3HNJA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWLLIGAIHDALHLANEGKVKEAQKAAELLKAICNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnjA00
3TOMA 3C62A 1CGNA 1CPRA 1RCPA 2XLVA 4L6RA 1MQVA 2YKZA 2CCYA 2BC5A 4JKVA 3QW1A 3NMKA 3ZTZA 4U9DA 3VRCA 3ZQVA 3TOLA 4IB4A 2YL0A 2XLDA 2XL6A 4IARA 3ZWIA 2YLGA 2YLDA 1JAFA 1NBBA 5B3IA 2XLWA 2YL1A 5JP7A 2J9BA 5JT4A 4CJOA 1YYJA 4JEBA 1GQAA 4U9EA 1E83A 1YYXA 4CIPA 3L1MA 5JS5A 3NMIA 3ZTMA 5JLIA 1CPQA 4JE9A 4ER9A 3DE9A 4IAQA 3QW0A 1YZCA 5JVEA 5JUAA 2QLAA 4CDVA 1CGOA 1QQ3A 1A7VA 5AGFA 4CDYA 4D4XA 3M4CA 4WGZA 4CJGA 3IQ6A 3HNJA 3M79A 4JEAA 3U8PA 4WGYA 1YZAA 3M4BA 2YL3A 3HNIA 5JRAA 1M6TA 3QVZA 4CDAA 1E85A 2XL8A 2J8WA 1BBHA 3FOPA 5JSLA 3QVYA 4EIYA 1EKYA 3DE8A 1LM3B 1S05A 2XLMA 2YL7A 3HNLA 3M15A 2YLIA 1QPUA 3IQ5A 2XLHA 4D4NA 4NC3A 4ULVA 2XM4A 4CX9A 2XLEA 3ZQYA 3HNKA 1APCA 2XLOA 4N6HA 1E84A 1E86A 256BA 3C63A 3FOOA 3NMJA 4N4WA 2XM0A
chains in the Genus database with same CATH superfamily
2WZLA 4CS9C 1N1CA 4ZLDA 2I8BA 1RCPA 2HFIA 2OQMA 3JCUQ 2LFDA 3LEVA 4BEMJ 4MW3A 3WHNA 1VYKA 1XWJA 4YL3A 3KKBA 1D0ZA 3MYIA 4EWCA 1LE2A 2BC5A 3FAJA 4R32A 1TWCA 4CSAA 3EZIA 4XEFA 3E9VA 4O7GA 2J9UA 1WGWA 3F47A 2CNWA 4XPWA 5EGYA 5KYUB 4E18A 4KNVA 2EPKX 3GM1A 3ZQVA 1DOWA 1B68A 2G62A 4MNDA 4U5BE 1OR2A 2YL0A 4MVUA 1T01A 1XZPA 1A7EA 1ZHWA 1G4WR 1O87A 1EI7A 5KYXA 3ECSA 3X2QC 5AC4A 2YLGA 4RD9A 3U2MA 2EILC 4DRIB 4MVRA 1JAFA 3GWNA 3LAYA 5B3IA 2TMVP 2PNOA 3CZ6A 1HE9A 1Z5ZA 4XQ1A 3BRJA 5CI8A 5A6AA 5L3VA 3UGPA 3CAXA 5DVWA 2Y69C 4U5EE 1EA8A 1FAPB 2XRHA 1GQAA 3EGDB 2V3CC 3LNRA 2W9YA 4Q4ZF 4CSAC 1WASA 2VH3A 3U9JA 1JPNA 3M1CB 4CIHA 5D91A 4G7OF 3AG4C 1LS1A 2NUTB 4XPYA 5GPGB 3ZTMA 5JLIA 3SP1A 3SXKA 4JE9A 5L0IA 3JYYA 1ZU5A 1A7DA 2NUPB 1M57C 5L0HA 2G3KA 4IWBA 4U5HA 4IAQA 3SXZA 5F5HA 4H4KC 5BUOA 5KYNA 1TFKB 4J30B 1ZYRF 3O39A 4JCZA 3V7OA 3C8GB 3T4RA 3UR3C 3HTKC 4EKWA 5BQIA 5JVEA 5L0CA 4K1OA 1U89A 4I3MA 2IBFA 4O6MA 3FHDA 2QE9A 2HSQA 1R5ID 1BR4A 2DB4A 5DLJA 3UGOA 2XXAB 2Q3TA 3HNJA 3OA1A 4NY3A 3JYHA 3TJ6A 5DS6A 2MYSA 5L3QA 1UFBA 1NU9C 3ZG1A 3AOUA 4JJFA 4OINF 5A6BA 3OWTA 3V5YA 4DOZA 3RVYA 4FAPB 2R7RA 1M2OA 1O5HA 3O10A 4I1MA 1T5OA 4EBKA 3ASOC 2QTVA 3S27A 1YZAA 3EGXB 1HY5A 4W8KA 3U5SA 4O79A 3EHNA 1I4YA 4FESA 4Z9JA 1OW7A 1M6TA 3E70C 4HE8D 3UMKA 3IEEA 4CDAA 1TQGA 2ETSA 5JRAA 5K0IA 1E85A 2OEXA 4N06A 4P6IC 1LIHA 4K0DA 4YL0A 3U3FA 1BBHA 2ZXPA 1RKEB 2AP3A 2VB6A 4PFOA 3NRHA 3UMHA 2Q00A 3RH3A 4YWQA 1Z7Qc 4CBEA 3LS1A 1IW7F 2CDQA 5DQTA 4HFFB 1D1CA 1ZVZA 3GEIA 3KL4A 2P6VA 2KSFA 2LD6A 3X1OA 1QPUA 3PCVA 4OIPF 3JSEO 1CGME 4BJ5A 2DYSC 4NC3A 3MYFA 4ULVA 4AE4A 1OQCA 4D4NA 2OEVA 4W8PA 3IQCA 2XS1A 1RKCA 2WVQA 2GFHA 4JJGA 3DMDA 3TK0A 1E84A 1G8XA 2RSEB 1WTYA 2ZXOA 4BJTA 3U2LA 5TJ5E 3ZWIA 1ORSC 3FVYA 3LESA 3TOMA 3DI5A 4WABA 1A41A 4Q7CA 2AU5A 5HV9A 