3HNLA

Crystal structure of the cu-induced dimer of the engineered cyt cb562 variant ridc-1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal templated design of protein interfaces.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 47
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3hnlA00
4ER9A 4L6RA 3FOPA 3M79A 3NMIA 5JP7A 3IQ5A 3ZQYA 5JT4A 1BBHA 2BC5A 4JKVA 2QLAA 3FOOA 1M6TA 4WGYA 2YL7A 2YLDA 3NMKA 5JLIA 5JVEA 1GQAA 4N4WA 1E86A 1LM3B 1YZAA 2XLHA 2XLDA 4CJOA 3IQ6A 4ULVA 3L1MA 2XLOA 1JAFA 4JEAA 4D4NA 3DE8A 4CDYA 3M4BA 3HNKA 1QPUA 1EKYA 1MQVA 4IAQA 4JE9A 3HNLA 4NC3A 1CPQA 4U9EA 3M4CA 2J9BA 256BA 2XLMA 3C62A 2CCYA 3ZQVA 4CDVA 3TOLA 2XLEA 3U8PA 1CPRA 3VRCA 1CGOA 4EIYA 2YLIA 2XM0A 3ZWIA 3QW0A 4WGZA 1S05A 1RCPA 2XLVA 3HNIA 5JRAA 4D4XA 1QQ3A 2YL0A 3DE9A 4CDAA 1E84A 3QVZA 3QVYA 3TOMA 2YL3A 4CIPA 3M15A 5JUAA 1YZCA 5AGFA 2XM4A 4N6HA 4JEBA 1CGNA 4CX9A 1E85A 4IARA 2XLWA 3ZTZA 1APCA 1YYXA 3C63A 1NBBA 5JSLA 2YLGA 3ZTMA 4U9DA 5JS5A 2XL6A 4CJGA 1E83A 1YYJA 4IB4A 5B3IA 3QW1A 2XL8A 2YKZA 3HNJA 2YL1A 1A7VA 3NMJA 2J8WA
chains in the Genus database with same CATH superfamily
1OKKA 1MMGA 3K7DA 2D4UA 1D0XA 2R7TA 3US6A 5JP7A 2Y3HA 3IQ5A 3PMRA 5A6JA 3U2LA 2YRFA 3FMSA 3AGTA 5IY5C 1OQCA 1SMYF 5JT4A 3F46A 3DJUB 1OCCC 1ZYRF 3TD7A 4K0DA 3MX3A 2KSFA 1D1AA 4ONSA 2HV7A 2VH3A 4OIPF 3U3FA 3KKBA 4U5EE 2A1DD 2HJ3A 1E86A 1LE2A 2EPNA 2DYRC 3JSZA 1LKXA 1OCOC 1LM3B 5T3TA 1YARO 2XS1A 3TJ6A 1BR1A 4BJ5C 1HW2A 4W8KA 2ZXPA 4FAPB 3IHUA 4YWQA 4MTFA 4XPWA 5KYXA 3NYLA 2MWQA 3IPMO 4XTKA 1TKNA 2WVQA 2QE9A 2YQYA 3G4XA 3ZIBA 2J46A 2KQ9A 3M4BA 1LI5A 5CI8A 5COGA 3WG7C 1JPJA 3HNKA 2A6EF 4JJFA 2V26A 4EBKA 2ZXWC 4MVOA 1T5OA 4RBNA 2L81A 4MQ9F 2OJED 4HE8D 5L3VA 2NPUA 4NY3A 3SXZA 1ORJA 5L0FA 2D5RB 3PHF2 4Z9HA 4KNWA 3SXKA 3LEVA 5AC4A 4BJ6A 3AJMA 1AUEA 2L6FA 1OXKA 3EG9A 3H2VA 3HJCA 5B3SC 3MLGA 5D91A 1H7IA 4O6NA 1Q0MA 4P6IC 1Y6DA 2HZ8A 2CCYA 1VMAA 2HSQA 4G7OF 4AK9A 1RMVA 1JRAA 3FAJA 3AQCA 5E3CA 1H9GA 2R7QA 3GM3A 3HLZA 4MNDA 2KGOA 2J9VA 5BUOA 4Z9IA 3KL4A 4E17A 3N24A 5COMA 4AE4B 3RQEA 4HEAJ 4N6CA 4CS8A 3T6GB 2HFIA 2IM8A 1GM5A 1CGME 3E70C 2XLVA 1VYIA 1VOMA 5L0JA 2YL0A 1E84A 3QVYA 2YVKA 2YL3A 2EIJC 2IBFA 3DM5A 5L0GA 1M2VA 4G0HA 3C8GD 1Z6AA 1WN0A 5L0HA 1OW6A 2KK1A 3I5QA 2CW0F 1TFKB 4IJJA 4N6HA 3RKOF 3NKEA 1BR2A 2Q4FA 4FWVA 4CX9A 3S27A 3PDMP 1DOVA 2XS8A 4YT4A 2XLWA 4D4XA 3W8IA 3ZTZA 4JTCB 1YAUO 1APCA 3UGPA 4E18A 1L7CA 3C63A 4PJNA 2Q7RA 5KYUB 1G4WR 3B0VC 2L9JA 3E9VA 2Y39A 2Q3TA 3NDBB 3U8VA 4PFPA 3AGUA 1QZXA 4MVUA 2VCCA 3ZG1A 2LCHA 4DVYP 3W2WA 4AL1A 1VTMP 3KMIA 2V3CC 2VCBA 4C3DA 3DM9B 4CJGA 2HKVA 1E83A 4G7ZF 4DVZA 4Q4ZF 2LP4A 3DKAA 3UMKA 1NLXA 4JCZA 3WAQA 1DOWA 5T3WA 2EIMC 2EPLX 5B3IA 4YN0B 1O3UA 4H54A 4XWJA 4PFOA 5KYWB 2A68F 1EQ1A 2YL1A 4XPXA 1M6TA 3SYNA 1GS9A 4L6RA 2EPKX 2B0JA 2H8AA 