3HN8A

Crystal structure of synaptotagmin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
279
structure length
279
Chain Sequence
GAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptotagmin-3
publication title Molecular mechanism of the synaptotagmin-SNARE interaction in Ca2+-triggered vesicle fusion.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 47
structure length 279
sequence length 279
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3hn8A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3hn8A02
3MJWA 3APFA 5G2NA 4LDCA 5CCHE 2V4LA 1DJXA 3RPBA 3TL5A 4TUUA 3L54A 2K3HA 3DPDA 1E7VA 4BFRA 2WXFA 4LCVA 3FBKA 4LT7A 3RDJA 5CCJA 3L08A 3ZVVA 5CCGE 4FHJA 3IBEA 2DMGA 2RD0A 4FJZA 4JPSA 3L4CA 1E8ZA 4ICXA 1WFJA 2CHWA 5JHBA 1DSYA 4XZ4A 4G11A 1CJYA 1QASA 3APCA 3IM1A 2WXMA 3ML9A 4AOFA 3W57A 2NSQA 2FK9A 1DJGA 2Q3XA 2X38A 2K8MA 3F00A 3QARA 2WXKA 4PS8A 2BWQA 5JHAA 4WWOA 4QAMB 3R7RA 3R7QA 3QR1A 5KJ7E 4XE0A 5H4ZA 2WXNA 4OVUA 3TJPA 4QJ5B 2LHAA 1BYNA 3T8MA 1DJZA 4TS6A 2CM6A 3PYCA 4ANUA 2EP6A 4FADA 1YRKA 2A4ZA 1W15A 3OAWA 2WXHA 4L1LA 5T8IA 4L23A 1BCIA 4FJYA 3NSJA 1DJWA 2CJTA 2N1TE 4EZJA 3HN8A 2D8KA 2WXLA 2WXQA 4DK5A 4EZKA 1E90A 2YRBA 2WXGA 1DJHA 2YOAA 4NPJA 4URKA 1E8XA 2WXJA 2ENPA 3F01A 2CJSA 2CHZA 4GB9A 4V11A 3F05A 1BDYA 2WXPA 3APDA 3B7YA 4IHBA 4GNKB 2ISDA 3SD5A 4HVBA 1UOWA 2R83A 1RSYA 2K4AA 3L9BA 4Y1SA 3GPEA 4FULA 3CSFA 1TJMA 1W16A 2CHDA 3ENEA 3PFQA 4KZ0A 5G55A 2Q0ZX 1A25A 1HE8A 4MJJA 4NP9A 4NPKA 2ENQA 4F92B 3F04A 4EZLA 3L16A 4WWNA 2WXIA 4J6IA 3QJZA 4XX5A 2FJUB 4L2YA 4A55A 2ZKMX 2CM5A 3N5AA 1RLWA 2JQZA 1K5WA 1QATA 3CSTA 3PS6A 1E8YA 3QAQA 1UOVA 1E7UA 2NCEA 3L17A 4PS7A 2WXRA 3KWUA 4WWPA 3S2AA 4TV3A 2ENJA 2K45A 4NS0A 4F91B 3DBSA 3NZUA 5EDSA 1DJYA 4KZCA 2Y3AA 3FDWA 4WEEA 4ICWA 3ZIMA 2QZ5A 3ZW3A 4KITB 2A5UA 1E8WA 3PREA 4QJ4B 3ML8A 3PRZA 4L1BA 4F1SA 4ANVA 3L13A 3QR0A 2WXOA 3NZSA 4FA6A 1V27A 3HIZA 2CHXA 4FLHA 2NQ3A 3OHMB 1TJXA 4QJ3B 1UGKA 5H4YA 4F93B 4IQHA 3TWYA 4FHKA 3KWTA 1GMIA 1DJIA 3QK0A 2KI6A 4AJWA 2UZPA 3M7FB 3HHMA 3JZYA 2Z0UA 4ANXA 3W56A 4HLEA 4WAFA 3LJ3A 1RH8A 1WFMA 4PS3A 3P2BA 4DNLA 4BGDA 4Y1TA 2DMHA 1DQVA 2QZQA 4OVVA 2B3RA 4ANWA
chains in the Genus database with same CATH superfamily
3APFA 4LDCA 1KN4L 3U82B 1HL8A 1CQYA 5D1ZC 4PJBE 4U6YA 5L2KD 1G84A 3D08A 3N0AA 5F89B 4JZOB 5DVPA 3WXWH 4I2XA 4LOFA 3BAJA 3I6SA 4J27A 5ALCL 3T8VA 4NRXB 4JHAL 3EFOB 4BJLA 5CAYB 4DIXA 5EG6C 1RZ8B 3GBEA 5ITFB 3D25B 3NEEA 2IJ0C 5DUBA 1G9NH 1WZ1H 1MWAB 3T65B 4N90E 3GSXB 3SGKA 25C8L 1FWXA 2BW5A 2N1KA 2NY5C 2AQPA 4LLVB 1TR7A 4TOYL 3ZDZB 4DP0X 2PP7A 3FSAA 3EJYC 1DQMH 3AW5A 43C9A 1HJBC 2DQMA 5BJTA 3ZE1E 4I9WD 4MS6A 4XP9H 3GHEH 4H2CA 1A14L 2EINB 2HG5B 4LLUA 4LQFH 5CLXA 5GIRB 1X5JA 4G9FE 4L18A 1KC5L 5FS5A 2PTUA 4X98B 2I69A 3OPZL 4PJAF 2YGOA 3O6FC 1HHJB 1S7TB 5DVOA 4H4NA 4PCSA 4GSXA 4NZTH 5JIKA 3GBLA 5F0LB 1BX2B 1BWMA 3B7SA 4OF3A 2V9QA 3O6FA 3N1MC 4HD5A 1O5DT 5EOTA 2YEZB 3KEDA 1A7NL 4K9EL 3F05A 3QS2A 3KPMB 4PJ9D 4HVBA 4YR6B 3MRPA 4YSQA 3TX4A 2GSIB 4M6AA 1H6EA 4U1HB 4JCWA 1ZHBB 4UTCA 5F9JB 3VQ2C 4JMNA 3MR9A 1HHKA 3TCLB 4YHLL 3VCLB 2ENQA 2OI9C 1RU9L 2ZD0A 3HB3C 3HJ0A 4GW5A 1AR1D 4Z7UF 1GYCA 3ZT6A 4A55A 2R56H 3UP6A 1PX8A 5G5DA 2D3VA 3SDCD 4D3CH 1WITA 4N0RA 5I8EA 5I1LB 5LHDA 5EBWB 4G59C 2N7AA 1ADQH 1YEKL 3GMPB 4XGZA 4IM8A 4BH8A 1EAJA 4BZ1H 2HTLC 1PNCA 5HVFB 3H8NA 1N0XL 2XKNA 4TKWA 1AIZA 3DOHA 3QRGH 4JM2C 4OF5A 1T2QH 4EI5C 5F7LB 5HJGA 2ZOLA 5I76A 2JKWA 3FO1B 3QIUD 4NT6B 3SBRA 1E4HA 2CDGA 2Z8WC 3D3VE 1ZCRA 2Z31B 5L8JB 1BECA 4UILL 1JNJA 1EHNA 3BLPX 1XGUB 3RGVC 1BVKA 4NUJB 4UU9B 2UUDK 2Z4TA 5CM1A 2NR6A 1ZLUH 1ZT7A 1Y6MR 3W56A 2QQLL 3LN4B 5BRPA 2X0UA 4YSPA 1K5NB 1KBBA 4GG6E 2DMHA 5DJAB 4ANWA 2J5LC 1CGSL 1X5AA 1N5YH 1MHHB 1G6RB 4PJ9B 3UC0H 2XXCB 3WTUA 4LSRH 3IK2A 3RE0A 3WU1A 4TUUA 3A6CH 2GG1A 2JB5H 3DGGA 1KBGH 4FC3E 4XNZC 1DDTA 4YQXL 1CGUA 5KVDE 2OQJA 1LO4L 1UCBH 2WBXA 3N85H 4KXCA 5EBMA 5TK2A 3DVGA 2P44B 5A43C 1NMBL 4PGBB 2PPCA 1XGPA 5IROD 2H2PC 3ABMB 3UAEA 2D31A 4XNQB 1M53A 2A6KB 3D2UA 4MRCA 3BCDA 2OMVA 3GXTA 4D0DA 2IH3B 4LVHC 1G1YA 4L2LA 4CVXB 2TRHA 3V79C 2APSA 4PJXA 3LSOB 2IXQA 1S7QB 2FD6L 2XV6B 3BO8B 5DEGA 3VI4B 3Q3GB 4PWKA 2D03H 1C5DB 4ZK8A 1MVUB 3QIUB 2VDRL 3V52L 2HJKA 4JREB 3U6RB 4H13C 1SJHA 5IB5B 3FQ4A 2CA3A 4O2EA 4RGOL 3HZMA 1BCIA 1BQUA 2OM5A 5FM5M 2EUZA 5CWSA 3QWNA 3VXUA 4POYA 5B39G 5JNYB 3NVQA 1PLGH 4DO5A 3BWUC 4AE1A 2G9HA 4NJAH 1AI1H 1X9RA 4URKA 1U8JA 2CQVA 2WXJA 3BP7A 3CH8A 1YEIL 3GEFA 4P46D 4AE0A 4EOWH 2HLFC 2ITCA 4WFGD 4Y19A 4FULA 1EAQA 1TJMA 2A7BA 1DQJB 3MYJB 3G5ZB 1HE8A 1NUDA 3ARBA 4LSQH 2DZEA 4I13B 1R47A 5KANG 2BVYA 3K72B 4MMYA 3WFCL 5KW9L 1CD8A 2J4WH 4P2RB 3V5KB 5B22A 1TFPA 2ARJQ 3I3BA 3UADA 5FR3A 1HKLH 4ZS7L 4DEWA 4CVWA 3OC8A 5LKNA 3DNKA 5JXAH 3LV3B 3ARGC 3L95B 5F7WC 3UCRA 1N9PA 1KLFB 3DUUB 4H20H 2YD6A 1SXZA 5ESQA 2OMXA 1GJWA 1T20A 2Z4QA 4TQIA 5DSCA 4NRYB 2NY1D 3ARGA 1F02I 3BJ91 3KLAA 3V5HA 1MFCH 4OUUA 3J2PA 5I5IA 3CC1A 2XVKA 4B9ZA 3HMXH 3SDDA 2GCYB 4L4TA 2XA8H 1S3KL 1CDIA 2ZWLT 2VRKA 3MLSL 3T8XB 1VKXA 5C08A 2XV2A 1LD9B 1JZDC 1CR9H 1S78D 4BSVB 4Q9CA 