3G4ZA 1VB5A 1FFTC 2MHRA 4AL0A 2PX3A 3AQBA 4JVSA 2E87A 2WZFA 2J7PD 3Q6NA 2EIKC 3FAPB 1G5ZA 2PFDA 2R02A 4YN0B 4DBQA 4NTBA 2O9XA 1L3PA 2EPMX 3LUTB 2PBEA 5DQZA 1VOMA 1T9KA 4OD5A 5L0GA 3NMKA 4QI2A 1SR2A 4BJ5C 3EH2A 2EIJC 2IXMA 5KYWA 1Q0GA 2WB7A 2IM8A 3JSZA 1KNYA 2XLDA 2VC9A 2B0JA 3C18A 2XSEA 3C8GD 4JTAB 4U5FE 5E2QA 1T6IA 4XWJA 3WAQA 1FFHA 5F28E 4G7HF 4LLEA 1FMVA 2X51A 3L34A 3LNMB 2GWWA 2DYRC 4J7YA 2YLDA 3W8IA 1NBBA 2G3VA 4ULWA 2EPOA 1Y6DA 5JT4A 2IXPA 3ABLC 2Q9AA 3RIPA 1YYJA 3S0XA 3HKKA 2D4UA 1SMYF 3VM6A 1MMDA 1Z6AA 4U9EA 1E83A 3IPMO 1H9TA 2L7AA 3T6BA 1Z63A 3MBGA 1M2VB 1YAUO 2Q4FA 4CIPA 1MNEA 2AVKA 3L1MA 5JS5A 2R7UA 2W4BA 1YVIA 3NKDA 3R2PA 2V26A 3A9CA 2L9JA 1Q0DA 3VF0A 1Q0FA 1TKNA 3MFNA 4O6NA 5T3TA 1NFNA 2KC3A 3DE9A 2FFHA 3EFOA 2QNLA 4JZAA 3QW0A 4CS7A 3DAFA 3MX3A 3DM9B 3DXJF 1CGOA 4LDRA 1QQ3A 2GA0A 1A7VA 1JPJA 5E33A 1PV3A 3K1IA 4MTFA 4CDYA 5AC5A 2J9VA 3N0TA 5B1AC 4GEHA 1F1MA 4I44A 2X0CA 4OIOF 3JT1A 2C04A 5T1DB 3U3BA 4WGZA 1PD1A 3KPHA 5A69A 3VAYA 2FAPB 4A4AA 1BDJB 2NSGA 3GEEA 4JTCB 4G0HA 1S7ZA 4JURI 3C8ZA 1T6UA 2LFFA 2M64A 3L0IA 3M79A 5BQGA 1LI5A 1MNDA 1OKKD 3U8PA 4ANJA 1VLTA 2HMQA 2LSEA 1J8MF 4BPMA 1IZMA 4C7OB 2R7TA 3EG9B 4F4BA 4G7ZF 1C17M 1VTMP 1V74B 4PACA 2HV7A 1TWAA 3CEXA 2ZD9A 2B0HA 4PK4A 2JPUA 4OD4A 3W2WA 4NCQA 1LPEA 2XL8A 4H54A 1L7CA 2CNWD 1G4US 2KW3C 2J46A 5FZTA 4C3DA 1OXBA 3K1IC 3KMIA 1TR2A 1Q0MA 3AG1C 1YJGA 2Q9CA 2R25A 3AGTA 3DWWA 3ZVRA 1S05A 2JX0A 4MS2A 4XTKA 5D92A 4Z9HA 4EUKB 2AWYA 3HNLA 4J7TA 4FX5A 1O3UA 4QDLA 3M15A 2AWCA 3NG1A 3CSKA 4MVQA 3SEOA 5KYYA 4P9TA 3G50A 3DZAA 2J0WA 2HSBA 2OJED 2XLHA 1SZIA 1WWPA 2YQYA 2XL4A 3V5XA 1HW2A 3B71A 2CW0F 2XM4A 3HNKA 1APCA 1LI7A 2R7XA 256BA 1E2XA 1QVXA 4DJ9A 3S28A 1RJ9A 3ZTZA 2R7SA 1HMOA 2XM0A 3NKEA 2L6FA 1CGNA 3RQFA 1CPRA 3V5ZA 4DVYP 3GM3A 3W8HA 4YL1A 1KU2A 4YT8A 4L6RA 4C3BA 4EBJA 5EHHA 3RKOF 5T3WA 2LK4A 5DS4A 1V55C 2OKUA 2YKZA 4BJ6A 1U0BB 3GORA 2CCYA 3T6JA 4KBLA 1J8YF 2EIMC 1FTSA 2P7VA 4YT5A 1ORJA 2FGYA 1Y4CA 2Z15A 1BZ4A 2KNHA 3RVZA 2YHSA 3T9OA 1ZW3A 2KQ9A 3ZIBA 3UMIA 4E0IA 3O55A 1PD0A 4U9DA 3F46A 3RQGA 2IXNA 2RD9A 4IB4A 3QZCA 3EGDA 4LERA 4ONSA 4NTAA 4RBNA 4WJ0A 2R7OA 1YDIA 4IARA 4B6IA 5L0JA 3Q6MA 3EHMA 4MVZA 3U9MA 1V4AA 4LDKA 2NUTA 2GDCA 4IAOA 4LACB 4X0RA 4JRZA 1QSPA 3ZSUA 2XLWA 2YL1A 3AG2C 3LJBA 4MVMA 2OG2A 3B0VC 4CJOA 4PJJA 3S90A 1GM5A 4BJ6C 3UNGC 3Q7GA 2Q9BA 2VCCA 3C8GA 2HS5A 1BR1A 2P0NA 2A1DD 1V54C 1FR0A 3SXMA 4BJ1A 1D0YA 2VCAA 1WATA 3A11A 3K33A 3ITFA 3RYLA 5KYXB 2R7VA 4XPXA 3MLGA 3LLIA 5F5FA 3ABMC 4ER9A 3W2VA 2EPLX 5L0DA 4XLPF 2XXAA 4OIRF 1OR3A 4KC9A 3JTLO 4PJNA 1HMDA 3B0UX 2M4EA 4FWVA 3ZC4A 5JUAA 4CDVA 4U5GA 2R7WA 2W45A 4AX2A 3GWLA 3H2VA 3Q7LA 4M63A 2HKVA 4JCHA 2ZPAA 4PFPA 3R7CA 4P9FA 1OCOC 1QKRA 3EGXA 2IYLD 3JRMO 3M4CA 1T6QA 3RQEA 2A6HF 1D0XA 1VK5A 2IXOA 2ZXRA 