3HN8A

Crystal structure of synaptotagmin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
279
structure length
279
Chain Sequence
GAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanism of the synaptotagmin-SNARE interaction in Ca2+-triggered vesicle fusion.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Synaptotagmin-3
total genus 47
structure length 279
sequence length 279
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3hn8A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3hn8A02
3HHMA 4PS7A 3TL5A 4TV3A 4F93B 2DMGA 2WXNA 2WXJA 3L54A 4FJZA 3TJPA 2NQ3A 3DBSA 4OVUA 3T8MA 2CM5A 4FULA 1UOVA 2N1TE 2YOAA 3L17A 4F91B 1CJYA 4BGDA 4L1LA 4WWPA 1DJIA 2JQZA 3QR0A 3PYCA 4FJYA 3TWYA 3ML8A 3ZVVA 3APCA 3QR1A 2D8KA 2WXFA 3APFA 2BWQA 3R7RA 4TUUA 3R7QA 5T8IA 3QK0A 1BYNA 2EP6A 3L9BA 2K3HA 3M7FB 2WXIA 1GMIA 3QARA 4ANWA 1DJYA 2FJUB 3SD5A 1DJWA 3NZUA 4ANXA 4LDCA 3RDJA 1E8ZA 2WXGA 3RPBA 1E8YA 3CSFA 1RLWA 3FDWA 3ZIMA 2WXLA 4Y1TA 2CHDA 5JHAA 4NP9A 4G11A 2RD0A 3APDA 3ZW3A 3F04A 4QJ4B 5G55A 2DMHA 4FHJA 4QAMB 2X38A 3L16A 4V11A 3L08A 2CJTA 4F92B 3L13A 5CCGE 4J6IA 5H4YA 2K45A 2QZQA 2NSQA 1E7UA 4DK5A 2WXKA 4WWNA 5G2NA 1RSYA 3LJ3A 3W57A 3W56A 3KWUA 1HE8A 3IM1A 3PS6A 4WAFA 4FA6A 1DJXA 2CHXA 4ICXA 4LT7A 4GNKB 5EDSA 1E90A 4WWOA 5KJ7E 3S2AA 1QASA 3F01A 2FK9A 3OAWA 4HLEA 4KITB 3MJWA 3OHMB 4URKA 1V27A 3ML9A 4IHBA 2UZPA 4A55A 3NZSA 3GPEA 2YRBA 4L23A 3PFQA 4ICWA 4PS8A 4PS3A 4LCVA 1DJZA 4NS0A 3L4CA 3B7YA 1DJHA 1W16A 1TJMA 4KZCA 4Y1SA 4L1BA 2WXPA 1UGKA 1BCIA 1YRKA 4AJWA 1QATA 2ZKMX 4NPJA 4NPKA 4JPSA 2Q0ZX 1RH8A 4EZJA 1BDYA 2KI6A 2Y3AA 1DJGA 3FBKA 4IQHA 2NCEA 4OVVA 4EZKA 4DNLA 4QJ3B 1DQVA 2Q3XA 3CSTA 3IBEA 4BFRA 4TS6A 2WXHA 2B3RA 1DSYA 1WFMA 1E8WA 2ENQA 4XE0A 4AOFA 4ANUA 5CCJA 1WFJA 2K4AA 4HVBA 4FADA 5H4ZA 2Z0UA 2QZ5A 3KWTA 3HIZA 4ANVA 1A25A 2WXOA 1TJXA 3HN8A 3P2BA 2WXQA 4FHKA 2ENJA 4MJJA 2K8MA 4XX5A 4F1SA 3DPDA 2A5UA 4XZ4A 2CHWA 2CHZA 4QJ5B 3QJZA 2R83A 3JZYA 4WEEA 2V4LA 3N5AA 2CJSA 3PREA 1K5WA 3QAQA 4FLHA 3F00A 1E7VA 4GB9A 3F05A 4EZLA 3PRZA 2LHAA 1W15A 2ENPA 3ENEA 3NSJA 2ISDA 2WXMA 4KZ0A 2A4ZA 2CM6A 2WXRA 5CCHE 5JHBA 1UOWA 1E8XA 4L2YA
chains in the Genus database with same CATH superfamily
3IEAA 2RCSL 2DMGA 5DK2A 3I9IA 3HS0A 3QXVA 1GTNA 4U7KA 2IH9A 2JK5A 4IGBC 3L3IB 2VDRL 5IEHA 3P02A 3D0VB 1PZSA 3UDWC 5CBAB 4JPVH 1WRFA 3CFIC 5E8PB 2AJZA 1TFHA 5KTEH 1CFBA 5MENE 2BP5M 1ZT1A 1F6FB 3WFEH 1M6UA 3SD5A 2OI9C 1MRDH 2QPSA 4PFEA 1SF5A 1U93B 1HZLA 1BD2D 3ZLQC 3RU8H 4JDZB 3F7VB 2WLIB 5HDWA 1NBZA 5GGTH 1X5KA 3H2PA 3T0EB 3IB4A 3QCUH 5IB4B 4JY5H 2CWRA 1W72L 1KCWA 2JSFA 1SJVA 4NM8L 4LLDB 4BFIB 3QUGA 2AJVL 4BQ6A 5GS0D 2YKLL 4PG9B 3BQUD 4P4RB 1HSBB 3BRGC 4JBSA 1UXMA 3AZUA 4LNRB 3DGCR 3NZHL 4IBWA 1J1PL 5AW9B 1AANA 3VUAA 5AZUA 3TA3D 5C0FA 2PTTA 4ZFGL 2FWSA 5IF0A 4N0RA 4RIRB 1F13A 5IT2L 1EK3A 5KS9F 3T6WA 1MLCB 1G5GA 2C9SA 2ICWJ 3JV4B 4M56A 5DMGC 4PB0H 5E4OA 4J3OH 4ORZC 1WVZA 2WO3B 3T0EE 3BEWA 2WIMA 5B8CB 3FCTB 4IU2B 1DEEA 1I3UA 2BMKA 3ZHKA 1KY6A 4JK0D 3TO4B 2DWDA 2PYEE 1CFNA 2V9RA 1EO8L 4HOMA 1G7HB 5AAMA 4K94L 1QD0A 3H7LA 4LASH 2IWKA 2WWMD 3K2UH 3DYOA 4NZRL 5HGHB 4F3FB 1YY9C 4OD3H 4FYQA 4TF4A 2A1WH 3WFDL 4PD4K 4U3HA 1PKQA 1I1YA 4LK4A 3KL3A 1MFBL 1IVLA 2LU5A 4J3TA 2XT1B 2VNCA 2VM9A 4NNYA 1A25A 5MP6H 1HHJA 4GKZB 5I6LA 5ALCL 4P0DA 4Y8AA 2NY4C 4FNLL 1NBCA 4XNDA 4A38A 1QLEH 5DJ6A 2NY1D 3ARQA 2E59A 3UIZA 3WYRA 3GT6A 3VW3L 3WNIA 2PUQT 4ALAH 4PY7B 5EBWA 2JELH 4M62H 4DCQA 4PJ9B 5IIEA 5ESQA 2VN7A 1TZHB 1UKQA 1GOFA 4QHKJ 1P5UC 2ADFL 4WUKL 1EHLL 4YHNA 1NOLA 4IDJL 3SCMD 5EWIH 1A6WH 4DSYA 4LPCA 2GTWB 3ARFB 1A9EB 2EO7A 2V2WA 5B3NA 4CL7A 3JYCA 2B4CC 1XH3A 3A6BL 5BV7H 4MNQE 3DX7A 4V1DA 1H5BB 2ITDA 1T03H 1Z32X 4NI3A 4EI5C 4BUGA 2I5YL 4HZLB 1O6TA 1E30A 1SDDB 2DWXA 4JG5A 2ZXBA 2F58H 3APFA 3ULVL 2XX1A 2NZ9D 4O2CB 1Q94B 3LZFL 4FZ8L 5HGBA 1GIGH 5IM7B 2HJKB 4QRTB 3GI9H 3RUGF 2APXA 4U31A 5DYOA 2OCFD 4L9LB 1DVZA 8FABB 2R1XB 1UQSB 3DARA 3QBTB 5F3FA 2L4OA 2EQDA 5J9PA 5JQ6H 3WLWD 1UENA 5CZVH 4M00A 2XKNA 4WCYH 5KVEH 5IW6B 3SDCA 3D39A 1XIWC 1SM3L 4FQXA 2NNRA 4HWEL 3UAAA 4WI0B 4QRFA 4RQQB 3RWGB 1FP5A 4NXKA 2YD5A 4JCLA 3D33A 4LSUL 2KUTA 3RWEA 4UBDC 3SBWA 4JE4B 3VFNB 3IGAA 1K4CA 4LQ1A 3RWCA 2JFCA 3H54A 3BP4A 3MUZ1 2E7LC 2YMXL 2VLMD 4ZXBC 2BIQA 3FUJA 2X89D 3ZTEA 3GXMA 3BVWA 1KPVA 1YN7A 4M1DL 3ZMRA 4HCRA 4Z95H 4GIOA 5LXVA 4ZJ9A 2O5YL 3QCTH 3NFSL 4XNUL 3MVSA 5ERWB 3A4FA 5KSVB 4CVXB 3ELAT 1A1MB 4BUQA 1QLRB 4KK5D 4U1NB 2MCG1 2GJ6E 1TZAA 1QPKA 1J12A 2M1KA 3EHBD 5BQ7A 2BP0A 3H6AA 1YY8A 4JFFB 4JFVA 4L1DA 4XVTH 3PP4H 3ZL4L 4WUUA 4XPAL 4N2GA 1KOAA 4OI8A 1RUKH 4DUXA 4W9FC 3QIBD 3AY4C 3DUUA 1RJCA 1OY3B 2LE9A 4MMZC 1P7HL 1PLCA 3LZFH 1WBXB 3EH3B 3NCFB 3UL4A 5IB5A 1TQTA 4JO5A 5JHDD 4DGIH 5D5ME 2XQ0A 4NQEB 4TVPH 4TNVK 5T3XE 4XNQA 5DJAA 2CO4A 4RGNE 2H26B 4JZJC 4QHUB 2ZQKA 2CDFB 4P2CG 5GZNA 5DJ0A 3N55A 5F6HJ 5CCHE 3RWIB 5F96H 5IFAL 4XCEB 1QEWB 1ZT7A 1MI5A 2JIXB 3FS9A 2WNWA 1IBBA 1T6BX 4G8AC 1A6WL 4O00A 2YN3A 4ETYA 3ULUC 3RWJB 1AG6A 1AD9A 2OMTA 5TH2B 2DIBA 2GTZB 3W3BA 5IMMB 1F4HA 1T4WA 2VSMB 5DI8A 5I16B 3QR2A 3VSUA 2V5YA 