4FFZH 1EGJA 1KLGB 4PS3A 1ET5A 3DIDA 4RGND 5HHPA 1BEYL 3PQYE 2UWEF 3ARDC 1H3VA 2W95A 1GGBL 2EDWA 3CE1A 4P46B 3F12B 3NCBB 3L3IA 4N0YL 2CLZA 3OSKA 3EFFA 1TLKA 1MDAA 4LNRB 1LO0L 5JUEL 3FQRA 1OAUH 5K39A 4ZSOB 2X9ZA 4I0PA 4L8SB 3F62A 5HGBB 1EEYB 4HCFA 2IANB 3QXVA 1PPIA 1D7FA 1JCKA 2V17H 5EZIL 3UGXA 1ZVYA 3DO4A 5SWSA 1F42A 3WDIA 5JXED 3KBPA 4LCWD 4A2FA 1CD1B 2R23B 1FN4B 3HB3B 4YDJB 2A9CA 4ODXA 2R69A 2XSKA 2HAZA 3JUZA 3ZKND 4M3KB 3TU6A 2XVGA 3DXAD 1FZOA 2BVTA 4MXWL 3WNJA 3T3MF 1CXLA 2WAQA 4HCIA 2E9IA 3ZUNC 4HUVA 1IIIA 2FLBT 3B9KA 1B0GB 4X5RA 5E8EB 2N1TE 3JV5A 1J1XH 4LVEA 4MZ2A 3UMNA 1UOKA 3EDKA 2VZ3A 4B50A 5JHLA 1DZ0A 2AQQA 3WKQA 4AENB 2B9AA 4B53A 4FRWA 5BZXA 4ABUA 5D1XE 5EC2B 1UM4L 4AG4H 4DPRA 5HJDA 4HMCA 2J7LA 3GMMB 2KKQA 1LK2B 5L4JA 4G82A 4WFED 4HJ0D 3UBXB 1L9NA 4EI0A 5JOPE 3HG1B 4UV4L 4FE9A 2WBKA 1EFXA 4NQSB 3RWJA 3V6BR 5DGRA 5KTEH 5IIEB 1MI5E 1AQHA 5F7DA 2F54A 5MENB 2VITB 32C2A 5I1DA 4HG4K 2JXMA 3KPSE 2Y06L 4Z0BH 3GRBA 1E2ZA 2YIHA 3FCTB 4JG0H 4LCWB 4CA4A 3L4TA 5JW5B 5LXVA 3K2IA 3IMWA 4JL1A 2GQHA 3SZ6A 4S1QL 8CGTA 3DX0A 3INUH 3OXSB 1WSST 3TYFB 3F65A 3TBTA 1J0ZA 2PWFA 5D55A 5ABZA 2ZOUA 2Q8BH 2G5UA 3EYVB 3BLBA 4OF6A 5FDWB 4FQHB 3TV8A 2G75B 3HC0B 5E4AA 5IFJB 4GUQA 3Q1SL 2WINA 3CFKB 2AF2A 3VFRA 4WNJA 4S10A 4ZMQA 3TNNB 3JZYA 3TIDB 4MAZA 1UASA 3LJ3A 4E42B 3KL5A 4MNGE 3DBXA 4HUWB 1IGYA 4G43B 1A7QL 1BZ7A 4LHUD 3EFDL 3CFJB 3RX7A 4WJKB 5EIVA 3VVWA 4N3TA 2PCFB 1GVIA 3BRGC 2YKKA 4GQRA 3MACH 3W2DL 2HVKA 2VDLL 5IQ7H 4HEPG 2D7QA 4YNYA 5D4JA 1RFDH 4PJ8D 4PJDA 3LQZA 4OGYL 2X28A 3QXAA 1UWYA 3MODL 1CT8B 1F4YH 3G08B 5EZJA 4NHUB 4JHUA 2KLSA 4DAGH 3DC0A 1L0XA 2YAFA 2XTJE 3WNPA 5FYKD 1JV2B 4N2DA 5BQ7B 4KPHL 4N5ED 4LMQE 4BK4A 1EVTC 3PV6A 3Q6FA 3O2WH 2MSPA 2JCCE 1KNOA 1KZQA 2Y24A 2QPDB 4PJBA 2XHNA 3GUFA 1CLCA 3NJXA 1FNSH 4Z7AA 1KMGA 2DWDA 1YNTA 3JTSB 1G7QB 4KGLA 5TDOA 5E6ZA 4E68A 5JORA 4QLRA 5DCCA 5T1MB 5BRQA 5GXBB 3L5WB 4GT0A 5IMOA 1RZIB 1J8HE 4YHOL 3GMNA 4RMTA 2W0PA 1BPVA 1N67A 5CD5D 2VKXA 2ICCA 1C5BL 4F7PB 4YHYC 4NQDE 4JUSA 1ORSB 3ZTCC 4AYSA 4G9FA 1C08A 4K5PA 4MD4A 2VXQH 1LO5A 1HHIB 2NY3B 3WY4A 4MA8H 3KYOA 4M62L 5C6TH 3DOIA 3VG9B 4F92B 1AC0A 4Z7NF 3F04A 3KYMB 3H53A 1SVCP 1XB6A 5E95B 5I19L 4CVUA 2AJYL 4DW2L 3FN0L 1JHKL 1I1AC 2OR9L 3RX9A 4B95C 4BQ9A 1AO7D 4FNRA 1G1KA 4KX7A 1E7UA 3CZFB 1EEZA 5DQ9A 4RAHA 5IM7B 2NY2B 3QDMB 4AWJC 3E8UH 1HNGA 2GEEA 3QXDA 4LSPL 5GZNA 5IUCA 3LQAL 1I1AA 2NRDA 2GBAA 3IDJB 3M6DA 2R0WL 4KITB 5T1KD 1OSEA 2NY7H 2UZXA 4PJ5A 1D6EB 4IBVA 3L13A 3IJHB 1PKOA 1NL0L 4QNPF 3A6BH 1ESOA 2R7EA 2UXFA 4XP4L 5E4EC 2NZ1A 3ISWA 3IETB 2Q7YB 4G8GE 2EYRB 4TQPA 2GEQA 4NRZA 1PFCA 5E51A 5GJSL 5AVTB 5JDSB 3S96A 3RVXC 2AP2A 2W9EH 1IAII 3GZQA 2YD4A 4FCAA 5DYOB 4BINA 3BH8A 1WP6A 3BSZA 5IB3A 1JV5B 1AGEB 2GBVA 4RQQA 4FLRA 4NQTA 1WIPA 5IGXL 1S3RA 1N8ZB 4TL4A 2Z7UA 4UMGA 3D3VA 4GUCA 3W5MA 1ETA1 4ODSL 1IM9A 5PCYA 1V54B 1M7IB 3KJ6H 5EU5A 1HXYA 5BMFL 5BV7C 3T71A 3NMEA 1ZDQA 2X3BA 3KHQA 4XNUL 4GAYB 4GG6A 4UAOC 5MP6L 4W68A 4UM8B 1MCFA 3GJFH 2IPKA 4DP6X 2WQRA 2BHUA 2PWGA 4OZ4A 1EO8H 4WSGA 2Y22A 3CN3A 3V4VL 1C12A 1Z7JA 4AYMC 3OG6B 2WWKO 4FXGA 5LDUA 1EHLL 4J3XA 5J6GA 2MKWA 4GO8A 1TETL 1JRHL 1FNGB 3PJNA 4GMSL 4WNSA 4N9GA 3RDTC 1T6WA 1T6BX 2XZZA 3CN4A 5HVGB 5C97A 2CH8A 2Z35B 4QTHA 1EBPA 2LU3A 4PREA 3STBA 2FEJA 3TVMC 1UB5B 4OBRA 1ZA3B 2XJLA 3VSVA 4QRPA 5F96L 2NZ9C 3RDTA 5BS0E 3U6XA 4PGEA 4N9OB 4MA3B 1UJ3C 5FW7A 5KS9B 4YLQT 2MHAB 4IS6A 1SNRA 4G6JH 4JK0D 1TZOA 4O2FA 3T2NL 5DLMH 1TJGH 1JZ8A 3EJPA 2NY6D 2A9NL 4YIQA 3NCXA 1H3PL 1LEKA 2V8LA 4KI5F 1HSAA 5BZDA 1DN0A 3DX7B 3EHBB 3K81A 2AZAA 2V9UA 1ZGLP 1I7ZB 1ZTXH 5HDBE 2JQAA 4H1LB 5KYXA 4I87A 2UYLB 1WGVA 1E6OL 2EDQA 2R0KL 4RDQF 2YARA 4LSTH 1LVEA 1E5YA 3JWOL 4DKDC 1CL7H 2F74B 3MRHA 5CBEA 1VGKB 2DTML 3MRRB 4DKAA 4BEIA 1ET8A 4OCWH 1IMHC 3RWCB 3EGDB 4TPRL 1ZXQA 4HH9B 2AC0A 5I0XA 1T1ZA 4TNEA 4KZCA 2GB2A 1S9YA 2Z65C 4X8JB 4QRUB 4HH8A 2XV3A 3HS0A 2LLNA 1IX2A 2KQNA 2WVVA 5JZ7C 5LQBH 1XTLA 1RIHL 1T5WA 1JI2A 5J5EA 1HXKA 3WO3B 3TZVD 3TGXA 3KWTA 4YUEH 15C8H 1BLIA 1UOLA 2DBLH 3I6GB 4JM0A 4NWUH 3FMGH 3MLZL 4Z77A 4QTIH 2Q86B 3HTLX 4DGUA 1WFMA 1DCLA 1UH3A 1ONQA 4Y2LA 3A21A 3B56A 3STLB 1U8KB 3IB4A 3EOTH 2CPCA 2WZPD 5FW6A 5GQBA 1WBXA 1KJVA 2PYEA 4YBQC 3LAFA 4MDJB 3FU6A 2YD8A 6FABL 1CK0L 4E41D 5IBLD 3DPDA 2UX6A 5D71H 3Q8EA 5FCUL 3RVTC 5CD3A 3O6KL 5EC1B 1KFAL 2VDMH 3NCYS 5GJTL 3P73A 3UC2A 1A4KB 3O9WC 5HHOE 3MBXH 3QZNA 4ZZKA 1JBJA 3O3BB 1G6VK 1EFQA 4UDUA 4D8PA 4LCIH 3CN1A 4JZJB 1E9QA 3SDAA 2Y4SA 1F1DA 1S7SB 1AGCB 2FK9A 4MX7B 4P04A 4QPEA 3PQYA 5KSAD 3X3GL 1A9BB 5F3BA 1VIWA 1AC6A 2QEJA 4XNYH 4FF9A 3VG0L 1PZDA 5FYLD 3ULVL 4HALA 2I07B 2VZVA 4CJ1A 1X5MA 2LHAA 1RZ7H 1NGZA 5DC4B 1FH5H 5KBLA 4KO5A 2F9BT 2WP3O 2O93L 1BJMA 5AALA 1DBML 1U41A 1JN6A 4NHCL 3B7TA 2ICES 4WO0A 3O3EB 4JGNA 1RSFA 2V7HB 3QDJD 5MERB 4X9YA 3Q9PA 4Z7WF 1QSEE 1WBYA 1I7TA 5H37G 4WZ9A 3HZYB 1PJWA 1FL5A 3IXTB 2NNFA 3FNKA 5DK0A 1WC7B 3ZKSD 1M2VA 4G8AC 2XWBA 4MTMA 3BPLB 2A9BA 4LKXA 3WL9A 2EE2A 3CLEL 1EUTA 2X4QA 2PW1A 3NACL 4NUPA 3B3IB 2AJUL 2ZONA 3NSXA 4MASA 6TAAA 5T3ZE 1KBWA 2J88L 2XXFA 1CXEA 1F4WL 4PGJA 