3HNLA

Crystal structure of the cu-induced dimer of the engineered cyt cb562 variant ridc-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 47
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnlA00
4CJOA 1E84A 3HNKA 1MQVA 5JSLA 2CCYA 3VRCA 4EIYA 2YL7A 5JT4A 1CPQA 1CGNA 4JEBA 1BBHA 2YL1A 2J9BA 3ZQVA 5JP7A 4ULVA 3NMJA 3M79A 4NC3A 3HNIA 3U8PA 3ZQYA 3ZTMA 4CDVA 3QVYA 1E83A 3M4CA 5JLIA 2XM4A 3TOMA 3IQ5A 4ER9A 2XLDA 3NMKA 3QVZA 2YLGA 4IAQA 2XLWA 4JEAA 2XLEA 3L1MA 1LM3B 1A7VA 3DE8A 4CDYA 4N6HA 2BC5A 4N4WA 3ZTZA 4JKVA 4JE9A 5JS5A 3M15A 4D4NA 2YL0A 1M6TA 1YYXA 1QPUA 3TOLA 256BA 3QW0A 2XM0A 4CJGA 1QQ3A 2YKZA 4CDAA 2YL3A 5B3IA 3HNJA 2YLIA 2XL6A 1RCPA 2J8WA 5JUAA 1CPRA 3DE9A 1S05A 3FOPA 4IARA 5AGFA 2XLHA 2XLVA 3M4BA 3IQ6A 3FOOA 4D4XA 1E86A 1GQAA 4CIPA 3C62A 5JRAA 5JVEA 2YLDA 1APCA 1JAFA 2XLMA 1EKYA 1YZCA 1YZAA 1NBBA 3NMIA 4IB4A 2QLAA 4L6RA 4WGZA 3C63A 4U9EA 4CX9A 3QW1A 1E85A 1YYJA 3HNLA 1CGOA 2XL8A 3ZWIA 4U9DA 2XLOA 4WGYA
chains in the Genus database with same CATH superfamily
3W8IA 3NDBB 3IQCA 2IXOA 5L3VA 1D0XA 5EK0A 5F28E 1T01A 5JSLA 1YJGA 1RMVA 4M63A 4JZAA 2HMZA 1L7CA 4G0HA 4EIYA 1XWJA 5KYXB 4CSAC 3SP1A 1CGNA 1WASA 4CS8C 5L0FA 3A9CA 5CI8A 4ZLDA 3O6XA 2I15A 4R32A 5EHHA 3H65A 2Y3DA 2P6VA 1D0YA 2J9BA 2P1AA 2DGJA 3SYNA 1Z5ZA 3ZQVA 3MX3A 2Q9CA 1VK5A 3W2VA 2A1DD 2QTVA 1T6UA 4BG0A 1WTYA 4I1OB 4C7OA 1O87A 2H7OA 2WVQA 3DJNB 3EGXB 1T5OA 4W8KA 2YRFA 2OJED 1Q0KA 2NPUA 3ZTMA 4BJ6C 4YT2A 4UDVA 2EIMC 1T6QA 2ICWG 1I5NA 2NUPA 3ZVRA 2RSEB 3EHMA 2R7VA 1ST6A 1OCCC 1ZHYA 3O39A 3W8HA 4LERA 4AE4A 2ZPAA 4MVUA 3TOMA 1O5HA 3IQ5A 3JRTA 3JZ0A 2HV7A 2L81A 3KYJA 2L7AA 2VCCA 4I44A 1M57C 2VCBA 4YL3A 3TJ5A 1YAUO 3EFOA 4AX2A 4E0HA 3ZC4A 1V55C 4IAQA 5L0CA 2WZLA 3T9OA 3EJNA 4I1MA 1ZW2A 4K0DA 1A7VA 4WABA 4AK9A 3LLIA 2IOQA 2Y69C 2BC5A 4N6HA 4CDYA 4EHPA 4OIQF 4JKVA 1A41A 4NY3A 3POVA 4YT4A 1HE1A 1L3PA 2WZGA 3ITFA 4MVZA 4DRIB 1Z7Qc 3T6BA 2J0WA 2CW0F 5L0DA 2B0JA 2EPKX 1PD0A 2Q3TA 1QPUA 2XS1A 3K6BA 4JTCB 4MVOA 4B6IA 4O79A 2HZ8A 1PD1A 3ABLC 5KYNA 2YL3A 4PR9A 2X51A 4MTGA 5TJ5E 2NUTA 4HFKB 2DYSC 3LEVA 1K04A 3T4RA 3LS0A 4P9TA 2ZXOA 5F5HA 4I3MA 3A11A 2CNWA 4XQ1A 3BEHA 3DE9A 2PF4E 4U5EE 3RFYA 2V3CC 4CS9A 1D1AA 5DQTA 1CGME 1DOWA 2NSFA 2XLHA 3GWLA 4JTAB 5A6JA 1XZPA 1VLSA 4LLCA 2OU6A 3I5PA 1GQAA 1WN0A 3T6JA 2YHSA 2H7VC 3EG9B 1NU9C 2EPNA 3LESA 5A6AA 2D5RB 2HKVA 3E9VA 5JRAA 3R2PA 4JURI 3S27A 1JAFA 2XLMA 1NU7D 3G4ZA 3J06A 3Q6MA 1G4US 2XSEA 3DAGA 4EBKA 3O10A 1QLEC 3R7CA 2ASRA 3HTKC 3WODF 2MYSA 3U5SA 4G7OF 4U9EA 2L6FA 2Y3HA 3RKOF 1A0BA 2HJ3A 3GEIA 4YL0A 2GA0A 3L0IA 4NTAA 2DYRC 1Q0GA 1M56C 1ORSC 3H2VA 2XL8A 4K1OA 5HV9A 1VMAA 4E0IA 5COFA 1HW1A 2KW3C 4PACA 3K66A 4WGYA 3TJ6A 4BEMJ 5BQIA 2YWAA 3DD7A 4DVZA 4XEFA 3NKDA 3FXHA 4CJOA 2KC3A 2KNHA 1Z6AA 3JYYA 3SEOA 1FNTc 4PJJA 1VYKA 