3HNOA

Crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
417
structure length
395
Chain Sequence
AAKNAFYAQSGGVTAVINASAAGVIEAARKQSGKIGRIYAGRNGIIGALTEDLIDTGQESDAAISALRYTPSGAFGSCRYKNRREYERLIEVFKAHDIGYFFYNGGGDSADTCLKVSQLSGTLGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASFDVASMSATSTKVFVLEVMGRHAGWIAAAGGLASSPEREIPVVILFPEISFDKQKFLAKVDSCVKKFGYCSVVVSEGVKGDDGKFGGVAPVVASMVKEGLGLKYHWGVADYLQRAARHIASKTDVEQAYAMGQAAVEFAVQGHNSVMPTIERISAPYQWKVGMAQLSQVANVEKMMPENFITEDGFGITDLCREYLAPLIEGEDYPPYKDGLPDYVRLKNVAVPKKLSGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pyrophosphate-dependent phosphofructokinase from Nitrosospira multiformis. Northeast Structural Genomics Consortium target id NmR42
rcsb
source organism Nitrosospira multiformis atcc 25196
molecule tags Transferase
molecule keywords Pyrophosphate-dependent phosphofructokinase
total genus 136
structure length 395
sequence length 417
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.90: Diphosphate--fructose-6-phosphate 1-phosphotransferase.
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00365 PFK Phosphofructokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hnoA01
3.40.50.460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hnoA02
4FYKA 2HIGA 4KXNA 4FYHA 3PFKA 4PFKA 1PFKA 2PMBA 4LJKA 4P5EA 2Q4OA 3SBXA 3IMKA 5AJTA 3UQZA 3O8LA 1S2DA 2IZ7A 2Q4DA 1S2LA 3K2QA 4P5DA 1RCUA 4OHRA 4JEMA 2F48A 2IZ5A 2PFKA 3MAJA 3OPYA 4I7EA 4U1RA 3EHDA 2A33A 1S3FA 4LJLA 2F64A 4I36A 4KXLA 3O8OB 4NPAA 1S2GA 5ITSA 2NX2A 1F8XA 4JENA 2F2TA 3BQ9A 3GH1A 1F8YA 2IZ6A 2KHZA 3OPYB 3U39A 1ZXXA 1WEKA 4LJRA 4KXMA 2KLHA 4MEJA 3QUAA 2A0KA 1MTOA 4HX9A 4WL0A 2F67A 4JELA 1KZHA 3O8OA 4MCJA 3F5MA 4FYIA 3O8NA 1YDHA 1WEHA 5AJUA 4I4IA 3HNOA 4RH3A 6PFKA 1S2IA 4OHBA 1T35A 2F62A 4A3SA
chains in the Genus database with same CATH superfamily
