3HNMA

Crystal structure of protein bt_411 (putative chitobiase, fragment 298-461) from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr319d
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
167
structure length
167
Chain Sequence
YTVKFQPDPIDKKGWSVIDFNNCCTQDGGWYLNMGWGVESLIDNNPGTQWLCRWDVKEPLPYYFVFDMGKEYTLFRFGFANPVAPAAHVWAGTSKAGYVEASIDNENWVKLKDWTSPKIGEPNVNMDVPATQARYIRFVITDTYPTYDGLRVSLGEVYAWGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target BtR319D
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Putative chitobiase
total genus 28
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3hnmA00
4BXSV 1KEXA 2V5DA 3I3DA 3LEKA 4BK5A 5B4XA 3C7OA 5JUVA 1OH4A 3ETPA 1UYYA 3LPGA 4QX0A 5IHRA 3DYOA 5EJ1B 2YB7A 1JYWA 2VZVA 3THCA 1GOGA 2VO5A 3WNPA 4W50A 1SDDB 1OT5A 3T2QA 3P6BA 4XUTA 3JXSA 1GQPA 4TXWA 1K12A 3OG2A 1UXXX 1UWWA 4XUQA 1UYZA 2WUHA 1UY4A 4YPJA 1US3A 3SEEA 3FN9A 3MV11 5C70A 2XHNA 2QQOA 2XOMA 2QQKA 3FL7A 1W0NA 5A1AA 1WKYA 2WAOA 4DEVA 1JU4A 4FI9A 4LHSA 1TG7A 1H6XA 3WF1A 5LCWL 3HEIA 4CU7A 2VL4A 1GOFA 3C7FA 1JYXA 1W99A 1PMHX 2VQTA 2J1AA 2B9VA 1HN1A 2BGPA 4OYUA 3NNGA 3E1F1 2Y6HA 1UY1A 1J84A 4PQQA 3I2FA 2LW8A 4DXTA 2WAAA 2WO3A 2LS6A 3A7QA 2VJXA 3VD5A 4P02B 2W1SA 3LE0A 2ORZA 3IB3A 3I2KA 1GNYA 4BJ0A 4UI9L 2VC9A 4RYDA 1H6YA 2YC2A 4M4PA 2CDOA 1F4HA 2PQSA 2J1VA 4CUBA 1YQ2A 2VZUA 2ZEZA 4JHZA 1L7RA 2Y64A 2Y6KA 2QBXA 3OEAA 4GWJA 3T2PA 1PX3A 4UAPA 3VD9A 2VCAA 2WDBA 3WNLA 2QQLA 2J22A 2Y6LA 2WZEA 3IDAA 3CZJA 1J83A 2XONA 3VDAA 4QX1A 3OGRA 2DCKA 4ARXA 1ULOA 4D8MA 4LPLA 3BGAA 3MO4A 5JMOA 1CX1A 1JZ5A 3PUIA 3SKVA 4QPWA 4W4ZA 2VZ1A 1JU3A 1L7QA 4QB2A 1LNSA 1GUIA 2C4XA 4A3ZA 3SEPA 3BN6A 3CQOA 4QX2A 5JXGA 1OD3A 3GGLA 1JYNA 4JKKA 1GU3A 3T08A 3I97A 4D0QA 2EICA 4P00B 4AG4A 3I2HA 1UZ0A 3IIIA 3NRUA 1F4AA 3SKJE 4GWIA 1I5PA 2JE8A 4HG6B 1NKGA 3GDBA 2OKXA 2VMDA 2VTFA 3A23A 3K46A 3LEIA 2V72A 4CUAA 3GXUA 2C9KA 1XPWA 1SHWB 3I2IA 2WO1A 1JI6A 1UY3A 1CIYA 4MADA 2J7MA 3F2ZA 1UY0A 3UESA 5DMYA 2BERA 2EIDA 1UXZA 2RJ2A 2W1QA 4DXSA 3K4DA 2VZRA 1PX4A 3MUZ1 1NX9A 4LQRA 2B4KA 2ZXQA 3I3BA 5LA2A 1CZVA 4QB6A 5DPNA 2J1TA 3PUHA 1DLCA 4XZUG 2WZ8A 1MPXA 2W95A 3ACGA 1UY2A 2W46A 4P5YA 3UETA 3T0AA 2JDAA 2W91A 5EJZB 5JXIA 1JZ4A 3ACIA 2VZOA 4OUEA 4DEQA 3HNBM 3ABZA 2VMEA 3OEBA 1JZ7A 5CZKA 1D7PM 2W94A 3T2OA 3LPFA 2VZTA 1OF3A 1KGYA 4MGQA 2Y8KA 2J1EA 2QQJA 2W47A 3DYPA 2HYXA 3HPNA 4QX3A 4CU8A 1O8SA 1T2XA 4W8JA 1NUKA 2VCCA 3A22A 4KWUA 3WNOA 4AAXA 3I2GA 3D3AA 4L0PA 1BHGA 2YG0A 2JD9A 3WNNA 3K4ZA 3IAPA 3IAQA 4XVHA 1RYYA 3CMGA 3EYPA 3FHQA 5B4NA 1JZ6A 5IFTA 3W5NA 2X10A 3LQCA 4PF1A 4XUPA 4IUGA 4DUWA 3VD3A 4BK4A 3MUY1 4MO3M 2VCBA 3OB8A 3HJRA 3K77A 1O8PA 1R64A 3DECA 1O59A 2ZEYA 3CZUA 2W5FA 2VOTA 3CIHA 3I2JA 3P1IA 2QQNA 3T0BA 3HNYM 4JKMA 2X05A 3WSOA 1P8JA 3U37A 2ZEXA 2VM9A 2VZPA 4OMCA 3WNKA 5F7UA 4JKLA 1UMHA 4UOJA 4OMDA 3K4AA 2ID4A 4ZXEA 1GMMA 3C7EA 3ECQA 4XUNA 2BGOA 2W87A 5IJRA 5JR2A 3VD4A 1TVGA 4QDQA 3HOBA 5C71A 2ZEWA 4RN5A 3ACFA 1K3IA 1JHJA 3FHAA 4OZOA 4M4RA 5CYYA 3WF0A 2W3JA 5J1XA 3MBWA 1UYXA 3WQBA 2WQ8A 5HPOA 5I0DA 1XNAA 3NJVA 3J7HA 3GM8A 4A4AA 3NJXA 2BBAA 2WN3A 5IYYA 4A6OA 2L9LA 2W1WA 5G05L 2YFZA 1W9TA 1XNTA 1W9WA 2J1RA 2QQIA 4JX0A 3K75B 4ZY9A 2DCJA 2R7EB 2RVAA 2YC4A 2HLEA 2WABA 1W8OA 2YFUA 4E8DA 2VQUA 2Z4FA 1DYOA 4KMQA 2WYSA 5JXJA 5HXMA 5G04L 2EIBA 3OBAA 2QQMA 4MGSA 1K45A 2W1UA 2J1SA 2VR4A 1JZ8A 3CDZB 3OGVA 3WF2A 1UMIA 3I3EA 4BDVB 2WO2A 4KI5M 3ZM8A 1DP0A 4QDRA 1IQDC 2J1UA 4QB1A 2W9XA 1WCQA 4DXRA 2ORXA 5FUIA 4XURA 3WF3A 1US2A 3WNMA 2E31A 3OGSA 1K42A 1JYVA 2RV9A 5EIYB 2VMFA 3WEZA 2WN2A 4A42A 1W8NA 2XQXA 1CZSA 3C7HA 2WBKA 4A44A 4ARYA 1EUTA 4QAWA 3C8XA 4A45A 4PT6A 1ULPA 1NAEA 4ZZ5A 4CUCA 3AC0A 4A41A 1EUUA 3UNPA 3HNMA 3VD7A 5LA1A 4ET7A 3C7GA 3VDCA 5LA0A 2V4VA 2VMCA 3W5MA 5DQ0A 2DDUA 5IFPA 3ACHA 3DYMA 4CU6A 2E26A 2KD7A 2E33A 2VZQA 4MOAA 4P08A 4E8CA 4CVUA 4DUVA 4DUXA 3CKHA 3HN3A 2Y6JA 1XC6A 2VZ3A 2C26A 2W92A 4LKSA 2E32A 4CU9A 4ZZ8A 4QDSA 1OF4A 4XUOA 5JXHA 3WF4A 3T0DA 3A21A 1JZ3A 3NQHA 5C7GA 4Z2AA 3VDBA 1PMJX 1SG3A 1JZ2A 3T09A 4GZ9A 2VZSA 2Y6GA 2BZDA 2EIEA 4TTGA 1GOHA 1CZTA 1UX7A 3MV01 3EB7A 5DN2A 2JKXA 3LEGA 3THDA 2CDPA 2X09A 1W9SA
chains in the Genus database with same CATH superfamily
5A7PA 1BK0A 4WM8A 5A32B 4Y26A 1RUJ1 2V5DA 1KRIA 1IG0A 3LEKA 3NMBA 4K1YA 3JD72 5F9TA 1K5MC 1W03A 4NE9A 4QKFA 1F5JA 3N4MA 4A7ZA 4A7KA 2JE9A 2VMGA 3ETPA 1Y3TA 2D5HA 1PGW1 4QPGA 1YO8A 1UX6A 2JG9C 1OMIA 3LPGA 2WSVA 4MGYE 4QX0A 5F2SA 1QY4A 4FQZA 2D3PA 4XDQA 1WCUA 3WDWA 2RJKA 2YB7A 5EJ1B 4LO7A 5A80A 5LEKA 4P9LA 1JMUB 4Y20A 3H3LA 1RUI2 1GWMA 1U5XA 5LEJA 2PMWB 1GZCA 1OT5A 4MV2A 2D6KA 5FPVA 4OFGA 3I59A 4XUTA 3JXSA 4C91A 1GQPA 1Y7BA 2YUEA 1JW6A 3N9LA 3LD8A 1RB8G 4TXWA 5D2AA 1K12A 5LK7B 1UXXX 2JXAA 3W20A 4TSVA 1W8UA 2BGCA 5CFCA 4B4QA 5F3CA 5BNNC 2ET7A 4F7ZA 2AEZA 3NNJA 3FMGA 1SZBA 1UPIA 4IGOA 3NJZA 4YPJA 3HQUA 5H9RA 3SEEA 5L9BA 3ATGA 4OHWA 2RMU2 3BIEA 1YNAA 5C3QA 1REEA 5FKCA 1RTVA 1W6NA 4PLNA 1PVC3 1QF3A 2E63A 4YVWA 1WCDJ 2RM23 2WT1A 2R073 2QQOA 4YWAA 4BLIA 2QQKA 1GANA 2UWCA 4KNCA 1VE0A 2JB8A 2JG9B 5LB6A 5LZ6A 1J59A 4HVRA 2BUKA 4Q4X2 1WMDA 1TG7A 4PLMA 2E51A 1HRI2 2VNGA 3GCWA 4YSFA 4CU7A 2VL4A 1MEC1 1YI7A 2A6YA 3C7FA 2I07B 1JYXA 2QDRA 3JQWA 4LBNA 1AR61 5L7OB 1DU3D 2B9VA 1KJLA 2BGPA 4OYUA 4IGPA 5FZMA 1L3JA 3C3VA 4Q4X1 4FAHA 2IUWA 3TN92 4K1ZA 1XYOA 4YW3A 1ULFA 4PQQA 2LW8A 1CAXA 1RUG3 1LHOA 2XKPA 3A7QA 3LAGA 2ZGRA 4PBPA 5F8PA 3IPVB 4P9XA 3AX4A 3T4VA 5BNPA 5HBAA 5FY8A 4IV1A 2W1SA 1OSGA 4EN8B 2WNEA 4C1WA 4CSWA 1H9WA 3ZYRA 5JMCA 3I2KA 1YFUA 3RZJA 3WP3A 4CDQA 4GD4A 4XABA 2GC1A 4FP2A 5AVAA 4N7IA 2YC2A 2Q1ZB 2CDOA 1F4HA 2EXKA 5FCCA 1NCRB 1EYBA 3KCYA 4HETA 2RDSA 5DG1A 4YARA 2VTXJ 1F35A 1YC61 1E5SA 1L7RA 2W52A 1T6GC 2VOVA 2XR4A 5FZ8A 5LBFA 1R1ZA 2JIJA 3U78A 3VD9A 1ZNPA 2VCAA 3MIFA 1Q3EA 1DZQA 4XXAA 5A3NA 5I0SA 2RE9A 4R9BA 1VBD2 2A1XA 2QQLA 1JOJA 5AC91 5GZEA 5BNOB 4CUGA 2DBNA 1J83A 2GN3A 4LUMA 2XONA 1Q8PA 4NWVA 5FZ6A 2P34A 3OGRA 2DCKA 3T1LA 3VDAA 1ULOA 4D8MA 1PGSA 2ENRA 2NMNA 2R1BA 1FNYA 4MVTA 4Q0PA 4TZDA 4RD7A 2YXSA 2D3SA 3B3QE 4TN7A 3HQRA 5FWJA 4IW3A 4DO0A 3RDIA 2E7AA 3ZIWA 1XOYA 2Q5TA 2P1BA 3H1WA 3CQOA 2GNBA 4YZ2A 3NO8A 2DCZA 4R4XA 4OZXA 5JXGA 4JKKA 2ATFA 4BA6A 4C0HA 3AKRA 5FK8A 3W59A 5DUXA 4D94A 2K2SA 4SLIA 2EICA 4P00B 4O7XA 3AXEA 3VHPA 2Z5WA 3AKPA 5BNPC 1PGL1 2ZZQA 1UZ0A 3GF6A 1AL0G 3NRUA 1IPKA 4UYBA 1ZVFA 3ZYHA 4FPFA 1F4AA 3HT1A 2JE8A 1VBA3 1TQ5A 4AHWA 1Y9MA 1NKGA 3OPZA 4DIQA 3RFRA 1NZIA 4YW5A 4B7EA 2WFF3 4Q4V1 2VTFA 3TNPB 5DUWA 1OLRA 3HVDA 3D6EA 3K46A 4ISRA 2V72A 3GHNA 4LKFA 4B1LA 3SH3A 1N1VA 2WR9A 1XPWA 5BNOA 2ILMA 2R071 5JOWA 3ZFEB 3I2IA 4YNIA 1DLLA 2WO1A 4MSVA 1JI6A 1CIYA 4HPKB 1E5RA 5GZCA 2ZGQA 3FC0A 2J7MA 3RG0A 1TZOA 3T4HB 2HWD3 1IQAA 1NG0A 2EIDA 5C3PA 4DXSA 3EBRA 5DMYA 1OD5A 3K4DA 5JIAA 2IC1A 4GB31 3B00A 5EJ3A 2LM3A 4LQRA 5A7NA 5A3TA 4K20A 4IV3A 4PLOA 4CCMA 3W58A 2BNNA 4N43A 1YQCA 3KT1A 3POWA 2MEV2 1CPMA 2XJUA 3I59B 1BYHA 1VBB3 3SISA 1VALA 3GZAA 2WZ8A 4ASKA 1MPXA 1R1A1 4NAMA 5FMOS 5C4WC 1WW6A 1CGPA 3MIBA 4XJ9A 3VDDB 1VPHA 4AOCA 4H3WA 1W6PA 1RJ8A 5JXIA 1AXYA 3KSCA 3ACIA 4QX8A 3WG3A 1R1A3 2VZOA 2G1MA 1EAH1 5F32A 4XF3A 1AR82 2D6PA 4Y1VA 4AI8A 3CF6E 5FZEA 5CG8A 5L9VA 2P4EA 4COVA 1EAH3 2RG4A 3OYWB 1H8TB 2R32A 3UGFA 2B8MA 1JYTA 2RS31 1ZA7A 4IEVA 1JHNA 2KA3A 1QJY1 3AZXA 1OFSA 4PIXA 1VBC2 1ZBE1 2J1EA 5FY1A 2QQJA 4WV8A 4UW3A 2DVBA 5I93A 3HPNA 1MEC3 1NYWA 4QXBA 3AP5A 4CU8A 1X82A 1O8SA 4NHYA 4IEWA 1L7LA 1J3QA 1ODMA 4R9CA 1FPN1 1LESA 4ZPIA 3SHRA 1KDKA 2ZGNA 4AXOA 3CLPA 4LUKA 3LF7A 2Q8CA 3D3AA 4JAAA 2QTWB 3J7MA 1BHGA 2D40A 2YG0A 2JD9A 3AP9A 2D7FA 4LLFA 4AHZA 1UU4A 1C4RA 1ONAA 1OBNA 4AHXA 1RYYA 4C8DA 2Q4SA 3N9MA 3FHQA 4LA2A 3WHTA 4R8HA 2UYBA 4HOOA 2WA4A 1UCXA 2X10A 3GJAA 5HCHA 3LEMA 4FOVA 2RS32 1XJAA 5FO7B 2WRAA 4OHVA 4H7LA 4BQ5A 3OY8A 2BW8A 1O7FA 1PHMA 4R4ZA 2D43A 1ZYBA 1YXWA 1O3SA 2D6NA 4WM7A 1Y9GA 4Y5Z0 2VCBA 2ZMNA 4QKBA 4B29A 1ND2A 3AKTA 3OB8A 5FMCA 5FPAA 3I2DA 2RS11 3BODA 2XDVA 3I3MA 2GU9A 3WQ0A 2GMMA 1J1TA 4KWKA 1H1MA 4QM8A 2W5FA 2PHLA 5A3PA 2VOTA 3CIHA 3C2UA 5EYXA 3WW3A 2AUYA 3DKWA 3HNYM 4LO4B 1DQ1A 1O4YA 3PMEA 2UY9A 2X05A 5DAQA 4XILA 1GBGA 3U37A 4QPGB 4LEJA 1FT9A 4XBQA 1SLBA 4YM3A 4FFIA 1AZDA 1NT0A 3WNKA 4HK8A 2Q8OA 1UMHA 4UOJA 1Z7S3 2R6QA 1HRV2 1NA1C 3BOWA 4ES8A 3V0BA 3K4AA 4CDWA 1C8NA 5LK5A 4NIIA 4LULA 4L9BA 1GMMA 1RUE3 1V0AA 3ECQA 4HONA 2W87A 5FPXA 1D0HA 3WW2A 4LITA 3ROUA 4QHZA 2LROA 4EZ4A 4RN5A 3JD73 4RGKA 1UZYA 2YGMA 1JHJA 4XDOA 3FHAA 4RGAA 4WM7B 1KFXL 4N53B 4JHTA 2W3JA 3AZWA 3KMHA 3WW4A 3OBZA 2R062 2ZX3A 1UIJA 3U0ZA 3Q8BA 2Q0AA 1M06G 4FXKB 1IS6A 1HRI1 2X53S 2HWF3 1QH7A 4OUMA 4S2DA 5BNNA 1IZ3A 5FZLA 5A6QA 2CHHA 4Q1PA 1QJY3 1CN1A 1TEIA 4WVMB 5C8CA 3J7HA 3KZ4C 1AXZA 4B3NA 1RHI3 3PTRB 1A8MA 5FMBA 1XB9A 2XLFA 1B35B 3VBHA 4EV0A 3VHOA 4Q4Y2 3J7NA 5KXEA 2ARAA 2D6LX 1IS3A 1FPN3 2WL1A 3MF9A 1S0BA 2YFZA 1W9TA 1BBT3 1W9WA 3VZJA 3ZXAC 2O8QA 1UNBA 2FDJA 2QNKA 3N7LA 4HN1A 4Y1XA 1WA6X 4ZY9A 2YGLA 1DF0A 3OF1A 1H8VA 2HBTA 3PU3A 4LHKA 3ZLIA 3ZYBA 3NNMA 4M0NA 1TNRA 4X6RB 3V56A 4CDWB 1QXJA 3VBRA 2CSGA 1C8M1 1VAKA 2MEV1 2AACA 2ZJCA 1RUD2 4KMQA 4I09A 4IV3C 4FOWA 2SLIA 3GNEA 5IATA 5ISLA 5G04L 2OQ6A 4HBNA 2JWPA 4RHV1 4NIDA 3KF3A 3VUOA 1O3TA 1LECA 2YU2A 3OBAA 4Q4X3 2YYOA 4MGSA 1K45A 2VOWA 4FPOB 2W1UA 2VR4A 2Y33A 3ZFEC 3RZMA 1RINA 3I3EA 4YW2A 4XFBA 1W2UA 4XJUA 1UZVA 1SBDA 1DP0A 2NZ9A 5LY2A 1IQDC 1W8ZA 1HV1A 5EXOA 2J1UA 1M4WA 1FYUA 2Y38A 3JBG1 1H4GA 4RQPB 5FBJA 1EPWA 1AJOA 1WCQA 2FBEA 5EHDA 2ORXA 2F17A 4D69A 4CPBD 1VBB1 2TBVA 4LOTA 4XURA 4AVSA 3WF3A 5KC5A 1WD4A 1NXD1 2WS91 3ZSJA 1PK6A 3ZR6A 5AC92 3GJBA 2ADEA 3OGSA 1O4TA 1UIKA 3M4FA 2BVVA 3OUHA 5FP4A 2PAKA 2RV9A 2VMFA 3J26N 1WA4A 4Y33A 3NKTA 4FFHA 1CX4A 1RJ7A 1PO12 4YYOA 5A33A 5IVYA 1W8NA 4KBBA 2XQXA 4CCCA 2WBKA 2XVLA 3LGRA 5JSPA 3S5AA 5BUVA 1YI9A 4ZXKA 3E97A 1CD3G 1DBNA 4A45A 1PO22 4KL1A 1R081 2OYZA 4Q5OA 1RUD3 1S0JA 3NV3A 1MZEA 2ZX0A 1J1LA 3ZYPA 4RS5A 1CAWB 1QEXA 1A78A 2BNMA 2C9AA 3H42B 4CXWA 4E4SA 1BVVA 5J96B 4ET7A 3THTA 1OOPB 1XRUA 1VRH1 3C7GA 2BOJA 3H50A 5DG2A 1VBA1 3WD5A 4AZZA 3MEPA 1J3PA 5E88A 1ASJ1 2ARXA 2DTWA 4COYA 3N9PA 4Y1YA 4MX3A 4AWDA 2MPFA 5EYYA 2DVAA 4BE3A 5I0RA 2VMCA 4YGEA 1VRH2 3N9QA 5LY1A 3BCWA 1G9FA 3LFMA 5IVVA 4Z1VA 2DUQA 1HB1A 1QXRA 1W2NA 2XBO3 2KD7A 2E33A 2QZ2A 4NRQA 2EAKA 4NIGA 4FFFA 3JCIA 4DUVA 1PK6C 1ZZCA 5GLTA 2MEV3 3DGTA 4XFCA 2GNMA 2Y6JA 5J37A 2W92A 5AC93 4CCOA 2E32A 2D6OX 3K3OA 5JZGC 3I2OA 4ZZ8A 1VBE3 4CXYA 4QDSA 1VP6A 2LRPA 2QKDA 1S0DA 2VW2A 4AR2A 3WF4A 1LULA 4AEJA 2DCTA 4Q4Y1 3H7YA 3N36A 1BBT1 3NQHA 