3HNJA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWLLIGAIHDALHLANEGKVKEAQKAAELLKAICNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnjA00
1E86A 4L6RA 2QLAA 5B3IA 2YL1A 5JVEA 3VRCA 2XLDA 4JEAA 4IAQA 1MQVA 2YLDA 2XM0A 1APCA 1RCPA 3M4CA 4JEBA 1S05A 3HNKA 1CPRA 1QQ3A 4IARA 4JKVA 3U8PA 1EKYA 5JUAA 2XL6A 2J9BA 2XLWA 1YZCA 5AGFA 3ZTZA 3DE8A 4WGYA 3TOLA 3M4BA 2J8WA 1YYJA 2YLGA 4ULVA 4U9EA 3NMKA 3NMIA 4U9DA 2XM4A 2YL7A 2CCYA 3IQ5A 2XLMA 3IQ6A 1CGNA 5JS5A 3M79A 4IB4A 5JP7A 3ZWIA 3HNJA 5JSLA 3ZQVA 1QPUA 3L1MA 5JLIA 1YYXA 3C63A 4CDYA 1A7VA 5JRAA 3DE9A 4JE9A 3ZTMA 4CDVA 3QW0A 3HNLA 3TOMA 4CX9A 2YL0A 1JAFA 1YZAA 2XLEA 3QVYA 2YLIA 3FOOA 4ER9A 1BBHA 1LM3B 5JT4A 4N4WA 2YKZA 1CPQA 4CJOA 4D4NA 1GQAA 4CIPA 4N6HA 3HNIA 4WGZA 4CJGA 2XLHA 2YL3A 1E85A 1CGOA 256BA 2BC5A 3NMJA 4NC3A 3ZQYA 4CDAA 2XLOA 1E84A 3QVZA 2XL8A 1NBBA 2XLVA 4EIYA 4D4XA 3C62A 1E83A 3QW1A 3FOPA 1M6TA 3M15A
chains in the Genus database with same CATH superfamily
4R32A 1G4US 4XPYA 1FAPB 5DQTA 1KTMA 2QLAA 2ZXPA 4O79A 5DS5A 2HFIA 2XLDA 4JEAA 4CSAA 2GFHA 4PJLA 3UMHA 5KYNA 3TJ6A 4CSAC 1GS9A 1XZQA 1RCPA 1ZZPA 2EIKC 2YLDA 3A9CA 3QZCA 4IGGA 2YWAA 5BQIA 1E2XA 3C8GA 2XS1A 2J7PA 5D92A 4I1MA 4BJ6A 5L0IA 2LSEA 1Q0GA 1RJ9A 2WB7A 3VM6A 2JX0A 4GQHA 4JCHA 2Q3TA 4YK5A 3T6BA 5CIVA 4I1OB 1TFOB 1A7DA 2XL4A 4G7OF 1WASA 2L81A 1OKKD 3JCUQ 4DVYP 1LI5A 2O9XA 3DWWA 3U9JA 4JCZA 5TJ5E 3Q7LA 3TULA 1OW8A 1G5ZA 1RKEA 1YZCA 4H54A 4WABA 3DE8A 2L9JA 3ZTZA 4BJ1A 3JYHA 1Q0MA 1C17M 3LUTB 4E7SA 4XEKA 4U5BE 2NG1A 4KBLA 5AC5A 2J7PD 2X51A 1W2WA 2WL8A 2YLGA 3AGUA 4KI2A 4OIPF 3U3FA 2R7XA 4Q7CA 5CI9A 1HE1A 2NUTA 3NMKA 3U2MA 2R7RA 3DAGA 3L8JA 2EPLX 1PD1A 2Q9AA 3LAYA 4IJJA 3G50A 2AP3A 2MWQA 3OWTA 3FHDA 3IQ5A 1Y6DA 3E70C 3B71A 3SNHA 5JS5A 2KNHA 5L0GA 2HV6A 2VCAA 3IQTA 2HKVA 4PJNA 4RD9A 3EGXB 3H2UA 4JVSA 3G4XA 1CGME 3GORA 2OEXA 2ICWG 1YYXA 1WTYA 3EPVA 5B1BC 5DQZA 3H2VA 2AU5A 3C63A 4XWJA 1D0YA 4C3BA 4DBRA 4QI2A 1EA8A 2EPMX 2W4MA 3EGDB 3RQEA 5GPGB 4FWVA 5KYWB 2PX0A 5JRAA 1BR2A 3WHNA 3MBGA 1XZPA 1V74B 1AUEA 1JR8A 1LKXA 1YARO 4PACA 3SXKA 3HNLA 1Q0DA 1WN0A 2XLEA 1NLXA 1ZW2A 3QVYA 3UR3C 3POVA 4NTAA 1UFBA 2Y39A 1LM3B 1N1CA 4FAPB 3GEIA 3C8GD 3ASOC 3JT1A 3RIPA 4EHPA 4N4WA 4G7ZF 1U6HA 1ZW3A 2C03A 3AG4C 3T6JA 1RKCA 4CJOA 3O55A 2OEVA 5KYUA 3WG7C 2PX3A 2A1DD 4HE8D 1LE2A 3G4ZA 4BG0A 4U5HA 1VB5A 3S28A 4EBJA 4C7OA 4OD4A 1Q0FA 3U3BA 2HJMA 2V3CC 3NYLA 3S0XA 1TR2A 2G3VA 3LJBA 3Q6MA 3V5ZA 256BA 5T1DB 3S90A 3IPMO 1XWJA 3MX3A 3KL4A 1GGQA 2A69F 3RKOF 2NSGA 4LLCA 3A11A 2HSQA 1SZIA 1V54C 2OU6A 1C02A 2H7BA 4K7BA 4DOZA 1F1MA 2R7VA 1EQ1A 2XL8A 1FMVA 1OXKA 1U89A 1LI7A 1TFKB 2DGJA 4U5GA 5B1AC 4D4XA 3H65A 3HTKC 1ORSC 3QW1A 2XXAB 1M6TA 1JPJA 1V4AA 1Z23A 4O6YA 3RYLA 2H7VC 1M57C 1LS4A 4LDKA 4QDLA 3M15A 4U5EE 3S27A 3S29A 1KNYA 3RFYA 