4OJFL 1UB5B 2AEPH 4RMWA 4JDVB 5C70A 3JSSA 3SE3C 2Z92B 4X4MA 4GJTB 3DURB 5ESAA 4ZYKB 5IR1B 5J11C 3RGVB 1VERA 5IY5B 4I18A 2Z1KA 3MA7B 1M57B 3T09A 4JFUA 5MP6L 3BLBA 2W81C 4MX7B 4YHIB 4WUUE 4IIQB 4QDGA 4LMQI 1PEZA 3S3JA 2ADGB 3EYQC 5AW6B 1MW3A 4GG6E 2ZX6A 2R56L 1IM3A 3IJSA 3HE6C 3JTTA 5GRXG 3GXIA 2YUZA 4N0UB 1HKLL 4G8FA 5I1IH 3N50A 2P7TA 4QWWC 4X80H 2B5IB 3VXUD 3MFFA 4NWUL 4LLQA 4P5TB 4DQOH 1EO8H 1S8DB 2BVTA 1CD0A 2RIKA 4HWUA 2X4PA 4IEFA 5J11B 5F70A 4RZKA 4BQBA 3C60B 2FE0A 4CN4A 1IZKA 2NPLX 3KDMA 4G9FD 4M7LT 4NENB 5KYYA 5HJ3A 4NFCA 4IBSA 2OYLA 3OAWA 2RAMA 1OF0A 4NFDA 4HKJA 3WJMA 5D1XA 3DV4B 3NABL 1BV8A 4MD0A 1MLBB 1TTUA 4EAEA 3VFSA 2VR4A 2A0LD 3MLVL 3PL6C 4KRLB 5IKCB 1OAXH 2YQ3A 1P5UB 3G5VA 3ZHNA 1UACL 3KLHC 4Z76A 1KPRA 1S46A 3VXNB 5HVHB 4WDIA 2D9QB 3QJOA 2BNQA 4YLBA 3EBHA 2CKNA 4ZS6C 3PXLA 2PO6C 4DTGH 4OGQC 5BPPA 1JK8B 4LLWA 1R5VB 3VTTA 1CICB 1T1WB 4GW1A 3GJEB 4KO6A 4N1HB 1U8KA 4HCRL 2EVHA 4KK5C 1DQMH 2DQIL 4GRMA 4G43A 2TRHA 5GS2D 4OCYH 3RWHB 4GRLA 1T66C 5D7IF 4BIKA 4NI6A 1MCLA 1ZA6B 4LCCB 1PL3A 4RFEB 5FGSA 3IYLW 4ZMAT 4ELME 1QUNA 4KY1H 1E6OH 2VAAA 4JGMA 3WNJA 4LF3B 4OU3A 4MB5A 3SBPA 4NQVB 1N5AA 4ZUUB 1J9TA 5EUOF 3QAZC 1MSPA 4OSUH 2BK8A 1I7UA 4EN3D 4TVUA 5JW4N 2WSKA 2VIRA 4S11A 3AWEA 3AREB 4KK9C 2OSLB 2F6AA 3GHEH 3GSNB 3V5KA 1NCOA 4PJFA 3KPQB 5BZWB 3S96B 4RAVA 4L4JA 3OSVA 2KLSA 3U6RB 3EH5B 4WFEE 5ISZE 1V3JA 1CFSB 4ORGA 4HUWA 3NH7L 4U6TA 5GSVA 2QGEA 1I8AA 5EEXA 4YAQB 2Q9OA 3HG1A 5EBLA 4QJ4B 4K3DL 3WKQA 1M3JA 2UYLB 3R4DA 4JKLA 5KBNC 4TNWF 3GKWH 2VT0A 3ARGA 1FHNA 4OJEH 1B0GA 3H7BB 1RZFH 4CVXA 2KZ1B 3F2LA 5D9SA 5F7FA 4BQ8A 1WO2A 3QUMA 1C12A 3SJVB 3VB8A 5JHLA 4YZWA 3C08H 3HKZA 4ONGL 4B50A 5L2JA 2Y69B 3NJVA 1KYAA 1S5IH 1R3KA 1MCIA 1YUHB 1BEYL 2ZWKA 5GRJL 5CP3A 1KXVA 5DHVH 1T1ZA 2QVKA 5JQ6L 1E27A 1Q38A 1HK6A 2O93L 1W8EA 1PX8A 1AGEA 5IIEB 4L8BA 3QEUB 2BC4B 2V8LA 4LAJH 4QCIA 1YEKL 3MRNA 3ZGHA 4O9HL 1KJ3L 3BPOB 4YHOL 1P4LB 3QFJD 5J13C 4O4YH 4Z7OE 3MBWB 2Q6WA 1KUMA 1IRAY 1MHPH 1QBMH 3K7UA 4NNYB 3RPKA 1PJWA 1GJWA 1BX2A 1QO3A 1U3JA 1UUSA 3NN8B 4KKRA 1NCGA 3GLDA 1HJCA 1B88A 2C9RA 4KV5F 4PV9A 4HX1B 2BJML 3FUDA 1EUTA 3QNYB 5DXWA 1BFSA 1JGLH 1LO5B 4QYAA 1TU2B 5E9DE 2COQA 3H0TB 1EZLA 5E8NA 3VRJB 1URLA 4R4FH 3QSKB 4OD2A 4TMPA 5JPNC 2KQNA 2EE9A 4OD1H 4ZS7H 2PN5A 4X5XA 2CG9X 3PRZA 2B9AA 3FTGB 2JB6B 4LCIH 4Z7UF 1XL4A 1KC5H 1JPGA 1H5BA 2ITDB 3HG4A 2X4OB 3EJCA 1AKJB 5E6UB 7PCYA 5TGBA 1GVIA 3PDGA 1KLGB 1U8LB 3LMJH 3MLTB 1MFEH 4OZIE 3S4SG 1GXEA 3VFGH 4HJ0C 3AMLA 5MEPB 5GS0C 3EYFB 5GGSA 1PSKH 1MRCL 3DV6A 3W1ZA 3D0AA 4A7GA 5CUSH 3MV9E 3PHQA 1A4BA 3TA3B 2YGOA 5H37G 1D7FA 1RJYA 4XPBL 3UJJH 3AXIA 3CV5A 2G75A 1R3IH 2EDNA 2WBWB 4NC0B 4RGND 1I1CA 3CSFA 2J71A 3PU7A 1VFAB 5T3XD 3DIDA 4NERA 1GAFL 4Y8DC 1IAIL 2AI0L 1HNYA 5JHAA 2FHFA 1MUJB 5C92A 1K8DA 2V9TA 3IN0A 4H0IA 2ORBL 2WV3A 4XC1H 2LFEA 2F53D 4Z7NE 5I76B 3FH8A 3BP7A 3FB6A 3S98A 3ZTCC 5CR1A 4HDIA 3FO1B 5F89A 1CGSH 2WIIB 2X6UA 4JCMA 3S8GB 2YHGA 2VR5A 5J56B 3EGSA 3U7WH 3HW7A 3SQOL 1W72H 4YIQB 3EJZD 1L7IH 4JO1H 2W0FA 3S2AA 1XH1A 1ZT4B 1FNHA 25C8H 3O3EA 2NSMA 5FYLH 3JWNH 2GB2A 4M3KB 4E9VA 3RZCC 4U6YB 4Z7WF 1T0NA 3C8HA 4YMPA 1LL1A 3TIEB 5KJRH 2PPEA 2GT9A 5IB5B 2OXHB 3QO0A 4X0NA 4AC2A 4HU8A 2CDEB 3QZWB 2ZYRA 2OMBA 2FX7H 4JO1L 3RQ3A 1WEJL 3US0A 4ZSOE 5D1ZB 2E27L 3EJUA 4NN5B 3MJ6A 5EZJA 2G2PA 2NR6C 1V5JA 2DQTL 3MBEC 3OQRA 4I0PB 3VU1A 4KK8C 1M4KA 4AQAB 4C56E 4Z3FA 3TT1L 4UB0H 4AYFA 2E27H 1I8IA 1EZVX 32C2A 4KROB 1AE6L 2BZ7A 2A6IA 3ZRSA 4AG4L 2MCAA 1NPJA 1IGTB 2FX7L 2L7QA 2WXHA 3BFOA 5F1KC 4KUZL 2DM7A 1NPUA 4XE0A 4N2NA 5EMYA 1TTGA 3HVNA 1SQMA 4JFEA 5B8CC 1NCAL 1FORL 4WK4B 4XWOD 2Z34A 3N1PC 5DJXA 3ARRA 4M5YL 5FGRA 2Q3ZA 3NCEB 1L7IL 4JJOA 4Z7IA 4PWKA 5C08D 3QA3A 2LU7A 1RI8A 2NY0B 2XSKA 5IROA 1PSKL 2X1XR 4KK8D 1I9RL 4OF0A 1W9XA 5LNDA 3NSJA 4XO9A 4RZCB 3WXWH 5GXBB 3QS2A 4CVWA 1L9QA 3X14A 4XC1L 3MMEA 3PG2A 4BFNA 2EIZA 4K94C 1WFUA 4MB3A 2A6JB 4NZTH 1IAIH 2AI0H 3QPXH 3VXMD 4ZW7A 4WWPA 4U3CA 1DJIA 3S5LG 4B97A 1ZPUA 1CD8A 2E4TA 3UZEA 3CDZA 3W0WB 2EVGA 3VFVB 3MTXA 1MHCB 1XF4B 3U1QA 1G7LB 4F80A 3WTUA 4PV8B 3I3EA 1JP5A 1NCDL 4HIIA 3KBPA 1DJYA 4R4FL 2MCPH 3ZHFA 2P7TB 3GPSA 2NXYB 3CFEB 4LLQB 1RUPL 2UXFA 1AGBB 5F1OB 1KB3A 3CN0A 5E08L 5DJDA 5ISZB 2FSEB 3WLBB 4FZEH 3FH5A 4ELMB 4X9BA 3FU7B 3U2IA 1WWWX 1WE5A 3PWLA 3LSOB 3SGDH 4Y2DB 4B0MM 3Q2CA 5EU6B 5E6IC 2WLIA 2AK1L 5C0DA 3LJ3A 3TA3C 1JZ7A 4DP8X 5LBSA 3NG5A 2R0KH 3QDJE 2KQMA 1F4AA 4XP5L 4H0LC 3RTQC 1JWMB 1AAJA 2Q76A 5K93A 2X9ZA 3TV8A 2Z31B 4WEUD 3BXNA 4A68A 3VTAA 4JY6A 2C9UA 2IFFL 3QI9D 5ID1A 5L6YH 1RUAH 5CO1A 3FTYA 4PJ7F 3FXIC 1L6PA 3DIVA 1KJ2A 2YEVB 2VH5H 4D8OA 1HH6B 4D8PA 3INOA 1KWGA 5C0CE 2ITFA 2DIJA 5AUMB 1MNUH 2HAZA 3CN1A 3O3BB 2FBJL 4EVNB 1CLOH 3A6OA 4KXZI 1LK2B 4QPEA 3HR5A 3QJXA 3HHSB 2JIXD 4JFDD 4YE4L 3CZJA 4F8TA 4M43L 3IJHB 4YDVB 4M1GH 3NJHA 4DF9A 4IKNA 3P77A 4Q89A 5GQBA 3ZDYB 4W9CC 2IBGA 2LQRA 3OR6B 5K9QI 4ANVA 3GSVA 4KAQL 3HN8A 4WEMB 4N2FA 4LCYA 5L7XL 3MRCA 2GIMA 5GRJH 1J5CA 1NANH 4M7KH 1ETA1 3JZYA 5C08E 1RZKL 3TC9A 2NNXA 4G7YL 2XVBA 4Y9GA 4JQVC 4X6CE 1DANU 2DQFA 5SWSB 5CR8A 3QJRB 3FUMA 