3HNJA

Crystal structure of the zn-induced tetramer of the engineered cyt cb562 variant ridc-2
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWLLIGAIHDALHLANEGKVKEAQKAAELLKAICNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
total genus 43
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnjA00
5AGFA 4CJOA 2XLOA 3C62A 5B3IA 5JSLA 1YZCA 2YLDA 3HNLA 2YL7A 5JLIA 4N4WA 5JT4A 1EKYA 2XL8A 3M15A 4NC3A 3HNJA 4CDAA 4CIPA 2YKZA 5JRAA 5JP7A 1CPQA 1MQVA 2QLAA 3QW1A 3NMJA 1E86A 1CGNA 5JVEA 5JUAA 2XLEA 1M6TA 3M79A 1E85A 4JEBA 2XLHA 2YL1A 1RCPA 3ZWIA 4D4XA 3ZTMA 256BA 4ER9A 2XM4A 4CDYA 4CDVA 4CJGA 1YYXA 3QVYA 1GQAA 1CGOA 2BC5A 4ULVA 3FOOA 3NMKA 3DE8A 1YYJA 3FOPA 2XM0A 2XLVA 3ZTZA 3L1MA 1QPUA 4JKVA 2J9BA 4EIYA 5JS5A 2XLWA 3HNKA 3HNIA 1LM3B 4IARA 4U9DA 4CX9A 1CPRA 2XL6A 3IQ5A 3QW0A 2YL0A 4L6RA 3M4BA 4IAQA 2YLIA 3U8PA 1BBHA 3QVZA 4IB4A 3TOMA 4N6HA 3DE9A 2XLDA 4JEAA 2J8WA 1E83A 4JE9A 4WGYA 2CCYA 1S05A 1APCA 1YZAA 1E84A 3ZQYA 4WGZA 1NBBA 4D4NA 3M4CA 1QQ3A 3ZQVA 2YLGA 1JAFA 3C63A 1A7VA 3IQ6A 4U9EA 2YL3A 2XLMA 3TOLA 3NMIA 3VRCA
chains in the Genus database with same CATH superfamily
3ASOC 4BJ6A 4LERA 4O6YA 4W8KA 4XPWA 3C62A 2GA0A 2KNHA 2XSEA 4PJLA 3EH2A 2YLDA 4PFOA 2IXNA 3GEHA 1H7IA 2ETSA 1XWJA 2L6HA 1RKEA 1HY5A 2OG2A 3GODA 2W4MA 4C7OB 1MMGA 4CS8A 3ZIBA 3LS0A 4XEKA 3U9JA 4YL1A 1T6UA 1OW7A 2AVKA 2NSFA 4QI2A 4E7SA 4NQFA 1HE1A 2ICWG 3S28A 3ABMC 1ZVZA 3M15A 3MBGA 1FMVA 3Q7LA 3MX3A 2L81A 4JTCB 4XPXA 1NU7D 3DJUB 1J8YF 4CIPA 1FNTc 5JRAA 3RQFA 1LIHA 1Z5ZA 1E2XA 2OJED 1M57C 3C8GD 4ZLCA 5JP7A 5KYUB 1CPQA 1HMOA 1LVKA 3K6BA 1PV3A 3AGTA 1NZEA 5T3TA 5DS4A 2A69F 4KNVA 2W4BA 3FXHA 3Q6MA 1CGME 1OCCC 2VASA 1WATA 2J9WA 5JVEA 1B68A 3CQZA 3ZC4A 2QTVA 1D0ZA 2NUTA 3M79A 1TFKB 3AQBA 4MTOA 1M2OA 2Q9AA 4HEAJ 1VYIA 1YVIA 4ULWA 1QKRA 1FFHA 1LE4A 1G4WR 1RCPA 4C3DA 4XLPF 1SZIA 3UGPA 3ZG1A 4EBBA 3J06A 3NYJA 1WASA 3NRHA 4RD9A 3RVZA 4AL1A 2NG1A 3KH2A 3BRJA 2ZXPA 1Z63A 2KJGA 5FZTA 3TJ6A 2Y69C 2YEVA 4LLCA 2R7TA 1KTMA 1GQAA 1A0BA 1M2VB 2WVOA 2Z15A 3FOOA 1LI7A 4J32B 4O6MA 3DE8A 4IAOA 1YYJA 2XRHA 2UUIA 5CI9A 2OU6A 2LCHA 4U5FE 3W2WA 1MNDA 3I5QA 4CS9C 3EHNA 1D1CA 1MNEA 4MTGA 4R32A 3AQCA 3DI5A 3QZCA 3LESA 3UGOA 1HW1A 1ZZPA 1QPUA 3GEEA 5L0IA 3DM5A 5F28E 3GORA 5KYWA 1R5ID 2Y3DA 2XXAA 1KNYA 4JJFA 3SXYA 2HZ8A 3VYWA 3ABLC 2HKVA 5JS5A 1BR4A 1S7ZA 3T6BA 1EQ1A 3RFYA 1I5NA 4NTAA 2PBEA 5BUOA 1AVOB 2Y3HA 5E3CA 3H65A 1G4US 4Z9JA 4KI2A 4IARA 4Z9IA 4J7YA 1BR1A 2XL6A 3TJ5A 3NKEA 2L6FA 4L6RA 3H2VA 2UUHA 4E18A 4BJ5A 2YLIA 4IAQA 3U8PA 1HE9A 3CSKA 4BG0A 1RMVA 4N6HA 3DE9A 2YWAA 2LK4A 4XPYA 1S05A 3G50A 3V7OA 1APCA 2LQGA 1E84A 3LNRA 4IWBA 3GM2A 3ZQYA 3LNMB 1Q0KA 3C8GB 1Z3IX 2G3VA 4GQHA 1ZHXA 3M4CA 3VF0A 3ZQVA 1MMNA 3E70C 1YAUO 2GWWA 1EI7A 4LACB 4YJWA 2A0BA 4YK5A 3R2PA 2DYRC 3IQ6A 3UR3C 2Q7RA 3B0VC 