1L7TH 1QBMH 5DS8B 3FB5B 4GSDH 4ZMXA 1PBYA 4K94H 2KERA 5A2AA 2XWJA 1AZBA 2E76C 5D1XA 3VW3H 1MFBH 3EBIA 4M48H 3NZUA 2H6OA 2P28B 3A4AA 3D18B 4XH2A 4XP6L 4JG5A 4ZNEE 1FGVL 2DDQL 3I6KB 4MAYC 1R3LB 2Y36H 1SMAA 5DMGC 3ULUL 1KEGH 3O2DA 2AKRA 3QJQB 5JHDB 2X4RA 5AWNH 2WLIA 3WENA 1MI5A 3HAEH 1E43A 5GHWH 1V3LA 3HG0A 4P3CH 3L45A 4MJIE 2TSBA 4HPHA 1KOAA 5H4YA 3KPSA 3QCUL 2WLLB 5I16A 3VRIA 1R46A 2CUAA 3QDJB 2DKUA 2UZPA 1GY1A 2DYRB 3W82A 4DN4L 3D69B 4ACTA 2X42A 4JKNA 2APTA 4BH7A 3CXDH 3HR5B 4OZGB 2IG2H 4AJVA 2NYYC 4GG8B 4DVRH 5D8JL 4DUVA 1MXGA 5B39A 4S1SH 1USQA 1DVYA 1SVBA 1UJ3B 5IMLB 2ZCKL 1J9CT 1JGVH 1E7VA 1PX3A 4LT7A 3TNMB 3QHZL 1QTPA 1UATA 1CE6B 1KPVB 4KQ4H 2IFFH 3L5HA 4OJDH 3EG9B 1DFXA 4JPSA 3WOVA 2CUHA 3SE4A 2BC4B 1DL7L 1ZGLM 5EORH 1KIUB 1QPKA 4AV0A 3QQ4A 4ZX4A 4JE4B 3T2PA 4MNGA 3V0GA 1SXCA 5AB9A 3ZR5A 1MJUL 4I4WA 4NQVB 4XBGA 5L9DL 5DRNB 1O7VA 4PJGB 5ICXA 2AV7B 1R5VA 4HHAB 3JT2A 1BYNA 1FFOB 3EGXA 4YC2C 1TU2A 2VLRD 5DJCB 2VN4A 2QQQA 5J56B 5AW5B 1QFPA 4ZOCA 4BHUA 4HK0A 1INEL 3BX7C 3RVUC 5I15L 3TA3D 5F21B 1MLBA 5EEXA 4F8TA 4M8QB 5K9OA 1OAYH 4LSUH 4M7JL 4E9LA 3PLYA 3ZDYE 4MAUL 4ZDHB 2X7LA 3A5VA 2JCCA 1O9ZA 2GT9A 1T5KA 5D4QA 4CDGC 1E27A 3FTUA 2FSEB 3GRWL 2BMKB 3HZKB 3CSFA 3OZ9L 2GKIA 1JNNL 3LHPL 4GKZB 4PRHD 4F2FA 3ARVA 2MWCA 3UBXI 4H0HB 2W0FB 4UINH 1AACA 4EMZA 5FUZL 2ED9A 4ORGB 4AIZA 1U3NA 4APXB 4GBXA 5AKVA 5F71A 1YUHB 1J8HA 3ZGIA 2B39A 3RPKA 3WEXA 1O6SA 2DLHA 1NKGA 5I1AA 3ETBF 1OP3H 1KV7A 4NQDA 4WI2A 4F57H 1OE1A 4GW4B 3WLWC 3KLHC 4IOFC 3V7AG 2PR9A 2VNCA 2XWZA 2A6DB 4G8IB 2VDOH 2X4NA 3GIZH 1EERB 5I71C 4YWGL 1UA7A 3MXVL 5E7BA 2YPLD 1KB5A 5J1TC 2NOYA 1RUKH 4WY7L 3S98A 2VLRB 3ALWA 1NLBL 1SY6L 3SO3C 5ISZE 1XMWA 2AHIA 1CFSB 2CIKB 3FHQA 1JF1B 3CH1B 3MUZ1 4XN9A 3EO9L 4MA1B 2QQKL 3TA3B 5BOJA 2PYFA 3BDBA 4FXLA 2E59A 1AY1H 3TA4D 5C0EB 2CDEA 2Y7OA 1D9KA 2V2XB 4NLHA 5EPMB 3QDGD 4PVNA 4Z7VB 5KVGH 4TYUA 3MRJA 2UY6A 2WKOA 5LGYA 3MUGA 4JKLA 4G80B 4X7FC 1CF8H 3BKML 1CFTB 1E4WL 5EU4A 2EEDA 3C2AL 4A6YH 4PB0H 4KK5C 2ALAA 3TBVB 1MREL 2P1YA 2ROXA 4W6XB 4U4BA 5C9JA 3LZNA 5HHQB 3KEHA 4G42B 3TBSA 3D9AH 4FMKA 4B60A 2R0LH 1QFOA 4PUBH 2ZOWA 3P3RA 4FN0A 4G8GA 3I6LE 4F2EA 4PV9B 5DJDB 3VXRD 1DSYA 1TCMA 2O5XH 1I9RL 3V9EA 4KJYB 1IB5A 3GSNH 4RFEB 1NANI 1PDKB 4EI6B 1BQRA 2P4AB 2H6PB 4F2MA 2XPGB 2JLLA 1FVDB 1IC5H 2R2EA 3TC9A 3WG7B 3CPUA 2HVJB 2LU4A 2R4RL 1MFAL 1JIBA 2JMRA 2YSSA 2IMMA 5DT1H 3HC4H 3LNGA 1LO2L 5CBAB 5ICYA 1HK6A 4CMMA 1URLA 4YSTA 4ZMVA 1RUAH 2A83A 2CMRH 4J7RA 1FSKC 1HXMB 5C70A 2XN1A 1BF5A 1W0WA 3WXWL 5DJXB 3VI3F 4BCYA 4C56E 2K0RA 3EYOB 2HTKC 4K3HA 4HKXB 1FFQA 1YY8A 5ALBH 2EEBA 4XXWA 3T9WA 1ZD6A 2ZX7A 4GI8A 1MCCA 3L4VA 1QSFB 5E4IA 1ZT4A 1W72L 3ESUF 1JMZA 2QT6A 2VDPB 1X9LA 2VSDA 4Y5XA 4L37A 4TVPD 3GLEA 4GNKB 4TF4A 5AVUB 4X6CF 4L8BA 1ECZA 2KZ1B 4K15A 1U91A 5I74C 3H9SD 1A25A 3GHEL 3MREB 2UX7A 2R1YA 2EEFA 4YEFA 2QSCL 1G7IA 5BRZB 3UZVA 4F37K 1JXKA 1L0YA 2CPUA 2BS9A 3DTDA 4QXTA 1NGWA 5HI5D 4QAWA 1CGXA 2AAVA 5GSRB 5BS0A 5CIPH 2DMKA 1DBBH 5INCB 2C9AA 3WCYA 9CGTA 2QDVA 4FL4C 4PVMA 1G7PB 3AXIA 5HYQA 2DB8A 1UXSB 5CGMA 1A7BA 2ZXWB 4JFFB 2LTQB 1I9IH 4OJAA 1A6PA 5HHMD 2B9BA 2EXTA 2VMDA 3APNA 2ZX9A 5TE7H 3RZCA 1CFQB 3FU8A 5E6SB 1CF1A 1T7WA 3TJHC 5I24A 5IBUG 1F2XK 4P4KD 4Q52A 1P1ZA 3GBDA 4KTDH 2OXGA 4OZHF 4MXQD 5DJZA 4DF9A 4DWHA 3I9IA 5KYNA 3O4LB 4I1PA 2EYSA 2NY0B 3OAZH 3IJEB 1HHGB 4XVTH 4D3CL 4HGWA 4OGXH 4PRAA 3L1EA 2ENYA 4GW1B 1RJLB 3EH3B 3DIVA 1KBPA 5J6SA 3ATDA 2WWMC 1FBIL 4JHBA 2AI0H 4BFOA 3L54A 2O61A 4M5YH 1XF2B 2LU7A 1SOXA 3RDJA 4BKLA 2HVBA 1EO5A 3OX8B 4E0RB 4U3HA 3VRJA 3OAUL 1I1FA 1T2QL 4PLOB 2FEDD 4L29A 4P07A 1KBVA 2VDNB 5JIIA 3DKHA 2UV3A 5D7HA 4M1GH 2NY4B 2M8XA 1IAKA 2XX0A 1ZV9A 3M17A 1SYSB 3P4MB 1E5AA 5I1IH 2BP8B 1KACB 1HEZB 2NSQA 3GSOA 3NIGB 5DA4A 1QX1A 2BY1A 3OJVC 5EFIB 2J25A 3AS2A 1Z1WA 1I1CA 3B2XA 1AQDB 3UTTD 5B38A 1N70A 4JJHA 3RHWF 3K6SA 5I1HH 3T6XA 3KBHE 2W92A 1ZK5A 4YZFF 3EF7A 3I3EA 4LSRL 2OL3A 3G9AB 1BFSA 4J28A 3A6CL 4HS3A 4LAJH 1Z9SA 5HHOA 4HJGB 3SODB 1OE2A 1YO4A 5JTWA 5FGBC 1UCBL 4JEGB 1EV2E 5ACZA 3HS9A 4HCRH 4QRQB 5C0DA 5DRXB 1AHWB 2ZUQC 1RD6A 1I8IB 2AJ3A 4Z3JA 3P0YH 2JELL 1UZ8B 2EDEA 4N2CA 4AUYA 4BFNA 5E8OA 4JM2F 4NIYE 1CFNB 4G71B 4HG4J 1IEBA 4NP9A 1YEFH 4NPKA 4GQ9H 1J0KA 7PCYA 1J12A 1ZV5A 2UVEA 4IMLA 1CXIA 5DVMA 4IKKA 3VNYA 3EOAB 4GY4A 5JIQA 3GSRA 3GZKA 5D7JB 5DRWB 1QSEA 3ZRSA 2GIYA 4DGIL 5FAAA 4RMQA 1A65A 4OCRL 1NINA 3KCPB 1Z66A 2UY7A 3NCYP 1KGXA 3C6EA 4F80A 3FDWA 1UWEH 3FQTB 1L3NA 3D0VA 4FFWC 1TG8A 3W9EB 2BNQE 4EOWL 2I27N 4LLAA 2B4CL 3L5IA 1RJYA 4FA8A 3EJZC 1LO3H 1DUZA 2ODIA 4DKTA 3QUMB 1NGQH 2DQFA 2HT4D 1KJ2H 5A40E 1QLEH 2J4WL 1M42A 3AB0B 1YY9C 4HAKA 5B7FA 4PWJA 2DLFH 1FAIH 4ZNEA 1KTKE 1MPAH 3RTQA 2O72A 2RB8A 3SDXE 2PXYC 5JXAL 3FO0L 4RISH 2WXFA 1FV1B 1VSCA 1WAEA 2EDBA 3WFBH 4JRYD 4MD5A 4MJIA 4JPWL 3K5RA 5KAQF 5LAXA 3VWJC 3R06A 3UBHA 1CICD 1V7NH 4F33A 3MXWH 4HKJA 5GGRB 4IGBD 4ICXA 4IRZA 5HDRA 1H3UA 5T1LB 5DDHA 1IKFH 4X8XA 3H2QA 5KSBA 2NXZC 3HC3L 1JGDB 3BWUF 2FVNA 2XA8L 1SLWA 5HDQH 2QPFA 2WQSA 5FOJA 1L9RA 4PAZA 4D9RE 2J5WA 2ZOTA 1CR9L 4QRFA 4FFZL 1A6AB 1NAMH 1I8KB 