3HN6A

Crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
271
structure length
271
Chain Sequence
PGSMRLIIRPTYEDISKWAANHVAQKINEFSPTKENPFILGLPTGSSPIGMYKNLIELNKNKKISFQNVITFNMDEYIGIEENHPESYHSFMWNNFFSHIDIKKENINILNGNASNLKKECEEYEKKIKSFGGIMLFVGGIGPDGHIAFNEPGSSLTSRTRIKTLTQDTIIANSRFFEGDVNKVPKNALTVGIGTIMDSQEVLIIVNGHNKARALKHAIEKGVNHMWTISALQLHKNAIIVSDKNATYELKVGTVEYFNDIERKNFNNDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Glucosamine-6-phosphate deaminase from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi
molecule tags Isomerase
molecule keywords Glucosamine-6-phosphate deaminase
total genus 90
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hn6A00
3EFBA 3L7OA 2BKVA 2J0EA 1XTZA 3ENVA 4L4ZA 3U7JA 3TX2A 1VL1A 3ENWA 1UJ4A 3NZEA 3UW1A 1LK7A 4OQQA 1FQOA 2BKXA 1DEAA 1UJ5A 2GNPA 3LHIA 1O8BA 2RI1A 3BXEA 3EB9A 3ICOA 4L51A 4X84A 3HN6A 3LWDA 3NWPA 1HOTA 4R7TA 3E7FA 4TM7A 4R9NA 4L5JA 1PBTA 1Y89A 2F8MA 4IO1A 4OQPA 3ENQA 3KWMA 5HJ5A 3IXQA 1LKZA 4GO1A 2OKGA 1NE7A 3E15A 4L4YA 1UJ6A 2WU1A 3BXHA 4M8LA 4GMKA 2W48A 3BXFA 3CSSA 3OC6A 4L50A 1JT9A 1M0SA 1CD5A 1LK5A 1FS5A 3BXGA 1HORA 3CH7A 1FRZA 3HHEA 4L5IA 4NMLA 4TM8A 1KS2A 3KV1A 2R5FA 1FSFA 2RI0A 2O0MA 1FS6A
chains in the Genus database with same CATH superfamily
2XB9A 4A73A 1Z33A 2R85A 2VJAA 3NWBA 4S1NA 4M9XA 5KQGA 4YJKA 5B2EA 1N3IA 2YJGA 4RGYA 1BHO1 2AEMA 2AOWA 1C2YA 5JEDA 1LQ2A 2D8MA 5DWDA 2HY7A 4YRNA 3WDLA 1AU9A 3C4JA 2EKQA 4MQ6A 1NU8A 3PEEA 3WIOA 1T25A 1LK0A 3JASA 1XOIA 3MEQA 1A7KA 3L3BA 4ZOBA 1N0VC 2AKEA 3GRFA 1GKYA 1UBEA 3HR4A 1OBHA 5I7VA 3GVPA 4WNYA 5AQ1A 4E2XA 1BD4A 3GG2A 5JSZB 3JX9A 3QXGA 2G1KA 5CX4A 3Q10A 3OTIA 5IBQA 3KDPA 5AVUA 1WKVA 3HBMA 5KBYA 3OUUA 4Y0VA 3RVMA 4GI3A 2EF0A 2BSXA 5GONA 4II2A 2YICA 5BQ3A 5K7SA 3A6DA 4BO0A 1ZEMA 1TAQA 2GR9A 3ESZA 1E2JA 3HCOA 1GAXA 1QR6A 2WG2A 2PE5A 2GDJA 1U3DA 5JECA 1FTWA 1LWNA 1AXGA 4UEWA 3ES9A 1QOQB 1CY6A 2CK3D 3T3IA 1BHQ1 2HBRA 3E8SA 1P7CA 1YB2A 3RSQA 1WR8A 3O8OA 3N05A 4WESB 3T95A 2PU7A 1XXLA 2QG9A 4CL2A 2XLBA 4JL5A 3NT2A 4M8LA 1XFDA 1GPH1 5FH9A 1D8TA 3D64A 3NOVA 4KXWA 4LWQA 5KTOA 1DKLA 3GGGA 4FYWA 1GG8A 2PLAA 3ZY6A 2ZWAA 3P26A 3RK1A 4DQXA 4EB6B 1I2DA 4KK4A 4AG3A 3IKTA 1EB8A 1N0HA 3DVSX 4LQ4A 2WT4A 2Z1MA 5D3QA 1YSCA 3HJRA 5K0NA 2JFHA 2O8VA 4UDYX 4PHTA 2HLPA 1O4WA 2V9ZA 4A4DA 2WFLB 1Q5PA 3IXLA 3CUVA 1LDGA 4YACA 1T8UA 4B32A 3B9PA 3H19A 4D9IA 1D9XA 2PT5A 4GM4A 3L0DA 3JQAB 2Q5EA 3GMDA 1K7FB 1XA4A 3WAGA 3GLRA 3RJZA 3RWBA 3QPUA 2IOQA 5DN6A 3IAAA 4NS4A 3NDIA 4LE0A 1XAHA 3EPKA 4MICA 1YQ9A 1DQRA 4IJMA 4DJEC 3KU1A 1YA8A 2XMBA 4DLZA 3ZLBA 4R8LA 1NYTA 1Z6AA 3RM3A 5LYJB 3QVXA 3GBSA 5GV8A 1ACMA 1OFTA 4UU8A 5D3KA 1VC2A 4NMXB 1G4UR 1Q1EA 1DFIA 4XJXA 1OTHA 3PFIA 2HH9A 4ZEMA 3GEEA 5K9ZA 5TE9A 4EW3A 3DKKA 1SB8A 4OAPA 2ZSKA 2WJZB 2JGAA 3W3AH 4I1PA 2DHCA 3OX4A 3FZQA 1Z6GA 4NE2A 1XEWY 4RC9A 5ALKA 5C7LO 3F5SA 4ZCTA 5KOJA 1X8KA 1NP3A 3B7GA 2R6HA 2XUJA 4PSVA 2GGSA 3VZQA 4FGZA 1WPQA 3C16C 2CLMB 4HQ6A 5LNK1 1W0KA 3AUJB 5A02A 3ERCA 4AFNA 1WXGA 1XTSA 3CX4A 1SBTA 4NBUA 2VF2A 1W88A 1K6IA 4ZAFA 1E99A 1ULBA 2PIDA 3CWCA 5DM0A 3KQOA 4HDRB 1AKTA 2Q0SA 3BVPA 3HXLA 1JDJA 2CN1A 1SWWA 4OXYA 1NLFA 5F78A 3ONNA 3ESXA 4HRVA 4RIGA 1Z0JA 3F4BA 4I66A 1Z5PA 1KA9H 1N3LA 2NO0A 4AF7A 2ZIVB 1U3TA 4CKBA 1C1HA 1KMIY 4L07A 1SKYE 2OK7A 3OD1A 2ZRCA 4LI0A 3P27A 3EDMA 4YROA 3V1KA 3EBLA 2VJMB 4K6KA 3RC2A 4F21A 4EA9A 2HU5A 3BGWA 3OZSA 2I6QA 2VXBA 2YMPA 1QG2A 5DFAA 4KE8A 5BR1A 1RKBA 1XEXA 4K81B 1I2AA 3CYFA 3DONA 3D59A 3CLRC 3I2GA 4HNSA 1U7OA 1A5AB 2PNFA 2RHRA 3OIVA 2ZPAA 2MIIA 3P32A 3RADC 2WK1A 3QBVA 1VB3A 2JBAB 3LP6A 4M8KA 1FS6A 4BNFA 3ASYA 3R7WA 3QEOA 2FR8C 3K53A 4D92A 5HTOA 3N74A 4R9RA 2D3TA 1UBOS 1UBGA 3DT9A 5A4IS 5I4BA 1QVWA 2ZTLA 3OF5A 5JXGA 5IT9A 1YB5A 2VSNA 4YCNA 3G9QA 1U1CA 1NVUQ 4ZMBA 3I9V1 1E63A 2ZRBA 2ZWOA 3OLXA 3LVRE 1EFVA 1BMTA 3G2IA 5DYYA 4P2BA 3TZCA 4LK2A 3K1TA 4EY5A 4LS3A 1EWTA 2EATA 1H05A 3LX5A 3UV7A 4Z1OA 3DJYA 3IHKA 1GCUA 4L57A 2Z9CA 2J5XA 4HEHA 4WLVA 3WGLA 2N46A 4PZYA 4BKQA 1BJRE 3DXYA 2VHWA 5HZKA 4ZCRA 4CT5A 5E3IA 3CR7A 4I1RA 3NCHA 4WFQA 1VIAA 3LUCA 2R7MA 3N87A 4ZU1X 4KKXB 3ET4A 3D6NB 4RIFA 4Z86A 4DMHA 3VC2A 4OXIA 1EM8B 4BO1A 1X70A 3DULA 4ZIRB 1SK8A 1AKUA 1KH3A 1WCIB 3LY9A 3ROZA 4LHYA 3FPSA 4G0PA 2GYVA 3IIKA 1JAZA 3RWOA 2H54A 3DAHA 2ZUEA 2XGOA 4JEIA 5CGZA 1XQ1A 1CY2A 1HQDA 1XV5A 1ZI9A 2IPAB 2ZI7A 4B87A 2ZE6A 2CLFB 2A84A 4I3HA 1SKYB 4EF5A 1YRQA 4FYPA 5AICA 1Z8FA 1IXRC 3O3OB 3E5NA 4NXNB 2GSDA 1CQIB 2G0NA 4XFJA 2JDID 2XOKD 1DMSA 2B4QA 2QLNA 3ILXA 4QOFA 3REQB 5DN6D 2IZOA 3I0ZA 1UXJA 3A4IA 5AJHA 3IYLW 5HNKA 4P3YA 3SD7A 4R3WA 2PU5A 3NORA 4GF5A 1V45E 2EW2A 2R48A 1DAOA 1P18A 3BFPA 3S2SA 4US2R 2QN6A 3D4NA 3UTCA 1HYQA 2I2WA 3E7PA 4QLOA 3L46A 4F5ZA 4Q9JA 4CMIB 2Z4TA 4NSNA 4DBVO 4L27A 1OB2A 1Z75A 4DEYA 4LKOA 4CUZA 4LTDA 1OSNA 3G7SA 2X7XA 1DZIA 1SXIA 2W6JA 2PA3A 2VAPA 3GR6A 1VCIA 4Q3AA 1PE0A 3TEFA 4EFNA 3ZOZA 2Q5LA 5JVDB 4AZSA 1BE0A 2VPPA 3TZHA 3NTXA 4EGCB 1FFXB 4BO7A 2PWBA 2O0MA 5EHQA 2AX3A 2ERXA 2I3GA 2QW0X 4R2KA 1HRKA 1K4KA 2EVWX 4AICA 1PT6A 1FBTA 2FLKA 4ATNA 1HOXA 5BN4B 1UJCA 5KOIA 4FP9A 1VLMA 1PNOA 2HSJA 