2QTVA 2P0NA 3FOPA 4P9TA 3V5XA 3AG4C 4PJLA 3JRMO 5L0IA 1M56C 5B1BC 4ANJA 4NQFA 3O10A 2Y3BA 1W2WA 4NTBA 3T9OA 2F22A 3EZHA 1IW7F 4JKVA 3FXHA 4RDAA 3T4RA 1FFHA 3LESA 2CYDA 4WGYA 1VYKA 2WZGA 1OCRC 1RXQA 2W4MA 1MMDA 1MMNA 3QZCA 4XEFA 4G78A 3SZRA 4EUKB 4QI2A 1GQAA 5EHHA 4N4WA 1QSPA 3KPHA 1TWCA 4IWBA 1ST6A 4BJ1A 1TWGA 1YZAA 1ZHXA 2B0HA 2O9XA 2XLDA 3F47A 3CAXA 3JZ0A 3DJNB 3EHMA 2R02A 3L1MA 3X1OA 2KW3C 4JEAA 4JZAA 3ZDLA 2IYLD 4YK5A 2MYSA 1GGQA 3EPVA 3H65A 4F4BA 2XL4A 2R7WA 3V7OA 4CSAA 1VLTA 3UMIA 3DE8A 5CI9A 3EGDB 2EIKC 2RD9A 1T6UA 2PX3A 3RW0A 1T9KA 4YL1A 1RKEB 4CIHA 1QLEC 5L3QA 2W4BA 1BR4A 3HNLA 4JE9A 2J45A 4NC3A 4AE4A 2KC3A 2XRHA 4OIQF 1LS4A 3L34A 2OG2A 3S84A 2Q9BA 4Q7CA 5GPGB 4EKWA 4YT8A 2L6GA 1Z7Qc 3UGOA 3KYIA 3V5ZA 4J30B 1PV3A 4YL0A 4MS2A 1H6GA 1RJ9B 256BA 2J9BA 2XLMA 2ZXRA 2R7OA 1MMAA 1FFTC 4KNVA 1OR2A 1Q0FA 1A0BA 5JRAA 4JURI 5F28E 3C62A 3RIPA 4DBQA 1NFOA 1V74B 4LDKA 2PBEA 3RVYA 3KH2A 4U5DE 4OIRF 5KYNA 2OU6A 3NKDA 3ZQVA 3K1IA 1NU7D 4WJ0A 1TQGA 2J7PD 3DAFA 4MW8A 3VRCA 2G3KA 2YZSA 1YA9A 2YLIA 2FAPB 3GODA 2CNWA 5A6AA 2AWCA 2OJQA 1IZMA 5A69A 2QUPA 2WL8A 3VYWA 5F5FA 2ZXOA 3LAYA 2JPUA 2AP3A 4WGZA 1S05A 3RF3A 3DZAA 2JX0A 3HNIA 4BJ5A 3ECSA 2FFHA 3B0PA 4EBJA 1ZHYA 1T01A 1EA8A 2IXOA 3GWNA 4NCQA 4FX5A 1SYQA 3H2UA 4XPYA 4C7OA 2QY9A 3DXJF 3M15A 2XXAB 1V55C 3Q7GA 5JUAA 1YZCA 3I5PA 3LLIA 4YT5A 3LNMB 5D92A 4JTAB 4JEBA 4P9FA 4W8PA 4CS9C 5BQHA 5KYWA 1NU9C 1E85A 2Y69C 4BJ6C 3Q6NA 1Q0KA 1OKKD 2IXPA 3IQCA 3EJNA 3ASNC 1L3PA 1ZW2A 1SZIA 1KU2A 2GDCA 2PNOA 1YYXA 4QI0A 1WWPA 1NBBA 1K40A 3LS1A 4MTGA 1WATA 1Q0DA 2OEVA 2GFHA 3ZTMA 4J7TA 5KYYB 1LI7A 2Y3GA 1Z3IX 4XLNF 3LS0A 2Z15A 4JVSA 2XL6A 1HMDA 1VB5A 2PX0A 4CBEA 1R5ID 1T6IA 2IXNA 3L0IA 3GM1A 3EQLF 4CS8C 4EWCA 3LEOA 1UFBA 3A11A 4BJTA 1ZW3A 2XL8A 1FAPB 2ETSA 2HMZA 3AOUA 3EH1A 3HNJA 3ABMC 1D0YA 3I4UA 5HSWA 2LIGA 2J8WA 1ZVZA 3X2QC 4ER9A 2IXMA 2A6HF 3EFOB 3GM2A 1J8YF 3UR3C 3W2VA 3NMIA 1F1MA 2KJGA 2DB4A 2ZPAA 1D0ZA 4JRZA 4OD4A 4DRIB 1UG7A 4E7SA 2DI3A 2FGYA 3B71A 3EHNA 1QKRA 3ZQYA 2HSBA 3O6XA 3EGDA 4IRUA 1FNTc 3VAYA 3EZIA 2J0WA 2C03A 4XQ1A 1RKEA 1D1CA 5A6BD 1V4AA 1C02A 2CGEA 3LJBA 4BPMA 1Q0GA 2ASRA 2QLAA 3FOOA 2RSEB 1YVIA 4A4AA 3Q7LA 3K33A 2YL7A 2P61A 2YLDA 1ZU5A 4J32B 5A6KA 3C8GB 3RYLA 5DLJA 5JLIA 2OKUA 2PP4A 3O55A 4LDRA 4ULWA 4DXWA 1I4ZA 3EH2A 4O79A 4R32A 2HUJA 3VF0A 4OINF 1FR0A 4PJMA 2XLHA 4MVSA 3SNHA 1EI7A 4G7HF 2P6VA 4CJOA 4LDQA 1JR8A 3IQ6A 4ULVA 4OIOF 1Z63A 4JC7A 1JAFA 1A7DA 4XEKA 1XZPA 2WVOA 3GANA 5DS4A 2X0CA 3QTHA 3C7JA 3UNGC 1D1BA 3JT1A 3LLKA 4I1MA 3S9OA 5K0IA 1XZQA 2J0XA 1OR3A 4I1OB 2ICWG 1R4TA 1WOLA 4U5GA 4CS7A 2LK4A 3ZVRA 1PD0A 4BG0A 3SEOA 3DI5A 1EKYA 4GYTA 1V54C 3OA1A 4QDLA 3ABKC 3S90A 1LIHA 1VK5A 5DQZA 3RH3A 3M4CA 2H7VC 4LERA 4EHPA 3U9MA 3N0TA 2TMVP 3AG3C 4I44A 4PJJA 2YWAA 3IEEA 3U0CA 5BQIA 3WHNA 2XXAA 