2XLMA 4FX5A 2VCCA 2R7QA 3RQEA 1YJGA 2R02A 4PFPA 3JRMO 3UNGC 4GYTA 2J7PA 3M1CB 3JSEO 5CI8A 5AGFA 2NUTB 2R7XA 4AL0A 5A6BA 2XLOA 3JTLO 2GFHA 5JSLA 5T1DB 1SYQA 5BQGA 2BL2A 3KMIA 4WJ0A 1VYKA 1HMDA 3O39A 5COMA 5EGYA 3BEHA 3EGDA 1LS1A 4FWVA 4Q7CA 3RIPA 4K1OA 4JW1A 3K66A 5DQZA 3DXJF 1N1CA 5JT4A 2EPOA 3B29A 1RKCA 3G4XA 4U5HA 5K0IA 3GWLA 3GM1A 5L0HA 5KYWB 4OINF 4XQ1A 1FR0A 3N0TA 3JYYA 1Q0GA 2WZFA 4NC3A 3HNJA 4CDAA 3O6XA 2EPLX 4JZAA 2DYSC 1OCRC 1O5HA 1MMDA 5F5FA 1O87A 1MQVA 1K40A 2QLAA 4MVUA 2NSGA 3QW1A 4YT5A 1E86A 3LAYA 4MVQA 4K7BA 3EG9A 2R05A 3T4RA 3FHDA 1OKKD 1M6TA 3AG2C 3DZAA 2IOQA 4JC7A 4JEBA 3MYFA 2YQYA 1E85A 4G7ZF 4I44A 3A11A 3R7CA 2G3KA 3S0XA 1VMAA 2J0WA 2PNOA 2VH3A 4JVSA 2L6GA 3EGDB 4OD5A 1QZXA 3UMKA 4XEFA 4CS8C 4ER9A 1ST6A 3DKAA 2FAPB 4P6IC 4CSAA 2OKUA 1D1BA 3EPVA 2AU5A 3FMSA 4HE8D 2CNWD 3DAFA 1Q0MA 1BR2A 3CZ6A 2WL8A 3NG1A 3QTHA 4RDAA 4CS9A 2MYSA 3F47A 5TJ5E 4B6IA 4C3EA 2OJQA 2A1DD 2Y39A 4DRHB 2BC5A 5IY5C 4ZLDA 2CNWA 3EH1A 1D0YA 4CBEA 3FOPA 2EIKC 4XTKA 1LKXA 2OCCC 2HMZA 5T3WA 3FAPB 3Q6NA 3S9OA 3DD7A 2XLVA 1Q0DA 5D92A 1TR2A 3U8VA 2CGEA 1JMWA 4OIQF 4EWCA 2C04A 4KC9A 1ORYA 1FAPB 2IXOA 5B3SC 1JOGA 5HSWA 4JKVA 3SXZA 1ZU4A 2D5RB 2J9BA 4EIYA 5A69A 3V5YA 4OIPF 2PP4A 2W45A 2RSEB 1VB5A 2E87A 3AOUA 4BJ5C 1RXQA 3ECSA 2YZSA 1C03A 1BDJB 2QUPA 2BE5F 4U9DA 2L7AA 4G78A 4F4BA 1CPRA 1GS9A 1BZ4A 1A7DA 3NYLA 3QW0A 3ZSUA 3L0IA 3M4BA 3N2ZB 3AGUA 1DOWA 3LEOA 2R25A 3S29A 4CSAC 4PR9A 2HUJA 2Q9CA 3L8JA 3OA1A 1LE2A 2B0HA 2KC3A 3IPMO 4JEAA 1E83A 4DRJB 2KSFA 4JE9A 3SZRA 4N06A 3AG1C 2AWYA 3EHMA 4LLEA 4AX2A 2VB6A 3KL4A 4YT4A 1IZMA 3EFOB 4MVMA 3ZVRA 1G5ZA 2FFHA 3HLZA 3K1HA 2D4UA 3NYMA 2LD6A 3PMRA 4JRZA 3UMHA 4LDQA 3DWWA 1V55C 1KU2A 1JAFA 1H9GA 2YLGA 4JIOA 2P7VA 3RH3A 3SNHA 1HW2A 4Q4ZF 3C18A 1D1AA 2KYHA 1VTMP 1IW7F 3JT1A 4GEHA 3T9OA 4O6NA 2XXAB 1Y6DA 1UFBA 1WOLA 4KBLA 3TOLA 1H6GA 2DGJA 2LIGA 3VRCA 1F1MA 1EA8A 4G7OF 1I4ZA 3EZIA 5FCLA 1MMAA 2LFDA 4G0HA 5L0CA 2H7VC 4DJ9A 1TWHA 1JPJA 2QNLA 2J45A 3E9VA 1LPEA 5D91A 5DS5A 4CJOA 2EPKX 2ZXRA 5L3QA 5B3IA 3WHNA 1V4AA 2A68F 5COFA 3C8GA 3TULA 1U0BB 4OIRF 1Q0FA 3DM9B 3HNLA 2R7SA 4P9TA 1SF8A 2G62A 3RKOF 2J7PD 4BJ1A 5DS6A 4FESA 1OR2A 3MFNA 4MNDA 2R7UA 1D0XA 3O55A 2P61A 3I4UA 4YL3A 2PF4E 2MWQA 4U5GA 4EBKA 2EINC 1Z7Qc 2EPMX 2HSBA 2YKZA 4Z9HA 2C03A 4QI0A 5E3AA 4XLNF 3SP1A 1PD0A 4U5EE 1QLEC 1C02A 2JD3A 5A6JA 3W2VA 1ZHTA 1ORJA 2NUPA 3U0CA 3C7JA 1G8XA 1TWGA 2CW0F 3CEXA 1LI5A 3NMJA 4JJGA 1CGNA 4A4AA 5L0GA 1YA7O 4PJJA 1TKNA 4AE4A 5JUAA 5AC5A 2KQ9A 4JTDB 4MW3A 1A7EA 1ORSC 2EPNA 2PX0A 3DAGA 4LDRA 1JRAA 1NLXA 2AP3A 4YL0A 4HFFB 3VAYA 4A2NB 1ZHZA 4Q5SF 2YL1A 2QY9A 2YHSA 5L3VA 3ZDLA 2YRFA 4E0IA 5KYYB 3NDBB 3KPHA 4M63A 5COGA 2J0XA 1ZW2A 3EJNA 3JCUQ 3RYLA 3FDQA 1JR8A 3C8ZA 4U5CE 4CDYA 2EIMC 4CJGA 2P6VA 1YYXA 4YN0B 3PCVA 4YWQA 1CGOA 2WZLA 4ULVA 