70 4PRKA 4C2TA 1UM9B 3DKVA 5GJCA 5FFMA 3HPRA 1VYUA 2SICE 4RQBA 1VCHA 4DRYA 1WVIA 4EAQA 5HKBA 3ER9A 1Y7PA 3A05A 3LUFA 1FTGA 3KR1A 1QWOA 2IZOA 4PRLA 2X7XA 4HB2A 1VBNA 2ISSD 1UJBA 5FNVF 4R9RA 4L85A 3W5AA 5CLHA 1V71A 3F3KA 2WFLA 3TZHA 3L0PA 3EDCA 1X7DA 4BO2A 4CVNA 3GH3A 3IVAA 3ZDDA 3FUUA 1CY1A 1TC1A 1UBMS 4PG7A 4R3UC 4P7JA 5T41A 1SVIA 5FJJA 4F0JA 1L7QA 2O2SA 1KPIA 2CJFA 1MB3A 4RTJA 1OC4A 2JKYA 4U4AA 5LQKA 4K9OA 5E3IA 1YB2A 4OXRA 5FPQA 2JFPA 4J2OA 4QODA 2P6NA 3AFIA 3L2OB 3GZNB 1MB0A 2CYCA 4RELA 4ZEWA 4OSPA 2JGNA 1K06A 2IY9A 4CDGA 2A9KA 2IYAA 3BORA 2RHJA 4D4JA 2VHZA 2BGNA 2YZ2A 2PNFA 4CXMA 1CVIA 2I4LA 1I4TD 4EH1A 3FIUA 3M6FA 2PUEA 1TM5E 4N39A 1V47A 4ZYUA 3KQUA 3I8OA 1XMPA 1KFCB 1YQDA 3IDZA 5DLYA 4YRGA 2VDJA 3VU9A 3GAZA 3UWSA 4DLLA 3A11A 1JPJA 2NM0A 3PCRB 4RVUA 3FUCA 1VBFA 5LCXA 3NHJA 4AC9A 2IOQA 3JWJA 1K0FA 2YFKA 3GL9A 1CZRA 4QNNA 1WUIS 3MTDA 4EUHA 4RK1A 3L7NA 2CF5A 3QLUC 3QRWA 5YASA 4F91B 3I53A 2JCXA 2RAUA 1T5LA 3UICA 3THWB 4KAFA 3NMUF 4II2A 2QKYA 2BFNA 3E5RA 3SD7A 4G0UA 3W90A 2FNAA 4X66B 3X1WA 3J81k 3ETCA 1P44A 4LV8B 1CX9B 1O97C 3UT6A 5A3SA 1TEXA 5BMVB 4QHSA 5CDTA 2KW5A 2WVHA 3SG0A 4AMZA 4BL5A 5JYCA 1RZRA 2P77A 1BXZA 1NVWQ 4MWSA 4RIFA 4YJHA 3T3PB 3UJ8A 3UUEA 5K0GA 2IYYA 4MKRA 2WI8A 3DL7A 5L6LB 2C9MA 3KPWA 1DEAA 3DF7A 4IYRA 4JENA 3S40A 4DRXA 2GMWA 5LP6A 1AZSC 1KK1A 5MGNA 1AA6A 2O3SA 5G3YA 2WAAA 3QEBZ 4X44A 2JZCA 2FSVA 4JP2A 4EHFA 5D3ZA 3KQHA 3G49A 4IVPA 1S8NA 3MGKA 1Q11A 3WB2A 1EUCB 4OP1A 3JARA 3ZDQA 3M6MD 1T9CA 5GV8A 1N7GA 2QZ9A 4F4FA 2W71A 3ILXA 1PR0A 2F6RA 3C6MA 3HJHA 4NBUA 3B3FA 1G21A 4HHEA 4JUCA 5IFLA 1CQIB 3F5QA 1JIIA 5T5QA 3JR3A 3FZQA 3ABSB 4DCMA 2QYOA 2WWHA 3LIIA 3V1LA 2XXJA 4N3AA 5LZ4A 1JDPA 1TM2A 4OI1A 3OEYA 3I3OA 1UC5B 3ETHA 4FIZA 4PC2A 4EHDA 3UJNA 4I5IA 3AUAA 1CY0A 2D4HA 4XX0A 5EWLA 5T6BA 1LPMA 3IQEA 4F46A 3I23A 1K9SA 5JYDA 2ACWA 2Q50A 4HUJA 4UPDA 3EXHB 2GXAA 2C2ZA 4D25A 1FDOA 3VH2A 2QZJA 5I7VA 1D0SA 4MQ4A 3VPFA 3T5TA 1SC9A 3ELBA 1QHNA 4LNHA 4A0QA 1SHUX 5B4TA 2XB4A 4LCJA 1KY2A 4ZCPA 3QWAA 3HKDA 4QTZA 4MS3B 1SBTA 4JKIA 4G26A 2YV5A 2XGOA 4U7JA 4QYIB 4QBHA 2Q46A 1D1SA 4HTFB 1U7PA 2XZTA 4BKMA 3DTTA 3GG2A 3L05A 3ST7A 1VDZA 4LDJA 3BMXA 2JLWA 1XLTC 1HEUA 1N1DA 3G9XA 4WNAB 2CEAA 1KJ8A 2WABA 3H5NA 5DTEA 4QYWA 3KXIA 1G19A 1NX9A 5HDQA 4KUHA 1F2TA 2GPAA 1I6LA 1FX0A 4HLUA 1ST2A 4G5SA 5LYJB 2ZRPA 1E18A 2V59A 2OXEA 1KEEB 5BT8A 3OG9A 4QREA 1D7AA 3LUBA 4HSGA 2DFPA 2J59A 4IXMA 4O1HA 4JBXA 4DDKA 2I22A 2Q8PA 4H3HB 4LOIA 2NZ8A 3WSVA 5JADA 1ZOLA 3CZPA 2VOEA 2HWWA 5G40A 4E1AA 2RHRA 1PFYA 3DUWA 2FF5A 5IK2D 1QKIA 2P7HA 5JQWA 5K6AA 1MH9A 3PNOA 2AN5A 1DIHA 2FWJA 1V3TA 3VR1A 2CWWA 3VVCA 1H0RA 1RIIA 3OIFA 5HRUA 2RGCA 2HM7A 5J3JA 4KVAA 2B35A 2UYOA 2XNCA 3T8YA 5IDYA 5LZ8A 3VPDA 3VDXA 2ONZA 1YASA 3NBKA 3QU5A 1JHYA 1EYZA 2WD7B 3ETLA 2PMEA 4HV4A 2AIRA 3BHJA 3ESDA 3KVNA 2RBGA 4HUQA 4XQCA 