3HNOA

Crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
417
structure length
395
Chain Sequence
AAKNAFYAQSGGVTAVINASAAGVIEAARKQSGKIGRIYAGRNGIIGALTEDLIDTGQESDAAISALRYTPSGAFGSCRYKNRREYERLIEVFKAHDIGYFFYNGGGDSADTCLKVSQLSGTLGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASFDVASMSATSTKVFVLEVMGRHAGWIAAAGGLASSPEREIPVVILFPEISFDKQKFLAKVDSCVKKFGYCSVVVSEGVKGDDGKFGGVAPVVASMVKEGLGLKYHWGVADYLQRAARHIASKTDVEQAYAMGQAAVEFAVQGHNSVMPTIERISAPYQWKVGMAQLSQVANVEKMMPENFITEDGFGITDLCREYLAPLIEGEDYPPYKDGLPDYVRLKNVAVPKKLSGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pyrophosphate-dependent phosphofructokinase from Nitrosospira multiformis. Northeast Structural Genomics Consortium target id NmR42
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Transferase
molecule keywords Pyrophosphate-dependent phosphofructokinase
total genus 136
structure length 395
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hnoA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hnoA02
4OHBA 4LJKA 2IZ6A 3SBXA 1MTOA 2F62A 2Q4OA 4JELA 1WEHA 4RH3A 4WL0A 1RCUA 1F8YA 4JEMA 3GH1A 4KXLA 4FYIA 4LJLA 4A3SA 1YDHA 1S2IA 2F2TA 3UQZA 4P5DA 4JENA 1WEKA 3EHDA 2A33A 2HIGA 4HX9A 4NPAA 1F8XA 2KLHA 2PFKA 3O8NA 4I4IA 3F5MA 5ITSA 4I36A 3OPYB 5AJUA 4MCJA 4FYHA 3O8OB 2IZ7A 4U1RA 3QUAA 1ZXXA 2NX2A 2IZ5A 3O8OA 4P5EA 5AJTA 2PMBA 4OHRA 4MEJA 6PFKA 1S3FA 3K2QA 3OPYA 4FYKA 3MAJA 4I7EA 1PFKA 4LJRA 2F48A 1S2GA 2A0KA 3IMKA 4KXMA 3U39A 3O8LA 1KZHA 2F67A 1S2LA 2Q4DA 4KXNA 1S2DA 3BQ9A 4PFKA 2F64A 3PFKA 2KHZA 1T35A 3HNOA
chains in the Genus database with same CATH superfamily
1EU1A 2VNJA 3HN7A 1YCDA 4LJKA 2XB2A 1D4FA 3P2MA 3WGNA 1DRJA 3O8CA 1NDHA 4ZOLB 5CVEA 4R05A 2BFOA 4WFIA 1E1QA 3WHLA 3TR6A 4CF5A 3LXRA 1BDBA 4BVKA 3CH6A 1N2JA 4WKBA 5AVSA 1EE9A 2P2LA 4QRHA 2I29A 3K9GA 4LJ5A 1W581 4MCHA 3LRTA 2CMDA 3ACCA 4CV1A 2BDEA 4MUAA 3T3MB 1C14A 2J3EA 1DWOA 1JG2A 2Q4RA 3R20A 1KOGA 2FEMA 2IOYA 3EWIA 1VIAA 2QAJA 2X8AA 3QKSA 4P7BA 1UBMS 3ANNA 5CFMA 1N6IA 5D5QA 2EKPA 2HGZA 3IDQA 1RRPA 1OLXA 3IGFA 5GVRA 1BH6A 1QZ3A 2OHIA 5BQOA 5AOAA 1RM5A 4L0QA 5FF9A 3I52A 1GIAA 5SYAA 4JUCA 1H2HA 3GLVA 4PLWA 1UJCA 5L3SA 2QX4A 4QNMA 2BIFA 3JVVA 3V8QA 1JR3E 2JAQA 3RVSA 2JLSA 1NVAA 4BVHA 4MV3A 1G21B 2EKLA 3VXKA 1FS6A 2I8AA 5GMOA 4A1OA 3BICA 1F0YA 4R9VA 2EXXA 2IBTA 3WISA 1PZMA 2X15A 3E70C 5HDBB 5SY6A 1MX1A 3H5AA 5H0IA 2VQFB 3CLTD 3WLEA 2J41A 3KQNA 3QENA 1QPGA 4KI0A 4QQ8A 1MB2A 1R27A 1XTKA 4YAFA 1PWHA 3BFVA 4DYVA 5HSGA 1O87A 5JYCA 3C45A 1XLVA 3SZUA 4HGRA 1JL3A 2R96A 1ECGA 2WI8A 1H9CA 9LDBA 3MCZA 3L82B 4Q37A 5LM3A 1ZXXA 2IZ5A 1ST3A 2ZUUA 3KOOA 4FR5A 5FJIA 2RHOA 5H9VA 2DFDA 5ALMA 2Z4SA 3DPUA 3U40A 3UXYA 4RPLA 4F5WA 4ZN6A 1RBMA 5IJ9A 1JW9B 4ZDJA 3QIVA 3VPAA 5BW4A 3OQ6A 2APJA 1FPQA 1GCOA 2QYOA 4NP6A 4PM4A 3W05A 3W6NA 1QC5B 1JAXA 4AO8A 3ERCA 3KTFA 1XTIA 1AS0A 1G3RA 1ID1A 1AF4A 1Q1NA 1JI0A 1VSUA 2VP3A 3HWRA 4B75A 1C9KA 3EFEA 2GLXA 2D5IA 3P0RA 1X2BA 3E4CA 4DJAA 5B7QA 2Z2YA 4JJAA 2DUNA 1PR9A 2J8ZA 1RVV1 2VF5X 3CA8A 4IXWA 4C0JA 5I7OA 4K6CA 4DCTA 2GAJA 3H2SA 4GG1A 1P2DA 3R5FA 1TVEA 3OQHA 5AH0A 3K9LA 3KM0A 2YASA 4UCWA 1O9GA 1HDYA 3EGCA 1CV2A 2B1JA 2UZ1B 3T7SA 1G291 2IEDA 1W1IA 2SCUA 3GCWA 4M21A 3QFHA 3HU1A 5DV9A 5LZ5A 5F9MA 3MHPA 3SJUA 3AB8A 1KJQA 3P26A 3H75A 2L69A 4PSUA 4F5DA 5A5GA 5IWCA 1S3SA 1IY1A 3M6IA 1SB8A 4O29A 4X1IB 1G55A 4HQ6A 2NP7A 1QP7A 3RVOA 2M2IA 4ZRDA 1SEVA 4H27A 1GRRA 3OCYA 1TTTA 3VH3A 4IUBS 2PXXA 5CTJA 3LIPA 3P9RA 4LE2A 1KMMA 3V8BA 1SUSA 3T3OA 1YONA 3EF1A 4YT5A 5BYBA 5TC4A 5DWVA 4U9IS 3RVPA 2F3TA 4JLBA 2Q4EA 1YMQA 5TX7A 1G4HA 1Z5VA 4L75A 4NTZA 2X77A 4IJWA 4YRQA 3L18A 3PDHA 4MR7B 5C4MA 2QZZA 2R4UA 2GF0A 4EHBA 3VKFA 4G0VA 1BQ4A 3F5SA 3QA9A 4OQDA 2YY6A 3RFXA 5GJVC 1W36B 3R7NA 2YZ7A 4NFHA 4EFMA 4BNMA 5IDWA 1GDTA 4HQKA 5G3ZA 5JZMA 2W8BA 4GDFA 1W5AA 2FJPA 2JCSA 3P0EA 1QFJA 2PTGA 2Z9BA 3EVTA 1NJ8A 4GSKA 4R0MA 3GIWA 3WIOA 1FMTA 3F2VA 1MFZA 4K2AA 1WU7A 2EP5A 3N87A 3HLTA 3NUZA 4U02A 4Y30A 5TS3A 1Y9EA 3GNQA 3G8BA 4W9RA 5EWLB 4YLYA 3PRHA 3VOAA 2ILTA 2PU7A 3KAPA 3OZUA 4YT4A 3WK9A 2VPWA 5EIOA 3DHYA 4N7BA 4BKOA 3ND7A 3A2MA 5LLDA 2YKGA 3RUPA 5DN9A 2H5EA 2K87A 2RE8A 1MXHA 3NEJA 2X0KA 1NWCA 3Q8LA 4QNRA 3IBFA 1KAGA 3EXIB 2NZWA 4NQZA 3Q12A 4MK4A 4XYEA 2JIZD 4ZEOA 1C7ZA 5JJ5A 1N5DA 3T1QA 1MEEA 1O58A 1TYZA 4AZ0A 3ZD7A 3NDPA 3OU6A 3BA1A 5AXCA 3UB3A 2WA2A 2YQ5A 4D99A 1J21A 1Y1TA 3H1BA 4NNJA 1RWNA 1RKUA 4TV8A 1IM8A 4HEJA 3O4FA 3WIBA 2B34A 5C0OE 8LDHA 1J2TA 1PDOA 4PRKA 1A5TA 3ESDA 2P9BA 3N8DA 1N8TA 4ZU6X 4F93B 5J4VA 2H7CA 3H2HA 4IOLA 4EB8A 3H8SA 4DIDA 3D2LA 1YS7A 1BYIA 1XRNA 1QGAA 4GWGA 3TKAA 2QUHA 1SCIA 5FWAA 4FMCF 2MCFA 3KZMA 2QSUA 2BHNA 2FSGA 1INLA 1M34E 2A78A 3AFNA 4MJ7A 3HWX1 4B3BA 1H66A 1QQ7A 4FQ5A 3CSSA 3IB6A 1BEUB 2ECPA 4HNAB 4MVJF 4Q1FA 2W2LD 4FSXA 4QRIA 3BE8A 3SQDA 3CW8X 1V3QE 4J0FA 2P9GA 3OIGA 1Y6ZA 3MWLA 5FDFA 4WERA 2IXEA 4OEHA 1J8QA 1GNRA 1NPDA 1K75A 2XOKD 2Z09A 4L57A 3HY3A 3H8JA 1IN1A 3HDQA 2ZUFA 3G68A 3GUUA 4IG4A 4X6YA 3TLYA 2WZDA 1NBHA 1WMDA 3BWDD 4QPCA 4CQMA 2NXJA 4HQOA 4QWWA 5L8VA 4U2BA 3IKJA 3DWEX 3ASYA 1BQEA 4JC4A 1QLHA 2QWXA 3MWFA 3QOXA 4UHFA 2JB9A 4CF4A 5BQ3A 3DEAA 4UE3S 