4LSMA 1P4JA 5J4YA 4FHEA 3KEOA 1AO3A 1Z47A 4K6FA 5HM6A 1K0UA 2RGNA 1V2GA 3MUEA 4M98A 1ODFA 3AR2A 3FIJA 3OZEA 4PAWA 1RCTE 3HL4A 2YZMA 2ZUSA 3IC5A 3S8MA 4KPUB 4M7RA 4X1YA 1CHNA 2HBYA 5FJIA 2HK7A 1MUUA 2QTMA 3BULA 3EWNA 2FW8A 2I9KA 1KO4A 3HNOA 2B25A 3MJVA 5EXEA 1JIJA 3W4KA 3KTAB 2J1LA 2JRLA 2WNSA 4FFDA 2Y3IA 3NLLA 4FDTA 1KS9A 2ZJ2A 1PGQA 4OY3A 4ZQHA 3WB0A 1K3FA 4A6XA 1OI2A 2QQGA 3KR0A 2QYSA 5F3RA 3R9IA 4GX1A 2KYRA 1YHZA 2P1DA 4M1SA 3LDUA 3QJGA 1LGYA 1M2VB 4AJ2A 5CGQB 2Q07A 1P7PA 1F38A 3PI6A 4GX5A 5I4IA 2LXNA 1JR6A 2J4FA 2GYUA 4MUIA 4I9UA 4EKNB 1P4SA 3B7WA 3C3XA 2BFFA 3LYAA 1NQTA 2WWTA 4ZREA 2BGGA 5H80A 1SHTX 3H04A 1AVTA 1BCRA 1QE3A 4CQLA 1ZL2A 4U8HA 3V6MA 3DCIA 2H11A 1UBLS 4N3GA 2ETVA 3ANXA 5DTQA 1A95A 1X1TA 3KSBC 3GIDA 3T1YB 1E8MA 4RAQA 3RBXA 4C7BA 3TTWA 1TPYA 1YZLA 3G82C 1LTHR 4ZOLF 1YRWA 2G4VA 2PANA 1EDDA 1F0YA 2VAMA 3MOIA 1T4CB 4MQFA 3G49A 3WKAA 3T9CA 4B31A 3COJA 5CU7A 2PMDA 4UZEA 2FZEA 2TS1A 3DHNA 4NCIA 2J41A 4O2AA 4PVDA 1EESA 2DHDA 1L5LA 3NBMA 3RF7A 1NW6A 1CNMA 4D3YA 2HSWA 1IRXA 3KVVA 1MJHA 2B82A 2C2ZA 3DHEA 4KGDA 2YYZA 3W5HA 3WQQA 1WTCA 2LIVA 4AP6A 4OX9B 3G0DA 1QH9A 4IUDS 1SN7A 2OSBA 1QZXA 3NEYA 3NHMA 2CVZA 2HPVA 2TRSB 5JNTA 2CK3A 5DYWA 2HWWA 1L1RA 4EEZA 5LQSA 4MYDA 3I1JA 4BBPA 3VNBA 4DSZA 5B1HA 1U7WA 4BY9E 3EC7A 2YV1A 3PDCA 1QKJA 4QQNA 3WQRA 4TT3A 5LMZA 1FYWA 5BWOA 2D7DA 2PAAA 2FWBA 3BRSA 4F06A 4HYEA 2QN8A 2XTJA 2HW8A 1RI2A 2QVBA 1T8RA 2AOXA 3GCDA 4QASA 4TL6A 1YK1A 1FFCA 1KI9A 1RCUA 2VQSA 4Q37A 2MSNA 5ALEA 4BAZA 4BQSA 4Q3LA 2NLOA 2P9QA 5JQGB 4BAGA 2FRDA 3MVEA 1NLZA 1VFPA 3TSCA 1GZDA 1JDZA 4UCQA 2VP3A 2VK1A 3PTLA 1L6IA 4DLSA 2H08A 3EWSA 2QDKA 3N58A 5GMOA 1YGPA 4N8SA 3NP9A 2RGBA 2PMFA 2IY9A 3PVCA 2X8AA 3E9NA 2R5NA 1P19A 1QVVA 1CFZA 1WXDA 2JFFA 2O2CA 3UUFA 3IAFA 3WKEA 1H3EA 4CMHA 2CDNA 1F8YA 2P9TA 2UVDA 3JAWB 3R1IA 4G3XA 3SX0A 4JJZA 3H5NA 5C52B 2HWKA 2WKSA 2W83A 1QVAA 4NAUA 1ISMA 1ZCZA 3IUBA 2QVXX 3HNRA 5H70A 3CCCA 4CDMA 2XRMA 3U6KA 4RL6A 2HAEA 3ANNA 2ZQYA 3VO2A 3OECA 4LC9A 2VPIA 3NVDA 3CX3A 4RZ3A 1FSGA 2BZ0A 2GKGA 3D1LA 4KQGA 3AC0A 4R1TA 3EPLA 5DPMA 4DRZA 5J2TA 2I4IA 5JVDA 1EBFA 2BLNA 3DM9B 1QYDA 2ZRIA 3OIGA 4ISCA 2NACA 1H4QA 3RGGA 3HM9A 3FKSA 3HQ4O 4JEUA 1L5MA 2PPVA 3GYGA 2YNMA 4LCEA 1ODLA 1ORRA 1U1GA 4QYWA 2JD2A 2HIAA 5HJ2A 2IV3A 2XZPA 5F7JA 2IBTA 2FYTA 2GXQA 3RC3A 1K2WA 4FBLA 3KSRA 4QRIA 1HT2E 1QRUA 1QU2A 1J2TA 5DRTA 2G06A 2IXDA 4MV4A 3WLFA 3P19A 4E12A 3N8NA 4E7OA 3IDOA 1WABA 3D4OA 4V38A 4G8DA 1ZGGA 3B52X 1ND6A 4G5RA 5EZ6B 3CNEA 1SKBA 2HQBA 3EUFA 3KJIA 2IODA 1O1YA 3ROKA 5KYTA 3SHWA 3THRA 5BMVF 5KX5B 3W06A 4ESVA 1GAWA 1ZFNA 1E3IA 2BEJA 1OZHA 2IXFA 4EUSA 3ROXA 3OU7A 3HZHA 4CBVA 2V74B 1JEQB 4KFTA 1ZRMA 1XPOA 4NH0A 5CLJA 1NMZA 1UKZA 3QFTA 1E4YA 2ERCA 2PUDA 2CHEA 1B15A 3K15A 2QLMA 3I92A 3PJFA 1N2CE 4HWRA 4FLFA 3STVA 2HXGA 4TXJA 4D8VA 4PG8A 2C2GA 3BTUA 2XYQA 4I55F 2CJFA 4FOSA 5DI3B 5JNVA 4M9RA 1ECGA 1Q0SA 1P62B 1QR2A 4GQIA 3CBGA 4GUDA 1FE8A 1KDPA 2EXXA 3ZQ4A 3ZCTA 4HUTA 3IUQA 1DX6A 5IHXA 4A82A 3H9UA 2FZVA 2SKEA 4EFMA 4CHTA 4ZZ3A 3R6WA 3JQAD 3ZYCA 3PK0A 2OFWA 4BEJA 1FMTA 4LF5B 2AI3A 3R5KA 5J4HA 1SRRA 2VKQA 3BFJA 4TYPA 3P9RA 3R5HA 4V0ME 3T7EA 4QPZA 3GIWA 3GGPA 2PH1A 5TNXA 2C7RA 3QKTA 1C7FA 2WUWE 4HH1A 3WLEA 3TUJC 4K0KB 1T0JB 3LW7A 3AHJA 3R0XA 4KE6A 2BUAA 1U1IA 4H7EA 4A6PA 1Q0LA 2K2WA 2O1XA 1C2TA 2CBXA 3IBFA 1ZN8A 4B4WA 1NONA 1AQLA 3DM5A 1YULA 2D5IA 5LSAA 4NJOA 2BGIA 2ZJBA 1BX1A 4HTFB 1SU4A 3ABOB 3SC2B 5JARA 4RJLA 2R9VA 3ZCSA 1C9MA 2XWSA 4FMBB 1SOMA 3T6KA 1JLHA 5EIFA 9MHTA 2C4HA 4U8GA 3KAJA 3CRVA 1TE2A 4LV6A 3WL5A 1W1UA 4XUEA 3NUQA 3NYWA 1Z8NA 5TC4A 4X7MA 1FRFS 4ARVA 1QE5A 1B0PA 4OAQA 4QAJA 1SBZA 1FF9A 2PX3A 1KI6B 3D3EA 4A1OA 1SZDA 4MIYA 3FMVA 5FV7A 1DC4A 2LCFA 2WKQA 5AXAA 5F33A 4EBFA 4WZ6A 4JU8A 5KHAA 1SXGA 5YASA 4TOIA 3UNXA 3GEBA 1PTJA 1FJXA 1H22A 1RHRA 4O4JA 3AEKA 2A92A 3AWDA 4Q6WA 3RYIA 4I5IA 2BR3A 1DIRA 4IH1A 5G53C 7GPBA 4C29A 1B00A 4BU1A 3WDSA 2I7VA 5BNZA 4JI5B 1YDWA 2GXSA 3EIXA 3IT1A 3DFIA 3KDAA 3U61B 3D4PA 1T4MA 5JAOA 1LX7A 1M6VB 2H4YA 4EPVA 1KAQA 1EFCA 4G0OA 4OLJA 4TTTS 2PT6A 4YRZA 4CUKA 1XXHE 4EF4A 4UVEA 3KVNA 4IVNA 1CY8A 3LECA 5CLQA 3FPFA 4BB0A 5BRAA 1ZM3A 2ZRPA 3GNTA 3ABIA 2ZPTX 1DWOA 2QRVB 4IFTA 3IHTA 2X4DA 3SBEA 3QWAA 4X1YB 13PKA 3B1JA 1R6VA 3GJ8A 4H3HB 4G9BA 2NYVA 2FFBA 3QXXA 1X13A 1XQVA 2VNSA 4ZALA 3EYAA 3PGA1 1WVIA 4BEVA 4FQ8A 3V8RA 5DTEA 4NEGA 5EPEA 1CK4A 3HBJA 4LY3A 4GQBA 5FFFA 1F20A 4UHFA 3RSCA 1U99A 1RS0A 4YXWD 1XPJA 1YJXA 3B85A 2G88A 3E2PA 1AMUA 5HP4A 1Y1KE 1T0UA 2WY2D 3TCNA 4OQEA 3GCZA 4K03A 2G04A 1JG4A 3PWSA 4I55B 4TL9A 2DPHA 2CHVA 3EGDA 3W7BA 1EFPA 3ZCQA 4H4DA 4EWLA 3KT3A 3UCXA 3ESRA 5CVEA 3SLGA 2DG2A 5HQ3A 2PXHA 5C5DA 1TI7A 5C46F 1REQB 3A9CA 2XE4A 4XVHA 2JGFA 5E95A 3N2ZB 3R24A 2QL9A 4DL9A 2XNCA 3EOBI 4BQQA 1H0RA 2OO5C 3FB4A 4JLKA 2E37A 3BRQA 2CWWA 2A3RA 4MWOA 5BWBA 1F1JA 2ZYAA 3ZE0B 3THWB 4QTXA 5ESDA 4YRJA 1K3UB 3G02A 5HF5A 3ZE2B 1TUGA 2WAMA 2X9NA 3O4GA 3RV4A 4CF5A 2F3UA 3HRKA 1P4RA 2VF7A 1L4HA 3TLCA 1T9CA 5DNEA 2PRJA 4PSKA 3ZW7A 4AJPA 2K6GA 4WERA 4IMIB 3ONDA 4JBLA 1KSHA 1DT3A 4RO0A 2PZEA 5FULA 1UMKA 1RTTA 4KODA 5IXYA 