3R2PA 3RQFA 3U3BA 4X0RA 4DJ9A 2NUTB 1I5NA 2A69F 5CIVA 2LD6A 4K1OA 5E3AA 2W45A 4ZLCA 4CDVA 5A6BA 3N2ZB 2LFFA 3CZ6A 3G4ZA 3U8PA 4DRHB 2R7XA 1PCXA 1NSGB 1CGOA 2NUPB 4EIYA 2XM0A 3LUTB 1KTMA 4MTOA 1G8XA 4JIOA 1Z23A 4JJGA 2A0UA 3L8JA 3NRHA 1PD1A 1MNDA 3MFNA 4HFKB 2AVKA 5E33A 2EILC 1YA7O 4YL3A 3A9CA 2R05A 2Q9AA 3L8IA 1A41A 2OEXA 3GEHA 3HKKA 1YJGA 4MVRA 1QQ3A 3SP1A 1M2OA 2L7AA 3LNRA 5BQGA 3DE9A 3R7CA 4CDAA 5KYYA 3SXYA 2NSGA 2R9RB 4FESA 1LS1A 1MNEA 1KNYA 1AVOB 2CDQA 1K05A 2YHSA 2VCAA 3DMDA 4JTDB 3MBGA 1OW7A 3CEXA 1HMOA 3JRTA 5AGFA 2XM4A 2XSEA 4O6MA 4J7YA 3UMHA 5L0DA 1CGNA 2BL2A 3ABLC 4E0HA 4IARA 2W9YA 2R25A 1ORSC 2OOCA 3EFOA 4E0IA 4DOZA 3DD7A 1A7EA 1N1CA 1Z5ZA 4N06A 4YJWA 5HV9A 1NFNA 2JD3A 3G50A 2H7BA 3TK0A 3W8HA 5FCLA 1H9TA 1ZHWA 3O39A 4IGGA 4LLCA 3CSKA 2OCCC 3AG2C 3K1IC 3K6BA 5JSLA 5KYUA 3S29A 2HJMA 1NG1A 2I8BA 3JSEO 3GORA 4NTAA 2R7SA 4K7BA 4PR9A 3BRJA 4DRJB 4IAOA 3EGXB 3RFYA 1ZHTA 1J8MF 3AQBA 3C8GA 2R7RA 4KI2A 2J9UA 4Q5SF 1YYJA 2E87A 4IB4A 4WABA 2VB6A 2WVNA 3TQOA 3S0XA 4GEHA 1JPNA 2MHRA 2YKZA 1LVKA 3BEHA 5EGYA 3J06A 4CDYA 4LLEA 4A2NB 4U5FE 4YT2A 5DS6A 4NTFA 3M79A 2Y3DA 1Y4CA 4Z9JA 2DGJA 1U6HA 2R7VA 2R7UA 2M4EA 1XWJA 1BBHA 2BC5A 2NG1A 2J9WA 3JTLO 4UDVA 2L6HA 3FVYA 4HFFB 5DS5A 4B6IA 5FZTA 3GEEA 1JOGA 4CS9A 2WZLA 3NMKA 4XEVA 4U5BE 5JVEA 4RD9A 4XLPF 3GWLA 3MYIA 1G5ZA 1HE9A 1SF8A 3GEIA 4EBBA 1FMVA 1FMWA 1WASA 1TWAA 5E2QA 2UUHA 4AL0A 2XLOA 1AEPA 3K1HA 1U0BB 1T6QA 2NUTA 1LPEA 4I3MA 4LACB 4D4NA 1ORYA 2EINC 4H4KC 3W4YA 3WODF 1TR2A 4U5HA 5DVWA 3JYYA 5T1DB 1NZEA 1JMWA 1RKCA 3IQTA 2NUPA 2X51A 5COFA 4C3EA 1QPUA 2VC9A 3C18A 2CNWD 1C17M 1MQVA 2IOQA 2Q9CA 4IAQA 1O5HA 3ASOC 4KC9A 2LSEA 3V5YA 3ZSUA 1CPQA 2LQGA 2KNHA 3DWWA 2GWWA 1OXBA 3RVZA 1S7ZA 3S28A 1HY5A 4U9EA 2A0BA 3POVA 1VLSA 1YLMA 2ZD9A 1WTYA 4O6YA 4E7ZA 2P1AA 4O7GA 5F5HA 1OCZC 4PK4A 4GQHA 2I15A 2NSFA 3FHDA 1FTSA 1RJ9A 4MVZA 3DAGA 5EK0A 2KYHA 4JCHA 3C8ZA 5KYXB 3OWTA 1OW8A 2P7VA 5L0CA 4ZLDA 1TWHA 4OD5A 3TOLA 2XLEA 4MVQA 4PACA 1CPRA 1K04A 2M64A 1QVXA 2OQMA 3ZWIA 1O87A 3CQZA 2WZFA 1BZ4A 3MYFA 3QMKA 3QW0A 3U5SA 4DBRA 2HV6A 3U9JA 2VASA 2YEVA 1TFOB 1RCPA 3ZC4A 1G4US 4C7OB 4BEMJ 1SR2A 3KYJA 3QVZA 3K66A 2LFDA 4U5CE 3B29A 3EGXA 2GA0A 3EG9B 3TOMA 4CIPA 2EPOA 3B9QA 4KBLA 2C04A 2EPMX 5DQTA 4C3BA 3ATPA 2PFDA 3TULA 5TJ5E 2DYSC 2AWYA 2G62A 2PF4E 4JW1A 2G3VA 3JYHA 2HS5A 2J7PA 4MVMA 5B1AC 2H7OA 1M57C 3OEOA 3Q6MA 3RQGA 1C03A 1WGWA 4M63A 1ZHZA 1HE1A 2UUIA 1U89A 3AG1C 3B0UX 3PCVA 1YDIA 3ITFA 4BEJA 3T6JA 1LE4A 1ZZPA 3T6BA 2YLGA 1I4YA 2AU5A 2WB7A 3U2MA 4CSAC 1B68A 3HTKC 4MW3A 4U9DA 1HW1A 4AX2A 2Q00A 5JS5A 2GAQA 3NYMA 3NG1A 3VM6A 1M2VB 2HMQA 2R03A 3M1CB 3NYJA 3SXMA 2BE5F 5AC5A 2QNLA 3FAPB 1BDJB 1E2XA 3JCUQ 3QW1A 3FDQA 3TJ5A 1ZU4A 1A7VA 3NMJA
chains in the Genus database with same CATH topology