1M34A 2VYND 5LQNA 5F9FA 4U0JA 2EX1A 3E6AA 1N0UA 1Z5WA 3PZBA 4DLTA 4X90A 4C6TA 3W04A 3VMMA 1EIWA 2YIMA 3ESXA 1L7RA 1ECJA 4MUJA 2HGZA 4UTNA 1QIJA 4Z0NA 4ZEXA 2N0SA 3L6EA 1UR5A 3K1JA 1OAAA 3DXFA 4V2UA 1H93A 1H42A 4UDOA 4CM9D 3LKZA 4Q3DA 2QLBA 2ZREA 2JCSA 1QP4A 5IXSA 3GUHA 3PXUA 4ZVPA 2XMBA 4GDFA 5SY9A 2QVBA 4RLSA 1VG0B 5JRZA 3EDRA 3F7NA 4JLVA 2AEEA 2KBEA 3WGOA 4AUNA 3FYTA 4BUZA 2WSSD 5JNTA 5CT5A 4KBFA 4D9GA 1PBNA 2NU9A 4C7VA 2ZDHA 1KYQA 3PGMA 2ZUTA 4YCSA 1IN1A 2P4EA 5EUQB 4MX8A 2WVGA 4UZSA 4A8TA 3IE0A 4BB9A 1Y1RA 3GYBA 5CDFA 3ICVA 4ZI7B 1RE0A 2BEWA 3CJTA 1M0SA 5TQ0B 5CXUA 1XVAA 3R7AA 1OBHA 2OZKA 1SG6A 4LVNA 3KJHA 2HRQA 1JAHA 1MP0A 4MV7A 4IP0A 4RC9A 2IV2X 4O4IA 4YRBA 2FFAA 2R8XA 1G8HA 2ZT8A 4JCOA 4TS1A 2GKGA 1JU9A 4HQKA 1OH5A 2EV9A 2Y6UA 3MNFA 4X20B 5FBVB 1Q22A 3KCQA 4YLEA 1W5SA 3JQCA 1H0KA 3S6JA 2RG7A 4HQLA 5KNLA 3PGLA 1I0ZA 2E9SA 2PX3A 3PXDA 1HDCA 2IGTA 3JQ8B 3CZCA 5JAZA 3IIIA 3MMNA 4LX8A 3EISA 3DMTA 1GAQA 3VKFA 2XGMA 2I55A 4GR4A 1UJMA 3C6MA 1M2NA 2OKCA 3LG2A 3URKA 4JN6B 1PFQA 2CFIA 2CUKA 2Q5FA 4R40A 1BIFA 3U4DA 3PC3A 1BAPA 3OOYA 4B2IA 2FWBA 2GKOA 1PVDA 4X1OA 4JU8A 1QONA 2BMEA 3VUFA 2QJOA 2E4AA 2GJAA 3JZFA 4BKPA 1WVGA 3U7HB 1N0HA 3F6BX 2M6LA 3ZE1B 5JXGA 1R0RE 1SZCA 1N32B 4E33A 4DAOA 2QPTA 3UMMA 4TYPA 1BMTA 1Y3AA 3Q98A 4WKPA 3WWDA 1Q1NA 1HEIA 1N3BA 3AOEA 5BSUA 2JIPA 4B79A 3WXBA 4QOIA 1E0AA 1DKUA 4G8BA 5DPMA 3QU4A 4PQEA 4WLFA 5COQA 5FFNA 1VMAA 2XDAA 4PLPA 1E7RA 2NP7A 4WL0A 2QE7D 1AHIA 1JHPA 4CCAA 2C00A 2YZNA 3L6UA 2R25B 4XSVA 4EHIA 3MT0A 3CE6A 4KJZA 3GCWA 5IAJA 5IAGA 2VHEA 3TPCA 3VR3A 2W58A 2BI4A 5FLYA 4ID9A 1BGVA 2NV6A 3DOEA 2IDMA 3H99A 4DQDA 3W34A 4LGCA 4EOGA 5BN1A 1NP3A 5K1ZA 1NNLA 3BWMA 1GYPA 4M9SA 3ROMA 2GARA 4JKYA 4WXPA 3ZUGA 1OXKB 1FP1D 3PJFA 4BE4A 3QLUC 5DNEA 1K9VF 1NQ5A 1ZA1A 5AOCA 4RGVA 2JLYA 2BKXA 2Q6LA 2W11A 2SKCA 1ZOOA 2PX2A 4TMKA 5SZJA 3QTBA 3NDPA 3O1LA 2QRGA 4RWEA 2CVFA 2ZT6A 4A1FA 3KL4A 5GADl 3KJEA 4ZCTA 2FQYA 3CNNA 4HGYA 1ZGBA 2BGNA 4M0FA 1WUYA 1V11B 1IAVA 4IZIA 1W30A 4O2LA 2IIQA 1PR0A 3G5LA 1YK1A 4LF4B 1G6OA 1AO0A 3UT0A 3EEFA 1XCPA 1RMQA 3DR5A 4B6FA 4EB8A 1UM8A 2NXWA 4UBLA 3FOZA 4TPKA 4EARA 3TG8A 3W5VA 3D81A 1RXEA 2G80A 3AU9A 1Z5ZA 