5KYWB 3S84A 2CCYA 2EIKC 2EINC 5A6KA 1LPEA 1LVKA 3N2ZB 3VRCA 4Q4ZF 2R03A 2PFDA 4DVYP 3K33A 1A7EA 3DAFA 5JT4A 3MYIA 3SXMA 2XL4A 1CPQA 1QSPA 1TR2A 3VF0A 2OKUA 1AUEA 1OKKD 1ZVZA 4W8PA 1QZXA 3LJBA 5GPGB 3LEOA 1TWHA 1BBHA 2R9RB 3UMIA 4JIOA 2G62A 4N6CA 4KI2A 4G7ZF 3PDMP 1Z3IX 1HMOA 3CQZA 1TQGA 4LDQA 3ASNC 3K1IA 1VLTA 3DXJF 3GM1A 4QI2A 4JJGA 5D91A 1WGWA 3ZQYA 2LK4A 3U9MA 2LFFA 4MVQA 3KKBA 5DQZA 5KYYB 1VOMA 1E83A 4JVSA 4XLNF 2KK1A 2R25A 4J30B 3M4CA 1PCXA 1T9KA 3I5QA 1NLXA 3JRMO 4U5BE 5EGYA 5IY5C 2XRHA 4OIPF 3AG1C 2HJMA 3RVYA 2XM4A 3C8GA 3LUTB 3T6GB 4ER9A 1AEPA 5B1BC 4P9FA 2XLDA 5T3TA 1OXBA 1FFHA 4H4KC 2KQ9A 3HKKA 1M2VB 3JTLO 4EKWA 4KNVA 5A6BA 2AU5A 5L0HA 2A68F 1SR2A 3AG4C 3QVZA 2XXAB 5KYUA 3DM5A 2Z15A 2BL2A 3GANA 2Q7RA 1OCRC 2R7UA 2ZD9A 3VYWA 1LM3B 1KTMA 3DM9B 5COMA 1B68A 1LE4A 3OEOA 4G78A 4XWJA 2JX0A 1GS9A 1V74B 4YK5A 2LFDA 4H54A 3DZAA 1ZHWA 1YVIA 4HE8D 4BEJA 3AGUA 3LLKA 4MQ9F 4JCHA 1Q0DA 4D4NA 5CI9A 2ZXRA 1I4YA 3LS1A 2X0CA 4OIOF 1OW7A 2EIJC 1YYXA 1JMWA 2FFHA 3GM2A 2IYLD 3TOLA 2A6HF 3QW0A 1ZYRF 3B29A 3EPVA 4J32B 5FZTA 1QQ3A 3ASOC 2CYDA 3C7JA 3M1CB 3S90A 2A6EF 2QNLA 4C3BA 3HNJA 1T6IA 3F46A 3LAYA 2QY9A 2XL6A 4MNDA 4NCQA 5E33A 1V54C 3WAQA 1MNEA 2WL8A 3MFNA 5D92A 3H2UA 4P6IC 4OINF 5JUAA 3FAJA 3B0UX 1G5ZA 1K05A 1OCOC 1S05A 1Y6DA 2QUPA 3NYLA 2OG2A 3UR3C 4LDKA 1BR2A 3FOOA 3NG1A 2YEVA 4D4XA 4JTDB 2R7RA 3EH2A 1ZW3A 4JRZA 2A0BA 3HLZA 4PJLA 5KYUB 4CIPA 3EGXA 2ETSA 5JVEA 5DS6A 1WWPA 3RF3A 2IM8A 3CSKA 2IXNA 1APCA 2M64A 1AVOB 3LNRA 3MBGA 3N0TA 5CIVA 1NBBA 3NMIA 4RD9A 5DS4A 4IB4A 5L3QA 3IHUA 3QTHA 2Q9BA 4WGZA 3KPHA 4IWBA 3EQLF 1UFBA 2CNWD 3EHNA 3NKEA 3QW1A 4JJFA 4Q5SF 1Z23A 4MW8A 4Z9JA 1M2OA 1NG1A 2OJQA 2GDCA 3RW0A 1BR4A 3K1HA 3UGPA 1LS1A 2QE9A 2AWYA 2UUHA 3MYFA 3UNGC 4WJ0A 3EH1A 1H6GA 4XEKA 2IBFA 4CSAA 2P0NA 2XLOA 1LI7A 5BQGA 4CS8A 2PX3A 2WB7A 4XEVA 2C04A 4DBQA 4FESA 3EZHA 2UUIA 3U0CA 2KSFA 1YARO 3US6A 1YA7O 1D1BA 1MQVA 1UG7A 1E84A 4C3EA 3PCVA 3RVZA 3DI5A 4E18A 1ORJA 4CBEA 5HSWA 2YVKA 3JYHA 2RD9A 1YA9A 3ZIBA 2R7SA 4NQFA 2CDQA 2LP4A 4Z9HA 4PFOA 2P7VA 4EWCA 2Y39A 4DRHB 3AOUA 3S28A 3RIPA 3RQEA 1BZ4A 2W4MA 4JEBA 4A2NB 4BJ6A 2J9UA 4ONSA 2G3KA 1SZIA 4BJ5C 4YWQA 3B0VC 1GGQA 2Y3BA 4ULVA 3U9JA 3AG2C 4ULWA 3RYLA 2HSBA 3AJMA 4X0RA 1RKEB 3F47A 3QZCA 1ZHXA 2IXMA 3EGDB 1JPJA 1TWCA 2LSEA 3FAPB 3HNIA 3PMRA 4GEHA 4HFFB 4N06A 4YT5A 2L9JA 3QVYA 3B9QA 1I4ZA 2OOCA 1OQCA 3O55A 1R5ID 1MMAA 1HY5A 1FMVA 4BPMA 5B1AC 3U2MA 1MNDA 1Y4CA 4CS7A 4Q7CA 1G4WR 4IAOA 5JLIA 2R7TA 3GEHA 5E2QA 2AWCA 4A4AA 3SXZA 3LNMB 2Q00A 1OW8A 1EA8A 2OEVA 3EG9A 3SNHA 1OR2A 4LACB 2DI3A 2VASA 4U5DE 2HUJA 1LKXA 3IQTA 1K40A 5E3CA 1FR0A 1F1MA 4FX5A 3L8IA 4QI0A 1WOLA 2J7PA 1NSGB 2IXPA 3S29A 4PFPA 1SMYF 1WATA 2C03A 3UGOA 1Z63A 4J7TA 1OXKA 4ZLCA 3V5ZA 2PP4A 3CZ6A 4YN0B 4N4WA 3ZTZA 2NSGA 1BR1A 4MVMA 