1DGRA 3PJYA 3VBOB 4Z2AA 5CISA 3VDBA 4Y1UA 3ZFEA 2FZ2A 3ZIXA 5A7SA 4KG0A 1VLNA 2WWUA 3A4UA 5FLJA 3OPWA 3VHNA 1MS3A 3CU7A 2WNUC 3VZLA 2QUOA 4XJAA 2B7YA 1RHI1 2RS52 4K40A 2EIEA 4DRRA 1SBFA 3KV6A 3AFKA 5FZKA 3PUQA 2PLV2 4GALA 3VBFA 3ZXGA 4AEDC 5C5TA 2A6WA 5FDBA 4CEWC 3EB7A 1SQ4A 2WNVC 1S1AA 4XTPA 4XMIA 5C6CA 1LOGA 3O1SA 2DU1A 3RYKA 2XHKA 5JI9A 4COWA 1W9SA 4HMZA 5DDJ2 2WC2A 5CBLA 1ENSA 4N53C 1LKNA 1R093 1KEXA 3RQ0A 3DV8A 2WNVA 5FXVA 1G9CA 2FDHA 3JD71 1POV1 3C7OA 1QWRA 2RDRA 4QHOA 2ZAHA 2C0ZA 1REFA 1BEV2 1CJPA 4W6WA 4FO9A 2BTVC 1W9YA 1C8M2 2GSYA 4NRMA 5FYIA 3ZN4A 3MIGA 4QXCA 3EXUA 4CEYA 4DQAA 2R0HA 5LWBA 4QQLA 2OT7A 3AJYA 2B46X 4Q0VA 4OQ9A 1QOOA 1AL21 4JGZC 1WUVA 4IV3B 1GOGA 4XFFA 5DAVA 3WNPA 3AZVA 2NQYA 5FZGA 3M8LA 1SDDB 5HCBA 5A3UA 3DPRB 4CEWA 3BTYA 5FYUA 3T2QA 2JDYA 3HN1A 5DXDA 2YBKA 5A1FA 4YVWC 3AMQA 2VPVA 5DUUA 3ZMNA 4Q8KA 3VBSB 1MR5A 4CTEA 3OG2A 1OOPC 2AYHA 4LNVA 4YW6A 4QQOA 5IVBA 1SFNA 4XUQA 1HQNA 2EAAA 4WBBA 2O8OA 1UY4A 2X5IB 3R05A 2RS53 2LUWA 4JV4A 4BIOA 5IVFA 4A7YA 5A7WB 4QD2A 2E7QA 1JYCA 1YJLA 3MV11 5C70A 4OLLA 4KU8A 5C8CC 4FT8A 5C9AB 3LDBA 3ZR5A 4AW7A 2ZGUA 4O9EA 4AVAA 5A1AA 1EAH2 2I74A 3WUCA 3O1OA 4HN0A 1UPSA 3L9JT 4FI9A 4XIOA 3WF1A 5BXXA 4M3CB 1WGPA 3WCRA 1G86A 2YU1A 1AVBA 3VZOA 4XFHA 1PIV2 3GALA 4G3YC 1PMHX 4CEYB 5AFBA 5FZBA 3OGGA 4X6QB 4Q8LA 3DEMA 2JDMA 4BB3A 3ZN6A 1QQP1 1UN1A 2BYVE 1BEV1 2AC1A 3MW3A 4AI9A 1XYPA 2FDKA 2JG8A 2HEWF 1J84A 4DXTA 1TNFA 4QXKA 3WG1A 3SC7X 3SNMA 2BV4A 4O61A 2VJXA 2R042 3JU9A 5FYBA 3POFA 5FZ7A 2BFUS 4E27A 1AHSA 2Y0IA 4FTBA 3LE0A 2X5IA 2AGSA 4UFHA 5FZ9A 3ALQA 2WZR2 3M70A 1VR3A 4AAPA 3Q9OA 4MG2A 3ZSMA 3TYJA 2VC9A 2R49A 5D21A 1OLME 1RHI2 2G9GA 1FNZA 5C9AA 4M4PA 2PQSA 4Y24A 1NA1B 3FE5A 2NPIA 2VZUA 1RUJ3 3LOIA 4FQ4A 3FFQA 4I3GA 3TEZA 2ZEZA 3MW2A 1Z78A 3AZYA 4QX7A 2D98A 1ND2C 2ARBA 2Y64A 1BBT2 2QCSB 2JKBA 1QXPA 1RL3A 1U5IA 2QBXA 3TNQA 3OEAA 1AJKA 3USUB 4LHLA 2EALA 3NJYA 3MFAA 3T2PA 2WLQA 2VUCA 4JRAA 4LBQD 1PGL2 5FYMA 3L2YA 2ZA9A 2B9UA 4I0WB 3WNLA 4Y3OA 5JCTA 4KWJA 2J22A 2DV9A 1ULDA 3B94A 3VDDC 4J6GA 3EQEA 1RUC1 3M3IA 4KWLA 5GLWA 2XPJA 3PIGA 1GLHA 1DIWA 4ARXA 4HVOA 4JDNA 1BK1A 2PHWA 3H3ZA 4LPLA 3V0BB 1UD1A 5BNNB 1N3OA 3FLRA 3I4IA 5FP3A 1JZ5A 1I3HA 1AL22 3HR9A 5L73A 1CAXB 1LOEA 4P14A 4COUA 3PUIA 2UU8A 1S2KA 3PL0A 4QHBA 4QPWA 1BLZA 1MS4A 2A73B 4W4ZA 1RVF1 4QB2A 4Q4W2 2C4XA 4K7JA 4NIHA 3SEPA 1DZRA 1YEWA 4XBNA 4INDA 1DGWA 1JYNA 1MS5A 1KQRA 3T08A 4Q4V3 3I97A 5KWRA 4AQ6A 5FPUA 4HSJA 4IEXA 3FBMA 4AG4A 1APNA 3NV2A 1D4M1 3I2HA 2P37A 2WFF1 3IIIA 4UT5A 3VKFC 1LEDA 2C5DA 3G6JB 3OBRA 2EXJA 3BI3A 2RMU1 1LHWA 1QGLA 4ATEA 1AR92 4GWIA 1I5PA 2PLV1 3D4KA 4HG6B 4AGGA 2YPJA 4BYYA 3LZZA 5FY7A 1WMXA 1QJFA 1ZX5A 1UZWA 2OKXA 1RIRA 2VMDA 3I7DA 2QQWA 1QOTA 1RUF3 2VW0A 3A23A 4H2AA 2GP3A 4WVZA 3LEIA 4WVWA 4XMAA 1VAMA 2IZWA 4B4RA 2P3YA 4CUAA 3R4UA 3ASIA 3GXUA 4GKXA 1RUH2 1LHNA 2UWAA 3U75A 1ZRCA 1H8TC 1UY3A 3H7JA 2F6BA 5L9RA 3TAYA 3WV6A 1CQ9A 2Y0OA 1LJ7A 4DOUA 5FFOC 2DVGA 2NP0A 1YFYA 2C24A 3CHXA 1AL23 1UXZA 2W1QA 3S30A 1HN0A 4QXHA 5CNAA 1UL9A 1FV3A 4RSUA 2O14A 4NHKA 1NXMA 2XG3A 2CGPA 2H0BA 2A7AA 1H1IA 2OS2A 1O5UA 2B4KA 4RHV3 1CZVA 5FXXA 1RITA 2J1TA 3PUHA 3ZXJA 5CFCB 1JS9A 3D5OA 2K0GA 1NE6A 4LMFA 3ELNA 2GDFA 4ONUA 2VNOA 2W39A 2XUEA 1UY2A 5FZCA 1QH6A 2FHRA 2W46A 3S5QA 3UETA 4L8QA 4NOTA 1FAYA 4BQ3A 2A75A 4HLTA 2ZX2A 4ZKTB 5BNOC 2HWC1 1EY2A 1H4HA 1HJGA 1PO11 1WW5A 4NN0A 4RS5C 1ZRDA 5FZHA 1JZ4A 4DEQA 1MQTA 1GZWA 4Q29A 3ZFGB 1CAWA 1YIPA 1POV3 4M00A 3Q8FA 3WT3A 1GNZA 3GZUC 3PLQA 1LCLA 5CZKA 1LOCA 2VNVA 1H1AA 2BJSA 5FPBA 1CESA 3GCXA 4BOWA 4CP9B 1F31A 2VZTA 5T3NA 1KGYA 3TRSB 2YPDA 3WX5A 2Y8KA 1X9TA 3KGLA 4Y22B 2PHXA 2HYXA 3DYPA 3KGZA 3PDQA 1QJU3 4LO8A 5L19A 3ES1A 3ZYJB 1HQLA 4KG8A 4W8JA 1N1SA 4C0BA 1PO23 2VCCA 3ZSKA 3ILFA 1MZFA 1W0PA 3K3NA 4XIKA 3KLSA 4KWUA 3ST7A 2P5BA 1IKPA 2OQ7A 3HBKA 4AAXA 1V00A 4FVVA 3D82A 4K8FA 5LRRA 5BNPB 1PNGA 3ZYFA 1MS9A 5C4WB 3K4ZA 1IGOA 3IAQA 4S2FA 3N7KA 3DCQA 3IMMA 3H8RA 4QMAA 1N47A 3ZOIA 4AEMA 4YZ1A 5FY5A 5A1LA 1KFUL 3DXTA 3QOPA 4NR1A 1BQPA 2JDUA 3ZKYA 5FR3A 2Y6FA 5ANQA 1FV2A 4XUPA 1N1YA 3JZVA 1KDMA 2PN5A 5DABA 4JCKA 5JWPA 1OVPA 4YG3A 4BK4A 3RI8A 5JPNB 4JTOA 1GYKA 2WIIB 2X29A 1B09A 3WP6A 3IDCB 3K77A 1O8PA 3WY6A 3I49A 1VBE2 1OVSA 3UKTA 2XH6A 5FK7A 3VN4A 2CY6A 2GNDA 3T0BA 4JKMA 5GLVA 4FPYA 3MGUA 4MGTA 3VBUA 1P8JA 1W3XA 4AFBA 2ZHNA 3E6BA 1H2NA 2HKXA 1S4CA 2ZEXA 2VM9A 4QT6A 4ZU5A 4NIAA 3ZFFA 5J09A 1G9AA 4IV1C 4OMCA 1D0GA 3BTZA 4JKLA 2I45A 1WZXA 3KD4A 1YIFA 2YY1A 3LIHA 1OH3A 1Q5OA 2VECA 2W68A 2ID4A 4TYSA 5KHIA 1RC6A 2AEYA 3C7EA 1W8HA 3G7DA 4XAEA 5FZ1A 3RZHA 1JODA 2UY8A 2N7GA 4I0BA 3VBSA 5JR2A 1ND3B 5KXDA 1CIWA 1HW5A 1ZZ6A 3HOBA 3KF5A 2VULA 4AK3A 5C71A 2R16A 3WW1A 3ACFA 3RYRA 1K3IA 1MZ6A 3KHBA 4WVVA 3OY8B 3O1TA 4OZOA 5SV8A 1C1LA 1X33A 2BVBA 2DUOA 1NZCA 1LOAA 2G9ZA 4YZ4A 1C8M3 5A7WA 3O1VA 1PIV1 1HJFA 4XXPA 3MBWA 3PURA 3AKQA 3OPTA 4B4PA 1KD7A 4N90A 5I0DA 1URXA 1UW8A 5F3IA 2JG9A 1WW7A 2EVXA 4LTAA 4AFMA 4BMEA 1F8VA 4FP3A 2BBVA 1K5MA 2P6HA 5IYYA 1KJRA 3JB8A 1WLCA 3M7AA 2QQIA 1XNTA 3U10A 4CUBA 1LGCA 1QJZA 2VVEA 4N9IA 4JX0A 5L7OA 2RVAA 1QMJA 1SPPB 3M3OA 5I0UA 2YC4A 3JUUA 3PVOA 1JOBA 4PDWC 4S2GA 5D8AA 3TB0A 4FAGA 1MVQA 4HKLA 4GH4B 3VBUC 2JG8B 2VQAA 1W8OA 1W05A 1Q8SA 3Q8CA 4XHXA 5C8WA 2WKKA 4NO4A 4NHMA 2Y60A 1SCRA 3PMSA 4K9SA 4OCTA 5I0TA 5ACA3 3ZN5A 1COV2 4DB5A 5HXMA 1I6XA 3IPVA 3MICA 3P3NA 3KB5A 1QQP3 2E53A 2VH9A 4JDMA 1RUC2 2QQMA 2X5IC 3VV1A 3VDDA 2WT0A 4GWNA 1JZ8A 4YM0A 4AGRA 3RZKA 3GBGA 3V0AB 1UMIA 4RA0A 4RR3B 2AR6A 2XJTA 5JIUA 1X36A 2JDNA 1E5HA 4QDRA 2A5ZA 3QH7A 4BQ2A 1O4ZA 2C6SA 2TEPA 4QPIC 4CCJA 2RHPA 4MUVA 4QX5A 4DXRA 1OLQA 4P5HA 1SMVA 2IXCA 5FUIA 1WBFA 1YHFA 2UWBA 1Y4WA 5ABJB 4UBHA 2E31A 2ZHKA 1SACA 4AGVA 3S6PA 1HQWA 5HI0A 1Z7S2 1AX1A 2ZKNA 3UJOA 3USUA 1K42A 4FPKA 1W2AX 3DN7A 3PUAA 2GN7A 4O65A 4PJYA 4XACA 4BWOA 3W9AA 1MS8A 5JOZA 3T1MA 3BOPA 2P3IA 2IFWA 2RS13 1VBC1 1ZBE2 4DXZA 4FFGA 3Q8AA 3KQRA 1CZSA 1AYN1 1GSLA 2Y34A 3A0KA 5AFEA 1W28A 2QFEA 1NAEA 4CUCA 3UNPA 3AFGA 3HNMA 1NOVA 4UF0B 3WZ1A 1A6CA 3M2MA 2ZPXA 1QQP2 1GZTA 1T6BX 3B5LB 3WDUA 5B2GB 1HX6A 3RRDA 4YFZA 1VMFA 4IE7A 2YHJA 3VBOC 5E1RA 5LBBA 3VBSC 1UZZA 3NL1A 4NROA 4IE4A 4L11A 1V6LA 5APAA 5DQ0A 2DDUA 1RXFA 5IFPA 1OA4A 2E9QA 3DYMA 4NRPA 3QD6A 4XQWA 4IDZA 2WT2A 4LT5A 1OHFA 1GZ9A 3H9AA 1SDWA 4IE5A 1FPN2 2XLGA 4Q0UA 4DUXA 3CKHA 5CIRA 5FZ0A 2WFPA 4MYEA 5I8SA 2VZ3A 4EJRA 1DQ5A 3MYXA 1HB3A 3ORJA 1VBD1 2XXZA 4CU9A 3CJIA 1UF2C 1OKQA 4IEQA 4QQ2A 3U4XA 1IS5A 1W39A 1NLRA 2ZTNA 4AE2A 1ND3C 3B69A 4PIZA 1ZBA2 3MLLA 3A21A 2XBO2 4E4DX 1DCSA 2AZ5A 2HWF2 2Z69A 4HT1T 1PMJX 1F15A 2CGNA 5EV7A 1ULGA 1JZ2A 1G8WA 2XBO1 2VVFA 4FPHA 4Q1RA 5CADA 2VZSA 4BU2A 2BZDA 1AR63 5J3UA 2VE1A 3AP7A 1YFWA 2BNOA 1POV0 2OVUA 4IL7A 4OHXA 1UX7A 3W21A 2YBSA 2QQUA 4CP2A 5BV6A 4CP1A 3ZXDA 3UT0A 5DN2A 2YDEA 4EQVA 1NLSA 2HWE1 5FO8B 3LEGA 4BH9A 1VMHA 2VUAA 1BMV2 4E4HA 3E5XA 5SV5A 2XJPA 3ZFFC 4BXSV 1RUF2 2HH9A 2RJLA 5T5OA 3I3DA 4LHNA 4CPBA 1JYIA 5B4XA 1A8DA 5H9PA 1UOBA 3TN91 5JUVA 1OH4A 1OPMA 1W6OB 2SBAA 2VXJA 2ZZJA 1AR71 4GB32 4YGDA 3BUCA 3K2OA 2ZMKA 1V9U3 5JZGB 1UYYA 2IVJA 2K9ZA 2OA2A 1XE7A 2ZX4A 5C8CB 5IHRA 2GZWA 1DFQA 4ZONA 3DYOA 4WZCA 3ZFGC 1QNWA 3UKVA 2Q1MA 2VZVA 3H1YA 2RDNA 1W90A 2VO5A 5F5QA 1B35A 4QGLA 2WA3A 4W50A 3LIGA 3OYWA 3QLQA 3VBHB 3AVSA 1W0OA 3P6BA 1PVXA 1X8EA 4E2SA 3BKZA 4AFCA 4FTEA 5LATA 5FYSA 3ENRA 5JSRA 1G9DA 2HYKA 1IG3A 1VJ2A 1AYM1 4C90A 2IXJA 3M3EA 4AI3A 2DBIA 1QNYA 5FOBB 2KR2A 1TMF1 4I3PA 3GBFA 1Z0HA 2BPA2 3IMNA 4HK9A 1US3A 3FN9A 3OTFA 1V9U1 3IIAA 4BQ4A 2PELA 3MF6A 3AM2A 4EYUA 2PXJA 2XHNA 5AVPA 1R1A2 1W8WA 2XQRA 2XOMA 1W6PB 4XJWA 1W0NA 3O14A 1FOD3 1WKYA 1OKOA 2WAOA 4DEVA 2WS92 1YQ6A 3N9NA 1JU4A 3I3QA 4LHSA 4URTA 4E2QA 5CAZA 1H6XA 1C5IA 4LJHA 5EZWA 1DGLA 5HV0A 1OLMA 3HEIA 4DS0A 3HWJA 1DYPA 1NCRC 5F37A 1UMZA 4D7TA 5JOYA 3LWCA 1W99A 3OOXA 2PHRA 4AHYA 3PVBB 5C3SA 1ZA4A 2J1AA 5H9QA 1HXS2 1LAJA 1XU2A 1HN1A 1C28A 1E57A 4UWDA 1HB4A 1CWPA 3NNGA 1BZWA 1G9BA 2B45X 4CEWB 4CXXA 2Y6HA 1ND2B 1UY1A 5FKBA 4B1MA 1EV12 2WWSA 3E5QA 3CJXA 2YZ4A 4LKDA 3I2FA 1IHMA 2WO7A 2WAAA 5FTTC 4CRQA 4AL9A 3O1MA 1PO21 4QKDA 2BWCA 2WQZC 3VD5A 1LU1A 5HCAA 4XZPA 1FI2A 3QACA 2TNFA 5J98B 1BMV1 5FY4A 4GA9A 4GMP3 4TLGA 2ORZA 5FZ3A 3CL1A 1R092 2Z42A 2A6ZA 4N9HA 4BJ0A 5IVCA 3U1XA 2ZGSA 3IDEA 1BEV3 4IESA 2J1VA 2VD7A 5FYZA 1YQ2A 5BPXA 1VBB2 5IVJA 2DFBA 5F5CA 4IEYA 1VMJA 3O1UA 2GMEA 3B9CA 4R9AA 1OUXA 4NJ4A 5T52A 4OUSA 1ND3A 1KS5A 1V6NA 4D6SA 4GWJA 5I8YA 1XNCA 2GALA 3KCXA 3P5BA 4IEOA 4UAPA 4ZHNA 3S7EA 2R061 2WDBA 4XETA 4D6QA 2VUJA 1RUNA 4UBGA 2OPWA 2BU9A 2RDQA 3UYJA 2WZEA 3IDAA 1I1EA 1UYPA 2FCTA 1NY71 3E6DA 1IPJA 2CGOA 2E7TA 3LFIA 3MFCA 4LE4A 4Z07A 3ES4A 1KITA 5JMOA 2FZ1A 4GXLA 4HANA 1DQ2A 2PTMA 2D44A 1VBC3 3ZYIB 3SKVA 3AB0A 5IT6A 4WVMA 1RUE1 3J9SA 4M3CF 4YRDA 4LBQA 4QPGC 5JAXA 3UV9A 1JU3A 1L7QA 1GWLA 3POSA 3RGBA 1U5ZA 4ZS3A 3ZDVA 4A3ZA 5LBEA 1RUG1 2UURA 3IDBB 1H2MA 4QX2A 4DZGA 1ZZ8A 4XAAA 2PHFA 4GH4C 4WM8C 1GU3A 2EXHA 3DUIA 4D0QA 2YC0A 3KCCA 3M3QA 1LOFA 4B7KA 3H1MA 2B42B 2HWE2 3HT2A 1XNBA 3ZKUA 1V70A 2UYAA 4K3UA 2GH8A 4KGGA 1UO9A 1ASJ3 2JD4A 2QZ3A 3PVEA 5F6LB 5A6ZA 4WM8B 3TEYA 4F8AA 1CAUA 2CNAA 3WNXA 4JQRA 1AYM2 1EPZA 4XF0A 5BNQA 2CTVA 3O0XA 1AUYA 5FRAA 2P3JA 3T30A 4YG6A 2C9KA 5DZGA 1SHWB 1OXCA 5FOJB 3HD8B 2ADDA 3QBQA 3U4SA 3S7IA 4HFSA 2GC3A 1BCXA 4MADA 4RQPA 1ALYA 4YVSA 3F2ZA 3BTAA 5FREA 3JBG3 1UY0A 3T3YA 1O91A 3UESA 4BPZA 2R041 1YCIA 1PX4A 1TMF3 3AK0A 5FZ4A 1NX9A 3IM0A 4HKWA 1QKQA 2ZXQA 5C9AC 2XJSA 5BYNA 4QWNA 5F2WA 3OCPA 4QB6A 1S0CA 3BIWE 4LO5B 1YLLA 5DPNA 3RI9A 1SBEA 1DLCA 5TSWA 5CFDA 1C1FA 4XZUG 5JVVA 1V6OA 3M3CA 4RR3A 3MIHA 3ACGA 3UL2A 2HEYF 4MLOA 3HQXA 4LR4A 1S0GA 5C5UA 5IAVA 1W6NB 3T0AA 2JDAA 5CB7A 2HWE3 3IWZA 1YQ5A 2FMYA 4BHPA 1PVC2 2YROA 4PDWA 4KQ7A 2Q8DA 4I2OA 1F5FA 4ES9A 4UF0A 1ZBA3 4QPYA 4OUEA 3N7MA 1QJX2 3HNBM 3N9OA 5GZFA 1SLTA 1ACCA 3BU7A 4ATFA 2H6CA 4JRLA 4M3CA 1F2NA 4YG0A 3WCSA 3TEWA 2D6MA 3T2OA 4HZFA 3THPA 3MLJA 5T5JA 2IXIA 2YBPA 4EWAA 2QQVA 1GICA 4NWWA 5FP9A 1DQ0A 1ZZBA 5K8SA 4XF4A 2RS12 3ZN6B 5IAXA 4JDOA 2AENA 1JOPA 2FQPA 4QX3A 3OUIA 2WZPP 4TWTA 3WHUA 3ZPOA 2FMDA 4M0HA 4P9JA 5IWFA 1NUKA 2LALA 3WOGA 2P6CA 1JN2P 1K5JA 4AEKA 2ZGMA 2ERFA 1JTZX 2FD8A 3FJSA 1LU2A 4XFIA 2FCUA 3KWVA 1GNHA 2RM21 1IOAA 5JLVA 5IK5A 1VIWB 5K0UA 4IV1B 3VKMA 4GB33 2VY0A 1REDA 3WNNA 1B35C 1PZ9A 3AMMA 3IAPA 4XVHA 1QJU2 1DZTA 2VBBA 4C1XA 4QM9A 4EROA 3EYPA 5F39A 4J1XA 1TE1B 4Q26A 2CAVA 3IN9A 4H55A 4ITCA 4CDQB 5B4NA 1JZ6A 3RZZA 1OOPA 1YWKA 2D97A 4YFWA 4CCEA 3EJKA 1LB2A 4QU2A 1UKGA 