5HJBA 3VWKC 4U1MB 4QOKB 4Z3TA 2QKSA 4KRNA 4LNVA 4FL4B 2I9LB 2VLJD 2YEQA 2ZF9A 4WTWA 5EN2B 4JKKA 3L7FB 4QXGH 3MOAH 5BPPA 5IVNA 4JBSA 5MI0C 5JW4Q 3HN5A 3RWHB 3CIQA 3X12B 4P06A 1YNKH 1VJSA 4M4PA 1I1YB 4P49A 2R59A 3DMMB 2P24A 3DHUA 1AKPA 1TKWB 4N25A 1TXKA 3VXMD 5SV3A 5I2IA 1B6DA 4LAQH 2HFGL 3IAQA 4MVBC 4TTGA 2H26B 5IMMB 1NGYB 2CLVA 2DIAA 1R5WA 3DTXA 3HRPA 3FT3A 5TJWK 4EIBA 1G9ML 3NZ8B 5GZOD 2FBJL 2Y7NA 2W81C 3ECWA 1TMCB 4JRYB 4AJ0A 4ETQB 4NQEB 1CICB 1HQ4B 1ZHKB 2WSKA 1WIUA 1K2DA 1PG7H 4U3XA 1W8NA 3F7YB 4DESA 1J1XL 1XGTB 4WUKH 2LW3A 5F7DB 4J3WA 4M6OH 2YD9A 3X1NA 4FZEH 3IAGC 4LOUD 1EXHA 2JJTC 5EDXA 4RAUB 3G6DH 5DQDL 3TV3H 4R0LA 4PVBA 5J3HC 3OR6B 1I3UA 4WW2C 2HKAA 4XOCA 4X5XA 3QPQD 3M1BA 5KVMC 1Z5LB 1QHQA 4P5TD 4AQAA 3QWOB 5A2JH 4ELKB 2Y07H 3IMUA 4EQ2A 3VFUA 1A9EA 2R1XB 4Z0BL 3VXMB 5IB4A 4D0BA 1QNIA 1RULL 3INOA 2OMZB 1T03H 2VM9A 3INUL 4PJIE 4WO4C 2J8HA 3FU3A 1ILUA 5DMYA 3VFMB 5ISZA 2ZUQB 5K9QG 4YHZL 4DEPC 2H6UA 2YMXH 5H37A 1Y6KR 4AMWA 5LXGH 4NDMB 2GSGB 2VL5A 2D7NA 4Q58C 4DVBB 4J5VA 4G6FD 1E42A 1SOSA 3K8MA 2BSRB 3QPXL 4OGZA 2C3XA 3TEYA 4HC1L 4Z7QB 3B2VL 1S9WA 1ND0A 2YPKA 3QIWA 5IK3A 1WS8A 1CDCA 5AW7B 5JHAA 5E00A 3VXTA 3DETC 3RBSA 4YGAB 2J8UB 3TS8A 5DJ6A 3P4NA 2XOTA 3VFVA 2HRGA 3AGWA 3LKNB 1FZMA 3V4PL 5FECB 2FRGP 1CC3A 3BDXA 3JV0A 1R3KA 3MACL 5D5MB 4IBSA 3IDMA 1TZGL 2RTTA 2X0VA 3FT4B 5CINH 4BZ2A 2ZKXA 5IQ7L 3B9DA 1BAFL 4P5TB 4FQIH 4H25A 5EBGA 4DAGL 5JR1H 3LMJH 3FCGA 4F27A 5BVJA 3BUDA 2GSMB 5KOVC 2G5BB 3WKMH 1KT2A 1KIPA 5I0DA 3ENEA 2IMNA 4J12A 5KSUB 1KJMA 3UTPD 4HIXH 1XIWA 4C83A 2O5YL 3E2HC 2Y6SD 2Y72A 4L2YA 5BNXD 1RJCA 4E9WA 4C56A 1FNSL 4CADA 1I85C 1XMEB 2DQTL 4FG4A 1XL4A 1JPGA 5BV7H 4G6FB 4BFKA 2KZKA 3S37H 3GDBA 2ZUWA 3QUKA 1VZGA 5DJ0B 2OMYB 3PDOB 1TO5A 3N55A 4LARL 1A64A 4UT7L 4XN1A 3DX2A 5C0CE 4WI5A 4Y4HB 4UTBH 4X0NA 1YEDB 2EKSA 5E94B 3LVEA 2HX9A 4M8RA 3P54A 1N6QH 3KPNB 2WXOA 1HZHH 4CSSA 4MS8C 5DO8A 2VRAA 2VXQL 3U2SA 3LNDA 4MA8L 5C6TL 3AWEA 4WTQA 1SUJA 2WMPB 1CFVH 2V9RA 2XIIA 2CU9A 2VB5A 1DBKH 5E6ID 3DRQB 1BFTA 4YFDB 4PJBF 4UQCA 3SE9H 4G8EA 5J12B 4ABQA 3GIVA 5E1AA 5DUMH 1BEXA 1LEGB 4J3BA 5IV2B 4PY7A 3E8UL 3FONB 3T4AB 4OLEA 3DJZA 3Q5TA 2J6EH 5LBSA 2F8VA 3PV7A 5HBBA 4CMHB 2Y0SA 2NY7L 1YQ2A 4G6KH 4WWKB 1B2WL 3ZPDA 4GI6A 2Z7WA 2GJ6D 4NPYB 4F7TA 5LGHH 4KY1H 2ILLA 3RZWA 3A6BL 2ESVE 5E5MB 4HXBH 2DJSA 3NCEB 2C3VA 3REWA 3K6DA 3QIBC 1A4BA 4JQIA 4N8PA 2K8MA 3MLRH 1IBBA 3DJSA 5D2NB 4W9KC 5HYSB 5HJ3B 1Y0LB 3NCMA 4OT1L 2OJEA 4ZMTA 4EE2A 1OM9A 2W9EL 4AZ8B 1XH3A 3ARQA 4XAKD 1GOFA 5TQ2L 2HX8A 2IDSA 4MWFB 4WU5B 2GBTA 1AZZC 1AAJA 3ARXA 1RUPH 3MBEA 1JGIA 2OSLB 5EO1A 4YO0A 4Y8DC 4MLSA 1IVLA 4LRIA 5E6IB 3BJLA 3WIFB 2G2RB 1LP9E 4IU3B 5D2LE 4NQCE 3RL2B 5A2IH 3VO0A 1JZHA 2WOYA 3OC5A 4AYFA 5DFWH 5AOIA 1UCTA 4ESKA 4XC3H 5FLUA 2VSKB 1H0DA 3M46A 1QACA 1EO8L 1FNEB 1W2KT 4JJ5B 4KJWC 3ZMEA 4FNLH 5J9PB 1AS6A 2OMUA 4ZUTB 3UG5A 4G1EA 5I66B 2JKRM 1OLLA 2CO2A 4PLJD 4OFYD 2KLRA 3FCSB 5LGKA 1DQKA 1TVHA 3DIFB 4K5LA 1OD7A 4XPBH 3H7BB 1UACH 4JPKL 1BPLB 4ZT1A 1GS8A 4AQ1C 4NS0A 3BAXA 4WFFE 1KCRH 1XWVA 3KPOB 1DFBH 5GGSA 4G6JL 4GMTH 4Y4FC 1I8LC 1SFHA 2OCCB 5C0GB 5DLML 1TJGL 4WFHD 5TQ0H 4A7VA 1EANA 4PI2A 2H45A 1EEUA 3P4OA 3VX0A 4ZXBA 3IN2A 2ICEA 1RJZA 3WN5C 1ZTXL 1XCWA 4N0UB 4XOEA 3N9GL 3T4YB 2PCPB 3OSVA 4HJJH 2FGZA 1Y6NR 3QG6B 1NCTA 3Q01A 3S35X 1FZJA 2VWEE 3WJJC 3O6FD 5B3SB 4I1NB 4YXKH 1CL7L 1J7VR 3WHE0 4OLYH 4XRCA 5D7EA 1LK3L 2P5WD 3KJ4B 1IQWL 2B5IC 1J9SA 4Y2OB 3WTYA 4L8CB 4NO5B 4ELME 1UWXK 5E23A 5HVHB 2BNQA 8FABA 4U0RB 4OI8A 4K3DH 5FFOA 3KPPA 3UAJC 3DV6A 4LCVA 5KOMC 1WH0A 3OLIA 1MCQA 1TTCA 3HNVL 1E8ZA 3ZTJG 4OD1H 3UAAA 3OMIB 1HCVA 3GBMH 3SKMA 4NFBA 3C9NA 2VZSA 3GZPA 1IAIL 4LHQB 1MRFH 1BBDH 3VFPA 15C8L 2X38A 4NWUL 1ILSA 3FMGL 5DC2A 3T0EE 4ZFOA 4OLZH 4QTIL 3SDXA 43C9B 5BJTB 4NSKA 3QAZB 3GLDA 5AYTA 5IOPA 3KLDA 2HTLD 3ATBA 4AYBA 2WTRA 3HPLA 4BRJA 3QORC 3BQUC 3F7VA 2V5TA 2BY2A 2HWZH 3KWWB 2WW8A 3SY6A 1B4LA 3BPNC 4K8RD 4HWBA 4LCCA 4RFNB 4ADJA 2CJSA 5CFHA 3BQUA 2M83A 4WHYG 4XMLL 3RB5A 4P2OA 4ZFGL 2CHDA 3MRPB 3QWRA 3ARSA 4JHWL 1FCGA 3ARYA 4MB1A 4XNAA 4DERA 5AW3B 5E2WL 4HFWA 2WO2B 3MR9B 1HHKB 1MW3A 3PAVA 3D34A 5E6RB 1R3HA 3L1OH 4YDZA 1RZ7L 2ZKMX 4GW5B 4NERA 5CZVH 1D5MA 2Z6FA 2LT9A 2YGNA 5G5DB 5SWZE 4RWYH 4AUJA 3BP4A 3AT9A 5I8EB 3QRBA 3J7HA 2XQYG 5F0JB 1M1SA 3FAXA 5I75C 2YAQA 3GM8A 4XGZB 3MUHL 4BH8B 2B1OA 3R0MA 2XETA 3BAEL 3O3UN 1WYJA 1SJMA 1HHHA 2XKNB 3C08H 3W11D 5A2FA 4KK6D 4N8CH 2F5BH 1Q9OA 4PR5A 3OJ2C 3H42H 4MJ6A 2ZOLB 2DLIA 3QFGA 4OTXL 2XV0A 5HDOA 4XHQA 1HL4A 4ODHH 2CDGB 3S35L 5IW3A 3GD1C 2H3XC 3GTNA 1F3JA 3GSUA 4FHKA 3VXUD 3Q6GH 1JYNA 1L7TL 3OM3B 5F7KC 1QBML 2HT2C 4B0MB 1BVKB 1P0SE 4UBDC 3LS5H 1A0QL 2IOIA 4WJG3 5EOQH 2YAOA 2IV8A 4GSDL 3OQ3B 1F8TH 5EMYA 1MSPA 3SPJA 5KVFL 3NFPA 1BJ8A 3VW3L 4FQCL 3MROA 4HKZB 4A7QA 4XOAA 4Y19D 3OBAA 2C8NA 3LX9A 2CO6B 1E4KC 1F3DJ 4KMTH 2WK2A 5B1CA 3ULSA 4DJMA 1KEGL 2Y36L 3DGGB 3SBWA 5CCGE 3ARBD 5EHFA 4QY8A 2HLFD 3HFMH 4ZJ9A 4PS4H 4ZTEA 4GP4B 5AWNL 4MJ5B 4YZWA 5EBMB 2WYIA 3C60C 5GHWL 3DVGB 1NH6A 4ADIA 4IOSA 5E2JA 4P3CL 1XGPB 3ARFA 2WXMA 3W57A 4R5XA 3BUPA 3D2UB 