2WWHA 3O91A 4DYHA 1JH8A 1LW6E 2F48A 3CZ5A 4I1PA 3IERA 4QEZA 1O0CA 1TYDE 3DAPA 4QBIA 3DJFA 3DZKA 5C7IO 2YQ4A 2JLVA 2PD3A 3L4KA 2R7MA 3I2GA 1IY2A 4CMBA 2PJZA 3HDQA 1EKXA 3A7DA 2DPMA 5H81A 5HSGA 1EPUA 5B1IA 4MUYA 1ZCBA 2CDRA 4Q9HA 5AVJA 4OMDA 3VR6A 4CMHA 4CQMB 1VYUA 3C5WP 3U4QB 1YBMA 2VYCA 5LZ9A 1VB5A 3BWCA 1JG7A 1Z25A 4GI2A 2PIAA 2OCAA 3B1YA 5CLHA 1C4WA 3H7AA 3OM0A 4B3JA 1Z4IA 2J7PA 1AUQA 1MHPA 2GM5A 3CW2A 5MGBA 2V3WA 4R68A 4CIBA 1OI2A 2HCRA 1MO6A 5KC8A 4PVCA 2QQGA 1YOVB 2AA3A 4GMKA 1HL7A 4PHGA 2WUFA 5HFJA 3PCTA 3ZJUA 1ARZA 4UEKA 5B3JA 2K7FA 2AT1A 2VSQA 1OTHA 1OI4A 4RCZA 1G6KA 3AFMA 3QW2A 1K7FB 1SCKA 2XTNA 1ESNA 4YALA 4P08A 3UIEA 2YTZA 2AJ8A 2ZR8A 1UEJA 2CSXA 2TS1A 1R0WA 1UODA 3IXMA 1E1NA 3MWYW 3GA5A 1K66A 2R5NA 4ILEA 4QPDA 2GHRA 1F8FA 4TL6A 2FSUA 3IIKA 4D4HA 2REQB 3DE1X 3PRYA 4EF4A 1UBFA 4FKZA 3ZGOA 4BP1A 1AZTA 1YA8A 2PKYX 3W3ZB 3F3SA 2G3YA 4C4PA 2OZVA 4LXUA 2AYXA 1TK3A 1YKFA 4KSCA 1ONBA 4CIVA 4AKEA 2PT9A 4Q3LA 5I5EA 3LZDA 2CWWA 1QFSA 4OOEA 3H3XA 1ULSA 2VK8A 5HKBA 2H1VA 5EOVA 1NY6A 1D0VA 4NMXB 4UHJA 3RBAA 2GAJA 2ZXUA 3JAKA 5FTJA 1K97A 2V4ZA 4Q7MB 5DE3A 4ZQCB 5DCWA 4N01A 3T94A 3TXYA 1MW8X 6ABPA 5DMXA 3ENKA 3FX2A 1F6DA 5HRCA 3EW9A 4RZIA 1WNFA 1DAFA 5DHAA 2L19A 2H11A 4BKRA 4BS9A 5AH0A 3G02A 4NICA 1FC0A 4NYIR 4RQBA 2PZAA 13PKA 2I66A 3K2IA 4J90A 4OGLA 3LO8A 1YNOA 5ALKA 1X1RA 1RJWA 2J9RA 3DBHB 4EPYA 2E5LB 1VBFA 1WZUA 2J3EA 2J32A 4KWCA 1DAOA 4RVDA 3W2TA 5E1BA 4AY2A 4E14A 3H1FA 2WJYA 2PWBA 4B7ZA 1K89A 1RPAA 3FTDA 3G82C 4P80A 1QORA 1YCDA 4HN2A 4MV1A 4J4TA 5CX4A 2FZ5A 3MMZA 1XZDA 4N6NA 4BJHB 1E7YA 4CBVA 2YWEA 4CMGA 4Y2SA 5EC8A 2IHVA 2WUEA 4EHLA 1JG2A 1MO2A 1NFQA 3R0VA 1I4TD 3UHFA 3C3XA 4CKBB 2EQBA 4WXYB 1XYGA 5K2MA 4BU0A 3DVRX 3W9BA 2REQA 1T8YA 3B13B 3OU6A 1WDLA 4I8IA 1KC3A 5ALEA 5G4KB 2Z83A 2ZRPA 3E9QA 3SF0A 3O93A 2Q0QA 1FXUA 4K86A 4G67A 3KB8A 1J8DA 5IZ4A 1KRWA 3PL1A 3KU4A 3GOQA 2BGUA 4MV5A 1H66A 2AOTB 2FUNB 3D43A 3OPNA 1M9NA 2FPPA 1JHXA 2J1LA 3FMOB 4URUR 4NDNE 4IEIA 2DFVA 4QU5A 2GEJA 4FD2A 4OXRA 2OORC 4TVBA 