3AL5A 2JECA 3KHCA 2VQ0A 4PF1A 4Q4W3 1F9KA 4BQXA 2XWBB 2Y26A 1MQTB 3NVCA 4IUGA 4LIVA 3CJIC 4GWMA 3MUY1 4BM8A 1OQEA 2VXRA 1EP0A 2WNUA 4XF1A 4Q4V2 5F3EA 1SLCA 2JEMA 1AYN3 3WR0A 4URAA 2TUNA 4YW7A 3ZX7A 4UFLA 1O59A 2BRTA 2FDFA 4LA3A 5DAPA 1Z7S1 2QE3A 3JQXA 4PBOA 5FO9B 2RS51 1MS0A 2QQNA 3P1IA 4QPIB 2GP5A 5CVRA 1YQ8A 4SBVA 3HAGA 3MIDA 2DVFA 4V2VA 5JZGA 1PMIA 4AQTA 2FDGA 5FQ0A 4JTNA 4Q4W1 3UK9A 4PI2A 5FV3A 4YGBA 3LSEA 3WQ1A 1CR7A 2R0FA 3NV4A 5FAXA 1H30A 1HIXA 2OW4A 2W2IA 3O0VA 4LE3A 4G9SB 3VBHC 2PLV3 1SLIA 4HXCA 3APBA 2WJSA 4NPRA 3DPRA 1S0IA 2JJ6A 4ZXEA 3X29B 3D0SA 3B7MA 2P2KA 4BCUA 1VRBA 4XUNA 2NN8A 1FMD3 5FP8A 3O12A 1AR83 2BGOA 1HXS3 3AP6A 5IJRA 1I9RA 1YYNA 2ZEWA 4OI0A 1X7NA 4RHV2 1XBFA 3V64A 2ZX1A 4M4RA 3I54A 5DDJ1 5FMOL 1MEC2 1ST8A 5HV4A 2ARCA 2ET1A 4H14A 4LORA 3J8F2 3WQBA 5HPOA 2BEOA 4QGNA 1LENA 1PZ7A 2DVDA 2XL9A 3RJRA 3ZSLA 2VMHA 1OA3A 1LEMA 3MZHA 2JDKA 4CCLA 3Q8EA 4Z8BA 3KV5A 3GM8A 3MDPA 4JQTA 4Y4YA 3TOJA 2BBAA 2WN3A 4XHBA 2Z79A 4YM2A 4A6OA 5ACA1 2W1WA 3NNLA 1JUIA 5G05L 3HMYA 5FYCA 5GZDA 5FBZA 4EWDA 5F1RA 4J25A 2J1RA 3VKOA 5M0TA 1OQ1A 3AP4A 5FZIA 4N8MA 1VBE1 3K75B 5IUQA 1ODNA 2R7EB 5A6YA 3PNAA 3VKNA 3LOBA 4PIYA 2HLEA 4N43B 4CDQC 3OD0A 2VQUA 2Z4FA 4M01A 4Z2WA 1W8FA 3V65A 1UOGA 1FOD1 5K4LA 4NHXA 1NCQA 3WDYA 3GHMA 1C5HA 3U14A 2DF7A 1EV11 1MZ5A 3FUOA 5KXBA 5A7QA 5IK4A 2J1SA 5CFDB 1W6MB 4GQ7A 4EN7B 4GULA 3ETQA 4YVSC 3LSDA 1W2TA 1RUI3 1I5ZA 1N1TA 2BQPA 2QVSB 2P3KA 2HWD1 3SITA 1G7YA 2DU0A 1AR72 4I02A 4GAZA 4W6XA 4XW3A 3EHKA 1LHVA 4PDWB 2A71A 3ZMOA 1R082 5FP7A 1H8TA 4MGZE 5J7MA 3PHMA 3DXUA 2NLRA 3NKGA 1OC1A 1SEFA 4CDXC 2IXHA 3FX3A 2IWGB 1K5MB 4DMIA 4XBLA 2ZOEB 3E6CC 2CL2A 2R30A 2ES3A 3ZPYA 3DF0A 3NAPB 2P17A 3WEZA 2WN2A 2RMU3 3MW4A 5JPMB 3KT4A 2R043 4F3JA 2ZCWA 2JDHA 5DAXA 4QKNA 1D4M3 1LOFC 1SPPA 2XWJB 3GZEA 3C7HA 4UFIA 5L7OC 4ARYA 2XUMA 4QAWA 1NQDA 5CKQA 3C8XA 1C3HA 3POBA 4GH4A 4DY5A 5F5IA 3SLIA 4A3XA 4XOGA 4D7YA 4ZZ5A 3AC0A 4A41A 3UGHA 3U07A 4MHUA 4IE6A 4Q27A 4XPVA 4UW6A 4LLOA 2PHDA 1RVF3 3POEA 4OI1A 5DUVA 5FZAA 1X50A 2D93A 2VMIA 5CFCC 3SCGA 2MHFA 1SFPA 3JBG2 4OHYA 4IGQA 3RMXA 2JENA 3AYAA 5FYYA 2RS33 3W5MA 1JBCA 2AREA 4AI0A 3UJQA 3ACHA 2CV6A 3J7LA 1AR73 4CU6A 1GV9A 2E26A 1A3KA 2VZQA 4P08A 4E8CA 3NWKA 4CVUA 4NHLA 3DL3A 4CDUA 1DGWX 2RM22 1UOJA 3P3PA 3ZVXA 2OXBA 3HN3A 4A2UA 1UU5A 1XNDA 5KBFA 5F5AA 3RS6A 4LKSA 4AI2A 4MGIE 1WLDA 1YRZA 1U5YA 4LBQB 4WZFA 1ZREA 5A3LA 3N35A 2PHTA 2WNUB 4AVVA 2CYFA 4JGYB 4N43C 5LBCA 1OF4A 1PIV3 4Y20B 4CYDA 3VBUB 4FPLA 4UW5A 1O5LA 5ACA2 3T0DA 1Y43B 1COV3 3F95A 4YZ3A 1JZ3A 5C7GA 1D4M2 3VZNA 4KH9A 4CE8A 1POQA 2W08A 2VU9A 1SG3A 2A3XA 3TWIA 1WCSA 3H8XA 5LW9A 1H2KA 1BKZA 5FYTA 5DAWA 4GZ9A 1R091 3NV1A 4WM7C 2Y6GA 1OQDA 4G4FA 4XYXA 1GOHA 4TTGA 4BXFA 4MXWA 1AR91 3MV01 4HKOA 4Y1ZA 3VKLA 2WINB 2CWMA 3CNAA 4Q0SA 3RYPA 3KQ4B 1VBD3 5A6XA 2HWC3 4GJZA 5GZGA 3THDA 1AR93 1XU1A 2VG9A 2OZ6A 2X09A 4EN9B 1CONA 4E9KA 4P9YA 5KHJA 4ISQA 4IETA 5KR7A 3NW4A 4KU7A 5FXZA 2V4AA 4BK5A 1HXS1 2ZHMA 4L2NA 5FY0A 5KHGA 1AR62 3NAPC 5A70A 2VVDA 4JGYC 1RUJ2 5F3GA 5FXWA 4YLZA 2JIGA 3RWKX 3TBDA 5I8TA 1GFF2 5D8AC 4AQ2A 4A6SA 4R9DA 1J3RA 2ZABA 2ZBJA 3B01A 4X8NA 5CKMA 3THCA 4AI1A 2KM2A 3ZXEA 1JYWA 1GQHA 3AVRA 1BVP1 1XE8A 3WDVA 2WWJA 5J36A 2BDRA 5LRSA 4QQPA 2HWB3 3ZO0B 4F83A 1MS1A 3AMPA 2R072 2XKOA 3R4DB 5K9YA 1AF9A 5IK7A 2XLAA 5KHHA 2G4IA 1UWWA 1LTEA 1UYZA 2WUHA 3MI8A 2RR11 2WSUA 3URFA 2ZAAA 1SFYA 4IERA 4XJ8A 5FUNA 4CDUC 3OJBA 1OURA 2VGDA 1AYN2 1V6KA 4RFRB 4MXWB 3M1HA 2O0OA 2RR13 1VRH3 3CBNA 1WBLA 2VCMA 4GIQA 4LKEA 5LA9A 5GLZA 4DRVA 5A3WA 1W9FA 2ETEA 5K0UB 4DNYA 2PFWA 5IW0A 3FL7A 4D3WA 4BISA 5C4WA 1QJEA 4LBKA 1W6QA 1O3RA 1KS4A 2XJVA 1UKRA 3H8UA 3ZFGA 5IVEA 1KXGA 1PVC1 2HWD2 2ZHLA 3ON7A 4QQHA 5E89A 2PQQA 4CP0A 1RUG2 2VBDA 5LCWL 2VUDA 4YW4A 1QJU1 1GOFA 5EP9A 3D0JA 4CDXB 1DG6A 2VQTA 5ABJA 4Y22A 2BWAA 1ZRFA 3ZXFA 3LA7A 5A3MA 1FMD2 2IVIB 1JUHA 1LGBA 2JB4A 4Z92B 1FOD2 1RUH1 3GBWA 2HJIA 3E1F1 1O6UA 4BQ1A 1BJQA 2WO3A 1COV1 2LS6A 3N3HA 3SQOA 4Q0QA 3ZYGA 1AX0A 3OD4A 3POYA 2ZGOA 1PO13 4OVEA 4V1PA 4P02B 4XC9A 3NSTA 1NQJA 2Q30A 1OUSA 1WD3A 1ULEA 2Q8EA 3ITQA 3IB3A 5FQ0B 3ZFFB 1RMU1 4NPLA 1GNYA 4DY3A 4AEDA 4MZUA 2DUPA 4UI9L 2ZGPA 1WLTA 2LTNA 5DZEA 2WYFA 4RYDA 1H6YA 1LHUA 5T5LA 4BQWA 3FLTA 4P9WA 1RMU3 1S0EA 4LK6A 3RSJA 4IQPA 1S2EA 2JICA 4AVTA 4JHZA 2Y6KA 2CWSA 4K21A 2VOKA 4ASMB 3RZLA 5H9SA 3E5UA 2F4LA 4I30A 2EIGA 3A0NA 5JSOA 1PX3A 4E4ZA 2WNOA 3D8CA 5ABJC 2WQ4A 3RPQA 1X8MA 4KBZA 3SMHA 1RGSA 1SLLA 4CZSA 4FTSA 3VB9A 2Y6LA 3FZ3A 5A33B 2QDNA 3CZJA 3WDTA 3WLUA 3L2HA 1DGRN 5FY9A 4QX1A 4FSJA 3O1RA 1QU0A 3RMYA 3LKJA 3CJIB 1NLQA 5K7PA 3BGAA 3MO4A 4CDUB 5FLHA 1CX1A 1XNKA 4QGMA 3WUDA 1JH5A 3WINE 5L36A 1WLWA 3BVCA 2VZ1A 2ZGTA 3WXPA 2EF6A 1V6MA 2WLPA 3SH5A 4BQYA 2MNGA 3MLKA 2GH2A 4JGYA 4L99A 1LNSA 1GUIA 1VBA2 4LIUA 4UFMA 5ERLA 5GKAC 3SH4A 5GLUA 3BN6A 1FX5A 1GQGA 2QJVA 5FIXA 4ASLA 2WS93 1R083 3INAA 1OD3A 2V09A 3GGLA 3WG4A 3VD4A 3AJZA 5LASA 3VBFB 3VZKA 2Q1FA 1AR81 1ENXA 5D8AB 3UGGA 4YM1A 3POJA 3DKQA 3AXDA 4IEZA 4W6YA 3SKJE 3OSDA 2HEVF 2JG8C 2OZJA 1UU6A 3GDBA 4FCAA 1NCQB 3RNSA 4FPJA 1SLAA 2EXIA 1EV13 3RVHA 1N3PA 1ZZ7A 1UQXA 5JI7A 4K8RB 2OUHA 4U2AA 5ANNA 3VGIA 2PHUA 5IK8A 2IFRA 3ILRA 4JGZB 4LBOA 4UFKA 2HWB1 2BOIA 3U11A 4LOSA 1RXGA 2XVKA 4FXGB 1GP4A 1RUE2 1W2OA 3KVAA 4AF9A 1W04A 4XF9A 1RUI1 1MQTC 2BERA 5KHKA 2RJ2A 2H6BA 5T54A 1MACA 2VZRA 4XJZA 2OPKA 3MUZ1 2DWRA 3UKNA 2Z2SB 4XQ4A 5EWSA 1PGW2 4P9GA 3VL8A 2A6XA 1NY72 3I3BA 5LA2A 2C1FA 5FPZA 3TEXA 3VBRB 2EA7A 1E5IA 4RFT0 2VBPA 1GKBA 4N7UA 4OQ8A 2V5YA 4FPCA 4CCKA 5A32A 2R063 2W95A 1TME3 2XMLA 4NPMA 2R1DA 3SCFA 4P5YA 4U36A 5C33A 1QDCA 1JXNA 4OI2A 1QJY2 2W91A 5FYHA 3VBRC 1GWKA 4OI4A 4PCRA 5EJZB 3V0AA 2B39A 1S2BA 2GNTA 3WP4A 1QJX1 3ABZA 1W8TA 2VMEA 3OEBA 1W3VA 4FBFA 4NUBA 1JZ7A 1D7PM 2W94A 1U0AA 2FCVA 2XB6C 3KV9A 3LPFA 4GJYA 2ZGLA 1OF3A 4I01A 1LOBA 1S0FA 1HRI3 2JDPA 4MGQA 1PK6B 1UAIA 1DYKA 2KXLA 3AMHA 4XEZA 1HB2A 3BTXA 5FUPA 2PA7A 2W47A 2DYCA 2FDIA 4DFSA 1T2XA 2HWC2 2GMPA 4DPNA 1TME1 2ZGKA 1ZBE3 1GR3A 4EWEA 3O1PA 4CDXA 4MHRA 1XSRA 3EMRA 4XFGA 4Z82A 3A22A 3RZGA 1QHDA 3IKWA 3K48A 4PF5A 4ZS2A 3RWNA 5KC6A 4OULA 4UW4A 3I2GA 3WNOA 4L0PA 2ZACA 3QCWA 4D6RA 2B5HA 3AL6A 2VW1A 1RVF2 5E6HA 3VBFC 5FPLA 3O7OA 1ASJ2 3T2TA 2QQPA 3FHIB 5E16A 4AYUA 2BP6A 2V73A 5D1IA 3ZSEA 1TME2 3S57A 1CJDA 3CMGA 1Q8OA 2VNRA 2WZR3 3AYCA 3KT7A 2JX9A 1GP5A 4M3CE 2VOXA 5IFTA 3B02A 4CEYC 2VTXA 3BPZA 1XYNA 1PNFA 2E6VA 1WMFA 3OBTA 4XCAA 3W5NA 1NA1A 2A70A 1QIQA 3FBYA 3LQCA 1HV0A 2VAUA 3LCPA 1NCQC 4QU1A 1XE0A 4PI0A 4E2GA 2HWB2 1XQNA 3KVBA 4AEDB 3R6SA 1RUF1 4DUWA 1RUD1 4MGKE 3J4UH 4L97A 5JDBA 3VD3A 4YW1A 4RR3C 4MO3M 4GMP0 4N53A 1HKDA 4KGQA 5GJ6A 2W0XA 3JB4C 3HJRA 4FOQA 4I0AA 1R64A 1ZM1A 3DECA 1TMF2 4DINB 2DTYA 5GM0A 1U12A 1ZRRA 2ZEYA 3CZUA 3PIJA 2G19A 3I2JA 5T55A 4LK7A 2GC0A 5EQUA 4META 2XGXA 1DQ6A 1W6OA 4YGCA 3WSOA 4YZ5A 4Y5TA 2H0VA 3FLPA 1AYM3 1PM7A 2A3WA 5EPAA 5J48A 1BXHA 2VZPA 3KV4A 1V6JA 1CAVA 4RQPC 3VHRA 3B93A 5F7UA 3LA2A 3O0WA 4AVBA 3PUSA 1X9PA 3ZXKA 3KM5A 4OMDA 3NNFA 4AFDA 4LBLA 1D4VB 2OIIA 2JE7A 2I2SA 4JVAA 4ORFA 3BALA 2J42A 3HIFA 3WQ7A 3H8OA 2A3YA 1HLCA 4EE2A 2X8KA 1RUOA 1DHKB 3LDRA 4X8PA 1TVGA 4QDQA 2D5FA 1UOFA 3TN93 4W65A 2CU5A 5CA6A 1AX2A 3ACLA 5BY5A 2IXKA 5F6KA 5FZDA 3BPSA 2WNVB 5CKNA 4Q4Y3 1GP6A 1CAUB 4Q2FA 5CYYA 4BIFA 3WF0A 1V9U2 5FJHA 5J1XA 1WCKA 4K6BA 1UYXA 1HRV1 4PQ9A 2WQ8A 2YMZA 5KXCA 4AFAA 1XNAA 4L92A 1YUDA 3ILNA 1W6QB 4UXAA 3AYDA 2WFF2 4HSLA 4MXVA 3HBZA 3IBMA 3NJVA 4A4AA 3NJXA 4COZA 2A6VA 3ZXLA 3GZTB 1RUH3 1V6IA 4XDPA 5EFUA 4YVSB 3GYDA 5GALA 1ZBA1 2L9LA 1QJX3 3MIEA 5FLIA 4LBMA 4BZ4A 4JGZA 2HWF1 3J8F1 4Y5SA 4Y4RA 3SXWA 1QOSA 4IEPA 4NMIA 3ZDSA 2DCJA 2ZKLA 4AQSA 5DDJ3 3POGA 3WG2A 2RR12 3R4SA 1MVEA 3MPBA 2WABA 4RGGA 4V2WA 4D7SA 3SCHA 1A34A 2YFUA 4ZU4A 4FPEA 3DPRC 1XXNA 4E8DA 1DYOA 2BFUL 4ZU7A 2WYSA 5C3OA 5JXJA 3BYWA 4IEUA 3VL9A 4HL0A 4S2HA 4H7MA 1D2SA 1LRHA 2EIBA 5JR7B 3LA3A 4RS5B 4NAOA 1XSQA 4R52A 4EZHA 3CDZB 4EN0A 1FMD1 3OGVA 5HXVA 3WF2A 5FZOA 1ZRIA 4BDVB 4BLJA 2WO2A 4GMP1 4KI5M 3ZM8A 1OPOA 3CO2A 1OA2A 2DFCA 1GZWB 1OFNA 4HPKA 2XVGA 2D3RA 3USSA 3WVJA 5K0UC 1VB4A 4QB1A 5FYVA 2W9XA 3IT8A 1IPSA 2IXLA 2PYTA 1FATA 2GC2A 3FFZA 5T50A 2ZS6B 4LXLA 1US2A 1S55A 3WNMA 2OUJA 1Q8QA 1JYVA 4IXLA 3BB6A 5EIYB 1WWYA 1YFXA 3R0RA 1STMA 1C57A 3OGJA 4GKYA 2WZR1 4LBJA 5DZFA 4XCBA 4LO6B 5A3OA 4A42A 3LDKA 1ENRA 3ME2A 4FPGA 2NM1A 3VBOA 3FUQA 1H9PA 4A44A 4RL7A 4HVQA 1IKQA 1EUTA 3I8TA 3KS7A 4O9GA 4PT6A 1ULPA 2NMOA 4MH0E 3LB9A 4XQDA 1NCRA 1EUUA 4XTMA 4CA9A 2XJRA 4CCNA 5C3RA 1RMU2 3H3UA 3VD7A 4EN6B 1DQ4A 4J1WA 3MPPG 3AYEA 1Y9QA 2XL7A 5LA1A 3IZOA 2F4PA 3VDCA 1W6MA 3BU0A 1G6NA 4B8EA 4CP9A 3VLBB 5FZOB 5LA0A 3O5SA 2V4VA 2OX0A 5JOXA 2NYYA 5E8AA 1DDLA 1WW4A 1J58A 3POIA 4FOYA 2CAUA 4TLFA 5FZFA 3AKSA 1Q56A 3K51A 3PJQA 4PHZA 4MOAA 1CPNA 1PZ8A 4JZRA 5FWEA 1ULCA 2GAUA 3PTYA 3PU8A 1NE4A 3QH6A 4BMBA 1IS4A 1N3QA 2HBUA 4XFAA 4XE9A 3EO6A 1Q43A 5CEHA 3CEWA 1OI6A 3OUJA 1W06A 1XC6A 4OHZA 2C26A 1AXKA 1LR5A 3PVNA 1ZZ9A 1VB2A 4CCDA 1LODA 1LGNA 1WMEA 5CU1A 5CG9A 4QPIA 4P9IA 2XJQA 2ZMLA 3NAPA 1H2LA 1ENQA 4NVPA 2DCYA 3B9IA 2K46A 1PM4A 4XUOA 3WDXA 4CDWC 5JXHA 3AZZA 5I91A 2O1QA 3S0MA 5HCFA 3J8F3 2AH2A 3N7JA 2PAEA 2G9FA 2JDZA 2YV8A 1CVNA 1RUC3 1QDOA 3T09A 3WP5A 3AMNA 5FJKA 1YJKA 2PAMA 5T5PA 5CFDC 3RJ2X 1Q8VA 1CAVB 1VAVA 1CZTA 3H0OA 4AVCA 1HRV3 3FWEA 4UFJA 2DURA 5FMDA 3VZMA 1FXZA 2JKXA 1D2QA 1H0BA 4JC1A 4IE0A 3MHZA 1SCSA 4YVWB 5A7OA 1O3QA 2CDPA 1HDKA
chains in the Genus database with same CATH topology