3A4IA 5H9WA 1N2HA 1YO6A 3F1LA 1KZHA 4C5BA 4Q3BA 3A1TA 4G3XA 1USKA 1XLTA 3ESBA 4MVJM 4MRMB 2V97A 1ENYA 1WTCA 4E21A 4CMKA 1TFRA 5EZYF 3LKVA 3OJEA 4DM3A 1QJ4A 2ONZA 3B70A 1J5XA 2IZ6A 1JEEA 1YJQA 3AZOA 3CMMA 4DBLE 1L5GB 5GONA 4RD3A 4A10A 3WL4A 3JARB 4MWEA 4REMA 1YAHA 3AH8A 4Q9HA 4TV9F 1MDBA 1MORA 3VNQA 1JECA 1OTXA 3MRVA 5JSKA 2NVOA 3NC4A 2CYBA 4ND3A 3UMCA 1RCUA 4F06A 3SIRA 1K4YA 4Z7NB 2IDKA 1P5FA 1KQPA 4HLNA 3WIUA 1RXCA 5DYYA 1OBFO 3SK0A 1JEJA 2FOLA 2HSWA 5ESXA 1BD3A 1QOZA 3TSWA 4A3SA 4YAKA 5A04A 3ZDAA 2IS1A 2G88A 2CD9A 1VJTA 2XZTA 1D09A 2WLTA 4JBIA 4FGJA 1SXJC 1PEYA 4FN5A 3EGDB 2C82A 1U80A 3OTQA 3PKIA 2I66A 1E2UA 3D1JA 2FX5A 1UMCA 5CFZA 3EQ7A 2G9UA 1F8XA 5JXIA 3E03A 3OMWA 1I4EB 4M0CA 4C4SA 2OHHA 1B26A 3U3OA 1MIHA 1NM5A 3NBAA 1Z2PX 5CDHA 4U9UA 5JHHB 2P3SA 3Q7PA 2OCGA 4WNAA 3W5HA 1T5BA 4LJ6A 3FKSD 1PG2A 2RHBA 2Y92A 2VWPA 2FJ0A 3C3PA 3HV2A 3JTMA 3VUFA 3H7IA 1JXMA 2B69A 4KAAA 4ZTUB 1T2UA 3FWKA 3LUJA 4FEYA 1DXHA 4Q7JB 3IBYA 4GEKA 4OUKX 2R65A 1H4TA 1SCQA 2BGRA 2VUIB 2EZ8A 1B3RA 2N42A 3OZDA 4G0ZA 2JIQA 3S8EA 2PO5A 4GS5A 4BB0A 4FDTA 4HRXA 1ZINA 3FYHA 4UHBA 2OGSA 3VDMA 1UPBA 2GXUA 2MR5A 3ETEA 4NENB 4WLUA 3OZGA 4UCXA 3ZV6A 4NBWA 3IUEA 3UGTA 4DUYB 4OM7A 1TUEA 2XUFA 4TTQA 4JD5A 2NO9A 3FBTA 3TOZA 4G4JA 4MTCA 4IICA 5BO5A 4ZHQA 4R8KA 4Z0HO 4ZJYA 1H65A 1IHUA 3SC2A 5JAHA 1IE3A 4MKZA 2Z5LA 1T4MA 3RC7A 1G1AA 3IB3A 3V1MA 5C8DA 5A9TA 3AK4A 2IEIA 1ZW6A 4AWBA 1JNXX 3AR3A 3R0ZA 2VSXA 3MJDA 4QOHA 3RK4A 2XRMA 3UT5A 4EI7A 1KEVA 4NZNA 3AR8A 2YTZA 3GG2A 4MXDA 4QATA 4FLFA 4Y2UA 4FUTA 2J32A 1I24A 3L6EA 4A2QA 1QH1B 1P0FA 1ZXBA 2QT9A 3FVRA 4UD2A 2G6TA 2TS1A 2C84A 5DM4A 4EP1A 4OQNA 4PYKA 5EHZA 2CMGA 1XZLA 3WHKA 1OX6A 3ADBA 2H2HA 4MMYB 4CM9D 2D1TA 1FYWA 4NEQA 2GZ1A 3U9LA 2EIXA 2FEPA 3AEQA 1E3EA 1X14A 4Z9YA 1DMSA 1E1QD 1TMGE 3FM9A 4D98A 1JXQA 1SKBA 3N3BC 1U0BB 4NZYA 1B8PA 1YDWA 3VHXA 5EZYA 1I5RA 1WMAA 1CUEA 1CUSA 3OVMA 4YFYA 3M4XA 5DTRA 3VPDA 4WDQA 5JISA 4EGSA 1Z82A 1OBCA 4O59O 3OQIB 4RQUA 4I55B 5FOVA 4ARBA 3PS9A 4D9HA 2OCKA 1EFTA 3IQXA 1CS0A 5EFOA 1UIRA 3TJRA 5KNBD 1QS0A 2NSDA 5EC8A 3PL5A 3T9CA 1IRIA 3ZWNA 2GD2A 3IUSA 2WZCA 3KSUA 2Z3ZA 3V7FA 3ZHSA 1JKJB 3GVIA 2NO5A 2PL9A 2REOA 4PQEA 4NE9A 4E11A 4ZT2A 1WABA 3HGMA 3SYLA 1BMQA 2PD4A 3VAYA 1JDVA 3H5VA 1HNWB 4HGNA 1EFVA 3RU7A 1R0YA 1LLQA 3BWXA 3CZQA 3WK8A 1IHYA 1FNDA 3LCCA 4IGFA 5BSKA 4N3GA 1V5IA 3K1YA 3M5CA 2PSEA 4PIPA 2Q0QA 3USCS 3GI1A 5JCOC 2AOTA 3ILVA 5BN1A 1T2AA 2IU6A 5F2NA 4JCCA 3HN2A 1VP3A 5AW1A 5D86A 3VHRA 3DVRX 4BMZA 2VJNA 1Q0RA 4ZV9A 1RADA 2HDOA 3V2UA 4C30A 2BZSA 5DULA 4W9MC 2UXDB 3INTA 1Z5WA 1IPHA 1E3LA 1HQCA 3OH8A 1FFSA 1P2TA 1HYEA 1TQ4A 2J3QA 2AEMA 4XW2A 4WCFB 4RKYA 4IY1A 1IJBA 1P1HA 3TNYA 3PEWA 1MZPA 3G59A 2YJ6A 4M9QA 5EE5B 2WHPA 4YP6A 4X3OA 2AJDA 4GOJA 3SYNA 1JYEA 4ATNA 5BN4B 2WMNB 1KO1A 1N1GA 4IQ8A 1M8GA 3RHZA 1T9ZA 4BMOB 3IUQA 3TS1A 1Z33A 1Z2EA 5LLTA 2R6JA 4MSUA 5CTAA 4F1WA 4YV7A 5LYJF 1K0UA 2FXVA 4JUBA 3VH4A 2R0QC 1I6KA 1V1RA 2C4MA 1ZU5A 2SKDA 2ZW9A 3BCHA 2GMWA 2H1OA 4OPMA 3SZOA 1TECE 4XX0B 4M0PA 3OZCA 4DJ5X 3LQYA 1AZSC 3GPIA 4NX2A 4YCBA 3QG1A 721PA 2Z95A 3BJIC 3I32A 3EDYA 2IA5A 2ONYA 3NV7A 3NJRA 3TQSA 4QOGA 2EZ9A 5BW6B 1GAXA 2AX4A 2J6BA 4N40A 4F86A 3UCFA 2BCEA 1PJQA 3RJZA 4TQ9A 2NO0A 2OV3A 3B6MA 1VYUA 4WZBE 2Y76A 1CR1A 2QORA 4EVRA 1TCBA 1DX9A 1PSZA 1V8FA 1GZ5A 1Y9AA 3CBQA 4HQFA 3ECSA 4XQ0A 2OV6A 4BZXA 1L1RA 4M9SA 4JQZA 2ZREA 3F73A 2JIBA 3D3WA 3ECCA 3RFVA 4PZAA 4MW1A 3ZCXA 1R88A 4KQWA 5AQ1A 3HZZA 4C0HA 1A7UA 1ZY2A 1WUYA 2V9PA 1NOJA 3EY9A 2RKWA 2ZSDA 3JX9A 3EEFA 1DRWA 3OFSA 4LQDA 5JS1A 5EMLA 2PMCA 4ZV7A 3R75A 2XJ4A 2DLNA 4KX3A 2SICE 2PT9A 4LOIA 4IIJB 3JQBC 4J4TA 1VKJA 2G1KA 4KH0A 3TRHA 3HU5A 4JGIA 1U9ZA 5D1HA 1E2NA 5LKRA 1XFDA 3CT4A 3CZ4A 2B4YA 1JG6A 1HMPA 2GF2A 3H1TA 3M6UA 5FJJA 4IQ0A 1EUYA 4Z9XA 1WMEA 3I23A 5EP4A 4FWIB 3HCBA 1EGMB 3LHIA 4AZTA 1U8TA 3HJAA 2FB9A 4ND5A 5JWOA 4RXTA 1YVDA 3EASA 2O2GA 2XVYA 4DWOA 3QXXA 1KI4A 2JIRA 3D3JA 1HTTA 2GWRA 4IP0A 2FE1A 3I2HA 4C7XA 5FH9A 1WR8A 4HLQB 1PYDA 2O23A 2BFPA 2ZBFA 3LAWA 4G26A 4ZP1A 1N2EA 2ADOA 2QGFA 3OLVA 1EFAA 3AB3A 4QXAA 2P0AA 4PSVA 2AN3A 3EDRA 1E1DA 1JH9A 2C2YA 1KVUA 5ECYA 1XTSA 2EL7A 3AEYA 3CE9A 4GZ6A 1ZJYA 4X6XA 4E5KA 5HGXA 3UJ6A 2C8JA 2WD9A 4NKRA 1L7NA 3COZA 4DMHA 2AHOA 2Y9PB 3AV3A 3L4BA 1Z4PX 3NETA 2GCEA 2EW1A 4LX8A 1CSEE 4Y1GA 5LOVB 5G0VA 1P61B 2O4UX 2OHOA 5A4DA 1U2RA 4GX2A 3PZRA 2OK8A 1IK4A 4K7JA 1I2ZA 1RHMA 2VYFA 4P33A 2RGEA 1VIDA 3IAHA 3JR3A 4PYJA 1XHFA 2QV7A 4E5DA 4AICA 1DJQA 1R8QA 4N49A 2W0SA 3MQ2A 1GPWB 1YI0A 4YMSA 1M2JA 3NOOA 4YJ3B 1MX5A 2BMWA 2QN3A 2Q2QA 3GLGB 4RJKA 1CQWA 2AZTA 1HDOA 2ABWA 1GFIA 2ID8A 2A1UB 1YS2X 4R54A 1RZRA 2BH2A 1DJPA 1CZLA 4UUBA 2G5GX 4V24A 1AHIA 1KK0A 4I5GA 4WEOA 3SF8A 5JJKA 2D00A 3RGWS 1YRWA 2ZE7A 3B48A 4YXWA 4AYTA 4GLOA 2VJOA 3VO9A 2QVZX 4ZZ3A 1E7RA 3FGNA 4E14A 4HX9A 4DEXA 7ABPA 3OZ7A 4PX3A 4B3DA 1M6HA 3QFTA 2E5WA 5I5GA 1TAGA 1V45E 1KFCB 1Z47A 2V5VA 4IDAA 1Q0TA 2UUBB 1EP1B 3R0QA 1RM0A 5FBQB 4AY2A 2A8YA 2XW6A 1QS0B 4HGZA 1J39A 2OKCA 1D8TA 1Q7RA 3LHFA 4YT8A 2NT4A 2PFGA 5F4ZA 2JLBA 2D2IA 3AVXA 3ZGNA 1BKDR 3RSQA 3I8XA 3QXSA 3B8EA 1EDOA 1T0PA 4WTOA 5IANA 5ESWA 1SUCA 1X8LA 4TUYA 