3ABMC 2BL2A 1I4ZA 1UG7A 2JPUA 2QY9A 3EFOA 1HW1A 2YL1A 3S84A 1G8XA 3VRCA 1DOWA 1BR4A 3TK0A 4J30B 2OCCC 4YL0A 4FESA 1MQVA 3B29A 5DVWA 4NCQA 1LPEA 2Y3GA 1QZXA 4JEBA 2PNOA 2R25A 3Q7GA 3DMDA 4IRUA 5T3WA 5L3VA 3T4RA 1RMVA 1CPRA 4CS8C 2H7OA 3EH2A 4KC9A 5HSWA 3GM1A 4OD5A 4IARA 2ZXOA 3EZHA 1NSGB 1Q0KA 1YA9A 2I15A 4I3MA 1NG1A 3PCVA 3GWNA 4JC7A 4JKVA 3NRHA 3U8PA 1BDJB 2KGOA 2IOQA 1ZHYA 3K33A 2ETSA 4JTAB 3K6BA 3JRMO 2J9BA 2FGYA 2YHSA 4W8KA 3SYNA 1T9KA 4C3DA 2Y3DA 1K40A 2QUPA 3K1IA 3MYFA 2R7WA 3LEVA 4I44A 2EPOA 2VC9A 1MNEA 3M4BA 1M2OA 3ZSUA 1HMOA 4M63A 3MFNA 4NTFA 4AX2A 1D1BA 1OCOC 4ULVA 2HMZA 4O7GA 4U9EA 5DLJA 3GEHA 3O6XA 2I8BA 5A6JA 3EHNA 4MS2A 2NSFA 2P7VA 3NMIA 4U9DA 4MVRA 3GM2A 3EGXA 2XM4A 3HJCA 4JTCB 4Z9JA 2YL7A 3UMKA 2CCYA 2HUJA 2XLMA 2OG2A 2ZXRA 1CGNA 2E87A 1FMWA 2YZSA 1T6IA 2RD9A 2W9YA 3FMSA 4N06A 4QI0A 5EHHA 1Z3IX 2PFDA 1OCCC 3EQLF 3HNJA 3IQ6A 3Q6NA 4XLNF 4Q4ZF 3T9OA 2WZGA 4WJ0A 3HKKA 3ZQVA 2CDQA 3EGDA 3GWLA 1OR2A 3DJUB 2F22A 4YT2A 2A68F 2WZFA 3B0UX 5A6BD 4CS8A 3RVYA 3I5QA 3GEEA 2EPNA 1A7VA 2H8AA 2MHRA 2Q9BA 3C8GB 4JJFA 1MMAA 3DM9B 4ONSA 3RW0A 2AWCA 3AG3C 4P9FA 1M2VB 4AE4A 4CS7A 2QTVA 3KYIA 4P9TA 2CNWD 1HE9A 5F5HA 3ZTMA 3ASNC 5KYXA 2J46A 2B0HA 3ECSA 2YLIA 3KPHA 1JPNA 1M2VA 4AE4B 4K0DA 4MVQA 2NUPA 3EFOB 2LFDA 1JOGA 1LIHA 2KQ9A 5A6AA 2M4EA 1Y4CA 3AGTA 2EIMC 4D4NA 4UDVA 5CI8A 4DXWA 3FDQA 4CBEA 4CIPA 2A6HF 2NUPB 3TQOA 4EBKA 1K04A 2LP4A 2X0CA 1VLTA 2YQYA 2ZD9A 1HMDA 2M64A 4CJGA 2XLHA 3JSEO 4F4BA 3PMRA 1Z6AA 4JZAA 3DXJF 1E85A 2R05A 4LLEA 1CGOA 2R7SA 2Q7RA 3EHMA 3WAQA 4YL3A 3RQFA 4CDAA 1HY5A 3SXZA 4U5DE 3R2PA 4P6IC 2Q9CA 4YJWA 1HW2A 2MYSA 4BJ5C 2XXAA 3JSZA 1TWAA 3QVZA 3U2LA 1T01A 3MLGA 4LERA 5EK0A 2XLVA 4MW3A 3AOUA 1MMNA 3C62A 3WODF 1WATA 4KNWA 4PFOA 1YAUO 3FOPA 1T6QA 1ZHTA 1I5NA 1NFOA 1YDIA 3E9VA 4YWQA 1L7CA 2KK1A 3SZRA 1PV3A 1A7EA 1ORJA 4C3EA 5L0DA 1A0BA 3PHF2 4L6RA 2KW3C 3ZIBA 2HS5A 3L34A 2Q00A 2WVOA 1T5OA 1T6UA 3W4YA 2IXNA 1VK5A 4PR9A 2WVQA 5A6BA 4XLPF 1IZMA 4E18A 4ZLCA 1APCA 4BEJA 2B0JA 3M4CA 2FFHA 2JD3A 3JTLO 3V5XA 4MVSA 5EGYA 2QNLA 1I4YA 1S05A 5E2QA 3DAFA 1TWHA 3X2QC 2BE5F 2PF4E 3HNKA 3C8ZA 4O6MA 4ZLDA 4DRIB 2CNWA 5A6KA 4OIRF 4BJTA 1NFNA 3EZIA 4IWBA 1FTSA 3VYWA 2UUIA 1ORYA 3NDBB 2R7UA 4KNVA 4MVMA 2FAPB 3LLIA 2J8WA 2AVKA 2DYRC 3EG9A 4PJMA 4CIHA 5F5FA 4Z9HA 5FZTA 3JZ0A 1SMYF 2OKUA 5BQHA 1Z5ZA 2ASRA 1KU2A 1J8YF 4GEHA 1D1AA 3K1IC 3KH2A 1MMDA 4J32B 4JTDB 1TQGA 3K1HA 4CS9C 5HV9A 1A41A 1YVIA 2CW0F 1S7ZA 3NYJA 3UNGC 4YT5A 4IB4A 3TD7A 3R7CA 1PCXA 2VASA 1QKRA 3ZWIA 1DOVA 5JSLA 3OEOA 2YVKA 5FCLA 1LVKA 4C7OB 3MYIA 3QTHA 1C03A 1ZU4A 1QPUA 3AG2C 1RJ9B 3CQZA 3JRTA 3L1MA 4BJ6C 4E17A 2VB6A 5JLIA 2D4UA 3EH1A 4YT8A 1WOLA 2A0UA 4NY3A 2R9RB 4MNDA 2J9UA 1JMWA 1H9GA 2L7AA 5DS6A 4OIQF 2DI3A 2J45A 3GANA 5KYUB 1AVOB 3RH3A 2R7TA 3DE9A 4G78A 