4MW8A 3S90A 1OCZC 4UDVA 2LSEA 2O9XA 3B71A 2XM0A 2M4EA 4EKWA 2JX0A 3O10A 2CYDA 2WVQA 1OCOC 3ZTZA 4PK4A 4I1OB 4DRIB 4XWJA 3AG4C 2LP4A 2HJ3A 3N24A 2LFFA 4WABA 1T6QA 1T9KA 2VCBA 2CDQA 3W4YA 4BEJA 1SR2A 3SXMA 2IXPA 3K1IC 4ONSA 3TK0A 1OXBA 1Z6AA 1WTYA 2NPUA 3T6JA 3WODF 2PFDA 4G7HF 1K04A 3EZHA 3X1OA 4CX9A 1Z23A 2B0JA 3A9CA 1ZHWA 3U3BA 1WN0A 3KYIA 1ZU5A 3PDMP 4DBQA 3KKBA 2R7VA 3FVYA 1YDIA 3S27A 1QSPA 2H7OA 2H8AA 2X0CA 3V5XA 3LS1A 4DVYP 2HV6A 5HV9A 5JLIA 2A6EF 4NCQA 2DB4A 1FTSA 2KGOA 1OQCA 1QVXA 2CCYA 2ZXOA 1T6IA 3Q7GA 4MVZA 1J8MF 2ZXWC 1YZAA 4ANJA 5L0FA 4C7OA 2A6HF 2I15A 2TMVP 1AUEA 1NBBA 3DMDA 3K1IA 4D4NA 1QQ3A 3ASNC 4AK9A 4EUKB 4PACA 3C63A 2IM8A 1A7VA 1NFNA 2Q4FA 3EGXB 3MLGA 3U2LA 5BQIA 4O79A 4JTAB 2YL3A 4U9EA 2WB7A 5DVWA 4E7ZA 3ABKC 3NMIA 4DVZA 4I1MA 1WWPA 2J9UA 2WZGA 3LLKA 3IEEA 2VCAA 3PHF2 1OXKA 1VLTA 1FFTC 4CS7A 1VOMA 2F22A 3HKKA 4BEMJ 3OWTA 3IQTA 1C17M 5EK0A 2XL4A 1YZCA 2HMQA 4YT2A 1TQGA 4NTFA 1I4YA 1K05A 2HFIA 5KYYA 2IBFA 3S84A 5L0DA 1L3PA 3RF3A 2JPUA 1M2VA 2YL7A 3I5PA 1YARO 2Y3BA 4N4WA 4P9FA 5GPGB 4BJ6C 2QE9A 4C3BA 1YLMA 3JZ0A 4CIHA 1EKYA 2Q00A 2XL8A 1VK5A 3K33A 4PJMA 4PJNA 2I8BA 1UG7A 4J30B 1TFOB 3W8HA 1V54C 4X0RA 1NSGB 1A41A 2OEXA 2P1AA 3JSZA 1XZQA 3IQCA 4IJJA 1OR3A 5KYUA 2H7BA 4E17A 3ITFA 3K7DA 3U2MA 3GM3A 5DLJA 4BJTA 2KK1A 2OQMA 3EG9B 4MVOA 3SEOA 2XS1A 2XLEA 3U3FA 4MQ9F 3RW0A 4JCHA 3LLIA 4MS2A 1T01A 2IYLD 3EFOA 4IGGA 3W8IA 1RJ9B 5E33A 3T6GB 1JPNA 1Y4CA 2HS5A 2XLHA 3ZWIA 2OOCA 5E2QA 4D4XA 4JCZA 3WG7C 1OKKA 3JRTA 256BA 3ZTMA 3POVA 2R7WA 4OD4A 2FGYA 2L9JA 4AE4B 5KYXB 2M64A 1OW6A 3RVYA 2XM4A 5B1BC 1TWAA 2P0NA 3SYNA 5BQHA 1YA9A 4CDVA 1U89A 2J9VA 5B1AC 3QVYA 3AG3C 1W2WA 1TWCA 2HSQA 3GWNA 2R03A 1XZPA 4QDLA 2EIJC 1NG1A 3NMKA 4U5DE 3TD7A 1ZYRF 2HV7A 5CIVA 3OEOA 2NUPB 2EILC 3FAJA 2OEVA 3F46A 3UMIA 3IHUA 3DJNB 1LS4A 3U5SA 2RD9A 4DBRA 3GANA 3LJBA 1FMWA 1L7CA 4KNWA 2HJMA 3TQOA 2V3CC 3KYJA 4HFKB 4U5BE 5A6AA 1DOVA 3L1MA 2W9YA 2GDCA 1PD1A 2R7OA 1RJ9A 4W8PA 1R4TA 2PX3A 2R9RB 5L0JA 2XLWA 3EGXA 3HNKA 4H54A 5DQTA 5F5HA 3JYHA 4H4KC 3HNIA 5KYXA 1NU9C 2ZPAA 2GAQA 1LM3B 3ATPA 5A6BD 1GM5A 4E0HA 3B9QA 2IXMA 4MVRA 4NTBA 3IQ5A 3HJCA 2AWCA 1PCXA 1T5OA 2YL0A 4DXWA 1H9TA 1VLSA 2VC9A 4FAPB 4XEVA 2XS8A 1RKEB 4I3MA 4MTFA 3U9MA 2YVKA 3G4ZA 1WGWA 2ZD9A 3LUTB 2Y3GA 1BBHA 3QVZA 4IB4A 4IRUA 3US6A 3TOMA 1O3UA 4O7GA 2Q9BA 1U6HA 1OW8A 2XLDA 3RQGA 2J8WA 5KYNA 2ASRA 3GEIA 1SMYF 4RBNA 3V5ZA 3B0PA 5AC4A 3VM6A 2V26A 4WGYA 2WVNA 2A0UA 5A6KA 2KW3C 3NKDA 3X2QC 1ZHYA 4WGZA 4DOZA 4EHPA 5EHHA 3L34A 1NFOA 4BPMA 2R7RA 2Q3TA 4JURI 1GGQA 4NY3A 4N6CA 4OIOF 1AEPA 4J7TA 3H2UA 1V74B 4K0DA 4EBJA 3CAXA 3MYIA 2DI3A 2J46A 2X51A 3AJMA 4YT8A 4MVSA 3EQLF 3LEVA 3L8IA 3WAQA 1M56C 3B0UX 3SXKA 1ZW3A 2MHRA 4LDKA 3QMKA 3HTKC
chains in the Genus database with same CATH topology