1V48A 2CVQA 3IV7A 3ZH2A 1UM8A 2ZUTA 3IQIX 6AT1A 2FN9A 1VKHA 3FPFA 1DJMA 4ARCA 3QNWA 4LXUA 3U5ZB 1M34A 1AMOA 5FB3A 2JH9A 4UDNA 1RI3A 1KQ3A 5L4NA 2D06A 2Q3FA 5IRCD 4ZREA 3KTDA 4Y2PA 4TXJA 4RTLA 1RBYA 1EAMA 3W3ZB 1DWQA 5K4HA 5ALZA 1VMDA 4J2TA 4UU7A 1G38A 1F8FA 2OLKA 2VHQA 3RRZA 4FN4A 1DMRA 2JGKA 2OHFA 3GJTA 5C8YA 2EJUA 4JXJA 3ZDRA 1OAOA 4YMGA 4M1SA 3ZD6A 3CIFA 5CX1B 1SVLA 3UKJA 1KVSA 1OV6A 2C20A 2FGKA 421PA 1ECCA 4DUGA 4YXWD 1OFGA 1H2XA 4DLVA 1OBOA 1NW5A 5PGMA 2O8FA 2ZXFA 2WVGA 3U62A 2ZJ3A 4WJKB 4QPZA 1Q17A 4P4NA 3DOUA 3U4AA 3X2FA 3LT0A 4YUZA 5KEIA 1J6UA 2RHTA 4LF9B 1QYDA 1D2AA 5JPDA 1TCUA 2BUBA 2I80A 4NU0A 5IBQA 2VRBA 5HUJA 1Y8QB 1MEOA 5JXGA 3IYLW 3N8IA 3Q0EA 4NJOA 1DGQA 4LFAB 4MW6A 1Q1AA 4V0ME 3VR6A 4GP7A 4DANA 1SVSA 4EJ0A 3C8ZA 1N5KA 3THYB 1CRQA 1NVFA 3SR4A 3OX4A 2YXLA 4Y2XA 4D9NA 1XEWY 4XB2A 1F2DA 4Y0AA 4YQFA 5SYNA 3F0TA 3OZVA 5GP1A 2IW3A 3LBAA 4ER3A 1X1CA 3NAGA 2FY8A 4M1TA 4XUEA 3LYLA 2QN2A 1TUIA 3I64A 1XCGB 4II3A 1HK7A 2JFZA 3NAQA 4UDOA 4CN8A 5LP6C 4CTKA 1VM6A 3BTVA 5BYAA 3OZBA 4WFQA 1SURA 2FRDC 1TIPA 4E08A 2HX1A 4BEJA 1HO3A 1UKCA 3ROEA 3KXKA 5ALDA 1CR2A 1NJ5A 4XIFA 2BFDB 3C5WP 3JASB 5AJWA 3RJMA 1JEAA 3NH6A 3UY4A 4C1BA 1M2NA 2O8EA 3CISA 3DLTA 1CUUA 3EXAA 3JR7A 1P3DA 3AF4A 5EMKA 3RC8A 2Q28A 3EFBA 1DC5A 1VJDA 4YAEA 3D4NA 4E7PA 1SAYA 1K5GA 1E4EB 2C58A 3M0EA 1UZAA 2YFYA 4IVPA 4M83A 3GP8A 5DHPA 3IT1A 1THGA 3TSYA 1E3JA 2O52A 5DBFA 2R2GA 1XZMA 4ZI3A 5INTA 3B3GA 2F1HA 1GNSA 3DZCA 1MT0A 3IEIA 4FT4A 1UANA 4LVUA 1VCOA 3KSMA 4EG0A 4RPHA 3NZEA 2HDWA 3D0RA 5FOUA 1NNUA 1VE6A 4X91A 3T52A 4R8VA 2IIVA 2Y77A 4DV7B 2JDID 2PT5A 2ODQA 4G1VA 2VWGA 3A3KA 3HJUA 4MVJH 3V2IA 3UWKA 1DQRA 1ACJA 1FTGA 4DJTA 1XZGA 3CRQA 3LC1O 1R4NA 1VBMA 1XG5A 3U19A 3OTOB 4RFSB 1E3WA 2VO1A 4E0BA 3HI4A 2QG9A 5JZSA 2DWUA 5GWXA 3VGJA 3JZAA 4ZV4A 3KFVA 4YP5A 1POWA 2G7ZA 1NHWA 3REQB 3X2EA 3S81A 2P7IA 3CW2A 3OKAA 5DTJA 2PEYA 1UFOA 2IUEA 2XJ9A 4EUHA 2BVNA 5A0VA 2P69A 4NOJA 1ZH0A 3QP9A 1KR2A 4OAPA 2TMKA 3FWPA 3KHSA 4FDAA 3S1SA 1Z6PA 4GSYA 1V6CA 2IUYA 1RQLA 4X20A 1IZ9A 2VJCA 3CU5A 1H1LA 4KVGA 4FMCB 2AWOA 1I4TD 2A59A 2HA2A 3CUYA 5IYZF 3P9SA 3RVJA 1PJLA 5C5IA 1P31A 4IDPA 2PJUA 1N77A 1QIMA 1Z38A 5BNFA 4I1OA 2Z5FA 4AKEA 2VH1A 4AWXA 4C7KA 4P7KA 2JGDB 5KIAA 4A4DA 3GG9A 4GVLA 4QO8A 5HF5A 3UXMA 4YWJA 5C8ZA 3QX3A 5DCWA 2C94A 5JOQA 5L6MB 3UZUA 4PLZA 2Y9MB 3K8YA 5B64A 1X70A 2PZAA 5LA6A 2GKSA 3VSCA 5F1OA 1E2MA 4NRDA 3PDIA 2PUBA 1W4LA 1Z2NX 5ADHA 3EZGA 5I8PA 4GXNA 1MFPA 1MAVA 3KL4A 2OUIA 3ZU3A 2YXNA 1SXPA 1WZ2A 1Q6ZA 1PJSA 3R0XA 3BMOB 2IHBA 4HXYA 4INAA 3IA7A 1W4ZA 2ZSFA 4Z3DA 4BNWA 5C7YA 1NUUA 1T10A 3WRXA 4DWWA 2ACVA 1H6AA 1MVOA 4KG7A 3IC5A 4Y9TA 3E3MA 5FR1A 4JJKA 3NDJA 1VECA 4TMWA 3WAGA 3I0MA 1VRVA 5L45A 2X5KO 3BHIA 4RTOA 2C9DA 4N5MA 3TLGB 2JATA 3K31A 4FFSA 4R1QA 1H2ZA 1GU7A 2R8EA 1PVOA 5J63A 4RA6A 1PQYA 1QO9A 2IHJA 2Z98A 3JQ9C 4H1WA 5B6PA 2C4UA 1EWVA 2BN4A 4G5YA 4C0KA 4F6LA 3PX7A 4J0IA 4QNNA 2HPAA 4WXPA 3R4CA 4UBLA 3IEPA 2FCRA 4ENSA 3M3PA 3FHJA 2DH6A 1ZN7A 4HEA6 1GQYA 2CV1A 1O03A 4L16A 5IZCC 1FLAA 3A1NA 3GRPA 4KXUA 3HP7A 1ITZA 4OGGA 2VHXA 2M9MA 2RHDA 2I7VA 4Q3KA 2I2WA 1QGYA 2OG2A 1BWSA 1OWMA 2YJ3A 4N7MA 4EK9A 5K0LA 1MV5A 3QX7A 3N0WA 5EFZA 2W00A 4AMVA 3ANMA 4FWBA 4LGCA 4AZVA 3MWEB 1P7CA 3KBOA 1KDPA 2QMUA 4L4SA 3RUAA 4RTNA 2C04A 4JEMA 5CB0A 5IAGA 4Q9AA 5KYUA 1COZA 3CNLA 4D9IA 1RYNA 4EY7A 1QUEA 2R62A 1M10A 1M7BA 2WUVA 4ER6A 4RFSA 1K86A 1Y4SA 3PQ3A 3ZWYA 2WE7A 3M1AA 5TJ9A 3BJEA 1YHYA 3AU9A 3MVEA 4U2KA 1XQXA 3NYWA 1NV9A 3SMQA 1J42A 3FPJA 1SBNE 4QUBA 3STWA 4OBBA 1HNNA 3X0DA 5AVTA 5IXSA 3L7AA 2IYPA 4QUAA 3NBUA 4X7BA 4ZPJA 1CWUA 4REQA 4PWYA 4M37A 1NTOA 2C0PA 2NAFA 1MG0A 1C80A 4MPDA 2VG8A 3JAKB 5T7BA 4PZZA 3HU3A 1WSBA 1II0A 1VZ3A 3OT1A 5JI3E 4GT1A 1PU2A 2FSPA 4Q3NA 2C5GA 1KO4A 1QBKC 2EIHA 1H2BA 2B5VA 4IGKA 3VPHA 5CAEA 3SC2B 4XLTA 4FGKA 3BHNA 3CE6A 2DEUA 4IDQA 1DJOA 3H11B 5DN6A 1JEYB 2DFPA 3DKKA 3QLVC 2HXGA 4L5AA 2I4TA 4YASA 1IOLA 3I92A 3KUDA 3MERA 3UW1A 4AKTA 1I80A 1IZ0A 2VPXA 3HSYA 4TKUB 3W9UA 4AJNA 2LIPA 5L40A 4FPXA 2IE0A 3SE0A 4G9EA 2OGZA 5J2UB 2J48A 5K3DA 4IS2A 3D8BA 1YIDA 2AXNA 2EFCB 2DQKA 2QN7A 2UZIR 2ZAYA 4ZCQA 2NUTA 4G2TA 1LDMA 1N6HA 2B4RO 4IG9A 5JNUA 1VHDA 2P62A 2CJXA 2QIOA 2VDKB 3ONDA 1ZM7A 4C5CA 4OG2A 2GEDA 3HY4A 1HI9A 5HG0A 1SC9A 3VSBA 4B6FA 3THWB 2FFRA 2QTMA 3KQYA 4MP6A 1NP7A 1YL6A 3EFOB 3GGGA 4H0NA 3WQRA 2IPXA 5EKSA 1LTHR 5FTJA 4C43A 3W5JA 1Z0JA 2GXAA 1U4OA 4C2BA 2GESA 1K6JA 2PJRA 2VYQA 1Y1RA 3B2EA 4RUKA 3S5JA 3WNDA 3KQOA 5JDIA 2HDHA 2IXGA 2W37A 2RIRA 5F7ZA 3VV3A 3N58A 3COYA 1T9CA 3ZWAA 1IQ0A 2WFMA 1FYEA 4R40A 3R6DA 5HM6A 1W4RA 2QTRA 3P9IA 4BTVA 1TDJA 1EGHA 5IZ4A 3AR7A 5AKZA 3OOYA 3WYCA 3P2YA 2PSSA 4FHZA 4OQZA 5A4MS 3G2OA 5EINA 3UMJA 4YAGA 4MLCA 2IU0A 2VIIA 1P9WA 2BZGA 4ZZ2A 3TMKA 2R6CA 2PMEA 3ZIAA 1HT0A 1KRHA 1R0RE 2PZMA 5E4FA 2GUGA 2HF7A 1HG0A 3EEBA 3U39A 1FMFA 3RBAA 3MJRA 3U81A 1GGJA 3OEHA 1Z5NA 4EELA 2JFQA 4OQ4A 2ZSEA 1DCFA 1KAOA 2N1BA 3QA3E 4MITA 1YOBA 3ITEA 4WXHA 4NG4A 3SS8A 5BR8B 1JIQA 1F7VA 3CQ9A 1C0IA 3W34A 2HMTA 4LK2A 3EIWA 4TTAA 2QW0X 5AYVA 3IHKA 3HA7A 4HRYA 4XLZA 3M6WA 1USIA 2RHHA 5TEWA 2JGIA 1L5SA 3DGEC 2VJQA 4LGYA 2O1WA 