4JQXC 2F8XC 5JO5A 3ZT5A 3K4AA 3EYFA 2OMVB 4D0DB 4YEEA 3L9YA 4PJIA 1N59A 3H56A 4PJXB 4NZDA 2IXQB 4ZRGA 3CXDL 3X1FA 1MCBA 2K6YA 2IQ9H 2DAVA 2YD5A 4JQXA 2QADC 5CEYB 1Q9WA 3RIFK 2IG2L 1ORQA 4XN7A 3ARGD 5AD0A 4HZ1A 3HUJB 1H8NA 3BZDA 4MZRA 1JGVL 3APMA 1FUNA 4TNVK 1SHSA 4O2EB 5KYYB 4IK7A 2YR3A 5ID0A 3HZMB 1AFVL 4L4TD 4Y5YB 3MOBH 4KQ4L 1ZLWH 5TF0A 4N2LA 2GJZA 5D1QC 5C08D 4NUGL 1S8DA 2B2XH 2DH2A 4K7PX 1GS7A 1KCVL 2G9HB 3HZVA 4NBYB 3U4EA 1U8JB 4OZFG 1K8IA 2CKNA 4YSEA 1IRAY 4AJYV 4NOBA 3TFKC 5KBKA 2ITCB 3OKEB 1XGQA 1YQVL 5DD0H 4RGMB 3NIFF 5DO2C 5FKAB 3QNXA 3WI9A 1TTAA 5K9KA 4J3OH 3ARBB 3ARDD 3SJVA 3QQ3B 2VL4A 4I0PD 5LBVA 2FGWL 3CFQA 4FZ8H 1IC1A 3GK8H 4MMYB 3N40F 1SLUA 1X6LA 2EZ0D 5K9JH 5SWSD 2O26U 3BXNA 3BISA 1IGCL 4LSUL 4M7KH 4YVNA 4MD0A 3F58H 3SCMC 5FWQA 1L9SA 4QIRA 3EJCA 4IRSC 3RPIA 2KDYA 5FPIA 3BKYH 5TTRA 1OARL 5ESQB 3RVWC 2OMXB 1T20B 5DSCB 3ZE0B 5FIEA 4XBMA 4JY4A 1Z2KA 3KLAB 3V5HB 1UGKA 4IRSA 1PIGA 4OUUB 3B9KD 2F8IA 3SDDB 4NO5A 1XCQB 4S11A 5JIMA 2BP5M 4YFLF 2D7MA 4E36A 3LNHA 4RGNE 1BV8A 1IM3A 1OXYA 1VKXB 1H5BC 1B6UA 1TZIA 5C0CA 5GRZA 5HPOA 2XZCL 4BIKA 2HFEB 4YS4A 4DZBA 2AEOA 4Y9BA 4K55A 4JFOB 4JFEE 4IIQC 2MKLC 3L3IB 2N56A 2CLZB 2K78A 4TUOA 2VDOL 3GIZL 3EFFB 2O5NA 3NSYA 3FQRB 1AD9A 2FDBP 5K39B 3RWEA 2F54D 1RUKL 4IIQA 3U36B 3LZPA 2YJLA 3CMOH 5SWSB 2ZOKA 1CU4L 4YL9A 1B4RA 4BQBA 3DXAE 1MY5A 1PTZA 4C55A 3F00A 4FLQA 1F0LA 4FG0A 5KVGL 2HG0A 1A7PL 5AVRB 4A7UA 3BAWA 3IN0A 2WXNA 2IQAA 3A22A 3WJLC 5KZCD 2X44D 1BVLA 1FZOB 2YPVL 2IDCA 4AEHH 1HOEA 5LO7A 1DLFL 4C4UA 1AQMA 2E9BA 4PB0L 1U2YA 4HUVB 3UZEC 1JVOA 2WXLA 1U30A 3B9KB 2ESVA 3L2LA 4WU7A 1KENH 5I1JH 4K7PL 1PF3A 2R0LL 5MEPB 2KZBA 4NC1C 4PUBL 3WDJA 4Q6KA 2ZZUT 1SJEA 2WKGA 3RWFA 3K71A 1M1XA 1TZHA 1FVCB 2ZNWA 4PW9A 1J5OL 2CKBH 1SHXA 4GEJA 1SEQH 2NUPA 3PFQA 1RY7B 1ZLEA 1IC5L 4FGMA 3RNKA 4Q9RH 1NUNB 5BO1H 2OPCA 3V95A 4XX5A 1EFXB 3HC4L 5DT1L 1V3MA 3RWJB 1SDDA 4PJEE 1MCDA 1RUAL 2WKOF 1QD0A 2CMRL 3GKWH 2YC1A 3C5ZB 4UB0H 3CSTA 4XXCA 32C2B 5CCKH 2D7OA 1OZUA 3H9YA 3ZKXB 1LP9A 1JZ6A 5DS1A 2JXMB 5D2LA 4NQCA 3BZEB 4X6DE 4NP4H 4A2GA 2GUYA 2IDFA 3E80A 3MV9B 4F91B 5FM8A 4Z3HA 1D7CA 1JGEA 1EUUA 1PIFA 4JO1H 5GISH 5KZCB 3BWAA 4OKVA 3TBTB 1T1WA 1M9SA 5LWYH 1NCIA 2C1PA 2WLMA 3IGFA 2ADJA 1SUHA 3OHMB 3OF6A 3HOGA 3KW8A 5GS0H 4XCFH 4U1GB 1T7ZA 4AM0A 4DTGL 4UQ2A 4YVUA 1P53A 2H2SD 1UQSA 2WINB 5L88H 5DEZA 3VFRB 1MFDH 5JYLA 1QI4A 5E8DH 1P5VA 5F7HA 4OAWA 4O58H 4YDLC 4KXDA 3EYUH 4D0CA 4E5XG 4NEHB 2AQNA 1I82A 3CFBA 3HVDA 5AW0B 4LEEA 1DBBL 3DBXB 2V33A 1BZ7B 4G9FD 4LEOA 2QGEA 5TPWH 2VDKB 4IMKA 3ZE2F 4BXVA 1CO1A 3GXUB 4S1DD 4NBXB 3KLKA 4KFMA 4X8GA 1I9IL 1JUFA 1NC2A 2VZTA 2HVKB 3HHSA 1YEGH 5TE7L 2O6DA 1OPGL 4KROC 5JHBA 4PJDB 3LQZB 4M7LL 2FEEL 3QXAB 1FG2A 2G2NA 5DD6A 1N3NA 2CCWA 1OO2A 2CRYA 1CCZA 1EJ6A 2VXVH 2DL9A 2FWLB 2QGDA 3NUKA 5A7BA 3NQIA 3WNIA 2BSDA 4PJ7E 4B9YA 2H32A 4NQUA 5GZND 5FGCB 3UTSE 4MQ7A 4ELMA 1I1AD 4XVTL 4DO4A 2FO1A 3Q6FB 4OGXL 1KNOB 4FTVA 1EJ8A 1Y1DA 3UTZA 3Q06A 4RMWA 5C0ND 4IOIA 4OM0H 4PJ5D 2AK4A 5IJVB 1X6NA 2AI0L 5JW4N 1TTFA 3X14A 2DWDB 3W37A 2ATPB 1YNTB 5TDOB 1N5AA 4HD9A 4ODVH 3FBQA 2XQBH 3N42B 2EUXA 4PP1C 3V2AR 3BYYA 2OTWA 3I75B 3GMNB 1ZHLB 4M1GL 5EUOF 5J6HB 3SGEI 5JPNA 3T0EA 3BT0A 1GSKA 4UQ9A 3JWNE 5I1IL 4NM4H 3ZE1B 2OULB 1WT5C 4JKMA 3ULUE 4YGVA 1Q72H 4M1CD 2DW5A 5HGDB 4G9FB 3NG5A 5CP3H 5FO9A 1WVZA 4MD4B 3H9HA 1OSPH 3L16A 4LPWA 3NFNA 4GINA 2DLGA 2ZWZA 3GPSA 1AO7E 3NGBB 4HZLA 5L8LB 4F9PC 3ZU8A 3N44B 4C4KO 4PS7A 2FJSA 2WXRA 2VERA 4M43H 4Y5VC 2YLHA 1EEZB 4HOXA 4XT1C 3JSSA 2A77H 3QXDB 3VA2C 1ECYA 2GUOB 1KCSH 4L1TA 3BSHA 2CSPA 1WTLA 3P0YL 2UZXB 3SDCA 3GS0A 2MPVA 4GAGL 3CZUB 4KZDH 4IBWA 1YEFL 3IDYC 2R7EB 3PNWB 2Y69B 5FKPA 4N20A 5SWZA 2IOOA 1GMIA 3VD2A 1EWHA 4HJUA 2CJ3A 4QRPD 2EDLA 4YHPA 4R3SB 2KL6A 1N2RA 1QO3B 4NRZB 5FYKL 3RDTD 2EH7H 1T0PB 2UXTA 2MH4A 2KZWA 3F5WB 4QHLA 3S96B 4FNPA 1YA5A 3P11L 5C3TA 3QEUA 2AJXL 3BH8B 2NZ9D 4P2QE 5IB3B 2K3HA 2OZ4H 5I6XC 4JMXA 3ZQ9A 4DQAA 2Z7YA 3G04A 1UM5H 3D3VB 2ID5A 3A4FA 1IM9B 2X2IA 3LIZH 4HF5H 5D4IA 2XICA 4LRNH 4PJAE 4CVZA 5EU5B 4ZMWA 3ABGA 1LO3L 4L8DA 1U3HA 3CVHA 3QUZC 1XF3A 4PG2A 1CURA 1NGQL 2RR3A 5L4MA 4GG6B 2J1XA 2AV1A 3IDNB 4F15C 3LNFA 2IPKB 2X9XA 5LAPA 4XCYA 1Z3GH 1OP4A 4OZ4B 4D9QE 3CLFH 3GI8H 4G9DB 4UZUA 1C12B 1FAIL 1PZBA 3QH3A 1ZANH 1UURA 1P4LA 2W94A 1I4FA 5IROA 4NUMA 3CU7A 5CEZH 2ADIA 4AQOA 1GIGH 5IP4A 1F6FB 1OW0A 2B1HH 3NP3A 4PREB 1TJIH 3WUWB 4HV8B 2I60H 3LRSA 4Z7UE 1YPZF 4GUOA 3KAAA 5JPMC 1MY7A 4HPOH 3SOBH 4YMPA 1UM6L 4YSUA 3PHOB 1IKFL 2C4FU 5JOFB 3B2UC 4IS6B 2FT8A 1T83C 5HDQL 4UT9L 5DFAA 2DM3A 4BWTA 4ES8A 2VTFA 5E2TL 3QJHA 3VM5A 4C59B 3VU1A 4CAGA 2PYED 3RKDD 1JFHA 3S3DB 4F7CA 5C1MB 2X6VA 1HSAB 1U8LA 1AANA 1E5UI 3BLKA 2P48B 3IGUA 1T83A 1CZ8L 3ILPB 1BLNA 3LQAC 3MZTA 1TDQA 3LKQB 3MOAL 5FHBH 1MCPL 2X4TA 2YUVA 1N12A 3MOQA 5F3FA 3G5XB 4PP2A 5CBEB 4NGHH 4YDMA 2X6MA 1U8PB 3E8VA 4TUJA 1II4E 3PQYD 3O9WD 1H15A 4ZUUB 3TTYA 1ZSDA 1V7MH 2FX9H 3OAYK 2A5UA 1T1ZB 3QZLA 3MNZA 4R2GC 3RWGA 5EU6E 4EUPG 3P2DA 5F7EH 2PW2A 1CDJA 1KGIA 3HS0B 4X6BB 4EIUA 5KSBF 2QKIA 3FQNA 2WVVB 3X11A 5IREA 4V33A 4KH9A 