4NTFA 1MMGA 1C03A 2YWAA 4MW8A 3TJ5A 2WVNA 1RXQA 5FCLA 4KI2A 3DM5A 1SYQA 5BQHA 3L8JA 4I1OB 4JEAA 2H7BA 3KYJA 1FMWA 5EK0A 5L0FA 3H65A 4XEVA 1ZHTA 3HLZA 4WGYA 4JTDB 1I4ZA 4A2NB 3M4BA 2NPUA 3T6GB 4EBBA 3SZRA 2PX0A 3JRTA 5B3SC 3QVZA 4K7BA 3K6BA 3KH2A 1AVOB 2Y3DA 3FXHA 4EHPA 3DKAA 1ZHYA 2WZGA 2L81A 3I4UA 3US6A 2J8WA 4NQFA 1ZHZA 2LP4A 3FOPA 3QVYA 3KYIA 5JSLA 2HV6A 4EIYA 1WOLA 2VASA 4Z9IA 3DD7A 3DE8A 3B29A 4YK5A 1LVKA 1LM3B 1HW1A 2XLMA 4HFKB 4MQ9F 1FNTc 4E7ZA 1JR8A 4UDVA 2KGOA 3EZHA 4O6YA 4XLNF 2H8AA 4JC7A 1RJ9B 2J45A 4GYTA 1D1BA 3S9OA 5HSWA 3C7JA 2A6EF 3VYWA 3AG3C 1NSGB 3W4YA 1AUEA 4QI0A 3S84A 2XLEA 3LS0A 3ZDLA 3AQCA 2HJMA 2QY9A 1PCXA 2CGEA 2Y3GA 3DAGA 2D5RB 2HJ3A 5E3AA 4CS8A 1E86A 4IGGA 1NFOA 2DGJA 3ABKC 3FOOA 1U6HA 4JW1A 4N4WA 1JRAA 2UUIA 1H6GA 3C62A 4XEKA 5B1BC 1OXKA 4E7SA 2XLVA 3B0PA 1XZQA 1ORYA 2EPNA 1MQVA 3RFYA 2C03A 4PR9A 4AE4B 2JD3A 3BEHA 4N6CA 1W2WA 2YZSA 4JKVA 4U5CE 2OOCA 3CQZA 1VLSA 2BL2A 2HMZA 1OW8A 2W4MA 2YEVA 2LCHA 3EPVA 3QW1A 2A68F 1H9GA 3HJCA 3K66A 1UG7A 2Q7RA 4YJWA 3QMKA 2R7QA 5CIVA 3RF3A 3VRCA 3TOLA 4E17A 2XS8A 3DJNB 1OCRC 3AJMA 4JIOA 3H2UA 2EINC 2XL6A 2A69F 1M2VA 2OCCC 1VMAA 2Y3BA 2DI3A 4CS8C 2MWQA 1D1AA 5KYUA 4G78A 4J32B 1H7IA 1NU7D 3K1HA 3U8VA 2OU6A 5JP7A 1ZHXA 2J9BA 1NZEA 5A6JA 1EQ1A 3I5QA 4LDQA 4IJJA 1KTMA 4U5DE 1OCCC 4JEBA 3SNHA 2KJGA 5KYWB 3IQTA 3S29A 1K05A 2NSFA 1ST6A 3FMSA 3K7DA 3GANA 4MVSA 1YYXA 3G4XA 5DS5A 3NDBB 2CYDA 3NYLA 5COMA 3NMIA 4MVOA 3PHF2 1NLXA 2H7VC 1CPQA 1Z23A 3POVA 1LS4A 1K40A 2P61A 2QUPA 3EH1A 4OIQF 2F22A 2R03A 1GGQA 1A0BA 3QTHA 1R4TA 1Q0KA 2J7PA 3WG7C 4YT2A 3ASNC 1YA9A 1YZCA 1DOVA 2ASRA 2QLAA 3FDQA 1ZU4A 1TWGA 2PP4A 3RW0A 4C7OA 2UUHA 2YRFA 3EG9A 4DRJB 4YT4A 1I5NA 3NYJA 5A6BD 3TD7A 3TQOA 2NUPA 5AGFA 3PDMP 4IRUA 4AK9A 1M56C 3PMRA 2ZXWC 4D4XA 3IHUA 3LLKA 3O6XA 3B9QA 1JMWA 4DBRA 2R9RB 1QLEC 3L8IA 3I5PA 4MTGA 3IQ6A 4CJGA 4DRHB 3SYNA 3EFOB 2PF4E 1HE1A 3AGUA 3GM2A 3JZ0A 3EJNA 4DVZA 1QZXA 1LE4A 3GEHA 4GQHA 2J9WA 2YVKA 2A0UA 3NYMA 1MMNA 4RDAA 2ICWG 2LIGA 3N24A 1YLMA 2YL3A 1VYIA 3OEOA 5CI9A 3DJUB 1TFOB 3J06A 1GS9A 3HNIA 2HZ8A 2IOQA 2R05A 5COFA 1TWHA 4BEJA 5IY5C 3EQLF 1OCZC 2LQGA 2BE5F 1ZZPA 4BG0A 4CS9A 2L6GA 2KK1A 2H7OA 1C02A 5KYYB 2J0XA 2WL8A 5COGA 2OJQA 2HUJA 4PJMA 4C3EA 1EKYA 1WN0A 2GAQA 4KNWA 2KYHA 2I15A 4LLCA 5A6KA 4PJLA 2P1AA 1SF8A 2VCBA 2YL7A 4DXWA 1BR2A 2WVOA 4E0HA 1LKXA 2NG1A 3GODA 3WODF 3TULA 2YLIA 1Z3IX 4ZLCA 4Q5SF 3N2ZB 2Y39A 1RKEA 1OW6A 3IQ5A 1RMVA 3SXYA 3ATPA 3U0CA 2Y3HA 1ZW2A 1K04A 1NG1A 4AL1A 4CX9A 3ZQYA 1YA7O 1MMAA 4HEAJ 2XLOA 3LEOA 2A0BA 4N6HA 2L6HA 1YARO 3C63A 1AEPA 5E3CA 1JOGA 3NMJA 4MTOA 1OKKA
chains in the Genus database with same CATH topology