4ER9A 4L6RA 3FOPA 3M79A 3NMIA 5JP7A 3IQ5A 3ZQYA 5JT4A 1BBHA 2BC5A 4JKVA 2QLAA 3FOOA 1M6TA 4WGYA 2YL7A 2YLDA 3NMKA 5JLIA 5JVEA 1GQAA 4N4WA 1E86A 1LM3B 1YZAA 2XLHA 2XLDA 4CJOA 3IQ6A 4ULVA 3L1MA 2XLOA 1JAFA 4JEAA 4D4NA 3DE8A 4CDYA 3M4BA 3HNKA 1QPUA 1EKYA 1MQVA 4IAQA 4JE9A 3HNLA 4NC3A 1CPQA 4U9EA 3M4CA 2J9BA 256BA 2XLMA 3C62A 2CCYA 3ZQVA 4CDVA 3TOLA 2XLEA 3U8PA 1CPRA 3VRCA 1CGOA 4EIYA 2YLIA 2XM0A 3ZWIA 3QW0A 4WGZA 1S05A 1RCPA 2XLVA 3HNIA 5JRAA 4D4XA 1QQ3A 2YL0A 3DE9A 4CDAA 1E84A 3QVZA 3QVYA 3TOMA 2YL3A 4CIPA 3M15A 5JUAA 1YZCA 5AGFA 2XM4A 4N6HA 4JEBA 1CGNA 4CX9A 1E85A 4IARA 2XLWA 3ZTZA 1APCA 1YYXA 3C63A 1NBBA 5JSLA 2YLGA 3ZTMA 4U9DA 5JS5A 2XL6A 4CJGA 1E83A 1YYJA 4IB4A 5B3IA 3QW1A 2XL8A 2YKZA 3HNJA 2YL1A 1A7VA 3NMJA 2J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ER9 A;  4L6R A;  3FOP A;  3M79 A;  3NMI A;  5JP7 A;  3IQ5 A;  3ZQY A;  5JT4 A;  1BBH A;  2BC5 A;  4JKV A;  2QLA A;  3FOO A;  1M6T A;  4WGY A;  2YL7 A;  2YLD A;  3NMK A;  5JLI A;  5JVE A;  1GQA A;  4N4W A;  1E86 A;  1LM3 B;  1YZA A;  2XLH A;  2XLD A;  4CJO A;  3IQ6 A;  4ULV A;  3L1M A;  2XLO A;  1JAF A;  4JEA A;  4D4N A;  3DE8 A;  4CDY A;  3M4B A;  3HNK A;  1QPU A;  1EKY A;  1MQV A;  4IAQ A;  4JE9 A;  3HNL A;  4NC3 A;  1CPQ A;  4U9E A;  3M4C A;  2J9B A;  256B A;  2XLM A;  3C62 A;  2CCY A;  3ZQV A;  4CDV A;  3TOL A;  2XLE A;  3U8P A;  1CPR A;  3VRC A;  1CGO A;  4EIY A;  2YLI A;  2XM0 A;  3ZWI A;  3QW0 A;  4WGZ A;  1S05 A;  1RCP A;  2XLV A;  3HNI A;  5JRA A;  4D4X A;  1QQ3 A;  2YL0 A;  3DE9 A;  4CDA A;  1E84 A;  3QVZ A;  3QVY A;  3TOM A;  2YL3 A;  4CIP A;  3M15 A;  5JUA A;  1YZC A;  5AGF A;  2XM4 A;  4N6H A;  4JEB A;  1CGN A;  4CX9 A;  1E85 A;  4IAR A;  2XLW A;  3ZTZ A;  1APC A;  1YYX A;  3C63 A;  1NBB A;  5JSL A;  2YLG A;  3ZTM A;  4U9D A;  5JS5 A;  2XL6 A;  4CJG A;  1E83 A;  1YYJ A;  4IB4 A;  5B3I A;  3QW1 A;  2XL8 A;  2YKZ A;  3HNJ A;  2YL1 A;  1A7V A;  3NMJ A;  2J8W A; 
#chains in the Genus database with same CATH topology
 1OKK A;  1MMG A;  3K7D A;  2D4U A;  1D0X A;  2R7T A;  3US6 A;  5JP7 A;  2Y3H A;  3IQ5 A;  3PMR A;  5A6J A;  3U2L A;  2YRF A;  3FMS A;  3AGT A;  5IY5 C;  1OQC A;  1SMY F;  5JT4 A;  3F46 A;  3DJU B;  1OCC C;  1ZYR F;  3TD7 A;  4K0D A;  3MX3 A;  2KSF A;  1D1A A;  4ONS A;  2HV7 A;  2VH3 A;  4OIP F;  3U3F A;  3KKB A;  4U5E E;  2A1D D;  2HJ3 A;  1E86 A;  1LE2 A;  2EPN A;  2DYR C;  3JSZ A;  1LKX A;  1OCO C;  1LM3 B;  5T3T A;  1YAR O;  2XS1 A;  3TJ6 A;  1BR1 A;  4BJ5 C;  1HW2 A;  4W8K A;  2ZXP A;  4FAP B;  3IHU A;  4YWQ A;  4MTF A;  4XPW A;  5KYX A;  3NYL A;  2MWQ A;  3IPM O;  4XTK A;  1TKN A;  2WVQ A;  2QE9 A;  2YQY A;  3G4X A;  3ZIB A;  2J46 A;  2KQ9 A;  3M4B A;  1LI5 A;  5CI8 A;  5COG A;  3WG7 C;  1JPJ A;  3HNK A;  2A6E F;  4JJF A;  2V26 A;  4EBK A;  2ZXW C;  4MVO A;  1T5O A;  