2HV7A 4AL1A 1OCZC 4JE9A 4B6IA 1WWPA 2UUHA 3EJNA 3HLZA 3TOMA 2HJ3A 4BJ5A 3CAXA 2XS8A 4E7ZA 2QE9A 2HZ8A 3FOOA 4ER9A 1BBHA 1SR2A 3LESA 3L8IA 1ZHZA 1M56C 2Y3HA 2EPKX 1D1CA 2WVNA 3RQGA 1CPQA 2DB4A 1TKNA 3CZ6A 3JYYA 4MTGA 4HFFB 4CS9A 4DBQA 5KYWA 3GM3A 1GQAA 1GM5A 2KJGA 1MMGA 4RDAA 4AL0A 4N6HA 4A4AA 2Y69C 4Q5SF 3HNIA 2OJQA 4ANJA 5COFA 4ULWA 4FX5A 4WGZA 3N2ZB 2P61A 1ZVZA 2EILC 2VCCA 2LK4A 2EINC 1RKEB 3W8HA 3LS1A 4E0IA 3FXHA 2BC5A 3NMJA 5E3AA 1FFTC 2RSEB 2VCBA 3ZQYA 4E0HA 2D5RB 3T6GB 3PDMP 5AC4A 2DYSC 1MNDA 4MVUA 1FR0A 1QLEC 5KYYA 2IBFA 1U0BB 1OKKA 2HSBA 2XLOA 2R7QA 4A2NB 4XEVA 4AK9A 3VAYA 1E84A 1WGWA 3TJ5A 1NBBA 4H4KC 3ZG1A 2KC3A 4EUKB 1OQCA 4J7YA 2IYLD 1R4TA 2R02A 3ABLC 4HFKB 4LDRA 3DKAA 1BR1A 3KKBA 3J06A 1ZYRF 3NKEA 1E86A 4W8PA 3K66A 2OJED 2VH3A 4G0HA 3I4UA 3UGOA 5B3IA 5JVEA 2GWWA 1OW7A 1QVXA 4GYTA 4XTKA 2EIJC 3U8VA 2J0XA 1TWCA 2J0WA 4IAQA 2J9WA 4YT4A 1ZHXA 2XRHA 1D0XA 3BRJA 3F47A 4X0RA 2XM0A 2GDCA 4MQ9F 3US6A 4JW1A 3ZC4A 3LLKA 1K05A 3FVYA 2PP4A 1LE4A 4JIOA 5D91A 3W2VA 1OR3A 1O87A 4EBBA 1OXBA 2G3KA 2YRFA 3KYJA 2XSEA 3KMIA 2P1AA 3U5SA 1QQ3A 3K7DA 1VYIA 2IXPA 1BZ4A 2IM8A 2IXOA 3IHUA 3OA1A 3SP1A 3AJMA 3ATPA 1YLMA 2HMQA 4U5CE 4Z9IA 3S9OA 1L3PA 3B0VC 5COMA 2W4BA 3W2WA 5B3SC 2XL6A 4NQFA 5JUAA 1EKYA 2GAQA 2P6VA 4HEAJ 2GA0A 2XLWA 1B68A 5AGFA 3N0TA 3NKDA 2Z15A 4WGYA 4XEFA 3NG1A 1O5HA 3TOLA 1O3UA 3FAPB 5F28E 1YYJA 2CGEA 2LD6A 1H9TA 1SYQA 3QMKA 3SEOA 2C04A 3SXYA 3UGPA 1YA7O 5L0CA 3C7JA 2L6GA 3GODA 2P0NA 1NU7D 2A6EF 3F46A 4EKWA 1QSPA 3LEOA 3LNMB 3IQCA 3C18A 3DI5A 1ST6A 2R03A 3M79A 5T3TA 3FAJA 4O6NA 3RVZA 5JP7A 4BEMJ 3ITFA 3DD7A 5KYXB 3N24A 3M1CB 3RF3A 1G4WR 3AG1C 2TMVP 2KSFA 3LS0A 2ZXWC 1EI7A 1SF8A 2L6FA 2J9VA 4JRZA 1NU9C 5A69A 3ZVRA 2LQGA 1FNTc 1H6GA 3O10A 4K1OA 4PK4A 2NUTB 2NPUA 4CDYA 4XPXA 3B0PA 3V5YA 4DVZA 1Z7Qc 3O39A 3W8IA 1VTMP 5KYYB 3VF0A 4J7TA 4MVZA 3V7OA 3NYMA 1VOMA 1V55C 4BPMA 1NZEA 4IAOA 4JURI 2L6HA 3BEHA 3IEEA 2G62A 5L0JA 1ZU5A 2PBEA 2KYHA 2LFFA 3QW0A 5COGA 4CDVA 4CX9A 2YL0A 1JAFA 3AQBA 1YZAA 4PJJA 3ZDLA 4XPWA 1FFHA 4YL1A 3DM5A 4JJGA 1VYKA 5JT4A 2CYDA 5IY5C 2YKZA 4MTFA 2A0BA 4DRHB 2LIGA 1RXQA 4LDQA 4G7HF 1VLSA 3DZAA 2AWYA 4U5FE 2R7OA 2LCHA 1YJGA 4YN0B 3ABKC 1R5ID 2V26A 3X1OA 1JRAA 5L0FA 3U0CA 2IXMA 1J8MF 2OQMA 2Y3BA 4MVOA 3U9MA 5BQGA 1AEPA 3DJNB 4OINF 1H7IA 3CSKA 4DJ9A 4DRJB 1Z63A 2YL3A 4NTBA 5K0IA 3L0IA 4RBNA 2OOCA 3LNRA 4N6CA 3UMIA 3B9QA 4NC3A 4XQ1A 4MTOA 4MW8A 3AQCA 5E33A 4PFPA 1LS1A 2WZLA 2Q4FA 3CEXA 1ZHWA 3SXMA 5L3QA 3I5PA 5DS4A 5L0HA 1TWGA 1OCRC 4LACB 1VMAA 1IW7F 4OIOF 5E3CA 1D0ZA 4EIYA 1PD0A 1E83A 5BUOA 1OW6A 2ZPAA 2YEVA 3EG9B 4EWCA 2W45A
chains in the Genus database with same CATH topology