1N4AA 3RS2A 2IDZA 4I6EA 4C0KA 5LWHA 1N7JA 4P93A 1B42A 1PT7A 3L8HA 1L5QA 3DQPA 3I04M 3PQ7A 2FEWB 3JAKB 1YNSA 1FUUA 1N4DA 1UPAA 2A59A 2DKNA 3WFJA 4YXWD 3KQVA 3B1WA 1BFDA 4Z1MA 1WZNA 3HKCA 3PQFA 2PO7A 3AVWA 1MLDA 3TQFA 5B12A 4J1NA 5KQPA 2GBFA 3E6AA 3ZWNA 1NN0A 3NOOA 3T35A 1C3LA 1FSZA 4A2CA 1ECGA 1AKQA 1U7DA 1BQEA 2IYEA 3PC4A 4HH3C 1GQOA 1XXHE 2CL7X 1WMSA 1N8NA 1MRNA 2YHAA 3A31A 3NC1C 4KKXB 2A1TR 2D5LA 1ZK0A 4PG8A 1NPYA 2QPOA 5KYGA 4IIUA 4FONA 1JU9A 3LHFA 1FK8A 1BOFA 4FHFA 1JLLB 2C5SA 3D7RA 1XCGB 3PJEA 2C42A 3BL5A 6REQA 5D1HA 1NPTO 3GJ6A 4FE4A 2Z83A 2Q07A 1TLTA 1FFAA 1XCMA 1ZOSA 2IYTA 3EZNA 3HJRA 4J3FA 5AP9A 2VT3A 3RE1A 2IS1A 4BGDA 1Q95A 3QV2A 4CKCA 2QZSA 3FR8A 2Y05A 2GERA 5T67A 1P31A 4E33A 3JRNA 4UZFA 4IHKA 4P3OA 4IZOA 4BBJA 1CEYA 1QLJA 2VK2A 4G5XA 2AR9A 4BFXA 1I0LA 2DFDA 3IXQA 3L7YA 2XNDA 3O4VA 1P18A 4CIYA 1E96A 1ZCBA 2NXWA 1D09A 4MCJA 5CXXA 1XYGA 1J0DA 2FR1A 4TLBA 1RYZA 1VE3A 1A9XA 4F6RA 4FXOA 2VJDA 1UEJA 4LVCA 5EP2A 4A0HA 4R9SA 2ERCA 4DYVA 2ZB8A 2OOKA 2RCNA 3NP9A 1PYOA 3P0EA 3STYA 3BK7A 3HEBA 1N5IA 5B30A 1U2TA 3OURA 3O03A 5A3VA 2F62A 3N8HA 4OXNA 1AHIA 1U4SA 2OGUA 5J5VA 4DB4A 4NBRA 5C8DA 3GNTA 1DFHA 1C4KA 1Q3HA 1HOTA 4OBEA 2CVQA 3L8MA 2V03A 2PYDA 1YRBA 1ZO8A 2XNDD 3GRVA 3ON5A 3OZTA 4G5GA 5F7OA 3OIUA 1RAAA 1TZKA 4PZDA 4IJQA 4GYWA 4TS9A 3PLAE 3UJ7A 4BCDA 1AXRA 5HBRA 4MIKA 2RH5A 3IXLA 1QRAA 4I9GA 2P1DA 2ZATA 4O2AA 1RQGA 1CUEA 3W7VA 4P4LA 4BFUA 4XSGA 3UGQA 1MO6A 4ZO4A 1W44A 1U7OA 3JPYA 3L0IB 4KQ2A 4Z8YA 2PR7A 3OFKA 2CL0X 1FFGA 5E6SA 4S24A 4KZPA 4DCUA 2P2LA 4MUAA 4B5KA 2GEKA 3WYFA 3U7HB 3O2NA 4PTZA 1R8JA 3WLNA 5AVKA 2WAYA 4HY3A 4LZLA 1WE2A 4B83A 2D6FA 4G8DA 3A1FA 2GYWA 4JKOA 4WA7A 1N34B 3O47A 5EJ2A 4U00A 4DGSA 1EI9A 3AVPA 3LVFO 2OXTA 5FL7D 3S70A 1CRZA 2BFDB 4EHNA 3A4MA 3R3SA 4Z0TA 2HHLA 2ZXFA 4LGVA 3IAUA 1S8OA 3F4LA 3R74A 2EERA 1NVVR 2FPMA 3GEBA 4OBXA 3OQBA 2ZVPX 2HHJA 3NBYC 1NU6A 4I1YA 4J7AA 5CNIA 4C03A 2P9EA 1SNYA 1SUPA 3SYNA 3ZH9B 1FMCA 2G4CA 2YXNA 2PLRA 3U1BA 2QMYA 4GDFA 3TKYA 3V9PA 3KJEA 2R2AA 5GONF 1Z4IA 4CG3A 2AT1A 3H4IA 1Y3HA 4QUDA 1TAUA 1CR6A 3N0VA 2FOIA 3SJUA 2IIPA 3IIMA 1GPNA 5A5EA 1SULA 3CZ9A 121PA 1PGQA 2C3UA 4NMMA 2C7VA 2X1MA 3LVRE 4R98A 4RCVA 3EEOA 1OV4A 4IHJF 3VBEA 2PH5A 4RANA 2HK8A 3NYQA 3N2YA 2J0UA 1DX9A 4V1CB 1GZ6A 2OORA 3OZXA 1WHTB 2VP2A 5FWNA 1VJ1A 2ZBVA 4D46A 1FMFA 3CZ5A 4UNSA 2QSUA 2HWXA 1YS2X 2QUHA 3HNOA 3JQDA 3LO8A 1V5WA 4RAQA 4EGFA 1W7AA 4D98A 4I1PA 4PF1A 2YX1A 4J1SA 2GD1O 2GS9A 2J30A 2WWXA 1DIOB 1I32A 3F47A 3PA6A 1KMQA 2WJJA 3E0XA 3LK6A 1U80A 3R0IA 2J5RA 3SQOA 3K70D 1MBZA 2ZSAA 2W9XA 1XQ1A 2OBFA 3MW8A 4ZCRA 5THKA 4KR3A 2CSUA 1U1GA 1P91A 3DJYA 3SS9X 3U16A 2J9YB 4LISA 4Y98A 3WL8A 2G76A 1H0HA 3NATA 3LX5A 2HHAA 1EA7A 4Z0PA 1OIXA 2B94A 2RGDA 3KD3A 4TT8A 4Y9TA 4CIXA 1RAEA 1X3LA 4RTRA 5HKAA 2I8CA 1KQPA 3FJ1A 1KZGB 3U61B 1TCUA 5DHAA 3D8HA 5DGHA 5IEJA 