4WBXC 4UQPA 4F04A 1FRVA 1Z36A 2C1ZA 4BBZA 4L95C 4G37A 3P71T 2Y4OA 2QZSA 1KGSA 1VE1A 3A9WA 2VZ8A 4R16A 4U3JA 3R8XA 1M8FA 2OG1A 4DDTA 3K96A 4D41A 5HGXA 2PD6A 3WLLA 3IBYA 4WNAB 3UB3A 1XNGA 1K9SA 3UKJA 3H2ZA 2QA5A 3RIHA 2CC2A 4YMGA 1RYEA 3PQ5A 4RZUA 5IH7A 1IG0A 2NNWB 4D43A 2XUPA 4NL4H 1UJNA 3SEZA 1QF9A 3AXTA 5G0VA 1XPRA 1TEVA 1G9XA 2W2KB 3T9FA 2H59A 3MLEA 3OOHA 3WZLA 3ND8A 5GTDA 5KZMB 4J3FA 1GL6A 2EBWA 2O8DB 2QBYB 1B2LA 5JMPA 2V45A 4GIBA 4G0UA 1KU0A 2NQTA 1IJKA 1E77A 1PG0A 4L0QA 4G5GA 4B81A 5BN3A 4UM5A 2QR2A 3UMRA 4K6CA 5KYXB 1R8QA 3JVDA 3WNVA 4PNHA 4ZV7A 3SP1A 2L19A 1UBRS 5ITZB 1QP0A 4DCOA 3SJUA 4IQ8A 3D81A 2O5RA 3HI4A 1NR5A 2FR0A 1DAPA 3ONVA 2WB2A 3EGVA 3HFJA 2ZI3A 3G85A 1DXHA 1E92A 5FPYA 2F1IA 4L6IA 4RWEA 4C5CA 4JKOA 4H27A 1F2UB 2J6BA 4CM9A 1PYDA 1G8FA 3KZ1E 1M0TA 3GD7A 2MU1A 3P1JA 3GPCA 5AUOB 1E4EB 1YQUA 4AUEA 2ZRQA 1F0PA 4F92B 1M6NA 2G1AA 4Q7KA 1NFFA 4MVJD 4B8YA 4CLRB 2WHEA 5C37A 3IQWA 3V32A 4XR9A 4HWPA 4MS4A 4FGSA 1XP5A 3CW2A 1UZNA 5FL7D 1OYWA 3WLTA 1GKIA 1I7NA 1FDRA 1FYXA 3Q5GA 4Q82A 1Z5UA 3BSFA 3AJ9A 2XVXA 3UB4A 3WGZA 3SE7A 5ICEA 3O38A 3MXTA 1JU9A 3ZWCA 3VR2A 3R7NA 1G7TA 4YP0A 2CDBA 5G3YA 2V97A 2ERYA 1X9IA 2I6TA 1D2AA 1RW4A 4LXYA 4FFSA 2DBRA 2VH5R 3G2KA 4AUKA 4C0SA 1LSJA 4DG5A 2O2DA 1U5BB 2GO7A 3JY6A 3AVPA 3L01A 4PQGA 5TQ2B 3PGXA 4HT3B 2WSIA 2ZBFA 5I5EA 3E9RA 4HUQA 2XIQA 1IUKA 1DSSG 4QO8A 3GW8A 1GYRA 3OIFA 3ICPA 1W9MA 1W7AA 4OJYA 3C85A 3IP7A 4D4HA 5BW6B 3ROTA 3MAAC 3MWFA 3JZDA 3AYZB 1N0UA 5B58T 1RI5A 3R74A 3ZTTA 2VZ9A 2CNNA 1SR8A 3G9ZA 1RAGA 3PRJA 2B36A 4ZRMA 1QO0A 4BC0A 4D44A 1IN8A 1WUKS 3B3GA 4J3JA 1P73A 4RZHA 4XGIA 3RTCA 4YNBA 2DCUA 4KHZA 1MFPA 1W0JD 2QD4A 1MCZA 2XXAA 3HFSA 1S3GA 4QUJA 2NZ8A 1AJEA 5FAXA 3FHLA 3HKDB 1V11A 2IU3A 2R6CA 3PDIB 1WCXA 2WTXA 1M9NA 4FS8A 4P6VF 2B3TA 3UJ9A 3PQ8A 5CITA 5C2JB 2IGTA 1ZW6A 5HILA 4ZHSA 1O95D 3R7DA 1KK1A 5FOUA 2SECE 3TIVA 3U2QA 1X94A 4QQKA 1MO4A 2ZB8A 2YH2A 3EUWA 4UE3S 5HDBB 3SZ3A 3ZQKA 1J4AA 5KJCA 2J0QA 4E03A 5IF3A 4AL4A 4B3XA 1WMFA 5L3QB 5L40A 3X1WA 1ZMRA 2Q62A 1U3FA 4A23A 2HYIC 3D6TB 1S2OA 1V71A 2IYLD 4YDRA 4JJAA 3ZE1B 3PIRA 1N7IA 3AILA 1CYEA 3UV6A 2HU7A 2XF8A 2I99A 5AMXA 1T43A 3EVCA 5E6RB 3R3ZA 2IEBA 1TO2E 2I1LA 4HWTA 3V4SA 4C08A 4F5YA 5CTJA 1I7PA 1YASA 4F85A 1AKEA 2NXNA 4LJ4A 5ALPA 4KFCA 1TLFA 2JGJA 3H6KA 3DEJA 4U2KA 2HSEA 5FIUA 2GHQA 2EP7A 4B3DA 1NIPA 5JH7A 4WGGA 2GZ1A 2N1MA 1SAYA 2O2SA 2QMUA 4EUKA 2QTWB 3C4QA 3CINA 3BL5A 3W6PA 3OMWA 4U63A 1B74A 4DXDA 3QX7A 4L3OA 1N2EA 2VNIA 3N7AA 3ZG6A 3L6EA 5L4SA 1M2GA 3EZGA 3GPBA 4I9GA 4ARSA 4NNJA 1SBQA 2W98A 5I7EA 4LF6B 1H85A 3DDOA 2YXBA 2VSQA 4BGUA 2ZLBA 4EG8A 4H7PA 2OBNA 3J7AC 3PJRA 4RGVA 2IFTA 2NYUA 3WSWA 1PJ4A 1ZI8A 5L53A 3GEIA 1A9XA 1XLTA 5C32A 1TK2A 4MROA 2OCKA 3HYTA 5DRYA 5B4VA 4L5JA 5MN6A 4JAVC 5CJ2A 2B5WA 1Y4ZA 1PWEA 3HJFA 5K09A 5G0TA 3GLHA 3QKRB 3QYPA 5C51B 1WVMA 2Z04A 3PZRA 2ZOSA 3OFSA 3PUWA 5KHLB 3WMFA 1ZMXA 2C5GA 4UARA 4R98A 4B35A 1XTPA 4PLGA 2DWPA 1SXJE 3HU3A 1GN8A 4TLBA 3TTYA 3PNKA 3Q7PA 4GW3A 5ITWA 3U4AA 7REQB 2FE1A 1DP4A 4W82A 3GGCA 1KY4A 2CHGA 3IVAA 5CYPA 4MYTA 4O59O 3DE7X 1VSTA 1QV9A 4Q4AB 2QRNA 3DZJA 3KRTA 4LFBB 1LS6A 2Y2UA 4DWVA 2X5KO 2X1LA 5KNBA 4ILEA 4U7HA 1SJ9A 4JUDX 4M1EA 1G20A 1X38A 3EE6A 4CF4A 1NI5A 1PDVA 1R5OA 4MMXB 1EE9A 3Q3CA 4OIFA 3DBLB 5AM2A 3UJPA 5FPHA 1LH0A 4ZVVA 3UFXA 1N2XA 4D79A 2ZITA 4UVDA 2FSFA 3KXIA 1FJGB 3OX1A 3PA8A 3L8MA 2G9QA 2JCVA 3NAMA 3A06A 1I4WA 3L8GA 1F2DA 5I7UA 1Z2AA 4QM6A 4DJFC 3TZEA 3NHRA 3C48A 3D3NA 4ND6A 4G0NA 4UUOA 1QLJA 1R4MA 2H7XA 4M9UA 3B2QA 1MRNA 1N6KA 1YAHA 1MU0A 1YACA 1ATZA 3CH6A 3DR5A 2ZJ5A 1W85B 1EAMA 1TDJA 4N82A 5K3DA 4X54A 3R5SA 2XNSA 4KQ1A 2AHRA 1JLSA 1QH8A 3DVAB 3HUFA 3JR3A 1BE6A 1JV2B 2WC1A 2YTZA 2JVKA 3AY6A 4FW9A 2BM0A 4Q66C 5TARA 1JX6A 1TT5B 4WKNA 1L5VA 3NBAA 2W58A 3RRNA 3NTOA 5AK6A 2CL6X 3G88A 1ISJA 2VDMB 1GTL1 2GLTA 3OEEA 3WFJA 4BLQA 3NG1A 1JAXA 4FHFA 4N7JA 4B3SB 4PONA 2G76A 2ATIA 2OOKA 3L1IA 1I33A 3KU4A 4HZGA 1NUQA 1W34A 5FOTA 4A9AA 1F5SA 2XUKA 4JJKA 2QZZA 1KO1A 1HLFA 4M49A 3PTZA 4LQLA 2MSLA 3OOSA 4LDNA 4N6GA 4ZYUA 1XZKA 1KETA 1X1AA 3CNOA 3FWHA 4M2LA 1JBKA 3FWZA 3HKBA 4PINA 1VMKA 4OBBA 4IJQA 2DM6A 2JJQA 3U7IA 4QREA 1FEZA 3QEAZ 1MVNA 1Y8ZA 3IOCA 4UBNA 3C8ZA 3HB9A 4QHYA 2WUVA 4X3OA 4X3CA 2JLYA 4IZIA 1CR0A 2ZJ3A 3BMOA 3DDCA 3HVRA 5EG5A 2WFMA 1DAGA 1AM4D 1SULA 2CVOA 4GI2A 3H0CA 4DDVA 1JHYA 2ETXA 2WQ7A 4BASA 2CNWA 3TOXA 1BN7A 4KLAA 2Q4EA 1DU4A 3K1AB 4LAFA 1E62A 1C81A 1A9OA 2CCJA 1JTVA 4TWBA 4TKMA 2GN9A 4JMLA 1VOTA 4TMWA 3QMMA 3FFTA 3OY7A 4EJ2A 5A0TA 5TQ0B 3LCMA 3JWGA 2CNWD 5LLTA 1MA0A 1N5JA 1R64A 2NTNA 2V6FA 5B4TA 4EX6A 5LZ5A 3GLGE 1ACJA 3AEKB 5E4FA 1JI3A 2X8JB 1XTZA 2FW1A 3QEMA 4AIRA 2FUNB 1NN1A 4DADA 5INTA 3L9WA 1NXVA 4TXLA 5SZKB 2IIVA 1YB1A 1DDIA 1QO9A 5ERYA 3OCVA 2IH4A 3SPXA 5KNDD 1MPTA 1QAQA 3HP1A 4GSLA 5KYUB 1TM5E 1H8HD 2KQUA 2XMPA 4LJAA 4YY3B 3FSJX 2EYQA 3D6JA 2HLNA 4LYJA 4QTYA 4L4RA 5AESA 1OA0A 3NR2A 4DQLA 1J56A 4YPVA 5BR8B 5I9SA 2WU1A 2H48A 3I1YA 3U26A 5FA5A 2VQEB 1UBNA 4BOYA 4QVGA 1JHRA 1T0BA 2H1WA 2WAAA 4Q3DA 3QPWA 3D6MA 1QPZA 3H2SA 4KRXA 3ZWYA 1QHGA 2DWCA 4ZZ1A 4Z4EA 3MTGA 3T52A 1PW7A 