4BXSV 1KEXA 2V5DA 3I3DA 3LEKA 4BK5A 5B4XA 3C7OA 5JUVA 1OH4A 3ETPA 1UYYA 3LPGA 4QX0A 5IHRA 3DYOA 5EJ1B 2YB7A 1JYWA 2VZVA 3THCA 1GOGA 2VO5A 3WNPA 4W50A 1SDDB 1OT5A 3T2QA 3P6BA 4XUTA 3JXSA 1GQPA 4TXWA 1K12A 3OG2A 1UXXX 1UWWA 4XUQA 1UYZA 2WUHA 1UY4A 4YPJA 1US3A 3SEEA 3FN9A 3MV11 5C70A 2XHNA 2QQOA 2XOMA 2QQKA 3FL7A 1W0NA 5A1AA 1WKYA 2WAOA 4DEVA 1JU4A 4FI9A 4LHSA 1TG7A 1H6XA 3WF1A 5LCWL 3HEIA 4CU7A 2VL4A 1GOFA 3C7FA 1JYXA 1W99A 1PMHX 2VQTA 2J1AA 2B9VA 1HN1A 2BGPA 4OYUA 3NNGA 3E1F1 2Y6HA 1UY1A 1J84A 4PQQA 3I2FA 2LW8A 4DXTA 2WAAA 2WO3A 2LS6A 3A7QA 2VJXA 3VD5A 4P02B 2W1SA 3LE0A 2ORZA 3IB3A 3I2KA 1GNYA 4BJ0A 4UI9L 2VC9A 4RYDA 1H6YA 2YC2A 4M4PA 2CDOA 1F4HA 2PQSA 2J1VA 4CUBA 1YQ2A 2VZUA 2ZEZA 4JHZA 1L7RA 2Y64A 2Y6KA 2QBXA 3OEAA 4GWJA 3T2PA 1PX3A 4UAPA 3VD9A 2VCAA 2WDBA 3WNLA 2QQLA 2J22A 2Y6LA 2WZEA 3IDAA 3CZJA 1J83A 2XONA 3VDAA 4QX1A 3OGRA 2DCKA 4ARXA 1ULOA 4D8MA 4LPLA 3BGAA 3MO4A 5JMOA 1CX1A 1JZ5A 3PUIA 3SKVA 4QPWA 4W4ZA 2VZ1A 1JU3A 1L7QA 4QB2A 1LNSA 1GUIA 2C4XA 4A3ZA 3SEPA 3BN6A 3CQOA 4QX2A 5JXGA 1OD3A 3GGLA 1JYNA 4JKKA 1GU3A 3T08A 3I97A 4D0QA 2EICA 4P00B 4AG4A 3I2HA 1UZ0A 3IIIA 3NRUA 1F4AA 3SKJE 4GWIA 1I5PA 2JE8A 4HG6B 1NKGA 3GDBA 2OKXA 2VMDA 2VTFA 3A23A 3K46A 3LEIA 2V72A 4CUAA 3GXUA 2C9KA 1XPWA 1SHWB 3I2IA 2WO1A 1JI6A 1UY3A 1CIYA 4MADA 2J7MA 3F2ZA 1UY0A 3UESA 5DMYA 2BERA 2EIDA 1UXZA 2RJ2A 2W1QA 4DXSA 3K4DA 2VZRA 1PX4A 3MUZ1 1NX9A 4LQRA 2B4KA 2ZXQA 3I3BA 5LA2A 1CZVA 4QB6A 5DPNA 2J1TA 3PUHA 1DLCA 4XZUG 2WZ8A 1MPXA 2W95A 3ACGA 1UY2A 2W46A 4P5YA 3UETA 3T0AA 2JDAA 2W91A 5EJZB 5JXIA 1JZ4A 3ACIA 2VZOA 4OUEA 4DEQA 3HNBM 3ABZA 2VMEA 3OEBA 1JZ7A 5CZKA 1D7PM 2W94A 3T2OA 3LPFA 2VZTA 1OF3A 1KGYA 4MGQA 2Y8KA 2J1EA 2QQJA 2W47A 3DYPA 2HYXA 3HPNA 4QX3A 4CU8A 1O8SA 1T2XA 4W8JA 1NUKA 2VCCA 3A22A 4KWUA 3WNOA 4AAXA 3I2GA 3D3AA 4L0PA 1BHGA 2YG0A 2JD9A 3WNNA 3K4ZA 3IAPA 3IAQA 4XVHA 1RYYA 3CMGA 3EYPA 3FHQA 5B4NA 1JZ6A 5IFTA 3W5NA 2X10A 3LQCA 4PF1A 4XUPA 4IUGA 4DUWA 3VD3A 4BK4A 3MUY1 4MO3M 2VCBA 3OB8A 3HJRA 3K77A 1O8PA 1R64A 3DECA 1O59A 2ZEYA 3CZUA 2W5FA 2VOTA 3CIHA 3I2JA 3P1IA 2QQNA 3T0BA 3HNYM 4JKMA 2X05A 3WSOA 1P8JA 3U37A 2ZEXA 2VM9A 2VZPA 4OMCA 3WNKA 5F7UA 4JKLA 1UMHA 4UOJA 4OMDA 3K4AA 2ID4A 4ZXEA 1GMMA 3C7EA 3ECQA 4XUNA 2BGOA 2W87A 5IJRA 5JR2A 3VD4A 1TVGA 4QDQA 3HOBA 5C71A 2ZEWA 4RN5A 3ACFA 1K3IA 1JHJA 3FHAA 4OZOA 4M4RA 5CYYA 3WF0A 2W3JA 5J1XA 3MBWA 1UYXA 3WQBA 2WQ8A 5HPOA 5I0DA 1XNAA 3NJVA 3J7HA 3GM8A 4A4AA 3NJXA 2BBAA 2WN3A 5IYYA 4A6OA 2L9LA 2W1WA 5G05L 2YFZA 1W9TA 1XNTA 1W9WA 2J1RA 2QQIA 4JX0A 3K75B 4ZY9A 2DCJA 2R7EB 2RVAA 2YC4A 2HLEA 2WABA 1W8OA 2YFUA 4E8DA 2VQUA 2Z4FA 1DYOA 4KMQA 2WYSA 5JXJA 5HXMA 5G04L 2EIBA 3OBAA 2QQMA 4MGSA 1K45A 2W1UA 2J1SA 2VR4A 1JZ8A 3CDZB 3OGVA 3WF2A 1UMIA 3I3EA 4BDVB 2WO2A 4KI5M 3ZM8A 1DP0A 4QDRA 1IQDC 2J1UA 4QB1A 2W9XA 1WCQA 4DXRA 2ORXA 5FUIA 4XURA 3WF3A 1US2A 3WNMA 2E31A 3OGSA 1K42A 1JYVA 2RV9A 5EIYB 2VMFA 3WEZA 2WN2A 4A42A 1W8NA 2XQXA 1CZSA 3C7HA 2WBKA 4A44A 4ARYA 1EUTA 4QAWA 3C8XA 4A45A 4PT6A 1ULPA 1NAEA 4ZZ5A 4CUCA 3AC0A 4A41A 1EUUA 3UNPA 3HNMA 3VD7A 5LA1A 4ET7A 3C7GA 3VDCA 5LA0A 2V4VA 2VMCA 3W5MA 5DQ0A 2DDUA 5IFPA 3ACHA 3DYMA 4CU6A 2E26A 2KD7A 2E33A 2VZQA 4MOAA 4P08A 4E8CA 4CVUA 4DUVA 4DUXA 3CKHA 3HN3A 2Y6JA 1XC6A 2VZ3A 2C26A 2W92A 4LKSA 2E32A 4CU9A 4ZZ8A 4QDSA 1OF4A 4XUOA 5JXHA 3WF4A 3T0DA 3A21A 1JZ3A 3NQHA 5C7GA 4Z2AA 3VDBA 1PMJX 1SG3A 1JZ2A 3T09A 4GZ9A 2VZSA 2Y6GA 2BZDA 2EIEA 4TTGA 1GOHA 1CZTA 1UX7A 3MV01 3EB7A 5DN2A 2JKXA 3LEGA 3THDA 2CDPA 2X09A 1W9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXS V;  1KEX A;  2V5D A;  3I3D A;  3LEK A;  4BK5 A;  5B4X A;  3C7O A;  5JUV A;  1OH4 A;  3ETP A;  1UYY A;  3LPG A;  4QX0 A;  5IHR A;  3DYO A;  5EJ1 B;  2YB7 A;  1JYW A;  2VZV A;  3THC A;  1GOG A;  2VO5 A;  3WNP A;  4W50 A;  1SDD B;  1OT5 A;  3T2Q A;  3P6B A;  4XUT A;  3JXS A;  1GQP A;  4TXW A;  1K12 A;  3OG2 A;  1UXX X;  1UWW A;  4XUQ A;  1UYZ A;  2WUH A;  1UY4 A;  4YPJ A;  1US3 A;  3SEE A;  3FN9 A;  3MV1 1;  5C70 A;  2XHN A;  2QQO A;  2XOM A;  2QQK A;  3FL7 A;  1W0N A;  5A1A A;  1WKY A;  2WAO A;  4DEV A;  1JU4 A;  4FI9 A;  4LHS A;  1TG7 A;  1H6X A;  3WF1 A;  5LCW L;  3HEI A;  4CU7 A;  2VL4 A;  1GOF A;  3C7F A;  1JYX A;  1W99 A;  1PMH X;  2VQT A;  2J1A A;  2B9V A;  1HN1 A;  2BGP A;  4OYU A;  3NNG A;  3E1F 1;  2Y6H A;  1UY1 A;  1J84 A;  4PQQ A;  3I2F A;  2LW8 A;  4DXT A;  2WAA A;  2WO3 A;  2LS6 A;  3A7Q A;  2VJX A;  3VD5 A;  4P02 B;  2W1S A;  3LE0 A;  2ORZ A;  3IB3 A;  3I2K A;  1GNY A;  4BJ0 A;  4UI9 L;  2VC9 A;  4RYD A;  1H6Y A;  2YC2 A;  4M4P A;  2CDO A;  1F4H A;  2PQS A;  2J1V A;  4CUB A;  1YQ2 A;  2VZU A;  2ZEZ A;  4JHZ A;  1L7R A;  2Y64 A;  2Y6K A;  2QBX A;  3OEA A;  4GWJ A;  3T2P A;  1PX3 A;  4UAP A;  3VD9 A;  2VCA A;  2WDB A;  3WNL A;  2QQL A;  2J22 A;  2Y6L A;  2WZE A;  3IDA A;  3CZJ A;  1J83 A;  2XON A;  3VDA A;  4QX1 A;  3OGR A;  2DCK A;  4ARX A;  1ULO A;  4D8M A;  4LPL A;  3BGA A;  3MO4 A;  5JMO A;  1CX1 A;  1JZ5 A;  3PUI A;  3SKV A;  4QPW A;  4W4Z A;  2VZ1 A;  1JU3 A;  1L7Q A;  4QB2 A;  1LNS A;  1GUI A;  2C4X A;  4A3Z A;  3SEP A;  3BN6 A;  3CQO A;  4QX2 A;  5JXG A;  1OD3 A;  3GGL A;  1JYN A;  4JKK A;  1GU3 A;  3T08 A;  3I97 A;  4D0Q A;  2EIC A;  4P00 B;  4AG4 A;  3I2H A;  1UZ0 A;  3III A;  3NRU A;  1F4A A;  3SKJ E;  4GWI A;  1I5P A;  2JE8 A;  4HG6 B;  1NKG A;  3GDB A;  2OKX A;  2VMD A;  2VTF A;  3A23 A;  3K46 A;  3LEI A;  2V72 A;  4CUA A;  3GXU A;  2C9K A;  1XPW A;  1SHW B;  3I2I A;  2WO1 A;  1JI6 A;  1UY3 A;  1CIY A;  4MAD A;  2J7M A;  3F2Z A;  1UY0 A;  3UES A;  5DMY A;  2BER A;  2EID A;  1UXZ A;  2RJ2 A;  2W1Q A;  4DXS A;  3K4D A;  2VZR A;  1PX4 A;  3MUZ 1;  1NX9 A;  4LQR A;  2B4K A;  2ZXQ A;  3I3B A;  5LA2 A;  1CZV A;  4QB6 A;  5DPN A;  2J1T A;  3PUH A;  1DLC A;  4XZU G;  2WZ8 A;  1MPX A;  2W95 A;  3ACG A;  1UY2 A;  2W46 A;  4P5Y A;  3UET A;  3T0A A;  2JDA A;  2W91 A;  5EJZ B;  5JXI A;  1JZ4 A;  3ACI A;  2VZO A;  4OUE A;  4DEQ A;  3HNB M;  3ABZ A;  2VME A;  3OEB A;  1JZ7 A;  5CZK A;  1D7P M;  2W94 A;  3T2O A;  3LPF A;  2VZT A;  1OF3 A;  1KGY A;  4MGQ A;  2Y8K A;  2J1E A;  2QQJ A;  2W47 A;  3DYP A;  2HYX A;  3HPN A;  4QX3 A;  4CU8 A;  1O8S A;  1T2X A;  4W8J A;  1NUK A;  2VCC A;  3A22 A;  4KWU A;  3WNO A;  4AAX A;  3I2G A;  3D3A A;  4L0P A;  1BHG A;  2YG0 A;  2JD9 A;  3WNN A;  3K4Z A;  3IAP A;  3IAQ A;  4XVH A;  1RYY A;  3CMG A;  3EYP A;  3FHQ A;  5B4N A;  1JZ6 A;  5IFT A;  3W5N A;  2X10 A;  3LQC A;  4PF1 A;  4XUP A;  4IUG A;  4DUW A;  3VD3 A;  4BK4 A;  3MUY 1;  4MO3 M;  2VCB A;  3OB8 A;  3HJR A;  3K77 A;  1O8P A;  1R64 A;  3DEC A;  1O59 A;  2ZEY A;  3CZU A;  2W5F A;  2VOT A;  3CIH A;  3I2J A;  3P1I A;  2QQN A;  3T0B A;  3HNY M;  4JKM A;  2X05 A;  3WSO A;  1P8J A;  3U37 A;  2ZEX A;  2VM9 A;  2VZP A;  4OMC A;  3WNK A;  5F7U A;  4JKL A;  1UMH A;  4UOJ A;  4OMD A;  3K4A A;  2ID4 A;  4ZXE A;  1GMM A;  3C7E A;  3ECQ A;  4XUN A;  2BGO A;  2W87 A;  5IJR A;  5JR2 A;  3VD4 A;  1TVG A;  4QDQ A;  3HOB A;  5C71 A;  2ZEW A;  4RN5 A;  3ACF A;  1K3I A;  1JHJ A;  3FHA A;  4OZO A;  4M4R A;  5CYY A;  3WF0 A;  2W3J A;  5J1X A;  3MBW A;  1UYX A;  3WQB A;  2WQ8 A;  5HPO A;  5I0D A;  1XNA A;  3NJV A;  3J7H A;  3GM8 A;  4A4A A;  3NJX A;  2BBA A;  2WN3 A;  5IYY A;  4A6O A;  2L9L A;  2W1W A;  5G05 L;  2YFZ A;  1W9T A;  1XNT A;  1W9W A;  2J1R A;  2QQI A;  4JX0 A;  3K75 B;  4ZY9 A;  2DCJ A;  2R7E B;  2RVA A;  2YC4 A;  2HLE A;  2WAB A;  1W8O A;  2YFU A;  4E8D A;  2VQU A;  2Z4F A;  1DYO A;  4KMQ A;  2WYS A;  5JXJ A;  5HXM A;  5G04 L;  2EIB A;  3OBA A;  2QQM A;  4MGS A;  1K45 A;  2W1U A;  2J1S A;  2VR4 A;  1JZ8 A;  3CDZ B;  3OGV A;  3WF2 A;  1UMI A;  3I3E A;  4BDV B;  2WO2 A;  4KI5 M;  3ZM8 A;  1DP0 A;  4QDR A;  1IQD C;  2J1U A;  4QB1 A;  2W9X A;  1WCQ A;  4DXR A;  2ORX A;  5FUI A;  4XUR A;  3WF3 A;  1US2 A;  3WNM A;  2E31 A;  3OGS A;  1K42 A;  1JYV A;  2RV9 A;  5EIY B;  2VMF A;  3WEZ A;  2WN2 A;  4A42 A;  1W8N A;  2XQX A;  1CZS A;  3C7H A;  2WBK A;  4A44 A;  4ARY A;  1EUT A;  4QAW A;  3C8X A;  4A45 A;  4PT6 A;  1ULP A;  1NAE A;  4ZZ5 A;  4CUC A;  3AC0 A;  4A41 A;  1EUU A;  3UNP A;  3HNM A;  3VD7 A;  5LA1 A;  4ET7 A;  3C7G A;  3VDC A;  5LA0 A;  2V4V A;  2VMC A;  3W5M A;  5DQ0 A;  2DDU A;  5IFP A;  3ACH A;  3DYM A;  4CU6 A;  2E26 A;  2KD7 A;  2E33 A;  2VZQ A;  4MOA A;  4P08 A;  4E8C A;  4CVU A;  4DUV A;  4DUX A;  3CKH A;  3HN3 A;  2Y6J A;  1XC6 A;  2VZ3 A;  2C26 A;  2W92 A;  4LKS A;  2E32 A;  4CU9 A;  4ZZ8 A;  4QDS A;  1OF4 A;  4XUO A;  5JXH A;  3WF4 A;  3T0D A;  3A21 A;  1JZ3 A;  3NQH A;  5C7G A;  4Z2A A;  3VDB A;  1PMJ X;  1SG3 A;  1JZ2 A;  3T09 A;  4GZ9 A;  2VZS A;  2Y6G A;  2BZD A;  2EIE A;  4TTG A;  1GOH A;  1CZT A;  1UX7 A;  3MV0 1;  3EB7 A;  5DN2 A;  2JKX A;  3LEG A;  3THD A;  2CDP A;  2X09 A;  1W9S A; 
#chains in the Genus database with same CATH topology
 5A7P A;  1BK0 A;  4WM8 A;  5A32 B;  4Y26 A;  1RUJ 1;  2V5D A;  1KRI A;  1IG0 A;  3LEK A;  3NMB A;  4K1Y A;  3JD7 2;  5F9T A;  1K5M C;  1W03 A;  4NE9 A;  4QKF A;  1F5J A;  3N4M A;  4A7Z A;  4A7K A;  2JE9 A;  2VMG A;  3ETP A;  1Y3T A;  2D5H A;  1PGW 1;  4QPG A;  1YO8 A;  1UX6 A;  2JG9 C;  1OMI A;  3LPG A;  2WSV A;  4MGY E;  4QX0 A;  5F2S A;  1QY4 A;  4FQZ A;  2D3P A;  4XDQ A;  1WCU A;  3WDW A;  2RJK A;  2YB7 A;  5EJ1 B;  4LO7 A;  5A80 A;  5LEK A;  4P9L A;  1JMU B;  4Y20 A;  3H3L A;  1RUI 2;  1GWM A;  1U5X A;  5LEJ A;  2PMW B;  1GZC A;  1OT5 A;  4MV2 A;  2D6K A;  5FPV A;  4OFG A;  3I59 A;  4XUT A;  3JXS A;  4C91 A;  1GQP A;  1Y7B A;  2YUE A;  1JW6 A;  3N9L A;  3LD8 A;  1RB8 G;  4TXW A;  5D2A A;  1K12 A;  5LK7 B;  1UXX X;  2JXA A;  3W20 A;  4TSV A;  1W8U A;  2BGC A;  5CFC A;  4B4Q A;  5F3C A;  5BNN C;  2ET7 A;  4F7Z A;  2AEZ A;  3NNJ A;  3FMG A;  1SZB A;  1UPI A;  4IGO A;  3NJZ A;  4YPJ A;  3HQU A;  5H9R A;  3SEE A;  5L9B A;  3ATG A;  4OHW A;  2RMU 2;  3BIE A;  1YNA A;  5C3Q A;  1REE A;  5FKC A;  1RTV A;  1W6N A;  4PLN A;  1PVC 3;  1QF3 A;  2E63 A;  4YVW A;  1WCD J;  2RM2 3;  2WT1 A;  2R07 3;  2QQO A;  4YWA A;  4BLI A;  2QQK A;  1GAN A;  2UWC A;  4KNC A;  1VE0 A;  2JB8 A;  2JG9 B;  5LB6 A;  5LZ6 A;  1J59 A;  4HVR A;  2BUK A;  4Q4X 2;  1WMD A;  1TG7 A;  4PLM A;  2E51 A;  1HRI 2;  2VNG A;  3GCW A;  4YSF A;  4CU7 A;  2VL4 A;  1MEC 1;  1YI7 A;  2A6Y A;  3C7F A;  2I07 B;  1JYX A;  2QDR A;  3JQW A;  4LBN A;  1AR6 1;  5L7O B;  1DU3 D;  2B9V A;  1KJL A;  2BGP A;  4OYU A;  4IGP A;  5FZM A;  1L3J A;  3C3V A;  4Q4X 1;  4FAH A;  2IUW A;  3TN9 2;  4K1Z A;  1XYO A;  4YW3 A;  1ULF A;  4PQQ A;  2LW8 A;  1CAX A;  1RUG 3;  1LHO A;  2XKP A;  3A7Q A;  3LAG A;  2ZGR A;  4PBP A;  5F8P A;  3IPV B;  4P9X A;  3AX4 A;  3T4V A;  5BNP A;  5HBA A;  5FY8 A;  4IV1 A;  2W1S A;  1OSG A;  4EN8 B;  2WNE A;  4C1W A;  4CSW A;  1H9W A;  3ZYR A;  5JMC A;  3I2K A;  1YFU A;  3RZJ A;  3WP3 A;  4CDQ A;  4GD4 A;  4XAB A;  2GC1 A;  4FP2 A;  5AVA A;  4N7I A;  2YC2 A;  2Q1Z B;  2CDO A;  1F4H A;  2EXK A;  5FCC A;  1NCR B;  1EYB A;  3KCY A;  4HET A;  2RDS A;  5DG1 A;  4YAR A;  2VTX J;  1F35 A;  1YC6 1;  1E5S A;  1L7R A;  2W52 A;  1T6G C;  2VOV A;  2XR4 A;  5FZ8 A;  5LBF A;  1R1Z A;  2JIJ A;  3U78 A;  3VD9 A;  1ZNP A;  2VCA A;  3MIF A;  1Q3E A;  1DZQ A;  4XXA A;  5A3N A;  5I0S A;  2RE9 A;  4R9B A;  1VBD 2;  2A1X A;  2QQL A;  1JOJ A;  5AC9 1;  5GZE A;  5BNO B;  4CUG A;  2DBN A;  1J83 A;  2GN3 A;  4LUM A;  2XON A;  1Q8P A;  4NWV A;  5FZ6 A;  2P34 A;  3OGR A;  2DCK A;  3T1L A;  3VDA A;  1ULO A;  4D8M A;  1PGS A;  2ENR A;  2NMN