3TOMA 3C62A 1CGNA 1CPRA 1RCPA 2XLVA 4L6RA 1MQVA 2YKZA 2CCYA 2BC5A 4JKVA 3QW1A 3NMKA 3ZTZA 4U9DA 3VRCA 3ZQVA 3TOLA 4IB4A 2YL0A 2XLDA 2XL6A 4IARA 3ZWIA 2YLGA 2YLDA 1JAFA 1NBBA 5B3IA 2XLWA 2YL1A 5JP7A 2J9BA 5JT4A 4CJOA 1YYJA 4JEBA 1GQAA 4U9EA 1E83A 1YYXA 4CIPA 3L1MA 5JS5A 3NMIA 3ZTMA 5JLIA 1CPQA 4JE9A 4ER9A 3DE9A 4IAQA 3QW0A 1YZCA 5JVEA 5JUAA 2QLAA 4CDVA 1CGOA 1QQ3A 1A7VA 5AGFA 4CDYA 4D4XA 3M4CA 4WGZA 4CJGA 3IQ6A 3HNJA 3M79A 4JEAA 3U8PA 4WGYA 1YZAA 3M4BA 2YL3A 3HNIA 5JRAA 1M6TA 3QVZA 4CDAA 1E85A 2XL8A 2J8WA 1BBHA 3FOPA 5JSLA 3QVYA 4EIYA 1EKYA 3DE8A 1LM3B 1S05A 2XLMA 2YL7A 3HNLA 3M15A 2YLIA 1QPUA 3IQ5A 2XLHA 4D4NA 4NC3A 4ULVA 2XM4A 4CX9A 2XLEA 3ZQYA 3HNKA 1APCA 2XLOA 4N6HA 1E84A 1E86A 256BA 3C63A 3FOOA 3NMJA 4N4WA 2XM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOM A;  3C62 A;  1CGN A;  1CPR A;  1RCP A;  2XLV A;  4L6R A;  1MQV A;  2YKZ A;  2CCY A;  2BC5 A;  4JKV A;  3QW1 A;  3NMK A;  3ZTZ A;  4U9D A;  3VRC A;  3ZQV A;  3TOL A;  4IB4 A;  2YL0 A;  2XLD A;  2XL6 A;  4IAR A;  3ZWI A;  2YLG A;  2YLD A;  1JAF A;  1NBB A;  5B3I A;  2XLW A;  2YL1 A;  5JP7 A;  2J9B A;  5JT4 A;  4CJO A;  1YYJ A;  4JEB A;  1GQA A;  4U9E A;  1E83 A;  1YYX A;  4CIP A;  3L1M A;  5JS5 A;  3NMI A;  3ZTM A;  5JLI A;  1CPQ A;  4JE9 A;  4ER9 A;  3DE9 A;  4IAQ A;  3QW0 A;  1YZC A;  5JVE A;  5JUA A;  2QLA A;  4CDV A;  1CGO A;  1QQ3 A;  1A7V A;  5AGF A;  4CDY A;  4D4X A;  3M4C A;  4WGZ A;  4CJG A;  3IQ6 A;  3HNJ A;  3M79 A;  4JEA A;  3U8P A;  4WGY A;  1YZA A;  3M4B A;  2YL3 A;  3HNI A;  5JRA A;  1M6T A;  3QVZ A;  4CDA A;  1E85 A;  2XL8 A;  2J8W A;  1BBH A;  3FOP A;  5JSL A;  3QVY A;  4EIY A;  1EKY A;  3DE8 A;  1LM3 B;  1S05 A;  2XLM A;  2YL7 A;  3HNL A;  3M15 A;  2YLI A;  1QPU A;  3IQ5 A;  2XLH A;  4D4N A;  4NC3 A;  4ULV A;  2XM4 A;  4CX9 A;  2XLE A;  3ZQY A;  3HNK A;  1APC A;  2XLO A;  4N6H A;  1E84 A;  1E86 A;  256B A;  3C63 A;  3FOO A;  3NMJ A;  4N4W A;  2XM0 A; 
#chains in the Genus database with same CATH topology
 2WZL A;  4CS9 C;  1N1C A;  4ZLD A;  2I8B A;  1RCP A;  2HFI A;  2OQM A;  3JCU Q;  2LFD A;  3LEV A;  4BEM J;  4MW3 A;  3WHN A;  1VYK A;  1XWJ A;  4YL3 A;  3KKB A;  1D0Z A;  3MYI A;  4EWC A;  1LE2 A;  2BC5 A;  3FAJ A;  4R32 A;  1TWC A;  4CSA A;  3EZI A;  4XEF A;  3E9V A;  4O7G A;  2J9U A;  1WGW A;  3F47 A;  2CNW A;  4XPW A;  5EGY A;  5KYU B;  4E18 A;  4KNV A;  2EPK X;  3GM1 A;  3ZQV A;  1DOW A;  1B68 A;  2G62 A;  4MND A;  4U5B E;  1OR2 A;  2YL0 A;  4MVU A;  1T01 A;  1XZP A;  1A7E A;  1ZHW A;  1G4W R;  1O87 A;  1EI7 A;  5KYX A;  3ECS A;  3X2Q C;  5AC4 A;  2YLG A;  4RD9 A;  3U2M A;  2EIL C;  4DRI B;  4MVR A;  1JAF A;  3GWN A;  3LAY A;  5B3I A;  2TMV P;  2PNO A;  3CZ6 A;  1HE9 A;  1Z5Z A;  4XQ1 A;  3BRJ A;  5CI8 A;  5A6A A;  5L3V A;  3UGP A;  3CAX A;  5DVW A;  2Y69 C;  4U5E E;  1EA8 A;  1FAP B;  2XRH A;  1GQA A;  3EGD B;  2V3C C;  3LNR A;  2W9Y A;  4Q4Z