2FUEA 5AJZA 1AXRA 5K51A 1ZEMA 1P45A 1QIDA 3W6UA 2R60A 4PLPA 4WK2B 3DYBA 5D3ZA 4BPRA 1ZGBA 2PRIA 3ZWDA 1OAKA 1BE8A 3RW9A 9ABPA 3V33A 2B9VA 1CC1S 4LGVA 1CXZA 4OA8A 3I4FA 3R7FA 5AW0A 5DGIA 5B3AA 2JCVA 3F3MA 4EUFA 1N5MA 3M5DA 4HDQB 4ER0A 1VG9B 3D6VA 4QBFA 3UOAB 3JQFA 4HOYA 1IC6A 3L02A 1TO1E 3OT4A 3FPBA 4BMYA 2V4UA 5DK6A 1U3DA 3CTPA 3NX4A 4CEHB 1QGDA 1G5IA 4ZZ1A 2WQ6A 2C29D 4KRXA 1A1VA 1XGKA 4WBXC 2DR2A 1SIBE 3DNFA 3I2YX 3VMFA 1TAQA 2JAOA 4ZVSA 4DCPA 3AONB 4P3KA 1W30A 2RGRA 4RSRA 2I33A 1FBTA 2D0PB 2C5HA 2AC7A 4I8IA 4RETA 2X2FA 1Q1ZA 1XPUA 4DR6B 2ZRIA 2IUSA 4XARA 3A3YA 1DBVO 1GRVA 1PK8A 2ZJZA 3BRWD 2DHEA 3H1AA 2FPUA 3SM3A 2FWMX 2VDJA 4NMXB 3DCIA 3R3JA 5FUWA 3TXXA 5H3LA 4DA6A 2XGMA 3VZCA 2YYYA 1U28A 2ZJ2A 4W4TA 2I3AA 3HVKA 3A6ZA 1MQ8B 4RPCA 4C14A 3PFBA 4IWXA 1PT7A 4OYLA 2QLNA 4DMRA 4C0BA 3TZHA 4FFMA 4J76A 3PYLA 3KLBA 1IZ7A 3A9UA 4N7JA 1PBNA 3VTZA 5JY1A 4RPKA 3CEHA 4F2PA 4CM4B 1FQWA 1V7QA 1JYSA 2RKOA 1K66A 2C9BA 4K8OA 3VOTA 5JHGB 1QYCA 4RENA 2J07A 1K68A 2PYZA 1PTJC 4IMJB 3W5SA 2LRHA 1M72A 3NOQA 3WGTA 4BO2A 2IXDA 1RT9A 4HB2A 1N6KA 5DP2A 5DRYA 2X5JO 4UMDA 1KWKA 1CF4A 1FP1D 3NR2A 5DHQA 2PSHA 5E9AA 3DL2A 2HRDA 3AVUA 4PTYA 2VT2A 4RO0A 1SIUA 3Q9LA 5EUBA 3T9BA 3ZXSA 4KN9S 1PGQA 4CG0A 2QPOA 1RWKA 1HWYA 3LF1A 2XA2A 4CFSA 3O38A 2WJWA 5ALGA 4N8SA 3UNXA 3HDYA 1FNNA 2ZGVA 3QX8A 4IJMA 3TFOA 1VG0B 5DVZA 1V5FA 2W6MA 4NPCA 3SDZA 2VSQA 1PR1A 4LVCA 4B45A 2QBYA 2H3EA 3F6EX 4HZGA 3GBSA 1L7VC 1J2JA 1S2LA 1W96A 3LLMA 4ZAYA 4EB6B 2CSXA 4GR9A 4U7HA 2O3UA 2XB4A 4F4HA 3DDOA 3U1VA 2GZMA 4BMNA 3F71A 1XEAA 4KR3A 1BGWA 2MHCA 1A71A 3A1VA 2Q3EA 5K45A 2NTVA 3KXIA 4B31A 2HBYA 2X0RA 1XV5A 1XVAA 2XYRA 5BSFA 5KB3A 2I78A 3JSAA 1M2GA 1RZUA 1AKQA 2RGYA 3JPWA 1ZW1A 1ZC3A 4R8RA 3BN3A 1TYCA 1NFFA 2GYUA 1SUPA 4C4TA 3ETNA 3QLJA 3O0TA 1WV1A 4S1PA 3PKZA 4WK4B 3MMXA 2AKAB 2BEWB 3EMVA 3WJ7A 2I6QA 3PVSA 2P0EA 5KQRA 4NXMB 1TJNA 3R24A 3ZWQA 1I0IA 1WLSA 1PUIA 3FH0A 1COWD 2ERCA 1W0KA 2BHTA 4MI9A 4R2IA 3ETJA 2BJVA 3BIWA 1QGOA 1JE0A 2FW7A 1ZL2A 2YUTA 1S2IA 4LXHA 4CR7A 3L0BA 4X66B 1H2AS 3HXMA 3R7BA 2HWWA 4MVJI 4BCBA 2WUGA 5A05A 4NARA 4GYJA 4XPIA 4B2PA 3ENNA 4P92A 4DA0A 3WMWA 3DR5A 5LQRA 4LMRA 2OV1A 3DYVA 3S5UA 5LOVA 3SC3A 4EI2A 3SHTA 2YHAA 4RCYA 4X7MA 3PQDA 3R7AA 1DEOA 1S9HA 1G4UR 3EG5A 3QKRA 3Q3EA 4URYR 5B3KA 1PR5A 3MELA 2DULA 1XVIA 1IU9A 5MN6A 2IHVA 3K2IA 2IYAA 3KLOA 3VI4B 4E5PA 1SC3A 3B3FA 5HQJA 1J4AA 3N07A 4YLGA 1X7HA 4QXRA 2RGXA 1RWOA 2UUAB 1U1CA 3Q1KA 4ED9A 2ZYVX 3TDMA 5KJ6A 3T0GA 2K2QB 4LK3A 1FJ2A 1KJ9A 1OFIA 2HJVA 3ZHOA 4M9CA 2OGUA 2R6GA 1T6XA 1A8PA 2G8LA 3MWEA 4OQXA 4WESA 3KNZA 2XNSA 3VNRA 5JNRA 1J8FA 3AQ4A 1N75A 1Z2OX 1OA1A 1TK2A 1UJNA 3FGPA 1IOZA 2Y68A 4OXRA 1D6SA 1H1LB 2I54A 3DE3X 3IXQA 2ECQA 3MBKA 4NCHA 4X45A 3N59A 4QFCA 5AHWA 5DNEA 2H2IA 4YALA 3DTVA 1U7WA 1OXSC 4TMVA 1KJNA 2EV9A 1UBKS 3L0PA 5ICCA 4DMUB 4BFTA 1EUCA 3BMXA 2BGTA 3QIAA 5ENDA 1P44A 4AMZA 3DB2A 1X1DA 1FSZA 1ZLYA 2PD6A 3REQA 4F2GA 5F73A 1NN1A 3NRCA 1XMXA 4D3FA 4D45A 1M2FA 3ONNA 3O2QB 4AAYA 2IWRA 3RCBA 1FSGA 4MUYA 1WHTA 2ATEA 2VK2A 3SG0A 5TLSA 3DMHA 1OROA 3KT6A 4C2AA 4RK4A 4YV0A 2HA4A 2HLHA 4JI7B 1OIVA 2C96A 3CPEA 2E85A 5DHFA 5F1YA 3JAWA 4AUKA 3QJ5A 4G9BA 4BLOA 1FLVA 2YWDA 3AWDA 2BFEA 4H35A 2A5JA 4MDFA 1F6DA 4XASA 4ZKDA 2ZVDA 5K8LA 4D0SA 5LA6B 2C4WA 1MC1A 1BMFD 3I30X 5KPJA 3EXHB 1XWFA 2FSUA 2ZRFA 5LBIA 2BM9A 2BSXA 2CFRA 2R8RA 3GMIA 4GLLA 1BOOA 3ANXA 3ZZTA 5K3BA 4D26A 4KXXA 3L7OA 5TPZD 4OP1A 1P7PA 1JAHA 1Q3KA 3H84A 2NO7A 1XZHA 2FUG6 2V6BA 3GQBA 3LOPA 1EP9A 4RWZA 1H2FA 4YB8A 3SNHA 2Q8PA 4A6PA 4JI0B 2IWHA 3UA3A 1JHYA 1FJHA 3NHBA 1SCNE 4UUAA 2OXEA 1CG6A 4KWIA 2R97A 1YFJA 2VT6A 3GA7A 2WKRA 3U6KA 3D3QA 5CFLA 5FWNA 4J6FA 1AC5A 4PO8A 4TV9A 5AI0A 4MQFB 4HQRA 2WJHA 4MW0A 2OZVA 1XVUA 4EI9A 1K88A 3GCZA 2WAOA 1ICEA 1BX1A 2QVXX 4NG5A 4URUR 4XIJA 1X9GA 1VHTA 2J9RA 3F7TA 2RGWA 1TKAA 3AR9A 3MT8A 3PL1A 4BVJA 5EHQA 1ORVA 2JLWA 3L84A 2QLLA 2DR3A 3LKBA 1QX3A 4QG3A 1HX7A 4J0EA 3I6ZA 1NE2A 4CXMA 3QMVA 3LOQA 5A7GA 3HHPA 1UJ5A 1V16A 3NVMB 5K8CA 2H11A 1H3EA 2VRNA 2IZ1A 1E92A 3SKVA 3JD0A 3NQ41 1BMTA 1ZRSA 1I36A 1X1SA 2PZKA 2QTCA 5CB4B 1CY6A 4LY6A 3HPQA 3DE1X 5LUBA 1RBZA 4U6NA 4XWOA 4RW0A 4U7WA 4CCWA 1I2AA 1I1OA 4HDNA 1I5EA 1B23P 3EB9A 5CBKA 1SIWA 3MJSA 3JVDA 3AYZB 4U0JA 2JLQA 4QPNA 5TE9A 4XEUA 5KTPA 3GWGA 2BUAA 1AT1A 2PXHA 3FD8A 4KFUA 3VJMA 3JQEA 3PVZA 3V4FA 3EPJA 1AQUA 4LPSA 3SSMA 1DO2A 4URHA 3D6MA 4FHGA 1MJFA 1XOIA 2C3OA 1YQQA 4XWTA 3HB4X 1P0QA 5K3FA 2VT3A 2FI1A 2I1QA 1CY4A 2YHBA 2Z6VA 3EWAA 1PD1A 1E5QA 1B8OA 1UBFA 4OGFA 5CJ2A 1ZM9A 3VU9B 2PLRA 4XDZA 1P3JA 5HMLA 3WLOA 1LFAA 3IP3A 3L6CA 3TRDA 3T8YA 4RK7A 3BKWA 3H1GA 4UXJA 3TOCA 3ROTA 2FQ1A 5AIBA 1DFHA 1AK9A 5EYPA 3WLIA 1NQXA 1G5HA 3HL0A 1U9IC 1UC4B 5D2CA 4BVAA 1XUOA 2NUBA 3OQVA 3FZNA 3ZW7A 1HFJA 4LSWA 1JMVA 3UTDA 3MLEA 1CRLA 1X92A 1YB4A 1W94A 4PX5A 1VRWA 4CLRA 1GPYA 5E6UA 1UDBA 3V9PA 2BFBA 2HZ7A 5JYBA 1OBVA 3E22B 5K6AA 3MTQA 4JU9A 3J81A 1ZUIA 3L04A 1G7SA 1F8UA 4MR9B 3KWFA 4B84A 3Q40A 4D3SA 2PYIA 2XB8A 1HE5A 5HFJA 2R1TB 4C7JA 1I7LA 2I1VB 2R751 1YGPA 3L43A 5T4BA 3RTEA 1Q21A 1AH2A 2ANBA 1QTIA 1TA0A 3OQOA 3BJZA 1KH1A 4DR1B 3SYMA 3IP6A 1UDRA 5IYZB 