1E86A 4L6RA 2QLAA 5B3IA 2YL1A 5JVEA 3VRCA 2XLDA 4JEAA 4IAQA 1MQVA 2YLDA 2XM0A 1APCA 1RCPA 3M4CA 4JEBA 1S05A 3HNKA 1CPRA 1QQ3A 4IARA 4JKVA 3U8PA 1EKYA 5JUAA 2XL6A 2J9BA 2XLWA 1YZCA 5AGFA 3ZTZA 3DE8A 4WGYA 3TOLA 3M4BA 2J8WA 1YYJA 2YLGA 4ULVA 4U9EA 3NMKA 3NMIA 4U9DA 2XM4A 2YL7A 2CCYA 3IQ5A 2XLMA 3IQ6A 1CGNA 5JS5A 3M79A 4IB4A 5JP7A 3ZWIA 3HNJA 5JSLA 3ZQVA 1QPUA 3L1MA 5JLIA 1YYXA 3C63A 4CDYA 1A7VA 5JRAA 3DE9A 4JE9A 3ZTMA 4CDVA 3QW0A 3HNLA 3TOMA 4CX9A 2YL0A 1JAFA 1YZAA 2XLEA 3QVYA 2YLIA 3FOOA 4ER9A 1BBHA 1LM3B 5JT4A 4N4WA 2YKZA 1CPQA 4CJOA 4D4NA 1GQAA 4CIPA 4N6HA 3HNIA 4WGZA 4CJGA 2XLHA 2YL3A 1E85A 1CGOA 256BA 2BC5A 3NMJA 4NC3A 3ZQYA 4CDAA 2XLOA 1E84A 3QVZA 2XL8A 1NBBA 2XLVA 4EIYA 4D4XA 3C62A 1E83A 3QW1A 3FOPA 1M6TA 3M15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E86 A;  4L6R A;  2QLA A;  5B3I A;  2YL1 A;  5JVE A;  3VRC A;  2XLD A;  4JEA A;  4IAQ A;  1MQV A;  2YLD A;  2XM0 A;  1APC A;  1RCP A;  3M4C A;  4JEB A;  1S05 A;  3HNK A;  1CPR A;  1QQ3 A;  4IAR A;  4JKV A;  3U8P A;  1EKY A;  5JUA A;  2XL6 A;  2J9B A;  2XLW A;  1YZC A;  5AGF A;  3ZTZ A;  3DE8 A;  4WGY A;  3TOL A;  3M4B A;  2J8W A;  1YYJ A;  2YLG A;  4ULV A;  4U9E A;  3NMK A;  3NMI A;  4U9D A;  2XM4 A;  2YL7 A;  2CCY A;  3IQ5 A;  2XLM A;  3IQ6 A;  1CGN A;  5JS5 A;  3M79 A;  4IB4 A;  5JP7 A;  3ZWI A;  3HNJ A;  5JSL A;  3ZQV A;  1QPU A;  3L1M A;  5JLI A;  1YYX A;  3C63 A;  4CDY A;  1A7V A;  5JRA A;  3DE9 A;  4JE9 A;  3ZTM A;  4CDV A;  3QW0 A;  3HNL A;  3TOM A;  4CX9 A;  2YL0 A;  1JAF A;  1YZA A;  2XLE A;  3QVY A;  2YLI A;  3FOO A;  4ER9 A;  1BBH A;  1LM3 B;  5JT4 A;  4N4W A;  2YKZ A;  1CPQ A;  4CJO A;  4D4N A;  1GQA A;  4CIP A;  4N6H A;  3HNI A;  4WGZ A;  4CJG A;  2XLH A;  2YL3 A;  1E85 A;  1CGO A;  256B A;  2BC5 A;  3NMJ A;  4NC3 A;  3ZQY A;  4CDA A;  2XLO A;  1E84 A;  3QVZ A;  2XL8 A;  1NBB A;  2XLV A;  4EIY A;  4D4X A;  3C62 A;  1E83 A;  3QW1 A;  3FOP A;  1M6T A;  3M15 A; 
#chains in the Genus database with same CATH topology
 4R32 A;  1G4U S;  4XPY A;  1FAP B;  5DQT A;  1KTM A;  2QLA A;  2ZXP A;  4O79 A;  5DS5 A;  2HFI A;  2XLD A;  4JEA A;  4CSA A;  2GFH A;  4PJL A;  3UMH A;  5KYN A;  3TJ6 A;  4CSA C;  1GS9 A;  1XZQ A;  1RCP A;  1ZZP A;  2EIK C;  2YLD A;  3A9C A;  3QZC A;  4IGG A;  2YWA A;  5BQI A;  1E2X A;  3C8G A;  2XS1 A;  2J7P A;  5D92 A;  4I1M A;  4BJ6 A;  5L0I A;  2LSE A;  1Q0G A;  1RJ9 A;  2WB7 A;  3VM6 A;  2JX0 A;  4GQH A;  4JCH A;  2Q3T A;  4YK5 A;  3T6B A;  5CIV A;  4I1O B;  1TFO B;  1A7D A;  2XL4 A;  4G7O F;  1WAS A;  2L81 A;  1OKK D;  3JCU Q;  4DVY P;  1LI5 A;  2O9X A;  3DWW A;  3U9J A;  4JCZ A;  5TJ5 E;  3Q7L A;  3TUL A;  1OW8 A;  1G5Z A;  1RKE A;  1YZC A;  4H54 A;  4WAB A;  3DE8 A;  2L9J A;  3ZTZ A;  4BJ1 A;  3JYH A;  1Q0M A;  1C17 M;  3LUT B;  4E7S A;  4XEK A;  4U5B E;  2NG1 A;  4KBL A;  5AC5 A;  2J7P D;  2X51 A;  1W2W A;  2WL8 A;  2YLG A;  3AGU A;  4KI2 