4X99A 3ZUCA 5A6MA 4W81A 3ZKXB 1LO3L 1FYHB 3FCBA 4N86A 5A2KH 3KYMA 1QWHA 4LKXB 1IAII 4C56B 3TEUA 3NA4A 4BM7A 4U1HA 3FOLA 4NAQA 1IB5A 4ENED 3LN4B 1CG9B 3VB9A 4LVHC 3V52H 4PY7A 3VI3F 2FD6H 3EF4A 4FULA 4HEPA 4X7DC 2HLFD 5D1XC 5HBBA 2RH0A 4CMHC 4PHZA 2YUXA 5GZNC 5E23A 2WWKO 3OC8A 4YGAB 3QPQC 5DJZB 3OM3B 4YSOA 2YOCA 3R18A 1QW8A 2B1HH 1CT8B 3NEXA 4I8DA 4EI5A 4PIRF 3IJEB 3RDJA 1YLBB 1A3LH 2CUHA 1T04A 1BVNP 2H41A 2YBGA 4J3OG 1FVCB 1V54B 2ADIA 2BWDA 1TQSA 3ZBMA 4XCYB 4GAFB 3KR3L 4Y5YA 2BCKA 5C3LD 2O6DA 1PZAA 2FJGA 2X0UA 1A9BB 1MZZA 3KW8A 1A4AA 2VW6A 4PLKD 4MXVF 1AH1A 3BWUF 2QKIB 3PWUA 3NN8A 1JZ6A 5AVRB 1E9QB 3DV6B 5J6GA 4GQRA 2Z35A 1FNGB 2MQ3A 2FTAA 5JW4R 4OCYL 5BMFL 4NQDE 1IQDB 3RRQA 4AI7A 4YE0A 4JVPA 1I85C 5E8OA 1TCRB 4AK1A 4JFFA 3MRLA 4JHWH 3K4AA 4QOKE 2PF6A 2HRLA 4LHQB 2MIZA 2N3JA 4L23A 4XNXL 2CUMA 4XNAA 2ZXCA 2H9GB 4CADA 1LE5B 2XWZA 1RZ8B 5BXFA 1CGXA 1ZD6A 1J8HE 2LV4A 5AKRA 5ABDE 2IQAB 3PJNA 1BVLB 4YL4A 1ZEAH 3K74B 1RZIB 1PZDA 2C9VA 1RH8A 5ACZB 5KSAC 1QI3A 5B39G 2MTAA 3V4VB 4MZ3A 3FPXA 1QQDA 2XDHA 3B8SA 3HUJB 3NYKA 4Q6YA 1WCQA 2X9YA 3FCUB 3FTXA 5F9JB 1Q9WA 1ZVHA 1UM5L 2D0FA 1E9PB 1QEWA 1ZT7B 2JIXA 4E5XA 1FAKT 1OSPH 3LQMA 4QXGH 4ADGA 1C5CH 4TM9A 5F7YC 4X6DF 1R24B 4TQEL 1GC1C 1UUNA 5BUAA 2W95A 1YAZA 4Z9KB 3U83A 4NCDA 3I50H 4CJ0A 2O61A 1BQHB 3PQYD 4MJIA 3U36A 5D7HA 3O4LA 2OR7A 1OGTB 3BVDB 5AVZB 4M8VA 4ODBD 4OJFH 4XGZA 1CE1L 2JK5B 4U1LA 4G8EB 1T21B 2ZIDA 5LB1A 2I69A 1WT5C 2J72A 4K8RH 2AQ3A 1ODAA 1QFWL 3EYFA 5GGSB 4B3VA 3FO1A 5F89B 4ZX3A 3LCYA 5IGXL 1VIWA 1TNNA 4BZ2H 3OLGA 3GSRA 1QTYT 4S1RL 3QUZA 3Q3GB 1G43A 2DI7A 4TLSA 4ECNA 1IEAA 1WWAX 2I7SA 4PUBL 5E7BA 3MBED 2B15A 1XF2A 2LR4A 3VFOB 1L9PA 3FN0H 4L5FE 1SOQA 4HWBH 5TJWK 1PLAA 1HSAB 4MJIE 1I8KA 1OSZB 1U42A 2X1WL 4XP1H 5E6IA 2ICEB 4X4ME 3AC0A 3L1GA 3VQ2C 3ZZQA 1E8YA 4HKBB 4R0LB 2XTSA 3DGGB 4XPGH 2HG5A 1Y6MR 2BNUA 3EO1B 1FCGA 4WTWA 3WD5H 2FSDA 4ZNEA 4N0FB 4X7TB 4APQB 3N85H 3RL2B 1G1CA 2DTML 2F7QA 1KV3A 3RIAK 3C5ZB 5CCKH 2VRQA 3IPFA 1XCTA 3F7YA 4R90H 5BZDB 3FCSA 2FJHB 4HISA 3F85A 3Q8EA 1G4MA 1RY7B 3MOQA 4DT2A 1ACYH 3PIQA 4OFYA 3H9SE 5DJ2A 3ILQD 2Y6TE 5E8EA 1AHWB 1MWOA 3S37X 4S2SA 1BZ9A 5J8OA 3DHJA 1H6TA 4DK6A 4G8GB 1KIPA 3DRQB 3FU0A 4X7SL 3A5VA 4D2NA 3ZT6A 4IOIA 3FQWA 4XAWL 5L2KD 2AEQL 2JCCB 1SXAA 2Y07L 4FF9A 1R1CA 4P5KA 4F27A 1NGZA 1GKEA 3DK0A 4NKDB 1NGQH 2NY2B 2O5NA 2XWJA 3FFOA 3MV7A 5DO8A 5HDBB 5K33A 3S3BB 4DWHA 2KPWA 3H56A 5EOCL 5CLZA 2WO2B 2CO6A 4JPSA 3UTQA 4DW2H 3CFTA 1AZZC 2R2EB 3MRFB 3FU9A 2V7HB 4AJYV 2WLHA 2HMIC 1KGCE 1KPUB 4X4YB 2E76C 4GW4B 4JGUA 1NMAL 4IBZA 5EA0H 2D3VA 3MOAL 1KJ2B 5A2FA 4E5XG 1R0AL 1X5FA 3BQUC 5LGHL 3H42H 5EIQA 5HY9A 4H2CA 4XOBA 5DZPA 3DHPA 1ZLUH 2G4EA 1IMHC 2X89A 5D7IE 4Z7OF 3FSWA 1KGIA 3BWZA 1IKNC 4O2EA 3FU8A 4L2LA 2NCMA 3KPQA 4KPHL 5I1DA 7CGTA 2HFGL 2CJUH 2HLAB 4DZBA 3PWLB 2CKBA 4HWEH 2XVKA 1RIUL 4I88A 1J9RA 2MKLC 5INDB 4L8SB 5C2BH 3V0HA 3LKSB 3L54A 3CK0H 3FONA 3FO0L 3TBYA 4OZIB 1JHLH 1RZKC 1WC7A 4JN1H 1LE9B 1L9TA 1ZVYA 3PAZA 1MCRA 4BFOA 3WD5L 4HOWA 5IVXB 4DUVA 2ZUYA 2NOYA 5F7DA 3RGHA 3HG5A 1UA6L 2AKRB 2PMZA 2V7NA 1R46A 2VAAB 4PTTB 2WVTA 5C0GB 2CLVB 3BH8B 4JQVA 2XV0A 3S36H 1Q0EA 1S9XB 5CN2A 3GIZL 2LTQB 3POHA 3ISYA 1EO7A 3MDJA 1BBJB 4JO2L 5FFOA 2OR8A 1TR7A 2AXJA 5AL0A 5J6SA 4LPTA 4IYKA 1WD8A 4LBAA 4OD3L 4X6EB 3APDA 5DUMH 3RGVD 3FT4B 3FAWA 5F7UA 3CVHB 1QX1A 3NCJH 1QVOA 2UVEA 1F42A 1QFWH 5J1AB 4B9KC 2BVEA 1SDDA 3MV8B 1EX0A 4KC3B 1OF2A 1RSYA 4CU6A 4ZTOL 4MA3B 1Q72H 2NYYD 4ODUB 1JVOA 4JPWH 5I75B 2P45B 4FTVD 5DC4B 4XP4L 4Z3TA 4LCYB 1U8JA 43C9A 2NY7L 2XBDA 5CGTA 5HYSB 3GJFA 1JDCA 2ZD0A 4PS4L 5FB8A 1NDGB 3DSNA 1F4XL 1Y07A 4PAZA 4UMSA 1BSIA 1PKQE 1OPGH 4Z7NB 4J5VA 3E6HB 1KXVC 5ANME 5GSRB 5I82A 2BVOA 4UOQA 3HHRB 3NDYE 4HT1L 3Q1SH 4IIZA 4Z77A 3US1A 1AYOA 3CZLA 1QNZL 2ZKMX 1U3HB 3P3SA 3MNVA 2FO4B 3DBXA 4LFHD 1DO6A 3EDFA 1J8HB 3GSQA 3ZSSA 1N6QL 3QFGA 2X4OA 2CO1A 2BIIA 2W38A 2CRZA 2DMCA 2O6EA 4HUMB 1MN4A 1YYLL 4LLYB 4HHAA 1AXIB 1P9MC 2F54E 2XQYK 3MA9L 3W9DB 2BP8A 1AR1B 1CE6A 1A4KA 1ZHNA 1CK0H 4KRPB 1A6UH 4FQIL 2A9CA 1YYMH 4L0PB 4Y4KB 2J25A 2JI3A 5AWNL 4NAJA 4MJJA 5KZCB 3LKRA 1IGML 2VTFA 3QW9A 1TEGA 3H8NA 5HDOA 2WOYA 4OKVB 1BVZA 2KZKA 4BXVA 4AIEA 2NNAA 2VDLL 2VMJA 5EBMA 2B2XH 2ZXEB 4ZXBD 5A2BA 5IMKA 5DRWB 2EH7L 3HPLA 4TQPA 4OFDA 2XPZA 3GSOB 2ATPB 1T22A 4I89A 5L8JB 1DVFB 3OLEA 1G1OA 3B5GA 3MYJA 4IRJC 1HJBC 4QRRB 4Q9BA 4X9YA 2OMZB 4NQCD 3FTGA 1LQSR 3D3VE 1MWAL 4K3HA 3TWYA 4L29B 1ROWA 4NQCB 5FM5O 5IB4A 1V7NL 3IFOA 2VDQH 2WXFA 3KLDA 3WS3B 2B0SL 3RY6A 1X7QB 1VPOL 3I02B 2VLJA 4PJ5B 1LE5A 3DHMA 2C9QA 4NO0B 1N8ZA 2AQ2A 2G60H 4RFNB 5IB2B 3DUSB 4UOW0 2CXKA 3ROLA 5LN8A 2XZCH 1FG9C 4PYHA 4TTGA 1QKZL 3OZ9L 1ZGLM 3CZEA 2XKUA 1Z5YD 2QSQA 4XVSH 4MAYB 3F58H 1BEXA 1MJJA 3RL1B 5TH2A 2CR3A 1KXQA 4I3RL 1IC4L 1OV8A 3ZQWA 3Q5YA 5ADPL 4WU7B 2DJMA 1FNLA 1C8PA 3UJIL 3DVGA 4JFDB 4EI5D 4ZQTA 4BQ9A 2ZCHH 4G80A 4R3SB 2OYPA 3EYSH 1A66A 2BCMA 5BRPA 3VH8A 1P7QD 2BWIA 4ICXA 3GEWB 3L5WB 1R19A 3CFUA 1CGWA 3P0VH 4N2HA 5C09D 3MJWA 4HDIB 1CC3A 3OJMB 3A23A 3KPRD 2Z8WC 1INQB 2I60L 3IBOA 1VEOA 2HXAA 2VJ0A 3UTTE 3G5ZB 