2IWHA 1OB2A 1FYXA 4N0DA 4G4GA 3KS9A 4GLFA 3LOPA 5BN3B 4QU0A 2BI7A 3C3EA 3EEQA 2O2IA 2YRXA 4F9EA 3UPUA 1REQA 1RKUA 1E9EA 2CK3A 4G81A 4KL8S 4Q48A 1GJRA 3F8SA 1P4GA 2CXQA 4I66A 4UU1A 1TC2A 3RIXA 3OETA 4HQ6A 1UAGA 1L4BA 2WINI 2IBTA 4KXNA 3FCXA 4HX9A 4XDGA 3I61A 1MJHA 1ZR4A 1M6WA 3RIHA 4OQEA 4M8NE 2H3EA 4YXFA 1B0PA 1S2GA 3FAKA 5CCEA 5LXTF 4EPRA 3UJ3X 4BFVA 2XA9A 4LCEA 3OO0A 1NOJA 4FT4A 4TXJA 5CRIA 4QG7A 1LQ2A 1T4BA 3COWA 3ENZA 1GG8A 4IUCS 1J00A 4MIOA 3F9CA 4M9QA 4RAOA 4Y2HA 1XPUA 4LJRA 2PMBA 3SYKA 1X7YA 3OECA 1O0CA 3AI1A 1Q0TA 3VR4A 4CRWB 1S96A 2DFTA 4B7ZA 2NLOA 1X1CA 3CNOA 1UXGA 1ZX1A 2ZWMA 3N8NA 4UXHA 3DMTA 5C4GB 1LBIA 1WXEA 2H18A 2NZ2A 2GHIA 2FZLA 2R5FA 4GYYA 4ND8A 2WY2D 1DKUA 4PPNA 3R8XA 1AU9A 1DRKA 4O2AF 1T5SA 5JI2E 1UXJA 2JEZA 3TB4A 3PUIA 1GEEA 3X2EA 4CMAA 3IIEA 1RYEA 2CGEA 4BX0A 4B7CA 5IF9A 2PSEA 4EFNA 3PIIA 3E5MA 4GKVA 1TKAA 3OJCA 4KWHA 1VGVA 2RI6A 2VYND 5EUMA 5K3FB 3AETB 1OGJA 2CXNA 4GZ6A 2XODA 1DJNA 3IAHA 3RKRA 1T4GA 2BKAA 2EGHA 3B6JA 1SPXA 2A9RA 2H7XA 2J48A 2PSFA 3BE4A 2JLAA 3C5EA 3QX7A 4HN4B 4I4TF 4D80A 4E2XA 3HTXA 2RGBA 4NMWA 1LCIA 2ZJYA 2ZYVX 5HOEA 1L5OA 4MRPA 1K27A 3N2NA 1OH7A 2PH1A 3VKHA 3DMFA 5A7FA 3BZBA 5EWJA 4WXYB 1DOZA 4QRDA 4JLVA 1JE1A 5DU2A 4F6LA 5KINB 3EF3A 1MCZA 1YZFA 4CEIB 4JR2A 2VXYA 4M1EA 4CPDA 1O96B 1PVOA 2BBSA 4GOLD 1CFJA 2EX1A 3KZOA 1FNCA 3T7IA 1F20A 1VGRA 4Y9UA 3OO1A 1ZXBA 3RS7A 5L9AA 2WQ6A 4MO9A 4MW7A 4TYYA 2FN7A 5SYAA 1DT5A 1SQFA 2E37A 2G5CA 4EHBA 5IDQA 5TIIA 3AXTA 3HU5A 3M3PA 4UULA 5JLAA 1RKVA 2WQZA 2XR1A 4KMOA 1M34A 1WL8A 4BGIA 4CIAA 1L4EA 1XK6A 3QNWA 4R6WA 1EH5A 1RQ7A 2GJAA 3FXAA 1BTOA 5ALPA 1F4VA 4AY5A 1CS0A 2BM8A 4X24A 4QU8A 3S99A 3AUJB 1FJXA 1U5AA 4JLUA 2PFKA 5DBFA 4RTSA 1N2CE 4QDKA 4UNRA 1OWMA 1GAJA 4BP3A 2ZSUA 4XJTA 1SCIA 1SXJB 2XADA 1QUEA 2HPAA 4QUIA 4AZTA 1Y6RA 5BNZA 3GJRA 2ZJ8A 4KGZA 3SMVA 5AOCA 4D9IA 3KYCA 5C5EA 3IT1A 4HXFB 4J03A 2JD2A 4MS1A 3HZZA 3AVOA 4DJTA 3BMOA 2PZ8A 4NDZA 5BN3A 4FVTA 3O31A 1P1JA 2B8NA 3D1JA 4OHVA 4NENA 4HPXB 1Z8FA 5FKJA 4EB6A 4CEHB 1Z4KA 3MBOA 3UXMA 3OX2A 6CHYA 1JV2B 3HHEA 5DBOA 1JECA 1EXMA 4R2WA 1J8QA 1I2CA 2OCGA 4BQRA 4G8CA 4LE1A 4YMTA 4F86A 621PA 4D0SA 1XMVA 5ES4B 5HIIA 5AH0A 4RVOA 5IYZF 2ZI7A 2O8FB 2JI7A 2G9ZA 1SOAA 1U8FO 4O59O 2BMVA 1WCYA 1UM8A 1D2CA 3EQ7A 3I9FA 3MM4A 3HUFA 3NETA 4P3XA 2EJTA 1PWYE 2PMFA 5AUOB 4UBIA 1ZMTA 3VOSA 4MVXA 4L78A 2EP5A 3QUTA 1YQWA 3ZIAD 5IULC 1UBOS 3A04A 2GA8A 4YAEA 5EMMA 5PNTA 5A4MS 1DX4A 2IITA 2XCLA 2IOFA 3GCWA 4MRMB 4I50A 1JFLA 5KX5A 1RM0A 4NICA 4GLBA 3BMCB 4KO4S 4V1CA 5ALZA 1EWTA 5DSTA 2DSNA 3K6SA 4IYJA 2PGIA 1H3EA 2JGIA 2HWYA 2IUYA 5DBIA 4H6PA 3UAXA 1OSNA 4Q93A 2DQSA 2TSYB 3DQQA 1ZD2P 4YO8A 3M70A 2X8AA 4B7XA 4DIEA 1E1CA 1HQCA 2WJ6A 1IJBA 2ZJ6A 2WWFA 2GESA 4GPAA 1KFEB 3GPLA 2QORA 4Y9DA 1ZAKA 1SKYB 2JGDB 5EA2A 3AILA 4FZRA 3NGMA 4B4OA 4XQEA 4HQRA 3WQBA 1EBBA 3KUCA 