2FGYA 3RH3A 4E7ZA 2GWWA 2R05A 3K7DA 4JE9A 1RJ9A 1JPNA 5FCLA 3UMHA 5JS5A 3M15A 2PNOA 2YL0A 3FHDA 4GQHA 2Y3GA 4E17A 2FAPB 3KYIA 2ZXWC 5BQHA 1TFOB 5DS5A 4C3DA 5B3SC 1FMWA 2TMVP 1VB5A 1O3UA 2YKZA 2VC9A 2VB6A 2WZFA 1D1CA 1ORYA 2J46A 3OA1A 4RBNA 1OKKA 4C7OB 3DMDA 2Q4FA 3JSZA 2J8WA 4HEAJ 4O7GA 4E7SA 1NZEA 4OIRF 1CPRA 1A7DA 3DJUB 3AG3C 4J7YA 4IJJA 3S0XA 1C02A 2J45A 3RQFA 2NUPB 3TQOA 3FOPA 2PBEA 4IARA 4XTKA 1OW6A 2XLVA 2EILC 3ABKC 2W45A 3IQ6A 3NRHA 4AE4B 1KU2A 2OEXA 1MMNA 1E86A 2JPUA 4EUKB 2J9WA 3GWNA 1YDIA 3B71A 3ECSA 1ZHTA 4XPYA 1S7ZA 3S9OA 3X2QC 2XS8A 2YLDA 1TKNA 1XZQA 5KYYA 2BE5F 2O9XA 3EFOB 1EKYA 1YZCA 3GODA 5K0IA 1FFTC 1LE2A 1C17M 2EPOA 2GAQA 1TFKB 2W4BA 4O6MA 4CS9C 3KMIA 2L6GA 2QLAA 1FAPB 4L6RA 3VM6A 4EBBA 2MWQA 1R4TA 3C63A 4U5FE 2ZXPA 4CX9A 2G3VA 4OD4A 3BRJA 3ZSUA 1M2VA 2R7OA 5KYXA 1D0ZA 3AGTA 4O6NA 5DVWA 1YYJA 1OCZC 3HNLA 2XXAA 3QMKA 1Q0FA 3E70C 1FTSA 1RXQA 3ZWIA 5T1DB 4MS2A 3WG7C 3SXYA 1IW7F 1SF8A 1MMDA 2YZSA 3C8ZA 2B0HA 3IPMO 4YT8A 5L0IA 3PHF2 2W9YA 4YJWA 4PJMA 3CEXA 1YLMA 2R7QA 3HNKA 3I4UA 3CAXA 2VH3A 3WHNA 3GEEA 4AL0A 4RDAA 4YL1A 2P61A 4NTFA 2LD6A 2NUTB 2CGEA 2YL7A 3DWWA 4U5GA 4BJ1A 4DOZA 2R7WA 4U5HA 2H7BA 1H7IA 4MVSA 2OQMA 3KL4A 2LCHA 3U3FA 1U0BB 4AL1A 2KGOA 3AQCA 2YL1A 5JP7A 3JT1A 4KBLA 1U6HA 4LLEA 3W4YA 1LIHA 3NMJA 1EQ1A 1J8YF 4F4BA 3M79A 4IGGA 4NC3A 4PJNA 2L6HA 3U8PA 1VTMP 3SZRA 5F5FA 4MVRA 2AVKA 3SXKA 3KH2A 4K7BA 1LI5A 4CDVA 1ZU4A 4MW3A 1G8XA 2J0XA 3TD7A 1U89A 2WVOA 3FVYA 2PX0A 1ZZPA 3V5XA 4FWVA 4NTBA 2V26A 4JW1A 2HS5A 5BUOA 3K1IC 3ZDLA 1E2XA 3NMKA 5AC5A 2NG1A 3B0PA 3EZIA 3OWTA 4G7HF 4DJ9A 1TWAA 2YLGA 2XLWA 1W2WA 4JEAA 2E87A 2HSQA 2XLEA 3NYMA 3GORA 1TWGA 4ANJA 1H9TA 1C03A 2AP3A 3L1MA 3L34A 2M4EA 1BDJB 3GM3A 1VYIA 2MHRA 5L0GA 3DE8A 1RKCA 2JD3A 4MTFA 4DBRA 2GFHA 3U3BA 4KNWA 1IZMA 3VAYA 2KJGA 1Q0MA 5E3AA 1JR8A 1MMGA 2Q9AA 1HMDA 1KNYA 1QKRA 1QVXA 2A69F 2HFIA 3ATPA 4IRUA 5AC4A 3NYJA 2YQYA 4U5CE 1M6TA 4XPXA 5DLJA 1NFNA 3ZG1A 256BA 1H9GA 1NFOA 5COGA 2XM0A 3G50A 4CJGA 4GYTA 4CDAA 2D4UA 2I8BA 2J7PD 3Q6NA 1OR3A 5B3IA 3N24A 4O6YA 4XLPF 5A69A 3V5YA 2YLIA 3HJCA 1JOGA 3FMSA 4DXWA 1DOVA 5T3WA 1RCPA 2F22A 1RJ9B 2OCCC 2HV6A 3AQBA 3W2WA 3MLGA 4LDRA 3V7OA 2J9VA 4MTOA 2WVNA 4QDLA 5AGFA 1HE9A 3L8JA 3TULA 3M4BA 1V4AA 1J8MF 2H8AA 3C8GB 1RKEA 2R02A 2VCAA 3EGDA 1LS4A 3JCUQ 1EI7A 3C62A 3DKAA 1ZHZA 3C8GD 4OD5A 4DRJB 1JRAA 4EBJA 2R7XA 4KC9A 3U8VA 3JSEO 3U2LA 5L0JA 3X1OA 2HMQA 2EPMX 2KYHA 1PV3A 5A6BD 1YZAA 3IEEA 3Q7LA 4JCZA 4XPWA 3RQGA 5KYWA 3G4XA 2EPLX 3UMKA 3TK0A 3ABMC 1SYQA 2DB4A 3C18A 1ZU5A 1N1CA 4Z9IA 1E85A 4FAPB 2LQGA 1CGOA 2A0UA 4CIHA 1GM5A 3FDQA 4JC7A 4U9DA 1HW2A 4PK4A 3Q7GA 2LIGA 4BJTA 4BJ5A
chains in the Genus database with same CATH topology