5EULV 1N70A 4NN5C 4P5MB 2EH8L 1P84K 3B7YA 1DJHA 2DD8L 3E8UL 1UGNA 3OG6B 2X4NA 4M43H 1BCIA 5FCUL 3ARWA 3UAJD 3ARBA 1ETZB 2UZIL 1BQ5A 1YPZA 2ZF8A 3HJEA 4N2BA 4FABH 3IDYC 3BESR 4UAOB 2E9GA 2WYIA 2Y0SA 2VDML 5IQ9A 4I5BA 1MFNA 4F33A 1FUNA 1O6SA 1U8IB 1IAKB 3MBXH 1IBHA 3MN8A 3U4EB 1MNUL 3FHAA 4U6XA 3KYOA 4NHCH 1HAUA 3HG3A 3VWKB 2W60B 1O7DC 3AB0C 3ESMA 1G9NH 3D85D 4JGNA 5IK3A 5K9JH 4MNHB 1N18A 3UZQB 1N3NA 2FEEL 1E5BA 4LSVL 2CO3A 5E2VH 5C0NC 1FJ1B 3RNQA 4NQQA 3UPAA 4X6DA 32C2B 4YWGL 4K5MA 2J8UA 4Y1AD 4WO0A 1SEBA 2CO6B 1XB6A 1D6EB 1NLBH 4XODA 1A1OA 2XTLA 4FNTA 1HEZB 1MW0A 3UABA 1VKXB 5T1DH 4B9PA 5I73C 4NC1C 2FUQA 4JFPA 4YHYB 1FL3A 5DURB 1I8LA 2EH8H 4CVZB 3FCSB 3CZNA 3IU4H 3MO1A 3ESNA 2E6PA 3O6FC 1NAKL 5FF6A 5JOPD 3GUTA 4FL4C 1A7QH 4XP6H 3S96A 3UBFA 5DJ2B 2ZNWA 2JQZA 4YDIH 5G5DA 2MCMA 2VLLA 2Q86A 4L4VE 4NDMA 1VZGA 2BY0A 3QG6A 1MY5A 3BWSA 3VMNA 2C3XA 2JLLA 1BAFL 1N7MH 3DI2B 4ZRGA 1WYJA 1JWMA 4ZZFA 3G9AB 4M5ZH 5I1DB 2XG5A 1O7SA 3Q2NA 1KBGL 4ERSH 3ORJA 4O5LH 1IQWH 2VLKA 2GIXA 4QIRA 2D7PA 3WNPA 4BDVB 3DO7B 1U8JB 2VXUH 5D7LB 1IFRA 1NCIA 2E9IA 4NPYA 2WQAA 4N2AA 2VC2B 3O11B 3M1CA 4Z7QB 3FQ1A 1TPXC 4ZPVB 2Q7YA 3KLLA 3TVMA 3D2UD 2P42B 2VDPL 2VDMB 1JFQH 3H3KA 4HK3J 2PCFB 3L6FB 1HL8A 5DJDB 1UCBH 2BVYA 5E0QA 4GI6A 4FG0A 5E70A 3W56A 5DHYA 5TK4A 4YBLB 2NYZA 4F7CA 2HUHA 3CDFA 1XF5B 1V7NH 5I1HH 5KSBF 5L8KB 2LT9A 3UBGA 5HYJA 4M5YH 2QELA 3QDGD 3R06B 3WUWA 4R97C 3ARYA 1LDPH 2XYCA 1CDIA 1KB9J 4KUZH 4OUUB 3NSDA 3QJHA 4LPUA 4P46A 3A4DA 1BX2B 3B83A 3KL0A 2RQ8A 4TSAH 2ICWI 5CKGA 2WBKA 4L9LA 1OARL 1NIAA 1V3MA 4E42A 1LYQA 1F00I 1OB1B 2YD9A 5EOQL 2VDLH 3CPLA 3H9SB 1JNHA 5JR1L 1WC7B 4R7DA 1HSBA 3O4OB 1LE9A 4F2ME 5A7EA 5DFVD 2BSRB 1CWVA 2E5EA 5BJTA 3FYIB 5K9KB 3A4EA 1WZKA 5JIHA 2HJLB 3ARFA 2OMZA 12E8H 5F3HB 4QKXB 5DMKB 3X12A 5KJRL 5DWPA 1QG3A 3P2BA 4HS8L 5C07E 1WFTA 4XVJH 3OGCA 4PJFE 2B14A 3UCRA 3EYQD 3MNMA 1IGIL 1K6QL 5FYKD 2EZ0D 2EE0A 5I1JL 5D2LA 3BD3A 1DANT 4P2RD 3ECVA 3EDDA 2HKFH 4N4YB 4O02A 4PJCE 1I3RA 2H32B 2YPKA 4FNSA 4Q6KA 2QADB 3QUML 2AXWA 4HT1H 3TASA 3RZCD 1GYWA 4I1NB 3U0WH 3K2KA 2X1OA 3T8MA 1A4KB 4D3CL 3KYKH 4DN3H 4UDTA 3SDCB 5IJBC 2NY7H 2AV7B 2GI7A 2NY3B 3AS1A 2DYRB 1R3IL 4Y16A 3U30C 3WIAA 3AJ7A 4QRAA 1ET8A 2OYMA 5I9QB 2AK4D 2I27N 3VH8B 2QTEA 1U91B 2LOEA 4PJEE 1PZ5A 5JLZA 3MRPA 1JPGB 2C3VA 1G9MH 3OKDA 5B8CA 5IQOA 1GGCH 1IAMA 4HG4K 3CC5A 1MFEL 4WTZG 5HYEA 3NACL 5DZ9A 2EICA 5DUML 5JA9A 1Q4NX 1TMQA 5GGQH 1WFIA 4QHUA 2ZUTA 2R23B 3ZE1B 4J7RA 5DJ0B 2CJTA 1BQKA 43C9B 5HYSA 4OLYL 1HKFA 1BWWA 1HCYA 3CFBA 1EWHA 5A6LA 1KJMA 2IF7A 3CDYA 1P7KA 2VLJB 3O2WH 2OZ4A 2YWYA 2QVMA 4LB8A 4JRXD 4CMMB 1S9YA 5TF1H 8FABA 4ZFOA 1T89C 1HEJC 1NAMH 3ALPA 1K2DA 4MA1C 5D72L 4YVUA 4UZUA 3MRIA 3KWWA 5EV7A 1JHLL 1N3NB 2FGWL 4FFWC 4P3DA 1OALA 5DDHA 1CLZH 3ZE2B 3DX3A 2F8XC 3HBQA 3GTNA 3CN4A 2UY6A 4JE0A 3WENA 4DAGH 1E4HA 4IIQA 4TULL 4DPBX 5JDSB 1BVNT 4PJ8D 5JIMA 4GRLC 1MG2C 4G80B 1BDYA 1N12A 1VKXA 1DFXA 1JN6B 3VGDA 1M7IA 4O9HH 4L0ZA 2BS71 4EPSA 3TH2T 2HMID 4KUCF 5GGVL 2XN1A 4XCEA 3ESPA 1YVLA 1ZLDA 3Q01A 3H85A 1TTBA 2OMYB 3LYRA 2GSGA 7PAZA 3QJSB 1SXNA 3G5ZA 4HJUA 4H5SB 1E40A 2Z93A 2R83A 4CUCA 2P5WD 4JG1H 1PZUB 4ZFQA 4LOUC 1BD2E 5ERWA 1FZKA 2VDKH 1BW8A 2BHFA 4PRPD 4XTRC 1GHFH 3ENEA 1U8IA 4QTHB 3VA6A 4D0CA 2XPYA 4Z76B 3CX2A 2NY6C 5E2WH 4AV5A 1TKWA 4DEWA 2BNUB 2X12A 3IGLA 2WXNA 1EFXA 3WS3A 1IM3B 5AW4B 4BFGA 2CR6A 1T6WA 3L17A 4G6AD 4QRPD 3STZB 3FNKA 4OCSL 4Z7VA 3I9AA 4QRPE 3AQZA 4HUVB 3ABGA 2HB0A 1XR9B 5DS2A 3RNQB 3QULB 4JQIH 3DMMA 4NUGL 4RDQF 3B3IA 5I0VA 3MKGA 4KGLA 5ISZA 3VSQA 5CJOL 3H9YA 5GZOD 1UATA 1QSEB 3DROB 3JWOC 3NEOA 1S7XB 4TNWK 3MLUH 1MCJA 3FU7A 5JNYB 4QMEA 4YH6A 1XF2B 3QNXA 3ZDZB 1D5BB 1M71B 3UP6A 5DTFB 3MR9B 3B7SA 2AQQA 3VWKD 3EXJA 4FYSA 4X98A 4ZAKA 5FUOL 3X11B 2XJKA 3RWJA 2IQ9L 3FQWB 4TNGA 3T65A 2DWEA 3WNMA 3CFQA 1DN2A 1QFHA 4GKOA 5EZPA 3TH4T 2AP2A 2ERJC 4J28A 1MHCA 1XF4A 2QQLL 3QCVH 5L8LB 4OZFB 3U1SL 1YAIA 4HCGA 3TYGL 3U82B 2IAND 1KBBA 2YD3A 3KXFA 1NGYA 3QZPA 1XH2A 2CKBL 4X7TA 4LL9A 4APQA 5EDSA 4GMSL 1EEYA 5B39B 1EGJL 5H2BA 4AH2B 1DLHB 4PR5B 3P4OB 3IDXH 3FN0L 4F15B 5C0EB 1K5NA 4HKZB 2D4FA 3TNNB 1IIKA 3VXRD 1ASOA 2B59B 3T0DA 1AC6A 3Q8CA 1O75A 4YDJB 1KTBA 1HEZA 1NFIA 3ZUNC 4YSCA 3OJ2C 1FBIH 4LHUA 1OCOB 3OD3A 2XICA 4O58H 3O9WC 2G3NA 1OAZH 1U8QB 2G2RA 3FQTB 1AJ7L 3ZRCC 5JXEA 1EDYA 3QUYA 3CZFA 4KOCA 2IBZX 3IGUA 3OC5A 4FQJH 2WVVA 4PJEA 5EO1A 1KCSL 1JYWA 1ZLSH 4OCRL 2C7UA 4N87A 1WWCA 3RPIA 4LCCA 5JDJA 1J5OH 2EYRA 4GAGL 2NY5C 1MCKA 2UX7A 2OSWA 5DFTA 2HFFB 1HHIA 1OAXL 5D9SB 1YO4A 4HZ1A 4FFTA 4HVBA 5F7EH 2XX0A 2Q10A 3HC0B 3NABH 3ZPDA 1OK8A 4PRHA 5LGYA 4QF1A 2Q7AA 3DO7A 1G0YR 1QSFE 1WAAF 2DKMA 1QHQA 2K3TA 4GW4A 1XMEB 1WHPA 3DVNB 1S4IA 1UZ8B 2F5AH 4RWHA 4XBEH 3VAEA 5FF6B 3GUTB 1U91A 4PGZA 2BNQB 2V17L 4OJDH 4XBPB 2FQDA 4KDVA 1U8OB 2AXHA 2CCVA 4YDVA 1IGYA 1FCCA 2N59A 2AK4E 1XZWA 3QO1A 1CICA 1T1WA 1Z3GH 4JDZA 3TN0B 2VR6A 1ONQB 4HGMA 4BE6A 2KH2B 4K7FB 3GSNL 2MPVA 4WKXA 1CT8A 3PCYA 3R1GH 4EI5B 3FZUD 3IDMB 1BREA 1RZQA 4KO7A 4DZBB 1E6JH 4HC1H 4LIQE 4OFPA 4RMVA 3KJ6L 1XFPA 1TG8A 3EJYC 3ALWA 3D12B 1JV2B 3MLYL 