1NKSA 1S01A 3L6BA 3MCWA 5AVXA 3P8ZA 1G9TA 1NF9A 1SGWA 2VKQA 3MUEA 3GPCA 3EC2A 3OEED 4DABA 4U8GA 4D4KA 1GR0A 3TBFA 2P9CA 4ENQA 4I1VA 2RGAA 5DCUA 3ZZMA 4IKEA 3K3PA 4ZVOA 1EVJA 2Y2VA 1X7WB 4MO9A 1DG1G 1WXHA 1VIVA 2LCFA 2OB1A 2WNSA 1MV8A 1UT5A 3BS4A 3IDFA 5ESRA 2IOFA 5LDGA 2MR6A 1ZP6A 3AJDA 3EBPA 3DAOA 2YY7A 3PIIA 2YV1A 4ZALA 1GSAA 4CW7A 5HW0A 3CX6A 2WSYB 4MP3A 3JSXA 4P58A 1QH8A 1KZ1A 1UR5A 4GBMA 1NC1A 1R16A 4FXPA 1JFFB 3CS3A 2V9CA 1AK2A 2AWNA 2PZEA 3AP3A 3O7WA 3RREA 3USZA 4EA9A 3F4KA 4L2IA 4EY3A 1GOTA 4G8BA 5F78A 3E4DA 3FHLA 2OBFA 4ND8B 1GYQA 2QGZA 2QQ5A 2F2TA 4CTOA 1C4XA 1IONA 1D2GA 4Q1VA 2O3TA 4F0JA 2LGJA 2WHYA 4F7DA 2OGTA 5HE8A 2WP0A 4TKVB 3CWZA 2HIGA 4X7RA 1YZKA 2BLLA 3JQ8B 2EZ4A 3EAGA 3KKKA 2J4DA 4UFOA 3V1NA 2YMMA 2Z1NA 3P19A 4O4IF 3RJ5A 3H5LA 1NSYA 2CLSA 3CNNA 4A8JC 5HIKA 1SWVA 2SBTA 4CV0A 4UEJA 1T6YA 2O2SA 2Z2IA 3QVVA 1P60A 4D0RA 3A70A 1IWOA 2C7OA 5CW2A 2HSDA 1Z0FA 5JROA 2B6NA 2Q6TA 3PVCA 5EZ6B 1Y3DE 4FFBA 2PRZA 2AMYA 2I8LA 1F8GA 2QUJA 1PJ4A 3K0FA 2WVJA 5AKIA 1Z4OA 2IKSA 5KYNA 1X7ZB 3RHSA 5D51S 3Q0TA 3VQTA 2VSFA 4BRUA 2Q8QA 5AKLA 1YRLA 3TNDA 3GP3A 4YGXB 1PS0A 5CYOA 3N6RA 4OIMA 5FUBA 4BEBA 2YV5A 1MNQA 4OJTA 2NZ2A 4OXXA 3R8CA 2W4MA 5KREA 2GF9A 4QDKA 4K9DA 1CQJB 1N1EA 3PKJA 3NHUA 3KZOA 5AVWA 3OY7A 2FQXA 1IN7A 2FH5B 3QVUA 4OLBA 1T2EA 4KXWA 4Z1MA 4C4ZA 1DNPA 3IUPA 1DC4A 4RTKA 2O7RA 3PEUA 4B8WA 2FG7C 3E3NA 3TOSA 2IPOA 1QYRA 1LJ8A 2VHTA 4D7AA 3BMNB 4P0PB 1VE7A 4HMOA 1E5TA 1LSOA 4M55A 4NMLA 4DJJA 3HVRA 2WNHA 3MWDA 5KOIA 4Z7QB 3CXUA 4GPZA 1NF2A 3RIEA 4ZVUA 3NBXX 3NYRA 5CB4F 5H5JA 2CMHA 3O8QB 3P9CA 2OWDA 4AC9A 1AIPA 4DILA 5CXSA 5AKKA 4WEQA 2QTFA 4LGMA 2R7MA 1O6GA 4E4RA 4DAEA 2AZMA 2EHJA 2QRPA 1ZCBA 3QF4B 3SFVA 5C80A 1CZUA 1BFDA 1DELA 4PRZA 3OHSX 2D2VA 4MB0A 1GNVA 2OWEA 4UBNA 1DC8A 1ANKA 2WM3A 3DPIA 4NMWA 5BYJA 3SOZA 4O5OA 5FX2A 3IODA 3TI7A 1OH7A 3O82A 4K9PA 2QRMA 5AT1A 4ZKEA 4HHEA 4AJ2A 1WCIA 3TH5A 4O4JB 5AVZA 3HSKA 1PHRA 4MYSA 4OOEA 1V95A 1DAHA 3PNBA 4LI3X 3V8EA 1ESNA 4IHJF 2A9FA 4RJTA 4OFWA 3KT0A 4YDSA 4JC0A 1YMUA 3GT4A 3HJNA 1NXVA 3TVDA 5E0KB 3MJVA 1RKVA 1C0KA 1YE8A 2DH5A 2QW1A 4KQFA 5THQA 4J3NA 5DXAA 1BOFA 2GVDC 1PJTA 3HXLA 4CKBA 2COEA 5EJFA 5A2QA 1KS9A 4U2DA 2ZSKA 1YJCA 1NRIA 4F4JA 2IFTA 4KX5A 5A2GA 2W6IA 3MMZA 5I9MA 4LBZA 3DC2A 3WGJA 4MW9A 1JFSA 4L27A 4WL0A 1XL0A 3GRFA 3G9QA 3UWSA 1KE2A 1CZNA 5IK2A 4IGIA 4LF7B 3D3EA 1V5WA 4M54A 2ZRHA 2EQAA 3Q72A 4HB0A 4RXMA 5D87A 3IUJA 2Z2KA 4DQDA 3ZC3A 3EVBA 5EZYB 3KE9A 1O9BA 5LA6F 2QLMA 1QM5A 1KNQA 2P40A 5EZ5A 1Q83A 2W2KA 1E4VA 2EG5A 4MUKA 5DK4A 5IBRA 1YRAA 3WY9A 3D59A 3C5HA 2QHXA 2A7XA 2P9TA 3DEFA 3VSEA 3C1UA 1EXWA 4X92A 1VI6A 1VBKA 3R76A 3RFCA 1YVPA 2BCJQ 4MIOA 3LHDA 5D3KA 1PZHA 2HXYA 1LDGA 4NEGA 4OLJA 2G70A 1EXDA 3OP4A 1JBEA 2EVWX 3BGSA 1BDHA 1D2CA 3QVSA 5JFGA 4P1ZA 1DQNA 1XDUA 4MGKR 4JLOA 4YTEA 2P4HX 1FFAA 3OC6A 3RSLA 4WKCA 4F84A 2WWFA 3PICA 1XZKA 1DEXA 4ZQIA 3TX6A 2Y66A 2MJLA 3PJRA 2PANA 2VJYA 2Y4NA 1KI6A 3BF7A 1JSCA 4M1QA 4MNTA 2IYLD 3A27A 3PF9A 1QGUA 2ZRJA 3FBGA 5F5XA 2I0FA 2XKJE 3MN1A 4O1HA 4CEHA 2NX2A 3E84A 1QORA 3OE5A 4TRNA 3O8OA 2XTNA 5J4KA 1XZQA 3BMQB 2O8FB 1C81A 3M7IA 3TNLA 4P54A 2X9QA 5KYKA 2OZEA 3KQVA 4MPPA 4OJKA 1SVMA 4BWYA 4WD3A 4C0AC 5K9ZA 3ZBTA 4DDMA 3KQWA 3OJ0A 4M38A 4CPDA 5FULA 3QJYA 3ABQB 1FXUA 4KO2S 4X60A 1DPFA 4CFYA 2IYWA 1Z5GA 1ZRMA 3UB2A 1MRSA 1N2ZA 4HATA 4MLDA 4DUPA 4BLRA 3FG9A 4S1VA 2MYNA 2YVKA 1G7TA 3H65A 4R8MA 3RM3A 5DN6D 4NZOA 3OFJA 4QOFA 1DKOA 1L5LA 1RQRA 1XDDA 2XDQA 2ZUDA 3O3NB 4IMPA 1ULHA 1M6NA 3VJKA 3N2ZB 4KXMA 1GSHA 3EYWA 3UFXB 2C07A 3VDQA 4I50F 4PS1A 5E2BA 2QL6A 3C43A 4JK3A 2N46A 1U0TA 5KQLA 4EHJA 1P4RA 3H4IA 3OE1A 3QITA 1QHGA 1UDXA 2DY0A 4R8LA 1P7WA 4PYRA 3FSRA 2QTBA 3I39X 4V0LA 1QYXA 1GXSB 3UC5A 4B4DA 3DBHB 5I48A 1KMHB 4KGXA 4P35A 4IDNA 4QT0A 1HSOA 1NI3A 4ZYXA 1FEZA 3HGTA 4K6HA 3PBKA 1W49A 2XEXA 7REQA 3IOCA 1YCFA 2DY1A 3ORQA 4F4IA 3VYUB 1FRFS 2BE7A 4II7A 4KMRA 4L8YA 5CCDA 1JA1A 3G49A 2BGKA 3I42A 4BP3A 4M8KA 2AIRA 2IU4A 1P39A 1Z16A 2HJGA 3LO8A 1F5NA 3MYYA 4S1OA 4N7RA 1P19A 2ZT7A 2L82A 2H1RA 2ZYDA 2Y99A 3CVJA 4MA5A 4X90A 4ESHA 3KB2A 4QGBA 4JKYA 1WZNA 3NS7A 1XJWA 1MBZA 1OT3A 3BDIA 3H9UA 2FUKA 4PYMA 5LVAA 1Y7HA 1DWPA 3PFNA 4JBLA 3TR0A 2B8JA 2BGUA 4QRDA 4J07A 4ENPA 1AUQA 3VNVA 4MV0A 1CPYA 1SQSA 5KC8A 4TRMA 1E2EA 3KSAC 1IY0A 2C31A 2IYQA 4NPAA 3RS9A 7REQB 1E3DA 4WBSA 2AMFA 2PH1A 2QTVB 4WACA 1NMSA 5KNCH 3P4XA 1NVEA 3AINA 4BQRA 3BEOA 1XA3A 4JLVA 3ENKA 4NAHA 3ADOA 3TIXB 1G5RA 4B9AA 2DOKA 3IERA 4EY8A 2HK9A 2V1UA 4LDPA 3AVQA 4EVQA 2R8BA 4LXGA 3AJ9A 4DSZA 2ZUSA 3WRXC 3EPPA 3KSDO 4OQFA 3H87A 1Z4JA 3QBVA 3RTCA 1E79D 2FEAA 2JNWA 3FOWA 3KKQA 4M1ZA 5F35A 2WHQA 5IAAA 3IEVA 4MUHA 2C8LA 3K9WA 3T94A 4IEEA 4XFJA 1W5FA 3WLTA 2PUJA 3IA2A 4IDEA 4PLGA 1E94E 4LYFA 2H65A 5H02A 4FB5A 3FOZA 5DI3B 3ELUA 1CYDA 4KUHA 4YUXA 2YZ2A 1WRBA 1KDVA 3PIDA 3COVA 1U2GC 2CHVA 3C4QA 1HKUA 3DYIA 2Y3IA 3NTOA 3CR8A 2J9YB 2ERYA 2ZFUA 3PGMA 3G79A 3PNKA 4PZ9A 4QJBA 4U3JA 4ZYVA 2O3RA 1QMGA 1ISRA 3CX4A 3UVEA 4MKFA 2ZJOA 4GAEA 4LQ4A 3R0VA 3SNKA 2G5TA 2JA2A 3UK2A 1QIFA 1KZGB 1TJPB 1BCSB 4OXIA 3G89A 5ILGA 2XWQA 4BOYA 4GPAA 1C1XA 5ICEA 1HDCA 1EM6A 1ULSA 1ECBA 4N3AA 