A;  2R1B A;  1FNY A;  4MVT A;  4Q0P A;  4TZD A;  4RD7 A;  2YXS A;  2D3S A;  3B3Q E;  4TN7 A;  3HQR A;  5FWJ A;  4IW3 A;  4DO0 A;  3RDI A;  2E7A A;  3ZIW A;  1XOY A;  2Q5T A;  2P1B A;  3H1W A;  3CQO A;  2GNB A;  4YZ2 A;  3NO8 A;  2DCZ A;  4R4X A;  4OZX A;  5JXG A;  4JKK A;  2ATF A;  4BA6 A;  4C0H A;  3AKR A;  5FK8 A;  3W59 A;  5DUX A;  4D94 A;  2K2S A;  4SLI A;  2EIC A;  4P00 B;  4O7X A;  3AXE A;  3VHP A;  2Z5W A;  3AKP A;  5BNP C;  1PGL 1;  2ZZQ A;  1UZ0 A;  3GF6 A;  1AL0 G;  3NRU A;  1IPK A;  4UYB A;  1ZVF A;  3ZYH A;  4FPF A;  1F4A A;  3HT1 A;  2JE8 A;  1VBA 3;  1TQ5 A;  4AHW A;  1Y9M A;  1NKG A;  3OPZ A;  4DIQ A;  3RFR A;  1NZI A;  4YW5 A;  4B7E A;  2WFF 3;  4Q4V 1;  2VTF A;  3TNP B;  5DUW A;  1OLR A;  3HVD A;  3D6E A;  3K46 A;  4ISR A;  2V72 A;  3GHN A;  4LKF A;  4B1L A;  3SH3 A;  1N1V A;  2WR9 A;  1XPW A;  5BNO A;  2ILM A;  2R07 1;  5JOW A;  3ZFE B;  3I2I A;  4YNI A;  1DLL A;  2WO1 A;  4MSV A;  1JI6 A;  1CIY A;  4HPK B;  1E5R A;  5GZC A;  2ZGQ A;  3FC0 A;  2J7M A;  3RG0 A;  1TZO A;  3T4H B;  2HWD 3;  1IQA A;  1NG0 A;  2EID A;  5C3P A;  4DXS A;  3EBR A;  5DMY A;  1OD5 A;  3K4D A;  5JIA A;  2IC1 A;  4GB3 1;  3B00 A;  5EJ3 A;  2LM3 A;  4LQR A;  5A7N A;  5A3T A;  4K20 A;  4IV3 A;  4PLO A;  4CCM A;  3W58 A;  2BNN A;  4N43 A;  1YQC A;  3KT1 A;  3POW A;  2MEV 2;  1CPM A;  2XJU A;  3I59 B;  1BYH A;  1VBB 3;  3SIS A;  1VAL A;  3GZA A;  2WZ8 A;  4ASK A;  1MPX A;  1R1A 1;  4NAM A;  5FMO S;  5C4W C;  1WW6 A;  1CGP A;  3MIB A;  4XJ9 A;  3VDD B;  1VPH A;  4AOC A;  4H3W A;  1W6P A;  1RJ8 A;  5JXI A;  1AXY A;  3KSC A;  3ACI A;  4QX8 A;  3WG3 A;  1R1A 3;  2VZO A;  2G1M A;  1EAH 1;  5F32 A;  4XF3 A;  1AR8 2;  2D6P A;  4Y1V A;  4AI8 A;  3CF6 E;  5FZE A;  5CG8 A;  5L9V A;  2P4E A;  4COV A;  1EAH 3;  2RG4 A;  3OYW B;  1H8T B;  2R32 A;  3UGF A;  2B8M A;  1JYT A;  2RS3 1;  1ZA7 A;  4IEV A;  1JHN A;  2KA3 A;  1QJY 1;  3AZX A;  1OFS A;  4PIX A;  1VBC 2;  1ZBE 1;  2J1E A;  5FY1 A;  2QQJ A;  4WV8 A;  4UW3 A;  2DVB A;  5I93 A;  3HPN A;  1MEC 3;  1NYW A;  4QXB A;  3AP5 A;  4CU8 A;  1X82 A;  1O8S A;  4NHY A;  4IEW A;  1L7L A;  1J3Q A;  1ODM A;  4R9C A;  1FPN 1;  1LES A;  4ZPI A;  3SHR A;  1KDK A;  2ZGN A;  4AXO A;  3CLP A;  4LUK A;  3LF7 A;  2Q8C A;  3D3A A;  4JAA A;  2QTW B;  3J7M A;  1BHG A;  2D40 A;  2YG0 A;  2JD9 A;  3AP9 A;  2D7F A;  4LLF A;  4AHZ A;  1UU4 A;  1C4R A;  1ONA A;  1OBN A;  4AHX A;  1RYY A;  4C8D A;  2Q4S A;  3N9M A;  3FHQ A;  4LA2 A;  3WHT A;  4R8H A;  2UYB A;  4HOO A;  2WA4 A;  1UCX A;  2X10 A;  3GJA A;  5HCH A;  3LEM A;  4FOV A;  2RS3 2;  1XJA A;  5FO7 B;  2WRA A;  4OHV A;  4H7L A;  4BQ5 A;  3OY8 A;  2BW8 A;  1O7F A;  1PHM A;  4R4Z A;  2D43 A;  1ZYB A;  1YXW A;  1O3S A;  2D6N A;  4WM7 A;  1Y9G A;  4Y5Z 0;  2VCB A;  2ZMN A;  4QKB A;  4B29 A;  1ND2 A;  3AKT A;  3OB8 A;  5FMC A;  5FPA A;  3I2D A;  2RS1 1;  3BOD A;  2XDV A;  3I3M A;  2GU9 A;  3WQ0 A;  2GMM A;  1J1T A;  4KWK A;  1H1M A;  4QM8 A;  2W5F A;  2PHL A;  5A3P A;  2VOT A;  3CIH A;  3C2U A;  5EYX A;  3WW3 A;  2AUY A;  3DKW A;  3HNY M;  4LO4 B;  1DQ1 A;  1O4Y A;  3PME A;  2UY9 A;  2X05 A;  5DAQ A;  4XIL A;  1GBG A;  3U37 A;  4QPG B;  4LEJ A;  1FT9 A;  4XBQ A;  1SLB A;  4YM3 A;  4FFI A;  1AZD A;  1NT0 A;  3WNK A;  4HK8 A;  2Q8O A;  1UMH A;  4UOJ A;  1Z7S 3;  2R6Q A;  1HRV 2;  1NA1 C;  3BOW A;  4ES8 A;  3V0B A;  3K4A A;  4CDW A;  1C8N A;  5LK5 A;  4NII A;  4LUL A;  4L9B A;  1GMM A;  1RUE 3;  1V0A A;  3ECQ A;  4HON A;  2W87 A;  5FPX A;  1D0H A;  3WW2 A;  4LIT A;  3ROU A;  4QHZ A;  2LRO A;  4EZ4 A;  4RN5 A;  3JD7 3;  4RGK A;  1UZY A;  2YGM A;  1JHJ A;  4XDO A;  3FHA A;  4RGA A;  4WM7 B;  1KFX L;  4N53 B;  4JHT A;  2W3J A;  3AZW A;  3KMH A;  3WW4 A;  3OBZ A;  2R06 2;  2ZX3 A;  1UIJ A;  3U0Z A;  3Q8B A;  2Q0A A;  1M06 G;  4FXK B;  1IS6 A;  1HRI 1;  2X53 S;  2HWF 3;  1QH7 A;  4OUM A;  4S2D A;  5BNN A;  1IZ3 A;  5FZL A;  5A6Q A;  2CHH A;  4Q1P A;  1QJY 3;  1CN1 A;  1TEI A;  4WVM B;  5C8C A;  3J7H A;  3KZ4 C;  1AXZ A;  4B3N A;  1RHI 3;  3PTR B;  1A8M A;  5FMB A;  1XB9 A;  2XLF A;  1B35 B;  3VBH A;  4EV0 A;  3VHO A;  4Q4Y 2;  3J7N A;  5KXE A;  2ARA A;  2D6L X;  1IS3 A;  1FPN 3;  2WL1 A;  3MF9 A;  1S0B A;  2YFZ A;  1W9T A;  1BBT 3;  1W9W A;  3VZJ A;  3ZXA C;  2O8Q A;  1UNB A;  2FDJ A;  2QNK A;  3N7L A;  4HN1 A;  4Y1X A;  1WA6 X;  4ZY9 A;  2YGL A;  1DF0 A;  3OF1 A;  1H8V A;  2HBT A;  3PU3 A;  4LHK A;  3ZLI A;  3ZYB A;  3NNM A;  4M0N A;  1TNR A;  4X6R B;  3V56 A;  4CDW B;  1QXJ A;  3VBR A;  2CSG A;  1C8M 1;  1VAK A;  2MEV 1;  2AAC A;  2ZJC A;  1RUD 2;  4KMQ A;  4I09 A;  4IV3 C;  4FOW A;  2SLI A;  3GNE A;  5IAT A;  5ISL A;  5G04 L;  2OQ6 A;  4HBN A;  2JWP A;  4RHV 1;  4NID A;  3KF3 A;  3VUO A;  1O3T A;  1LEC A;  2YU2 A;  3OBA A;  4Q4X 3;  2YYO A;  4MGS A;  1K45 A;  2VOW A;  4FPO B;  2W1U A;  2VR4 A;  2Y33 A;  3ZFE C;  3RZM A;  1RIN A;  3I3E A;  4YW2 A;  4XFB A;  1W2U A;  4XJU A;  1UZV A;  1SBD A;  1DP0 A;  2NZ9 A;  5LY2 A;  1IQD C;  1W8Z A;  1HV1 A;  5EXO A;  2J1U A;  1M4W A;  1FYU A;  2Y38 A;  3JBG 1;  1H4G A;  4RQP B;  5FBJ A;  1EPW A;  1AJO A;  1WCQ A;  2FBE A;  5EHD A;  2ORX A;  2F17 A;  4D69 A;  4CPB D;  1VBB 1;  2TBV A;  4LOT A;  4XUR A;  4AVS A;  3WF3 A;  5KC5 A;  1WD4 A;  1NXD 1;  2WS9 1;  3ZSJ A;  1PK6 A;  3ZR6 A;  5AC9 2;  3GJB A;  2ADE A;  3OGS A;  1O4T A;  1UIK A;  3M4F A;  2BVV A;  3OUH A;  5FP4 A;  2PAK A;  2RV9 A;  2VMF A;  3J26 N;  1WA4 A;  4Y33 A;  3NKT A;  4FFH A;  1CX4 A;  1RJ7 A;  1PO1 2;  4YYO A;  5A33 A;  5IVY A;  1W8N A;  4KBB A;  2XQX A;  4CCC A;  2WBK A;  2XVL A;  3LGR A;  5JSP A;  3S5A A;  5BUV A;  1YI9 A;  4ZXK A;  3E97 A;  1CD3 G;  1DBN A;  4A45 A;  1PO2 2;  4KL1 A;  1R08 1;  2OYZ A;  4Q5O A;  1RUD 3;  1S0J A;  3NV3 A;  1MZE A;  2ZX0 A;  1J1L A;  3ZYP A;  4RS5 A;  1CAW B;  1QEX A;  1A78 A;  2BNM A;  2C9A A;  3H42 B;  4CXW A;  4E4S A;  1BVV A;  5J96 B;  4ET7 A;  3THT A;  1OOP B;  1XRU A;  1VRH 1;  3C7G A;  2BOJ A;  3H50 A;  5DG2 A;  1VBA 1;  3WD5 A;  4AZZ A;  3MEP A;  1J3P A;  5E88 A;  1ASJ 1;  2ARX A;  2DTW A;  4COY A;  3N9P A;  4Y1Y A;  4MX3 A;  4AWD A;  2MPF A;  5EYY A;  2DVA A;  4BE3 A;  5I0R A;  2VMC A;  4YGE A;  1VRH 2;  3N9Q A;  5LY1 A;  3BCW A;  1G9F A;  3LFM A;  5IVV A;  4Z1V A;  2DUQ A;  1HB1 A;  1QXR A;  1W2N A;  2XBO 3;  2KD7 A;  2E33 A;  2QZ2 A;  4NRQ A;  2EAK A;  4NIG A;  4FFF A;  3JCI A;  4DUV A;  1PK6 C;  1ZZC A;  5GLT A;  2MEV 3;  3DGT A;  4XFC A;  2GNM A;  2Y6J A;  5J37 A;  2W92 A;  5AC9 3;  4CCO A;  2E32 A;  2D6O X;  3K3O A;  5JZG C;  3I2O A;  4ZZ8 A;  1VBE 3;  4CXY A;  4QDS A;  1VP6 A;  2LRP A;  2QKD A;  1S0D A;  2VW2 A;  4AR2 A;  3WF4 A;  1LUL A;  4AEJ A;  2DCT A;  4Q4Y 1;  3H7Y A;  3N36 A;  1BBT 1;  3NQH A;  1DGR A;  3PJY A;  3VBO B;  4Z2A A;  5CIS A;  3VDB A;  4Y1U A;  3ZFE A;  2FZ2 A;  3ZIX A;  5A7S A;  4KG0 A;  1VLN A;  2WWU A;  3A4U A;  5FLJ A;  3OPW A;  3VHN A;  1MS3 A;  3CU7 A;  2WNU C;  3VZL A;  2QUO A;  4XJA A;  2B7Y A;  1RHI 1;  2RS5 2;  4K40 A;  2EIE A;  4DRR A;  1SBF A;  3KV6 A;  3AFK A;  5FZK A;  3PUQ A;  2PLV 2;  4GAL A;  3VBF A;  3ZXG A;  4AED C;  5C5T A;  2A6W A;  5FDB A;  4CEW C;  3EB7 A;  1SQ4 A;  2WNV C;  1S1A A;  4XTP A;  4XMI A;  5C6C A;  1LOG A;  3O1S A;  2DU1 A;  3RYK A;  2XHK A;  5JI9 A;  4COW A;  1W9S A;  4HMZ A;  5DDJ 2;  2WC2 A;  5CBL A;  1ENS A;  4N53 C;  1LKN A;  1R09 3;  1KEX A;  3RQ0 A;  3DV8 A;  2WNV A;  5FXV A;  1G9C A;  2FDH A;  3JD7 1;  1POV 1;  3C7O A;  1QWR A;  2RDR A;  4QHO A;  2ZAH A;  2C0Z A;  1REF A;  1BEV 2;  1CJP A;  4W6W A;  4FO9 A;  2BTV C;  1W9Y A;  1C8M 2;  2GSY A;  4NRM A;  5FYI A;  3ZN4 A;  3MIG A;  4QXC A;  3EXU A;  4CEY A;  4DQA A;  2R0H A;  5LWB A;  4QQL A;  2OT7 A;  3AJY A;  2B46 X;  4Q0V A;  4OQ9 A;  1QOO A;  1AL2 1;  4JGZ C;  1WUV A;  4IV3 B;  1GOG A;  4XFF A;  5DAV A;  3WNP A;  3AZV A;  2NQY A;  5FZG A;  3M8L A;  1SDD B;  5HCB A;  5A3U A;  3DPR B;  4CEW A;  3BTY A;  5FYU A;  3T2Q A;  2JDY A;  3HN1 A;  5DXD A;  2YBK A;  5A1F A;  4YVW C;  3AMQ A;  2VPV A;  5DUU A;  3ZMN A;  4Q8K A;  3VBS B;  1MR5 A;  4CTE A;  3OG2 A;  1OOP C;  2AYH A;  4LNV A;  4YW6 A;  4QQO A;  5IVB A;  1SFN A;  4XUQ A;  1HQN A;  2EAA A;  4WBB A;  2O8O A;  1UY4 A;  2X5I B;  3R05 A;  2RS5 3;  2LUW A;  4JV4 A;  4BIO A;  5IVF A;  4A7Y A;  5A7W B;  4QD2 A;  2E7Q A;  1JYC A;  1YJL A;  3MV1 1;  5C70 A;  4OLL A;  4KU8 A;  5C8C C;  4FT8 A;  5C9A B;  3LDB A;  3ZR5 A;  4AW7 A;  2ZGU A;  4O9E A;  4AVA A;  5A1A A;  1EAH 2;  2I74 A;  3WUC A;  3O1O A;  4HN0 A;  1UPS A;  3L9J T;  4FI9 A;  4XIO A;  3WF1 A;  5BXX A;  4M3C B;  1WGP A;  3WCR A;  1G86 A;  2YU1 A;  1AVB A;  3VZO A;  4XFH A;  1PIV 2;  3GAL A;  4G3Y C;  1PMH X;  4CEY B;  5AFB A;  5FZB A;  3OGG A;  4X6Q B;  4Q8L A;  3DEM A;  2JDM A;  4BB3 A;  3ZN6 A;  1QQP 1;  1UN1 A;  2BYV E;  1BEV 1;  2AC1 A;  3MW3 A;  4AI9 A;  1XYP A;  2FDK A;  2JG8 A;  2HEW F;  1J84 A;  4DXT A;  1TNF A;  4QXK A;  3WG1 A;  3SC7 X;  3SNM A;  2BV4 A;  4O61 A;  2VJX A;  2R04 2;  3JU9 A;  5FYB A;  3POF A;  5FZ7 A;  2BFU S;  4E27 A;  1AHS A;  2Y0I A;  4FTB A;  3LE0 A;  2X5I A;  2AGS A;  4UFH A;  5FZ9 A;  3ALQ A;  2WZR 2;  3M70 A;  1VR3 A;  4AAP A;  3Q9O A;  4MG2 A;  3ZSM A;  3TYJ A;  2VC9 A;  2R49 A;  5D21 A;  1OLM E;  1RHI 2;  2G9G A;  1FNZ A;  5C9A A;  4M4P A;  2PQS A;  4Y24 A;  1NA1 B;  3FE5 A;  2NPI A;  2VZU A;  1RUJ 3;  3LOI A;  4FQ4 A;  3FFQ A;  4I3G A;  3TEZ A;  2ZEZ A;  3MW2 A;  1Z78 A;  3AZY A;  4QX7 A;  2D98 A;  1ND2 C;  2ARB A;  2Y64 A;  1BBT 2;  2QCS B;  2JKB A;  1QXP A;  1RL3 A;  1U5I A;  2QBX A;  3TNQ A;  3OEA A;  1AJK A;  3USU B;  4LHL A;  2EAL A;  3NJY A;  3MFA A;  3T2P A;  2WLQ A;  2VUC A;  4JRA A;  4LBQ D;  1PGL 2;  5FYM A;  3L2Y A;  2ZA9 A;  2B9U A;  4I0W B;  3WNL A;  4Y3O A;  5JCT A;  4KWJ A;  2J22 A;  2DV9 A;  1ULD A;  3B94 A;  3VDD C;  4J6G A;  3EQE A;  1RUC 1;  3M3I A;  4KWL A;  5GLW A;  2XPJ A;  3PIG A;  1GLH A;  1DIW A;  4ARX A;  4HVO A;  4JDN A;  1BK1 A;  2PHW A;  3H3Z A;  4LPL A;  3V0B B;  1UD1 A;  5BNN B;  1N3O A;  3FLR A;  3I4I A;  5FP3 A;  1JZ5 A;  1I3H A;  1AL2 2;  3HR9 A;  5L73 A;  1CAX B;  1LOE A;  4P14 A;  4COU A;  3PUI A;  2UU8 A;  1S2K A;  3PL0 A;  4QHB A;  4QPW A;  1BLZ A;  1MS4 A;  2A73 B;  4W4Z A;  1RVF 1;  4QB2 A;  4Q4W 2;  2C4X A;  4K7J A;  4NIH A;  3SEP A;  1DZR A;  1YEW A;  4XBN A;  4IND A;  1DGW A;  1JYN A;  1MS5 A;  1KQR A;  3T08 A;  4Q4V 3;  3I97 A;  5KWR A;  4AQ6 A;  5FPU A;  4HSJ A;  4IEX A;  3FBM A;  