5AGFA 4CJOA 2XLOA 3C62A 5B3IA 5JSLA 1YZCA 2YLDA 3HNLA 2YL7A 5JLIA 4N4WA 5JT4A 1EKYA 2XL8A 3M15A 4NC3A 3HNJA 4CDAA 4CIPA 2YKZA 5JRAA 5JP7A 1CPQA 1MQVA 2QLAA 3QW1A 3NMJA 1E86A 1CGNA 5JVEA 5JUAA 2XLEA 1M6TA 3M79A 1E85A 4JEBA 2XLHA 2YL1A 1RCPA 3ZWIA 4D4XA 3ZTMA 256BA 4ER9A 2XM4A 4CDYA 4CDVA 4CJGA 1YYXA 3QVYA 1GQAA 1CGOA 2BC5A 4ULVA 3FOOA 3NMKA 3DE8A 1YYJA 3FOPA 2XM0A 2XLVA 3ZTZA 3L1MA 1QPUA 4JKVA 2J9BA 4EIYA 5JS5A 2XLWA 3HNKA 3HNIA 1LM3B 4IARA 4U9DA 4CX9A 1CPRA 2XL6A 3IQ5A 3QW0A 2YL0A 4L6RA 3M4BA 4IAQA 2YLIA 3U8PA 1BBHA 3QVZA 4IB4A 3TOMA 4N6HA 3DE9A 2XLDA 4JEAA 2J8WA 1E83A 4JE9A 4WGYA 2CCYA 1S05A 1APCA 1YZAA 1E84A 3ZQYA 4WGZA 1NBBA 4D4NA 3M4CA 1QQ3A 3ZQVA 2YLGA 1JAFA 3C63A 1A7VA 3IQ6A 4U9EA 2YL3A 2XLMA 3TOLA 3NMIA 3VRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGF A;  4CJO A;  2XLO A;  3C62 A;  5B3I A;  5JSL A;  1YZC A;  2YLD A;  3HNL A;  2YL7 A;  5JLI A;  4N4W A;  5JT4 A;  1EKY A;  2XL8 A;  3M15 A;  4NC3 A;  3HNJ A;  4CDA A;  4CIP A;  2YKZ A;  5JRA A;  5JP7 A;  1CPQ A;  1MQV A;  2QLA A;  3QW1 A;  3NMJ A;  1E86 A;  1CGN A;  5JVE A;  5JUA A;  2XLE A;  1M6T A;  3M79 A;  1E85 A;  4JEB A;  2XLH A;  2YL1 A;  1RCP A;  3ZWI A;  4D4X A;  3ZTM A;  256B A;  4ER9 A;  2XM4 A;  4CDY A;  4CDV A;  4CJG A;  1YYX A;  3QVY A;  1GQA A;  1CGO A;  2BC5 A;  4ULV A;  3FOO A;  3NMK A;  3DE8 A;  1YYJ A;  3FOP A;  2XM0 A;  2XLV A;  3ZTZ A;  3L1M A;  1QPU A;  4JKV A;  2J9B A;  4EIY A;  5JS5 A;  2XLW A;  3HNK A;  3HNI A;  1LM3 B;  4IAR A;  4U9D A;  4CX9 A;  1CPR A;  2XL6 A;  3IQ5 A;  3QW0 A;  2YL0 A;  4L6R A;  3M4B A;  4IAQ A;  2YLI A;  3U8P A;  1BBH A;  3QVZ A;  4IB4 A;  3TOM A;  4N6H A;  3DE9 A;  2XLD A;  4JEA A;  2J8W A;  1E83 A;  4JE9 A;  4WGY A;  2CCY A;  1S05 A;  1APC A;  1YZA A;  1E84 A;  3ZQY A;  4WGZ A;  1NBB A;  4D4N A;  3M4C A;  1QQ3 A;  3ZQV A;  2YLG A;  1JAF A;  3C63 A;  1A7V A;  3IQ6 A;  4U9E A;  2YL3 A;  2XLM A;  3TOL A;  3NMI A;  3VRC A; 
#chains in the Genus database with same CATH topology
 3ASO C;  4BJ6 A;  4LER A;  4O6Y A;  4W8K A;  4XPW A;  3C62 A;  2GA0 A;  2KNH A;  2XSE A;  4PJL A;  3EH2 A;  2YLD A;  4PFO A;  2IXN A;  3GEH A;  1H7I A;  2ETS A;  1XWJ A;  2L6H A;  1RKE A;  1HY5 A;  2OG2 A;  3GOD A;  2W4M A;  4C7O B;  1MMG A;  4CS8 A;  3ZIB A;  3LS0 A;  4XEK A;  3U9J A;  4YL1 A;  1T6U A;  1OW7 A;  2AVK A;  2NSF A;  4QI2 A;  4E7S A;  4NQF A;  1HE1 A;  2ICW G;  3S28 A;  3ABM C;  1ZVZ A;  3M15 A;  3MBG A;  1FMV A;  3Q7L A;  3MX3 A;  2L81 A;  4JTC B;  4XPX A;  1NU7 D;  3DJU B;  1J8Y F;  4CIP A;  1FNT c;  5JRA A;  3RQF A;  1LIH A;  1Z5Z A;  1E2X A;  2OJE D;  1M57 C;  3C8G D;  4ZLC A;  5JP7 A;  5KYU B;  1CPQ A;  1HMO A;  1LVK A;  3K6B A;  1PV3 A;  3AGT A;  1NZE A;  5T3T A;  5DS4 A;  2A69 F;  4KNV A;  2W4B A;  3FXH A;  3Q6M A;  1CGM E;  1OCC C;  2VAS A;  1WAT A;  