4RBN A;  2L81 A;  4MQ9 F;  2OJE D;  4HE8 D;  5L3V A;  2NPU A;  4NY3 A;  3SXZ A;  1ORJ A;  5L0F A;  2D5R B;  3PHF 2;  4Z9H A;  4KNW A;  3SXK A;  3LEV A;  5AC4 A;  4BJ6 A;  3AJM A;  1AUE A;  2L6F A;  1OXK A;  3EG9 A;  3H2V A;  3HJC A;  5B3S C;  3MLG A;  5D91 A;  1H7I A;  4O6N A;  1Q0M A;  4P6I C;  1Y6D A;  2HZ8 A;  2CCY A;  1VMA A;  2HSQ A;  4G7O F;  4AK9 A;  1RMV A;  1JRA A;  3FAJ A;  3AQC A;  5E3C A;  1H9G A;  2R7Q A;  3GM3 A;  3HLZ A;  4MND A;  2KGO A;  2J9V A;  5BUO A;  4Z9I A;  3KL4 A;  4E17 A;  3N24 A;  5COM A;  4AE4 B;  3RQE A;  4HEA J;  4N6C A;  4CS8 A;  3T6G B;  2HFI A;  2IM8 A;  1GM5 A;  1CGM E;  3E70 C;  2XLV A;  1VYI A;  1VOM A;  5L0J A;  2YL0 A;  1E84 A;  3QVY A;  2YVK A;  2YL3 A;  2EIJ C;  2IBF A;  3DM5 A;  5L0G A;  1M2V A;  4G0H A;  3C8G D;  1Z6A A;  1WN0 A;  5L0H A;  1OW6 A;  2KK1 A;  3I5Q A;  2CW0 F;  1TFK B;  4IJJ A;  4N6H A;  3RKO F;  3NKE A;  1BR2 A;  2Q4F A;  4FWV A;  4CX9 A;  3S27 A;  3PDM P;  1DOV A;  2XS8 A;  4YT4 A;  2XLW A;  4D4X A;  3W8I A;  3ZTZ A;  4JTC B;  1YAU O;  1APC A;  3UGP A;  4E18 A;  1L7C A;  3C63 A;  4PJN A;  2Q7R A;  5KYU B;  1G4W R;  3B0V C;  2L9J A;  3E9V A;  2Y39 A;  2Q3T A;  3NDB B;  3U8V A;  4PFP A;  3AGU A;  1QZX A;  4MVU A;  2VCC A;  3ZG1 A;  2LCH A;  4DVY P;  3W2W A;  4AL1 A;  1VTM P;  3KMI A;  2V3C C;  2VCB A;  4C3D A;  3DM9 B;  4CJG A;  2HKV A;  1E83 A;  4G7Z F;  4DVZ A;  4Q4Z F;  2LP4 A;  3DKA A;  3UMK A;  1NLX A;  4JCZ A;  3WAQ A;  1DOW A;  5T3W A;  2EIM C;  2EPL X;  5B3I A;  4YN0 B;  1O3U A;  4H54 A;  4XWJ A;  4PFO A;  5KYW B;  2A68 F;  1EQ1 A;  2YL1 A;  4XPX A;  1M6T A;  3SYN A;  1GS9 A;  4L6R A;  2EPK X;  2B0J A;  2H8A A;  2QTV A;  2P0N A;  3FOP A;  4P9T A;  3V5X A;  3AG4 C;  4PJL A;  3JRM O;  5L0I A;  1M56 C;  5B1B C;  4ANJ A;  4NQF A;  3O10 A;  2Y3B A;  1W2W A;  4NTB A;  3T9O A;  2F22 A;  3EZH A;  1IW7 F;  4JKV A;  3FXH A;  4RDA A;  3T4R A;  1FFH A;  3LES A;  2CYD A;  4WGY A;  1VYK A;  2WZG A;  1OCR C;  1RXQ A;  2W4M A;  1MMD A;  1MMN A;  3QZC A;  4XEF A;  4G78 A;  3SZR A;  4EUK B;  4QI2 A;  1GQA A;  5EHH A;  4N4W A;  1QSP A;  3KPH A;  1TWC A;  4IWB A;  1ST6 A;  4BJ1 A;  1TWG A;  1YZA A;  1ZHX A;  2B0H A;  2O9X A;  2XLD A;  3F47 A;  3CAX A;  3JZ0 A;  3DJN B;  3EHM A;  2R02 A;  3L1M A;  3X1O A;  2KW3 C;  4JEA A;  4JZA A;  3ZDL A;  2IYL D;  4YK5 A;  2MYS A;  1GGQ A;  3EPV A;  3H65 A;  4F4B A;  2XL4 A;  2R7W A;  3V7O A;  4CSA A;  1VLT A;  3UMI A;  3DE8 A;  5CI9 A;  3EGD B;  2EIK C;  2RD9 A;  1T6U A;  2PX3 A;  3RW0 A;  1T9K A;  4YL1 A;  1RKE B;  4CIH A;  1QLE C;  5L3Q A;  2W4B A;  1BR4 A;  3HNL A;  4JE9 A;  2J45 A;  4NC3 A;  4AE4 A;  2KC3 A;  2XRH A;  4OIQ F;  1LS4 A;  3L34 A;  2OG2 A;  3S84 A;  2Q9B A;  4Q7C A;  5GPG B;  4EKW A;  4YT8 A;  2L6G A;  1Z7Q c;  3UGO A;  3KYI A;  3V5Z