A;  4OIP F;  3U3F A;  2R7X A;  4Q7C A;  5CI9 A;  1HE1 A;  2NUT A;  3NMK A;  3U2M A;  2R7R A;  3DAG A;  3L8J A;  2EPL X;  1PD1 A;  2Q9A A;  3LAY A;  4IJJ A;  3G50 A;  2AP3 A;  2MWQ A;  3OWT A;  3FHD A;  3IQ5 A;  1Y6D A;  3E70 C;  3B71 A;  3SNH A;  5JS5 A;  2KNH A;  5L0G A;  2HV6 A;  2VCA A;  3IQT A;  2HKV A;  4PJN A;  4RD9 A;  3EGX B;  3H2U A;  4JVS A;  3G4X A;  1CGM E;  3GOR A;  2OEX A;  2ICW G;  1YYX A;  1WTY A;  3EPV A;  5B1B C;  5DQZ A;  3H2V A;  2AU5 A;  3C63 A;  4XWJ A;  1D0Y A;  4C3B A;  4DBR A;  4QI2 A;  1EA8 A;  2EPM X;  2W4M A;  3EGD B;  3RQE A;  5GPG B;  4FWV A;  5KYW B;  2PX0 A;  5JRA A;  1BR2 A;  3WHN A;  3MBG A;  1XZP A;  1V74 B;  1AUE A;  1JR8 A;  1LKX A;  1YAR O;  4PAC A;  3SXK A;  3HNL A;  1Q0D A;  1WN0 A;  2XLE A;  1NLX A;  1ZW2 A;  3QVY A;  3UR3 C;  3POV A;  4NTA A;  1UFB A;  2Y39 A;  1LM3 B;  1N1C A;  4FAP B;  3GEI A;  3C8G D;  3ASO C;  3JT1 A;  3RIP A;  4EHP A;  4N4W A;  4G7Z F;  1U6H A;  1ZW3 A;  2C03 A;  3AG4 C;  3T6J A;  1RKC A;  4CJO A;  3O55 A;  2OEV A;  5KYU A;  3WG7 C;  2PX3 A;  2A1D D;  4HE8 D;  1LE2 A;  3G4Z A;  4BG0 A;  4U5H A;  1VB5 A;  3S28 A;  4EBJ A;  4C7O A;  4OD4 A;  1Q0F A;  3U3B A;  2HJM A;  2V3C C;  3NYL A;  3S0X A;  1TR2 A;  2G3V A;  3LJB A;  3Q6M A;  3V5Z A;  256B A;  5T1D B;  3S90 A;  3IPM O;  1XWJ A;  3MX3 A;  3KL4 A;  1GGQ A;  2A69 F;  3RKO F;  2NSG A;  4LLC A;  3A11 A;  2HSQ A;  1SZI A;  1V54 C;  2OU6 A;  1C02 A;  2H7B A;  4K7B A;  4DOZ A;  1F1M A;  2R7V A;  1EQ1 A;  2XL8 A;  1FMV A;  1OXK A;  1U89 A;  1LI7 A;  1TFK B;  2DGJ A;  4U5G A;  5B1A C;  4D4X A;  3H65 A;  3HTK C;  1ORS C;  3QW1 A;  2XXA B;  1M6T A;  1JPJ A;  1V4A A;  1Z23 A;  4O6Y A;  3RYL A;  2H7V C;  1M57 C;  1LS4 A;  4LDK A;  4QDL A;  3M15 A;  4U5E E;  3S27 A;  3S29 A;  1KNY A;  3RFY A;  3ABM C;  2BL2 A;  1I4Z A;  1UG7 A;  2JPU A;  2QY9 A;  3EFO A;  1HW1 A;  2YL1 A;  3S84 A;  1G8X A;  3VRC A;  1DOW A;  1BR4 A;  3TK0 A;  4J30 B;  2OCC C;  4YL0 A;  4FES A;  1MQV A;  3B29 A;  5DVW A;  4NCQ A;  1LPE A;  2Y3G A;  1QZX A;  4JEB A;  2PNO A;  2R25 A;  3Q7G A;  3DMD A;  4IRU A;  5T3W A;  5L3V A;  3T4R A;  1RMV A;  1CPR A;  4CS8 C;  2H7O A;  3EH2 A;  4KC9 A;  5HSW A;  3GM1 A;  4OD5 A;  4IAR A;  2ZXO A;  3EZH A;  1NSG B;  1Q0K A;  1YA9 A;  2I15 A;  4I3M A;  1NG1 A;  3PCV A;  3GWN A;  4JC7 A;  4JKV A;  3NRH A;  3U8P A;  1BDJ B;  2KGO A;  2IOQ A;  1ZHY A;  3K33 A;  2ETS A;  4JTA B;  3K6B A;  3JRM O;  2J9B A;  2FGY A;  2YHS A;  4W8K A;  3SYN A;  1T9K A;  4C3D A;  2Y3D A;  1K40 A;  2QUP A;  3K1I A;  3MYF A;  2R7W A;  3LEV A;  4I44 A;  2EPO A;  2VC9 A;  1MNE A;  3M4B A;  1M2O A;  3ZSU A;  1HMO A;  4M63 A;  3MFN A;  4NTF A;  4AX2 A;  1D1B A;  1OCO C;  4ULV A;  2HMZ A;  4O7G A;  4U9E A;  5DLJ A;  3GEH A;  3O6X A;  2I8B A;  