4CJOA 1E84A 3HNKA 1MQVA 5JSLA 2CCYA 3VRCA 4EIYA 2YL7A 5JT4A 1CPQA 1CGNA 4JEBA 1BBHA 2YL1A 2J9BA 3ZQVA 5JP7A 4ULVA 3NMJA 3M79A 4NC3A 3HNIA 3U8PA 3ZQYA 3ZTMA 4CDVA 3QVYA 1E83A 3M4CA 5JLIA 2XM4A 3TOMA 3IQ5A 4ER9A 2XLDA 3NMKA 3QVZA 2YLGA 4IAQA 2XLWA 4JEAA 2XLEA 3L1MA 1LM3B 1A7VA 3DE8A 4CDYA 4N6HA 2BC5A 4N4WA 3ZTZA 4JKVA 4JE9A 5JS5A 3M15A 4D4NA 2YL0A 1M6TA 1YYXA 1QPUA 3TOLA 256BA 3QW0A 2XM0A 4CJGA 1QQ3A 2YKZA 4CDAA 2YL3A 5B3IA 3HNJA 2YLIA 2XL6A 1RCPA 2J8WA 5JUAA 1CPRA 3DE9A 1S05A 3FOPA 4IARA 5AGFA 2XLHA 2XLVA 3M4BA 3IQ6A 3FOOA 4D4XA 1E86A 1GQAA 4CIPA 3C62A 5JRAA 5JVEA 2YLDA 1APCA 1JAFA 2XLMA 1EKYA 1YZCA 1YZAA 1NBBA 3NMIA 4IB4A 2QLAA 4L6RA 4WGZA 3C63A 4U9EA 4CX9A 3QW1A 1E85A 1YYJA 3HNLA 1CGOA 2XL8A 3ZWIA 4U9DA 2XLOA 4WGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJO A;  1E84 A;  3HNK A;  1MQV A;  5JSL A;  2CCY A;  3VRC A;  4EIY A;  2YL7 A;  5JT4 A;  1CPQ A;  1CGN A;  4JEB A;  1BBH A;  2YL1 A;  2J9B A;  3ZQV A;  5JP7 A;  4ULV A;  3NMJ A;  3M79 A;  4NC3 A;  3HNI A;  3U8P A;  3ZQY A;  3ZTM A;  4CDV A;  3QVY A;  1E83 A;  3M4C A;  5JLI A;  2XM4 A;  3TOM A;  3IQ5 A;  4ER9 A;  2XLD A;  3NMK A;  3QVZ A;  2YLG A;  4IAQ A;  2XLW A;  4JEA A;  2XLE A;  3L1M A;  1LM3 B;  1A7V A;  3DE8 A;  4CDY A;  4N6H A;  2BC5 A;  4N4W A;  3ZTZ A;  4JKV A;  4JE9 A;  5JS5 A;  3M15 A;  4D4N A;  2YL0 A;  1M6T A;  1YYX A;  1QPU A;  3TOL A;  256B A;  3QW0 A;  2XM0 A;  4CJG A;  1QQ3 A;  2YKZ A;  4CDA A;  2YL3 A;  5B3I A;  3HNJ A;  2YLI A;  2XL6 A;  1RCP A;  2J8W A;  5JUA A;  1CPR A;  3DE9 A;  1S05 A;  3FOP A;  4IAR A;  5AGF A;  2XLH A;  2XLV A;  3M4B A;  3IQ6 A;  3FOO A;  4D4X A;  1E86 A;  1GQA A;  4CIP A;  3C62 A;  5JRA A;  5JVE A;  2YLD A;  1APC A;  1JAF A;  2XLM A;  1EKY A;  1YZC A;  1YZA A;  1NBB A;  3NMI A;  4IB4 A;  2QLA A;  4L6R A;  4WGZ A;  3C63 A;  4U9E A;  4CX9 A;  3QW1 A;  1E85 A;  1YYJ A;  3HNL A;  1CGO A;  2XL8 A;  3ZWI A;  4U9D A;  2XLO A;  4WGY A; 
#chains in the Genus database with same CATH topology
 3W8I A;  3NDB B;  3IQC A;  2IXO A;  5L3V A;  1D0X A;  5EK0 A;  5F28 E;  1T01 A;  5JSL A;  1YJG A;  1RMV A;  4M63 A;  4JZA A;  2HMZ A;  1L7C A;  4G0H A;  4EIY A;  1XWJ A;  5KYX B;  4CSA C;  3SP1 A;  1CGN A;  1WAS A;  4CS8 C;  5L0F A;  3A9C A;  5CI8 A;  4ZLD A;  3O6X A;  2I15 A;  4R32 A;  5EHH A;  3H65 A;  2Y3D A;  2P6V A;  1D0Y A;  2J9B A;  2P1A A;  2DGJ A;  3SYN A;  1Z5Z A;  3ZQV A;  3MX3 A;  2Q9C A;  1VK5 A;  3W2V A;  2A1D D;  2QTV A;  1T6U A;  4BG0 A;  1WTY A;  4I1O B;  4C7O A;  1O87 A;  2H7O A;  2WVQ A;  3DJN B;  3EGX B;  1T5O A;  4W8K A;  2YRF A;  2OJE D;  1Q0K A;  2NPU A;  3ZTM A;  4BJ6 C;  4YT2 A;  4UDV A;  2EIM C;  1T6Q A;  2ICW G;  1I5N A;  2NUP A;  3ZVR A;  2RSE B;  3EHM A;  2R7V A;  1ST6 A;  1OCC C;  1ZHY A;  3O39 A;  3W8H A;  4LER A;  4AE4 A;  2ZPA A;  4MVU A;  3TOM A;  1O5H A;  3IQ5 A;  3JRT A;  3JZ0 A;  2HV7 