3TBYB 5E4EC 4DJMA 4ZMPA 4H1LA 3SE3A 4YUEL 1JHTB 4XWGH 4P2QE 2GW5A 4ZMYA 1KEGH 4YL9A 2QADC 4AV0A 3D48R 2AQPA 1J9QA 1A64A 2Z6FA 2P1YA 3CFKB 3Q7JA 4BFJA 2CO2A 3S35L 3KLAA 1CLCA 5FUOH 2XQYG 4M9PA 4C54A 5E99H 2XA8L 3PPEA 4HAFA 5BJTB 5CSZB 1AO7A 2DQHH 3SDYH 2MJWA 4FQCH 1D5MB 1S6NA 4DGIL 4ZMVA 2KL6A 3D1MC 5AZ2H 3UAEA 2F5BL 1PJ9A 1D5XA 3O41B 3BVXA 1J8SA 1XZ0B 1FVCA 2ADIB 3BQUA 5L88L 3T1WA 4YBQC 1LO2H 4YAQA 1PKQB 3HG0A 4JMNA 4Y1AB 2CBPA 3V4VH 3V10A 3PWNB 3RVVD 4UNUA 5I6XB 4ZTPH 3TIDB 1CXEA 3KVPA 4BA0A 2BOBB 1BFVL 5E00B 4OZ4A 2GJ6A 4ODWB 5IVZA 1JXGA 2P8MB 4CGUB 4EUPH 2E8YA 2VDOH 2DEYX 3LH2H 5F6IB 1Q90A 3CDGA 1KIRB 4W9JC 1IBGL 3HVDA 5L7XH 4QO1B 1KTDA 1Q9KA 2PW1A 1BMZA 3FL7A 4U1GB 1HHGB 3QP3A 1DVFA 2DLFH 5F1IA 4KKNA 4XZUB 5DQ9B 5CHNB 1MAML 3EFFB 2X9WA 2WXOA 5GS0H 5IV2B 3OHXB 4OZFH 5FGBC 4XPFL 3HB3B 2GFBA 5D70L 5BVJB 2APFA 2WWOA 4ILDA 4X2UA 1CFMA 5FK9B 4JDTL 5GS0L 3BAEH 3W5MA 3QRLA 1JHKH 3NIGB 3VXSE 2HH0L 4P23A 3QQ3A 4NWTH 1BGXH 3DXAB 1R5WB 4HWZB 2EIKB 2B9BA 4MMYA 4WCYL 3H2WA 1UG9A 2OQJB 3RIKA 2V0AA 2WUBL 5HGDA 2ZWZA 5E1AA 1KGJA 4ADIA 5A7BA 4UDUB 5I6OA 3BPNC 3DGGA 4HUXA 4JFXB 4WJG3 3STBA 2DQGH 1C16B 3QDGE 2QSTA 3Q8AA 4OAWA 5F0PB 1KCUH 4GLRI 4PJCB 3H4FA 4X50A 1BIIA 3MOBH 4X4KA 4XGZB 1O9WA 2WZAA 2CDGA 3S37L 2A6DB 2I9TB 1DBAL 3CE1A 4TSCH 1XCTB 2ZYHA 5BV7L 4ZODA 1X5YA 2G2NA 1MEXL 2QBWA 3DJTA 3EOTL 3I9GL 3R0NA 4JGJA 4J4PC 1INQA 1OTUC 4MJHA 4XXCC 5EU4B 1IEAB 3DX6A 3LPWA 4JJ5A 1C08B 4G42B 1LWRA 3NCBB 1HL9A 2ADFH 4RZCA 4WUKH 5IQMA 5CJXC 3BJ91 3S97C 1I1AC 3EAKA 4ZMWA 3BGMB 4EDXA 1ZSDB 2DQHL 3SDYL 3SQRA 1F2XK 6CGTA 4BQCA 5C0CA 1MREH 3WKYA 4ZZKA 3GFUA 4AEIH 4L3CA 5B7MA 1ED3A 3GM0A 1JPFB 1OCRB 5DTFA 5I6NA 3RVWD 4UQBA 2F08A 5F7LB 5JZ7C 5LGJB 3P9LA 4XC3H 3IDYB 4TXVB 4WO4D 4Y4HD 1EA9C 1JE6A 3RI5K 4ZOCA 1A6AB 3U0WL 1V10A 4P07A 1KEGL 5DFVC 5D7JA 3WDIA 1FLTX 5IREA 1AGBA 1FIGH 1TKWB 2RALA 3FT2B 3LEXB 2L0DA 5E4EB 3AABA 5C09E 5KN5B 1VGEH 1QRNA 4NKMB 1JZJA 4MXVE 1ZY9A 5EZLB 1I4FA 3LB6C 5H8DA 1FAIH 4DIXA 3P9MB 4IW4C 2P46B 3GSNH 4JRXA 5HVFB 2Z93B 15C8L 3N42B 1TZ8A 3G5WA 4KKBC 1ETZA 2VWEC 3P40A 4JB9L 2O26U 3VXSD 1KFAL 3VE0A 3ZOAA 4HHGA 3BLPX 4FQPA 3OKKA 3VXOB 4HH9B 4KX8A 2F61A 3F12B 3NIDE 2BIOA 1J0ZA 4ATTA 3UX9B 1M2VA 4OB5H 2AS5M 2VXSH 4FFZA 5HHOB 5ENWB 2Z7YA 4OLWL 2DH3A 3NSCA 4KK9D 1PEWA 1L5GB 1GZQA 1JRHI 1SYSA 4R8WL 3OMIB 3TBBA 5MHSE 3TBVB 1SN5A 4GUOA 2FEEI 3P11L 4NM8H 3L5JA 2VZ1A 5AEAA 1G7IB 5SWQA 4B5ZA 4EVNA 2A6IB 2HWZH 3QRGH 5PCYA 4YJZL 3DBSA 3EO9H 2AXFB 3GRWH 1E50A 1F86A 1AD0A 3IETB 5FWRA 1ZTXH 5KANI 1ZGLA 4R97B 5E1HB 1F56A 4YPGB 2ATKB 1L0PA 2GCYB 5F2FA 2HG0A 3MR9A 5CSZA 3IKCA 5AKSA 4ZQKB 1FZMA 3QA3B 5T1KB 5CBEB 1OQXA 1FRGH 1TVBA 3K2IA 5TDOA 3RKDC 3KW7A 4ANXA 3FSZA 4Y5VB 2JVUA 5D7IB 4F9PA 2J5WA 2VN4A 4EIUA 1Q0XH 5B21A 2RJMA 3HAEA 3OVUB 4AGMA 3GMQA 2V5RA 1Z5LB 4OI7A 2VDRH 2ORBH 1FG2B 1PG7L 1F90H 2EDOA 3RFZB 5IJKA 1V8HA 2LGNA 5B1JC 1A1NB 2SEBA 2R69H 1VHPA 5DJ8A 5GJSH 4DKAA 3ILPB 1NOFA 2ZAIA 4M9OA 3OHXC 1UM4H 3STLA 2WAHA 1UWEL 4H2AA 4O5LL 2B08A 2GBAA 1S3KL 5ICYB 4KZDH 5JOFB 1EIBA 2E6JA 3HS9A 5KSAA 2B59A 2P8MA 1AZNA 3B2XA 1CTMA 2FEDD 1F97A 4N8UA 1J0IA 1C8QA 2VW7A 2VN3A 3CHQA 3E6FB 3SPIA 3LVEA 3UMNA 3ARUA 4W68A 4MTMA 5HGAB 3F7VA 3BE1H 1HHGA 4PVBA 5H35A 3DX9A 4EOWH 5T1LD 3T2OA 1FO0A 2YPLB 2DJ4A 3L95A 3OR6A 3EYOA 3FTUA 3ZYIA 5DLMH 1QBLL 5CIPB 2HT4D 1W6LA 4XE5B 1TQBB 1AGCA 3BKCH 5CU5A 4XX1E 5T1DL 2HPOA 5CJOH 5D7SH 3HMWH 2JJSC 1L7TL 1Z9OA 4O02B 4UM9B 3ZYOA 1T7XA 4OD1L 5HI4C 4ZMXA 4LQFH 1HL5A 1MCPH 4PEEA 3VM5A 4ZMQA 5T5NG 3N3EA 2D3JA 3QIUB 2BERA 2VDOB 1QZ1A 4HFUH 3LRGA 1N9PA 4L3EE 5LO7A 2ED6A 4Q9RL 1L9OA 5C07B 3W38A 3HCVB 1IE5A 3GSOA 2VMFA 4YSRA 1T22B 4A2FA 5K9KA 2UZYA 5HDQL 3PQYE 3F00A 3MXVH 4FQ2L 1MQKL 1M56B 2QGDA 3ILDA 3HHSA 2YFNA 3NCXA 4BWWA 3IVKA 3RVTC 5BXFB 4X83A 3NMEA 1T04B 4HWNA 4LSSH 3QC5X 4OGXH 3QI9C 4AEFA 1BFTA 2C7FA 1VGKA 3FH7A 2P5EB 5CZRA 2DYSB 3KGSA 3OTTA 3OXSB 4LEOA 4XZUA 4KJWC 4TUOB 5C71A 5I8EB 4Y4KA 3BRDA 2ADJB 1D6VH 1V3LA 1H3XA 1S7QA 3O41A 4P2QB 1JAEA 2C1PA 5DGQA 3P0VL 3UC0H 2DQMA 4JY6B 4S1SH 4JZOA 3QT2A 3QR1A 5FIEA 4FMVA 3CLFL 3ZR5A 3RY6C 3S88L 3AWFA 3MRGB 3FMGL 1DLFH 2EDWA 2DQCH 2A9MH 3BZ4B 4UILH 4UQ9A 3WEXB 2WXGA 2OKMA 3WFCH 2BW5A 4MQTB 4P99A 4LEEA 4FOMA 4Y16B 3L3OC 4I3RH 5I2IB 4R2GB 2Y1AA 3EFOB 4N1EA 1WSST 5B7EA 1WCBA 2EO9A 2ZKXA 4NQDD 3IGKA 2JWYA 3WKMH 1IFGA 1RMFL 4FHJA 1XH3B 3ZDYE 3ULVF 5HGDB 5TF0A 4Q58C 2VMEA 1LP9B 1XZ0A 2IMMA 3BQUB 3RB5A 1XDTT 4BK8A 4ZPTB 1DEDA 5DRZA 4OI9A 1T5WA 2NUPB 4ZUTB 4PVMA 4IJTA 5F21B 2X42A 1I4FB 3ARGD 3F7LA 3NIFF 5AVXB 5FYJL 5IV2A 2ARJB 5I19L 4OSUL 3WEMA 1MW2A 2DM4A 4DKFL 4DHLA 3JWOL 4HULB 4J6RH 3C75A 4Z7WE 2VXVH 3GS0A 1EAOA 3GLZA 4KWUA 3GHBH 2W07B 1V7ML 3SODB 4HKBA 3O9WB 2ZUSA 1AP2B 4ONOA 4P23B 4ETQB 3DVGB 4M93B 3O81A 2IIJA 3MV01 4OR1A 1G0XA 1NJ9B 2X2HA 4LE8A 5DHEA 3HI1B 3N0PB 5TPWH 3D87B 2JF1A 2BIPA 2EDDA 3TEXA 3EYUL 1T80A 3DUHA 1DCEA 1UT1A 4IKLA 4RMBA 2NX5A 4WVRA 1G7IA 5SWQB 3SCMC 3TA4D 2J8UB 3PNWB 1J86A 5I23A 4KRPC 5DZNA 3KCPB 4NRXB 5FGCB 2GSMB 2OV0A 2Z1PA 4HLZH 4OCWL 4HEMA 1M6OA 2NQCA 4KQ3L 3IE9A 3SHSA 3ZYZA 5E8EB 1A6AA 