4YJFA 1L5LA 1E9VA 1XTRA 2V98A 2XSZD 1WL8A 3RYCB 1Y8ZA 3KKKA 3PZRA 1PZHA 1Y8QA 4GL4A 4YCCA 2YXEA 2YWRA 1XRRA 1PVOA 5I7SA 2NQ8A 3CF4A 3EXAA 1USWA 3G0BA 2OBLA 1TNDA 3H5AA 2WRZA 3CZ4A 1W59A 2R86A 3AO0B 3GNQA 2ZCVA 3IOMA 3AHCA 4TYYA 2F3RA 2QPAA 3EUAA 4XEHA 4EK9A 2C77A 2ZBDA 3G23A 2F3QA 3TLMA 1WMSA 1KZYC 2XT0A 3CUKA 1JBEA 3GH1A 4XYGA 4BV2A 2ZPAA 5I9IA 1RRPA 3S5JA 2ZAIA 5BV2P 4ESOA 3IVCA 3KXKA 2O2CA 2VEOA 3IOCA 3UMJA 4PYMA 1JVSA 3D2CA 1VG9B 2OV3A 1N6NA 3V8RA 1A9XB 1W0KD 3DDCA 1UDRA 4BMXA 1YZFA 1NP7A 1AZSC 1TUEA 1XTSA 1MFPA 3LWBA 5H70A 3DEZA 4URZR 2PXCA 1HF3A 3PTLA 4FR5A 1EFHA 2P68A 5HKKD 3L1IA 2WFLA 5DH9A 3DF9A 4HWTA 2GCNA 3CSSA 3IHLA 1KJIA 2J0VA 2YWDA 4NATA 1G7RA 3IUMA 1YR7A 1E1RD 4Z8YA 2BEUA 5I7RA 3KLNA 3WJ7A 1PAUA 2O8NA 4NH0A 3F5FA 4YS6A 1Y9DA 4XWGA 1UPAA 2OCGA 3ECCA 3HXPA 3RVRA 5A2QA 2FCRA 1G1MA 2AKAB 2GNPA 3KQUA 3U5TA 4YRCA 2VK4A 3ICQB 1TJ5A 1UKBA 3DFMA 1ENPA 1PS0A 2VUIB 1IUKA 1P61B 3FBWA 4RY0A 4L27A 3WLHA 4A16A 2D2VA 2VBCA 4DZZA 3DTVB 2DXIA 1X8JA 5E6SB 1T3TA 4FU0A 4NMWA 1P5HA 2K2QB 3ZGLA 3K1ZA 1C30A 1R9JA 1ZNQO 1EM8B 4OHBA 1RBZA 4TMVA 1KFJB 3V48A 1H4SA 3DH0A 3SZUA 4YMUA 2G70A 2BP7B 3A1UA 3BE6A 2BI7A 1NI4B 3AEKA 4QJ5A 1B8VA 2XEXA 3DYBA 4NONA 5AJVB 4G37A 5D01A 1JPUA 2VTEA 2B98A 5ENDA 3SK0A 4PFKA 4WUVA 5JSZA 7AT1A 4L74A 1DCKA 3ONVA 5EKTA 1SXJA 4C2TA 4QOSA 1PTJA 1CUBA 1RQ2A 3UUWA 1RWQA 1H6BA 2EERA 1WKBA 1IOLA 1LZKA 2X22A 4GDMA 4S1PA 5E9QA 3BZUA 1XEFA 4GNRA 3N3AC 4GPBA 4U2GA 4JS0A 2CDBA 2QU7A 3C45A 3F8WA 1HFKA 2H1SA 1S2DA 3HJRA 2XQIA 5C0OE 4H0CA 4I8XA 2OT3B 1K8ZB 3PJDA 1NUTA 4M21A 3ENNA 4RF2A 3WLKX 1CRPA 2FPGA 3RSZA 1ESEA 1CC1S 1E2PA 1TPYA 3L79A 4BLOA 3HEMA 2X0FA 3GAFA 3HJFA 3HDYA 1QUFA 2JFWA 6ADHA 4JI3B 4D0RA 4AZVA 3HKCA 5D51S 4Z8XA 2FFHA 3MT7A 1G4UR 2QEQA 2EDCA 4QNMA 4E03A 3HO6A 3B89A 3GPIA 3TZQA 2J0SA 2W2QA 2VF4X 5CGQB 1MEOA 2XXAB 5EP4A 4OY3A 4EJFA 4XB6B 5F64A 3BFKA 1OT5A 2JGRA 3RVLA 3KD3A 1Y9EA 4AWXA 2QZ4A 1AB5A 3KJZA 4PC7A 3LP6A 4O4LF 4ZI7A 5K7SA 4UBNA 1NE7A 4WZAA 2AOVA 1RYFA 1QYRA 1S2MA 3N7AA 3NALA 3MZ0A 