F;  4CSA C;  1WAS A;  2VH3 A;  3U9J A;  1JPN A;  3M1C B;  4CIH A;  5D91 A;  4G7O F;  3AG4 C;  1LS1 A;  2NUT B;  4XPY A;  5GPG B;  3ZTM A;  5JLI A;  3SP1 A;  3SXK A;  4JE9 A;  5L0I A;  3JYY A;  1ZU5 A;  1A7D A;  2NUP B;  1M57 C;  5L0H A;  2G3K A;  4IWB A;  4U5H A;  4IAQ A;  3SXZ A;  5F5H A;  4H4K C;  5BUO A;  5KYN A;  1TFK B;  4J30 B;  1ZYR F;  3O39 A;  4JCZ A;  3V7O A;  3C8G B;  3T4R A;  3UR3 C;  3HTK C;  4EKW A;  5BQI A;  5JVE A;  5L0C A;  4K1O A;  1U89 A;  4I3M A;  2IBF A;  4O6M A;  3FHD A;  2QE9 A;  2HSQ A;  1R5I D;  1BR4 A;  2DB4 A;  5DLJ A;  3UGO A;  2XXA B;  2Q3T A;  3HNJ A;  3OA1 A;  4NY3 A;  3JYH A;  3TJ6 A;  5DS6 A;  2MYS A;  5L3Q A;  1UFB A;  1NU9 C;  3ZG1 A;  3AOU A;  4JJF A;  4OIN F;  5A6B A;  3OWT A;  3V5Y A;  4DOZ A;  3RVY A;  4FAP B;  2R7R A;  1M2O A;  1O5H A;  3O10 A;  4I1M A;  1T5O A;  4EBK A;  3ASO C;  2QTV A;  3S27 A;  1YZA A;  3EGX B;  1HY5 A;  4W8K A;  3U5S A;  4O79 A;  3EHN A;  1I4Y A;  4FES A;  4Z9J A;  1OW7 A;  1M6T A;  3E70 C;  4HE8 D;  3UMK A;  3IEE A;  4CDA A;  1TQG A;  2ETS A;  5JRA A;  5K0I A;  1E85 A;  2OEX A;  4N06 A;  4P6I C;  1LIH A;  4K0D A;  4YL0 A;  3U3F A;  1BBH A;  2ZXP A;  1RKE B;  2AP3 A;  2VB6 A;  4PFO A;  3NRH A;  3UMH A;  2Q00 A;  3RH3 A;  4YWQ A;  1Z7Q c;  4CBE A;  3LS1 A;  1IW7 F;  2CDQ A;  5DQT A;  4HFF B;  1D1C A;  1ZVZ A;  3GEI A;  3KL4 A;  2P6V A;  2KSF A;  2LD6 A;  3X1O A;  1QPU A;  3PCV A;  4OIP F;  3JSE O;  1CGM E;  4BJ5 A;  2DYS C;  4NC3 A;  3MYF A;  4ULV A;  4AE4 A;  1OQC A;  4D4N A;  2OEV A;  4W8P A;  3IQC A;  2XS1 A;  1RKC A;  2WVQ A;  2GFH A;  4JJG A;  3DMD A;  3TK0 A;  1E84 A;  1G8X A;  2RSE B;  1WTY A;  2ZXO A;  4BJT A;  3U2L A;  5TJ5 E;  3ZWI A;  1ORS C;  3FVY A;  3LES A;  3TOM A;  3DI5 A;  4WAB A;  1A41 A;  4Q7C A;  2AU5 A;  5HV9 A;  3G4Z A;  1VB5 A;  1FFT C;  2MHR A;  4AL0 A;  2PX3 A;  3AQB A;  4JVS A;  2E87 A;  2WZF A;  2J7P D;  3Q6N A;  2EIK C;  3FAP B;  1G5Z A;  2PFD A;  2R02 A;  4YN0 B;  4DBQ A;  4NTB A;  2O9X A;  1L3P A;  2EPM X;  3LUT B;  2PBE A;  5DQZ A;  1VOM A;  1T9K A;  4OD5 A;  5L0G A;  3NMK A;  4QI2 A;  1SR2 A;  4BJ5 C;  3EH2 A;  2EIJ C;  2IXM A;  5KYW A;  1Q0G A;  2WB7 A;  2IM8 A;  3JSZ A;  1KNY A;  2XLD A;  2VC9 A;  2B0J A;  3C18 A;  2XSE A;  3C8G D;  4JTA B;  4U5F E;  5E2Q A;  1T6I A;  4XWJ A;  3WAQ A;  1FFH A;  5F28 E;  4G7H F;  4LLE A;  1FMV A;  2X51 A;  3L34 A;  3LNM B;  2GWW A;  2DYR C;  4J7Y A;  2YLD A;  3W8I A;  1NBB A;  2G3V A;  4ULW A;  2EPO A;  1Y6D A;  5JT4 A;  2IXP A;  3ABL C;  2Q9A A;  3RIP A;  1YYJ A;  3S0X A;  3HKK A;  2D4U A;  1SMY F;  3VM6 A;  1MMD A;  1Z6A A;  4U9E A;  1E83 A;  3IPM O;  1H9T A;  2L7A A;  3T6B A;  1Z63 A;  3MBG A;  1M2V B;  1YAU O;  2Q4F A;  4CIP A;  1MNE A;  2AVK A;  3L1M A;  5JS5 A;  2R7U A;  2W4B A;  