A;  4J30 B;  1PV3 A;  4YL0 A;  4MS2 A;  1H6G A;  1RJ9 B;  256B A;  2J9B A;  2XLM A;  2ZXR A;  2R7O A;  1MMA A;  1FFT C;  4KNV A;  1OR2 A;  1Q0F A;  1A0B A;  5JRA A;  4JUR I;  5F28 E;  3C62 A;  3RIP A;  4DBQ A;  1NFO A;  1V74 B;  4LDK A;  2PBE A;  3RVY A;  3KH2 A;  4U5D E;  4OIR F;  5KYN A;  2OU6 A;  3NKD A;  3ZQV A;  3K1I A;  1NU7 D;  4WJ0 A;  1TQG A;  2J7P D;  3DAF A;  4MW8 A;  3VRC A;  2G3K A;  2YZS A;  1YA9 A;  2YLI A;  2FAP B;  3GOD A;  2CNW A;  5A6A A;  2AWC A;  2OJQ A;  1IZM A;  5A69 A;  2QUP A;  2WL8 A;  3VYW A;  5F5F A;  2ZXO A;  3LAY A;  2JPU A;  2AP3 A;  4WGZ A;  1S05 A;  3RF3 A;  3DZA A;  2JX0 A;  3HNI A;  4BJ5 A;  3ECS A;  2FFH A;  3B0P A;  4EBJ A;  1ZHY A;  1T01 A;  1EA8 A;  2IXO A;  3GWN A;  4NCQ A;  4FX5 A;  1SYQ A;  3H2U A;  4XPY A;  4C7O A;  2QY9 A;  3DXJ F;  3M15 A;  2XXA B;  1V55 C;  3Q7G A;  5JUA A;  1YZC A;  3I5P A;  3LLI A;  4YT5 A;  3LNM B;  5D92 A;  4JTA B;  4JEB A;  4P9F A;  4W8P A;  4CS9 C;  5BQH A;  5KYW A;  1NU9 C;  1E85 A;  2Y69 C;  4BJ6 C;  3Q6N A;  1Q0K A;  1OKK D;  2IXP A;  3IQC A;  3EJN A;  3ASN C;  1L3P A;  1ZW2 A;  1SZI A;  1KU2 A;  2GDC A;  2PNO A;  1YYX A;  4QI0 A;  1WWP A;  1NBB A;  1K40 A;  3LS1 A;  4MTG A;  1WAT A;  1Q0D A;  2OEV A;  2GFH A;  3ZTM A;  4J7T A;  5KYY B;  1LI7 A;  2Y3G A;  1Z3I X;  4XLN F;  3LS0 A;  2Z15 A;  4JVS A;  2XL6 A;  1HMD A;  1VB5 A;  2PX0 A;  4CBE A;  1R5I D;  1T6I A;  2IXN A;  3L0I A;  3GM1 A;  3EQL F;  4CS8 C;  4EWC A;  3LEO A;  1UFB A;  3A11 A;  4BJT A;  1ZW3 A;  2XL8 A;  1FAP B;  2ETS A;  2HMZ A;  3AOU A;  3EH1 A;  3HNJ A;  3ABM C;  1D0Y A;  3I4U A;  5HSW A;  2LIG A;  2J8W A;  1ZVZ A;  3X2Q C;  4ER9 A;  2IXM A;  2A6H F;  3EFO B;  3GM2 A;  1J8Y F;  3UR3 C;  3W2V A;  3NMI A;  1F1M A;  2KJG A;  2DB4 A;  2ZPA A;  1D0Z A;  4JRZ A;  4OD4 A;  4DRI B;  1UG7 A;  4E7S A;  2DI3 A;  2FGY A;  3B71 A;  3EHN A;  1QKR A;  3ZQY A;  2HSB A;  3O6X A;  3EGD A;  4IRU A;  1FNT c;  3VAY A;  3EZI A;  2J0W A;  2C03 A;  4XQ1 A;  1RKE A;  1D1C A;  5A6B D;  1V4A A;  1C02 A;  2CGE A;  3LJB A;  4BPM A;  1Q0G A;  2ASR A;  2QLA A;  3FOO A;  2RSE B;  1YVI A;  4A4A A;  3Q7L A;  3K33 A;  2YL7 A;  2P61 A;  2YLD A;  1ZU5 A;  4J32 B;  5A6K A;  3C8G B;  3RYL A;  5DLJ A;  5JLI A;  2OKU A;  2PP4 A;  3O55 A;  4LDR A;  4ULW A;  4DXW A;  1I4Z A;  3EH2 A;  4O79 A;  4R32 A;  2HUJ A;  3VF0 A;  4OIN F;  1FR0 A;  4PJM A;  2XLH A;  4MVS A;  3SNH A;  1EI7 A;  4G7H F;  2P6V A;  4CJO A;  4LDQ A;  1JR8 A;  3IQ6 A;  4ULV A;  4OIO F;  1Z63 A;  4JC7 A;  1JAF A;  1A7D A;  4XEK A;  1XZP A;  2WVO A;  3GAN A;  5DS4 A;  2X0C A;  3QTH A;  3C7J A;  3UNG C;  1D1B A;  3JT1 A;  3LLK A;  4I1M A;  3S9O A;  5K0I A;  1XZQ A;  2J0X A;  1OR3 A;  4I1O B;  2ICW G;  1R4T A;  1WOL A;  4U5G A;  4CS7 A;  2LK4 A;  3ZVR A;  1PD0 A;  4BG0 A;  