A;  2L81 A;  3KYJ A;  2L7A A;  2VCC A;  4I44 A;  1M57 C;  2VCB A;  4YL3 A;  3TJ5 A;  1YAU O;  3EFO A;  4AX2 A;  4E0H A;  3ZC4 A;  1V55 C;  4IAQ A;  5L0C A;  2WZL A;  3T9O A;  3EJN A;  4I1M A;  1ZW2 A;  4K0D A;  1A7V A;  4WAB A;  4AK9 A;  3LLI A;  2IOQ A;  2Y69 C;  2BC5 A;  4N6H A;  4CDY A;  4EHP A;  4OIQ F;  4JKV A;  1A41 A;  4NY3 A;  3POV A;  4YT4 A;  1HE1 A;  1L3P A;  2WZG A;  3ITF A;  4MVZ A;  4DRI B;  1Z7Q c;  3T6B A;  2J0W A;  2CW0 F;  5L0D A;  2B0J A;  2EPK X;  1PD0 A;  2Q3T A;  1QPU A;  2XS1 A;  3K6B A;  4JTC B;  4MVO A;  4B6I A;  4O79 A;  2HZ8 A;  1PD1 A;  3ABL C;  5KYN A;  2YL3 A;  4PR9 A;  2X51 A;  4MTG A;  5TJ5 E;  2NUT A;  4HFK B;  2DYS C;  3LEV A;  1K04 A;  3T4R A;  3LS0 A;  4P9T A;  2ZXO A;  5F5H A;  4I3M A;  3A11 A;  2CNW A;  4XQ1 A;  3BEH A;  3DE9 A;  2PF4 E;  4U5E E;  3RFY A;  2V3C C;  4CS9 A;  1D1A A;  5DQT A;  1CGM E;  1DOW A;  2NSF A;  2XLH A;  3GWL A;  4JTA B;  5A6J A;  1XZP A;  1VLS A;  4LLC A;  2OU6 A;  3I5P A;  1GQA A;  1WN0 A;  3T6J A;  2YHS A;  2H7V C;  3EG9 B;  1NU9 C;  2EPN A;  3LES A;  5A6A A;  2D5R B;  2HKV A;  3E9V A;  5JRA A;  3R2P A;  4JUR I;  3S27 A;  1JAF A;  2XLM A;  1NU7 D;  3G4Z A;  3J06 A;  3Q6M A;  1G4U S;  2XSE A;  3DAG A;  4EBK A;  3O10 A;  1QLE C;  3R7C A;  2ASR A;  3HTK C;  3WOD F;  2MYS A;  3U5S A;  4G7O F;  4U9E A;  2L6F A;  2Y3H A;  3RKO F;  1A0B A;  2HJ3 A;  3GEI A;  4YL0 A;  2GA0 A;  3L0I A;  4NTA A;  2DYR C;  1Q0G A;  1M56 C;  1ORS C;  3H2V A;  2XL8 A;  4K1O A;  5HV9 A;  1VMA A;  4E0I A;  5COF A;  1HW1 A;  2KW3 C;  4PAC A;  3K66 A;  4WGY A;  3TJ6 A;  4BEM J;  5BQI A;  2YWA A;  3DD7 A;  4DVZ A;  4XEF A;  3NKD A;  3FXH A;  4CJO A;  2KC3 A;  2KNH A;  1Z6A A;  3JYY A;  3SEO A;  1FNT c;  4PJJ A;  1VYK A;  5KYW B;  3S84 A;  2CCY A;  2EIK C;  2EIN C;  5A6K A;  1LPE A;  1LVK A;  3N2Z B;  3VRC A;  4Q4Z F;  2R03 A;  2PFD A;  4DVY P;  3K33 A;  1A7E A;  3DAF A;  5JT4 A;  3MYI A;  3SXM A;  2XL4 A;  1CPQ A;  1QSP A;  1TR2 A;  3VF0 A;  2OKU A;  1AUE A;  1OKK D;  1ZVZ A;  4W8P A;  1QZX A;  3LJB A;  5GPG B;  3LEO A;  1TWH A;  1BBH A;  2R9R B;  3UMI A;  4JIO A;  2G62 A;  4N6C A;  4KI2 A;  4G7Z F;  3PDM P;  1Z3I X;  1HMO A;  3CQZ A;  1TQG A;  4LDQ A;  3ASN C;  3K1I A;  1VLT A;  3DXJ F;  3GM1 A;  4QI2 A;  4JJG A;  5D91 A;  1WGW A;  3ZQY A;  2LK4 A;  3U9M A;  2LFF A;  4MVQ A;  3KKB A;  5DQZ A;  5KYY B;  1VOM A;  1E83 A;  4JVS A;  4XLN F;  2KK1 A;  2R25 A;  4J30 B;  3M4C A;  1PCX A;  1T9K A;  3I5Q A;  1NLX A;  3JRM O;  4U5B E;  5EGY A;  5IY5 C;  2XRH A;  4OIP F;  3AG1 C;  2HJM A;  3RVY A;  2XM4 A;  3C8G A;  3LUT B;  3T6G B;  4ER9 A;  1AEP A;  5B1B C;  4P9F A;  2XLD A;  5T3T A;  1OXB A;  1FFH A;  4H4K C;  2KQ9 A;  3HKK A;  1M2V B;  3JTL O;  4EKW A;  4KNV A;  5A6B A;  2AU5 A;  5L0H A;  2A68 