4KCGA 3IELA 1KI1A 4LYYA 3UF0A 1JG3A 4F5DA 2GGSA 5BSGA 2RHHA 1M6VB 2VZEA 3O0TA 4JX9A 2AN9A 3BGVA 3BKXA 3Q3IA 2IQ5A 4BXOA 4PY2A 3PQ6A 2QX9A 3V97A 3WIDA 4QE3A 1ZJWA 1GDDA 1GL7A 1UP6A 2QRUA 3GOQA 2PSHA 1YRYE 2QX8A 5HS6A 3SX4A 2XY4A 4X92A 2IDMA 5JAUA 5B2EA 1II8A 2EFGA 2Y66A 1AK2A 1R0CA 1XN1A 13PKA 1WLSA 2CXTA 2OLEA 1N2CA 2G6BA 3BS4A 4ACAA 4IIDA 1KWKA 2UV8A 4EY6A 4FWIB 5LB2A 1U2RA 3NPAA 4X85A 3V32A 3FOBA 3K8OE 6Q21A 4KJXA 5CJPA 5JSFA 5J1SB 4U6NA 1P74A 5FFNA 2GF0A 3DAOA 5HG0A 1OQAA 3AR9A 2JFVA 5CVTA 1DNPA 4QOSA 4ND3A 1NBWB 5AI8A 3KZ1E 5G4KB 4YECA 1OU4A 5CBPB 2D4AA 4MLDA 4O2AB 3ZU6A 2GCIA 4EHJA 2D1FA 1IK6A 1QIGA 3FKJA 1U8UA 5EEGA 3RBAA 5EERA 4CKBB 5HQ3A 5I7HA 4DOMA 3S3TA 4GOOD 5ALMA 3IEVA 1DC4A 1IXYA 3BCUA 3PPWA 1YT5A 1IC6A 1DV2A 2CZCA 2VC2B 5DTIA 3E53A 1GTMA 3F3SA 3L02A 4P1ZA 3VPAA 2G0NA 2FMKA 2O4UX 2OV6A 5AHXA 5T4BA 4K05A 4HAIA 1M8JA 4LJKA 3BGIA 4C05A 5AVRA 1VHWA 1FTQA 3VNVA 5DULA 1K2VN 1LBTA 3RM3A 4K6OA 4GH5A 5FFFA 4R3NA 4GXRA 3C1OA 3V4FA 5JWRA 1WU8A 3I64A 3E2IA 4BP8A 2VAPA 3DE3X 3LMKA 1QQAA 4DB2A 1N6NA 1WXGA 1ZK2A 2ODEA 2PJZA 2ZBDA 4LC0A 3OHPA 3PJGA 4LA4A 3W04A 5FXMA 3LFHA 3IQIX 1YVDA 2FK8A 2O8BA 1R6VA 2YCBA 3P96A 1IXKA 1Z13A 2EQ5A 2ZLBA 3PWZA 1NM5A 2AF4C 3DAYA 4PIPA 2DXIA 1IN4A 1AE1A 3LT5A 3K9HA 1CUAA 1XU4A 2VZ8A 1NYLA 4YCCA 3O1HB 1KNQA 4B0OA 3TR6A 2JAWA 2PLAA 3ZD8A 1XZPA 2ZUDA 4CTJA 4BNJA 4DLNA 1DIRA 1AUXA 4DWVA 1OYOA 3E1GA 1P9OA 2PUVA 4UM7A 2BR5A 1PNOA 4QOJA 4YASA 4CM3A 1XV5A 4DV2B 1E5QA 3FPEA 3SX2A 2TECE 1DTSA 2GDZA 3K0CC 3ADOA 4M7RA 1MTOA 1FMJA 2H4HA 4Q4HB 1FPMA 2PCJA 2X3UA 2APJA 2XZPA 1E9FA 3D3WB 4QUHA 4YJKA 1L5LA 3OWXA 3GRPA 4H1UA 4EDHA 4WDRA 5ELMA 5HM6A 4IGKA 1NVXQ 3FPSA 1DCKA 1UFVA 4KYIB 3ANNA 1G20E 2Q5FA 2QN9A 3ZLJA 2CHEA 1MNAA 2HCTA 1C3VA 2EEZA 2JL1A 2G06A 4UM8B 5LZ5A 4F2DA 3AR6A 3D54D 3DLAA 1KVRA 4ALNA 4LWQA 4BWVA 2YJ3A 2R48A 3PHCA 1KQGA 4NYIR 4IVNA 1RTTA 1JP7A 2ES4A 4JA0A 5M2QA 5EUQB 2C9DA 3FX2A 3TAUA 5IT9A 2WIAA 4OREX 5JNLA 4XB6B 5DW0A 2PX0A 3MAAC 3VDQA 3WIBA 3MIIA 3ONVA 3LNTA 3NM5A 4KPFC 4F93B 1XG5A 4GFDA 1APBA 5LQJA 1U0GA 1RHUA 2YJGA 2W48A 4FEAA 1AHHA 3LIPA 1J9ZA 1P1BA 1M0TA 2V5AA 2ZCVA 1DARA 1G66A 1GFZA 3GJ3A 3HWSA 3KJFA 1GUDA 3DKRA 2H2DA 3HBMA 3WY9A 3ZCSA 4C0JA 5LOVB 5FCDA 3DP9A 2QS9A 1T9ZA 4YJGB 1GAXA 3AJ8A 3IALA 4ND5A 3GPDG 3VAYA 1E0SA 2PZLA 4XUGB 3I09A 2XUJA 1T8YA 1YZKA 1ZUWA 4R8SA 2OFOA 5IZCA 5CFZA 4BDTA 5K0JA 1D9ZA 2GUGA 3MMSA 2Q4DA 3H4VA 3E18A 3S8YA 5K8UA 1KAQA 4IPTA 1WCWA 2X0DA 3KJIA 4IFIA 2WV7A 1BXKA 5FUBA 3ANMA 1XDWA 2ZETA 6NULA 4DR6B 1KYVA 4DA7A 1NTOA 1IY8A 1ECLA 2R6R1 2VJAA 3HB0A 4G56A 1L5KA 5LXTB 2IEAA 2DJIA 3AERA 2O2YA 4FZ5A 4U39A 4XUDA 3UOAB 3FMIA 2JAOA 3U1TA 4NJMB 1DKRA 1HDCA 5JSQA 3ZCQA 5CEEA 4FDVA 2DETA 3HJBA 1CQXA 1R5BA 1GUBA 4CDNA 1FQOA 4QC2A 5BP7A 1FTSA 4A27A 3HH8A 2P5SA 3W1WA 1Q7BA 4COOA 1Y8ZA 3FMVA 2CFRA 3K1JA 4G8BA 1IEWA 1EFVA 