1HBJA 4J0EA 4LTMA 4RV5A 2WF8A 2VAMA 3EMBA 3GQBB 3OM9A 3RT7A 1Y6FA 3W8RA 2VZ8A 3CEPB 5B3LA 3C5EA 3T38A 3ZBTA 2R4QA 4QXPA 1U4OA 3GBVA 4X94A 5DNDA 1D2EA 3T6KA 3WRYA 5BV0A 4AKIA 3N8HA 2ASEA 4CDGA 3IKLA 4WNYA 4AWAA 1H6DA 2OC4A 4OJMX 1VZ2A 3H83A 4LBZA 2AR9A 1D0SA 4TSRA 5BMOA 1NW5A 2FQXA 5MFPA 1DUSA 1C7RA 4DSNA 4RMGA 3Q8MA 2BMDA 1GT6A 5BRJA 4F2DA 3LFTA 1XCGB 2J07A 3KOUA 3QVTA 5DYNA 3DKIA 3F98A 1W6RA 4J3NA 2HAEA 3VZBA 4AG5A 2L17A 4OL9A 4PCUA 4P82A 1AMNA 4ZVRA 2I1WA 2CZGA 3AUXA 4MVJH 4EITA 5I4BA 2RH5A 4U7WA 5B4UA 3KHSA 5C46F 4Q1FA 3U4IA 1AQYA 2RGRA 1MQSA 1UPXA 4OLAA 2A0KA 2XX3A 2D2XA 3MJRA 2FF7A 3QIAA 2LZ0A 2FPIB 4BMCA 2BY4A 1AQ6A 5BQPA 1QVZA 4QRDA 3K7EA 4XZ3A 2IU0A 2FWNA 1Q83A 3FDJA 4EQZA 3I64A 2E1PA 1ZIDA 3ONDA 4R5MA 3UAYA 3P19A 3V3KA 2OAGA 4MEBA 3ZC3A 3TNYA 4EWLA 3LBAA 4ETIA 1D3AA 4IJWA 4Y7CA 3DLIA 2UZ0A 1UJCA 4TV8B 4TS9A 1ZD3A 3FRHA 2DT5A 2VYNA 3AERB 4L5IA 4Z7OB 4OBXA 1OYOA 3OD1A 4NFLA 2CFRA 3GIDA 3I0NA 1AS0A 4BE9A 3G2HA 4YREA 1TKAA 2CJYA 4BATA 1I1QB 1PLJA 4TWJA 1CW2B 2FAXA 2X2EA 5LYJF 1LI4A 2AE2A 1BH2A 1YJ5A 2DLNA 2OV1A 4OYYA 1T34A 3R4CA 2JFYA 1P5JA 5THXA 2AMLA 3RODA 4A7PA 2ARKA 2J9GA 2YXNA 1PZXA 1P3JA 3REQA 4ZQGA 2EU8A 3K6JA 2WA2A 4KCGA 1I30A 2PUWA 2VJQA 5SZKB 4J91A 3MN1A 1J6UA 4KX3A 4UAGA 2DBRA 1XZQA 3QWFA 5ITZA 3DMFA 1FFYA 1G41A 3N2LA 1I24A 2QP4A 2ZI7A 4OHXA 4B75A 5KYTA 3HBNA 1VQ1A 3L7NA 4ENPA 3FCSB 3HCRA 3I30X 4L6IA 5FR1A 3NYQA 4X1KB 1U0LA 3B1KA 4FEAA 2L82A 2NZ2A 4MR8A 4TYNA 3NGXA 2JFOA 3VM6A 3I5MA 3PGA1 4G0PA 4W1RA 4L72A 3F8TA 3V00A 3FJOA 1ZI8A 3QE9Y 1KXZA 2O8FA 3E9EA 2I33A 3MQFA 5KQPA 4Y9RA 3ORYA 4PFQA 4DMGA 2OKGA 5F1OA 1OYWA 5HK8A 3PFCA 1C2TA 2NW6A 1NSFA 4R2KA 1H2BA 5P8WA 4OAOA 2F7SA 1ZX1A 3E2PA 4DLLA 4F11A 5IN4A 3CNHA 1WCIB 1QZTA 5AVOA 3WK5A 3GPBA 2Q9CA 3KYJB 4IEFB 4FIZA 1GKKA 2OCPA 3UNXA 4DIMA 4O1HA 5JYCA 2HK8A 2IYVA 3N2IA 4K9OA 4QFCA 3QHAA 2QSYA 1HORA 3DO8A 3NVMB 4K2HA 4U0KA 1ILEA 1USUA 4B3MB 1E7WA 4RLHA 3LVQE 3GUZA 3ADKA 4M7RA 3SVTA 1RXWA 1HDXA 3HEBA 1E5QA 1T8PA 1M7HA 2GEFA 3DQZA 4M1YA 4TV8A 