4AG4 A;  1APN A;  3NV2 A;  1D4M 1;  3I2H A;  2P37 A;  2WFF 1;  3III A;  4UT5 A;  3VKF C;  1LED A;  2C5D A;  3G6J B;  3OBR A;  2EXJ A;  3BI3 A;  2RMU 1;  1LHW A;  1QGL A;  4ATE A;  1AR9 2;  4GWI A;  1I5P A;  2PLV 1;  3D4K A;  4HG6 B;  4AGG A;  2YPJ A;  4BYY A;  3LZZ A;  5FY7 A;  1WMX A;  1QJF A;  1ZX5 A;  1UZW A;  2OKX A;  1RIR A;  2VMD A;  3I7D A;  2QQW A;  1QOT A;  1RUF 3;  2VW0 A;  3A23 A;  4H2A A;  2GP3 A;  4WVZ A;  3LEI A;  4WVW A;  4XMA A;  1VAM A;  2IZW A;  4B4R A;  2P3Y A;  4CUA A;  3R4U A;  3ASI A;  3GXU A;  4GKX A;  1RUH 2;  1LHN A;  2UWA A;  3U75 A;  1ZRC A;  1H8T C;  1UY3 A;  3H7J A;  2F6B A;  5L9R A;  3TAY A;  3WV6 A;  1CQ9 A;  2Y0O A;  1LJ7 A;  4DOU A;  5FFO C;  2DVG A;  2NP0 A;  1YFY A;  2C24 A;  3CHX A;  1AL2 3;  1UXZ A;  2W1Q A;  3S30 A;  1HN0 A;  4QXH A;  5CNA A;  1UL9 A;  1FV3 A;  4RSU A;  2O14 A;  4NHK A;  1NXM A;  2XG3 A;  2CGP A;  2H0B A;  2A7A A;  1H1I A;  2OS2 A;  1O5U A;  2B4K A;  4RHV 3;  1CZV A;  5FXX A;  1RIT A;  2J1T A;  3PUH A;  3ZXJ A;  5CFC B;  1JS9 A;  3D5O A;  2K0G A;  1NE6 A;  4LMF A;  3ELN A;  2GDF A;  4ONU A;  2VNO A;  2W39 A;  2XUE A;  1UY2 A;  5FZC A;  1QH6 A;  2FHR A;  2W46 A;  3S5Q A;  3UET A;  4L8Q A;  4NOT A;  1FAY A;  4BQ3 A;  2A75 A;  4HLT A;  2ZX2 A;  4ZKT B;  5BNO C;  2HWC 1;  1EY2 A;  1H4H A;  1HJG A;  1PO1 1;  1WW5 A;  4NN0 A;  4RS5 C;  1ZRD A;  5FZH A;  1JZ4 A;  4DEQ A;  1MQT A;  1GZW A;  4Q29 A;  3ZFG B;  1CAW A;  1YIP A;  1POV 3;  4M00 A;  3Q8F A;  3WT3 A;  1GNZ A;  3GZU C;  3PLQ A;  1LCL A;  5CZK A;  1LOC A;  2VNV A;  1H1A A;  2BJS A;  5FPB A;  1CES A;  3GCX A;  4BOW A;  4CP9 B;  1F31 A;  2VZT A;  5T3N A;  1KGY A;  3TRS B;  2YPD A;  3WX5 A;  2Y8K A;  1X9T A;  3KGL A;  4Y22 B;  2PHX A;  2HYX A;  3DYP A;  3KGZ A;  3PDQ A;  1QJU 3;  4LO8 A;  5L19 A;  3ES1 A;  3ZYJ B;  1HQL A;  4KG8 A;  4W8J A;  1N1S A;  4C0B A;  1PO2 3;  2VCC A;  3ZSK A;  3ILF A;  1MZF A;  1W0P A;  3K3N A;  4XIK A;  3KLS A;  4KWU A;  3ST7 A;  2P5B A;  1IKP A;  2OQ7 A;  3HBK A;  4AAX A;  1V00 A;  4FVV A;  3D82 A;  4K8F A;  5LRR A;  5BNP B;  1PNG A;  3ZYF A;  1MS9 A;  5C4W B;  3K4Z A;  1IGO A;  3IAQ A;  4S2F A;  3N7K A;  3DCQ A;  3IMM A;  3H8R A;  4QMA A;  1N47 A;  3ZOI A;  4AEM A;  4YZ1 A;  5FY5 A;  5A1L A;  1KFU L;  3DXT A;  3QOP A;  4NR1 A;  1BQP A;  2JDU A;  3ZKY A;  5FR3 A;  2Y6F A;  5ANQ A;  1FV2 A;  4XUP A;  1N1Y A;  3JZV A;  1KDM A;  2PN5 A;  5DAB A;  4JCK A;  5JWP A;  1OVP A;  4YG3 A;  4BK4 A;  3RI8 A;  5JPN B;  4JTO A;  1GYK A;  2WII B;  2X29 A;  1B09 A;  3WP6 A;  3IDC B;  3K77 A;  1O8P A;  3WY6 A;  3I49 A;  1VBE 2;  1OVS A;  3UKT A;  2XH6 A;  5FK7 A;  3VN4 A;  2CY6 A;  2GND A;  3T0B A;  4JKM A;  5GLV A;  4FPY A;  3MGU A;  4MGT A;  3VBU A;  1P8J A;  1W3X A;  4AFB A;  2ZHN A;  3E6B A;  1H2N A;  2HKX A;  1S4C A;  2ZEX A;  2VM9 A;  4QT6 A;  4ZU5 A;  4NIA A;  3ZFF A;  5J09 A;  1G9A A;  4IV1 C;  4OMC A;  1D0G A;  3BTZ A;  4JKL A;  2I45 A;  1WZX A;  3KD4 A;  1YIF A;  2YY1 A;  3LIH A;  1OH3 A;  1Q5O A;  2VEC A;  2W68 A;  2ID4 A;  4TYS A;  5KHI A;  1RC6 A;  2AEY A;  3C7E A;  1W8H A;  3G7D A;  4XAE A;  5FZ1 A;  3RZH A;  1JOD A;  2UY8 A;  2N7G A;  4I0B A;  3VBS A;  5JR2 A;  1ND3 B;  5KXD A;  1CIW A;  1HW5 A;  1ZZ6 A;  3HOB A;  3KF5 A;  2VUL A;  4AK3 A;  5C71 A;  2R16 A;  3WW1 A;  3ACF A;  3RYR A;  1K3I A;  1MZ6 A;  3KHB A;  4WVV A;  3OY8 B;  3O1T A;  4OZO A;  5SV8 A;  1C1L A;  1X33 A;  2BVB A;  2DUO A;  1NZC A;  1LOA A;  2G9Z A;  4YZ4 A;  1C8M 3;  5A7W A;  3O1V A;  1PIV 1;  1HJF A;  4XXP A;  3MBW A;  3PUR A;  3AKQ A;  3OPT A;  4B4P A;  1KD7 A;  4N90 A;  5I0D A;  1URX A;  1UW8 A;  5F3I A;  2JG9 A;  1WW7 A;  2EVX A;  4LTA A;  4AFM A;  4BME A;  1F8V A;  4FP3 A;  2BBV A;  1K5M A;  2P6H A;  5IYY A;  1KJR A;  3JB8 A;  1WLC A;  3M7A A;  2QQI A;  1XNT A;  3U10 A;  4CUB A;  1LGC A;  1QJZ A;  2VVE A;  4N9I A;  4JX0 A;  5L7O A;  2RVA A;  1QMJ A;  1SPP B;  3M3O A;  5I0U A;  2YC4 A;  3JUU A;  3PVO A;  1JOB A;  4PDW C;  4S2G A;  5D8A A;  3TB0 A;  4FAG A;  1MVQ A;  4HKL A;  4GH4 B;  3VBU C;  2JG8 B;  2VQA A;  1W8O A;  1W05 A;  1Q8S A;  3Q8C A;  4XHX A;  5C8W A;  2WKK A;  4NO4 A;  4NHM A;  2Y60 A;  1SCR A;  3PMS A;  4K9S A;  4OCT A;  5I0T A;  5ACA 3;  3ZN5 A;  1COV 2;  4DB5 A;  5HXM A;  1I6X A;  3IPV A;  3MIC A;  3P3N A;  3KB5 A;  1QQP 3;  2E53 A;  2VH9 A;  4JDM A;  1RUC 2;  2QQM A;  2X5I C;  3VV1 A;  3VDD A;  2WT0 A;  4GWN A;  1JZ8 A;  4YM0 A;  4AGR A;  3RZK A;  3GBG A;  3V0A B;  1UMI A;  4RA0 A;  4RR3 B;  2AR6 A;  2XJT A;  5JIU A;  1X36 A;  2JDN A;  1E5H A;  4QDR A;  2A5Z A;  3QH7 A;  4BQ2 A;  1O4Z A;  2C6S A;  2TEP A;  4QPI C;  4CCJ A;  2RHP A;  4MUV A;  4QX5 A;  4DXR A;  1OLQ A;  4P5H A;  1SMV A;  2IXC A;  5FUI A;  1WBF A;  1YHF A;  2UWB A;  1Y4W A;  5ABJ B;  4UBH A;  2E31 A;  2ZHK A;  1SAC A;  4AGV A;  3S6P A;  1HQW A;  5HI0 A;  1Z7S 2;  1AX1 A;  2ZKN A;  3UJO A;  3USU A;  1K42 A;  4FPK A;  1W2A X;  3DN7 A;  3PUA A;  2GN7 A;  4O65 A;  4PJY A;  4XAC A;  4BWO A;  3W9A A;  1MS8 A;  5JOZ A;  3T1M A;  3BOP A;  2P3I A;  2IFW A;  2RS1 3;  1VBC 1;  1ZBE 2;  4DXZ A;  4FFG A;  3Q8A A;  3KQR A;  1CZS A;  1AYN 1;  1GSL A;  2Y34 A;  3A0K A;  5AFE A;  1W28 A;  2QFE A;  1NAE A;  4CUC A;  3UNP A;  3AFG A;  3HNM A;  1NOV A;  4UF0 B;  3WZ1 A;  1A6C A;  3M2M A;  2ZPX A;  1QQP 2;  1GZT A;  1T6B X;  3B5L B;  3WDU A;  5B2G B;  1HX6 A;  3RRD A;  4YFZ A;  1VMF A;  4IE7 A;  2YHJ A;  3VBO C;  5E1R A;  5LBB A;  3VBS C;  1UZZ A;  3NL1 A;  4NRO A;  4IE4 A;  4L11 A;  1V6L A;  5APA A;  5DQ0 A;  2DDU A;  1RXF A;  5IFP A;  1OA4 A;  2E9Q A;  3DYM A;  4NRP A;  3QD6 A;  4XQW A;  4IDZ A;  2WT2 A;  4LT5 A;  1OHF A;  1GZ9 A;  3H9A A;  1SDW A;  4IE5 A;  1FPN 2;  2XLG A;  4Q0U A;  4DUX A;  3CKH A;  5CIR A;  5FZ0 A;  2WFP A;  4MYE A;  5I8S A;  2VZ3 A;  4EJR A;  1DQ5 A;  3MYX A;  1HB3 A;  3ORJ A;  1VBD 1;  2XXZ A;  4CU9 A;  3CJI A;  1UF2 C;  1OKQ A;  4IEQ A;  4QQ2 A;  3U4X A;  1IS5 A;  1W39 A;  1NLR A;  2ZTN A;  4AE2 A;  1ND3 C;  3B69 A;  4PIZ A;  1ZBA 2;  3MLL A;  3A21 A;  2XBO 2;  4E4D X;  1DCS A;  2AZ5 A;  2HWF 2;  2Z69 A;  4HT1 T;  1PMJ X;  1F15 A;  2CGN A;  5EV7 A;  1ULG A;  1JZ2 A;  1G8W A;  2XBO 1;  2VVF A;  4FPH A;  4Q1R A;  5CAD A;  2VZS A;  4BU2 A;  2BZD A;  1AR6 3;  5J3U A;  2VE1 A;  3AP7 A;  1YFW A;  2BNO A;  1POV 0;  2OVU A;  4IL7 A;  4OHX A;  1UX7 A;  3W21 A;  2YBS A;  2QQU A;  4CP2 A;  5BV6 A;  4CP1 A;  3ZXD A;  3UT0 A;  5DN2 A;  2YDE A;  4EQV A;  1NLS A;  2HWE 1;  5FO8 B;  3LEG A;  4BH9 A;  1VMH A;  2VUA A;  1BMV 2;  4E4H A;  3E5X A;  5SV5 A;  2XJP A;  3ZFF C;  4BXS V;  1RUF 2;  2HH9 A;  2RJL A;  5T5O A;  3I3D A;  4LHN A;  4CPB A;  1JYI A;  5B4X A;  1A8D A;  5H9P A;  1UOB A;  3TN9 1;  5JUV A;  1OH4 A;  1OPM A;  1W6O B;  2SBA A;  2VXJ A;  2ZZJ A;  1AR7 1;  4GB3 2;  4YGD A;  3BUC A;  3K2O A;  2ZMK A;  1V9U 3;  5JZG B;  1UYY A;  2IVJ A;  2K9Z A;  2OA2 A;  1XE7 A;  2ZX4 A;  5C8C B;  5IHR A;  2GZW A;  1DFQ A;  4ZON A;  3DYO A;  4WZC A;  3ZFG C;  1QNW A;  3UKV A;  2Q1M A;  2VZV A;  3H1Y A;  2RDN A;  1W90 A;  2VO5 A;  5F5Q A;  1B35 A;  4QGL A;  2WA3 A;  4W50 A;  3LIG A;  3OYW A;  3QLQ A;  3VBH B;  3AVS A;  1W0O A;  3P6B A;  1PVX A;  1X8E A;  4E2S A;  3BKZ A;  4AFC A;  4FTE A;  5LAT A;  5FYS A;  3ENR A;  5JSR A;  1G9D A;  2HYK A;  1IG3 A;  1VJ2 A;  1AYM 1;  4C90 A;  2IXJ A;  3M3E A;  4AI3 A;  2DBI A;  1QNY A;  5FOB B;  2KR2 A;  1TMF 1;  4I3P A;  3GBF A;  1Z0H A;  2BPA 2;  3IMN A;  4HK9 A;  1US3 A;  3FN9 A;  3OTF A;  1V9U 1;  3IIA A;  4BQ4 A;  2PEL A;  3MF6 A;  3AM2 A;  4EYU A;  2PXJ A;  2XHN A;  5AVP A;  1R1A 2;  1W8W A;  2XQR A;  2XOM A;  1W6P B;  4XJW A;  1W0N A;  3O14 A;  1FOD 3;  1WKY A;  1OKO A;  2WAO A;  4DEV A;  2WS9 2;  1YQ6 A;  3N9N A;  1JU4 A;  3I3Q A;  4LHS A;  4URT A;  4E2Q A;  5CAZ A;  1H6X A;  1C5I A;  4LJH A;  5EZW A;  1DGL A;  5HV0 A;  1OLM A;  3HEI A;  4DS0 A;  3HWJ A;  1DYP A;  1NCR C;  5F37 A;  1UMZ A;  4D7T A;  5JOY A;  3LWC A;  1W99 A;  3OOX A;  2PHR A;  4AHY A;  3PVB B;  5C3S A;  1ZA4 A;  2J1A A;  5H9Q A;  1HXS 2;  1LAJ A;  1XU2 A;  1HN1 A;  1C28 A;  1E57 A;  4UWD A;  1HB4 A;  1CWP A;  3NNG A;  1BZW A;  1G9B A;  2B45 X;  4CEW B;  4CXX A;  2Y6H A;  1ND2 B;  1UY1 A;  5FKB A;  4B1M A;  1EV1 2;  2WWS A;  3E5Q A;  3CJX A;  2YZ4 A;  4LKD A;  3I2F A;  1IHM A;  2WO7 A;  2WAA A;  5FTT C;  4CRQ A;  4AL9 A;  3O1M A;  1PO2 1;  4QKD A;  2BWC A;  2WQZ C;  3VD5 A;  1LU1 A;  5HCA A;  4XZP A;  1FI2 A;  3QAC A;  2TNF A;  5J98 B;  1BMV 1;  5FY4 A;  4GA9 A;  4GMP 3;  4TLG A;  2ORZ A;  5FZ3 A;  3CL1 A;  1R09 2;  2Z42 A;  2A6Z A;  4N9H A;  4BJ0 A;  5IVC A;  3U1X A;  2ZGS A;  3IDE A;  1BEV 3;  4IES A;  2J1V A;  2VD7 A;  5FYZ A;  1YQ2 A;  5BPX A;  1VBB 2;  5IVJ A;  2DFB A;  5F5C A;  4IEY A;  1VMJ A;  3O1U A;  2GME A;  3B9C A;  4R9A A;  1OUX A;  4NJ4 A;  5T52 A;  4OUS A;  1ND3 A;  1KS5 A;  1V6N A;  4D6S A;  4GWJ A;  5I8Y A;  1XNC A;  2GAL A;  3KCX A;  3P5B A;  4IEO A;  4UAP A;  4ZHN A;  3S7E A;  2R06 1;  2WDB A;  4XET A;  4D6Q A;  2VUJ A;  1RUN A;  4UBG A;  2OPW A;  2BU9 A;  2RDQ A;  3UYJ A;  2WZE A;  3IDA A;  1I1E A;  1UYP A;  2FCT A;  1NY7 1;  3E6D A;  1IPJ A;  2CGO A;  2E7T A;  3LFI A;  3MFC A;  4LE4 A;  4Z07 A;  3ES4 A;  1KIT A;  5JMO A;  2FZ1 A;  4GXL A;  4HAN A;  1DQ2 A;  2PTM A;  2D44 A;  1VBC 3;  3ZYI B;  3SKV A;  3AB0 A;  5IT6 A;  4WVM A;  1RUE 1;  3J9S A;  4M3C F;  4YRD A;  4LBQ A;  4QPG C;  5JAX A;  3UV9 A;  1JU3 A;  1L7Q A;  1GWL A;  3POS A;  3RGB A;  1U5Z A;  4ZS3 A;  3ZDV A;  4A3Z A;  5LBE A;  1RUG 1;  2UUR A;  3IDB B;  1H2M A;  4QX2 A;  4DZG A;  1ZZ8 A;  4XAA A;  2PHF A;  4GH4 C;  4WM8 C;  1GU3 A;  2EXH A;  3DUI A;  4D0Q A;  2YC0 A;  3KCC A;  3M3Q A;  1LOF A;  4B7K A;  3H1M A;  2B42 B;  2HWE 2;  3HT2 A;  1XNB A;  3ZKU A;  1V70 A;  2UYA A;  4K3U A;  2GH8 A;  4KGG A;  1UO9 A;  1ASJ 3;  2JD4 A;  2QZ3 A;  3PVE A;  5F6L B;  5A6Z A;  4WM8 B;  3TEY A;  4F8A A;  1CAU A;  2CNA A;  3WNX A;  4JQR A;  1AYM 2;  1EPZ A;  4XF0 A;  5BNQ A;  2CTV A;  3O0X A;  1AUY A;  5FRA A;  2P3J A;  3T30 A;  4YG6 A;  2C9K A;  5DZG A;  1SHW B;  1OXC A;  5FOJ B;  3HD8 B;  2ADD A;  3QBQ A;  3U4S A;  3S7I A;  4HFS A;  2GC3 A;  1BCX A;  4MAD A;  4RQP A;  1ALY A;  4YVS A;  3F2Z A;  3BTA A;  5FRE A;  3JBG 3;  1UY0 A;  3T3Y A;  1O91 A;  3UES A;  4BPZ A;  2R04 1;  1YCI A;  1PX4 A;  1TMF 3;  3AK0 A;  5FZ4 A;  1NX9 A;  3IM0 A;  4HKW A;  1QKQ A;  2ZXQ A;  5C9A C;  2XJS A;  5BYN A;  4QWN A;  5F2W A;  3OCP A;  4QB6 A;  