2MIIA 5U4QA 3BB3A 3HGTA 1FTWA 1SBIA 2AJLI 3KKQA 3MQ2A 4MKGA 4OUDB 2I8AA 3AL2A 3S7TA 1TFRA 1NUHA 4KQHA 4ND2A 3A4IA 2X14A 4NCIA 2SKCA 5ARDA 3TNDA 3U4HA 4HNRA 4OVKA 2C3OA 3FVWA 2IODA 1DCFA 2EGUA 3U0BA 3W1EA 1EVQA 5BPFA 4Y1EA 3VH4A 5HSGA 3DAFA 1KZHA 2P5UA 2R8RA 3S2YA 4EYOA 2CJXA 1I4OA 1L9KA 1XJ5A 1KU6A 1ABEA 3B89A 1CNEA 2XOKA 3LBFA 4FFWA 4Y6PA 3RRXA 3TSZA 1SFRA 2WPDA 2YQ5A 4IFEA 4E4TA 4ZEVA 4OI0A 1E89A 1ZK3A 3DGFC 3ZHUA 4YLYA 2P3QA 1MA0A 1C41A 2CDCA 3I58A 4E1VA 3QWHA 3TKAA 2PUHA 3AXSA 4D8UA 4LOHA 4RJTA 2P9BA 4ND6A 3JYPA 1ZESA 3U19A 3UK2A 4B2IA 3R7LA 3ZHQA 3CX3A 1B73A 3DZGA 1PJTA 1I01A 5CP8A 3RVMA 2WT9A 4UHJA 1J39A 3RRYA 3WX0A 4KRGA 3VA7A 2IZ6A 2EP7A 3Q85A 1U7WA 4S1VA 4X62B 2C8JA 2B8TA 1J9EA 1PR1A 5JZVA 1VRWA 3GCZA 3H5OA 4IMPA 3M6UA 2O3QA 4KODA 2GEVA 3W8FA 1BS9A 1PJRA 4GF5A 2P67A 3BSYA 3CVYA 5CDFA 2ZPAA 2ZB4A 3H1TA 3WVNA 4CU2A 2QN1A 3RAGA 3I9V6 3ITNA 1OAOA 2HU7A 4BYGA 1J99A 1YONA 2I2DA 1OXXK 4LRXA 4WECA 1NF8A 2G0AA 2QUJA 4OY3A 5H16A 1G6KA 1Y7IA 1L7PA 3F6SA 3BERA 3ZLUA 5JXJA 2AL7A 1P7WA 3GJZA 4TTTS 4U7PB 1H5QA 2YC4C 4WZBE 4XVRA 4QTUB 9GPBA 1PSWA 1ZSVA 1XCOA 5KYXB 2R68A 5FL3A 2R7AA 3BFVA 4QOFA 4GR9A 4B71A 4NAHA 4YT2A 1GOTA 4OB8A 3OKPA 4G9EA 3R4CA 3C5WP 1H4VB 1P0QA 5CCXA 1VE7A 1LSSA 3RLIA 3TMYA 4CG0A 2UYYA 5EZ6B 3WNDA 4TVSA 1J20A 3JWIA 1QRTA 5JAQA 4QT0A 5LMUB 4Z9BA 5FBVB 3OOEA 3T1NA 3TUIC 1E6KA 4MEBA 3BGDA 3M6LA 3C1UA 8ATCA 4GKBA 1GPLA 2FU5C 2Q7OE 2RI1A 2B37A 3AP2A 4X41A 3TQRA 2DFNA 1Y5NA 1TVCA 1QZXA 5BSWA 3I76A 4ES6A 4I1OA 1SVUA 1XDDA 4HDSA 1WDMA 4R5HA 5AICA 3FTCA 2IS6A 3VNRA 3WWDA 1OX6A 2Z4SA 4H31A 1DT3A 2I6XA 4BDSA 3MTQA 2FG7C 4GUAA 1GTG1 4WK2B 3TRDA 5BN5B 4DILA 1W0KD 3O2QB 5EXTA 1I7DA 1JQ3A 4QSHA 1Z74A 2R5NA 5M5BA 3OQ6A 2HF2A 1DMRA 2ZVQX 4CLOA 2FW1A 2KMLA 1MIOB 2O20A 1AUPA 4UATA 5KQLA 2BKXA 4HQOA 4C6TB 1H23A 4MV7A 3L9WA 4MYUA 3KZNA 3IILA 4QYXA 3U7QA 2Z1NA 3D8SA 1LY1A 3MJEA 3TJRA 2LWIA 4WBNB 1CQZA 2PRZA 1M0EA 3DO8A 2RHMA 1H6CA 3DXFA 1ZQ1A 4K9RA 1NJSA 4FX2A 5DDIP 4HYQA 4OPMA 1A27A 3HJUA 3LG2A 1L6RA 4FGLA 2VOJA 1KMHA 4HEA6 1X7ZA 2NU7A 3F97A 3V1KA 2YNMD 1WB9A 1CUSA 3H42B 3IRUA 5HIAA 4G1EB 1E1MA 3AUUA 1FCJA 1G291 1D4OA 1N57A 2ADOA 1J5XA 3MT8A 2VKTA 5SYNA 3RNOA 4E6EA 5JD4A 1OAOC 2EBUA 3BD7A 3ZLBA 5IJ9B 4F2GA 2WD9A 2ZVDA 1TUEA 4IDAA 4DSNA 5ITSA 2ZP1A 4W8OA 2O0JA 1W87A 4RV4A 4O5OA 3IUSA 1AKRA 3UV6A 1OLUA 2NUPB 3A1EA 2XMZA 4PXYA 3FOZA 3VVLA 3IULA 2GM3A 1Z07A 1TJ3A 4GLJA 3RS4A 3EEBA 1Z8NA 2WHQA 1EDZA 3IKJA 1B8PA 1CUBA 1CNMA 1Z28A 4MULA 3GD7A 4RKQA 4O2BB 2NMVA 2V96A 5KOHA 1ZD3A 2H4JA 1VG0B 2C5BA 1EAYA 4B8ZA 1EVJA 3V7FA 3C4JA 3BL6A 3T7JA 4L4UA 4C2AA 1GL9B 3BWYA 3LDAA 2FMUA 1FDWA 4QXMA 3ZGXA 3MMZA 3VO9A 3AH8A 1DOAA 2AX4A 3NDIA 2BEJA 2EARA 2DC1A 2HPHA 2YHIB 3Q98A 4P5EA 3PSHA 1TD9A 5AM3A 4IIGA 5L53A 1FVOA 2OYRA 4D9JA 5CFNA 4KR2A 1HC7A 2W93A 3Q2KA 3M8KA 1OOEA 5BMVF 1RU3A 3E05A 5F23A 