F;  1SR2 A;  3AG4 C;  3QVZ A;  2XXA B;  5KYU A;  3DM5 A;  2Z15 A;  2BL2 A;  3GAN A;  2Q7R A;  1OCR C;  2R7U A;  2ZD9 A;  3VYW A;  1LM3 B;  1KTM A;  3DM9 B;  5COM A;  1B68 A;  1LE4 A;  3OEO A;  4G78 A;  4XWJ A;  2JX0 A;  1GS9 A;  1V74 B;  4YK5 A;  2LFD A;  4H54 A;  3DZA A;  1ZHW A;  1YVI A;  4HE8 D;  4BEJ A;  3AGU A;  3LLK A;  4MQ9 F;  4JCH A;  1Q0D A;  4D4N A;  5CI9 A;  2ZXR A;  1I4Y A;  3LS1 A;  2X0C A;  4OIO F;  1OW7 A;  2EIJ C;  1YYX A;  1JMW A;  2FFH A;  3GM2 A;  2IYL D;  3TOL A;  2A6H F;  3QW0 A;  1ZYR F;  3B29 A;  3EPV A;  4J32 B;  5FZT A;  1QQ3 A;  3ASO C;  2CYD A;  3C7J A;  3M1C B;  3S90 A;  2A6E F;  2QNL A;  4C3B A;  3HNJ A;  1T6I A;  3F46 A;  3LAY A;  2QY9 A;  2XL6 A;  4MND A;  4NCQ A;  5E33 A;  1V54 C;  3WAQ A;  1MNE A;  2WL8 A;  3MFN A;  5D92 A;  3H2U A;  4P6I C;  4OIN F;  5JUA A;  3FAJ A;  3B0U X;  1G5Z A;  1K05 A;  1OCO C;  1S05 A;  1Y6D A;  2QUP A;  3NYL A;  2OG2 A;  3UR3 C;  4LDK A;  1BR2 A;  3FOO A;  3NG1 A;  2YEV A;  4D4X A;  4JTD B;  2R7R A;  3EH2 A;  1ZW3 A;  4JRZ A;  2A0B A;  3HLZ A;  4PJL A;  5KYU B;  4CIP A;  3EGX A;  2ETS A;  5JVE A;  5DS6 A;  1WWP A;  3RF3 A;  2IM8 A;  3CSK A;  2IXN A;  1APC A;  2M64 A;  1AVO B;  3LNR A;  3MBG A;  3N0T A;  5CIV A;  1NBB A;  3NMI A;  4RD9 A;  5DS4 A;  4IB4 A;  5L3Q A;  3IHU A;  3QTH A;  2Q9B A;  4WGZ A;  3KPH A;  4IWB A;  3EQL F;  1UFB A;  2CNW D;  3EHN A;  3NKE A;  3QW1 A;  4JJF A;  4Q5S F;  1Z23 A;  4MW8 A;  4Z9J A;  1M2O A;  1NG1 A;  2OJQ A;  2GDC A;  3RW0 A;  1BR4 A;  3K1H A;  3UGP A;  1LS1 A;  2QE9 A;  2AWY A;  2UUH A;  3MYF A;  3UNG C;  4WJ0 A;  3EH1 A;  1H6G A;  4XEK A;  2IBF A;  4CSA A;  2P0N A;  2XLO A;  1LI7 A;  5BQG A;  4CS8 A;  2PX3 A;  2WB7 A;  4XEV A;  2C04 A;  4DBQ A;  4FES A;  3EZH A;  2UUI A;  3U0C A;  2KSF A;  1YAR O;  3US6 A;  1YA7 O;  1D1B A;  1MQV A;  1UG7 A;  1E84 A;  4C3E A;  3PCV A;  3RVZ A;  3DI5 A;  4E18 A;  1ORJ A;  4CBE A;  5HSW A;  2YVK A;  3JYH A;  2RD9 A;  1YA9 A;  3ZIB A;  2R7S A;  4NQF A;  2CDQ A;  2LP4 A;  4Z9H A;  4PFO A;  2P7V A;  4EWC A;  2Y39 A;  4DRH B;  3AOU A;  3S28 A;  3RIP A;  3RQE A;  1BZ4 A;  2W4M A;  4JEB A;  4A2N B;  4BJ6 A;  2J9U A;  4ONS A;  2G3K A;  1SZI A;  4BJ5 C;  4YWQ A;  3B0V C;  1GGQ A;  2Y3B A;  4ULV A;  3U9J A;  3AG2 C;  4ULW A;  3RYL A;  2HSB A;  3AJM A;  4X0R A;  1RKE B;  3F47 A;  3QZC A;  1ZHX A;  2IXM A;  3EGD B;  1JPJ A;  1TWC A;  2LSE A;  3FAP B;  3HNI A;  3PMR A;  4GEH A;  4HFF B;  4N06 A;  4YT5 A;  2L9J A;  3QVY A;  3B9Q A;  1I4Z A;  2OOC A;  1OQC A;  3O55 A;  1R5I D;  1MMA A;  1HY5 A;  1FMV A;  4BPM A;  5B1A C;  3U2M A;  1MND A;  1Y4C A;  4CS7 A;  4Q7C A;  1G4W R;  4IAO A;  5JLI A;  2R7T A;  3GEH A;  5E2Q A;  2AWC A;  4A4A A;  3SXZ A;  3LNM B;  2Q00 A;  1OW8 A;  1EA8 A;  2OEV A;  3EG9 A;  3SNH