3SEO A;  3DI5 A;  1EKY A;  4GYT A;  1V54 C;  3OA1 A;  4QDL A;  3ABK C;  3S90 A;  1LIH A;  1VK5 A;  5DQZ A;  3RH3 A;  3M4C A;  2H7V C;  4LER A;  4EHP A;  3U9M A;  3N0T A;  2TMV P;  3AG3 C;  4I44 A;  4PJJ A;  2YWA A;  3IEE A;  3U0C A;  5BQI A;  3WHN A;  2XXA A;  3R2P A;  3RQF A;  3U3B A;  4X0R A;  4DJ9 A;  2NUT B;  1I5N A;  2A69 F;  5CIV A;  2LD6 A;  4K1O A;  5E3A A;  2W45 A;  4ZLC A;  4CDV A;  5A6B A;  3N2Z B;  2LFF A;  3CZ6 A;  3G4Z A;  3U8P A;  4DRH B;  2R7X A;  1PCX A;  1NSG B;  1CGO A;  2NUP B;  4EIY A;  2XM0 A;  3LUT B;  1KTM A;  4MTO A;  1G8X A;  4JIO A;  1Z23 A;  4JJG A;  2A0U A;  3L8J A;  3NRH A;  1PD1 A;  1MND A;  3MFN A;  4HFK B;  2AVK A;  5E33 A;  2EIL C;  1YA7 O;  4YL3 A;  3A9C A;  2R05 A;  2Q9A A;  3L8I A;  1A41 A;  2OEX A;  3GEH A;  3HKK A;  1YJG A;  4MVR A;  1QQ3 A;  3SP1 A;  1M2O A;  2L7A A;  3LNR A;  5BQG A;  3DE9 A;  3R7C A;  4CDA A;  5KYY A;  3SXY A;  2NSG A;  2R9R B;  4FES A;  1LS1 A;  1MNE A;  1KNY A;  1AVO B;  2CDQ A;  1K05 A;  2YHS A;  2VCA A;  3DMD A;  4JTD B;  3MBG A;  1OW7 A;  3CEX A;  1HMO A;  3JRT A;  5AGF A;  2XM4 A;  2XSE A;  4O6M A;  4J7Y A;  3UMH A;  5L0D A;  1CGN A;  2BL2 A;  3ABL C;  4E0H A;  4IAR A;  2W9Y A;  2R25 A;  1ORS C;  2OOC A;  3EFO A;  4E0I A;  4DOZ A;  3DD7 A;  1A7E A;  1N1C A;  1Z5Z A;  4N06 A;  4YJW A;  5HV9 A;  1NFN A;  2JD3 A;  3G50 A;  2H7B A;  3TK0 A;  3W8H A;  5FCL A;  1H9T A;  1ZHW A;  3O39 A;  4IGG A;  4LLC A;  3CSK A;  2OCC C;  3AG2 C;  3K1I C;  3K6B A;  5JSL A;  5KYU A;  3S29 A;  2HJM A;  1NG1 A;  2I8B A;  3JSE O;  3GOR A;  4NTA A;  2R7S A;  4K7B A;  4PR9 A;  3BRJ A;  4DRJ B;  4IAO A;  3EGX B;  3RFY A;  1ZHT A;  1J8M F;  3AQB A;  3C8G A;  2R7R A;  4KI2 A;  2J9U A;  4Q5S F;  1YYJ A;  2E87 A;  4IB4 A;  4WAB A;  2VB6 A;  2WVN A;  3TQO A;  3S0X A;  4GEH A;  1JPN A;  2MHR A;  2YKZ A;  1LVK A;  3BEH A;  5EGY A;  3J06 A;  4CDY A;  4LLE A;  4A2N B;  4U5F E;  4YT2 A;  5DS6 A;  4NTF A;  3M79 A;  2Y3D A;  1Y4C A;  4Z9J A;  2DGJ A;  1U6H A;  2R7V A;  2R7U A;  2M4E A;  1XWJ A;  1BBH A;  2BC5 A;  2NG1 A;  2J9W A;  3JTL O;  4UDV A;  2L6H A;  3FVY A;  4HFF B;  5DS5 A;  4B6I A;  5FZT A;  3GEE A;  1JOG A;  4CS9 A;  2WZL A;  3NMK A;  4XEV A;  4U5B E;  5JVE A;  4RD9 A;  4XLP F;  3GWL A;  3MYI A;  1G5Z A;  1HE9 A;  1SF8 A;  3GEI A;  4EBB A;  1FMV A;  1FMW A;  1WAS A;  1TWA A;  5E2Q A;  2UUH A;  4AL0 A;  2XLO A;  1AEP A;  3K1H A;  1U0B B;  1T6Q A;  2NUT A;  1LPE A;  4I3M A;  4LAC B;  4D4N A;  1ORY A;  2EIN C;  4H4K C;  3W4Y A;  3WOD F;  1TR2 A;  4U5H A;  5DVW A;  3JYY A;  5T1D B;  1NZE A;  1JMW A;  1RKC A;  3IQT A;  2NUP A;  2X51 A;  5COF A;  4C3E A;  1QPU A;  2VC9 A;  3C18 A;  2CNW D;  1C17 M;  1MQV A;  2IOQ A;  2Q9C A;  4IAQ A;  1O5H A;  3ASO C;  4KC9 A;  2LSE A;  3V5Y A;  3ZSU A;  1CPQ A;  