2VAMA 2ERXA 2I6GA 3WRWA 2D1YA 4H7IA 1ZD5A 3HACA 3IB3A 4QBGB 3QWIA 4QU5A 2ZTSA 2D2XA 1W5AA 3K6KA 3U9TA 4DVGA 3PQ4A 1HXHA 1NRWA 2ASEA 3CH5A 3CLRC 1G18A 4NJEB 3HVRA 4BQFA 1V5FA 2FPIB 1W59A 1W0JA 2AWOA 2QTZA 4WZAE 5BSVA 1R4AA 3K9QO 5F7ZA 1F8FA 4Q01A 2VBIA 4C0BA 3ND9A 2HA6A 4WESA 3W5DA 4ESVA 3QKRA 3KOXA 3NDRA 2YZGA 5EHXA 3CISA 3DZFA 1JEQB 3PKJA 1XGKA 3E81A 3HN6A 4Y2XA 4QKQA 4WCFA 4O1IA 4DA4A 2XLCA 2GPSA 2XHEA 5K0FA 1VHJA 4Q7JB 4C22A 1NF2A 2VSOA 3HZHA 2IHJA 3D2BA 4ABYA 1OA0A 3AW9A 1N6LA 3NR2A 1XZDA 1JFFB 5FOXA 1V1JA 3ABRB 4PQYA 3E9ZA 4RS4A 3GLIB 2CVOA 2IHYA 2OZKA 2RHTA 4AS1A 2C88A 2EHDA 5EHQA 5CVEA 3QJYA 4HAZA 4P6VF 4KDFA 5ADWA 4WOJA 1UBCA 3ETEA 3HB4X 5C3UA 4DMLA 1ZH6A 4WLOA 3WFIA 5KNDA 1QQ5A 1EIZA 3N7UA 5E3JA 3T5BA 1VIYA 1Q7RA 1PG0A 1Q0SA 3OLQA 1OXUA 4P36A 3L7BA 1OXKB 3O8LA 2Y3IA 4TT3D 2DFVA 3PGA1 1OBVA 2ZIAA 1GXSA 3L4KA 2RIRA 4LF5B 2PD6A 4CEJA 1TM1E 2WV9A 2AJBA 3QOXA 2J7KA 1EDEA 4CTMA 4CR6A 3VKVA 1A4RA 2Z9DA 4TMZA 3EMKA 1SXJD 4XIYA 1OVMA 1XMIA 3LX8A 2NXCA 3SOZA 4EYSA 1SD2A 2PWAA 2VNAA 1E3WB 1A3CA 3BFXA 2PQ6A 3H5RA 3OA0A 1OUMA 3T99A 4UEKA 1A5TA 1OH5A 4F6CA 3T4EA 4QM7A 1XU7A 2Q3DA 3IYLW 1N2JA 2GPNA 2IYFA 4FDAA 3TRIA 4KXYA 4BU0A 4DREA 1ZH4A 4BNFA 4G9GA 1VJTA 1E9DA 1WD5A 1BE1A 3C6XA 4N40A 4BATA 5KQMA 1VDMA 2YFHA 3F3YA 2G17A 4XYBA 2CF6A 2R1VA 2NTYC 5CA1A 4B2YA 1D07A 1KHTA 2VHUA 3OQVA 1UMCA 1NW7A 4Y7CA 4L0QA 4QQRA 5IUNC 4EGCB 2V3WA 1TQ6A 1UKCA 1RI5A 1ZA2A 1UPTA 1OV6A 4INJA 3TDKA 3LYLA 2ORED 1LSJA 2PA0A 2W2XA 2ZQYA 1NN5A 4KTTE 1U6IA 1PWZA 2YBDA 4LY9A 1Y82A 4N1AA 4G1UC 3T61A 4D74A 3EXHC 2VK8A 3UHPA 1T6YA 1BD4A 4CCAA 4G5OA 2GAFA 5B1DA 3U9SA 3HC7A 4FOOA 3F5FA 1V3UA 3LF1A 3NNDA 3LW7A 4TL7A 3C16C 3A0UA 3HCPA 4MUXA 4O4JA 4UFNA 4DC1A 3QMWA 3L6OO 4FMCF 1FRQA 1FFCA 2BKLA 2INGX 5TQ2B 1V96A 1KI4A 4HNAA 4RE6A 1J90A 2O23A 2EZ8A 2PU7A 3T9DA 3AOEA 3UENA 1GKUB 4BV2A 1SXJE 5C8XA 1IN1A 1E1QD 5I9NA 5JBIA 1UMCB 4QPCA 1PG5A 3COVA 2GBPA 1R6XA 3R76A 3AUXA 1C0PA 4G2TA 5JJIA 1YA8A 1PUIA 2G77B 2YYAA 3CVJA 4MNTA 3K09A 2DBYA 3UCEA 1Q3KA 4BV8A 2VJBA 2O1WA 1F7UA 4B48A 1QYWA 1SEVA 2W6ZA 4LK2A 1QAMA 5DMXA 3TBHA 1JDBC 1IUNA 1TCBA 4MJLA 1P1IA 4GGMX 4A9AA 3TO5A 1DGQA 4RV5A 3UWDA 3HFGA 3VC1A 1JEOA 3TGPA 2IX9A 5JCJD 4K6HA 1OASA 4LWOA 4MA4A 4RPHA 5A71A 5T64A 2DSTA 3ROGA 4X00A 2CUZA 5G3ZA 3W79A 4OB6A 1QSGA 2Y92A 2FFRA 2PO5A 2QLTA 3MBKA 3T3OA 1V6CA 4PQRA 3WRYA 5GINE 1I4EB 4UDYX 2PKXA 2ZT5A 4ZQBA 4DMCA 2N42A 3IHTA 2C94A 4QRIA 3N0XA 1PZGA 2ZWOA 1W2GA 3GRUA 5ERGB 1YUNA 1Z38A 1T9HA 2BFOA 2ZR8A 1E0JA 4RSGA 2M98A 3C4VA 5AXAA 4F96A 4P81A 2ZRCA 2C96A 3GEIA 2AJDA 3N74A 4YXWA 4EUNA 3B2NA 1FU8A 1PDOA 1HR0B 2XITA 2YIDA 4UNIA 4PR3A 4JVOA 1QS0A 1XWFA 2QLBA 2VHCA 5JCJA 1GA6A 2HSWA 4E2WA 4LZNA 2E5LB 3WV5A 1K8RA 1ST3A 3A70A 3UMYA 3B6ZA 1WDKA 2PKRA 3PE3A 1V39A 4MHOA 1UDAA 4LQDA 3HCEA 5EJMA 1OFHA 1IH8A 1RJ9B 1T36B 1TGYA 2EW1A 