5A6J A;  3EHN A;  4MS2 A;  2NSF A;  2P7V A;  3NMI A;  4U9D A;  4MVR A;  3GM2 A;  3EGX A;  2XM4 A;  3HJC A;  4JTC B;  4Z9J A;  2YL7 A;  3UMK A;  2CCY A;  2HUJ A;  2XLM A;  2OG2 A;  2ZXR A;  1CGN A;  2E87 A;  1FMW A;  2YZS A;  1T6I A;  2RD9 A;  2W9Y A;  3FMS A;  4N06 A;  4QI0 A;  5EHH A;  1Z3I X;  2PFD A;  1OCC C;  3EQL F;  3HNJ A;  3IQ6 A;  3Q6N A;  4XLN F;  4Q4Z F;  3T9O A;  2WZG A;  4WJ0 A;  3HKK A;  3ZQV A;  2CDQ A;  3EGD A;  3GWL A;  1OR2 A;  3DJU B;  2F22 A;  4YT2 A;  2A68 F;  2WZF A;  3B0U X;  5A6B D;  4CS8 A;  3RVY A;  3I5Q A;  3GEE A;  2EPN A;  1A7V A;  2H8A A;  2MHR A;  2Q9B A;  3C8G B;  4JJF A;  1MMA A;  3DM9 B;  4ONS A;  3RW0 A;  2AWC A;  3AG3 C;  4P9F A;  1M2V B;  4AE4 A;  4CS7 A;  2QTV A;  3KYI A;  4P9T A;  2CNW D;  1HE9 A;  5F5H A;  3ZTM A;  3ASN C;  5KYX A;  2J46 A;  2B0H A;  3ECS A;  2YLI A;  3KPH A;  1JPN A;  1M2V A;  4AE4 B;  4K0D A;  4MVQ A;  2NUP A;  3EFO B;  2LFD A;  1JOG A;  1LIH A;  2KQ9 A;  5A6A A;  2M4E A;  1Y4C A;  3AGT A;  2EIM C;  4D4N A;  4UDV A;  5CI8 A;  4DXW A;  3FDQ A;  4CBE A;  4CIP A;  2A6H F;  2NUP B;  3TQO A;  4EBK A;  1K04 A;  2LP4 A;  2X0C A;  1VLT A;  2YQY A;  2ZD9 A;  1HMD A;  2M64 A;  4CJG A;  2XLH A;  3JSE O;  4F4B A;  3PMR A;  1Z6A A;  4JZA A;  3DXJ F;  1E85 A;  2R05 A;  4LLE A;  1CGO A;  2R7S A;  2Q7R A;  3EHM A;  3WAQ A;  4YL3 A;  3RQF A;  4CDA A;  1HY5 A;  3SXZ A;  4U5D E;  3R2P A;  4P6I C;  2Q9C A;  4YJW A;  1HW2 A;  2MYS A;  4BJ5 C;  2XXA A;  3JSZ A;  1TWA A;  3QVZ A;  3U2L A;  1T01 A;  3MLG A;  4LER A;  5EK0 A;  2XLV A;  4MW3 A;  3AOU A;  1MMN A;  3C62 A;  3WOD F;  1WAT A;  4KNW A;  4PFO A;  1YAU O;  3FOP A;  1T6Q A;  1ZHT A;  1I5N A;  1NFO A;  1YDI A;  3E9V A;  4YWQ A;  1L7C A;  2KK1 A;  3SZR A;  1PV3 A;  1A7E A;  1ORJ A;  4C3E A;  5L0D A;  1A0B A;  3PHF 2;  4L6R A;  2KW3 C;  3ZIB A;  2HS5 A;  3L34 A;  2Q00 A;  2WVO A;  1T5O A;  1T6U A;  3W4Y A;  2IXN A;  1VK5 A;  4PR9 A;  2WVQ A;  5A6B A;  4XLP F;  1IZM A;  4E18 A;  4ZLC A;  1APC A;  4BEJ A;  2B0J A;  3M4C A;  2FFH A;  2JD3 A;  3JTL O;  3V5X A;  4MVS A;  5EGY A;  2QNL A;  1I4Y A;  1S05 A;  5E2Q A;  3DAF A;  1TWH A;  3X2Q C;  2BE5 F;  2PF4 E;  3HNK A;  3C8Z A;  4O6M A;  4ZLD A;  4DRI B;  2CNW A;  5A6K A;  4OIR F;  4BJT A;  1NFN A;  3EZI A;  4IWB A;  1FTS A;  3VYW A;  2UUI A;  1ORY A;  3NDB B;  2R7U A;  4KNV A;  4MVM A;  2FAP B;  3LLI A;  2J8W A;  2AVK A;  2DYR C;  3EG9 A;  4PJM A;  4CIH A;  5F5F A;  4Z9H A;  5FZT A;  3JZ0 A;  1SMY F;  2OKU A;  5BQH A;  1Z5Z A;  2ASR A;  1KU2 A;  1J8Y F;  4GEH A;  1D1A A;  3K1I C;  3KH2 A;  1MMD A;  4J32 B;  4JTD B;  1TQG A;  3K1H A;  4CS9 C;  5HV9 A;  1A41 A;  1YVI A;  2CW0 F;  1S7Z A;  3NYJ A;  3UNG C;  4YT5 A;  4IB4 A;  3TD7 A;  3R7C A;  1PCX A;  2VAS A;  1QKR A;  3ZWI A;  