1YVI A;  3NKD A;  3R2P A;  2V26 A;  3A9C A;  2L9J A;  1Q0D A;  3VF0 A;  1Q0F A;  1TKN A;  3MFN A;  4O6N A;  5T3T A;  1NFN A;  2KC3 A;  3DE9 A;  2FFH A;  3EFO A;  2QNL A;  4JZA A;  3QW0 A;  4CS7 A;  3DAF A;  3MX3 A;  3DM9 B;  3DXJ F;  1CGO A;  4LDR A;  1QQ3 A;  2GA0 A;  1A7V A;  1JPJ A;  5E33 A;  1PV3 A;  3K1I A;  4MTF A;  4CDY A;  5AC5 A;  2J9V A;  3N0T A;  5B1A C;  4GEH A;  1F1M A;  4I44 A;  2X0C A;  4OIO F;  3JT1 A;  2C04 A;  5T1D B;  3U3B A;  4WGZ A;  1PD1 A;  3KPH A;  5A69 A;  3VAY A;  2FAP B;  4A4A A;  1BDJ B;  2NSG A;  3GEE A;  4JTC B;  4G0H A;  1S7Z A;  4JUR I;  3C8Z A;  1T6U A;  2LFF A;  2M64 A;  3L0I A;  3M79 A;  5BQG A;  1LI5 A;  1MND A;  1OKK D;  3U8P A;  4ANJ A;  1VLT A;  2HMQ A;  2LSE A;  1J8M F;  4BPM A;  1IZM A;  4C7O B;  2R7T A;  3EG9 B;  4F4B A;  4G7Z F;  1C17 M;  1VTM P;  1V74 B;  4PAC A;  2HV7 A;  1TWA A;  3CEX A;  2ZD9 A;  2B0H A;  4PK4 A;  2JPU A;  4OD4 A;  3W2W A;  4NCQ A;  1LPE A;  2XL8 A;  4H54 A;  1L7C A;  2CNW D;  1G4U S;  2KW3 C;  2J46 A;  5FZT A;  4C3D A;  1OXB A;  3K1I C;  3KMI A;  1TR2 A;  1Q0M A;  3AG1 C;  1YJG A;  2Q9C A;  2R25 A;  3AGT A;  3DWW A;  3ZVR A;  1S05 A;  2JX0 A;  4MS2 A;  4XTK A;  5D92 A;  4Z9H A;  4EUK B;  2AWY A;  3HNL A;  4J7T A;  4FX5 A;  1O3U A;  4QDL A;  3M15 A;  2AWC A;  3NG1 A;  3CSK A;  4MVQ A;  3SEO A;  5KYY A;  4P9T A;  3G50 A;  3DZA A;  2J0W A;  2HSB A;  2OJE D;  2XLH A;  1SZI A;  1WWP A;  2YQY A;  2XL4 A;  3V5X A;  1HW2 A;  3B71 A;  2CW0 F;  2XM4 A;  3HNK A;  1APC A;  1LI7 A;  2R7X A;  256B A;  1E2X A;  1QVX A;  4DJ9 A;  3S28 A;  1RJ9 A;  3ZTZ A;  2R7S A;  1HMO A;  2XM0 A;  3NKE A;  2L6F A;  1CGN A;  3RQF A;  1CPR A;  3V5Z A;  4DVY P;  3GM3 A;  3W8H A;  4YL1 A;  1KU2 A;  4YT8 A;  4L6R A;  4C3B A;  4EBJ A;  5EHH A;  3RKO F;  5T3W A;  2LK4 A;  5DS4 A;  1V55 C;  2OKU A;  2YKZ A;  4BJ6 A;  1U0B B;  3GOR A;  2CCY A;  3T6J A;  4KBL A;  1J8Y F;  2EIM C;  1FTS A;  2P7V A;  4YT5 A;  1ORJ A;  2FGY A;  1Y4C A;  2Z15 A;  1BZ4 A;  2KNH A;  3RVZ A;  2YHS A;  3T9O A;  1ZW3 A;  2KQ9 A;  3ZIB A;  3UMI A;  4E0I A;  3O55 A;  1PD0 A;  4U9D A;  3F46 A;  3RQG A;  2IXN A;  2RD9 A;  4IB4 A;  3QZC A;  3EGD A;  4LER A;  4ONS A;  4NTA A;  4RBN A;  4WJ0 A;  2R7O A;  1YDI A;  4IAR A;  4B6I A;  5L0J A;  3Q6M A;  3EHM A;  4MVZ A;  3U9M A;  1V4A A;  4LDK A;  2NUT A;  2GDC A;  4IAO A;  4LAC B;  4X0R A;  4JRZ A;  1QSP A;  3ZSU A;  2XLW A;  2YL1 A;  3AG2 C;  3LJB A;  4MVM A;  2OG2 A;  3B0V C;  4CJO A;  4PJJ A;  3S90 A;  1GM5 A;  4BJ6 C;  3UNG C;  3Q7G A;  2Q9B A;  2VCC A;  3C8G A;  2HS5 A;  1BR1 A;  2P0N A;  2A1D D;  1V54 C;  1FR0 A;  3SXM A;  4BJ1 A;  1D0Y A;  2VCA A;  1WAT A;  3A11 A;  3K33 A;  3ITF A;  3RYL A;  5KYX B;  2R7V A;  4XPX A;  3MLG A;  3LLI A;  5F5F A;  3ABM C;  4ER9 A;  