3SBDA 2ZU0C 3U44B 3HI4A 2ZWAA 2ADMA 1T0BA 2VXBA 3Q0TA 2MTBA 2TMGA 1ATZA 1A8PA 3DS8A 3BYZA 3QTLA 2XWQA 2H4WA 3T9BA 1ZZGA 1LDEA 4DLPA 1E6CA 1TT5A 3CW8X 3H7IA 3UJ6A 4BVFA 4D56A 1I30A 1MAVA 1RQLA 4BIIA 3A14A 5C3MA 1TA9A 3ZQKA 2BMFA 1V37A 2X8WA 2ATVA 3HYTA 4HBGA 3LH5A 4NEHB 3HUTA 1P29A 2ZI5A 1EKXA 2R9VA 3JARB 3WYBA 1ORTA 3LT0A 5CYOA 5EPEA 2ZAGA 3NYIA 1PJ8A 4FMDB 4B40A 1LDGA 2RFLA 1KNXA 4IDFA 2JHGA 3OEWA 3R7FA 1GRCA 5IS2A 3V34A 1E6WA 2BBTA 3DC7A 3LPNA 3FKQA 4FI3F 4D3XA 3EVBA 4I6GA 3HHPA 4XLLA 3QYPA 1J2TA 2AJ8A 2ZSEA 1XFAA 3AR5A 3DFIA 2PKQP 2RBKA 4OXQA 4TSKA 4YAWA 3GAFA 2VF5X 4XJXA 3SBOA 5CFLA 1A7KA 1H94A 1PF7E 4IX9A 4FLEA 4C4PA 2HEIA 3I9LA 4DQKA 2D0DA 5A5DA 2JG3A 4FCVA 5KTPA 3E27A 4MB0A 4AKGA 2WYUA 3SSNA 3CONA 2K7ZA 1DJQA 2A86A 2D1QA 2WHEA 1W88B 2XYHA 1W5FA 4ZO9A 3CKKA 4YN3A 5CX1A 3ZIDA 3F46A 5G0WA 3H9BA 3OZFA 4JP3A 1QC5B 2DH6A 3DZIA 5BQXA 5J4HA 5LBIA 4X60A 1II0A 1GGJA 5TPZD 1W4LA 1G8SA 5GGYA 1RNLA 4EI9A 1M73E 3MSXA 3U17A 3FYUA 5HA5A 3KR9A 2P1ZA 3L6CA 1QGZA 4HF7A 4IIFA 2HT1A 2QYTA 5AVOA 1JBQA 3WMEA 1GGMA 2F8MA 1E32A 2QQ0A 3BQMB 3I6ZA 4B5LA 4JBIA 4REQA 1PRYA 2JFXA 1AK1A 2GJKA 2VSNA 4IVRA 3RVDA 1I6MA 1EQUA 3B3GA 4G4JA 5HE8A 3SXUB 4DUGD 4ARBA 4J8PA 4MVJA 4Y1FA 5KNBH 2WBLC 4HWRA 4W5HA 3EWNA 1IBCA 3MWEB 4CCWA 5JRDS 4HWSA 4X7BA 4O0MA 4UTXA 2J3QA 3DDHA 1SK8A 3OCJA 5LYYA 4HFRA 1D2EA 3GNQA 5AVJA 1J5EB 2IPLA 2W6NA 1NP3A 3DAGA 1E3DA 1N9ZA 3AUTA 3TD9A 3ZXYA 1TQ4A 3D7SA 3T1YB 1U2QA 2PJDA 4Q3BA 1AJEA 2R3SA 4IJKA 1PZFA 1KK2A 3D2AA 4H1TA 3F71A 2FWIA 3PVSA 4YP7A 4FOSA 1W36D 1G3IA 3OZBA 3LC2O 3UMSA 4C3OB 5C1BA 5JD5A 3QX3A 4Q1VA 1R5OA 1FSSA 3FB1A 3OUUA 1SOUA 3TI9A 3VX3A 1FLDA 2QIPA 1NIPA 4KH1A 4BY9E 4Z7NB 3MJTA 4AMUA 3AJRA 5F78A 1FQKA 3I3SR 4NZZA 4QJ5A 1X1AA 4XVQA 5KQRA 5F98A 5THQA 1AKMA 4PX9A 4U2BA 4UBMA 4D6XA 4FHZA 2FWNA 1M34E 4WWHA 3QVTA 1PQWA 2JAHA 3TL6A 4AW9A 2LIVA 2FCRA 4ED9A 3NIFB 1B7GO 5CCDA 1CUJA 5JNVA 3ONDA 2W6MA 2L2QA 4Y2RA 5HUJA 3DKPA 1UADA 3I6YA 4OLJA 1LLDA 3NPMA 1KI7A 4C7OA 3IAAA 1YUMA 3AEZA 4C5AA 3EXFA 4XDZA 1XRJA 1FSPA 1ZJJA 4AICA 3IAM6 2GPBA 4LQCA 4GX5A 4FE7A 4LJAA 1ZIYA 4X20B 3EJWA 3VAZA 3WL3A 4YJ3B 4ECAA 1T91A 4B81A 3K0KA 4BU1A 1DWQA 2K87A 4S3MA 2O0MA 3S1SA 2CV1A 4CM8B 3H83A 1B6TA 4P58A 3R7BA 1ZQ9A 1XRSB 2Q5HA 1AURA 3G6KA 3FGOA 5CHYA 4G97A 4YP9A 3U3JA 1F8GA 5IXJA 1NVDA 4HJXA 3PTAA 1WMAA 1BZYA 1QC5A 4XSHA 2GHTA 5A9RA 2VTBB 1TNDA 1YK1A 1AN9A 1E3SA 4FLMA 4KXVA 2AUMA 1FRVA 2XSZA 3C3PA 2IV2X 3DG9A 3ZV7A 1YZGA 1SBYA 2O14A 2FX2A 2WIFA 3B9PA 1E4VA 4C01A 3F6EX 3G0IA 3MINB 2FZ4A 5B3LA 1WB5A 1JU3A 1H6BA 1ZHHA 3PHHA 3G9ZA 4J0EA 3H19A 4FB5A 2WJYA 4LXTA 4XWGA 3NZEA 2WOJA 3K35A 4JGGA 4O4LF 3ZWOA 2OCBA 3F9IA 4IY1A 3G13A 3KSZO 1G8YA 1QGUA 2FZGA 3B1XA 3ONWA 4XLTA 4LRUA 5B55A 1NSTA 4WI1A 1VB5A 2HSEA 3GROA 3NTUA 4K40A 1OZ0A 2QXYA 4UVIA 2C7QA 1PO7A 4TTPA 1ZS9A 1FUEA 4JNCA 2C9BA 2NV6A 4M83A 