2LQG A;  2KNH A;  3DWW A;  2GWW A;  1OXB A;  3RVZ A;  1S7Z A;  3S28 A;  1HY5 A;  4U9E A;  2A0B A;  3POV A;  1VLS A;  1YLM A;  2ZD9 A;  1WTY A;  4O6Y A;  4E7Z A;  2P1A A;  4O7G A;  5F5H A;  1OCZ C;  4PK4 A;  4GQH A;  2I15 A;  2NSF A;  3FHD A;  1FTS A;  1RJ9 A;  4MVZ A;  3DAG A;  5EK0 A;  2KYH A;  4JCH A;  3C8Z A;  5KYX B;  3OWT A;  1OW8 A;  2P7V A;  5L0C A;  4ZLD A;  1TWH A;  4OD5 A;  3TOL A;  2XLE A;  4MVQ A;  4PAC A;  1CPR A;  1K04 A;  2M64 A;  1QVX A;  2OQM A;  3ZWI A;  1O87 A;  3CQZ A;  2WZF A;  1BZ4 A;  3MYF A;  3QMK A;  3QW0 A;  3U5S A;  4DBR A;  2HV6 A;  3U9J A;  2VAS A;  2YEV A;  1TFO B;  1RCP A;  3ZC4 A;  1G4U S;  4C7O B;  4BEM J;  1SR2 A;  3KYJ A;  3QVZ A;  3K66 A;  2LFD A;  4U5C E;  3B29 A;  3EGX A;  2GA0 A;  3EG9 B;  3TOM A;  4CIP A;  2EPO A;  3B9Q A;  4KBL A;  2C04 A;  2EPM X;  5DQT A;  4C3B A;  3ATP A;  2PFD A;  3TUL A;  5TJ5 E;  2DYS C;  2AWY A;  2G62 A;  2PF4 E;  4JW1 A;  2G3V A;  3JYH A;  2HS5 A;  2J7P A;  4MVM A;  5B1A C;  2H7O A;  1M57 C;  3OEO A;  3Q6M A;  3RQG A;  1C03 A;  1WGW A;  4M63 A;  1ZHZ A;  1HE1 A;  2UUI A;  1U89 A;  3AG1 C;  3B0U X;  3PCV A;  1YDI A;  3ITF A;  4BEJ A;  3T6J A;  1LE4 A;  1ZZP A;  3T6B A;  2YLG A;  1I4Y A;  2AU5 A;  2WB7 A;  3U2M A;  4CSA C;  1B68 A;  3HTK C;  4MW3 A;  4U9D A;  1HW1 A;  4AX2 A;  2Q00 A;  5JS5 A;  2GAQ A;  3NYM A;  3NG1 A;  3VM6 A;  1M2V B;  2HMQ A;  2R03 A;  3M1C B;  3NYJ A;  3SXM A;  2BE5 F;  5AC5 A;  2QNL A;  3FAP B;  1BDJ B;  1E2X A;  3JCU Q;  3QW1 A;  3FDQ A;  3TJ5 A;  1ZU4 A;  1A7V A;  3NMJ A; 
#chains in the Genus database with same CATH homology
 4ER9 A;  4L6R A;  3FOP A;  3M79 A;  3NMI A;  5JP7 A;  3IQ5 A;  3ZQY A;  5JT4 A;  1BBH A;  2BC5 A;  4JKV A;  2QLA A;  3FOO A;  1M6T A;  4WGY A;  2YL7 A;  2YLD A;  3NMK A;  5JLI A;  5JVE A;  1GQA A;  4N4W A;  1E86 A;  1LM3 B;  1YZA A;  2XLH A;  2XLD A;  4CJO A;  3IQ6 A;  4ULV A;  3L1M A;  2XLO A;  1JAF A;  4JEA A;  4D4N A;  3DE8 A;  4CDY A;  3M4B A;  3HNK A;  1QPU A;  1EKY A;  1MQV A;  4IAQ A;  4JE9 A;  3HNL A;  4NC3 A;  1CPQ A;  4U9E A;  3M4C A;  2J9B A;  256B A;  2XLM A;  3C62 A;  2CCY A;  3ZQV A;  4CDV A;  3TOL A;  2XLE A;  3U8P A;  1CPR A;  3VRC A;  1CGO A;  4EIY A;  2YLI A;  2XM0 A;  3ZWI A;  3QW0 A;  4WGZ A;  1S05 A;  1RCP A;  2XLV A;  3HNI A;  5JRA A;  4D4X A;  1QQ3 A;  2YL0 A;  3DE9 A;  4CDA A;  1E84 A;  3QVZ A;  3QVY A;  3TOM A;  2YL3 A;  4CIP A;  3M15 A;  5JUA A;  1YZC A;  5AGF A;  2XM4 A;  4N6H A;  4JEB A;  1CGN A;  4CX9 A;  1E85 A;  4IAR A;  2XLW A;  3ZTZ A;  1APC A;  1YYX A;  3C63 A;  1NBB A;  5JSL A;  2YLG A;  3ZTM A;  4U9D A;  5JS5 A;  2XL6 A;  4CJG A;  1E83 A;  1YYJ A;  4IB4 A;  5B3I A;  3QW1 A;  2XL8 A;  2YKZ A;  3HNJ A;  2YL1 A;  1A7V A;  3NMJ A;  2J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...