4YK4B 4F37F 3V79C 1T2QH 3BUDA 4XCFL 2VC2H 4ZQKA 4U1IA 1Z1WA 2V4LA 2HVJA 3WIIH 1XR8A 1FGNH 5ID0B 3OKEA 1QSEA 3KPOA 3B2UD 4WV1C 2C4FT 4HBCH 4X5WA 3EBGA 1QUPA 4QXTB 4WWID 5E1GA 1AOHA 3PWPD 4OCWH 1FL6B 1OTUD 3IDGA 1XSOA 2R9HC 4LEXH 4PD4J 4OGYL 1FG2A 3K5SA 3LAFA 4WO4B 3OX8A 2NLJA 2X6AA 4MNQD 4R5VA 3C5ZA 1ORSA 3FRPG 4M6ML 5CJQH 3EYUH 4UQ2B 4QI3A 1HH9B 2ZSVB 1OAUH 1NKRA 4WWKD 2VUYA 2OL3H 3BKML 4G8EA 4ZTOH 4PSPA 3RBSA 3DMMC 1Z66A 4DQOL 4NRZB 3D09A 4KI1A 1FNEA 1NBVH 5HGAA 2JKIS 4Y1TA 3IMWA 5AYUH 2AJZB 2X4QB 4AZ8B 1UADC 2X53A 3AW5A 3NFNA 5EU5A 5A3ID 2G30A 3UPRB 2YGVA 5G55A 4NKMA 1BFOA 3LNIA 4NAMA 1BQRA 1PTZA 3BAKA 3WJMB 2Z7UA 3P4NB 5DRXA 1XVSA 2G5UA 4NQDA 5DK2B 2MPAL 1PYWA 2OA9A 5FUZH 1H3WM 3L9RB 4QY8A 1IO4C 4W9HC 3MV11 5F7AA 3PQYA 4MJID 4NQUA 5AB9A 5IEHB 4TPRL 4FA7B 3T65B 5E95B 4P5SA 2IADA 2R2BA 4P9ML 2DBLH 5FHBH 3QDMD 4TVSa 5IHWA 3ABZA 3D7PA 3V6OA 3BZ5A 4M61A 3MSPA 4ICWA 4L8SC 2HRGA 1UWYA 2WMPA 1YSOA 4YXHH 2WGXA 5D2NA 2H0FA 1QUNB 2C3WA 4PN6A 1FL5B 4ODXB 5CEYA 4G82A 4LF3A 2HFGH 1KXTA 2A2QT 3SDDB 2DTSA 3B7RL 4PBVC 4QHNB 1E5ZA 1DJGA 4HIHB 5D2LF 2CLRB 3X12B 3T6QC 3GMNA 3N1GC 1NCTA 1I3GL 3WV0A 4GPVA 4MQ7A 2Z31C 5ETUB 4HC1A 5LGHH 1J1OH 1DSWA 3INUH 3X14B 1M2OA 5ADOL 4IRJA 5IKCA 2FO8A 1R0AH 1MDTA 4NO5A 3GEFA 3VCLB 4P2RE 5HHNB 4ES8A 4NZFA 4QNPF 5CINH 3T0BA 1MQKH 3BH9B 3LKPA 4BFFA 1USQA 1MFMA 1RV6X 2FGZA 2ZXQA 1JYVA 4Z3HA 3PHOB 1UZ6F 1YYCA 3SZKC 3EGXA 3G6DH 4QT5B 3WY1A 3W2DL 3TTYA 5IQLA 3A67H 1PD0A 4QF1B 1BA9A 1UT9A 3U25A 5MEND 1MZYA 3GNMH 2X4RA 3QIUC 3GSWA 3TGXA 3ZT7A 4BD4A 1EHXA 3GGWA 3O6FD 4GUPA 2YARA 3CQPA 5JLZB 3AITA 2XI9A 4QOKD 5D1ZD 1YC7A 1BF2A 3B43A 4NZDA 4TOYL 2DRUA 4M7LL 2LW3A 4N20A 3MLXH 1WBYB 4CILA 5KWYC 2Z8VC 3WN5C 4NN7C 1PD6A 3V5DA 1R47A 3FUEA 1Q8MA 3BP6A 3PWJB 4HA1A 3VQ1C 3CXDH 4UM8A 1BPVA 1CVSC 1LO0H 4AXWA 4K3EH 3PWPE 3ZDZE 4Q52A 2E0PA 4U33A 1HHHB 1ZXKA 4XNMA 3V4PL 1IAOB 2OL3B 4ZFFB 1PGRB 4LZKA 1TXKA 4EUPA 5CZVL 1X44A 2H2PC 3SYQA 4EDWL 3KHQA 5DZAA 1S7SA 3HPJA 3IFNH 4XB7A 2VR8A 3IF1A 5FYKE 3KEDA 2XWEA 4XHQA 1H3PL 1XSIA 4YHML 4ZFOB 2BSCA 2Z65C 3GZQA 2CRYA 3LQAC 3KD4A 1UT2A 4X8XA 2YBRB 5FO2A 1T20A 5E2UL 3OR7A 3HMXA 3DMMD 2N7BA 3KLAB 4N3TA 4G7RB 1RERA 4RAVB 1L9NA 2A7BA 2I5YH 4CW1A 3F58L 4KOBA 1T03L 1U8MB 3EG9B 3GZOA 3OG4B 4FQXB 4MAYC 1F90L 3N43B 2ZCKH 2H32H 2EE3A 3VGBA 4HG4J 5F1IB 2VUKA 3UAFA 4AGLA 4XN2A 1M7IB 2QQNH 5CGMA 4NUMA 5JPMC 2VXTL 5D2LE 2ZONA 1UGKA 3D05A 5HHQB 2H1XA 4NZJA 2C9PA 4HGWB 5IQ7L 1EPFA 3FN9A 4O2FA 3SJVE 1YEDB 2H8PB 1SN0A 1TU2A 1NM9A 4UT7L 1JCVA 2D0GA 3ZX1A 3K4ZA 3BLKA 3P69A 2NXYD 1QOKA 4KKLD 1KPVB 1YN7B 1VADB 1X7TA 5D5MB 3DXAA 3IBEA 1KCVL 3N6YA 3SGEH 3KPSA 1RULL 1NCCH 2BHZA 4B6ZA 1I9IH 1UKTA 1WITA 2BVPB 4PJBE 4PBDA 5LBSL 4NKIL 1S3RA 2QQKH 3GBNL 1EXUA 2MHAB 2FZ3B 1N67A 2DIEA 4N6RB 4PHXA 3W81A 1K4CB 3WIHA 5GRUH 3X3GL 1RZJC 3QXDA 2FYYB 4ONHA 4F7TA 4JFDE 3DJRA 5ESAB 3HNVL 4UWQB 5K59F 3MLTA 4M7JL 5ELIA 3QJFA 3HRZA 1H6FA 3S7GA 1CB4A 3T3ME 2HRPL 4WI3A 1JMZA 4PGBA 3IAPA 3C2SA 1KCBA 2YFOA 3MJ9H 2IOOA 2GVYA 3LPGA 3MA9H 3GBDA 1OAJA 3PJSA 5HHMB 3VGEA 5ICUA 5E6SB 3CFMA 5MERB 3TBTB 3BZ4A 3EFDH 4MCZB 3VXME 1HFUA 2UY7A 1P4UA 2H3NA 2W0FB 4OD2B 1TSHA 5CJ8A 2R4RL 4Q0XL 2X7LA 2B7DT 3DPBB 5I0ZA 4X98B 2E86A 3T4AB 3VRIB 1JZ3A 1Q0YH 3TZVB 3C60A 3UBXI 3QDJD 3DC0A 3BP7B 2GUOB 4WGWB 3QFDB 4X6DB 3BVTA 5LBSH 4UDUA 3X1GA 4YHYC 4FLOA 5FO9B 2A99A 4ETQA 5IB1A 2F1EA 5I16A 1O9ZA 4QXVA 4PQXA 3MRQB 2PWEA 3BN9D 3LHPL 3SB3A 3MRBB 3KXFB 1URZA 3QXAA 4G6ML 4JHBA 2HFTA 4XP4H 4EUPG 1ITCA 5FYKH 1OD9A 2JLPA 3SZ6A 1KJ2H 4S0TD 4XTRD 4JPWL 4JW3A 1LEGA 2DQUL 3UTOA 1KWKA 2EVFA 1LXMA 1GZHA 1M1XB 2EDMA 3PLYA 3WFEL 4JFQA 2ZSVA 3GMPA 4L3ED 4HD9A 2NTFA 2VKXA 4L4VA 2R29A 5FO8B 1S7XA 1Y7VA 3IM1A 3HS8A 4LHUB 1A3ZA 5KTEL 2J6WA 4N0UA 1W72B 1NINA 1KNOB 2IO5A 1OTTC 3CIAA 1D5BA 1M71A 3FQNA 1SOSA 2ZX5A 1S78D 2W60A 4IGBB 2J6EL 3BAWA 4A55A 5DK0A 3B6SB 5DYFA 4M7ZB 5KAQG 1DBAH 3KPNB 4OCLC 2X6VA 4OIIH 1A7NH 4RSYA 3Q2LA 3RX9A 2WPGA 4BDVA 5GRWA 5HI4D 4YXKL 1WAAA 3FTVA 3DJSA 3D3VB 3H3BC 3I3BA 3NJJA 5AG9A 1ADWA 5FA4B 4NPKA 4PG9A 2C3HA 3D3VD 5K69A 3IU3A 5FGCE 1INEH 3T04D 3IFNL 2DWSA 1KCRH 1M9SA 4AQOA 3P4OA 4EDWH 4NJ9L 1OM9A 2XZAH 1S7TA 2X3BA 2X4SA 4J3UA 4TL5A 4UQIM 5EO9B 2X4RB 3BRFA 3ESUF 2BRRH 2GT9B 3QQ4A 4NQVA 3V6OC 1NDTA 3MO1B 4D94A 3JV4A 3ULUF 2Z8SA 2DN7A 5TE7H 1LEIA 2R4SH 4JL2A 3MUUA 3QJZA 1OTSC 2VRAA 2G3ZA 4PP2A 5K1JA 2ZG2A 3OKYA 1G7HA 3GSNA 3V5KB 2IV8A 3VD7A 5DQDL 4HIHA 4UU9B 1CLOL 1AKJD 2F19H 4RFNC 1JXKA 2F54D 4QRUA 3IDNB 2FBRA 2W1NA 1RCYA 3GMMA 1PF3A 1JERA 5EIVA 1J9CT 1CD9B 4HKXA 2DMBA 4H8WH 4N1CA 1J5DA 2VQ1A 3UZQA 4JO3H 5HTSA 5I5MA 3K4DA 3GJFK 4GMTH 3ASOB 3HI6H 4FFZH 4NO3B 4OLEA 2IFFH 4KKZA 1U2HA 2YR3A 3NRPA 1LNUB 4XRCB 4XPHH 1JGUL 5EOTA 3U9PL 4OLVH 4EKJA 4UMGA 3ARGB 4JM2F 1HVXA 3RHWK 2JKWA 5T8IA 3VD9A 4Z8FH 1TYRA 2XIIA 3KJ4C 4MAUL 4WY7L 3HBPA 3G7TA 3Q2WA 3NP3A 4HFWA 4ZTPL 4HPYL 1HIMH 3H4HA 1B4RA 4JNXA 2GBVA 1CGUA 3FF7A 3B9KD 4G9DB 2O5XH 5KYWB 3FDWA 3TJEL 1GCFA 3H1ZA 1G1KA 4OJYA 1HE7A 4LVNB 1OM3H 5DHDA 2YQBA 1NM4A 5JIKA 1OW0A 2F53E 4PRBB 4WHCA 4JDEA 5MHSD 2YMTA 1YEFL 1CO1A 4FLSA 