1H0RA 1DFIA 1J9ZA 1GKLA 2ZYWX 3E7PA 3EMDA 4OO3A 5FI0B 4DZRA 2GHTA 3GC6A 4GKJB 3AOEA 1AQJA 1B8UA 5EEHA 3EPKA 4M7RA 1AKNA 4BXOB 1L7EA 3MB5A 1NQWA 4OFBA 3FR7A 1OTYA 4FE7A 4BMDA 1I2MA 2HTFA 5EZSA 3GVXA 4GGMX 4JC8A 4LXTA 3JYPA 2EKDA 4FS3A 1J2YA 3PUJA 4ZJUA 4E13A 3WDMA 1CVLA 1URPA 1US8A 1PDWA 3LUBA 1T5HX 4CZ2A 3LRXA 4ZVVA 3IRVA 2IX3A 4MIYA 5DASA 2WC1A 3T7RA 1UL1X 2X7HA 3A4LA 2A88A 4KQ1A 3WYAA 3OLQA 4HDRB 4B85A 4BNNA 5SZHB 3RWMB 1G8HA 3FJYA 2ZRCA 2XKBA 3I6YA 3I9FA 1GKKA 221PA 3QWFA 4NYIR 6ADHA 4GVXA 3AF6A 5AK4A 1W52X 5A1TA 5I45A 1EK6A 1PJCA 2FSIA 5EI5A 1TK9A 4R2LA 3MNFA 1XQ6A 1KJIA 2DTEA 4BX9A 4GH5A 4ENRA 2IS2A 2QGNA 1EJ6A 4YRCA 2ORWA 3UHJA 2NVUA 4LFBB 1MLDA 1QGED 3CURA 4V0QA 3R74A 3SR3A 1WHSB 3JS5A 4RK5A 3ZU4A 4RK1A 4EPYA 1AOXA 3LZDA 4LJLA 3DC7A 3UXEA 2JGDA 3OZEA 2EEZA 1P9LA 5MGBA 3KG2A 1NI5A 4GIBA 1C1YA 2R47A 5K6TA 2B6HA 3O9MA 1DVRA 1QQ6A 3DL7A 3IP9A 1C30A 2CJFA 4JZYA 5CNJA 4YMWA 1CUIA 2UDPA 3O8BA 2IE8A 1EJ0A 2AZDA 5GM1A 2V7EA 3G82C 4F46A 4DR3B 2VXBA 5BPHA 1TD9A 1HFEL 4NZZA 5KNLA 1FP4A 4CGYA 4I5IA 3KDSE 2OP0A 2XYQA 1U0HC 2YV4A 1QHYA 1X13A 4R84A 5SZIA 2GR9A 2R8XA 1Y5RA 2FRXA 4P3YA 4G09A 4J7XA 3VKWA 5ERXA 4AJEA 4MJXA 1H0HA 4EGCB 3BILA 2OHXA 2B21A 4WLFA 2NVUB 2ZTLA 2ZRNA 3TLGA 4BE9A 1G6Q1 1EM8A 4AJJA 5BP7A 3IR5A 3KYCA 3RRFA 1XAJA 1R9JA 2XLCA 1LSUA 1G64A 5IVKA 1AQIA 4INJA 5KCZA 3FLBA 1UMDB 1LK0A 1YBFA 4JR1A 5KAMA 3RAPR 1QP0A 4H1UA 1DJNA 5KAPA 5LD2C 1LZKA 3TD2A 4FC6A 4Y0VA 4HSGA 2AK3A 4UEOA 3BK1A 1M74A 4OGLA 3GRUA 1NVUQ 3HKEB 1SUWA 2WTEA 3OA0A 4M8LA 1PF7E 4U2CA 5LU9A 2D0OB 4GWKA 2QTHA 4DSNA 5B30A 1PKXA 1P2BA 1YR1A 1KMCA 2JARA 1E7QA 1XYGA 4RVCA 3VPFA 4EGFA 4XX0A 4GXRA 5FFNA 2HXSA 4HYQA 3EC7A 2GBLC 4ADSG 4N5NA 4MRAA 1JDBC 3DLCA 4IHQA 1IN8A 3O1JC 2WD7B 3ESYA 1A4UA 1ISIA 3DFIA 3DQQA 3RUIA 1CDEA 4FCTA 3BIFA 1QKKA 4KK3A 4V02A 4EHLA 4ESEA 3OT5A 4K9SA 4WZAA 3QHPA 1JKMA 1QLWA 2BTQA 2OOSA 1JJ7A 3SQOA 4U2FA 3MSCA 4QTTB 1AHHA 3ONEA 2IUUA 4ZGWA 2G1AA 1L4EA 3PQ4A 2C1XA 1C7IA 5EKDA 2WM8A 3WV4A 2CVPA 1U2EA 1U9JA 1H2YA 4ZA2A 3RYIA 4DNQA 2XE7A 2ZU6A 3NT5A 3G5UA 2QZSA 4G5HA 3V97A 2X6QA 4KFCA 1WLYA 4EG6A 5M29A 4IWYA 3EVDA 1QV7A 5FPPA 3WGQA 1JT9A 4XTRA 5L51A 4H17A 4PFKA 2I2BA 5HE9A 3S8YA 3F8TA 4FQ7A 1E98A 4QICA 4U4AA 1BS2A 1IZYA 1PEDA 4FOTA 5KYXA 4EH1A 1E2DA 3MGKA 3Q85A 4EYSA 1WP4A 1CD5A 2O5CA 3TWOA 3ORYA 2P4QA 4EKYA 2V6FA 2QP9X 1NBWB 1Z34A 2OQRA 4M0KA 3NH9A 3V4ZA 3TECE 3IV9A 3JQCA 1D1QA 2IGBA 1YL5A 3RVBA 5CJJA 2HHJA 3G0CA 3L4EA 1QP8A 5FBRB 1E1RA 2OBNA 3WB0A 4C0XA 2UZ3A 5KU1A 3G5AA 5AXAA 4LDRA 3NHFA 3QYAA 1BHSA 4PF1A 3UOWA 4Q03A 4PG6A 3G7UA 1N6RA 3AFGA 4PCUA 4NF2A 1NGSA 1SU4A 3MM4A 2VP2A 4RORA 1D2EA 1VKRA 1OWLA 4IIYA 4JJEA 5K3AA 4FBLA 3LVFO 3IPLA 3DEKA 4GSLA 4QYIA 4UM5A 3UFXA 3A1FA 5ICFA 3RAEC 4WZAE 3EZNA 4Q7EA 5LQSA 2AOUA 2VRCD 3D3KA 4ND4A 4UAJA 4Q3DA 1TX4B 3GVHA 1OYOA 3AQIA 3G2JA 2WJJA 4D3YA 2VC2B 1KEPA 4DSUA 5HPYB 4GBGA 3N8HA 4R3NA 3I04A 1ECPA 2OCIA 3PUVA 4IIHA 3UHPA 2HR1A 4H2DA 1UJ2A 5CW1A 5DCLA 1H4QA 1OV4A 2O50A 1IY2A 4N39A 5IHXA 2F90A 4ZEMA 1UOOA 3GLGE 3NGLA 4C3OB 2PZ8A 2QMOA 1Y8RA 1EX7A 3HWSA 5DBHX 1CY0A 1CIVA 5DGCA 3URMA 2FFBA 2CLCX 3AIIA 3LQKA 4RFVA 4TXHA 4E30A 4I46A 2JVJA 4CGZA 3JQBA 3UYKA 1PLLA 4CKCB 2GPAA 3VUEA 5EMJA 4J90A 1PD0A 2QQ0A 1Y6RA 2QTVA 4X1OA 5BUSA 3WGOA 2CEKA 5IFKA 3FCOA 3SX2A 4D8XA 2KYRA 4A6DA 2R68A 2H48A 2V8OA 1YZQA 4CEIB 3BREA 1RC0A 4I9NA 4WCFC 5CVCA 1ZXLA 2BOVA 4QIHA 1IWPB 4Q4JA 4XAQA 3WMRA 3ZU6A 2W7TA 3JXEA 3ML1A 3EZ2A 4LVNA 4NYJR 4TX1A 2ZETA 4ZDIA 2ODPA 3M4YA 1SBQA 2KPOA 1M6YA 2VDUE 3G88A 4PPQA 4DM4A 1MW9X 3SI7A 3IPXA 4BKQA 2E0IA 2C7GA 4Z4QA 2DBYA 2WJ4A 3L0SA 4C6HA 5KVSA 2AJ8A 2WSMA 3WOHA 3ZDQA 2AUTA 5C4IA 2EDAA 4M86A 1DU4A 1N9ZA 1NVGA 1DO8A 3A7DA 3H5IA 2CYCA 3QPWA 4Q3AA 2FWIA 5EMMA 1UDWA 3GBVA 1QYWA 3O3OB 1PR4A 4CMBA 1ADCA 3VJRA 4JYMA 3CG4A 1ZDMA 1TA4A 3GXBA 4JYZA 1WU8A 1V6SA 3NIGB 3O7MA 3KWMA 1Q3HA 1JMKC 1GAEO 4HTFA 4QBKA 5EHNA 3ZWPA 2ZQYA 3QE0A 2QTNA 3EH1A 4HQNA 4RKFA 3GFTA 5THKA 1F51E 1O8BA 4L7QA 1PLKA 1WF3A 3CRVA 1BDJA 1UBNA 4UREA 2NV0A 3PFWO 4HAUA 4ZU1X 3GLFA 5HKAA 4DV2B 2H63A 3WIDA 4WXEA 3MBOA 1OXBB 4C4PA 1GYPA 5K8VA 1EVZA 2WA1A 3T9FA 1HRKA 4Y0NA 3UTCA 1F9EA 1I6LA 2RKBA 1DUIA 4M36A 3SGLA 3SMVA 3UT6A 2G76A 1P81A 3DS8A 2WT9A 4IZHA 5F52A 2O2EA 3K53A 4OLHA 2OZKA 5AW5A 3VC7A 3CZAA 2I34A 3ED5A 1E64A 3OP1A 4TUYB 1L8OA 2QLFA 3KL2A 3QBJA 3ONFA 2R87A 1X77A 3AY6A 4W5HA 4I3HA 5EJGA 2HNKA 1XMIA 1JPVA 2AR0A 1QE5A 3EQ2A 4A5SA 5AIAA 3DUWA 1P7YA 5I9SA 1FRQA 1N2CA 4ASUD 1H9BA 3REGA 3ST7A 4IZ6A 4BECA 1JG7A 1OXKB 2OCBA 2QP4A 5CG2A 5IKPA 3WGLA 4E2FA 4YXFA 4Q4HA 1DKUA 1REQB 3IPCA 3F90A 4P4SB 4MWCA 2IEZA 3K71B 1WAMA 1XX6A 3X2SA 1R4MA 2H2AA 3D7LA 3IT2A 4HPJB 2JD2A 3HCCA 3NCTA 4HKTA 4LOJA 4PHFA 4C5AA 2NTJA 4CUZA 2E18A 1RRMA 3HBJA 3MJTA 3LQ2A 2GT1A 2GA9A 2FTKE 4RSMA 4HZUA 3VC3A 2XKAA 4FIDA 5TMPA 3QVJA 2XUAA 4M76B 4DLBA 3LHSA 2ASVA 2AI3A 1USVA 4HNGA 1DAMA 3HR7A 1T8TA 1VL5A 1Z4LA 2BM0A 4BLQA 2J6HA 3ICCA 5KOYA 1NVDA 1UFRA 1Z7BA 4KYIB 4YNBA 3L7CA 3LLCA 5AJUA 1C3EA 4P80A 5FL3A 3RIXA 4ROTA 2J3IA 2Q9UA 4RZSA 3I9LA 4NDAA 1I2DA 4HMQA 2GRUA 4LSMA 3DL0A 3R3XA 4YI5A 4ZMRA 4LF5B 1T5TA 3QUAA 4DR7B 4P0TA 3WKEA 