3HCAA 4KR6A 5C53B 1JE1A 4F1WA 1XD2A 5LQCA 4JXXA 4Y6GB 3IE2A 3H86A 4FGWA 4QHTA 4GS5A 4MUIA 3GXOA 3KX2A 1PK8A 5A7GA 4DR1B 3CX7A 5K0BA 3R3HA 1UXIA 5CGZA 1DDGA 4UVHA 2IIVA 3HA3A 5EHIA 3AV3A 2ZBFA 1CXZA 4F12A 2YWFA 3GRUA 2WAOA 4KLAA 4LDPA 3SIRA 4C0SA 4QU0A 3QMVA 4MV6A 3QFTA 2I4MA 3D0RA 3KAJA 5FLKA 2QTLA 2RKOA 1OB2A 1U9CA 4X1YA 3WGGA 3AKCA 2IXGA 1NAHA 2VVTA 2PCJA 2JGFA 2PUHA 2YHSA 3CLTC 4AB1A 1GSHA 3AM5A 3LTNC 2BGWA 3MF4A 3KE8A 4DLYA 1JSXA 3TEMA 4BP8A 4PPNA 3W3AH 3CUUA 1K08A 2VDMB 3P9SA 3QYJA 2PKCA 4LDRA 2NN3C 3HVJA 1XKQA 3VI3B 4YDSA 4GWLA 2CGEA 2A4KA 3PJRA 4NZOA 1R4ZA 4AFNA 3CKMA 3HKEB 5CFPA 3OA0A 1COZA 3F6RA 3OEED 1A9YA 3MGCA 4KGXA 3VNBA 3U3XA 4JXJA 3SI7A 5L8VA 1ZU4A 2XV1A 3VU3A 4A6EA 4BGVA 1BN6A 1DPFA 1SBQA 3U0VA 7GPBA 2QTBA 3LFUA 2OFPA 4TTVA 3PLRA 5D84A 5AK5A 1JHAA 1X8KA 1L9XA 2X4IA 2MCFA 5EFOA 1HDZA 1V39A 4PZDA 3GMDA 2R3SA 3LNTA 3TM4A 3AUAA 2A58A 1H2FA 1UEXC 1ZVJA 1PZEA 3DT6A 3EG5A 5H3LA 2W5UA 4O4LB 4S12A 5JE8A 3WK8A 3L7MA 5IF9A 5GJVC 3AF6A 4FYKA 3V4SA 5ECWA 1BCRB 3E3MA 4DLPA 3K0CC 4CMAA 1U7PA 1DEOA 2OE2A 4P81A 4E4YA 3CEMA 5HQTA 1Q84A 2Y1LA 3JW8A 4D46A 4CQNA 1EVEA 5BQFA 5K3OA 5AVQA 3EGOA 3NXKA 3I9OA 1AGNA 3PNVA 3VOSA 3ZJTA 3QE3A 1ZMXA 3S1AA 4IMRA 1XD8A 2FW1A 1P31A 1UC9A 5DCLA 2Z04A 2PCLA 3FFBA 3GZ4A 3SMVA 1K75A 4IRMA 4PXYA 1NLFA 1QOZA 3LA8A 4K9SA 4RHXA 1GWNA 3MOIA 4WGFA 4BASA 4ENSA 3N8GA 2RGNC 5A03A 4EMUA 5DXJA 1TVKA 3ZHSA 1BE8A 3Q2IA 1NKTA 2QTGA 3ILVA 3TX6A 2CL7X 3KM0A 4IKEA 4KE6A 2PUTA 1Z7BA 2P5UA 2PM8A 3CG4A 3NPAA 4MI9A 1COWD 5BT9A 4OX9B 3HCFA 3Q3GE 1N5IA 3V1MA 3K72B 2GPBA 2RHCA 3GPDG 4UUBA 2NAPA 1I3LA 2VHQA 4ZAYA 4LYHA 2VP2A 3FHOA 4OSOA 1VYHA 3P9RA 1U0BB 3IB3A 3UENA 2VHZA 1II9A 4MKIA 3JQEA 4K6FA 3NG1A 3THXB 4JYPA 1J1UA 2ATEA 2Q9AA 4BNTA 3SXUB 3UFBA 2Y1XA 3QLJA 3HKDA 5IWAB 1Z2EA 2EYUA 2VJNA 4TRJA 2FJPA 1F0YA 2SCUB 1GD1O 2GS9A 1VE9A 3H8JA 4QGBA 4MWBA 5E6RA 5HKLA 2IYXA 4G1EB 4MWEA 1DMRA 1X0VA 2PSHA 2WZDA 4D3FA 2NVBA 4K3VA 1C9DB 1YB5A 4U02A 1P1KA 3RANA 5I51A 2BYTA 1DUVG 2C9ZA 3GIWA 1SCIA 2QS9A 1U2GC 