1DQTA 4XB7A 1EHKB 3EYSH 2OA9A 5CO1A 1AIFA 3UGUA 3MX0A 3EUUA 1CBJA 1EHXA 3MLUH 1PCXA 4X9FA 1PG7L 3CTTA 3FFCE 1ONQB 2ZXDA 3MKGA 3BPOC 2H1LM 4M6OL 2BFVL 5JIDA 4IBLT 3SQOH 3S37X 5F70A 3I9AA 1WBXB 1KJVB 3PGFH 2RFXA 5EZPA 3U1SH 3NH7L 1WDAA 3G6DL 2JJSA 2LVCA 4G7YH 3IBEA 5IWLC 3TV3L 4KKLC 2H47C 4JZNA 3LXBA 1FFPA 2Q6WA 3DV4A 5CD3B 4Y7MA 4L4VD 4IU2A 3P73B 4YE0A 5ICZA 1QR1A 2CK0H 3AQDA 1NEPA 5I6PA 1RIVL 3CDYA 2JKSA 4UDUB 5ANME 4AT6A 4D8PB 4KGJA 5D1XD 3SDAB 3WAKA 1E9QB 5JMRA 3V4VA 1SXSA 2BWQA 5AW2B 3PQYB 1UWFA 5F3BB 3CUPA 1MNNA 1Q0XH 2AQRA 4JFEA 3SPVB 5KVEH 4GJTB 5ITBH 5JOPD 1VCBC 2C9PA 1NUFA 1EAPA 4PD4K 1NGZB 1YJDH 4HLJA 2VUOA 1MI5D 2WBJC 5DURD 5JXEA 5IVZA 2R29L 4Z76B 3GUTA 4MAYD 2CIIA 1OGAD 2BP0A 5EUKB 1VERA 1DQDH 3KPSD 5LXGL 2G2PA 5B1JC 3WNKA 2BY3A 5I26A 5IF0A 1ZVSB 4MBRA 4XNDA 5C8JA 5TD4A 1WBYB 3VSQA 1I7TB 1BOGA 3FB8A 3FT0A 4B6ZA 5B1JA 1HVXA 5T5FA 5DK0B 3JWOC 3ZIYA 3NP4A 3MVSA 1A3LL 1PYWA 3O3AA 1M2VB 4R4BB 1YEHH 2XWBB 2D9CA 4WW2F 4HOMA 4WV1A 4LKXB 2JCWA 3WL9B 1H6UA 2K7PA 2X4QB 2YMTA 1U92A 4EDWH 3BDYH 3CZLA 4R97C 4X7EC 2FX8H 5CNHA 3FO9B 3TOPA 3SY0A 1YLBB 2J12B 3WDHA 4MMXA 4AV5A 1F86A 2XWJB 4P5RA 1HC1A 5D1XB 2VXTL 1F6AA 4FQIL 4G8FA 2KPNA 2QZ5A 5DF0A 5T5NG 5D9SA 4XH2B 5A3ID 3SGJC 1FFRA 5JR1L 1MCSA 1RP8A 2UWEE 3BIAX 3FYIB 4N6QA 5D70H 1TPXB 1XO8A 2AKRB 3WKML 5CEXA 3FUDA 2WVSA 1LILA 2WLIB 4PJEA 1MI5B 5DURB 4N8VG 2N01B 3MV11 2DWSA 5J06A 4XNMA 2TSAA 4GRLA 3TH4T 3KPSB 5AKTA 1U8OA 2AANA 4X6DA 3WIHA 2XTJD 3IRZA 2HH0H 3VRIB 1HINH 1FC2D 5I16B 4KY2A 5E8PA 5BV7L 3H6AA 3RVUD 4KKBC 3FRPA 3S37L 2OBGA 5FYLL 1B3JA 1P5UC 4CNIA 2VW6A 1QBLH 4MJ2A 1X5FA 5JIPA 5SX4I 1OSYA 1CDBA 3U0PA 4UTBL 1KYOK 4Q8BA 5DZNA 4MDIA 3T3ME 5DVKA 1N6QL 1NKRA 1BQLH 1ETZA 4OZFA 3ULVC 4GBXD 1OGSA 4MCZA 1J8HD 3QI9A 5AYUL 1XGYH 5T33H 1J1PH 1CFVL 4IDJL 1QSZA 2V8MA 3QQ4B 1AQ8A 1KWKA 1DBKL 2P3YA 1A21A 2PPEA 4F8NA 4MNGB 3SE9L 3ZXAC 1CLZL 2DS4A 4B41A 5JW3H 4K4KA 1BXXA 1WZKA 3OKDA 3K80A 4I4WB 4K73A 4HUXA 3T0XA 4P0DA 4PJ8A 1R5VB 5ICXB 3ZZ1A 2EH8H 3EGXB 2ZUSA 1VFAA 3CFDA 1TU2B 4HT1H 1NTDA 2J6EL 4IOFD 4L23A 2EDYA 1U3YA 4A39A 1DVSA 3POHA 3IJYA 4KJQC 4H8PA 4G6KL 2YKLL 1SYVA 3BWSA 4TLSA 1MLBB 5AVXB 4NPJA 5GGTH 2WKLA 4GKOA 2XTJB 1D9KD 4RAVA 4PJ7A 3UTSA 1T0MA 3RILA 4R4ND 3ARRA 2C7UA 5GS1B 2JCCB 1IC4H 2GT9B 2IDUA 1GHFH 4R5TA 2ZKHL 3T77A 2F7PA 3MLRL 2X2UA 1G0XA 2EXYD 3Q5OA 2FL5A 5GRYA 3TPKA 1MCOH 1GAFH 1S9XA 4KO7A 2WXIA 3QZBA 1JNLH 1X9QA 3AQXA 3BP6A 4XC1H 1NFDE 1MIMH 1KGCE 2BOCA 3VXPA 4KK5D 3QNYA 4G8GD 1E8YA 4GBXB 1F58H 2WZ6A 4B7LA 1JZ4A 1J8HB 4JRXD 1FNHA 5GRJH 3CZGA 3KYKH 4ONHB 3QEQB 3WEXB 1O6SB 1NMAL 1XL6A 3GI9L 3DO3A 5I1AB 4NQDB 2YPLE 2YUZA 3GXMA 2PO6C 1OD9A 3PPEA 2X4NB 4FQ2H 1IC7H 3Q2VA 4GO9A 3DTUB 3QP3A 1KB5B 1L7IL 4LB8A 1OANA 4FA6A 1IKOP 4O51A 1AO7A 3KVDD 3RURA 1IIKA 2F2HA 4FNLL 4QRTA 3FL7A 3QDGE 5DRZA 1JZIA 1P4IL 2XBTA 5D7IF 4DFHA 1OAXL 2PYFB 3UXFA 2CDEB 5FC9A 3JVFC 1D9KB 4XPBL 2JWYA 1MNUL 4WGVB 2ICWA 2BIMA 3MRJB 4U3SA 1UACL 2UY6B 2P5EE 3QXTA 5DZJA 2H1PL 2HTKD 1T22B 3MUGB 1A6VH 2EXWD 3BFQG 5EU4B 1KCRL 3DROA 2MCMA 4HS6A 4NX0A 4TLUA 2XLLA 3MAWA 5EV7A 3EF4A 5T3XH 3B5TA 4ODUA 1MIEL 1QEWA 5F1NA 3TBSB 3KWVA 2DPKA 4ZTPH 3VXRE 3TURA 1P69B 1CGTA 2J21A 3AREC 4ERSH 5C0FA 4RH4A 5TF1H 2W5PA 1NCDH 2VT0A 4HJTA 4BUQA 3P9WB 5AQ0A 4CGUB 5BS0D 3ISYA 4KQ0A 2LOEA 4H8HA 1WAAF 2ERJB 3CPLA 2ZCLH 3SHSA 2X12A 3H6JA 1VACA 3AREA 5B8CC 1BSIA 4P2QA 4YXKL 1KELH 4AH2A 1BW8A 5HHNA 4OLYL 1KCKA 2R2EB 1KXTB 3ROLB 4Y1AD 1E4JA 2YEVB 3OHXA 3WGVB 1DVFA 2YSSB 5C09E 4FADA 5ICYB 5D6DC 4CMMB 2MOQA 4K3DL 2A83B 1ZLUK 2R2CA 4Z9KB 4UYQA 1OAZH 4PJAA 1EXUA 2COQA 1P4BL 4C47A 5FK9A 1X5KA 2A0LD 2BNRD 1VB9A 4XVJH 4Z7NE 2GTWA 1FF5A 3WGUB 1O9VA 4UV7H 5CN3A 4DT2A 1QG3A 4JFZL 4NAMA 1FL3B 4FXKC 1ZT4B 3ME0A 5ANHA 3MRNA 5ALCH 3EUDA 2CUMA 5CJXC 3H9SE 5DHYA 3IJ9A 4Y5XB 1WD8A 1BBDL 4JHAH 2Z92B 3VXSE 4OLZL 1U91B 3MRCA 4PGDB 1TVDA 4R7DA 4TOYH 1FIGL 1ES0A 4ZUVA 1CMOA 2XWXA 2R1YB 3QYCA 5KEZA 3PWVB 3UZVB 1JD9A 1CYWA 2M2DA 1OAKL 3GXNA 4Z7UA 4DKFH 1ACZA 1NGWB 5DFTA 4Q7DA 3BYTA 4NLAA 5BS0B 2HWZL 1KC5H 2VDPL 4PJHF 3OPZH 4J4PA 4ZI8A 1QFWH 1C5CH 4C4BA 5HHME 4CBPA 3NIDF 2D7TH 2PUQT 3L3OA 1HAWA 4K5MA 4OQTH 4TNWF 5HDBB 1OCCB 2BM3A 3CGTA 3OKMA 4IEFA 3RZCB 4A2LA 3HIZA 3MCKA 4PN6A 1MKFA 2JI3A 5I1KL 1F3RB 3MNVA 2XWEA 3STZA 4AEIH 3L1OL 3FHEA 4NJ9H 1P1ZB 4BE5A 2OXGB 3CHSA 4KKRA 5DJZB 1H6FA 5CZVL 2OMBA 3H3BC 2LAGB 2EYSB 4Z7IA 2NTSP 4ALAC 1IAOA 4HGWB 4PRAB 4FLOA 1RU9H 2O6FA 2E7LC 1U95B 3FU9A 5EU6A 2R0ZH 1BVNP 4L1DA 4PYGA 2CG9X 2O61B 1RPQA 1ZPLA 3TZVA 3BUTA 2RCSH 3C08L 4BKLB 4N8CL 1EDHA 3CMGA 3UBGA 1NWOA 1I1FB 4JFWA 3H42L 3D6GA 3F7RA 4L9LC 3MRMA 4ODHL 1N0XH 4M29A 4AVHA 1J5DA 3GWJA 3SE3C 1IAKB 1QSED 1UYWL 3MUJA 4L3CB 3M17B 3E3QC 3Q6GL 3TF7C 2FJGA 3FFCA 3N43B 3OZLA 4TVPL 1FZKB 3GSOB 5EO0B 2OYLA 3UTTE 3LS5L 4LFHG 5EOQL 2ZXQA 1QR4A 4OVUA 1TQSA 5CR1A 3E6HA 4IHOA 3FT2B 5B38B 4NNYB 1LQSR 3K6SB 1FRGH 2HP4A 4AI7A 1XB3A 3OMAB 4NI6A 2VDNL 4KI5E 4Z7OF 2OL3B 4KMTL 4WIQA 4HS3B 1GS6X 5HHOB 1Z9SB 2IALB 1CGSH 2VQ1A 3HFML 4PS4L 1A2YA 3D09A 5ANMA 3NRPA 5ACZB 3EJZD 2EADA 5M95B 1MEXL 5C0DB 2VW4A 2IDTA 3S4SG 