5BXQC 1MB3A 3CHYA 2PZFA 1EUYA 3W1EA 3RBAA 5EMLA 2C2HA 4XYBA 4B34A 3LS2A 4H16A 5BN5B 1DOZA 3H8WA 4LJ7A 3A1EA 4PO1A 1RQLA 2FR1A 4LDJA 4LRSB 5TY0A 3WKCA 3AOEC 3BH7A 4BNIA 3KZNA 1TEHA 3GLFE 4FEEA 4YAKA 1XN1A 2Q3DA 5HBGA 2X5NA 4L72A 5EP3A 2H4HA 1AV6A 3HK2A 4OQDA 4MGEA 1YZNA 3L07A 4RETA 3ETJA 10MHA 5DHRA 1THMA 4MP8A 4PXYA 3MOSA 5C8DA 5FOWA 2HPZA 3BWCA 3MILA 3FKJA 1K7SN 3W34A 4ADSG 4EABA 1IZ8A 5KSZA 4MUHA 2JVIA 1E9DA 3BRWD 4DNXA 1HFWA 3QBTA 5FOXA 2EJVA 3TLGB 4N3CA 8AT1A 3UGJA 1IOLA 4NG5A 4J1SA 4OO3A 5ULLA 1C1YA 2WD7A 3QVMA 2JBHA 4PYOA 1JHUA 1OLSB 3H1TA 2VDVE 2H2HA 1M8KA 3OJXA 5C1IA 2BFFB 2HA3A 4OHFA 2W2MA 2NOAA 1T6NA 4PHCA 5J5CA 1H5NA 1Y8QB 1Y1PA 2IX9A 1TM2A 3X3HA 1ZIXA 1FP6A 2H2AA 2AMJA 3GRYA 1YCHA 1DWQA 1Q95A 3PJDA 4QTZA 3CVJA 3FUXA 2PSFA 4MVXA 3C4VA 1IN4A 5EJ8A 1Q7EA 2CFSA 1V2HE 1JT9A 4B40A 4F3KA 1C4XA 4ZCPA 4EVRA 1B6TA 2XDQA 4DDHA 2R751 4YWJA 1B93A 1N9KA 2YJZA 4CF6A 1J42A 4XASA 4YIHA 4A91A 1ILWA 1JDTA 1XLVA 4NOJA 3WGTA 4MGIR 5DTRA 2DPGA 2GCOA 5IBCA 1PV4A 1CQWA 1AMOA 1VJ5A 4O5OA 5JU6A 1C7EA 2A0YA 4RDIA 2ZBVA 3TLEA 4ZJPA 1YZFA 3Q0IA 1MRZA 3KKQA 2VP9A 1ZHHA 4JLJA 3RUPA 4DIMA 4KUHA 1A82A 1M6YA 3RKSA 3OT1B 1QIKA 2W2PA 4CKCB 5LOVF 2ENUA 3DZ8A 5CX1A 1KZYC 4NDZA 3CLTD 2YFHA 4X6UA 5FUXA 3HG7A 4Q3NA 4GMFA 4EJ0A 2HQOA 3I6BA 3U49A 5JNRA 2RB5A 4FR2A 1FSZA 1ZK4A 1S8FA 3ER9A 4R2MA 3COVA 1OMOA 2WSMA 4ZARA 2YUIA 4TRRA 3JVIA 3T9EA 3UK0A 3FF1A 3RJ9A 3ML1A 1G63A 1XC7A 2PZGA 2Z08A 5J40A 3WBJA 1FFDA 4OMDA 4DC0A 3MTAA 5FJJA 3ETGA 1DX4A 1TXGA 3DW3X 2RGNC 3OFND 1YDGA 3GFBA 3V00A 3O9MA 1NY6A 3LC1O 4EHHA 3N70A 2GX6A 2G72A 2BGRA 1A5ZA 2HB6A 2LKCA 3FE2A 3WYAA 3NHFA 3ZXXA 1FXSA 5E6SB 4G2NA 4B9EA 2GCEA 1MHTA 2RH8A 4HDNB 121PA 2EG5A 4KNVA 2ZIXB 1TCAA 1E89A 5B1SA 4YDQA 2WF8A 1T3SA 3RO7A 2E18A 3GUCA 1ECFA 4JJ6A 3IOBA 1NVFA 4IUBS 4R81A 1HURA 4O4IB 2Q45A 3I39X 4PLFA 4OA8A 3RU2A 4E07A 5KO2A 2BTEA 3SQDA 3NEJA 3I2JA 3RGWS 4NF2A 4QLAA 1YDFA 1IU9A 3PGLA 4HEQA 1AN9A 1D2EA 4IRUB 3T7KA 3C1AA 3AHEA 1VZ2A 4EECA 3L77A 3TOSA 2DWUA 4EGSA 4G01B 4XZ3A 1MDBA 2BONA 2ECFA 4R54A 3RSZA 1HRDA 1TVCA 3O4JA 4TV8A 4BNMA 5KTPA 2P0AA 1XI2A 1GL7A 3ELWA 4NONA 5CA0B 5CG2A 2J33A 4CPDA 3A4TA 4JR0A 2IHKA 3E9DA 4RCVA 3KYCA 1BEUB 5CB4F 2BFPA 2JIQA 3L5KA 4R69A 4FNAA 1LRKA 3OCZA 4DSAA 3RC8A 4P3KA 3CSUA 1D7OA 1UPXA 2GTIA 2HOQA 1FNDA 3AERB 4MPDA 2FXIA 4BKPA 1H4TA 1NG1A 2R6JA 4P53A 1I01A 3I32A 1ZMBA 3L7OA 5JC1A 2AYZA 4Q18A 3KB6A 3N6RA 3PFNA 3RT7A 3BXOA 5F7ZA 3I8OA 4U7FA 2V7TA 3GQVA 4WEQA 2XOXA 4BNJA 1UJBA 1V37A 3FTQA 3R0ZA 2HIGA 4W7HA 5LXTA 1VYVA 2R7AA 3N7TA 4C6HA 4HQ0A 2VNKA 3THXB 3PFBA 1VCNA 1JJVA 4KV9A 5DYGA 3UMGA 1R16A 1RYFA 2FPGA 4EARA 2IBMA 1UQRA 4OGWA 3P5SA 1GZUA 5DI9A 2FI1A 5IAJA 2GKSA 5JTTA 3H5AA 5CIWA 4TTAA 3RKUA 4XJSA 3I5AA 3K05A 4E3WA 4C4OA 1R0KA 4YV2A 1A4IA 1N2BA 3AHGA 5G40A 3O7MA 4XFKA 1KYTA 3ST7A 1MABB 1C9EA 1O97C 4L1KA 1V8PA 3WGYA 4EK9A 2PUEA 3C3AA 2HDHA 1E6MA 3ELBA 3V4OA 3QKIA 4IUYA 3O1LA 5EWMA 1I1OA 1PJ2A 2ZSDA 5T3YA 1R0LA 2E1RA 1JB9A 1UZLA 4MWGA 1QCZA 3PC6A 4KITB 4J1TC 2FPPA 3R4VA 4DUPA 4JIMA 3B78A 1ND5A 1T26A 1E2LA 1I10A 2LPMA 3BILA 3SSNA 2JCYA 1F8XA 4AJNA 1GQRA 1HFJA 1UZAA 1KO5A 1ZJYA 3UICA 3WGMA 5FV4A 2QN3A 2C2YA 3RRYA 5DISB 3JZAA 4KPEC 2BFWA 2FB9A 1Z0FA 3PHHA 3RD5A 4ER5A 5ALNA 3T5PA 1AQJA 2O3UA 1H8EA 1G8SA 1FTSA 4J0GA 2GOYA 3EVGA 3QHAA 2A67A 1YMVA 4D56A 5EVJA 1T3HA 4W8GA 3M1AA 2FZKA 3ZHOA 4F6RA 4K3VA 3UBMA 4TKUA 3L4SO 3K3PA 4MSUA 3H18A 4FI3F 4TVKA 4QD3A 5M2QA 1II8B 3P94A 4H18A 3QITA 2YV2A 2F3TA 2WVAA 4OJTA 4M9QA 2YQ5A 5E4JA 4MULA 2I6XA 1F2VA 4ZDJA 2UYQA 1HDYA 2EJTA 1VIYA 1HL7A 2QRUA 2HQ1A 2CUZA 2VRCA 1T4BA 3DTVD 4OK6A 3MCZA 4YP7A 4BTVA 1VMEA 1YVRA 3FXAA 3O92A 5EL0A 4KIWA 5KVAA 1XYGA 1ODSA 4P32A 2QB5A 2XYPA 5D8DA 3RB8A 3GP8A 4ZOAA 1DV2A 3DBRA 2FK8A 4E5NA 1Z7WA 4JV5B 4RKRA 2XTNA 3CTPA 3VMMA 4DCSA 3MMPA 5KPJA 1PJAA 3TGWA 1QNFA 3UM9A 2C7VA 2X5XA 5AOVA 4P5DA 1OGJA 1UF9A 3QOWA 4XE5A 5CAEB 3A1VA 3GLSA 2QD2A 2GBCA 1XHFA 6CHYA 2J31A 4JHXA 4QELA 2DP4E 2GCNA 5C8ZA 4Y2VA 3LDAA 3FVWA 4AJLA 3KSUA 5JS7A 1P5RA 1NW5A 4AZTA 2L42A 4C7JA 3AKZA 2CFTA 1N5MA 1OZAA 1XG5A 4ZQFA 2MT9A 3MTJA 3RVKA 3AUAA 2ZYHA 3THYA 5AI0A 4TYNA 4Q3CA 2YWCA 4IQ4A 3PR1A 3I9V6 2EF1A 5H5JA 1TD1A 4UTVA 1BFUA 1VXOA 2RFLA 3LHFA 4BFXA 4AG5A 2BY4A 3H83A 2GZ3A 4RCYA 2J45A 3IV7A 3W8RA 1WXXA 5BP7A 1P0FA 2NU9A 2NZUG 2D0PB 3IPLA 2IYVA 3LLSA 5TQ0A 5ARCA 2BHSA 2PKRA 2Q6OA 5BUSA 1C3XA 3G2HA 5J1SB 4DPMA 2GAIA 4WN9B 3TUIC 1NUPA 3N7UA 5J43A 4DV4B 3SQNA 1SH7A 4AY2A 1NQVA 1SIBE 1N36B 3DVRX 4C01A 2O1WA 2WE8A 2LW7A 3AUKA 1KY2A 1ICIA 1Z5GA 1XTVA 4E1AA 3ICQB 2VSFA 1G21B 1GUBA 1O03A 4LYGA 4PBRA 1JEEA 2GZAA 1UT5A 2CLEB 2V7QA 1P3Y1 2BGJA 2EJBA 3CO5A 4NNPA 3TTUA 3UYKA 1L4YA 3BMCB 2BT4A 2JZNA 2OCAA 2GTPA 3ND5A 2VDNB 4TN5A 3BWEA 4PLCA 1N5LA 4NMHA 1T5HX 2PFGA 4LE1A 2IY8A 3UT5B 4EB8A 2DFVA 1F7VA 2UVPB 3NOOA 5F7XA 5IANA 2D1SA 2FQQA 4EMUA 2PMBA 2SHKA 2AFIB 2QY9A 1BXRA 4N3NA 2WFAA 3KTDA 1B8NA 1G98A 3COWA 3NH9A 4IOLA 3ZCRA 1EVQA 1PBNA 2O8CA 4P93A 4JCOA 4HGNA 1OTXA 1E2MA 1ZCJA 4MVJM 5ESWA 3UAXA 2AR0A 2HL6A 4EYSA 2CMGA 1J1UA 1NVBA 3LF1A 7ADHA 1U9YA 3OX2A 5IJ9A 1LKZA 3F7TA 1ZBDA 