3L0DA 1ZWKA 3ES9A 2P8JA 3IPAA 2G4CA 2P6MA 1TQDA 1U8EA 3C7TA 3NQ41 1TAHA 3QWHA 3TQTA 5KYVA 1H69A 3D8RA 4NK4A 3OFND 5BOVA 5GZ1A 4EX6A 3WGLA 3SF8B 3NYRA 3L9XA 5TRTA 4UPEA 1Q3KA 3A6EA 1EIZA 3AF5A 4LSWA 2WR8A 3STHA 1FIUA 3AYXB 1SUFA 1J7JA 3E03A 2Y4NA 3HBMA 2OCBA 3U5ZB 4R8MA 4H60A 2IX9A 3BFXA 2HBZA 2B25A 5CVVA 1ZM3A 1GA6A 4RTMA 4OHMA 1NR7A 2O2HA 4H31A 5LR6A 4ARIA 1GAEO 3WL4A 2BDTA 2YFYA 4QPNA 3TD9A 4EENA 1DTWB 4LRXA 3ICOA 5K0SA 3VNQA 2EQAA 3J80A 5AJZA 2WSMA 5AVRA 2NU9B 3X2SA 4MVXA 2PMEA 2CNWA 2AXQA 4UHHA 4WY8A 4FDVA 4NNOA 4F5EA 3LXRA 4ETWA 5EJ6A 1JHQA 2H5IA 3HTXA 3AFNA 5AI0A 4PHHA 3NANA 1QMPA 4AZTA 3GELA 3ZUPA 1T5IA 4OJTA 4DQ0A 4LFBB 3QMMA 4PANA 4KIGA 4EW2A 1PYDA 2NZVG 2QTNA 4UU1A 5LP6B 1B6RA 1L8XA 4Q9NA 3KPYA 4G86A 5A7FA 4JT4A 4WLVA 2WUGA 1T9CA 4A15A 1X3SA 1NVXQ 4GPD1 1XJWA 2H31A 1RQPA 4OLJA 3SC3A 4ZQFA 3PE4A 3RSGA 3E4CA 5HQ3A 4M54A 4DRXB 3VJLA 1OASA 1NW7A 3NR2A 1CP2A 3UM9A 1M2FA 3USCS 3U1BA 3NHYA 1XFAA 1OZFA 1E66A 3AR5A 3PDWA 4FMDF 4HG2A 5FADA 4EB6A 3NIGB 3HQ4O 1OPRA 2B92A 3HCDA 3AQIA 4Q3BA 1NJGA 2YYYA 2IBTA 3WSWA 1YWGO 5KYXA 3L7JA 1YRLA 3QKRB 4RPLA 4BUJA 1L1FA 2WYWA 3WGQA 3E48A 3COSA 3FF1A 3NCHA 4UTZA 1FTWA 1E8DA 3D0QA 1SVMA 1T36B 3C2QA 5JO9A 1JG3A 4C2AA 5CLJA 2M2IA 5EZYB 2WIKA 1T24A 2ZZNA 4OBWA 3HPQA 4GKAA 2ODPA 3NPMA 1HFEL 1HXHA 1YDEA 2WKRA 3QIVA 4DC1A 5HZHA 4BO4A 5COAA 1M54A 2GF0A 1A5TA 2OTCA 5KBYA 5EPEA 2D06A 2HU7A 1A5SB 3WGZA 4B81A 4PG4A 1L4EA 3GWGA 4ZEMA 2Z8YA 4WSOA 3Q1LA 1T9GS 3T1QA 1DSSG 4EABA 2Q6TA 2ZKIA 4WOBA 2RHWA 2G9VA 3ESRA 5E2AA 2WD7A 5IG2A 3P94A 1JGTA 4N3BA 1IM2A 2XRYA 1E1DA 4IG4A 4N0MA 2RBGA 5AI6A 1PQPA 4BRUA 3SJAA 3VC3A 5IJ0A 2HJVA 1GVHA 1AQIA 2B61A 2FW7A 3AEQA 4EW6A 2XXAA 3RYHB 5JFGA 2X3FA 3C3WA 4HMOA 1VI5A 2G76A 3C4QA 3QE4A 3UJ9A 2BTQA 3HBJA 1FE8A 2V65A 3I6ZA 2FG5A 4JODA 4K0KB 4XYEA 1P7VA 3DF7A 3CZQA 3PC4A 4JP5A 1CJUC 1QYXA 4ZAFA 1EQAA 1II8A 5J2UA 4H0NA 3ZCQA 3NHJA 3CF2A 2W4QA 1VECA 3KZCA 3MWDA 5MHTA 4G84A 4BVAA 1PLKA 4ZK6A 3D1LA 5CB6A 2W8ZA 3KUKA 4B8YA 2CLEB 4MR8B 3U48A 4H3VA 5AM1A 4O2BA 