A;  1OR2 A;  4LAC B;  2DI3 A;  2VAS A;  4U5D E;  2HUJ A;  1LKX A;  3IQT A;  1K40 A;  5E3C A;  1FR0 A;  1F1M A;  4FX5 A;  3L8I A;  4QI0 A;  1WOL A;  2J7P A;  1NSG B;  2IXP A;  3S29 A;  4PFP A;  1SMY F;  1WAT A;  2C03 A;  3UGO A;  1Z63 A;  4J7T A;  1OXK A;  4ZLC A;  3V5Z A;  2PP4 A;  3CZ6 A;  4YN0 B;  4N4W A;  3ZTZ A;  2NSG A;  1BR1 A;  4MVM A;  2FGY A;  3RH3 A;  4E7Z A;  2GWW A;  2R05 A;  3K7D A;  4JE9 A;  1RJ9 A;  1JPN A;  5FCL A;  3UMH A;  5JS5 A;  3M15 A;  2PNO A;  2YL0 A;  3FHD A;  4GQH A;  2Y3G A;  4E17 A;  2FAP B;  3KYI A;  2ZXW C;  5BQH A;  1TFO B;  5DS5 A;  4C3D A;  5B3S C;  1FMW A;  2TMV P;  1VB5 A;  1O3U A;  2YKZ A;  2VC9 A;  2VB6 A;  2WZF A;  1D1C A;  1ORY A;  2J46 A;  3OA1 A;  4RBN A;  1OKK A;  4C7O B;  3DMD A;  2Q4F A;  3JSZ A;  2J8W A;  4HEA J;  4O7G A;  4E7S A;  1NZE A;  4OIR F;  1CPR A;  1A7D A;  3DJU B;  3AG3 C;  4J7Y A;  4IJJ A;  3S0X A;  1C02 A;  2J45 A;  3RQF A;  2NUP B;  3TQO A;  3FOP A;  2PBE A;  4IAR A;  4XTK A;  1OW6 A;  2XLV A;  2EIL C;  3ABK C;  2W45 A;  3IQ6 A;  3NRH A;  4AE4 B;  1KU2 A;  2OEX A;  1MMN A;  1E86 A;  2JPU A;  4EUK B;  2J9W A;  3GWN A;  1YDI A;  3B71 A;  3ECS A;  1ZHT A;  4XPY A;  1S7Z A;  3S9O A;  3X2Q C;  2XS8 A;  2YLD A;  1TKN A;  1XZQ A;  5KYY A;  2BE5 F;  2O9X A;  3EFO B;  1EKY A;  1YZC A;  3GOD A;  5K0I A;  1FFT C;  1LE2 A;  1C17 M;  2EPO A;  2GAQ A;  1TFK B;  2W4B A;  4O6M A;  4CS9 C;  3KMI A;  2L6G A;  2QLA A;  1FAP B;  4L6R A;  3VM6 A;  4EBB A;  2MWQ A;  1R4T A;  3C63 A;  4U5F E;  2ZXP A;  4CX9 A;  2G3V A;  4OD4 A;  3BRJ A;  3ZSU A;  1M2V A;  2R7O A;  5KYX A;  1D0Z A;  3AGT A;  4O6N A;  5DVW A;  1YYJ A;  1OCZ C;  3HNL A;  2XXA A;  3QMK A;  1Q0F A;  3E70 C;  1FTS A;  1RXQ A;  3ZWI A;  5T1D B;  4MS2 A;  3WG7 C;  3SXY A;  1IW7 F;  1SF8 A;  1MMD A;  2YZS A;  3C8Z A;  2B0H A;  3IPM O;  4YT8 A;  5L0I A;  3PHF 2;  2W9Y A;  4YJW A;  4PJM A;  3CEX A;  1YLM A;  2R7Q A;  3HNK A;  3I4U A;  3CAX A;  2VH3 A;  3WHN A;  3GEE A;  4AL0 A;  4RDA A;  4YL1 A;  2P61 A;  4NTF A;  2LD6 A;  2NUT B;  2CGE A;  2YL7 A;  3DWW A;  4U5G A;  4BJ1 A;  4DOZ A;  2R7W A;  4U5H A;  2H7B A;  1H7I A;  4MVS A;  2OQM A;  3KL4 A;  2LCH A;  3U3F A;  1U0B B;  4AL1 A;  2KGO A;  3AQC A;  2YL1 A;  5JP7 A;  3JT1 A;  4KBL A;  1U6H A;  4LLE A;  3W4Y A;  1LIH A;  3NMJ A;  1EQ1 A;  1J8Y F;  4F4B A;  3M79 A;  4IGG A;  4NC3 A;  4PJN A;  2L6H A;  3U8P A;  1VTM P;  3SZR A;  5F5F A;  4MVR A;  2AVK A;  3SXK A;  3KH2 A;  4K7B A;  1LI5 A;  4CDV A;  1ZU4 A;  4MW3 A;  1G8X A;  2J0X A;  3TD7 A;  1U89 A;  2WVO A;  3FVY A;  2PX0 A;  1ZZP A;  3V5X A;  4FWV A;  4NTB A;  2V26 A;  4JW1 A;  2HS5 A;  5BUO A;  3K1I C;  3ZDL A;  1E2X A;  3NMK A;  5AC5 A;  2NG1 A;  3B0P A;  3EZI A;  3OWT A;  4G7H F;  4DJ9 A;  1TWA A;  2YLG A;  2XLW A;  1W2W