1SOAA 4L28A 3OLCX 1E1DA 3QXSA 1FZQA 3A8TA 4KIFA 5CHEA 5SZJA 5FUVA 4QG3A 2ZB2A 2MOKA 3IJRA 1PD0A 1G2PA 3LZ6A 4H6VA 8MHTA 1IBMB 3G17A 4HDKA 3Q88A 1LRJA 4KJZA 4QLBA 5CEFA 1X86B 1CZKA 3CVVA 5JRJA 1PI3A 1QF7A 4X91A 4MQ5A 1RC1A 1X7ZA 3DAYA 1AS3A 1XQ6A 4H15A 4JL8A 2JFYA 3GX1A 2V0NA 4P54A 1EAYA 4HVTA 2H85A 4YTEA 3PFHA 4MH0R 1VL6A 1DTWA 1SUIA 4QBHA 4DUGD 4FMDB 5CLGA 4PZ9A 2IV7A 4BZZA 4DDWA 1GTG1 1VHDA 2JIBA 5IJXA 2LCQA 3W9YA 1FVHA 2D5LA 1YUNA 4U2BA 5H0IA 2E0IA 5KC9A 4QFMA 4TVOA 3TW6A 5JAHA 4P2GA 4N0DA 1ODIA 1AQIA 3DO8A 3C3JA 3HB1A 4FFWA 1ZVQA 4B2PA 4B6FA 1SHLA 2QTLA 4HG2A 1NATA 4CLOA 1YZVA 1WUIS 4MVJE 1OOEA 4AN0A 3VNQA 2IOYA 2ONYA 3ID6C 4MUJA 5JNUA 2P35A 1ZCBA 2QSZA 5JYCA 3TW0A 4L2IA 2EX0A 2ARKA 4UTZA 4B4UA 2M6RA 1NM5C 3OH8A 3ZKAA 1IUNA 2AYYA 2IYFA 1UOQA 2HPAA 2ODWA 3DUWA 3PHCA 1N1DA 3P9IA 4UEOA 4DT1B 1N5KA 3WK7A 3STTA 1XZEA 3ET5A 4H7FA 1U2ZA 4MRRA 4WK0B 2ZYVX 5DXFA 4AWBA 2JF0A 3ZCVA 4ZZ2A 2BUBA 3SR3A 2PUWA 2QAJA 3DEIA 1J5XA 2LDBA 1M2HA 3OOEA 4Y2SA 2VS1A 5CURA 2ZS7A 4JH0A 3QE3A 3TEJA 3F1KA 1W73A 4FJ0A 3I4FA 4K2AA 3V2IA 4B80A 3PLNA 1IMJA 3L1JA 4LV5B 1PJQA 2FZGA 1ONBA 1OXVA 3IUSA 2YWEA 5F5XA 4WTOA 3HDYA 4Y6OA 2X58A 4LBYA 4YAJA 2IJGX 4OVKA 4AY3A 4BMYA 4ZXFA 3Q8WA 1NUTA 1Z8HA 3EIOA 3TDNA 3WDMA 2AFIA 4HFNA 2OMEA 4RMIA 4UUPA 3VKUA 4YP1A 1VMAA 5HZGA 1BCSA 2F90A 5LXTB 6AT1A 4MQBA 4MS4B 5DGHA 4QOSA 1X9GA 2C84A 4DR1B 4JI1B 1KR2A 4WESA 1OBCA 5A05A 4FMCB 1JDBC 1I30A 2XYHA 3JU3A 3MSXA 4HS4A 4P86A 1P2UA 1JI0A 4DNFA 3DFMA 2XEXA 4M6WA 4HDOB 3VJMA 2HR1A 4MV8A 1GFIA 2EU8A 1PTKA 3Q9LA 1U2DC 3L41A 2F3QA 2Z1NA 3A37A 4QYTA 2EKZA 4OOEA 1L9KA 1SXJA 2ILTA 3DP9A 2EKLA 3NIWA 2ZFUA 3BOSA 3PICA 1GT91 1WUJS 2UZ1A 3QLVA 4O8CA 4LSZA 5ILQA 3T4XA 4JXZA 3LUBA 2BMFA 2J3LA 3OQVA 1REQA 1G38A 1T10A 4HDAA 2HEIA 1Y3IA 1LSOA 5JNSA 4ZK2A 1RABA 1G6KA 4OMCA 3GVXA 4KZPA 3H05A 4MI6A 3FZGA 2WAYA 3SFVA 2I78A 1KL7A 2Y1CA 4YRTA 4LDAA 4X20B 4XJVA 4EGJA 4FYXA 4DV5B 1MQSA 1VGRA 2RHTA 2ACVA 4HQKA 4Y9UA 4C0LA 1PZEA 3IALA 3CM0A 2W8BB 4BYGA 3K9NA 5C1DA 2IYPA 1FUIA 2JK0A 4XWYA 1K6JA 5JCZA 5LWQA 3DS8A 1XDBA 1E2HA 3GZJA 5FF9A 3ENZA 2GYYA 3T0GA 1QCDA 2WSBA 1NXOA 3ZE9A 5ARBA 5TJ9A 1FFAA 1ZDMA 2J9XB 2XQKA 3GNQA 4LVCA 1J8DA 1XLUA 4U4AA 3F0TA 4GXQA 4CKYA 2D74A 1NYLA 2Y0BA 4G09A 3UQZA 2CMFA 3CF4A 1DO8A 4PAGA 3IE0A 2FX2A 3EHDA 1I6KA 4GPBA 3RARA 3SQWA 2P6RA 2GHTA 3AETB 2I8AA 4UFOA 1GCOA 1OV4A 4GBED 2AZTA 4Y6SA 2FG6C 1BFDA 5K8TA 4UDXX 3W5IA 4QOHA 3RYHA 3C3KA 1RT9A 2JI6A 3BEOA 4HLNA 4KSBA 4S1WA 4MITA 4UBOA 1A4XA 3LUKA 4TTJA 4MEAA 1AG9A 3A6JA 2RJNA 6ABPA 3A31A 2R4UA 1D4AA 3U0VA 3K9CA 3DQPA 4XVQA 4YMSA 3D43A 2NSHA 5IKEA 5LQKA 2N1BA 1PR4A 1XDGA 4ZT6A 1ZX1A 2AQ8A 3GXBA 3LK7A 1R5JA 1K8YB 3HKEB 4JLUA 4N39A 3TLGA 3JAMA 4JBGA 1MENA 2FRXA 1G7SA 1PSWA 2AN1A 2AN9A 3NFYA 3NGMA 4B43A 1ETUA 1IJFA 4AMUA 1HT3A 2VXOA 4OH7A 3FCEA 5H02A 3KETA 4CRWB 5CIYA 4IGEA 1WB6A 2WIBA 2Q3CA 3QFRA 4QYXA 5ESXA 3PPWA 4UOEA 3C98A 3P4UA 2G9NA 4F4CA 1CUCA 5J2UA 2P30A 4Q7LA 3DWIA 5LIPA 1IG3A 1P5JA 4DR4B 4Y0NA 3QSGA 3NEAA 1VCMA 4DR6B 1ISIA 2G5GX 4LHWA 1LLDA 4ODIA 5M3BA 5IHPA 4PAQA 1EK5A 2EJWA 2X22A 4HC4A 4KKVA 4RSGA 4NRDA 2HLHA 3KQYA 5TRTA 2JLWA 5DM4A 2XUZA 3HZRA 4I5GA 3KOMA 2ISQA 4JX9A 2GUWA 4BS9A 3BICA 4F2DA 1OLXA 4H4EA 3EGOA 3Q7TA 3SQLA 5HZHA 3U60B 5D7BA 4N4AA 5A62A 3ODPA 5CH3A 2P1RA 3IAS1 2I3ZA 5A5VA 1PK7A 4CIBA 2B1RA 1RRFA 1NMSA 4BJ1A 2FPRA 1UXIA 4N65A 3NOQA 1SOWA 4UC0A 4ZYLA 2H7VA 1GKUB 3M5WA 5K0FA 2DXIA 3F78A 1NMYA 4ZVNA 4CNBA 1A8UA 5GINE 4QBTA 1KQNA 1RHUA 4P38A 1RJ9A 2HRZA 5LLSA 1NBMA 1EMDA 1H6BA 1EQ2A 3W79A 1L8QA 1JHQA 1VKOA 2GRJA 3N0RA 4IQFA 4MR9B 4FFNA 2E9SA 3SJZA 1KEKA 4FNMA 4WADA 4D0SA 2EC5A 1CJMA 1WMAA 1TYCA 1IZ7A 2PRIA 2X7JA 5EHZA 1U0GA 4YAFA 4ZCIA 4I1SA 2X9QA 4NU8X 2VWGA 5AKGA 3LBYA 1PVDA 3KZKA 1P2FA 4W6ZA 2BHLA 3R76A 5EMKA 5K8CA 2FKNA 1P77A 3TZLA 1SVUA 3I01A 1I5OA 1BDBA 2FUCA 1N8NA 1Z83A 4F5DA 4TZ0A 2YINC 4PPNA 5JSYA 4NI5A 1Z56C 2L0XA 4RESA 5M04A 1JKJA 3S28A 2GILA 1JAIA 2ZXEA 4C14A 5AKKA 1DAHA 3QKUA 3GDOA 4U2GA 4WDRA 1T9GR 4OL9A 4QEZA 2FX3A 5JE8A 1Q0QA 1RBYA 2DLCX 1FX0A 4JP5A 3H13A 4W7IA 2R8EA 5EGSA 1RLUA 2X7HA 3D3JA 1J2JA 1J21A 4XLTA 2J5RA 2AJCA 5TR9A 4D82A 2GK7A 5D5QA 1B2RA 1P75A 2QN9A 3AUXA 5EKTA 2PYZA 2A57A 3UWOA 2RGRA 1GA1A 2X9GA 2FP3A 2C9DA 3P4XA 4G0ZA 3SM9A 2BFNA 2P6OA 3TRHA 3HI6A 4ZI7F 1YC2A 3O0TA 2QU8A 4W8HA 3IBCA 4FC7A 2CDCA 4B3FX 4EDFA 1RQXA 1JE0A 2H8GA 1B0AA 2IHVA 1A2KC 1TZMA 2F17A 4ZC1A 1AO0A 1ZM4A 2GBLC 5IEJA 2BJVA 3B9RA 1ADFA 3IUEA 1L4GA 3IRVA 2KMLA 4YPOA 3LK6A 4GX2A 4HDRA 1CVRA 5B55A 3X1ZA 4JJ8A 2CUKA 3I0MA 2FLVA 3IBSA 1OZGA 1ZP6A 3CEHA 1C5KA 1FA9A 2AEJA 3K20A 4P82A 1G41A 2WM9B 1HE5A 1VE9A 3WHPA 1CY0A 4PXSA 3JQ8B 4DY6A 4C0XA 2PR2A 3PQDA 2FF5A 3FNRA 3OCJA 4QO7A 4L73A 4GZ6A 1VLJA 4E32A 1ZAYA 1FFHA 2HMYB 4AJOA 1F3OA 1TC1A 3MFYA 3SM3A 1BMFA 4S2UA 3TFWA 3GD5A 3RQSA 2Z58A 1U7PA 3L4JA 4AECA 3VOTA 3OP4A 2HJWA 4QBKA 5B6JA 3FMIA 2H1FA 3KPVA 4HB3A 4DAOA 4V1CB 3TLZA 1RPTA 2CXHA 4MWCA 3Q5EA 1LA2A 2W8BA 1M8GA 2C5AA 1EP1B 1M2VA 2A5LA 3FNHA 3UUEA 3R4CA 3URMA 1TJ3A 2C5SA 3R09A 4HDKB 4B48A 4D9GA 5I7WA 1LI5A 1VPEA 3SHTA 1P3JA 3MTQA 4BLSA 1QYWA 5K8LA 