3W2V A;  2EPL X;  5L0D A;  4XLP F;  2XXA A;  4OIR F;  1OR3 A;  4KC9 A;  3JTL O;  4PJN A;  1HMD A;  3B0U X;  2M4E A;  4FWV A;  3ZC4 A;  5JUA A;  4CDV A;  4U5G A;  2R7W A;  2W45 A;  4AX2 A;  3GWL A;  3H2V A;  3Q7L A;  4M63 A;  2HKV A;  4JCH A;  2ZPA A;  4PFP A;  3R7C A;  4P9F A;  1OCO C;  1QKR A;  3EGX A;  2IYL D;  3JRM O;  3M4C A;  1T6Q A;  3RQE A;  2A6H F;  1D0X A;  1VK5 A;  2IXO A;  2ZXR A;  4NTF A;  1MMG A;  1C03 A;  2YWA A;  4MW8 A;  3TJ5 A;  2WVN A;  1RXQ A;  5FCL A;  4KI2 A;  3DM5 A;  1SYQ A;  5BQH A;  3L8J A;  4I1O B;  4JEA A;  2H7B A;  3KYJ A;  1FMW A;  5EK0 A;  5L0F A;  3H65 A;  4XEV A;  1ZHT A;  3HLZ A;  4WGY A;  4JTD B;  1I4Z A;  4A2N B;  3M4B A;  2NPU A;  3T6G B;  4EBB A;  3SZR A;  2PX0 A;  3JRT A;  5B3S C;  3QVZ A;  4K7B A;  3K6B A;  3KH2 A;  1AVO B;  2Y3D A;  3FXH A;  4EHP A;  3DKA A;  1ZHY A;  2WZG A;  2L81 A;  3I4U A;  3US6 A;  2J8W A;  4NQF A;  1ZHZ A;  2LP4 A;  3FOP A;  3QVY A;  3KYI A;  5JSL A;  2HV6 A;  4EIY A;  1WOL A;  2VAS A;  4Z9I A;  3DD7 A;  3DE8 A;  3B29 A;  4YK5 A;  1LVK A;  1LM3 B;  1HW1 A;  2XLM A;  4HFK B;  4MQ9 F;  1FNT c;  4E7Z A;  1JR8 A;  4UDV A;  2KGO A;  3EZH A;  4O6Y A;  4XLN F;  2H8A A;  4JC7 A;  1RJ9 B;  2J45 A;  4GYT A;  1D1B A;  3S9O A;  5HSW A;  3C7J A;  2A6E F;  3VYW A;  3AG3 C;  1NSG B;  3W4Y A;  1AUE A;  4QI0 A;  3S84 A;  2XLE A;  3LS0 A;  3ZDL A;  3AQC A;  2HJM A;  2QY9 A;  1PCX A;  2CGE A;  2Y3G A;  3DAG A;  2D5R B;  2HJ3 A;  5E3A A;  4CS8 A;  1E86 A;  4IGG A;  1NFO A;  2DGJ A;  3ABK C;  3FOO A;  1U6H A;  4JW1 A;  4N4W A;  1JRA A;  2UUI A;  1H6G A;  3C62 A;  4XEK A;  5B1B C;  1OXK A;  4E7S A;  2XLV A;  3B0P A;  1XZQ A;  1ORY A;  2EPN A;  1MQV A;  3RFY A;  2C03 A;  4PR9 A;  4AE4 B;  2JD3 A;  3BEH A;  4N6C A;  1W2W A;  2YZS A;  4JKV A;  4U5C E;  2OOC A;  3CQZ A;  1VLS A;  2BL2 A;  2HMZ A;  1OW8 A;  2W4M A;  2YEV A;  2LCH A;  3EPV A;  3QW1 A;  2A68 F;  1H9G A;  3HJC A;  3K66 A;  1UG7 A;  2Q7R A;  4YJW A;  3QMK A;  2R7Q A;  5CIV A;  3RF3 A;  3VRC A;  3TOL A;  4E17 A;  2XS8 A;  3DJN B;  1OCR C;  3AJM A;  4JIO A;  3H2U A;  2EIN C;  2XL6 A;  2A69 F;  1M2V A;  2OCC C;  1VMA A;  2Y3B A;  2DI3 A;  4CS8 C;  2MWQ A;  1D1A A;  5KYU A;  4G78 A;  4J32 B;  1H7I A;  1NU7 D;  3K1H A;  3U8V A;  2OU6 A;  5JP7 A;  1ZHX A;  2J9B A;  1NZE A;  5A6J A;  1EQ1 A;  3I5Q A;  4LDQ A;  4IJJ A;  1KTM A;  4U5D E;  1OCC C;  4JEB A;  3SNH A;  2KJG A;  5KYW B;  3IQT A;  3S29 A;  1K05 A;  2NSF A;  1ST6 A;  3FMS A;  3K7D A;  3GAN A;  4MVS A;  1YYX A;  3G4X A;  5DS5 A;  3NDB B;  2CYD A;  3NYL A;  5COM A;  3NMI A;  4MVO A;  3PHF 2;  1NLX A;  2H7V C;  1CPQ A;  1Z23 A;  3POV A;  1LS4 A;  1K40 A;  2P61 A;  2QUP A;  3EH1 A;  4OIQ F;  2F22 A;  2R03 A;  1GGQ A;  1A0B A;  3QTH A;  1R4T A;  1Q0K A;  2J7P A;  3WG7 