1S0C A;  3BIW E;  4LO5 B;  1YLL A;  5DPN A;  3RI9 A;  1SBE A;  1DLC A;  5TSW A;  5CFD A;  1C1F A;  4XZU G;  5JVV A;  1V6O A;  3M3C A;  4RR3 A;  3MIH A;  3ACG A;  3UL2 A;  2HEY F;  4MLO A;  3HQX A;  4LR4 A;  1S0G A;  5C5U A;  5IAV A;  1W6N B;  3T0A A;  2JDA A;  5CB7 A;  2HWE 3;  3IWZ A;  1YQ5 A;  2FMY A;  4BHP A;  1PVC 2;  2YRO A;  4PDW A;  4KQ7 A;  2Q8D A;  4I2O A;  1F5F A;  4ES9 A;  4UF0 A;  1ZBA 3;  4QPY A;  4OUE A;  3N7M A;  1QJX 2;  3HNB M;  3N9O A;  5GZF A;  1SLT A;  1ACC A;  3BU7 A;  4ATF A;  2H6C A;  4JRL A;  4M3C A;  1F2N A;  4YG0 A;  3WCS A;  3TEW A;  2D6M A;  3T2O A;  4HZF A;  3THP A;  3MLJ A;  5T5J A;  2IXI A;  2YBP A;  4EWA A;  2QQV A;  1GIC A;  4NWW A;  5FP9 A;  1DQ0 A;  1ZZB A;  5K8S A;  4XF4 A;  2RS1 2;  3ZN6 B;  5IAX A;  4JDO A;  2AEN A;  1JOP A;  2FQP A;  4QX3 A;  3OUI A;  2WZP P;  4TWT A;  3WHU A;  3ZPO A;  2FMD A;  4M0H A;  4P9J A;  5IWF A;  1NUK A;  2LAL A;  3WOG A;  2P6C A;  1JN2 P;  1K5J A;  4AEK A;  2ZGM A;  2ERF A;  1JTZ X;  2FD8 A;  3FJS A;  1LU2 A;  4XFI A;  2FCU A;  3KWV A;  1GNH A;  2RM2 1;  1IOA A;  5JLV A;  5IK5 A;  1VIW B;  5K0U A;  4IV1 B;  3VKM A;  4GB3 3;  2VY0 A;  1RED A;  3WNN A;  1B35 C;  1PZ9 A;  3AMM A;  3IAP A;  4XVH A;  1QJU 2;  1DZT A;  2VBB A;  4C1X A;  4QM9 A;  4ERO A;  3EYP A;  5F39 A;  4J1X A;  1TE1 B;  4Q26 A;  2CAV A;  3IN9 A;  4H55 A;  4ITC A;  4CDQ B;  5B4N A;  1JZ6 A;  3RZZ A;  1OOP A;  1YWK A;  2D97 A;  4YFW A;  4CCE A;  3EJK A;  1LB2 A;  4QU2 A;  1UKG A;  3AL5 A;  2JEC A;  3KHC A;  2VQ0 A;  4PF1 A;  4Q4W 3;  1F9K A;  4BQX A;  2XWB B;  2Y26 A;  1MQT B;  3NVC A;  4IUG A;  4LIV A;  3CJI C;  4GWM A;  3MUY 1;  4BM8 A;  1OQE A;  2VXR A;  1EP0 A;  2WNU A;  4XF1 A;  4Q4V 2;  5F3E A;  1SLC A;  2JEM A;  1AYN 3;  3WR0 A;  4URA A;  2TUN A;  4YW7 A;  3ZX7 A;  4UFL A;  1O59 A;  2BRT A;  2FDF A;  4LA3 A;  5DAP A;  1Z7S 1;  2QE3 A;  3JQX A;  4PBO A;  5FO9 B;  2RS5 1;  1MS0 A;  2QQN A;  3P1I A;  4QPI B;  2GP5 A;  5CVR A;  1YQ8 A;  4SBV A;  3HAG A;  3MID A;  2DVF A;  4V2V A;  5JZG A;  1PMI A;  4AQT A;  2FDG A;  5FQ0 A;  4JTN A;  4Q4W 1;  3UK9 A;  4PI2 A;  5FV3 A;  4YGB A;  3LSE A;  3WQ1 A;  1CR7 A;  2R0F A;  3NV4 A;  5FAX A;  1H30 A;  1HIX A;  2OW4 A;  2W2I A;  3O0V A;  4LE3 A;  4G9S B;  3VBH C;  2PLV 3;  1SLI A;  4HXC A;  3APB A;  2WJS A;  4NPR A;  3DPR A;  1S0I A;  2JJ6 A;  4ZXE A;  3X29 B;  3D0S A;  3B7M A;  2P2K A;  4BCU A;  1VRB A;  4XUN A;  2NN8 A;  1FMD 3;  5FP8 A;  3O12 A;  1AR8 3;  2BGO A;  1HXS 3;  3AP6 A;  5IJR A;  1I9R A;  1YYN A;  2ZEW A;  4OI0 A;  1X7N A;  4RHV 2;  1XBF A;  3V64 A;  2ZX1 A;  4M4R A;  3I54 A;  5DDJ 1;  5FMO L;  1MEC 2;  1ST8 A;  5HV4 A;  2ARC A;  2ET1 A;  4H14 A;  4LOR A;  3J8F 2;  3WQB A;  5HPO A;  2BEO A;  4QGN A;  1LEN A;  1PZ7 A;  2DVD A;  2XL9 A;  3RJR A;  3ZSL A;  2VMH A;  1OA3 A;  1LEM A;  3MZH A;  2JDK A;  4CCL A;  3Q8E A;  4Z8B A;  3KV5 A;  3GM8 A;  3MDP A;  4JQT A;  4Y4Y A;  3TOJ A;  2BBA A;  2WN3 A;  4XHB A;  2Z79 A;  4YM2 A;  4A6O A;  5ACA 1;  2W1W A;  3NNL A;  1JUI A;  5G05 L;  3HMY A;  5FYC A;  5GZD A;  5FBZ A;  4EWD A;  5F1R A;  4J25 A;  2J1R A;  3VKO A;  5M0T A;  1OQ1 A;  3AP4 A;  5FZI A;  4N8M A;  1VBE 1;  3K75 B;  5IUQ A;  1ODN A;  2R7E B;  5A6Y A;  3PNA A;  3VKN A;  3LOB A;  4PIY A;  2HLE A;  4N43 B;  4CDQ C;  3OD0 A;  2VQU A;  2Z4F A;  4M01 A;  4Z2W A;  1W8F A;  3V65 A;  1UOG A;  1FOD 1;  5K4L A;  4NHX A;  1NCQ A;  3WDY A;  3GHM A;  1C5H A;  3U14 A;  2DF7 A;  1EV1 1;  1MZ5 A;  3FUO A;  5KXB A;  5A7Q A;  5IK4 A;  2J1S A;  5CFD B;  1W6M B;  4GQ7 A;  4EN7 B;  4GUL A;  3ETQ A;  4YVS C;  3LSD A;  1W2T A;  1RUI 3;  1I5Z A;  1N1T A;  2BQP A;  2QVS B;  2P3K A;  2HWD 1;  3SIT A;  1G7Y A;  2DU0 A;  1AR7 2;  4I02 A;  4GAZ A;  4W6X A;  4XW3 A;  3EHK A;  1LHV A;  4PDW B;  2A71 A;  3ZMO A;  1R08 2;  5FP7 A;  1H8T A;  4MGZ E;  5J7M A;  3PHM A;  3DXU A;  2NLR A;  3NKG A;  1OC1 A;  1SEF A;  4CDX C;  2IXH A;  3FX3 A;  2IWG B;  1K5M B;  4DMI A;  4XBL A;  2ZOE B;  3E6C C;  2CL2 A;  2R30 A;  2ES3 A;  3ZPY A;  3DF0 A;  3NAP B;  2P17 A;  3WEZ A;  2WN2 A;  2RMU 3;  3MW4 A;  5JPM B;  3KT4 A;  2R04 3;  4F3J A;  2ZCW A;  2JDH A;  5DAX A;  4QKN A;  1D4M 3;  1LOF C;  1SPP A;  2XWJ B;  3GZE A;  3C7H A;  4UFI A;  5L7O C;  4ARY A;  2XUM A;  4QAW A;  1NQD A;  5CKQ A;  3C8X A;  1C3H A;  3POB A;  4GH4 A;  4DY5 A;  5F5I A;  3SLI A;  4A3X A;  4XOG A;  4D7Y A;  4ZZ5 A;  3AC0 A;  4A41 A;  3UGH A;  3U07 A;  4MHU A;  4IE6 A;  4Q27 A;  4XPV A;  4UW6 A;  4LLO A;  2PHD A;  1RVF 3;  3POE A;  4OI1 A;  5DUV A;  5FZA A;  1X50 A;  2D93 A;  2VMI A;  5CFC C;  3SCG A;  2MHF A;  1SFP A;  3JBG 2;  4OHY A;  4IGQ A;  3RMX A;  2JEN A;  3AYA A;  5FYY A;  2RS3 3;  3W5M A;  1JBC A;  2ARE A;  4AI0 A;  3UJQ A;  3ACH A;  2CV6 A;  3J7L A;  1AR7 3;  4CU6 A;  1GV9 A;  2E26 A;  1A3K A;  2VZQ A;  4P08 A;  4E8C A;  3NWK A;  4CVU A;  4NHL A;  3DL3 A;  4CDU A;  1DGW X;  2RM2 2;  1UOJ A;  3P3P A;  3ZVX A;  2OXB A;  3HN3 A;  4A2U A;  1UU5 A;  1XND A;  5KBF A;  5F5A A;  3RS6 A;  4LKS A;  4AI2 A;  4MGI E;  1WLD A;  1YRZ A;  1U5Y A;  4LBQ B;  4WZF A;  1ZRE A;  5A3L A;  3N35 A;  2PHT A;  2WNU B;  4AVV A;  2CYF A;  4JGY B;  4N43 C;  5LBC A;  1OF4 A;  1PIV 3;  4Y20 B;  4CYD A;  3VBU B;  4FPL A;  4UW5 A;  1O5L A;  5ACA 2;  3T0D A;  1Y43 B;  1COV 3;  3F95 A;  4YZ3 A;  1JZ3 A;  5C7G A;  1D4M 2;  3VZN A;  4KH9 A;  4CE8 A;  1POQ A;  2W08 A;  2VU9 A;  1SG3 A;  2A3X A;  3TWI A;  1WCS A;  3H8X A;  5LW9 A;  1H2K A;  1BKZ A;  5FYT A;  5DAW A;  4GZ9 A;  1R09 1;  3NV1 A;  4WM7 C;  2Y6G A;  1OQD A;  4G4F A;  4XYX A;  1GOH A;  4TTG A;  4BXF A;  4MXW A;  1AR9 1;  3MV0 1;  4HKO A;  4Y1Z A;  3VKL A;  2WIN B;  2CWM A;  3CNA A;  4Q0S A;  3RYP A;  3KQ4 B;  1VBD 3;  5A6X A;  2HWC 3;  4GJZ A;  5GZG A;  3THD A;  1AR9 3;  1XU1 A;  2VG9 A;  2OZ6 A;  2X09 A;  4EN9 B;  1CON A;  4E9K A;  4P9Y A;  5KHJ A;  4ISQ A;  4IET A;  5KR7 A;  3NW4 A;  4KU7 A;  5FXZ A;  2V4A A;  4BK5 A;  1HXS 1;  2ZHM A;  4L2N A;  5FY0 A;  5KHG A;  1AR6 2;  3NAP C;  5A70 A;  2VVD A;  4JGY C;  1RUJ 2;  5F3G A;  5FXW A;  4YLZ A;  2JIG A;  3RWK X;  3TBD A;  5I8T A;  1GFF 2;  5D8A C;  4AQ2 A;  4A6S A;  4R9D A;  1J3R A;  2ZAB A;  2ZBJ A;  3B01 A;  4X8N A;  5CKM A;  3THC A;  4AI1 A;  2KM2 A;  3ZXE A;  1JYW A;  1GQH A;  3AVR A;  1BVP 1;  1XE8 A;  3WDV A;  2WWJ A;  5J36 A;  2BDR A;  5LRS A;  4QQP A;  2HWB 3;  3ZO0 B;  4F83 A;  1MS1 A;  3AMP A;  2R07 2;  2XKO A;  3R4D B;  5K9Y A;  1AF9 A;  5IK7 A;  2XLA A;  5KHH A;  2G4I A;  1UWW A;  1LTE A;  1UYZ A;  2WUH A;  3MI8 A;  2RR1 1;  2WSU A;  3URF A;  2ZAA A;  1SFY A;  4IER A;  4XJ8 A;  5FUN A;  4CDU C;  3OJB A;  1OUR A;  2VGD A;  1AYN 2;  1V6K A;  4RFR B;  4MXW B;  3M1H A;  2O0O A;  2RR1 3;  1VRH 3;  3CBN A;  1WBL A;  2VCM A;  4GIQ A;  4LKE A;  5LA9 A;  5GLZ A;  4DRV A;  5A3W A;  1W9F A;  2ETE A;  5K0U B;  4DNY A;  2PFW A;  5IW0 A;  3FL7 A;  4D3W A;  4BIS A;  5C4W A;  1QJE A;  4LBK A;  1W6Q A;  1O3R A;  1KS4 A;  2XJV A;  1UKR A;  3H8U A;  3ZFG A;  5IVE A;  1KXG A;  1PVC 1;  2HWD 2;  2ZHL A;  3ON7 A;  4QQH A;  5E89 A;  2PQQ A;  4CP0 A;  1RUG 2;  2VBD A;  5LCW L;  2VUD A;  4YW4 A;  1QJU 1;  1GOF A;  5EP9 A;  3D0J A;  4CDX B;  1DG6 A;  2VQT A;  5ABJ A;  4Y22 A;  2BWA A;  1ZRF A;  3ZXF A;  3LA7 A;  5A3M A;  1FMD 2;  2IVI B;  1JUH A;  1LGB A;  2JB4 A;  4Z92 B;  1FOD 2;  1RUH 1;  3GBW A;  2HJI A;  3E1F 1;  1O6U A;  4BQ1 A;  1BJQ A;  2WO3 A;  1COV 1;  2LS6 A;  3N3H A;  3SQO A;  4Q0Q A;  3ZYG A;  1AX0 A;  3OD4 A;  3POY A;  2ZGO A;  1PO1 3;  4OVE A;  4V1P A;  4P02 B;  4XC9 A;  3NST A;  1NQJ A;  2Q30 A;  1OUS A;  1WD3 A;  1ULE A;  2Q8E A;  3ITQ A;  3IB3 A;  5FQ0 B;  3ZFF B;  1RMU 1;  4NPL A;  1GNY A;  4DY3 A;  4AED A;  4MZU A;  2DUP A;  4UI9 L;  2ZGP A;  1WLT A;  2LTN A;  5DZE A;  2WYF A;  4RYD A;  1H6Y A;  1LHU A;  5T5L A;  4BQW A;  3FLT A;  4P9W A;  1RMU 3;  1S0E A;  4LK6 A;  3RSJ A;  4IQP A;  1S2E A;  2JIC A;  4AVT A;  4JHZ A;  2Y6K A;  2CWS A;  4K21 A;  2VOK A;  4ASM B;  3RZL A;  5H9S A;  3E5U A;  2F4L A;  4I30 A;  2EIG A;  3A0N A;  5JSO A;  1PX3 A;  4E4Z A;  2WNO A;  3D8C A;  5ABJ C;  2WQ4 A;  3RPQ A;  1X8M A;  4KBZ A;  3SMH A;  1RGS A;  1SLL A;  4CZS A;  4FTS A;  3VB9 A;  2Y6L A;  3FZ3 A;  5A33 B;  2QDN A;  3CZJ A;  3WDT A;  3WLU A;  3L2H A;  1DGR N;  5FY9 A;  4QX1 A;  4FSJ A;  3O1R A;  1QU0 A;  3RMY A;  3LKJ A;  3CJI B;  1NLQ A;  5K7P A;  3BGA A;  3MO4 A;  4CDU B;  5FLH A;  1CX1 A;  1XNK A;  4QGM A;  3WUD A;  1JH5 A;  3WIN E;  5L36 A;  1WLW A;  3BVC A;  2VZ1 A;  2ZGT A;  3WXP A;  2EF6 A;  1V6M A;  2WLP A;  3SH5 A;  4BQY A;  2MNG A;  3MLK A;  2GH2 A;  4JGY A;  4L99 A;  1LNS A;  1GUI A;  1VBA 2;  4LIU A;  4UFM A;  5ERL A;  5GKA C;  3SH4 A;  5GLU A;  3BN6 A;  1FX5 A;  1GQG A;  2QJV A;  5FIX A;  4ASL A;  2WS9 3;  1R08 3;  3INA A;  1OD3 A;  2V09 A;  3GGL A;  3WG4 A;  3VD4 A;  3AJZ A;  5LAS A;  3VBF B;  3VZK A;  2Q1F A;  1AR8 1;  1ENX A;  5D8A B;  3UGG A;  4YM1 A;  3POJ A;  3DKQ A;  3AXD A;  4IEZ A;  4W6Y A;  3SKJ E;  3OSD A;  2HEV F;  2JG8 C;  2OZJ A;  1UU6 A;  3GDB A;  4FCA A;  1NCQ B;  3RNS A;  4FPJ A;  1SLA A;  2EXI A;  1EV1 3;  3RVH A;  1N3P A;  1ZZ7 A;  1UQX A;  5JI7 A;  4K8R B;  2OUH A;  4U2A A;  5ANN A;  3VGI A;  2PHU A;  5IK8 A;  2IFR A;  3ILR A;  4JGZ B;  4LBO A;  4UFK A;  2HWB 1;  2BOI A;  3U11 A;  4LOS A;  1RXG A;  2XVK A;  4FXG B;  1GP4 A;  1RUE 2;  1W2O A;  3KVA A;  4AF9 A;  1W04 A;  4XF9 A;  1RUI 1;  1MQT C;  2BER A;  5KHK A;  2RJ2 A;  2H6B A;  5T54 A;  1MAC A;  2VZR A;  4XJZ A;  2OPK A;  3MUZ 1;  2DWR A;  3UKN A;  2Z2S B;  4XQ4 A;  5EWS A;  1PGW 2;  4P9G A;  3VL8 A;  2A6X A;  1NY7 2;  3I3B A;  5LA2 A;  2C1F A;  5FPZ A;  3TEX A;  3VBR B;  2EA7 A;  1E5I A;  4RFT 0;  2VBP A;  1GKB A;  4N7U A;  4OQ8 A;  2V5Y A;  4FPC A;  4CCK A;  5A32 A;  2R06 3;  2W95 A;  1TME 3;  2XML A;  4NPM A;  2R1D A;  3SCF A;  4P5Y A;  4U36 A;  5C33 A;  1QDC A;  1JXN A;  4OI2 A;  1QJY 2;  2W91 A;  5FYH A;  3VBR C;  1GWK A;  4OI4 A;  4PCR A;  5EJZ B;  3V0A A;  2B39 A;  1S2B A;  2GNT A;  3WP4 A;  1QJX 1;  3ABZ A;  1W8T A;  2VME A;  3OEB A;  1W3V A;  4FBF A;  4NUB A;  1JZ7 A;  1D7P M;  2W94 A;  1U0A A;  2FCV A;  2XB6 C;  3KV9 A;  3LPF A;  4GJY A;  2ZGL A;  1OF3 A;  4I01 A;  1LOB A;  1S0F A;  1HRI 3;  2JDP A;  4MGQ A;  1PK6 B;  1UAI A;  1DYK A;  2KXL A;  3AMH A;  4XEZ A;  1HB2 A;  3BTX A;  5FUP A;  2PA7 A;  2W47 A;  2DYC A;  2FDI A;  4DFS A;  1T2X A;  2HWC 2;  2GMP A;  4DPN A;  1TME 1;  2ZGK A;  1ZBE 