1A7BA 2IGFH 4LVOC 3QQXA 1PW3A 3QIBB 1WUNT 3ZE0E 3C5JB 2XXGA 1NCDH 1NEZA 3O0LA 1BQSA 1XF1A 1J1XL 1U3NA 5HGBB 1U6AH 3MBWA 4EBQH 4HS3B 2F0CA 3PNRB 3AROA 5HHNA 1QSFA 1GOGA 4D9LL 1NC4B 3E7JA 3S35H 3I6GB 1CF8L 4FXKB 1SEBB 1BYPA 5FHBL 4HX1A 4J2XA 4L37B 5LAXA 3FFDA 3LRKA 2J4WH 4UT6H 3RVTD 2IH1A 4AEEA 1PZ5B 2H45A 3ETSA 2QSCL 4MNGB 2XIBA 1MJ7H 2R0WL 1OEZW 3G6JE 4P8QA 3T1FA 3U2SB 3SYCA 5E9DB 1T20B 2FX9H 1XGUA 2ROYA 1FI8C 4AYEC 4M1CD 2ZWYA 3ASNB 3GMLA 4J3BA 3QEUA 1QFUL 3IGAB 4R4NC 1S78C 4Y1AE 4WEBH 2VLLB 4F5CA 3D4ZA 1YDPB 4BA8A 1OAQH 1WQVT 2GJRA 2R7EA 1CD1A 1C5BL 2KYIA 3KPSE 1P4LA 4HXBL 4S1RH 5C7XL 3U7AA 5IFJA 4QRSB 4DERA 1ZK9A 1CBVL 3G9VA 3NCCB 4R84A 1WTLA 2H7WA 5FYJD 1I85A 1UXWA 4R5TA 3V5HA 4AM0B 5FECB 1IBYA 2CNZA 3RY4A 4UM8B 1JGIA 3UH8A 1IM9B 1Z9NA 3GXDA 2NXZC 5TDNA 4AXWB 2A5UA 5K39A 5I1GL 2CHWA 4CC4C 1EMTH 1R5IB 1KENH 1KGUA 4MHHI 4XBGA 1WWBX 1ZS8B 3T4AA 3VRIA 3BIKB 1OWRM 2VO5A 1S9XA 4X9IA 5KVFE 4U0RB 4R7DB 4IBUA 2OMUA 3MRKB 3WJJC 2ENPA 1OGAA 3B2UC 2YUWA 3QJQB 4HLZG 5ANMA 1U3HD 5CGBA 3LNDA 3BSZA 3MREB 2NY3D 3QQDB 3LEVH 4F37K 2QKIA 4I2XE 3WNLA 1VESA 3SDAC 4PRAB 5C2UB 5CF3A 2XC8A 1IKFH 1QSVA 3DOHA 1TQWA 1HDMB 1PKOA 4ZAKC 1HOCB 2WM0A 3RE0A 4ZG1A 3I3DA 2DPKA 4RISH 3J07A 4F8NA 4HBCL 3OXRB 4KQ4L 1KCSH 3B2MA 5DMIL 2DF3A 5DA0B 4BRVA 1NH6A 3S8WA 3U7WL 4CN1A 2EP6A 4Z3IA 3TEZA 1ZDSA 3SQBB 1FV1B 1GZHC 4JM4H 2QPEB 3TT3H 4P46B 2VZVA 2AV1A 2PP7A 3LDBB 4IBYA 1N2RA 4L4TE 3US9A 2Y6SD 2HTKD 1SOXA 3GZKA 4MB4A 1NEUA 1BZOA 5CEZL 3UBHA 5HPOA 3ARPA 3VI3B 5C3TA 2IH3B 3MZTA 3QWOB 4MCZA 5I15L 2YA2A 4GP5B 2ZUXA 1ED3B 1YEHL 4JDVA 4ENZA 1TDQA 4DZ8B 4J8QA 4KMQA 4ZYKA 3IE4A 4GG8A 2PXYB 2N7SA 1I7TB 3LKNB 1IC5L 4MBOA 4TQHA 1NWPA 3A22A 1XIWA 4PJIF 4H40A 1D5ZA 2ZP8A 3Q8FA 5C0ND 2PO6B 1E4XI 3VFGL 1R9FA 2DI9A 1P0SE 1KGCD 2AABL 4NRXA 3IPEA 4DKFH 1MFAH 3TBSB 3DX6B 4JJ5B 4NQCE 5LXGH 1T5KA 5I19H 5IJDC 1YNTA 1N0XH 3QEGH 2WVSA 4HEPG 3MLUL 4AVJA 5ITBH 3SY0B 5D5MA 4A6YH 1YQ2A 3DA0A 1WIPA 3AM8A 2NNAB 4Q97A 1G7JA 4MQSB 4K07A 3FRPB 3L9YA 4U1KA 5F8QC 5HI3C 3T0VA 5I76A 5KYUB 4HH9A 2G9HB 1RMFH 2W0KA 1QYGL 3T77B 4DH2A 1J48A 4MJ6A 3QUKB 5AG8A 4ONHB 4QOKB 4LVHB 4LCUA 2ENQA 2XWDA 2BSED 3MRIB 3TEWA 5TQ0H 4PJHE 4P5TC 1RZJH 1P5UA 2XN9E 2BY1A 4XOCA 4PJ7B 4XN4A 3SCMA 5JW3H 3BDBA 4XRCA 3ILQC 3DVFA 3GBMH 5KSBE 1RLBA 4UV7H 3KYAA 2ODIA 1EAPA 1HH9A 5BV7C 2BVQB 2Y2WA 3QIUD 3GIVB 2Q8AH 3PHAA 3OKNA 1T2JA 2WTPA 1YEKH 3P3YA 2ZWLT 4R4BB 2CBMA 1XGPB 5T1KA 1HNFA 1RZ7L 3BUPA 3HS0C 4TLUA 5TQ2H 4LLUB 4BH8B 3FTSA 4DEPC 4HSAC 3BWAB 3LN5A 4YOKA 4Y9BA 5IZ7A 2VOTA 1S5IL 2XG4A 4EI6A 2FB4L 2GSIB 1IJ9A 1F11B 3IJYA 1NEZB 4FTVE 1KXHA 3VGAB 5KSBA 4UT9H 3VFMB 1H3VA 1N64L 1SLXA 2VMCA 5BOJA 4KNUA 1EEYB 3KCWA 4DAGL 5B39A 1BJ1J 3U7YL 1CLZL 3LPOA 2FGWH 4YHKL 1I9JH 3VXUE 3V4UL 2ZX7A 4PCKA 3VO0A 1PX3A 5DK3A 4N8PA 4AQ1B 3EHBC 3ARDD 4HLJA 5KZCD 2XFXB 3HMWL 4NM4H 4U2YA 4AE1A 3ARBB 2H3KA 3WDJA 1OL0A 2AK1H 2FYVA 5SV4A 1NC2B 3MJ7B 2G0LA 1HCZA 4G1MB 3GHEL 3QQ9C 5TDOB 3ARBD 2CK0H 3P2DA 3UTSA 3UGUA 4DVRL 3DX7B 3C6LA 3OB0H 2YWZA 1ZTMA 4V1DB 1GYVA 5T5FH 2H3XC 5GGQL 1J8RA 5C0RH 3RHWF 2BNRE 2GAZB 5AW2B 3LZRA 1OW0C 5A2IH 4EJ1C 4V33A 1KYDA 1LO4H 4OIFA 1YNLH 2WWNA 1JIBA 3H55A 5EN2A 3ZDXB 2CSPA 2Y7OA 1CR9L 2EDRA 3B2VL 3CHSA 2OX5A 3D2UB 1QATA 5BRZA 1ECYA 3RTQD 3FAXA 5DLLA 2XTJB 3VD2A 3BD5A 5JHDE 4IRZH 3NFPB 2NCEA 3FQYA 4NO0D 3MRJB 4A6YL 1B3IA 2EDXA 4RGNB 1I1RA 3NBNA 1OQOA 4PTTA 2F1BA 1JI2A 1ZXQA 4RGMB 3DX8B 4ANKA 4G7QB 3JTSA 5AAWA 4UU9A 2P3YA 2V9UA 1JYNA 3O6ML 2UUDK 4EE2A 1NCNA 1XQ4A 4OFQA 3MACH 2CNYA 5FLUA 3Q06A 1N19A 1MELA 2DWDB 2WBJC 1WG3A 1HH6A 1YEEL 4D8PB 1W0VA 1KIUB 3IFLH 1IC0A 4HS8H 1S5HB 3BP5A 3TIDA 3DYMA 1P53A 1AI1H 3ABLB 3UGXA 4BUHA 4IBLT 2IG2L 2NY1B 3KZ8A 4AG4H 5TE6L 1AE6H 1WA1X 3BZEB 3JTBA 4JLRB 1OT1A 5IBUB 2R1WA 2Q8BH 2KKQA 5FECA 1NLDH 4GAJH 4R6UA 5IW6A 3UZVB 3IF1B 3I85A 3QR0A 4MAZA 3BKJH 3MLZL 2ROXA 2A9NH 3EGDB 2B77A 4XN9A 3WSQH 4Y9CA 1VDGA 5EOQH 1D5MA 2Z35B 5DJCA 5I1GH 2R8SL 5EBWB 4F7CB 1WEJH 4RMTA 2HLAA 4K0OA 5L4FA 1OCWL 5CWSB 3MRCB 3SYPA 2VM4A 4GSRA 4RRPG 4P49A 4XO8A 1QTPA 1UHVA 4MXWH 4Y7OC 4JB9H 3VDBA 1MJ8H 1WBYA 1CPUA 1CIDA 1LDPL 3I6LD 2R56H 4Y2LA 1SEQL 25C8L 4KU1A 1D5RA 2P5WE 4AJ0A 4AUJA 1IBDA 1MF2H 3SQOH 4JZJA 4YPJA 5FUCE 3I6GA 4A6YB 2ZOWA 4NEHB 4WWNA 1NANI 1UCBL 2XA3A 3RX5A 3CPLB 2BP8B 5IOPA 4HUUB 3O8XB 3EYVA 4W9EC 3K3QA 1C1EL 2D0HA 4J3WA 1FSKC 4KITB 2AERT 2ICWA 4Z5RB 2BFGA 4U3SA 1KIQB 3LEYL 4XC3L 2L7EA 4ODTL 4BSVB 3QWNA 1K4DB 4DP0X 3M45A 4I0CC 3CMOL 1LVEA 1TMCB 3UYOD 1KBGH 4JO8A 4ERSL 4KZCA 3AG1B 3QDAA 3PWVA 4XI5D 5FW7A 3SDXA 1QFUH 1AHKA 4ATWA 4PRAA 1CI3M 1J1XH 4TKWA 1AQHA 1J5IA 1LK3L 4GT0A 3BYYA 3FT0A 1S7VB 4N2DA 5I1AA 5DRZB 1MRCH 5CGYD 2FX9L 4NKQB 1T5WB 1LEKB 4PB9L 5I26A 1UXWB 3BW9B 3ZE2F 4CC4A 4DOHB 1CGYA 1RURL 2JJTA 4IQHA 1D5XB 3EBIA 2EC9T 1MHEA 5AAPA 4JPKH 3IU4L 4HZLA 4AVKA 3AGVA 4MSWB 4NNXB 4P2OD 2L3BA 4AUYA 2PWDA 4BFEA 2WJ7A 3PP4L 2O5XL 2XETA 3Q3GA 2MTPA 4UAHA 2W07A 3WNNA 1KC5L 4LCIL 3H6JA 1K3IA 4DKEL 2IPKA 5DZOA 2Y5TB 2WSDA 3MOBL 3QUYD 3ZDXE 4M03A 3QAQA 3CFKA 1UZ6E 3UERA 1ORQA 2XWTA 3KBHE 1JGUH 2K6YA 1E67A 3GS7A 4UOJA 4AZUA 