2G1UA 1UMDB 4MQLA 5REQA 3S1SA 3GOQA 3WK4A 1UAAA 3QX3A 3HCAA 4EFLA 2H4WA 2RHHA 2WICA 5I8ZA 1E59A 5IK2A 1XTQA 2ZSUA 4LXTA 3S1LA 4AUNA 1AGRA 4LCBA 5JH7F 5B5SA 4D02A 3OZUA 1Y42X 2XZLA 4Y2JA 4EM6A 1EHYA 4EUHA 1O6BA 5KNCH 2C9ZA 1FFEA 2BM1A 3L1VA 1Y3HA 4Y3UA 4G2TA 5JYDA 4HL6A 3PXCX 3PQEA 3FPHA 4P7GA 1QGUA 4KQ6A 3V3TA 1LWOA 1SRQA 2GDZA 3G1UA 3KQPA 2XUFA 1UEXC 3MRVA 4BV3A 4FWTA 2CCKA 3GYBA 3DF7A 3VYTB 3IDAA 4POOA 2WR8A 4W4TA 2WWFA 1P1FA 5DM60 3EB9A 3SSOA 3E81A 3UMYA 3QTTA 5FI5A 2IH5A 1U02A 4IHQA 5T8KC 3G2NA 1KY5A 1RYDA 1T1RA 3PFFA 4NULA 3AKDA 5TQJA 4DJAA 3AR3A 2P5YA 2JLSA 4QATA 5AR1A 3CJQA 3KS9A 1V4VA 2OKGA 1NL3A 4PW0A 4DVJA 1BD3A 2B21A 2UYGA 4EMBA 1NBHA 1UEJA 3AGQA 3FAZA 4RPJA 4RXUA 2IXAA 1W30A 3KV1A 3MQFA 4IICA 2BRUA 3GLHE 4N12A 2O1SA 1YFJA 5IEBA 4QYIA 4Z1MD 1ZR2A 3KEMA 3ZHSA 4J2OA 7YASA 3DR3A 3REQA 4JUBA 5DOZA 1KWGA 2OORC 2N75A 2UV8A 1DIHA 3AR9A 3U3DA 4E7PA 1SPXA 2FCRA 3T3OA 4XVCA 1EVLA 3NONA 1O97D 2PX2A 1YS9A 2A9JA 4K1XA 5IUKC 2OYCA 2QZ9A 3ZD6A 5I9MA 4WRRA 1H4SA 2G82A 3E22B 4IHAA 1AY0A 1TZJA 3E3NA 1Y9AA 4II3A 3IKMB 3I4LA 3ZQJA 2E7ZA 3L84A 4RS3A 3RPEA 2UVPA 3ZTWA 5JJKA 2EJUA 1VP3A 3CNHA 4YIKA 3SS8A 4P84A 1X77A 2DUNA 2ZTMA 3FZNA 1EM8A 1T5IA 3FGPA 5CLFA 3BIOA 1WPGA 4HS9A 1MX3A 1WXQA 2EP8A 2NTEA 1GRRA 2DPXA 1TU3A 1XKXA 2ODTX 3A3YA 5KTRA 1T2CA 2VF4X 2COUA 3P0FA 3FDZA 3V8EA 3UT6A 4DNOA 1JDPA 1DJNA 4NBTA 1IUOA 4BNDA 5IVIA 4MCAA 3KL2A 3KQUA 4PO8A 2XWQA 5F1OA 3DDZX 3OO0A 4C4AA 1HETA 4WKBA 4EAAA 1R6TA 1FJ2A 4AMBA 4UUAA 2XZOA 5FOVA 3EGXA 4IDNA 3A4VA 3LO5A 4RA9B 3LW8A 1EI9A 2VTBB 3KIPA 2XQFA 3HXOA 4PBSA 2QXYA 2C95A 1IE3A 1W94A 3AH8A 3VV3A 1A71A 4EL0A 2YJ5A 4GBMA 4UBLA 4OQZA 3AESB 1E5LA 1IBRA 3FVQA 3OPVA 1YL5A 2L2QA 4QL3A 1YBAA 1RAFA 3M1LA 4NZYA 3VUFA 3ZLTA 5LPNA 4FZVA 1WF6A 1FW6A 4NOLA 4M86A 5FO0A 2GD0A 1V4NA 3Q0EA 5EKDA 1RVDA 3MYRA 3V4ZA 4D4GA 5KOJB 1ZA2A 1WG8A 5LR6A 4TLDA 1N32B 5JAPA 1WLYA 4IFEA 5CG1A 1N6IA 3FHTA 3GAMA 3AR6A 4XX0B 2B0JA 3GG9A 3GJQA 4WQMA 2CYCA 3N59A 3F3MA 1H5UA 2BYTA 1AKWA 2QRLA 2P67A 3OPQA 4RLQA 4Y9TA 5DV9A 4CQLB 3ZCPA 5DX8A 1IIRA 2ORED 4BB5A 3TGPA 5C4IA 4XIFA 3GLKA 4O5AA 3PC4A 3OTOB 2ZRHA 1VG0B 4YJ3F 1ZOPA 4BO3A 1QOPB 2P75A 2ZUBA 1WY5A 3K9LA 1X7GA 1L7AA 4OQLA 2ZT7A 5KJ6A 5FP0A 1OWOA 2PX0A 3STHA 1DDOA 3UK1A 2V4UA 4YP5A 5KSYA 2AG0A 2O3JA 4GR4A 4C03A 3D6AA 1L8OA 3GUHA 4FZ5A 3SHVA 3L6DA 4LOJA 2AMVA 2G80A 3R0IA 4DCVA 5H81A 1BH2A 3QWIA 1N2CA 1X1SA 4LYEA 3DMTA 3AG5A 3O8OB 4X65B 2RD2A 2IL1A 5F4BA 3NM4A 4G0QA 2HM7A 1GGKA 3T5CA 1NURA 2PZJA 3EXAA 3NHAA 3MT8A 5HEKA 3FCSB 5GADl 1Z74A 4GPZA 4HSGA 3JQDA 2HXYA 4X90A 1ZZEA 3JSAA 3VDRA 4ZI3A 3PV0A 1GTJ1 1EE2A 3DFZA 3Q7IA 1H8HA 2O23A 3HO6A 3P2YA 1ID8A 4URFA 1G5RA 1UKAA 1AK9A 3CY6A 3KVOA 3TW8A 2OHGA 3V8PA 3WJ7A 4PN3A 5CB4B 3K9FC 1E2BA 2I2CA 8OHMA 1JA9A 1FYVA 2QMEA 1W76A 2C3PA 3PB3A 4RTKA 3CKYA 3JQFA 4ZCSA 4EI2A 4CDGA 1M6HA 4ZHQA 5AVVA 4KGZA 1P0QA 1Z38A 3LCRA 2LZ0A 4ETWA 2D1QA 3DFFA 1LTKA 2Y1FA 4YDHB 2G71A 5GJCA 3RAPR 3RIGA 3Q87B 2P65A 2GAFA 3U5ZB 1TKCA 3D5EA 3GLQA 3KX2A 3VR0A 3PF8A 4BP8A 4RHXA 3ZWDA 1T36B 1WNTA 3TTXA 5E9QA 3D4LA 4JR1A 1JSZA 1PS0A 4HMQA 4C4SA 4B3IA 3MJHA 3KCQA 3FVVA 1PL8A 3BHMA 3EXHA 3B6IA 4G5QA 4MHOA 5CA0A 4X66B 2EBUA 1M0SA 1E5QA 4DA0A 2WD9A 1TUBB 1NMQA 3GMIA 2H2IA 4B85A 1YS7A 3P0RA 2JGNA 3N76A 5ALGA 4XX1A 3V8MA 3IEKA 1LJUA 1PUJA 4D4MA 3UWSA 1HNWB 3E84A 3PF9A 4NCKA 2Y6UA 3OWXA 2YHBA 4YJHB 3VDXA 3WWEA 2D8AA 5LP6C 1N6OA 2HEGA 3LPCA 5LJLA 1GRCA 2ZG6A 3MBIA 1KJZA 1U3GA 2J4DA 3HN6A 3LE8A 2JLVA 3TL2A 3EG9B 3NDBB 4KO8A 3VR6D 2VP5A 3KE9A 4GG1A 4G1VA 1BDIA 1M2EA 3TFQA 2VCEA 1RQNA 2QVCA 2R8PA 3WISA 1W6RA 4HX5A 1LF5A 3G2LA 1EUCB 1R2QA 1E3LA 1Z3IX 3M6AA 1G42A 4Y2GA 5JDCA 5KNCA 1JPJA 1WKBA 2N0SA 2WPDD 2VNJA 3ZH2A 5KYNA 2R7KA 1EUDB 1MOPA 1VA4A 3GAFA 4G0YA 4UEQA 5DLEA 1E9AA 5IF9A 2JFVA 4Q9IA 3EXFA 3M4XA 1T4CA 5K6AA 3TMYA 1TKRA 2Y1XA 4QU5A 1KQFA 1Q14A 3QM1A 1JHOA 1DKMA 1WP9A 1L4UA 1BMQA 5E9JA 3C3BA 4DQ0A 5FT9A 3DEZA 2GAOA 2YR0A 4PG4A 5CVJA 3VOAA 1B0ZA 4G1EB 2ZTHA 1N1EA 2GHRA 1BZYA 1V26A 1ABFA 1F51E 1TPZA 3JALB 3PIIA 3J80A 2IUFA 1WMBA 3ZVMA 3OTGA 2GESA 4MVJP 1SVSA 2REQB 3SSAA 4XWKA 2QG4A 3E22A 5DNDA 1QP8A 1FDUA 2NSJA 3R7WB 3GV0A 1YVDA 1KARA 3K6RA 4AN1A 5DGCA 2GJAA 2EFGA 3WQBA 4FE3A 1W93A 3EGEA 1NZFA 1QK5A 1GG5A 4ISBA 5LZ7A 5EY5B 3CQ9A 2RK3A 3O26A 2GAJA 3HLYA 3TXAA 1NTOA 4NK4A 4ZQGA 3CS3A 1CCWA 1EKXA 4A0RA 2GZHA 3KHSA 1L8XA 5K5EA 3NP7A 2XCLA 1NN5A 3QNWA 4MEJA 2TYSB 1E5XA 2C61A 3ZV7A 3LQ1A 1LBEA 3HGMA 4H6PA 2HDNB 2PGNA 3BEDA 1O3YA 3L7BA 5FYQA 5IM4A 2GM4A 3O2NA 3ZWOA 4IVPA 1NZJA 2ZW9A 4Y1RA 4DLPA 2PAFA 4YR9A 4GDFA 1U1DA 3W4IA 2XYGA 2G5CA 1BHSA 2PSHA 3RC1A 1N2CB 3BB3A 3CUTA 4ASUD 2ZJFA 2H7CA 3L7MA 1PQUA 3D8UA 4L8YA 1PS8A 1LDNA 2YHIA 3CRQA 2DFPA 2AN5A 1ZOSA 4LWPA 2PUCA 1OXXK 5KAPA 5ALHA 4NENA 3IHLA 5AYVA 1Y7IA 5EMMA 1S7CA 2UDPA 4INZA 3QV1A 4P4LA 2ZR0A 4G8CA 2YOFA 1DJQA 5LUBA 3PENA 2G4LA 1GD1O 1PFKA 3VC7A 4BB6A 1KIAA 2WE7A 2GN0A 4FT2A 1TJ4A 5DEIA 5JXHA 4TMFA 2C5LA 1QAOA 3NCTA 4GECA 1F4PA 1DOAA 1SD1A 1SFRA 2WUEA 4EW2A 1LVUA 1U6KA 5KQRA 5KHOC 2BMWA 1DKUA 1IHUA 1PF7E 1SG6A 1NVDA 1QGYA 1UK6A 2QUKA 4B6QA 4PSAA 1N6NA 1USIA 