2J9W A;  5JVE A;  1B68 A;  3CQZ A;  3ZC4 A;  2QTV A;  1D0Z A;  2NUT A;  3M79 A;  1TFK B;  3AQB A;  4MTO A;  1M2O A;  2Q9A A;  4HEA J;  1VYI A;  1YVI A;  4ULW A;  1QKR A;  1FFH A;  1LE4 A;  1G4W R;  1RCP A;  4C3D A;  4XLP F;  1SZI A;  3UGP A;  3ZG1 A;  4EBB A;  3J06 A;  3NYJ A;  1WAS A;  3NRH A;  4RD9 A;  3RVZ A;  4AL1 A;  2NG1 A;  3KH2 A;  3BRJ A;  2ZXP A;  1Z63 A;  2KJG A;  5FZT A;  3TJ6 A;  2Y69 C;  2YEV A;  4LLC A;  2R7T A;  1KTM A;  1GQA A;  1A0B A;  1M2V B;  2WVO A;  2Z15 A;  3FOO A;  1LI7 A;  4J32 B;  4O6M A;  3DE8 A;  4IAO A;  1YYJ A;  2XRH A;  2UUI A;  5CI9 A;  2OU6 A;  2LCH A;  4U5F E;  3W2W A;  1MND A;  3I5Q A;  4CS9 C;  3EHN A;  1D1C A;  1MNE A;  4MTG A;  4R32 A;  3AQC A;  3DI5 A;  3QZC A;  3LES A;  3UGO A;  1HW1 A;  1ZZP A;  1QPU A;  3GEE A;  5L0I A;  3DM5 A;  5F28 E;  3GOR A;  5KYW A;  1R5I D;  2Y3D A;  2XXA A;  1KNY A;  4JJF A;  3SXY A;  2HZ8 A;  3VYW A;  3ABL C;  2HKV A;  5JS5 A;  1BR4 A;  1S7Z A;  3T6B A;  1EQ1 A;  3RFY A;  1I5N A;  4NTA A;  2PBE A;  5BUO A;  1AVO B;  2Y3H A;  5E3C A;  3H65 A;  1G4U S;  4Z9J A;  4KI2 A;  4IAR A;  4Z9I A;  4J7Y A;  1BR1 A;  2XL6 A;  3TJ5 A;  3NKE A;  2L6F A;  4L6R A;  3H2V A;  2UUH A;  4E18 A;  4BJ5 A;  2YLI A;  4IAQ A;  3U8P A;  1HE9 A;  3CSK A;  4BG0 A;  1RMV A;  4N6H A;  3DE9 A;  2YWA A;  2LK4 A;  4XPY A;  1S05 A;  3G50 A;  3V7O A;  1APC A;  2LQG A;  1E84 A;  3LNR A;  4IWB A;  3GM2 A;  3ZQY A;  3LNM B;  1Q0K A;  3C8G B;  1Z3I X;  2G3V A;  4GQH A;  1ZHX A;  3M4C A;  3VF0 A;  3ZQV A;  1MMN A;  3E70 C;  1YAU O;  2GWW A;  1EI7 A;  4LAC B;  4YJW A;  2A0B A;  4YK5 A;  3R2P A;  2DYR C;  3IQ6 A;  3UR3 C;  2Q7R A;  3B0V C;  2XLM A;  4FX5 A;  2VCC A;  2R7Q A;  3RQE A;  1YJG A;  2R02 A;  4PFP A;  3JRM O;  3UNG C;  4GYT A;  2J7P A;  3M1C B;  3JSE O;  5CI8 A;  5AGF A;  2NUT B;  2R7X A;  4AL0 A;  5A6B A;  2XLO A;  3JTL O;  2GFH A;  5JSL A;  5T1D B;  1SYQ A;  5BQG A;  2BL2 A;  3KMI A;  4WJ0 A;  1VYK A;  1HMD A;  3O39 A;  5COM A;  5EGY A;  3BEH A;  3EGD A;  1LS1 A;  4FWV A;  4Q7C A;  3RIP A;  4K1O A;  4JW1 A;  3K66 A;  5DQZ A;  3DXJ F;  1N1C A;  5JT4 A;  2EPO A;  3B29 A;  1RKC A;  3G4X A;  4U5H A;  5K0I A;  3GWL A;  3GM1 A;  5L0H A;  5KYW B;  4OIN F;  4XQ1 A;  1FR0 A;  3N0T A;  3JYY A;  1Q0G A;  2WZF A;  4NC3 A;  3HNJ A;  4CDA A;  3O6X A;  2EPL X;  4JZA A;  2DYS C;  1OCR C;  1O5H A;  1MMD A;  5F5F A;  1O87 A;  1MQV A;  1K40 A;  2QLA A;  4MVU A;  2NSG A;  3QW1 A;  4YT5 A;  1E86 A;  3LAY A;  4MVQ A;  4K7B A;  3EG9 A;  2R05 A;  3T4R A;  3FHD A;  1OKK D;  1M6T A;  3AG2 C;  3DZA A;  2IOQ A;  4JC7 A;  4JEB A;  3MYF A;  2YQY A;  1E85 A;  4G7Z F;  4I44 A;  3A11 A;  3R7C A;  2G3K A;  3S0X A;  1VMA A;  2J0W A;  2PNO A;  2VH3 A;  4JVS A;  2L6G A;  3EGD B;  4OD5 A;  1QZX A;  3UMK A;  4XEF A;  4CS8 C;  4ER9 