4PJ8B 3TU6A 3NQIA 4RLDA 5DUJA 5GS1C 3II2A 2OI9B 4WU7A 2PO6D 4M1DH 4PJ8C 4HHAB 1E28A 2COVD 3RWGA 3WIHH 3ZZLA 5I1CH 5LDUA 3MRBA 4NHCL 4AQ1A 2HPTA 4CU8A 2VB5A 4I4WA 1IC7H 5EZLA 2F19L 3VXRE 3MGTB 3WE6A 2EDKA 3UMTA 3SKNB 1E9PA 4LRIC 4O4YL 5LBVA 3AVEA 1H8NA 3PL6D 2J1XA 4OKVA 3TONA 4UTAL 4RDQG 1OAKH 1M42A 4DN4L 1EZVY 1PY0A 1X3DA 5SWZB 5CSBA 3ZZSA 1CZ8H 3N44B 4PWHA 2VDNL 3FO2B 2P44B 4A63A 2DD8H 3OKKB 5DUPL 3QXTA 1TQCB 2HX7A 3S3CB 2VLRE 5CKAA 1UZGA 1HXMA 4FFZL 1KIPB 1T7WA 3DRQA 1OGTA 5CN3A 2QV4A 1EERB 4N24A 3KPNA 4U1NA 2H2SC 3L16A 3X17A 4GH7B 5H37H 4PJEF 3WIFB 1W0YT 2VDOL 3B9KA 3GC3A 4ZDHA 3BPLB 4JFXA 4PLJD 1GIGL 5DQDH 1CU4H 4AEIL 1Q9LA 3IJ9A 4M61B 1YEWA 2WGNB 1JL8A 5EU3A 1TVHB 4KROC 1QPXA 3V4VL 3QE5A 4NC1E 4Y88A 4JG0L 2RMNA 5IFHL 4C56D 3PDOB 4AIZA 4OV5A 3WLBA 1CMOA 2VSKB 4E9TA 5FPIA 3CNKA 3S5LA 3WY3A 1O9VA 5A2JH 4IDJH 4LSPL 2NXZD 4MA8L 1EHLH 5EZOH 4WI9A 3L81A 4M02A 2WBXA 1P4IL 4MJ6B 4PCSA 1YRKA 4PJ9C 2OS7A 4JAMA 2W0LA 1ZSDA 1ZHLA 3GXTA 3LS4H 3HG1B 1U8CB 3Q6GL 4N0YL 3AREC 2DQUH 3VFTB 1WISA 1J05A 1S9WB 2VSDA 2WKGA 3QNZB 4TLKA 5SX4I 4DGVL 4NKDA 4YXKH 5EF0A 5B3JE 4QNPE 5ALCH 1VFBA 3Q5OA 4PRPA 5J0BA 3U46A 2OTWA 5J1TC 4FC3E 5KSBB 1DVFC 3LQZA 3L3IA 1KN4H 1TJGH 2HT2C 2ZXDA 5F88A 1AHWA 3C6LC 2VDNB 2CH8A 2I9TA 4KRPD 5FM5M 3V55A 4Y4KD 3EGDA 1R4XA 4PTUA 3VG0H 3QJVB 3TO4C 2H0EA 1E6JL 3I2CL 1PIFA 1IAKA 2BC4A 1JD9A 4XO3A 2EEFA 1MCBA 1II4E 2WXRA 1CK0L 2W65B 1DL7L 1UWXH 4WNQA 5C0CD 1CXIA 1TTFA 1ZHKB 2ZZUT 2WVUA 2X2JA 4XO4A 1KB9K 3I6KA 3MV9D 2R2EA 1H3TA 3MRFA 4NNPH 5DJ8B 1IGFL 5C0CB 3PGFH 1Z9PA 3PYCA 3VXPA 1LQBC 4YZFF 3GZPA 3ZVVA 3UYPB 4YNYB 2G5BB 1ESOA 1JPFA 1C1EH 2Z31D 1FA4A 3FT3A 1U36A 4YQXH 5ICXA 4E9XA 1LO5A 3MUGB 4XMWA 4XVUC 5GRUL 5TDPA 3X3GH 1NGYB 2YKLH 1ZKAA 1UACH 4FFYA 2YAMA 5GZND 4JFYB 5L9DL 4QHMA 3K6SB 3OAZK 1CTOA 5D6CA 5C0EA 3C5SA 4PJGA 4U3SB 3RVXD 5KBKA 4FFVD 4CVZA 3VXRA 3L5HA 4NNPL 5HPMB 3QUXB 4G6FD 4YO0B 5LAXB 2YPLA 3VD0A 4LPYA 1MCQA 4FA8A 4WRLA 3CAFA 3DRTA 1QLEB 4Q2ZA 3UTTB 4MCNA 3UTSD 4FQJL 1B9KA 2VIRB 2BMKB 2P5WB 1EV2E 1SHXA 3NJFA 1S7VA 5G2NA 2DLHA 1YHPA 3I2CH 2FO4A 3DBXB 4MDJA 2C9XA 3WSQL 4Z7UA 2QVIA 3APNA 1OT4A 4HIJB 4MVBD 1X6NA 2K9UA 2GPZA 3BKJL 4B0MB 4F20A 3P0YL 4CKVX 4MSWA 4NNXA 1PU0A 2NZ9C 3NZSA 2PWGA 3RFZA 3TVMB 4HOXA 4Z3EA 2JTDA 3V5HB 4XN5A 2QGBA 3LRMA 5A3IC 1A5FL 4RGOL 1AZVA 1MCWW 3NESA 3SBRA 3KXFE 4YBQD 2UZXB 5E2UH 2LTQC 3IFLL 3RWDB 3HOGA 3T4YB 3MYZA 4I77L 4J4PD 2AEPL 4PLJC 5ESVB 4L8CB 1WCBB 4NCC1 3HEIB 4FXTA 4JLRA 1BQLL 4DCQB 1NA8A 4ONFL 2X4UA 1U3ZA 1P4IH 2YJQA 2L7UA 1T1YA 5EZOL 1EFQA 3HE7A 5C0AA 3MGAA 2FH6A 1B0WA 3WKPA 3VGAC 3H9HB 1GMEA 4B9JA 4B27A 3IJ8A 1XCQA 4X8CA 3BEVB 1I75A 4YR6B 4A7GF 1X5LA 1SFHA 2FWOB 4HS6A 3X3FH 5HGHA 1CFVL 2E4FA 4IRZL 3H9SA 4DO6A 4YHZL 1XBDA 2UXGA 3SGJA 4TOYH 4P06A 1JZGA 1F8TL 3BW9A 4R96A 3T3PF 1T6VN 3WS6A 3O9WA 3UJTL 1N59B 1JTPA 3BT0A 1FQ9C 4XPAH 5CZKA 3FUFA 4L4TD 1T0MA 4PWFA 4M8UA 4JX0A 4ZO7A 1VCBC 2FATH 2WHVA 4M29A 4G5AA 1NMAH 5JOFA 4YXLL 1LO4L 2XVGA 1PQZB 4OM0L 1KT2B 4GBXD 3EO0A 3MRRA 3W2DH 5I5IA 1WFOA 4XXDB 2NY2D 3GK8L 1K8IA 5EDXA 4K3EL 1U8HB 1LO0L 4K23H 1BF8A 2V2XA 4XNUH 3O4LB 3QCTL 3NJXA 5ALBL 5FFGA 5I74B 4BCXA 3QK0A 2HFEA 5LWYH 1AQDA 3HZVA 2EKSB 4D0BB 3CVIH 3BMWA 1DVUA 5D7JC 2H0JA 3CXHJ 1A7OL 2Y07H 2AEQH 4NQXA 3MRNB 2WNXA 2DAVA 1QFPA 4A6YA 4FNRA 3NPSB 3P9WB 2P5EA 3ULVE 3INUL 2ESVD 5TGBB 4Y19A 2C4FU 2RD0A 2R0ZL 5T3XL 4GYBA 4K3JH 3NPSC 5IOKA 3T3MB 4UQAA 3QZWA 5I1CL 3B1TA 5DVNA 1E5UI 4MJ2A 1H6UA 2WLMA 3RLSA 4YHKH 1GGIL 3N1MC 2X4NB 2DLTA 1G6VK 1ADQL 3D4CA 1KTJA 3G6DL 1MCEA 1OO2A 3EJRA 4GKNB 4U05A 4U1SB 3RIAF 1AXSA 1S9KC 1JXJA 4DPRA 5CLWA 2AZUA 3ARBC 3H0TA 3F01A 4DKEH 3WEBA 2JKJA 5D4HA 2UWEF 3W0WA 2P47B 4OY9A 5I1AB 2YPVH 4IBTA 4P9MH 4XPGL 1K8DB 1DO5A 4PRID 4PS8A 5JOPE 4XR8C 4NS0A 4E41B 1UWGH 3X13A 5DJXB 3S5ZA 5JPMB 3SOBH 3K71B 1ANUA 3DUSA 4LRNL 1ZLVH 1PG7X 2UWEB 3QQ4B 2BX5A 4IRSD 3TV3H 3G6JB 3IXAA 3LN9A 5JHDA 4XO5A 2FWLB 1WICA 5CEXA 5I8EA 4JCWA 4I4WB 3VYPA 1ZV5A 3A6BH 4LSTH 3AY4A 4F15C 3UDWA 3FQXB 4PPTA 2EXTA 4X9FA 2JMRA 2XHNA 2Y5TA 4RMQA 5IJKC 1JV5B 3CMOH 3FOMB 3BUTA 3A3YB 3V0FA 5E9DD 3PGCB 3UG3A 1KJVA 3P2TA 4Q6IB 1G0DA 4WTZA 3GTTA 4PJ8A 2ERJB 4LLMB 1RKRA 3BXNB 1DQIA 4JS7A 4Q4EA 4I48B 1SYVB 1BZEA 3VW3H 1WUZA 2GSIA 1IFHL 3IJYB 5F0JB 3SYOA 2NYYC 1I7RA 3RGVA 2NUTB 2CO7B 3EZJB 3HC4L 3MROB 4M4PA 4XMKH 1SHSA 2M8XA 3KPRA 1R3LB 3QULA 4KKCD 1A4JB 1OHQA 5IB3B 3MLRH 3QHTC 1ICTA 1PD1A 1TEYA 4Z1PA 5F7WC 4OGYH 1AQ8A 3KM1A 2ESVA 2P28B 4P2OA 1WDAA 1OB0A 2P49B 4PRDA 4WZ9A 1PY9A 4NQEA 4Q4IA 1M6OB 5IHUL 1HQRB 3MXWL 3KPRE 3GB7B 3MU3A 4NO2B 3HRZC 3QAZB 3S9DB 5HJGA 4E0RA 1ZEAL 3IPBA 1AIZA 4Q9QL 2DS4A 1ECZA 4FDWA 5C9KA 2CDEA 2OMTB 4PB0L 4JRFA 4FERA 5HYQB 3HJ0A 2X87A 4BEIA 5L2KB 2C8NA 2F53A 4XNXH 1NCHA 4PU2A 2IXQA 1JZ2A 1A1OB 4YVNA 4FNUA 1U8CA 3F6JA 1HILA 1X7SA 3TPKA 3FO9A 3O6LH 3QZWG 5IHZA 1DLHA 2CPCA 2AFNA 1L0XA 5ISZD 2DV6A 2DI8A 4JM4L 1IKNA 4QHNA 4D7PA 1F0LA 5FYLD 4JHAH 4LT7A 4MDRA 4X7EC 1NL0H 1CFTB 2XKSA 2VC2L 5KYWA 4EO5A 3QG6B 4P5TA 2VLJD 3MXWH 3TWCH 3GJEA 1MVUB 1MFVA 4DETA 2HJLA 4GO9A 2XG5B 1NKOA 2FVNA 4PJDB 3CBRA 5D93