2DQKA 1BRMA 2NZ2A 2ZAMA 4V0RA 5JXJA 2NO9A 3ZGOA 5JYBA 2Q6VA 1YA4A 3AVTA 2LUOA 2R4TA 3CXUA 3EEIA 4JLDA 4EQ6A 4AB1A 4MEBA 3X2SA 5DMXA 2HMWA 3QSYA 3I53A 3GAAA 1CJCA 1UBHS 4CTMA 2P5TB 4PYNA 4QARA 5E6SA 3V1MA 4DM7A 1RM0A 1K8ZB 2ZJ1A 1PZFA 1XMJA 1RLOA 2PKEA 3QLEA 1T8SA 4PLTA 4RIEA 4JBHA 2Q3LA 2Q4DA 2HI0A 1COWD 2D2IA 3RVQA 5B7QA 4DN6A 4X6XA 4XWWA 1ZD8A 2OCIA 3HY6A 3LA6A 4PWYA 1ZVVA 5ADWA 1E8DA 2BI8A 1QK4A 3QXJA 4EMTA 3HVUA 3RAFC 3SI7A 1KKUA 3RVLA 4X94A 1HNNA 1GL9B 1D0SA 3RSLA 2XTZA 3PQCA 3LSYA 1M6VA 4PFSA 3IMEA 2QAGB 1XYVA 1Z7BA 4ND1A 8ADHA 3AOGA 4PZUA 2XSZD 2WMNB 1VHJA 1Y4UA 2VUSA 3RTAA 1M6WA 3EUEA 1UPAA 4KQXA 3WLRA 2NPIA 3VR6H 3LWNA 3V7UA 1Y6GA 3I73A 3IODA 3FOAA 3BA6A 2EGGA 3I6YA 1P7VA 3AK4A 3NM6B 4HX9A 5FWAA 4C3VA 3OTWA 5A4DA 3MTDA 3QU9A 3WGJA 1NBEA 4DLUA 4KQJA 4Y2PA 2BWJA 1RBZA 2ADMA 2PIAA 3G79A 1LC0A 1YZUA 1EFDN 1P1CA 5AW8A 4X63A 5JSHA 3BBLA 1B6SA 1QYXA 1A8HA 3R40A 5U1PA 4BRUA 3SVTA 4AWXA 2H1VA 2GCOB 1F3LA 4TMXA 3RUEA 1J0BA 1PUXA 1T3ZA 1UBTS 1DPFA 4IDBA 1PNVA 4LOAA 1V39A 3UWMA 2JI7A 2ZI4A 1U2RA 4P7FA 2NU8A 1UT8A 4YCMA 3L0OA 4QECA 4FJ1A 4DLXA 1U7TA 5ALLA 2JLAA 3U4IA 1UP6A 2X1MA 3C74A 2YQZA 5E1DA 1OW3B 5FD8A 4OKIA 4G25A 3VDQA 3R3VA 4A3SA 5FWXB 3FHCB 1DC5A 3LCUA 5KDOA 3T3HA 4E4TA 1E2PA 3CEAA 1PZGA 1E6UA 2HJRA 2K5UA 3D8SA 3IMGA 4FDVA 5H9WA 1G6OA 2HMSA 2IPNA 4BN0A 4YT5A 5GJVC 4JHLA 4K6MA 3AKYA 2KSQA 4KWEA 4V1CA 1W48A 1X19A 2BE9A 1M5UA 4PICA 5KKCA 1SBIA 1C30A 5D3ZA 1B3RA 4RD3A 2G28A 1D2HA 4ZGBA 9ATCA 2ADOA 1MAUA 1O87A 4UAJA 3LQKA 3SEFA 2G07A 3U39A 2QX4A 1KJNA 1RHQA 2BEVB 2CJXA 2YASA 4RE6A 2JKVA 2R68A 3OP1A 4WK4B 5KSPA 4MW5A 4NP6A 2JHGA 5E3HA 1Y4DE 3PNYA 3AGPA 3EF1A 2PX4A 4JELA 4U5XA 2BEWA 4J1TA 4TXHA 2IYZA 4DCUA 3HGQA 3WRXA 3K9BA 2AD5A 5JS6A 3I9LA 3HB0A 4R1QA 2E4XA 4BLPA 4BB9A 4CQJA 3VTZA 5JMTA 3CEJA 2CCGA 3AVXA 3R9XA 4B1FA 3K70D 4ZODA 3RG8A 3G2PA 4GVLA 5KB3A 1WHSB 2XA1A 3JQGA 2QD5A 4KR2A 2BTQA 2QR5A 1O6GA 4ZI7A 1H2AS 3WKDA 4EG6A 2QTTA 5DGDA 4JSRA 2BEUA 4FMCF 4E4YA 1GU1A 1T8YA 5DHPA 4UOZA 3T7IA 5DW0A 5F2EA 3RIYA 1MVOA 1YB7A 4ZTZB 1P5FA 3OZRA 3THWA 3DLBA 1WCYA 2VC2B 4N41A 1YQXA 1GKLA 5CFQA 1IB0A 3TH5A 4PZZA 1OIWA 4MV5A 3F6RA 3NEPX 1K5GA 4RK0A 4NZZA 3WHKA 1T9GS 3RS3A 4J07A 3I6QA 2W8ZA 3DZHA 4B09A 3PVSA 1SCUB 3GGDA 1G18A 1KBZA 1QGOA 4A0GA 1U5BA 1XHEA 3MGBA 2GJ8A 2AZXA 1ZJZA 3CLKA 3KUCA 3B8EA 4KCGA 4Z0HO 4WZAB 2FSPA 1O0BA 5IVHA 4X93A 5G3ZA 3BCRA 3GLTA 3ZI0A 1TMYA 3KOXA 1FSFA 2JGDB 3BE5A 2E87A 2VQ3A 1BNCA 3G8BA 3PD0A 1H66A 5BO5A 2EARA 2G40A 2W2QA 4OYHA 4D3XA 1GG2A 1H9BA 1U98A 2BOVA 3E9EA 3NHUA 4W9RA 1R8XA 5BSRA 3CMMA 2H31A 3LHIA 4KBFA 4CW7A 2ONZA 5L8VA 4PNPA 3CRZA 2NXWA 1ZVKA 2JJ1A 2ORVA 3A7DA 5JADA 4YPFA 1NDUA 2FSUA 1XNHA 1IXZA 2GN4A 2HADA 2WFZA 4ZTBA 1KK0A 3X1YA 1H69A 1RRVA 2FFJA 5I7AA 3WWCA 4F97A 5F35A 1M6EX 2AYXA 1GFSA 4FSXA 3AU9A 1VCOA 3PFWO 5DBEX 1TM7E 1QOZA 1G2OA 3KT0A 3F6EX 1WZCA 4MJXA 1PD1A 3TIFA 1BGVA 1YU6A 2WYIA 5LIRA 1DUVG 3ZGXA 2BBWA 2J3MA 3D2CA 1NQOA 4ALNA 5IAEA 2HN9A 4M1ZA 4UULA 2ID4A 4DMUB 1P31A 1FSPA 4LXUA 3WICA 1MAHA 1EPUA 4Q7MB 1NLYA 3WDKA 4A15A 4M8IA 9ABPA 5A0VA 4PRKA 2IRWA 5K0BA 1FNNA 3CA8A 2Q0XA 3D0QA 1GV0A 1B1CA 1QIDA 4FB5A 1BKYA 1VKHA 1N4DA 2IIBA 1GLNA 5HBRA 3RFVA 3ZPXA 4MVWA 4JKIA 5CDSA 2I2DA 2O2XA 2V7PA 3TVTA 5I48A 1ZRSA 3LTNC 3FCYA 2B8NA 4C88A 1MX1A 5BSMA 3FDIA 3FYDA 1NY5A 3NFRA 1ZIOA 4L75A 4EA8A 4EVQA 4I50F 1SKMA 3HY3A 1JEOA 2NU8B 1AB6A 4GPIB 2J9YB 2RMKA 3ZS8A 1O5OA 3I23A 4G84A 3SYTA 4DLNA 2YOHA 1YJ5A 5HCUA 4CDRA 1QC5B 3AHFA 4PTLA 3VU1A 1OX4A 3D7NA 3W8DA 1Q16A 4AURA 2O4UX 1Q44A 3W5VA 5L7YA 3LO8A 3FNQA 3VU3A 4PSUA 1VM6A 1PEKE 1R0XA 3GT0A 3IQDB 1UT6A 1Z37A 1FRNA 3JD2A 1T2AA 3K09A 5CLHA 5FORA 4ZC8A 3TNYA 4CM7A 4WBNA 3AQIA 3K4PA 2H3EA 4QUHA 4OGFA 4XM0A 4BQIA 5DHQA 2C8KA 1W25A 1E3WB 1UWKA 4LEIA 2Q1XA 4GOXA 4EFKA 3IESA 4D8YA 2Z2IA 3QF7A 4URUR 2HC9A 2C82A 2JGKA 3JR7A 5C3UA 5ER6A 5EIXA 2CBGA 2B6HA 3D6FA 5A06A 2OEPA 4TM8A 1EB9A 1EVKA 3PXAA 4NICA 1OV6A 2HCBA 2R1UA 3OQBA 3PYXA 4OP1A 4XEUA 1ZY2A 2ZYRA 2RGDA 3NBFA 1JR3D 4WUVA 2ORIA 4JXJA 1QHFA 3GVHA 4F4DA 1BA2A 3O84A 1WRBA 1QNLA 4JWKA 3MTIA 2DYKA 1XELA 3SYKA 2W6ZA 2ZSFA 4GP9A 4NATA 4WZAE 4ZT7A 2DUJA 5FR1A 1QORA 4BP1A 1UODA 4O3MA 2HA6A 1JR3E 3OQ6A 4EYGA 5E6RA 2NUPB 1M2WA 1A9SA 4CI0B 4YRSA 4QEDA 2J67A 4I99A 3PE3A 4MO9A 2V5VA 5BW5A 1RJFA 3WHIA 4AIIA 3PDJA 1H1TA 4KBGA 2IWRA 2ACEA 5DIZA 3QPBA 1OFUX 2JD0A 3GEGA 4JIGA 2XBUA 4PC2A 4I4IA 4ZEVA 2DC1A 4RJ2A 3F71A 1Q1ZA 3MCUA 5DU2A 1QU3A 3RU3A 4WN3A 1J2EA 1GZHB 4MDEA 4G86A 3M3PA 3BWXA 4RDCA 4C5BA 2ZJZA 1M7HA 1U04A 3MB5A 3B70A 4JSYA 3WG9A 3ZDFA 5EI5A 1IEXA 2YRXA 2B9EA 2JFPA 2IOHA 3GLIA 1EYZA 4YC7A 1O7JA 1CVIA 4CVNA 1RZRD 1GRQA 3PC7A 3VC1A 1TO1E 3CPSA 4O63O 3L05A 1MO3A 2WM2A 3HUDA 2ZT6A 3PNBA 4P4UA 1KRWA 1E7RA 3D7LA 4ZD6A 3BMXA 3DDUA 4RTQA 1CR1A 4BECA 5EYPA 5BURA 5IDXA 1R5BA 3O93A 1IIBA 3CB4A 1U9IA 1WHSA 2GM3A 3E7XA 4TMTA 2DH6A 1BS9A 1XMVA 2AVNA 1MO5A 2O3RA 2WIKA 1QAMA 4MKFA 4FZRA 1IK4A 1DCMA 2PFSA 3RC7A 1U8AA 4ZKEA 3E0QA 4JENA 1KMCA 5F21A 5TEWA 4P35A 1GZ6A 4IXWA 4NOKA 3PLAE 1UBFA 3HUTA 3BMQA 5DE3A 1AKNA 3IQHX 2P9ZA 3AHIA 3MT0A 4QC2A 1E3TA 3BKWA 4OBEA 