3Q2OA 4LOAA 1SVOA 4R8SA 2GFIA 3LVQE 3RRXA 1G4AE 1X7YB 3TL2A 4DEYA 1EXVA 5B2EA 4P4SA 1G8JA 5CVJA 3U37A 3B60A 2CCKA 4L78A 2HRQA 4JB8A 4WVLA 3F7MA 2JHPA 2YJ5A 4MEJA 3EPHA 4XJXA 1W36D 1ZCAA 4OH7A 5I47A 4UVDA 1SD2A 3VKHA 2DF8A 2QRVA 4NNOA 4NEHB 3GLKA 4YJHB 3AY0A 4P8RA 1U0GA 3R09A 4RH1A 1DB3A 3BCUA 3KS9A 1DHRA 3FSGA 3RG2A 4J0JA 3JW8A 4GM0A 2P9FA 3AFMA 2QMEA 3MD9A 1TEHA 1FA9A 5TF4A 4XGQA 5JO9A 4OQQA 3DKIA 2WYOA 1C41A 2VDRB 5F4BA 2ZZNA 1U0SY 3CEJA 2JZCA 4O4IB 2IV2X 2CMKA 3EXEA 4V3BA 1ML4A 4OHKA 4HFMA 4NJMB 1TU3A 1ILWA 5GY7A 5BPFA 4IVNA 1BD4A 4KIWA 5FOWA 4BGUA 4KWEA 2YFKA 2FMIA 2YW2A 2YVQA 1RQXA 3AT1A 4IDHA 4K9KA 4MIKA 1RIIA 1XWIA 3GEIA 2FG6C 4O2AB 3TTYA 2OZLB 2Q5FA 2QXUA 4S1TA 2BFCB 1AB5A 1B14A 1U7OA 1YMVA 4L0MA 5ETJA 1G59A 4WQMA 4CM4A 5JI2E 2YRXA 4D5EA 3EZYA 2ONJA 3PTAA 3BE5A 4NS1A 4LW8A 4NDZA 3TXYA 4OHYA 1Z7WA 1VPLA 5LYYA 3H2JA 4OHZA 1OGYA 3AX6A 2LTAA 5FEMA 4HMPA 3FI0A 1X8JA 3NBFA 3DMTA 2DPGA 2PXCA 5T3UA 3K5PA 4FLEA 1C9YA 2R86A 3ICWA 3AYXB 2B4KA 2FUCA 3G0OA 3NIFB 3TR5A 4CIVA 1QZXA 2KE5A 2OXTA 5EJ9A 1GP2A 4PRYA 1U63A 1CRPA 3IQDB 4R7ZA 3WQQA 1BFUA 1CRZA 2GRAA 4EJMA 1E1RD 4FYPA 2NYRA 2HO4A 1GT91 3M4NA 5E8RA 1JIIA 3C1AA 3MWJA 4CU2A 4EHIA 5HRUA 3II6X 1ODKA 4RVUA 5IBPA 5KC9A 2AFHB 5EUQB 1J9EA 1EFRD 1XKQA 1XYYA 3ZX5A 1NF3A 4L4XA 4J0CA 4Z99A 5EL0A 4ARVA 3C98A 2NQ8A 5BN4A 4GE3A 4JITA 1L1QA 1SU7A 1WF6A 2Z2XA 4H7PA 1BN6A 3TRIA 1PGNA 2ENWA 2VDVE 1EZ1A 1R8SA 1LEHA 1VSTA 2JI7A 1KI7A 4ZZIA 4XYGA 4EIWA 2UUPA 4G2NA 2VJAA 2OBLA 3D02A 1HE1C 4FNAA 2HMAA 3DKRA 4RE6A 1Z3IX 2XHZA 1TK3A 4BRSA 3AHFA 5KYUB 1U8UA 2GCGA 5FOSA 4UE6A 4O4LA 2VDNB 3ZU5A 1Q50A 4N5DA 1RXEA 4F7WA 4FHCA 1PO7A 4M87A 5CP8A 1WTAA 3KEOA 1AK1A 3UGQA 4YRBA 4NOMA 4PR0A 2AF4C 3TM5A 4W5OA 5J47A 2RAPA 2QNBA 4ENWA 5BNZA 3I3OA 2VHYA 3NHRA 3S2ZA 2O0JA 2EAUA 2P4UA 5IC5A 3H1EA 3VYTB 3DZIA 3GDFA 3SBDA 2BSQA 1ZNWA 1J0DA 3DZFA 1L3CA 3LCMA 4AX8A 1F9AA 3UF0A 5DBEX 2J30A 1DAGA 1QVAA 1Q16A 2V0NA 5LKAA 1QDLB 1BIFA 4M98A 2AN4A 4LKOA 2Z1MA 5J1TB 5JCJA 4C7VA 4ZEVA 4GMXA 4WGFA 4V0KA 5K2MA 3ZK9A 1TYBE 4U63A 5CA1F 1T3TA 1NUAA 4XH9B 1CUFA 2IF0A 4AO7A 3I01M 1GQSA 1L7MA 1TMOA 2Y93A 5IJ0B 1VC2A 3H4VA 2EBUA 4EJSC 3KAKA 4PZUA 5DLEA 3ZN2A 2TYSB 2A3RA 3ECAA 4QDJA 3S6JA 3V1UA 4KJXA 4JLSA 5KYXB 2CVFA 1L4LA 1ZK3A 3IO5A 5FQNA 3HP4A 3BK2A 2JFXA 4EKNB 5JEDA 2ECKA 4L08A 1T25A 3IAUA 4PIMA 3OBBA 5E0OA 2B8TA 2ZITA 2M1XA 1Z9BA 4YFVA 2W2XA 4NV0A 4B43A 4BB5A 5KYWB 2AK2A 3LPAA 2QR2A 1KC1A 1P5HA 4WOCA 3P52A 3BVPA 2D8MA 3OUZA 4IH1A 3TZCA 3TVYA 3FX2A 4HDSA 3FUXA 4KN6A 4YONB 5GOTA 4XCXA 2ZYHA 3BZUA 3FTPA 5B5SA 4MCIA 4DL9A 2PSFA 1W5BA 4XIGS 1D0VA 3E53A 3P2IA 3T1OA 1TYDE 1KYXA 1L5HA 1PX2A 1T3ZA 4ZTBA 5IJAA 3THOA 4B7CA 4F1JA 3QEKA 4QAJA 1A98A 3VHQA 4RIIA 1ZH8A 2FPLA 3RV3A 1EG2A 5KPDA 1JDNA 1VHWA 1MA3A 4OHCA 3T9AA 1YKFA 1E9RA 1RJEA 1N5RA 1XI2A 3PTLA 1NVWQ 4QHTA 3TTTA 5IFLA 5B6IA 3DE7X 2LR0A 4Q1BA 3ZI7A 1IXZA 3MRXA 1IEQA 1D7OA 2TECE 4MS4A 1FFCA 2CXTA 2R9VA 5HTKA 4B17A 1I94B 3DE2X 3ZV4A 1MB0A 3MPUA 3KDPA 4XVHA 4IEFB 3FWHA 2JASA 1YR3A 3LRPA 4PONA 4XEHA 5FO1A 3SCZA 1YJAA 2BBSA 1ZQ9A 4EHAA 1GPH1 5ALHA 5CIYA 4HLUC 2GPWA 3E9YA 4KLAA 3DBIA 5EJ7A 5JATA 5TQVA 1KDOA 2J3HA 5AJVB 3TL6A 3TUJC 3ICVA 2GI4A 4E4TA 4UMEA 3W79A 5K05A 1NDQA 2ZUEA 3DDZX 4NV3A 1QR6A 4HWGA 1DI0A 5EAIA 3WA6A 2O8BB 1Y0BA 3KAQA 2JA1A 1ETHA 1J97A 2ZK7A 3GNLA 4KN5A 1CEQA 1EWQA 3I2JA 4Q1EA 5CLIA 1TZ2A 2PNJA 1V3UA 2WIKA 2EWWA 4BC0A 3VZDA 2WP8J 1R0CA 3ISVA 4UEWA 1VJRA 1OWPA 4JKIA 5E1DA 3WL6A 4DN6A 5A06A 4GRIA 1XRQA 4JXXA 1YDEA 4OSEA 3VNUA 1N6LA 1UUFA 4CQMB 2ZVQX 2FXIA 2KJQA 3IEXA 4DBLC 3SX4A 4CKZA 1HXHA 1VMIA 3BULA 1XNRB 5KS2A 3SPXA 1UH5A 4F2DA 4PV7A 4LMBA 1TF7A 2P8SA 3UV7A 2P67A 4ENUA 2LW7A 1BVHA 5AI5A 1PQPA 2H1IA 3HJBA 2ZI4A 4IYRA 1HE8B 3IUBA 2YMQA 2OYCA 1QHHB 1XU7A 3O4RA 2ODAA 4GNKA 4X6LA 4ARZA 2CV0A 3SSNA 2YR0A 4FEEA 3ZDEA 5CB6A 4HNTA 4FSDA 1CYEA 5C1BA 3VR4D 3U4GA 1T2FA 3RYIB 1ONBA 3AIKA 4I19A 2JEYA 4CQLA 1ECLA 1V71A 5HS4A 3PU6A 4KYTA 4Y9DA 4POAA 5H1YA 4V39A 4LN1A 4E70A 2HCBA 5CD9A 2HOQA 1WXWA 3H7AA 2F9MA 1CUHA 5CCBA 4LJRA 3KV1A 2A94A 4YJ2F 3CRNA 2WWXA 1IYZA 3GUHA 3VHLB 2EFGA 1E0JA 3M70A 3T1TA 3AETB 1TW3A 3LWZA 1YU6A 1Z0KA 3EH2A 4QGAA 1LJLA 3OOHA 1WB6A 1NASA 2YOHA 1HORA 1N4DA 2ALJA 3UJCA 4E2ZA 1YS6A 3BGOS 4MQBA 2H7YA 4JYPA 1SR8A 5DM0A 4P84A 1GCUA 3KX2A 2E9SA 4D9MA 1W76A 5FKJA 2ZB7A 3SQMA 1PFUA 1EFDN 1BXZA 3TSZA 4IZIA 3WB9A 3V7UA 1FBNA 2JI6A 5KDOA 4I1YA 2XCTB 2J33A 3ZY6A 1PT8A 4FM9A 3VPBA 4A23A 4JSTA 3UB4A 1EPUA 1LBQA 4F21A 1UXHA 1NNI1 1Y5MA 3LSTA 2DLDA 2GYVA 3AG5A 4DA8A 4DQVA 1VIMA 4KQMA 1P73A 4JA2A 1S96A 5HKKD 3VPSA 2O2IA 3GN2A 3P45A 2WUEA 5IAOA 3SJ7A 1Z6QA 3W2HA 3GH1A 1ZR4A 1K97A 2WZQA 5E1BA 5FUVA 1S4QA 1DZ3A 2EP7A 4PSDA 1FOEB 1WD5A 2CSUA 2FETA 1C29B 4JP3A 4TS4A 4ZT6A 1Q92A 2LVBA 4LJ8A 4MYUA 1TM7E 4B44A 4JEIA 4Q9JA 1R3UA 4F3TA 1JSXA 4CM8B 2RGGA 2ZWMA 3I9V6 3OG9A 2A4MA 4ETMA 1FB5A 1J07A 2A86A 5AJXA 1GU1A 2EWVA 3H1FA 4ACAA 1VYTA 2PUTA 4EPVA 1FSSA 4KV9A 1JX6A 1E6UA 3BZWA 3S2YA 2FR0A 5DE3A 2VPZA 4ESVA 4D92A 4RQBA 4BDTA 3IQWA 2RCNA 4I4IA 4XQEA 2HWKA 1ZJ4A 3CX7A 2HA6A 4BJ1A 3KQHA 4CCYA 3A6GA 1TU0A 2VCYA 1AKEA 3PZBA 4FKMA 4G5RA 4OXNA 1IBKB 