1E2BA 4WNIA 2AXPA 3H99A 5HF9A 3W5VA 4PONA 2E4VA 4EI7A 4WBXC 3U7RA 3H2YA 4ZREA 4OHXA 4AVYA 3O90A 3IR7A 2BF4A 1RWBA 4I4LA 1ZN8A 1IN7A 3IVCA 3K6SB 3FNIA 3QXGA 4EBFA 4QAJA 4PGAA 5LQAA 1N9GA 4DDTA 4Q9NA 3TLEA 1OXSC 1JDZA 2UUAB 2XWPA 3ZQ4A 4Z49A 2XIJA 3PFWO 4Z8XA 3NXKA 2UUPA 1HMPA 2DUJA 1W1WA 4M87A 5JDCC 1KVUA 1C7RA 4PYOA 4URYR 3ADDA 3I34X 2GZ3A 1AQ6A 5F76A 1NXVA 3AFHA 3L43A 4RY0A 1TYZA 3CHYA 4Z51A 1M9NA 4TM8A 3WXBA 1UQTA 3KQYA 1XXHA 4OLFA 4CFSA 3PXUA 2CZGA 4ER3A 4PINA 4Q1CA 3II6X 3S2SA 5E8JA 4W5QA 2OCLA 1KJIA 3HDHA 3NEYA 4YRTA 3PCTA 3R20A 3RAJA 4BC0A 4BN4A 2PYIA 3DMTC 1BW9B 3DEFA 5BN4B 1Y0BA 3RROA 1M2VB 3OFSA 3S1LA 1ISFA 4DJDC 1X1DA 2AR0A 3L79A 4CG1A 2FQWA 4PO8A 5DLPA 5IAEA 3VYWA 1G17A 4ZI2A 1VHDA 1PTJA 2A33A 1GR0A 1HZZA 2I6QA 1Y5IA 2ZBFA 3TPFA 1H1TA 1X87A 1Z68A 2D13A 2OZPA 2A0KA 3QK7A 2P6MA 4KFTA 3HJFA 3ZNNA 1FS6A 1GTZA 3GGGA 2HW8A 1V45E 1X92A 4GWGA 1L5FA 1L7AA 1TPZA 4S1NA 5GVSA 1OZGA 1ZU4A 5TMPA 2GM5A 1F5NA 1NXQA 4EFKA 4C43A 2OD7A 3HV2A 1IHXA 3K0AB 2CE7A 3PNSA 3SS8A 4PG5A 1ADJA 2GO7A 4RPLA 2B83A 1E66A 2QAIA 3HJAA 1LU9A 1L3CA 1OWPA 1XTVA 2QX6A 2B6NA 1K4MA 3IEKA 3EA5A 4PSDA 1P2TA 2JC3A 1PFQA 3G5UA 2B3TA 3GVCA 3L46A 4JKYA 4M99A 3COYA 4RO0A 3UBMA 1ABFA 1PR9A 1G8MA 1QQTA 3E23A 4MJ3A 3M4NA 3GMSA 2DTEA 3GLFB 3B78A 3R7NA 3MWYW 2PKCA 1EXWA 4AG5A 2X9LA 1KAMA 4DLVA 4ETMA 2F55A 3OM1A 4RD0A 1YK0A 2OFFA 3TRHA 3OT1A 4GP9A 5KHLB 3IOBA 5J23A 4NZ9A 4P0PB 3WWEA 4YQYA 2Q8NA 4H6WA 5DEOA 1LA2A 3IUPA 4KREA 2V6MA 3C4QA 5EJ5A 3VPSA 4HH1A 3HLKA 2XV1A 1B93A 1PQYA 4F72A 5K4AA 5C8YB 4MRNA 2NN3C 3FLMA 2W42A 3S81A 2AEFA 5TGDA 4AJJA 3A4YA 3QKSA 3DEAA 5JS7A 4M53A 5A4DA 3T9EA 5I7UA 1SUIA 3QQPA 3U1VA 3ZVLA 3TAXA 2F8SA 5JHHB 3AR8A 3UMBA 4HMQA 4EPXA 3MRXA 4YNBA 3GDOA 3JQBA 2OUKA 3QXXA 1IAVA 2CHGA 4TSFA 1QB8A 5EWMB 3S1AB 3TX6A 4CTKA 2B6HA 1IM2A 3M4JA 4CQJA 2VWPA 2ICAA 1D4FA 5H3HA 1Q12A 1BMFA 3ZIUA 1AMOA 1GKLA 1WB6A 2VP3A 3RSOA 3BL8A 4RD1A 1RKBA 3TXXA 1BQ4A 4C5CA 3M2PA 3BDIA 1HL3A 2AFHA 5GADl 5JU6A 2Z4TA 1NLZA 1OPRA 2QTGA 3A10A 2Q4TA 4DLTA 2A14A 1JNYA 1II9A 3B3JA 3UPTA 4NCBA 2WF5A 1NVFA 4EW3A 3W2TA 1N32B 1T26A 1SKBA 2Y1GA 3DE5X 4L4RA 1BWRA 2HLNA 3MEQA 1DV1A 1YGPA 5B3JA 3R0VA 3E48A 3KPYA 1BEUB 3PHIA 4I1VA 4CQLA 4LDZA 4OHPA 3ZGZA 3FVTA 1BSVA 1QFMA 1JQBA 1W0KA 1XDZA 3OD1A 4OLBA 2GVNA 1CYEA 2XE8A 1HE3A 1SZDA 3LCJA 2PLNA 4WEQA 3TKLA 3WE7A 1YCGA 2PZFA 4MQMA 3VSBA 3BK2A 1YE5A 3BZUA 1B14A 2A0UA 3MAGA 3SJCA 4F5ZA 4Y2TA 2V0CA 3I6QA 3O8NA 3EMVA 4HDNA 1HT0A 3ITKA 4NBVA 4MQ5A 4LJYA 5E6UB 1HNXB 1YIDA 3AEQB 1ZU5A 1A98A 3G0OA 2OG1A 4D6PA 2V6BA 3PBKA 1KOFA 2HMWA 2RHCA 3F49S 3GEMA 1D6MA 2FI1A 3MMNA 5AK4A 2ATCA 4QLOA 1WXIA 3RFVA 1THZA 5ESWA 3LKDA 5I9IA 1G2IA 4JVLA 4LHZA 4TTRA 1PR6A 2C82A 4QXRA 5EP3A 1KVTA 3TZKA 3IA7A 4Y1GA 4BLQA 4CL8A 3C3DA 1ACJA 1N92A 1RCFA 1U0OC 3DKKA 4G37A 4YO7A 3WKBA 3WSWA 4UZEA 3BXFA 3H11A 4BTLA 2X4IA