C;  4YT2 A;  3ASN C;  1YA9 A;  1YZC A;  1DOV A;  2ASR A;  2QLA A;  3FDQ A;  1ZU4 A;  1TWG A;  2PP4 A;  3RW0 A;  4C7O A;  2UUH A;  2YRF A;  3EG9 A;  4DRJ B;  4YT4 A;  1I5N A;  3NYJ A;  5A6B D;  3TD7 A;  3TQO A;  2NUP A;  5AGF A;  3PDM P;  4IRU A;  4AK9 A;  1M56 C;  3PMR A;  2ZXW C;  4D4X A;  3IHU A;  3LLK A;  3O6X A;  3B9Q A;  1JMW A;  4DBR A;  2R9R B;  1QLE C;  3L8I A;  3I5P A;  4MTG A;  3IQ6 A;  4CJG A;  4DRH B;  3SYN A;  3EFO B;  2PF4 E;  1HE1 A;  3AGU A;  3GM2 A;  3JZ0 A;  3EJN A;  4DVZ A;  1QZX A;  1LE4 A;  3GEH A;  4GQH A;  2J9W A;  2YVK A;  2A0U A;  3NYM A;  1MMN A;  4RDA A;  2ICW G;  2LIG A;  3N24 A;  1YLM A;  2YL3 A;  1VYI A;  3OEO A;  5CI9 A;  3DJU B;  1TFO B;  3J06 A;  1GS9 A;  3HNI A;  2HZ8 A;  2IOQ A;  2R05 A;  5COF A;  1TWH A;  4BEJ A;  5IY5 C;  3EQL F;  1OCZ C;  2LQG A;  2BE5 F;  1ZZP A;  4BG0 A;  4CS9 A;  2L6G A;  2KK1 A;  2H7O A;  1C02 A;  5KYY B;  2J0X A;  2WL8 A;  5COG A;  2OJQ A;  2HUJ A;  4PJM A;  4C3E A;  1EKY A;  1WN0 A;  2GAQ A;  4KNW A;  2KYH A;  2I15 A;  4LLC A;  5A6K A;  4PJL A;  2P1A A;  1SF8 A;  2VCB A;  2YL7 A;  4DXW A;  1BR2 A;  2WVO A;  4E0H A;  1LKX A;  2NG1 A;  3GOD A;  3WOD F;  3TUL A;  2YLI A;  1Z3I X;  4ZLC A;  4Q5S F;  3N2Z B;  2Y39 A;  1RKE A;  1OW6 A;  3IQ5 A;  1RMV A;  3SXY A;  3ATP A;  3U0C A;  2Y3H A;  1ZW2 A;  1K04 A;  1NG1 A;  4AL1 A;  4CX9 A;  3ZQY A;  1YA7 O;  1MMA A;  4HEA J;  2XLO A;  3LEO A;  2A0B A;  4N6H A;  2L6H A;  1YAR O;  3C63 A;  1AEP A;  5E3C A;  1JOG A;  3NMJ A;  4MTO A;  1OKK A; 
#chains in the Genus database with same CATH homology
 3TOM A;  3C62 A;  1CGN A;  1CPR A;  1RCP A;  2XLV A;  4L6R A;  1MQV A;  2YKZ A;  2CCY A;  2BC5 A;  4JKV A;  3QW1 A;  3NMK A;  3ZTZ A;  4U9D A;  3VRC A;  3ZQV A;  3TOL A;  4IB4 A;  2YL0 A;  2XLD A;  2XL6 A;  4IAR A;  3ZWI A;  2YLG A;  2YLD A;  1JAF A;  1NBB A;  5B3I A;  2XLW A;  2YL1 A;  5JP7 A;  2J9B A;  5JT4 A;  4CJO A;  1YYJ A;  4JEB A;  1GQA A;  4U9E A;  1E83 A;  1YYX A;  4CIP A;  3L1M A;  5JS5 A;  3NMI A;  3ZTM A;  5JLI A;  1CPQ A;  4JE9 A;  4ER9 A;  3DE9 A;  4IAQ A;  3QW0 A;  1YZC A;  5JVE A;  5JUA A;  2QLA A;  4CDV A;  1CGO A;  1QQ3 A;  1A7V A;  5AGF A;  4CDY A;  4D4X A;  3M4C A;  4WGZ A;  4CJG A;  3IQ6 A;  3HNJ A;  3M79 A;  4JEA A;  3U8P A;  4WGY A;  1YZA A;  3M4B A;  2YL3 A;  3HNI A;  5JRA A;  1M6T A;  3QVZ A;  4CDA A;  1E85 A;  2XL8 A;  2J8W A;  1BBH A;  3FOP A;  5JSL A;  3QVY A;  4EIY A;  1EKY A;  3DE8 A;  1LM3 B;  1S05 A;  2XLM A;  2YL7 A;  3HNL A;  3M15 A;  2YLI A;  1QPU A;  3IQ5 A;  2XLH A;  4D4N A;  4NC3 A;  4ULV A;  2XM4 A;  4CX9 A;  2XLE A;  3ZQY A;  3HNK A;  1APC A;  2XLO A;  4N6H A;  1E84 A;  1E86 A;  256B A;  3C63 A;  3FOO A;  3NMJ A;  4N4W A;  2XM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...