A;  1ST6 A;  3DKA A;  2FAP B;  4P6I C;  4CSA A;  2OKU A;  1D1B A;  3EPV A;  2AU5 A;  3FMS A;  4HE8 D;  2CNW D;  3DAF A;  1Q0M A;  1BR2 A;  3CZ6 A;  2WL8 A;  3NG1 A;  3QTH A;  4RDA A;  4CS9 A;  2MYS A;  3F47 A;  5TJ5 E;  4B6I A;  4C3E A;  2OJQ A;  2A1D D;  2Y39 A;  4DRH B;  2BC5 A;  5IY5 C;  4ZLD A;  2CNW A;  3EH1 A;  1D0Y A;  4CBE A;  3FOP A;  2EIK C;  4XTK A;  1LKX A;  2OCC C;  2HMZ A;  5T3W A;  3FAP B;  3Q6N A;  3S9O A;  3DD7 A;  2XLV A;  1Q0D A;  5D92 A;  1TR2 A;  3U8V A;  2CGE A;  1JMW A;  4OIQ F;  4EWC A;  2C04 A;  4KC9 A;  1ORY A;  1FAP B;  2IXO A;  5B3S C;  1JOG A;  5HSW A;  4JKV A;  3SXZ A;  1ZU4 A;  2D5R B;  2J9B A;  4EIY A;  5A69 A;  3V5Y A;  4OIP F;  2PP4 A;  2W45 A;  2RSE B;  1VB5 A;  2E87 A;  3AOU A;  4BJ5 C;  1RXQ A;  3ECS A;  2YZS A;  1C03 A;  1BDJ B;  2QUP A;  2BE5 F;  4U9D A;  2L7A A;  4G78 A;  4F4B A;  1CPR A;  1GS9 A;  1BZ4 A;  1A7D A;  3NYL A;  3QW0 A;  3ZSU A;  3L0I A;  3M4B A;  3N2Z B;  3AGU A;  1DOW A;  3LEO A;  2R25 A;  3S29 A;  4CSA C;  4PR9 A;  2HUJ A;  2Q9C A;  3L8J A;  3OA1 A;  1LE2 A;  2B0H A;  2KC3 A;  3IPM O;  4JEA A;  1E83 A;  4DRJ B;  2KSF A;  4JE9 A;  3SZR A;  4N06 A;  3AG1 C;  2AWY A;  3EHM A;  4LLE A;  4AX2 A;  2VB6 A;  3KL4 A;  4YT4 A;  1IZM A;  3EFO B;  4MVM A;  3ZVR A;  1G5Z A;  2FFH A;  3HLZ A;  3K1H A;  2D4U A;  3NYM A;  2LD6 A;  3PMR A;  4JRZ A;  3UMH A;  4LDQ A;  3DWW A;  1V55 C;  1KU2 A;  1JAF A;  1H9G A;  2YLG A;  4JIO A;  2P7V A;  3RH3 A;  3SNH A;  1HW2 A;  4Q4Z F;  3C18 A;  1D1A A;  2KYH A;  1VTM P;  1IW7 F;  3JT1 A;  4GEH A;  3T9O A;  4O6N A;  2XXA B;  1Y6D A;  1UFB A;  1WOL A;  4KBL A;  3TOL A;  1H6G A;  2DGJ A;  2LIG A;  3VRC A;  1F1M A;  1EA8 A;  4G7O F;  1I4Z A;  3EZI A;  5FCL A;  1MMA A;  2LFD A;  4G0H A;  5L0C A;  2H7V C;  4DJ9 A;  1TWH A;  1JPJ A;  2QNL A;  2J45 A;  3E9V A;  1LPE A;  5D91 A;  5DS5 A;  4CJO A;  2EPK X;  2ZXR A;  5L3Q A;  5B3I A;  3WHN A;  1V4A A;  2A68 F;  5COF A;  3C8G A;  3TUL A;  1U0B B;  4OIR F;  1Q0F A;  3DM9 B;  3HNL A;  2R7S A;  4P9T A;  1SF8 A;  2G62 A;  3RKO F;  2J7P D;  4BJ1 A;  5DS6 A;  4FES A;  1OR2 A;  3MFN A;  4MND A;  2R7U A;  1D0X A;  3O55 A;  2P61 A;  3I4U A;  4YL3 A;  2PF4 E;  2MWQ A;  4U5G A;  4EBK A;  2EIN C;  1Z7Q c;  2EPM X;  2HSB A;  2YKZ A;  4Z9H A;  2C03 A;  4QI0 A;  5E3A A;  4XLN F;  3SP1 A;  1PD0 A;  4U5E E;  1QLE C;  1C02 A;  2JD3 A;  5A6J A;  3W2V A;  1ZHT A;  1ORJ A;  2NUP A;  3U0C A;  3C7J A;  1G8X A;  1TWG A;  2CW0 F;  3CEX A;  1LI5 A;  3NMJ A;  4JJG A;  1CGN A;  4A4A A;  5L0G A;  1YA7 O;  4PJJ A;  1TKN A;  4AE4 A;  5JUA A;  5AC5 A;  2KQ9 A;  4JTD B;  4MW3 A;  1A7E A;  1ORS C;  2EPN A;  2PX0 A;  3DAG A;  4LDR A;  1JRA A;  1NLX A;  2AP3 A;  4YL0 A;  4HFF B;  3VAY A;  4A2N B;  1ZHZ A;  4Q5S F;  2YL1 A;  2QY9 A;  2YHS A;  5L3V