A;  4JEA A;  2E87 A;  2HSQ A;  2XLE A;  3NYM A;  3GOR A;  1TWG A;  4ANJ A;  1H9T A;  1C03 A;  2AP3 A;  3L1M A;  3L34 A;  2M4E A;  1BDJ B;  3GM3 A;  1VYI A;  2MHR A;  5L0G A;  3DE8 A;  1RKC A;  2JD3 A;  4MTF A;  4DBR A;  2GFH A;  3U3B A;  4KNW A;  1IZM A;  3VAY A;  2KJG A;  1Q0M A;  5E3A A;  1JR8 A;  1MMG A;  2Q9A A;  1HMD A;  1KNY A;  1QKR A;  1QVX A;  2A69 F;  2HFI A;  3ATP A;  4IRU A;  5AC4 A;  3NYJ A;  2YQY A;  4U5C E;  1M6T A;  4XPX A;  5DLJ A;  1NFN A;  3ZG1 A;  256B A;  1H9G A;  1NFO A;  5COG A;  2XM0 A;  3G50 A;  4CJG A;  4GYT A;  4CDA A;  2D4U A;  2I8B A;  2J7P D;  3Q6N A;  1OR3 A;  5B3I A;  3N24 A;  4O6Y A;  4XLP F;  5A69 A;  3V5Y A;  2YLI A;  3HJC A;  1JOG A;  3FMS A;  4DXW A;  1DOV A;  5T3W A;  1RCP A;  2F22 A;  1RJ9 B;  2OCC C;  2HV6 A;  3AQB A;  3W2W A;  3MLG A;  4LDR A;  3V7O A;  2J9V A;  4MTO A;  2WVN A;  4QDL A;  5AGF A;  1HE9 A;  3L8J A;  3TUL A;  3M4B A;  1V4A A;  1J8M F;  2H8A A;  3C8G B;  1RKE A;  2R02 A;  2VCA A;  3EGD A;  1LS4 A;  3JCU Q;  1EI7 A;  3C62 A;  3DKA A;  1ZHZ A;  3C8G D;  4OD5 A;  4DRJ B;  1JRA A;  4EBJ A;  2R7X A;  4KC9 A;  3U8V A;  3JSE O;  3U2L A;  5L0J A;  3X1O A;  2HMQ A;  2EPM X;  2KYH A;  1PV3 A;  5A6B D;  1YZA A;  3IEE A;  3Q7L A;  4JCZ A;  4XPW A;  3RQG A;  5KYW A;  3G4X A;  2EPL X;  3UMK A;  3TK0 A;  3ABM C;  1SYQ A;  2DB4 A;  3C18 A;  1ZU5 A;  1N1C A;  4Z9I A;  1E85 A;  4FAP B;  2LQG A;  1CGO A;  2A0U A;  4CIH A;  1GM5 A;  3FDQ A;  4JC7 A;  4U9D A;  1HW2 A;  4PK4 A;  3Q7G A;  2LIG A;  4BJT A;  4BJ5 A; 
#chains in the Genus database with same CATH homology
 4CJO A;  1E84 A;  3HNK A;  1MQV A;  5JSL A;  2CCY A;  3VRC A;  4EIY A;  2YL7 A;  5JT4 A;  1CPQ A;  1CGN A;  4JEB A;  1BBH A;  2YL1 A;  2J9B A;  3ZQV A;  5JP7 A;  4ULV A;  3NMJ A;  3M79 A;  4NC3 A;  3HNI A;  3U8P A;  3ZQY A;  3ZTM A;  4CDV A;  3QVY A;  1E83 A;  3M4C A;  5JLI A;  2XM4 A;  3TOM A;  3IQ5 A;  4ER9 A;  2XLD A;  3NMK A;  3QVZ A;  2YLG A;  4IAQ A;  2XLW A;  4JEA A;  2XLE A;  3L1M A;  1LM3 B;  1A7V A;  3DE8 A;  4CDY A;  4N6H A;  2BC5 A;  4N4W A;  3ZTZ A;  4JKV A;  4JE9 A;  5JS5 A;  3M15 A;  4D4N A;  2YL0 A;  1M6T A;  1YYX A;  1QPU A;  3TOL A;  256B A;  3QW0 A;  2XM0 A;  4CJG A;  1QQ3 A;  2YKZ A;  4CDA A;  2YL3 A;  5B3I A;  3HNJ A;  2YLI A;  2XL6 A;  1RCP A;  2J8W A;  5JUA A;  1CPR A;  3DE9 A;  1S05 A;  3FOP A;  4IAR A;  5AGF A;  2XLH A;  2XLV A;  3M4B A;  3IQ6 A;  3FOO A;  4D4X A;  1E86 A;  1GQA A;  4CIP A;  3C62 A;  5JRA A;  5JVE A;  2YLD A;  1APC A;  1JAF A;  2XLM A;  1EKY A;  1YZC A;  1YZA A;  1NBB A;  3NMI A;  4IB4 A;  2QLA A;  4L6R A;  4WGZ A;  3C63 A;  4U9E A;  4CX9 A;  3QW1 A;  1E85 A;  1YYJ A;  3HNL A;  1CGO A;  2XL8 A;  3ZWI A;  4U9D A;  2XLO A;  4WGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...