2PN5A 2GHZA 1CLOH 3IGAA 4XCEA 4R8WL 5IJBC 3RTQD 4KZ0A 4U2YA 5G55A 1NMBH 2GC7C 4LP4A 3LN9A 5E8OB 5E99L 5BOPA 3GLZA 1YY9D 1IEBB 2XWRA 4JRLA 4J6IA 1GR7A 1XZ0B 5L6YH 2IQ9L 2ZAGA 5IJKC 4MJID 1PY0A 3RFZB 1NFKA 2YZ1A 2FD6H 4XWOC 2BY0A 3GSRB 5I5JA 2R8SL 1QSEB 3ZTDC 3F6LA 1MXDA 2CD0A 2R2HA 2YN3A 2BJMH 2N7BA 1RUML 4YBLC 4LP8A 4JKPH 2B2XL 2UY7B 1JP5A 3K1KC 4RGOH 2VAAA 5DVNA 3D0VB 3BCFA 4LGPB 1NM9A 3MBWA 2YRPA 1HNFA 3HE6C 1CQKA 2EKJA 5DD0L 1RJYB 3DOSA 4NN5B 1I9EA 2Y5TB 1DUZB 3GB7A 2DQFB 3JTBA 3LKOA 3AG4B 4FZ8L 4XO5A 1IGIL 3PHQA 4W81A 3D39A 2OSYA 3ZUCA 2WBWB 1ADQA 3O6LL 5K9JL 4EQ3A 1T5XA 2HKFH 4BZ1A 4CC4C 1NCCH 5E1HB 3S7GA 3KYNB 5KW9H 3RTQB 1KIRA 1MRDH 2UWEA 1E3ZA 5AVZB 2FJFA 2Y3NA 5C6WH 3F58L 2QR0A 2CBQA 4GIAA 1G7LA 2WTOA 4UNTA 1JXDA 2ADYA 5J11B 5G4NA 1AE6L 3BKYL 3QUML 3ZRCC 1B0IA 2FE0A 4MJIB 3IE9A 5LAXB 3R06B 1GC1C 1YNLH 4YHKL 3ZDXF 3H54A 4HKJB 4M7LT 1NCGA 4IKLA 4EVNA 1OVZA 5IR1A 5DDHB 3VFWA 1HEHC 5HI3C 5HGHA 2IAMB 4OW6A 2IH9A 4LSSH 3HLAB 2ZWNA 4L0YA 1B4TA 4Z7WE 4NXSA 3KDPB 3O8XC 2VLJE 5FO2A 1P7KA 3M7OA 4FS0A 4G3YL 4DN3L 3LXUX 1S3KH 2ZQKA 3MLSH 4BK5C 1W15A 3LCYA 4P23A 1JPEA 3W1ZA 3O8XA 2MQGA 1USZA 2PCYA 2JKIS 3EZJB 1BEYH 2QVKA 4JFTA 4PWIA 2CA4A 1GGBH 4AEFA 1E90A 1Z9PA 4BK5A 3D4YA 3WSQL 4N0YH 2EDJA 5FA3B 1L5GA 3LNIA 3ARWA 2G3XA 1LO0H 3B7YA 5JUEH 3U7AA 2OXHA 1I8UA 3LDBC 5I2IB 3KLQA 5IEKA 1GMEA 2CLVB 3CU1A 1R5WB 3DTXB 3TBCA 3FT3B 1IT9H 3G6JB 1GZQA 3QUXC 2XA3A 2WTPA 4WKZA 3MFFA 4Z0XA 5ISZD 3SKNB 1SXBA 3O41B 2DEXX 4OCNC 5DHVH 1G0DA 4AEHL 5J7CC 2WIMA 2GVYA 3FH7A 5F9OH 1WISA 4TQEL 1RV6X 2FNWA 2IH8A 3ZTEA 4WO4D 3UAFA 4R26H 4X42A 4MZ3A 1K2DB 3WN6A 4EN3C 3NTCL 1KENL 2B4CC 4F8OA 2EVHA 3ZDYB 3HRZB 2KLTA 4U4IA 1DJYA 1HFUA 4EDXA 3DSFL 3SOTA 2MQ3A 3QIWD 1I7RA 1XR9A 4ZO6A 1OB1A 1CDGA 4HBQA 3FT9A 5A2KH 2LABA 4MKTA 2GYSA 3SQRA 3M07A 1O75A 1PZAA 4R0LB 4KTGA 4OCXH 2XN2A 1IE4A 2W0KA 3V6ZA 3O6MH 1NFDA 3MKKA 4HSQA 4EBQL 4Q9RL 3DETD 2E27H 5LUMA 3I6LD 3M1BB 2JI1A 4XX1E 1DJIA 3ZK0A 1KCWA 5FLVA 2R39A 4UI2A 3GKWL 5CCKL 4UB0L 4DNLA 3B9EA 3EGSA 5CMAA 1WWCA 3F2LA 3FKUS 3VFUB 4WTXA 2X2YA 1KB9J 3EBHA 3B5HA 1O6VA 4NP4L 4D0BB 5IB4B 2BSTA 1MCRA 1YYLH 2OMWA 5E2UL 4K23H 3T6ZA 3WS3B 4CUCA 2X10A 2Y06H 3JUYA 3B34A 5FYJH 4JO1L 3ZTNH 1XIWD 2B7DT 4LVNC 3V0VA 4U7KA 5LWYL 4TNGA 3IFPA 1DQLH 4HUKB 1BMWA 4PM1A 3QDGA 4C56D 4HIEA 3HMXA 1IKNC 1O5PA 2Y7SA 5LCVL 3TXAA 3RY4A 1PNDA 3A4EA 3MV8D 4XCFL 5GS0L 4I85A 1H3TA 2P5EA 2PTVA 3CG8A 3BH9A 1MFDL 3ZKMC 5L88L 4JE0A 5E8DL 4FP8H 2X70A 4NKDA 4O58L 5KJ7E 2YPKB 3EYUL 3QIWB 5IK3B 4B96A 1A6ZB 1KTBA 5DK2B 4E9VA 4QYAA 5E00B 3Q1SH 1E67A 3VXTB 4BFFA 4LLDA 3LIUA 5DJ6B 4CKQA 3P4NB 3P3UA 1I8MA 1O7DE 3VXRA 4ZBJA 4A63A 1TO4A 1FZMB 5E7FA 3CDGA 1OSZA 5FM5O 1EZUA 4G6MH 2WXQA 3IDMB 4BHUI 2PNDA 3H0TA 1YEGL 1RZGA 5CSZA 3FQXA 3GGWA 1G9MC 3RKPA 3LH9A 4GB9A 5E1GA 5AVSB 3W2DH 4J3UA 2VDLH 2VXVL 4XZUB 2OR7A 1A22B 3V9FA 4QT5A 1JTTA 2FWOA 3KM1A 4OGYH 3UTPE 1JZ5A 3MODH 4FQXB 5C09A 1KT2B 1P84K 1KIPB 4PMEA 5D7KE 3TIEA 4PSPA 2IWEA 1KJMB 1XIWB 4C83B 3MLVH 2C34A 1G9EA 2ZCHL 2ZXEB 1HILA 3GJFK 4CADB 4CU7A 1QWNA 2BNUA 5AAMC 1JPGB 4I3SH 4N68A 3S3JA 3WIIL 5E56A 5F6IC 1NC4A 2WVTA 3QUKB 3J8F7 4ZPTA 2Q8AH 4K7PY 1U42A 4W9JC 2WYTA 3QJRB 3ZMNA 3VXSA 4MNQE 3K7UA 3AM8A 1KYUA 4S0SD 1DYZA 1QHOA 3PL6A 2AITA 1KTLA 2GY5A 1IFRA 4NM4L 2EKSB 4LDLB 5JLZA 2F8OA 2P9RA 1Q72L 5HD8C 3NPSC 5K69A 3U2SB 3AC0A 3FXIC 4OGAC 2AJVH 3OD3A 1OSPL 4POUB 3HNSH 3UBFA 4LO9A 3PUCA 5IFAL 2OSXA 1A8JH 1RK1A 3FB7A 4G8EB 2WN3A 4GAJL 2NNAB 3TH2T 4RIRA 4Y0GA 3GIVB 1F11A 3DGCR 1DSWA 3FULA 3QCVH 4M43L 5E1AB 5HHVH 5I19H 4PY7B 1AOZA 3SGDH 3LRKA 2A77L 3FN0H 4JO3L 5L0QC 4P4KA 1HDMA 4FKEA 3GDCA 4GAFB 3TPUA 2J2ZA 2GJ6E 3BUBA 4TTDC 3UBXG 1SF5A 2B08A 2RD0A 3L4CA 4APQC 2Y9RT 2MFNA 2VLLA 3LQAH 4WJ5A 5B3JF 1ZA6A 4F7TB 4KRPD 4QXVA 4KJWD 1HNYA 3UCQA 2ZUXA 4W70A 3VI3E 4NNXA 4L05A 2C3VB 3ZTJH 5TE4H 3REWB 4S1RH 1NL0H 4PD4J 1A7OL 2CO1A 5IHBA 3G6AB 3MJ9H 4XP4H 4OFVA 1NJ9A 2OJEB 4TSBH 4EPSA 3S5LB 4OJEH 1XSIA 1Q9KA 3OJDA 4X6CE 1XH3B 1BZDA 3WIAA 5GJSH 5EEYA 3SKOA 2DQGL 1G7MB 2VSCA 5ETUA 4ZXBD 5AW8B 1R19A 3C09B 3VRLF 4Q6IA 4ISVA 1TENA 4Y4FD 1ZLDA 5EZLB 3MBEB 4JO8A 3C8DA 1YVLA 5EO1B 4JN2A 1U36A 5H94A 4HF5L 2ZSWB 2E6PA 3LIZL 5FHAL 4LRNL 3UTTA 5AOKA 2A6IA 2G4GA 4OKDA 1CWVA 1Q94B 4AGMA 2BNQD 4QF1A 5BMFH 3KPLA 1JZ7A 4WHYH 3TN0A 4UM9A 1H0DB 4XNUH 3GI8L 2C3HA 1F56A 2L0DA 1ZANL 2OMUB 5AL8A 1FLRL 3F85A 3TT1L 2F53D 3QR2A 5FF6A 1GW0A 3JV4A 2BO0A 3K8LA 1GIGL 1TVHB 1GZHA 3UAJD 4KRPB 5CJBA 4YK4C 2EDXA 3NEOA 5AKRA 4EZMA 1GZPA 2B1HL 2LV4A 1HWGB 1TJIL 1TETH 4OZHE 1JRHH 2I60L 5J0BA 4IRJC 4XBEL 1PSKH 4WFHE 4HPOL 3SOBL 1SMDA 4D8OA 4J1UA 3B6SA 5L4FA 1I53A 3CAFA 1UEYA 4MQXC 1J5HA 5CZKA 2ZX6A 3VGEA 1P9MC 2VXQA 1IL1A 3U83A 1J9TA 1N64H 4G7QB 1DEDA 4ZXBB 3KVPA 4U05A 2ICEB 1RJZB 3BVNB 1KGUA 3O0LA 1LYQA 5AZEH 3T2NH 4L5FL 3QWQB 1QRNB 2A9NH 2RH0A 1H3PH 4MA7L 5L2JA 4GRWB 2P5WE 4OB5L 5FHBL 1FZJB 1NBVL 3M1OA 2XBZA 3QC5X 1VENA 3C6LA 3BQUD 4NGHL 4WHCA 4HIJA 1E6OH 2R0KH 4JX0A 4HWNA 5C2BL 3JWOH 4P2OD 3HW7A 3FBKA 3QWRD 8FABB 2DYPA 3L08A 2FX9L 1MFMA 2DTMH 2RGSA 1NGPL 3HBGA 4FHJA 3DV6B 1BFVL 2NW3A 4BZYA 4N2FA 4XBPA 4TPRH 4C58B 5F7EL 1XB8A 4YZFE 5IHWA 2C4XA 5T3XD 4JR9L 5IBTL 4TUKL 3DJ9A 3SKMB 5I9QB 3L4WA 3C9NB 5D96C 1P6FA 2EJ1A 1J18A 3T0DA 1MWOA 4AY0A 1F90L 3VFPB 4CU6A 2FQGA 3CK0L 1RIHH 5CSGA 2QDWA 4ZFOB 2MCG1 1OK0A 4FMFA 4OLVL 1DJZA 1FO0B 3HE7C 3HKFA 1U8HA 2PETA 4NSKB 1NOLA 2PP9A 1XGZA 1MW0A 1NPUA 3MC0A 4IGBA 2VC2B 3SQOL 5IOPB 3U1SL 3GO1H 2R9HC 3VXQB 4G7YL 1OF2A 3MLWH 4KKCC 4ODWA 4Y9GA 1VFBB 2D2OA 2QTVA 3QFJB 1GY2A 3QO0A 1YEEH 2EIEA 4WK0B 3EW3B 4OIAA 5DTFA 5FCUH 4LCCB 4Z7WA 3ECVA 4MQTB 7FABL 3GJFA 3KBEA 2VLJA 5GJTH 3RUGF 2HT2D 5IBUB 4M6NH 3REVA 1JK9B 1K3ZA 1YYMH 4P2OB 4KDTA 3I3DA 1NA8A 1Q0XL 3RLSA 3N0PB 3QEHA 4OQ1A 3SD2A 2VR5A 1R3HB 2C9SA 4CC0A 2MNUA 1YJDL 3PS6A 1JWUB 1GGTA 2TRYA 1D5MB 3ULVH 3NT0A 4I18B 4IOSD 3ARFD 3MPCA 1DQDL 3KDMA 5E9DD 1NDMA 3A47A 4DKEH 3BAYA 3ZIMA 2A9ML 5FA4A 2OW6A 3H2WA 3NEXA 3ZL2A 4XN4A 5GZOA 2FT7A 1BQKA 5GGQH 1H8OA 1XT5A 1OB0A 3C6SB 1QFUH 4JFHE 1HHHB 1TJHL 4JRWA 4NHCH 1IEHA 2AK1L 5A7EA 1Q9OB 4PR5B 3A3YB 4MJ6B 4IIZA 1F4HA 3CQFA 4L3FA 2V5RA 2PR4H 2BCKA 3SEPA 4Y16A 1S7VA 2QADD 3VD1A 1QQDB 1F3JB 3GSUB 4Y2DB 2FX8L 4A37A 3CLEH 4X8CA 4BRVA 3AITA 5E1IA 2AJUH 3UPCA 4Y19E 2J88H 2QVTA 4W9EC 2PTTA 3NFPB 4BD4A 1NCNA 4H88H 5GGVL 4ZO8A 3MROB 3VQMA 3UJJL 3SBQA 2V2WA 3BD4A 3ULSB 1BYOA 5D70L 3SJVD 4P4RB 1THAA 4U1IA 4N1EA 4QY8B 1B9ZA 4R7VA 1UH4A 2P8PA 2RHEA 1KXHA 4H1LG 1OP3K 2H0PA 4ENED 3MRIB 3PXLA 2WQVA 2DDQH 3B8SA 5DO2D 1D5BA 3VFNB 3PWJA 4XPHL 3ARFB 2Q3XA 2NTFB 5JO5B 1V3JA 4MKMA 2NZIA 3DVIA 3EYFB 2WQXA 4BCXA 5I1CH 1MAKA 1N59B 4PJIB 1QZ1A 1JE6A 2A99A 2VO5A 3ECQA 5JIHA 3UACA 4H26A 4WRLA 2F7RA 4FG6C 1Q9WB 3THMH 1QBLL 3KLLA 1ORQB 3JBG7 3FSZA 4ZUWA 4DN4H 5ITFA 3SCMD 5AD0B 2WQUA 5HVWA 3A24A 4ZAKA 5H2BA 4IRSD 1NM4A 4EZKA 5C08E 3WFDL 4LHJB 5DC9B 3CHOA 4BXSV 5D8JH 1WBZA 4MMZA 2GJZB 2ZCKH 1F6LL 1NFIA 1S8DB 1XGYL 4PRPD 4N2EA 3RHWK 5T33L 2X4OA 5C0CD 1J1PL 3U4EB 4X98A 5SX5H 1K8IB 1Q0EA 2VN3A 2AXHA 3EYQD 1C1EL 1S7TA 1XGQB 1A7RH 3F83A 4FNUA 4GO6B 1NOAA 3NJJA 3QNXB 5K9KB 3SYCA 1AG0A 2QFPA 4HT1L 1SBBA 3V0JA 1KF9B 4M02A 4PRIE 4DFIA 5AZ2L 3E9UA 2G9KA 3QQ9D 2GSIA 1RLBA 1M7DA 1T4KA 3BKCL 5DUPH 5GGTL 4GLRI 4U1HA 2D0HA 5CFAA 3AADB 1BZQK 4F7MA 5T3ZH 4QJ4B 3VCLA 5I15H 2FHBA 2AW2A 5I6KA 1J05A 3FTVA 3NN8A 4MQSB 1NLDH 1GHFL 4F8PA 1CPUA 4M7JH 5IMKB 4IKIA 4KDVA 5FFGA 1JZGA 7CGTA 3V6FA 1LMIA 4MAUH 3MGTB 3PG2A 2J71A 4JY4B 4XOBA 5CGTA 1CG9A 1R3IL 3QEGL 4XP5L 3ULVF 3IDIA 3MNMA 3KXFE 2ESVD 1M4KA 5BW7C 3TEXA 4XC1L 3SN6N 1ZLSH 3S3CB 2WPGA 2DWXA 1DVXA 3NJMA 4WI6A 3HPJB 3N41F 1F58L 4QLWA 1IM3B 3MJWA 1TZIB 1KEMH 2Z31C 1KY6A 4KX8A 3KYKL 4MNQA 4IK6A 5C0CB 4E41B 5BW7A 3BRDA 4I1RA 1GOGA 3U4AA 3VFSA 2KYIA 3EO0B 4BFRA 4HHWA 5AG8A 2RMNA 3U1QA 2Z31A 4TUOB 5E4OA 1XGUA 2DQDH 4NUJA 4FQ2L 1IC7L 3HAEA 4QD2E 2Z3FA 3BIBX 4PJ9C 1WFJA 1AD9B 4CDHA 3ZRFC 4G11A 1X7TA 2BOLA 4N2IA 5FV2A 3PCYA 5DJAA 5ILTH 4NC0B 4XCNA 1UD6A 2DQHH 4NQCD 4X9HA 1SJXA 2ZOKB 4KMQA 3D06A 4WY7H 3D30A 1NLBH 1SY6H 2NNCA 3ETSA 3TO4B 4HJ1A 5EWIL 5LG6A 2KBGA 2PWEA 4ANUA 1BVLB 2GJ6A 1AP2A 1A6VL 1R75A 5D7LD 2VDRB 2IPTH 4N28A 4FYTA 4A2EA 5EF2A 2LFEA 1OP5H 3N1PC 1OL0A 3OF6D 5M7QA 2LQRA 2ESVB 4XMPH 3BKMH 1CVRA 1E4WH 3FN9A 2D3JA 2IH3A 4JAMA 4WU7B 3QIUC 3V0HA 3VI3A 4OFPA 3FH8A 4CVXA 4JREC 1JK8B 4KKPA 2Y1VA 1MREH 1S7QA 3RWFB 4M8VA 4DPAX 4ERSL 5TF1L 1MW2A 3GC3A 3Q3GA 4PFEA 3CDFA 1TZHB 5IQ9A 4ALAH 3ARPA 1GRWA 3QUYA 2IO5A 2AZUA 2AXFB 4HP5A 1IUZA 5IB5A 5EIIA 4X6CA 2BDNL 4BUHA 1I9RH 1A6WL 2BHFA 3RNKB 4YFEA 5F0PB 5JHMA 2N0KA 1NC2D 3FU5A 5GS1A 1T1XB 2A3TA 5KYUB 2HT3C 3P3YA 1E4XI 2VR6A 1G5AA 5IVXF 2YC1B 4HWEH 4GAAA 1MFAH 1OAZL 3JYCA 1LP9B 4KX9A 1J8RA 5D2LB 1LO2H 2CNZA 4U3CA 4NQCB 4XVJL 5CZXD 4JFUA 2YA2A 4KROD 4UV7L 3MYJA 1LWJA 3G5ZA 1JGEB 1GYAA 1ITCA 2IEPA 2L8AA 3QZWA 4FTVD 4FHBD 3MUY1 3PIQB 4OFYA 4OKVB 4X50A 5D1ZA 3ZHDA 2AK4D 9PCYA 4P2RA 2C1PB 2XN9E 3CZKA 3QJFA 4QJ3B 3V5KA 3MA7A 1W72H 1CI5A 2P7TA 1DVQA 2HN7B 3BN9D 3FQWA 3NZHL 2KI6A 2LGNA 4AM0B 3LV3A 1WFUA 4UQ2B 2BZDA 1JCVA 1UQSB 1KLFA 4QCIA 4OZHA 4JJOA 1GA2A 1P5VB 3WKYA 4DKFL 4OAWB 4YDIH 4D0CB 1OWWA 5AUMA 3T0ED 4HAFA 3CFBB 2K1MA 2NXYD 3AY4C 4QWWC 2QSCH 4LLWA 1GYUA 2C26A 2X40A 5PAZA 3UPAA 2DWEA 4PP1D 3BZ4A 2Y5QA 4XO4A 1QFWL 5GRVK 1C5CL 2F19H 5DMJB 2CUIA 5HY9B 3FU7A 2D7TL 2MTPA 5AW9B 3S88H 1JUFB 4P46C 4OQTL 3T8XA 2YN5A 1FC1A 1LD9A 4CSPA 3HHSB 4XMKL 3JV6A 2QSQA 1JDCA 2OR8A 3MCLL 2P5WA 1TQWA 4HUUA 4Y4KB 3WE6A 4UIMB 2EICA 4L8SC 4AEIL 3DYOA 2V7NA 2ZWYA 4NJ9L 4NZRH 4YH6A 5F8QC 4TNFA 5I8KH 4P2AA 5L2KB 2H32B 4ELMB 3IT8D 4MQ7B 2WC7A 4PJ5E 4QJ5B 3CVCA 3MV7D 4ZSOA 2D0FA 5HGBA 1CE1L 4A6YA 2IANA 3UTZB 1M7XA 2DEYX 4IOIB 4PBXA 1SM3L 2R0ZL 3M88A 1U8NB 2O6PA 1DANT 1IZJA 5FYKU 3Q44A 3X14B 2W8CA 2RCSL 1FBIH 5SWZD 4RSVA 1N5AB 3NJKA 2FSDA 1NMCB 4ZW3A 3NJVA 4FNSA 4JNXA 3KYAA 3GSNA 3WEOA 4IHBA 4HIHA 5JPNB 1TSHA 3T0EB 3OAUH 1FYHB 2NXYB 2BINA 3TYGH 2G3NA 4YGVB 3L5JA 2JJVA 5D93B 5FO9B 2VDQH 1I3RA 4JM2A 2KHAA 3L9RA 1OIOA 3H9HB 4EI5A 4P59L 3RRQA 1U8MA 1XD0A 2YD0A 1FRGL 3DVNA 3RL1A 1RK0A 3NJHA 1U9KA 4WWPA 4B9GA 1GC1H 3ASNB 5ERWA 1U3HD 3ZZQA 3RGVA 3KNBA 3LKPB 3G6JF 5AG9A 4I7ZC 1T66C 3QJVB 2VIRA 3PREA 1MOEA