A;  3ZDL A;  2YRF A;  4E0I A;  5KYY B;  3NDB B;  3KPH A;  4M63 A;  5COG A;  2J0X A;  1ZW2 A;  3EJN A;  3JCU Q;  3RYL A;  3FDQ A;  1JR8 A;  3C8Z A;  4U5C E;  4CDY A;  2EIM C;  4CJG A;  2P6V A;  1YYX A;  4YN0 B;  3PCV A;  4YWQ A;  1CGO A;  2WZL A;  4ULV A;  4MW8 A;  3S90 A;  1OCZ C;  4UDV A;  2LSE A;  2O9X A;  3B71 A;  2XM0 A;  2M4E A;  4EKW A;  2JX0 A;  3O10 A;  2CYD A;  2WVQ A;  1OCO C;  3ZTZ A;  4PK4 A;  4I1O B;  4DRI B;  4XWJ A;  3AG4 C;  2LP4 A;  2HJ3 A;  3N24 A;  2LFF A;  4WAB A;  1T6Q A;  1T9K A;  2VCB A;  2CDQ A;  3W4Y A;  4BEJ A;  1SR2 A;  3SXM A;  2IXP A;  3K1I C;  4ONS A;  3TK0 A;  1OXB A;  1Z6A A;  1WTY A;  2NPU A;  3T6J A;  3WOD F;  2PFD A;  4G7H F;  1K04 A;  3EZH A;  3X1O A;  4CX9 A;  1Z23 A;  2B0J A;  3A9C A;  1ZHW A;  3U3B A;  1WN0 A;  3KYI A;  1ZU5 A;  3PDM P;  4DBQ A;  3KKB A;  2R7V A;  3FVY A;  1YDI A;  3S27 A;  1QSP A;  2H7O A;  2H8A A;  2X0C A;  3V5X A;  3LS1 A;  4DVY P;  2HV6 A;  5HV9 A;  5JLI A;  2A6E F;  4NCQ A;  2DB4 A;  1FTS A;  2KGO A;  1OQC A;  1QVX A;  2CCY A;  2ZXO A;  1T6I A;  3Q7G A;  4MVZ A;  1J8M F;  2ZXW C;  1YZA A;  4ANJ A;  5L0F A;  4C7O A;  2A6H F;  2I15 A;  2TMV P;  1AUE A;  1NBB A;  3DMD A;  3K1I A;  4D4N A;  1QQ3 A;  3ASN C;  4AK9 A;  4EUK B;  4PAC A;  3C63 A;  2IM8 A;  1A7V A;  1NFN A;  2Q4F A;  3EGX B;  3MLG A;  3U2L A;  5BQI A;  4O79 A;  4JTA B;  2YL3 A;  4U9E A;  2WB7 A;  5DVW A;  4E7Z A;  3ABK C;  3NMI A;  4DVZ A;  4I1M A;  1WWP A;  2J9U A;  2WZG A;  3LLK A;  3IEE A;  2VCA A;  3PHF 2;  1OXK A;  1VLT A;  1FFT C;  4CS7 A;  1VOM A;  2F22 A;  3HKK A;  4BEM J;  3OWT A;  3IQT A;  1C17 M;  5EK0 A;  2XL4 A;  1YZC A;  2HMQ A;  4YT2 A;  1TQG A;  4NTF A;  1I4Y A;  1K05 A;  2HFI A;  5KYY A;  2IBF A;  3S84 A;  5L0D A;  1L3P A;  3RF3 A;  2JPU A;  1M2V A;  2YL7 A;  3I5P A;  1YAR O;  2Y3B A;  4N4W A;  4P9F A;  5GPG B;  4BJ6 C;  2QE9 A;  4C3B A;  1YLM A;  3JZ0 A;  4CIH A;  1EKY A;  2Q00 A;  2XL8 A;  1VK5 A;  3K33 A;  4PJM A;  4PJN A;  2I8B A;  1UG7 A;  4J30 B;  1TFO B;  3W8H A;  1V54 C;  4X0R A;  1NSG B;  1A41 A;  2OEX A;  2P1A A;  3JSZ A;  1XZQ A;  3IQC A;  4IJJ A;  1OR3 A;  5KYU A;  2H7B A;  4E17 A;  3ITF A;  3K7D A;  3U2M A;  3GM3 A;  5DLJ A;  4BJT A;  2KK1 A;  2OQM A;  3EG9 B;  4MVO A;  3SEO A;  2XS1 A;  2XLE A;  3U3F A;  4MQ9 F;  3RW0 A;  4JCH A;  3LLI A;  4MS2 A;  1T01 A;  2IYL D;  3EFO A;  4IGG A;  3W8I A;  1RJ9 B;  5E33 A;  3T6G B;  1JPN A;  1Y4C A;  2HS5 A;  2XLH A;  3ZWI A;  2OOC A;  5E2Q A;  4D4X A;  4JCZ A;  3WG7 C;  1OKK A;  3JRT A;  256B A;  3ZTM A;  3POV A;  2R7W A;  4OD4 A;  2FGY A;  2L9J A;  4AE4 B;  5KYX B;  2M64 A;  1OW6 A;  3RVY A;  2XM4 A;  5B1B C;  1TWA A;  2P0N A;  3SYN A;  5BQH A;  1YA9 A;  4CDV A;  1U89 A;  2J9V A;  5B1A C;  3QVY A;  3AG3 C;  1W2W A;  1TWC A;  2HSQ A;  3GWN A;  