3;  1GR3 A;  4EWE A;  3O1P A;  4CDX A;  4MHR A;  1XSR A;  3EMR A;  4XFG A;  4Z82 A;  3A22 A;  3RZG A;  1QHD A;  3IKW A;  3K48 A;  4PF5 A;  4ZS2 A;  3RWN A;  5KC6 A;  4OUL A;  4UW4 A;  3I2G A;  3WNO A;  4L0P A;  2ZAC A;  3QCW A;  4D6R A;  2B5H A;  3AL6 A;  2VW1 A;  1RVF 2;  5E6H A;  3VBF C;  5FPL A;  3O7O A;  1ASJ 2;  3T2T A;  2QQP A;  3FHI B;  5E16 A;  4AYU A;  2BP6 A;  2V73 A;  5D1I A;  3ZSE A;  1TME 2;  3S57 A;  1CJD A;  3CMG A;  1Q8O A;  2VNR A;  2WZR 3;  3AYC A;  3KT7 A;  2JX9 A;  1GP5 A;  4M3C E;  2VOX A;  5IFT A;  3B02 A;  4CEY C;  2VTX A;  3BPZ A;  1XYN A;  1PNF A;  2E6V A;  1WMF A;  3OBT A;  4XCA A;  3W5N A;  1NA1 A;  2A70 A;  1QIQ A;  3FBY A;  3LQC A;  1HV0 A;  2VAU A;  3LCP A;  1NCQ C;  4QU1 A;  1XE0 A;  4PI0 A;  4E2G A;  2HWB 2;  1XQN A;  3KVB A;  4AED B;  3R6S A;  1RUF 1;  4DUW A;  1RUD 1;  4MGK E;  3J4U H;  4L97 A;  5JDB A;  3VD3 A;  4YW1 A;  4RR3 C;  4MO3 M;  4GMP 0;  4N53 A;  1HKD A;  4KGQ A;  5GJ6 A;  2W0X A;  3JB4 C;  3HJR A;  4FOQ A;  4I0A A;  1R64 A;  1ZM1 A;  3DEC A;  1TMF 2;  4DIN B;  2DTY A;  5GM0 A;  1U12 A;  1ZRR A;  2ZEY A;  3CZU A;  3PIJ A;  2G19 A;  3I2J A;  5T55 A;  4LK7 A;  2GC0 A;  5EQU A;  4MET A;  2XGX A;  1DQ6 A;  1W6O A;  4YGC A;  3WSO A;  4YZ5 A;  4Y5T A;  2H0V A;  3FLP A;  1AYM 3;  1PM7 A;  2A3W A;  5EPA A;  5J48 A;  1BXH A;  2VZP A;  3KV4 A;  1V6J A;  1CAV A;  4RQP C;  3VHR A;  3B93 A;  5F7U A;  3LA2 A;  3O0W A;  4AVB A;  3PUS A;  1X9P A;  3ZXK A;  3KM5 A;  4OMD A;  3NNF A;  4AFD A;  4LBL A;  1D4V B;  2OII A;  2JE7 A;  2I2S A;  4JVA A;  4ORF A;  3BAL A;  2J42 A;  3HIF A;  3WQ7 A;  3H8O A;  2A3Y A;  1HLC A;  4EE2 A;  2X8K A;  1RUO A;  1DHK B;  3LDR A;  4X8P A;  1TVG A;  4QDQ A;  2D5F A;  1UOF A;  3TN9 3;  4W65 A;  2CU5 A;  5CA6 A;  1AX2 A;  3ACL A;  5BY5 A;  2IXK A;  5F6K A;  5FZD A;  3BPS A;  2WNV B;  5CKN A;  4Q4Y 3;  1GP6 A;  1CAU B;  4Q2F A;  5CYY A;  4BIF A;  3WF0 A;  1V9U 2;  5FJH A;  5J1X A;  1WCK A;  4K6B A;  1UYX A;  1HRV 1;  4PQ9 A;  2WQ8 A;  2YMZ A;  5KXC A;  4AFA A;  1XNA A;  4L92 A;  1YUD A;  3ILN A;  1W6Q B;  4UXA A;  3AYD A;  2WFF 2;  4HSL A;  4MXV A;  3HBZ A;  3IBM A;  3NJV A;  4A4A A;  3NJX A;  4COZ A;  2A6V A;  3ZXL A;  3GZT B;  1RUH 3;  1V6I A;  4XDP A;  5EFU A;  4YVS B;  3GYD A;  5GAL A;  1ZBA 1;  2L9L A;  1QJX 3;  3MIE A;  5FLI A;  4LBM A;  4BZ4 A;  4JGZ A;  2HWF 1;  3J8F 1;  4Y5S A;  4Y4R A;  3SXW A;  1QOS A;  4IEP A;  4NMI A;  3ZDS A;  2DCJ A;  2ZKL A;  4AQS A;  5DDJ 3;  3POG A;  3WG2 A;  2RR1 2;  3R4S A;  1MVE A;  3MPB A;  2WAB A;  4RGG A;  4V2W A;  4D7S A;  3SCH A;  1A34 A;  2YFU A;  4ZU4 A;  4FPE A;  3DPR C;  1XXN A;  4E8D A;  1DYO A;  2BFU L;  4ZU7 A;  2WYS A;  5C3O A;  5JXJ A;  3BYW A;  4IEU A;  3VL9 A;  4HL0 A;  4S2H A;  4H7M A;  1D2S A;  1LRH A;  2EIB A;  5JR7 B;  3LA3 A;  4RS5 B;  4NAO A;  1XSQ A;  4R52 A;  4EZH A;  3CDZ B;  4EN0 A;  1FMD 1;  3OGV A;  5HXV A;  3WF2 A;  5FZO A;  1ZRI A;  4BDV B;  4BLJ A;  2WO2 A;  4GMP 1;  4KI5 M;  3ZM8 A;  1OPO A;  3CO2 A;  1OA2 A;  2DFC A;  1GZW B;  1OFN A;  4HPK A;  2XVG A;  2D3R A;  3USS A;  3WVJ A;  5K0U C;  1VB4 A;  4QB1 A;  5FYV A;  2W9X A;  3IT8 A;  1IPS A;  2IXL A;  2PYT A;  1FAT A;  2GC2 A;  3FFZ A;  5T50 A;  2ZS6 B;  4LXL A;  1US2 A;  1S55 A;  3WNM A;  2OUJ A;  1Q8Q A;  1JYV A;  4IXL A;  3BB6 A;  5EIY B;  1WWY A;  1YFX A;  3R0R A;  1STM A;  1C57 A;  3OGJ A;  4GKY A;  2WZR 1;  4LBJ A;  5DZF A;  4XCB A;  4LO6 B;  5A3O A;  4A42 A;  3LDK A;  1ENR A;  3ME2 A;  4FPG A;  2NM1 A;  3VBO A;  3FUQ A;  1H9P A;  4A44 A;  4RL7 A;  4HVQ A;  1IKQ A;  1EUT A;  3I8T A;  3KS7 A;  4O9G A;  4PT6 A;  1ULP A;  2NMO A;  4MH0 E;  3LB9 A;  4XQD A;  1NCR A;  1EUU A;  4XTM A;  4CA9 A;  2XJR A;  4CCN A;  5C3R A;  1RMU 2;  3H3U A;  3VD7 A;  4EN6 B;  1DQ4 A;  4J1W A;  3MPP G;  3AYE A;  1Y9Q A;  2XL7 A;  5LA1 A;  3IZO A;  2F4P A;  3VDC A;  1W6M A;  3BU0 A;  1G6N A;  4B8E A;  4CP9 A;  3VLB B;  5FZO B;  5LA0 A;  3O5S A;  2V4V A;  2OX0 A;  5JOX A;  2NYY A;  5E8A A;  1DDL A;  1WW4 A;  1J58 A;  3POI A;  4FOY A;  2CAU A;  4TLF A;  5FZF A;  3AKS A;  1Q56 A;  3K51 A;  3PJQ A;  4PHZ A;  4MOA A;  1CPN A;  1PZ8 A;  4JZR A;  5FWE A;  1ULC A;  2GAU A;  3PTY A;  3PU8 A;  1NE4 A;  3QH6 A;  4BMB A;  1IS4 A;  1N3Q A;  2HBU A;  4XFA A;  4XE9 A;  3EO6 A;  1Q43 A;  5CEH A;  3CEW A;  1OI6 A;  3OUJ A;  1W06 A;  1XC6 A;  4OHZ A;  2C26 A;  1AXK A;  1LR5 A;  3PVN A;  1ZZ9 A;  1VB2 A;  4CCD A;  1LOD A;  1LGN A;  1WME A;  5CU1 A;  5CG9 A;  4QPI A;  4P9I A;  2XJQ A;  2ZML A;  3NAP A;  1H2L A;  1ENQ A;  4NVP A;  2DCY A;  3B9I A;  2K46 A;  1PM4 A;  4XUO A;  3WDX A;  4CDW C;  5JXH A;  3AZZ A;  5I91 A;  2O1Q A;  3S0M A;  5HCF A;  3J8F 3;  2AH2 A;  3N7J A;  2PAE A;  2G9F A;  2JDZ A;  2YV8 A;  1CVN A;  1RUC 3;  1QDO A;  3T09 A;  3WP5 A;  3AMN A;  5FJK A;  1YJK A;  2PAM A;  5T5P A;  5CFD C;  3RJ2 X;  1Q8V A;  1CAV B;  1VAV A;  1CZT A;  3H0O A;  4AVC A;  1HRV 3;  3FWE A;  4UFJ A;  2DUR A;  5FMD A;  3VZM A;  1FXZ A;  2JKX A;  1D2Q A;  1H0B A;  4JC1 A;  4IE0 A;  3MHZ A;  1SCS A;  4YVW B;  5A7O A;  1O3Q A;  2CDP A;  1HDK A; 
#chains in the Genus database with same CATH homology
 4BXS V;  1KEX A;  2V5D A;  3I3D A;  3LEK A;  4BK5 A;  5B4X A;  3C7O A;  5JUV A;  1OH4 A;  3ETP A;  1UYY A;  3LPG A;  4QX0 A;  5IHR A;  3DYO A;  5EJ1 B;  2YB7 A;  1JYW A;  2VZV A;  3THC A;  1GOG A;  2VO5 A;  3WNP A;  4W50 A;  1SDD B;  1OT5 A;  3T2Q A;  3P6B A;  4XUT A;  3JXS A;  1GQP A;  4TXW A;  1K12 A;  3OG2 A;  1UXX X;  1UWW A;  4XUQ A;  1UYZ A;  2WUH A;  1UY4 A;  4YPJ A;  1US3 A;  3SEE A;  3FN9 A;  3MV1 1;  5C70 A;  2XHN A;  2QQO A;  2XOM A;  2QQK A;  3FL7 A;  1W0N A;  5A1A A;  1WKY A;  2WAO A;  4DEV A;  1JU4 A;  4FI9 A;  4LHS A;  1TG7 A;  1H6X A;  3WF1 A;  5LCW L;  3HEI A;  4CU7 A;  2VL4 A;  1GOF A;  3C7F A;  1JYX A;  1W99 A;  1PMH X;  2VQT A;  2J1A A;  2B9V A;  1HN1 A;  2BGP A;  4OYU A;  3NNG A;  3E1F 1;  2Y6H A;  1UY1 A;  1J84 A;  4PQQ A;  3I2F A;  2LW8 A;  4DXT A;  2WAA A;  2WO3 A;  2LS6 A;  3A7Q A;  2VJX A;  3VD5 A;  4P02 B;  2W1S A;  3LE0 A;  2ORZ A;  3IB3 A;  3I2K A;  1GNY A;  4BJ0 A;  4UI9 L;  2VC9 A;  4RYD A;  1H6Y A;  2YC2 A;  4M4P A;  2CDO A;  1F4H A;  2PQS A;  2J1V A;  4CUB A;  1YQ2 A;  2VZU A;  2ZEZ A;  4JHZ A;  1L7R A;  2Y64 A;  2Y6K A;  2QBX A;  3OEA A;  4GWJ A;  3T2P A;  1PX3 A;  4UAP A;  3VD9 A;  2VCA A;  2WDB A;  3WNL A;  2QQL A;  2J22 A;  2Y6L A;  2WZE A;  3IDA A;  3CZJ A;  1J83 A;  2XON A;  3VDA A;  4QX1 A;  3OGR A;  2DCK A;  4ARX A;  1ULO A;  4D8M A;  4LPL A;  3BGA A;  3MO4 A;  5JMO A;  1CX1 A;  1JZ5 A;  3PUI A;  3SKV A;  4QPW A;  4W4Z A;  2VZ1 A;  1JU3 A;  1L7Q A;  4QB2 A;  1LNS A;  1GUI A;  2C4X A;  4A3Z A;  3SEP A;  3BN6 A;  3CQO A;  4QX2 A;  5JXG A;  1OD3 A;  3GGL A;  1JYN A;  4JKK A;  1GU3 A;  3T08 A;  3I97 A;  4D0Q A;  2EIC A;  4P00 B;  4AG4 A;  3I2H A;  1UZ0 A;  3III A;  3NRU A;  1F4A A;  3SKJ E;  4GWI A;  1I5P A;  2JE8 A;  4HG6 B;  1NKG A;  3GDB A;  2OKX A;  2VMD A;  2VTF A;  3A23 A;  3K46 A;  3LEI A;  2V72 A;  4CUA A;  3GXU A;  2C9K A;  1XPW A;  1SHW B;  3I2I A;  2WO1 A;  1JI6 A;  1UY3 A;  1CIY A;  4MAD A;  2J7M A;  3F2Z A;  1UY0 A;  3UES A;  5DMY A;  2BER A;  2EID A;  1UXZ A;  2RJ2 A;  2W1Q A;  4DXS A;  3K4D A;  2VZR A;  1PX4 A;  3MUZ 1;  1NX9 A;  4LQR A;  2B4K A;  2ZXQ A;  3I3B A;  5LA2 A;  1CZV A;  4QB6 A;  5DPN A;  2J1T A;  3PUH A;  1DLC A;  4XZU G;  2WZ8 A;  1MPX A;  2W95 A;  3ACG A;  1UY2 A;  2W46 A;  4P5Y A;  3UET A;  3T0A A;  2JDA A;  2W91 A;  5EJZ B;  5JXI A;  1JZ4 A;  3ACI A;  2VZO A;  4OUE A;  4DEQ A;  3HNB M;  3ABZ A;  2VME A;  3OEB A;  1JZ7 A;  5CZK A;  1D7P M;  2W94 A;  3T2O A;  3LPF A;  2VZT A;  1OF3 A;  1KGY A;  4MGQ A;  2Y8K A;  2J1E A;  2QQJ A;  2W47 A;  3DYP A;  2HYX A;  3HPN A;  4QX3 A;  4CU8 A;  1O8S A;  1T2X A;  4W8J A;  1NUK A;  2VCC A;  3A22 A;  4KWU A;  3WNO A;  4AAX A;  3I2G A;  3D3A A;  4L0P A;  1BHG A;  2YG0 A;  2JD9 A;  3WNN A;  3K4Z A;  3IAP A;  3IAQ A;  4XVH A;  1RYY A;  3CMG A;  3EYP A;  3FHQ A;  5B4N A;  1JZ6 A;  5IFT A;  3W5N A;  2X10 A;  3LQC A;  4PF1 A;  4XUP A;  4IUG A;  4DUW A;  3VD3 A;  4BK4 A;  3MUY 1;  4MO3 M;  2VCB A;  3OB8 A;  3HJR A;  3K77 A;  1O8P A;  1R64 A;  3DEC A;  1O59 A;  2ZEY A;  3CZU A;  2W5F A;  2VOT A;  3CIH A;  3I2J A;  3P1I A;  2QQN A;  3T0B A;  3HNY M;  4JKM A;  2X05 A;  3WSO A;  1P8J A;  3U37 A;  2ZEX A;  2VM9 A;  2VZP A;  4OMC A;  3WNK A;  5F7U A;  4JKL A;  1UMH A;  4UOJ A;  4OMD A;  3K4A A;  2ID4 A;  4ZXE A;  1GMM A;  3C7E A;  3ECQ A;  4XUN A;  2BGO A;  2W87 A;  5IJR A;  5JR2 A;  3VD4 A;  1TVG A;  4QDQ A;  3HOB A;  5C71 A;  2ZEW A;  4RN5 A;  3ACF A;  1K3I A;  1JHJ A;  3FHA A;  4OZO A;  4M4R A;  5CYY A;  3WF0 A;  2W3J A;  5J1X A;  3MBW A;  1UYX A;  3WQB A;  2WQ8 A;  5HPO A;  5I0D A;  1XNA A;  3NJV A;  3J7H A;  3GM8 A;  4A4A A;  3NJX A;  2BBA A;  2WN3 A;  5IYY A;  4A6O A;  2L9L A;  2W1W A;  5G05 L;  2YFZ A;  1W9T A;  1XNT A;  1W9W A;  2J1R A;  2QQI A;  4JX0 A;  3K75 B;  4ZY9 A;  2DCJ A;  2R7E B;  2RVA A;  2YC4 A;  2HLE A;  2WAB A;  1W8O A;  2YFU A;  4E8D A;  2VQU A;  2Z4F A;  1DYO A;  4KMQ A;  2WYS A;  5JXJ A;  5HXM A;  5G04 L;  2EIB A;  3OBA A;  2QQM A;  4MGS A;  1K45 A;  2W1U A;  2J1S A;  2VR4 A;  1JZ8 A;  3CDZ B;  3OGV A;  3WF2 A;  1UMI A;  3I3E A;  4BDV B;  2WO2 A;  4KI5 M;  3ZM8 A;  1DP0 A;  4QDR A;  1IQD C;  2J1U A;  4QB1 A;  2W9X A;  1WCQ A;  4DXR A;  2ORX A;  5FUI A;  4XUR A;  3WF3 A;  1US2 A;  3WNM A;  2E31 A;  3OGS A;  1K42 A;  1JYV A;  2RV9 A;  5EIY B;  2VMF A;  3WEZ A;  2WN2 A;  4A42 A;  1W8N A;  2XQX A;  1CZS A;  3C7H A;  2WBK A;  4A44 A;  4ARY A;  1EUT A;  4QAW A;  3C8X A;  4A45 A;  4PT6 A;  1ULP A;  1NAE A;  4ZZ5 A;  4CUC A;  3AC0 A;  4A41 A;  1EUU A;  3UNP A;  3HNM A;  3VD7 A;  5LA1 A;  4ET7 A;  3C7G A;  3VDC A;  5LA0 A;  2V4V A;  2VMC A;  3W5M A;  5DQ0 A;  2DDU A;  5IFP A;  3ACH A;  3DYM A;  4CU6 A;  2E26 A;  2KD7 A;  2E33 A;  2VZQ A;  4MOA A;  4P08 A;  4E8C A;  4CVU A;  4DUV A;  4DUX A;  3CKH A;  3HN3 A;  2Y6J A;  1XC6 A;  2VZ3 A;  2C26 A;  2W92 A;  4LKS A;  2E32 A;  4CU9 A;  4ZZ8 A;  4QDS A;  1OF4 A;  4XUO A;  5JXH A;  3WF4 A;  3T0D A;  3A21 A;  1JZ3 A;  3NQH A;  5C7G A;  4Z2A A;  3VDB A;  1PMJ X;  1SG3 A;  1JZ2 A;  3T09 A;  4GZ9 A;  2VZS A;  2Y6G A;  2BZD A;  2EIE A;  4TTG A;  1GOH A;  1CZT A;  1UX7 A;  3MV0 1;  3EB7 A;  5DN2 A;  2JKX A;  3LEG A;  3THD A;  2CDP A;  2X09 A;  1W9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...