1Q20A 1NJ6A 3H17A 2AB0A 2QE7A 3AUAA 3GYBA 4B34A 4CKWA 4H15A 3WBFA 4DB2A 4FJ2A 1IB6A 3PYXA 3S40A 4F6RB 2D1RA 4UZFA 3HGQA 3QF7A 2OK7A 1R0KA 2QAIA 4PC2A 4TXLA 2Z8YA 3OZSA 3R0JA 4K9QA 3ZDBA 3C3KA 1JLMA 1DO0A 4XQGA 3GW8A 4RY2A 1F4PA 1V39A 2Z4TA 2V5AA 4DGSA 3C1OA 4ZGBA 3D6HA 2DTDA 1RC8A 2REBA 3TQHA 2P6NA 4K6FA 2FUG1 4TKLA 4FOPA 1ZJ6A 4PNHA 2EJBA 1Z13A 2XWBF 3P96A 3RVRA 2Z2JA 1OYVA 4QHSA 1RPZA 4CKEB 4OI4A 1DAKA 1C8VB 2O2HA 6PFKA 2YN4A 1D6MA 3BFKA 1DS6A 4L0DA 3K2QA 3PXGA 3PNOA 1MQAA 5HKBA 1Z73A 3AMVA 3H2KA 2GKGA 3KAJA 4U9HS 2I8CA 4ARZB 2CKDA 3W3AD 3VR4A 4CG2A 2ZB4A 4P83A 1KKUA 3H6KA 4QPPA 1K2VN 3A9WA 1HT1E 2IYNA 4HD8A 1WPXA 5L7TA 1XEXA 5A02A 2Q5CA 1PQWA 2ZDHA 4Q9NA 2PUAA 5EUMA 1TTHA 1RZVA 4L15A 4EAAA 6ABPA 3HM2A 1HTWA 5KTRA 2B25A 1JTFA 1EIWA 4EMTA 5IKOA 1BW9A 1OPRA 5TJHA 2CB9A 1NR5A 3OU2A 2W90A 4I4CA 3WBKA 4AS1A 3TZKA 1FMJA 3O4IA 4FBMA 3L3BA 2RIPA 5CNKA 3GJ6A 1FRZA 2HNBA 5ECWA 2ZAMA 2RG7A 1V7ZA 3DV0A 3DXFA 4DTCA 4ALIA 3VYSB 2V5UA 3O5AA 1M5UA 2C3UA 4G1EB 2PKQP 4WY8A 4ICIA 3E9QA 1IIRA 3U4QA 3I83A 1KQOA 1O94A 3NBKA 5DW0A 1ONOA 4AS3A 5LCXA 3ZWBA 2JVIA 1YB5A 2BHLA 4QXMA 4TS3A 4PAMA 5ALXA 1G8AA 1U7HA 1WNFA 3E9EA 3GDHA 3H97A 3QLUA 4K05A 4RH0A 3RSOA 2F62A 2HK8A 1I3KA 2YWFA 4P36A 3S4YA 2JCXA 3W7AA 5BWOA 3TQOA 5AW4A 4MGZR 1U11A 2VTVA 4TS1A 2QRNA 4Y6RA 1LI5A 1ZCJA 4OB8A 5DI9A 1U81A 1NLMA 3ZHYA 3W8NA 2RGDA 5AW8A 2V9ZA 2O7SA 1PFQA 1UADA 2IVZA 1JIJA 4RLSA 1MO2A 3WNVA 2ZR0A 1FY2A 4IIUA 2CL0X 3IJ5A 4IO0A 5C1IA 2WHXA 3TLJA 5CJPA 3FPEA 3HBFA 2FZLA 2BBWA 2ZJ1A 2JJ1D 3TQQA 3WGHA 4KNYA 3VJLA 4BCCA 3KYJB 2A5LA 1K8QA 2ON6A 3KSZO 3NVAA 4FYJA 3INRA 2XBUA 1Q0SA 1KPGA 2W11A 4FFNA 1TI7A 3RNOA 3ZWKA 1XR3A 1BA3A 1CJSA 5ADVA 5ARBA 2UVDA 5I7UA 4MV6A 5AHXA 2P6MA 1SKYE 1XD2A 4F4CA 1KETA 2IL1A 1RHUA 5DNAA 2G77B 2X9LA 4CKCA 3U09A 5HJEA 3DDNA 1GR1A 1PQUA 1UBSB 2BM1A 3P0FA 3F5MA 4I2VA 5TV2A 2UYOA 1SU8A 5CFOA 5ALKA 5HXAA 1RI5A 3BSYA 2C88A 2WIBA 5E3IA 1JSZA 4RX1A 1E2BA 3HEBA 4BN0A 2HW8A 2VQ3A 3QVMA 4CKEA 5DF1A 3AUTA 4KIFA 4QGSA 1MO5A 1TT7A 2HF9A 4LKRA 5AKHA 4AG6A 3PJGA 5A9SA 1IH8A 2B7LA 2P30A 4NECA 5DWQA 2R79A 2W71A 2P91A 1QIKA 1KK3A 3IUMA 2AS0A 3UHAA 3E2IA 3IVGA 3DCJA 3S27A 5HQ3B 2QM8A 5K3FB 4YIHA 2CDRA 3PLNA 4TYWA 2YXDA 4RMHA 4B7UA 5AJTA 3DV2A 3IIIA 4JJ8A 2O2YA 2JRCA 2I6SA 2Y0DA 5ICSA 3A2LA 2O5EA 4QDUA 2JKZA 4CTNA 4B3IA 3JAMA 1A5AB 2WABA 3AR4A 5AJYA 1RHKA 1RPTA 3FPSA 3ELYA 3H18A 1XTTA 4E1VA 2XCRB 1IULA 4KWHA 1K9VF 1N3BA 3FVWA 1UJ6A 2O0HA 3RS5A 3HYNA 1Q0UA 2CJWA 4GOLD 1WPRA 2FPRA 2V7WA 3L1VA 1FS4A 5BT9A 3ZGYA 4US2R 2XUGA 3GO4A 4AG5A 1JMYA 2YRWA 4CMGA 2QL7A 2RHLA 3N6XA 1YV9A 5F3RA 5A4KA 2BKLA 3DOJA 3OLWA 4QOIA 4GPIB 4MWTA 3TD6A 4HQ0A 1SG0A 4XYLA 5EESA 4J43A 5KWJA 3R4VA 1RJDA 3UMMA 4PICA 1MQ9A 5JMWA 1SELA 2VK8A 3ASZA 2QZPA 4I1PA 1H5NA 2CLMB 3TTSA 5IU6A 2Q2OA 3W90A 3C85A 3CWQA 1JKXA 4F56A 4JL5A 2IODA 4CM5A 1DOAA 4OBEA 3P27A 3AI1A 2P2NA 3JALB 3V4OA 3X1XA 1UODA 1JLLB 1MXFA 1RRKA 1UMKA 3K5HA 4B3HA 2XRFA 3AU8A 4EJFA 2FWJA 2ZR7A 3T15A 1T91A 2KHZA 3KU4A 1QNLA 3CT6A 1QX4A 2QAGC 4JLJA 2GJ9A 4EHFA 1L5HB 2BTQB 5F5LA 3A4MA 2ZI6A 4OHOA 4XJVA 4F71A 4MMXB 3A32A 4EG7A 1JHXA 1WW8A 3KQPA 5IC4A 3QY0A 1MABB 1WPQA 1YFZA 3P5BA 1ZISA 1VLQA 2WWGA 4URZR 5H82A 4F9EA 4RH3A 5JXHA 3KUKA 3F5QA 4J7AA 3C5VA 2OTCA 5EHIA 4EA6A 5ED4A 4CDRA 4BKRA 3UGJA 3UMYA 2IPLA 4UASA 4KGDA 3KZXA 1T5SA 4CKYA 1HOTA 1Q95A 1GN9A 5K4AA 3URKA 5F64A 1QGZA 1YVUA 2GEKA 4DCNA 1OREA 3EULA 4TT8A 4YQEA 5AW3A 2OCLA 2B5OA 3K6RA 3PFIA 4KDCA 5JAIA 1XQWA 1ZN8A 2PL3A 3F96A 4K3UA 5FUYA 5HKLA 5JD6A 1A8UA 3D4OA 3HZHA 3AETA 1YK1A 3NIWA 2H2WA 1KEUA 4P86A 2NU8B 4F45A 2EKZA 4DB4A 3ZIAD 3GJZA 1XXLA 3ZJUA 2OFOA 4RESA 1GG8A 1LY1A 1CT9A 3D5QA 2OAGA 1MOSA 3LW8A 3RU2A 1FUKA 1WDKA 1L5KA 1ATZA 1TPYA 3FPAA 3GOQA 2M6SA 4MRVA 2QZ4A 5EG5A 4LECA 1LFDB 4DUZB 2UUOA 4V1CI 1F5SA 2YJNA 3RYTC 2YFQA 2E4VA 4YRIA 4OHXA 3C7TA 2O8DA 1Y3IA 4JLNA 1TLLA 5JLAA 2JLRA 3HKEA 3AEZA 2D7DA 1Y7TA 1UZNA 5F7OA 1XJ0A 4M8IA 7GPBA 2YNMA 4I3GA 3GT7A 1RYHA 3EA5A 5EIFA 4L9AA 1SNYA 5J5CA 1W93A 2FPIA 3NUQA 4XSHA 3ELDA 3NHJA 3TQCA 2D1YA 5MN5A 2XCUA 3GP5A 4OVKA 1LRJA 2WWVD 3B85A 1XTVA 3AR5A 2E6KA 2QEQA 5I3ZA 3M83A 3MEQA 4CQJA 5IDVA 4IVQA 2VJMA 3FYSA 4G36A 4JDPA 3UG6A 1E4YA 2F3PA 3R6LA 3NXKA 1U8ZA 5K0CA 2HT1A 1GL9B 5AVKA 3PITA 4QYSA 3V7NA 1R6XA 1ZK4A 3DJYA 3JWIA 1VRCA 2Q8NA 4MGEA 2ZXUA 2IH5A 3N53A 2V3WA 4XR4A 4IDCA 5AK6A 3N2GB 3JQ7A 3ENQA 1HE4A 1L3IA 1CJUC 4OJMX 5KOHA 4QARA 2LZ0A 4BFSA 3ROGA 4DKXA 3NMUF 1E6LA 1S2GA 3QYJA 1V8OA 3KP1A 2UXCB 1HF3A 2H57A 4AYWA 1S8FA 5LQJA 4TKUA 4ZVNA 4OIFA 1G8YA 1QG4A 1T4DA 3GAFA 3PWKA 4FC7A 4UNQA 4CETA 1LXCA 1TZBA 2A0UA 4FJ0A 2NV2B 5T8KA 2JS7A 4Q02A 4NHOA 2WFZA 4IIDA 1MHPA 3PV0A 2VYCA 3FW1A 2F4NA 3KJHA 2A9QA 2I6UA 3N0VA 1KP9A 1PG5A 1KOFA 3E5RA 3OQPA 4XDHA 4DADA 3ZHBA 3HKCA 5EIBD 4NBNA 2JKYA 1VGVA 1J33A 1W0JD 2SCUB 4PZYA 1VLJA 1T15A 3CKYA 1HFWA 2MDTA 4R2HA 3V7WA 3SZGA 5B55A 3GLIA 1JE1A 4POOA 2JZOA 3E9NA 2EJVA 1GGMA 2IYRA 1TGYA 3BMCB 3PNVA 4Y7DA 1TC2A 4FUQA 4LJSA 2E37A 2P68A 2QNIA 4NNPA 2ZS9A 3PTZA 2VNSA 4BJ6A 5KOHB 2G08A 4IL5A 4RIHA 1OW3B 1X7ZA 3C1TA 4LHWA 1YXMA 5DLDA 3GT0A 5DTEA 4IR7A 1IHOA 3E7XA 3GFQA 4WN9B 5E6UB 4LZLA