2R03 A;  1XZP A;  4QDL A;  2EIJ C;  1NG1 A;  3NMK A;  4U5D E;  3TD7 A;  1ZYR F;  2HV7 A;  5CIV A;  3OEO A;  2NUP B;  2EIL C;  3FAJ A;  2OEV A;  3F46 A;  3UMI A;  3IHU A;  3DJN B;  1LS4 A;  3U5S A;  2RD9 A;  4DBR A;  3GAN A;  3LJB A;  1FMW A;  1L7C A;  4KNW A;  2HJM A;  3TQO A;  2V3C C;  3KYJ A;  4HFK B;  4U5B E;  5A6A A;  1DOV A;  3L1M A;  2W9Y A;  2GDC A;  1PD1 A;  2R7O A;  1RJ9 A;  4W8P A;  1R4T A;  2PX3 A;  2R9R B;  5L0J A;  2XLW A;  3EGX A;  3HNK A;  4H54 A;  5DQT A;  5F5H A;  3JYH A;  4H4K C;  3HNI A;  5KYX A;  1NU9 C;  2ZPA A;  2GAQ A;  1LM3 B;  3ATP A;  5A6B D;  1GM5 A;  4E0H A;  3B9Q A;  2IXM A;  4MVR A;  4NTB A;  3IQ5 A;  3HJC A;  2AWC A;  1PCX A;  1T5O A;  2YL0 A;  4DXW A;  1H9T A;  1VLS A;  2VC9 A;  4FAP B;  4XEV A;  2XS8 A;  1RKE B;  4I3M A;  4MTF A;  3U9M A;  2YVK A;  3G4Z A;  1WGW A;  2ZD9 A;  3LUT B;  2Y3G A;  1BBH A;  3QVZ A;  4IB4 A;  4IRU A;  3US6 A;  3TOM A;  1O3U A;  4O7G A;  2Q9B A;  1U6H A;  1OW8 A;  2XLD A;  3RQG A;  2J8W A;  5KYN A;  2ASR A;  3GEI A;  1SMY F;  4RBN A;  3V5Z A;  3B0P A;  5AC4 A;  3VM6 A;  2V26 A;  4WGY A;  2WVN A;  2A0U A;  5A6K A;  2KW3 C;  3NKD A;  3X2Q C;  1ZHY A;  4WGZ A;  4DOZ A;  4EHP A;  5EHH A;  3L34 A;  1NFO A;  4BPM A;  2R7R A;  2Q3T A;  4JUR I;  1GGQ A;  4NY3 A;  4N6C A;  4OIO F;  1AEP A;  4J7T A;  3H2U A;  1V74 B;  4K0D A;  4EBJ A;  3CAX A;  3MYI A;  2DI3 A;  2J46 A;  2X51 A;  3AJM A;  4YT8 A;  4MVS A;  3EQL F;  3LEV A;  3L8I A;  3WAQ A;  1M56 C;  3B0U X;  3SXK A;  1ZW3 A;  2MHR A;  4LDK A;  3QMK A;  3HTK C; 
#chains in the Genus database with same CATH homology
 5AGF A;  4CJO A;  2XLO A;  3C62 A;  5B3I A;  5JSL A;  1YZC A;  2YLD A;  3HNL A;  2YL7 A;  5JLI A;  4N4W A;  5JT4 A;  1EKY A;  2XL8 A;  3M15 A;  4NC3 A;  3HNJ A;  4CDA A;  4CIP A;  2YKZ A;  5JRA A;  5JP7 A;  1CPQ A;  1MQV A;  2QLA A;  3QW1 A;  3NMJ A;  1E86 A;  1CGN A;  5JVE A;  5JUA A;  2XLE A;  1M6T A;  3M79 A;  1E85 A;  4JEB A;  2XLH A;  2YL1 A;  1RCP A;  3ZWI A;  4D4X A;  3ZTM A;  256B A;  4ER9 A;  2XM4 A;  4CDY A;  4CDV A;  4CJG A;  1YYX A;  3QVY A;  1GQA A;  1CGO A;  2BC5 A;  4ULV A;  3FOO A;  3NMK A;  3DE8 A;  1YYJ A;  3FOP A;  2XM0 A;  2XLV A;  3ZTZ A;  3L1M A;  1QPU A;  4JKV A;  2J9B A;  4EIY A;  5JS5 A;  2XLW A;  3HNK A;  3HNI A;  1LM3 B;  4IAR A;  4U9D A;  4CX9 A;  1CPR A;  2XL6 A;  3IQ5 A;  3QW0 A;  2YL0 A;  4L6R A;  3M4B A;  4IAQ A;  2YLI A;  3U8P A;  1BBH A;  3QVZ A;  4IB4 A;  3TOM A;  4N6H A;  3DE9 A;  2XLD A;  4JEA A;  2J8W A;  1E83 A;  4JE9 A;  4WGY A;  2CCY A;  1S05 A;  1APC A;  1YZA A;  1E84 A;  3ZQY A;  4WGZ A;  1NBB A;  4D4N A;  3M4C A;  1QQ3 A;  3ZQV A;  2YLG A;  1JAF A;  3C63 A;  1A7V A;  3IQ6 A;  4U9E A;  2YL3 A;  2XLM A;  3TOL A;  3NMI A;  3VRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...