1DOV A;  5JSL A;  3OEO A;  2YVK A;  5FCL A;  1LVK A;  4C7O B;  3MYI A;  3QTH A;  1C03 A;  1ZU4 A;  1QPU A;  3AG2 C;  1RJ9 B;  3CQZ A;  3JRT A;  3L1M A;  4BJ6 C;  4E17 A;  2VB6 A;  5JLI A;  2D4U A;  3EH1 A;  4YT8 A;  1WOL A;  2A0U A;  4NY3 A;  2R9R B;  4MND A;  2J9U A;  1JMW A;  1H9G A;  2L7A A;  5DS6 A;  4OIQ F;  2DI3 A;  2J45 A;  3GAN A;  5KYU B;  1AVO B;  3RH3 A;  2R7T A;  3DE9 A;  4G78 A;  2HV7 A;  4AL1 A;  1OCZ C;  4JE9 A;  4B6I A;  1WWP A;  2UUH A;  3EJN A;  3HLZ A;  3TOM A;  2HJ3 A;  4BJ5 A;  3CAX A;  2XS8 A;  4E7Z A;  2QE9 A;  2HZ8 A;  3FOO A;  4ER9 A;  1BBH A;  1SR2 A;  3LES A;  3L8I A;  1ZHZ A;  1M56 C;  2Y3H A;  2EPK X;  1D1C A;  2WVN A;  3RQG A;  1CPQ A;  2DB4 A;  1TKN A;  3CZ6 A;  3JYY A;  4MTG A;  4HFF B;  4CS9 A;  4DBQ A;  5KYW A;  3GM3 A;  1GQA A;  1GM5 A;  2KJG A;  1MMG A;  4RDA A;  4AL0 A;  4N6H A;  4A4A A;  2Y69 C;  4Q5S F;  3HNI A;  2OJQ A;  4ANJ A;  5COF A;  4ULW A;  4FX5 A;  4WGZ A;  3N2Z B;  2P61 A;  1ZVZ A;  2EIL C;  2VCC A;  2LK4 A;  2EIN C;  1RKE B;  3W8H A;  3LS1 A;  4E0I A;  3FXH A;  2BC5 A;  3NMJ A;  5E3A A;  1FFT C;  2RSE B;  2VCB A;  3ZQY A;  4E0H A;  2D5R B;  3T6G B;  3PDM P;  5AC4 A;  2DYS C;  1MND A;  4MVU A;  1FR0 A;  1QLE C;  5KYY A;  2IBF A;  1U0B B;  1OKK A;  2HSB A;  2XLO A;  2R7Q A;  4A2N B;  4XEV A;  4AK9 A;  3VAY A;  1E84 A;  1WGW A;  3TJ5 A;  1NBB A;  4H4K C;  3ZG1 A;  2KC3 A;  4EUK B;  1OQC A;  4J7Y A;  2IYL D;  1R4T A;  2R02 A;  3ABL C;  4HFK B;  4LDR A;  3DKA A;  1BR1 A;  3KKB A;  3J06 A;  1ZYR F;  3NKE A;  1E86 A;  4W8P A;  3K66 A;  2OJE D;  2VH3 A;  4G0H A;  3I4U A;  3UGO A;  5B3I A;  5JVE A;  2GWW A;  1OW7 A;  1QVX A;  4GYT A;  4XTK A;  2EIJ C;  3U8V A;  2J0X A;  1TWC A;  2J0W A;  4IAQ A;  2J9W A;  4YT4 A;  1ZHX A;  2XRH A;  1D0X A;  3BRJ A;  3F47 A;  4X0R A;  2XM0 A;  2GDC A;  4MQ9 F;  3US6 A;  4JW1 A;  3ZC4 A;  3LLK A;  1K05 A;  3FVY A;  2PP4 A;  1LE4 A;  4JIO A;  5D91 A;  3W2V A;  1OR3 A;  1O87 A;  4EBB A;  1OXB A;  2G3K A;  2YRF A;  3KYJ A;  2XSE A;  3KMI A;  2P1A A;  3U5S A;  1QQ3 A;  3K7D A;  1VYI A;  2IXP A;  1BZ4 A;  2IM8 A;  2IXO A;  3IHU A;  3OA1 A;  3SP1 A;  3AJM A;  3ATP A;  1YLM A;  2HMQ A;  4U5C E;  4Z9I A;  3S9O A;  1L3P A;  3B0V C;  5COM A;  2W4B A;  3W2W A;  5B3S C;  2XL6 A;  4NQF A;  5JUA A;  1EKY A;  2GAQ A;  2P6V A;  4HEA J;  2GA0 A;  2XLW A;  1B68 A;  5AGF A;  3N0T A;  3NKD A;  2Z15 A;  4WGY A;  4XEF A;  3NG1 A;  1O5H A;  3TOL A;  1O3U A;  3FAP B;  5F28 E;  1YYJ A;  2CGE A;  2LD6 A;  1H9T A;  1SYQ A;  3QMK A;  3SEO A;  2C04 A;  3SXY A;  3UGP A;  1YA7 O;  5L0C A;  3C7J A;  2L6G A;  3GOD A;  2P0N A;  1NU7 D;  2A6E F;  3F46 A;  4EKW A;  1QSP A;  3LEO A;  3LNM B;  3IQC A;  3C18 A;  3DI5 A;  1ST6 A;  2R03 A;  3M79 A;  5T3T A;  3FAJ A;  4O6N A;  3RVZ A;  5JP7 A;  4BEM J;  3ITF A;  3DD7 A;  5KYX B;  3N24 A;  3M1C B;  3RF3 A;  1G4W R;  3AG1 C;  2TMV P;  2KSF A;  3LS0 A;  2ZXW C;  1EI7 A;  1SF8 A;  2L6F A;  2J9V A;  4JRZ A;  1NU9 C;  5A69 A;  3ZVR A;  2LQG A;  1FNT c;  1H6G A;  3O10 A;  4K1O A;  4PK4 A;  2NUT B;  2NPU A;  4CDY A;  4XPX A;  3B0P A;  3V5Y A;  4DVZ A;  1Z7Q c;  3O39 A;  3W8I A;  1VTM P;  5KYY B;  3VF0 A;  4J7T A;  4MVZ A;  3V7O A;  3NYM A;  1VOM A;  1V55 C;  4BPM A;  1NZE A;  4IAO A;  4JUR I;  2L6H A;  3BEH A;  3IEE A;  2G62 A;  5L0J A;  1ZU5 A;  2PBE A;  2KYH A;  2LFF A;  3QW0 A;  5COG A;  4CDV A;  4CX9 A;  2YL0 A;  1JAF A;  3AQB A;  1YZA A;  4PJJ A;  3ZDL A;  4XPW A;  1FFH A;  4YL1 A;  3DM5 A;  4JJG A;  1VYK A;  5JT4 A;  2CYD A;  5IY5 C;  2YKZ A;  4MTF A;  2A0B A;  4DRH B;  2LIG A;  1RXQ A;  4LDQ A;  4G7H F;  1VLS A;  3DZA A;  2AWY A;  4U5F E;  2R7O A;  2LCH A;  1YJG A;  4YN0 B;  3ABK C;  1R5I D;  2V26 A;  3X1O A;  1JRA A;  5L0F A;  3U0C A;  2IXM A;  1J8M F;  2OQM A;  2Y3B A;  4MVO A;  3U9M A;  5BQG A;  1AEP A;  3DJN B;  4OIN F;  1H7I A;  3CSK A;  4DJ9 A;  4DRJ B;  1Z63 A;  2YL3 A;  4NTB A;  5K0I A;  3L0I A;  4RBN A;  2OOC A;  3LNR A;  4N6C A;  3UMI A;  3B9Q A;  4NC3 A;  4XQ1 A;  4MTO A;  4MW8 A;  3AQC A;  5E33 A;  4PFP A;  1LS1 A;  2WZL A;  2Q4F A;  3CEX A;  1ZHW A;  3SXM A;  5L3Q A;  3I5P A;  5DS4 A;  5L0H A;  1TWG A;  1OCR C;  4LAC B;  1VMA A;  1IW7 F;  4OIO F;  5E3C A;  1D0Z A;  4EIY A;  1PD0 A;  1E83 A;  5BUO A;  1OW6 A;  2ZPA A;  2YEV A;  3EG9 B;  4EWC A;  2W45 A; 
#chains in the Genus database with same CATH homology
 1E86 A;  4L6R A;  2QLA A;  5B3I A;  2YL1 A;  5JVE A;  3VRC A;  2XLD A;  4JEA A;  4IAQ A;  1MQV A;  2YLD A;  2XM0 A;  1APC A;  1RCP A;  3M4C A;  4JEB A;  1S05 A;  3HNK A;  1CPR A;  1QQ3 A;  4IAR A;  4JKV A;  3U8P A;  1EKY A;  5JUA A;  2XL6 A;  2J9B A;  2XLW A;  1YZC A;  5AGF A;  3ZTZ A;  3DE8 A;  4WGY A;  3TOL A;  3M4B A;  2J8W A;  1YYJ A;  2YLG A;  4ULV A;  4U9E A;  3NMK A;  3NMI A;  4U9D A;  2XM4 A;  2YL7 A;  2CCY A;  3IQ5 A;  2XLM A;  3IQ6 A;  1CGN A;  5JS5 A;  3M79 A;  4IB4 A;  5JP7 A;  3ZWI A;  3HNJ A;  5JSL A;  3ZQV A;  1QPU A;  3L1M A;  5JLI A;  1YYX A;  3C63 A;  4CDY A;  1A7V A;  5JRA A;  3DE9 A;  4JE9 A;  3ZTM A;  4CDV A;  3QW0 A;  3HNL A;  3TOM A;  4CX9 A;  2YL0 A;  1JAF A;  1YZA A;  2XLE A;  3QVY A;  2YLI A;  3FOO A;  4ER9 A;  1BBH A;  1LM3 B;  5JT4 A;  4N4W A;  2YKZ A;  1CPQ A;  4CJO A;  4D4N A;  1GQA A;  4CIP A;  4N6H A;  3HNI A;  4WGZ A;  4CJG A;  2XLH A;  2YL3 A;  1E85 A;  1CGO A;  256B A;  2BC5 A;  3NMJ A;  4NC3 A;  3ZQY A;  4CDA A;  2XLO A;  1E84 A;  3QVZ A;  2XL8 A;  1NBB A;  2XLV A;  4EIY A;  4D4X A;  3C62 A;  1E83 A;  3QW1 A;  3FOP A;  1M6T A;  3M15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...