4C43A 2JGRA 5ED4A 4URHA 2F4NA 4JBXA 3D8NA 3NAGA 2QAIA 4I46A 3SBDA 3BE8A 3VBCA 1FPMA 2QRJA 4D3ZA 4PGAA 1XP8A 2Z3ZA 2C2XA 3FYUA 2XRYA 4NQZA 1UEIA 1V8FA 4YRCA 1EXMA 2Y67A 1SXJB 4MHTA 3LQ4A 3OJLA 2CD9A 3I2FA 3LQ2A 2H17A 1DS6A 2W43A 2EGUA 5G0SA 1MIOB 1FDOA 2OK8A 2XE8A 3LDFA 3EVDA 1FYFA 4DVGA 5HRUA 1JIQA 1DEAA 1KSGA 2QVGA 2M2IA 4DDMA 1KZGB 5ITVA 2GJ9A 1N5OX 2BMVA 3TNJA 4QHTA 1RLJA 3UFBA 3UOWA 3BXPA 4B3BA 3W9SA 1Z4NA 4JLOA 3Q4GA 4PC7A 3DOHA 2ZE5A 4HNQA 2IW3A 2NZWA 3EFOB 4NJMA 3GFSA 4F3TA 1CRPA 3C7DB 3DMYA 3DTYA 1TECE 1Y1QA 4U7PB 1HZZC 4FINA 3ZX5A 3NJ4A 3PYLA 4PLVA 1HE8B 5SYAA 5JH7B 3BJRA 2NWQA 4BFTA 5JWRA 3MCVA 3OKFA 5T4HA 1PWYE 4AU1A 2BJWA 4EX7A 5K03A 2XODA 3U80A 2OHHA 1RLMA 4LHXA 4JDUA 3SC4A 3RBZA 2PSDA 4BZWA 3U56A 2WQ6A 2R47A 1NRWA 1A77A 1P74A 3KPJA 1EZZA 1BMFD 5IMBA 1AMNA 1XTKA 3ZDAA 2JFBA 1CUYA 4Y1RB 1OLXB 3VR5H 1Z6QA 5A03A 3RHZA 3PL1A 5D3MB 4MV7A 2A35A 3CLUD 2PQ2A 4MCIA 4WPGA 2DLDA 4LF4B 1UOEA 3L8YA 1QQTA 2R1VA 3DLAA 1HFKA 1XO1A 2AZDA 3AIKA 3LUGA 3ND6A 4K5QA 5A0FA 4OXKA 1B41A 5ETJA 2Q2QA 1KIFA 5IC5A 4B44A 1CR2A 1Y0BA 1Y37A 1OBOA 1ZN7A 4NBSA 3WJAA 3IV6A 1KJWA 4EW6A 5HIAA 1H9CA 3HCRA 1JHZA 5JMWA 4WWHA 3T7AA 3LMKA 3UUWA 5KUTA 2A5GA 1WE2A 2C4WA 2CFOA 2JJ2D 4S0ZA 3IAEA 4TS4A 2PN1A 3WMWA 1I6MA 4IIXA 2Q4RA 1YJ8A 1XZCA 2QTAA 1ZH6A 3A2NA 1LBIA 4FYVA 4PCUA 5ALFA 3ZHCA 3D5TA 2E3JA 4L9AA 4MA5A 2J30A 3E9YA 5CVUA 4DILA 5DW3A 1EGQA 3QZUA 4F84A 2FN7A 1NJ2A 3W6ZA 4GL2A 4E2ZA 4A5OA 3DP7A 3DE5X 4Q7JB 1E4EA 3QBEA 5IS2A 1QHNA 3VTFA 1XK6A 3MWEB 2J0EA 3VYRB 2M9MA 4YMLA 5HA5A 3OMXA 2ONCA 1HLPA 3HB5X 4PZ0A 5HFJA 1H9AA 3UMFA 3CVXA 1DXQA 2UKDA 3EXG1 3MWGA 2EYUA 4I5FA 3DDSA 4D97A 3KC2A 4DIFA 2EGHA 1EFHA 2FW9A 2WHQA 1Y5RA 3MJTA 5LDGA 3K1YA 2PZMA 1ML3A 3PR3A 3MGCA 4RY8A 4E09A 4QM7A 3WBBA 5TSDA 4YJGA 1PR0A 4UMVA 1MH9A 3TLMA 4IXMA 4CKZA 4IXDA 4NU0A 2XCSB 4ON9A 1ZG3A 2YXDA 3UHFA 4IMJB 1OBFO 2QAGC 4LJSA 1KS2A 5BWLA 1T15A 4TUYF 1FP4A 1ZESA 1UFQA 4GOMD 1R12A 1T2EA 3UJ7A 1W0CA 5CEJA 2WHRA 2Q9CA 2O2ZA 3VM6A 2Y68A 3EGIA 3TQFA 4EITA 3LD9A 5T64A 3KFXA 4KDRA 4KWCA 4RH0A 4EHJA 2SNIE 4NAHA 1YR9A 3FDZB 4FWIB 4J75A 2P9JA 3BORA 1FQWA 4XI9A 6GPBA 1JEYB 3CR3C 2JKYA 2APJA 1AF4A 3AINA 2Z5LA 1TVMA 2GKOA 3G2QA 3LV8A 4J8PA 1XRLA 4DJ5X 4F2GA 3S8YA 3H5TA 3KLMX 1YI0A 4OGLA 5EZ5A 1U0RA 4K87A 4ARAA 2CJWA 4B4DA 4DEVA 4MIOA 2G5PA 2CV1A 3HFRA 1NV8A 3P2MA 2RHBA 3UIEA 2VQFB 1QRTA 5DNVA 1NRXA 3UMVA 4XWOA 1BXGA 5CYGA 2IHNA 3WGHA 4JVLA 4OXRA 3O8LA 1Q20A 1EWKA 4R83A 1NBOA 4XOIA 2V03A 2TMGA 1LRLA 3G9TA 3R0VA 2I7CA 3A05A 1XJQA 5FUQA 3LBHA 1HE1C 1PS9A 5HGJA 1XN4A 5A9TA 4MOWA 1XMOB 4I6GA 4ZPJA 3DFKA 4EPWA 2IK8A 2JAWA 1L3BA 1VPLA 3EXG2 1ISPA 3PNVA 4BJ6A 4XVUA 1V41E 3B8HA 1SUEA 3PUYA 3BX1A 3NHBA 2OBYA 3IJEB 4MRMB 1O6ZA 2ASVA 3IQEA 1VMDA 4CEIA 3DV0A 1ZXBA 3KOYA 1A4UA 3QWHA 1WBJB 5IKOA 4IJVA 5BPFA 5IDQA 2PQ6A 1K2VN 3G8DA 5IU6A 4IO0A 2IPMA 3KOZA 3PXXA 1JHAA 2H8KA 3WXBA 1TCBA 4KQWA 3M4JA 4UTPA 2HA4A 3DXFA 1DXYA 2NO6A 1RXWA 3WV5A 3U4QA 4IZHA 3KWFA 4J16A 5FUYA 5A3JA 5HE8A 2BFEA 4I1IA 5ICSA 4MR7A 3U40A 2FXVA 2ZPUA 1TJNA 4GUAA 3TFOA 2QTFA 4YJFB 5CVDA 4G85A 4KQMA 2IEZA 3KQVA 3PHLA 4OSEA 3W2TA 1D9ZA 4Q16A 1U7DA 1JFLA 3LPNA 4E5VA 3LLVA 1P17A 3U7HB 2H1LA 2JHPA 1M8PA 1S2LA 1NOIA 4OQ4A 4NCBA 3DHVA 3FI0A 2ZT5A 5EXTA 1XWWA 4O0LA 4OHCA 4Q19A 2CYBA 2J3KA 4L7VA 4BX2A 3PUIA 621PA 1YFZA 2R60A 3BHNA 3E05A 5BSVA 1V9SA 3KLPX 3ZQ6A 2A5JA 4B8WA 4DBZA 3GUYA 5L3ZA 4I4TF 3MIIA 3GI1A 1XVIA 1RZUA 3KQWA 1NLUA 1YRYE 4UBKA 5LBIA 3L93A 1PG2A 2YY5A 2E49A 1EK1A 3V34A 4IKOA 5IPFA 4GKKB 1SZCA 1JJAA 4BMNA 2MYNA 1V43A 1HA3A 2HMAA 2D62A 4MW1A 4MHSA 1OIVA 3C14C 1QVZA 2I0FA 3CH5A 1AK1A 2HJHA 1T0HB 1A7JA 1QH1A 3HPRA 4ZV4A 3OO1A 5JCJD 4HLUC 2P9FA 1KAMA 3L49A 3M6MD 3TE6A 4F2WA 1QP4A 1TJYA 4YI3A 4WW0A 3BT7A 4JLWA 2V0CA 2UYHA 2YS7A 2AT1A 2YWJA 1S1MA 1XQ9A 2V98A 2VEDA 3DMGA 4M54A 4N7RA 4NEHB 4AI6A 1K7YA 1KI4A 1R15A 4YJ2B 3T7JA 2Q49A 3NOXA 2BELA 1CJBA 4O4HF 4UUNA 4Y6LA 3X1MA 1XQXA 1QSGA 1I24A 1Y6RA 2GEBA 4S2EA 4WXRA 1K8XB 1V8DA 2CL7X 3G8YA 2HV9A 4GZLA 3RFCA 4IIFA 2LBPA 4DR3B 3B5JA 3K0AB 5BSUA 3MAJA 5IDWA 1CHDA 3BF8A 4I8XA 4QT0A 1UDAA 1RXYA 3SZMA 3O82A 4KVFA 1N33B 2Y66A 5FWYA 2QRHA 4PZAA 3TQOA 2VDUE 2VPWA 2UZ0A 1CIVA 1RWNA 1NQWA 4R6XA 5JV5A 1IPFA 1BVUA 1E2FA 2X2FA 3HP7A 3K0CC 3PR2B 1GA6A 1UPCA 3QEKA 2KLBA 4M1WA 4E51A 1IN7A 1TVKB 4FGLA 4KYVA 4DYDA 1I51A 4P80A 1NP7A 1BQ4A 4FS3A 6YASA 1GDTA 3G9XA 1YDHA 2CHUA 4C6TB 4BWFB 3TI7A 2M6SA 2QQ0A 1XYYA 2AI2A 1T91A 2ZYSA 1RZRA 1ORIA 1Q17A 3WFZA 1V3TA 3IAM6 1PSDA 4PFJA 2PEZA 3QWFA 3PNPA 4R2HA 4H7IA 2FGKA 3NDRA 1EINA 4HGPA 1IUPA 1UQUA 4TWRA 1BYUA 1ONNA 1WV0A 4NDNE 1L1FA 4KE7A 5K8IA 2XCQA 1P0CA 1XGKA 4ROTA 4TTRA 3HYCA 2PMEA 5EP1A 1JYSA 2IEAA 5CX1B 3H7IA 1IVNA 5JAZA 3I2IA 3H97A 1JXOA 4IILA 2W93A 2OV3A 1OAOA 3KQHA 3HXMA 5AHKA 4C30A 2H1HA 1W8IA 2NXJA 2DKFA 4PSDA 5BQXA 4KK3A 4ZVMA 2AMFA 2D1TA 1P91A 5D1NA 1ESMA 4HWGA 4IGIA 5GP1A 3WMEA 4UBMA 3EOAI 3EQ6A 4HD8A 5EMJA 1VG9B 2BZ1A 2C96A 3RODA 3IQFA 4CKEB 1BOFA 3AL3A 1I0LA 3OQIB 2OB1A 4IBOA 4ARUA 4CIWA 4IRMA 5TMBA 2ZVJA 2XB8A 1CUSA 3B5IA 2FN4A 1Z8DA 4HR7A 1J8YF 4JFRA 3EIHA 3ZY5A 4B17A 4DPLA 3R75A