1X86B 1KH1A 4HRVA 1FP4A 3N05A 1VDZA 3OG9A 4LV8B 5D85A 2A4MA 1UMBA 3QVSA 1KEVA 5BN3B 5I3ZA 4YT8A 1D6JA 3K6RA 4A03A 4DM3A 3TL3A 2JL1A 1FYVA 1QMGA 4RHFA 2EWVA 2X9GA 4YONB 3VJRA 3PGKA 2VAVA 2CZCA 3QPWA 6Q21A 1UWCA 5IX8A 4CQLA 3GA0A 3FGZA 2G08A 5IMBA 1DKPA 2IXTA 1IQ0A 1QB8A 3GLHB 1YFJA 2R1ZA 2R7AA 3ANTA 3B1XA 1L4BA 1VRCA 1H9BA 3CJQA 5JH7B 1W88A 1IHPA 1BX3A 1ZWLA 1C9NA 1J5XA 2FUKA 2Q21A 2IE8A 2DY0A 1EDBA 2QNRA 1BEEA 3OKCA 1EGHA 3GUVA 2P75A 3T1OA 4DILA 1U5BB 1ZUNA 2QMZA 4MARA 2YHUA 4S1TA 4W7HA 3MELA 5EERA 5EQDA 3T4EA 1TVKB 1CUEA 2XNKA 3SC2B 2VPXA 3T7IA 4YJ2F 4Y0AA 1G5FA 1OLOA 4MWDA 2FY8A 4TT3A 1KP9A 4D81A 1P45A 1UKYA 4FLMA 3RLFA 3W2IA 3M5CA 2CBZA 3RVMA 5AW8A 5IJWA 2O8DA 1R9NA 1Z2PX 3E84A 4INZA 3DVLA 4H1VA 1N9KA 3W5SA 5EIXA 1EGMB 3CVOA 5HQJA 4D1YA 1FUIA 1R18A 1YDWA 4JBYA 2AC2A 1TZCA 2ZM6B 3AR3A 3PEVA 5C3MA 3PUZA 2FSPA 2FLVA 4ZAWA 4DCNA 2BEVA 5IT4A 3NRBA 1OXXK 3V9PA 5SICE 3EIFA 4L3WA 1LPBB 5MN5A 1DBRA 1Z56C 4G1CA 2Q9BA 3FXAA 3L8GA 3EH1A 2QQ5A 2VZLA 4LW8A 1S1MA 1Y8QB 4ZALA 1PG2A 4MB0A 1VGRA 1WMAA 4L3VA 3KKPA 3ZZ0A 1Y1QA 4DCMA 2HLDA 1W75A 3PLNA 3VSCA 5CITA 2HEIA 4QBKA 4TXJA 5ALRA 5I4CA 1DAHA 2Q28A 1IQPA 2A78A 3DG9A 4FZJA 4B3FX 4C4YA 3SEAA 4P4TA 3ACBA 2AJBA 1T2NA 3QPCA 3FGPA 1JFFA 1A9TA 1GY8A 4UPVA 2WV9A 1MXFA 1XQ6A 1KR5A 1M6NA 1AH2A 4EEKA 2GCIA 3KPVA 1XQVA 3CH4B 2FMXA 3TIXB 4YCBA 1CY6A 4V3CA 4ENUA 4HDNA 3Q9SA 1QAMA 3K1YA 2AZDA 4AN1A 1E1CA 1QR2A 2CL5A 2V5AA 1U2DC 2XWSA 2K7ZA 3COYA 1JECA 3SOPA 5IAOA 3M6XA 3PUKA 5EJ7A 2HU5A 4FDUA 4MJXA 4L8VA 4LI3X 1EWYA 1RDFA 1RI1A 3B7GA 4ER3A 1BE1A 1KJNA 4L5JA 3UF0A 1XTUA 1UAYA 4KXMA 1TRHA 2WLSA 2ZYSA 1FJGB 1N1GA 1QHIA 1UMDA 3E7PA 4JLJA 4W7IA 4YQYA 1E2QA 3T9BA 3L01A 2A0FA 2DHRA 1MGPA 2N1MA 4DV6B 4HMPA 4P58A 3HFGA 4Z53A 2OY0A 1ORHA 3QWIA 3RU7A 2P5SA 2GZSA 3OP1A 3ZK8A 2FW6A 2A1UA 5SYNA 3DOUA 5JDIC 1T9BA 3U9TA 1B93A 3A1CA 1DINA 3LU1A 4TMTA 4UCQA 3GJ6A 1ZJ6A 2WU8A 3HNRA 4C3OB 4HV4A 4G8DA 2IEZA 1FYDA 3L0SA 5E3HA 2BFPA 2QENA 1K6EA 3PPYA 3I04A 2RAVA 5KQRA 1TLFA 3AINA 1UT8A 4PLZA 2OENG 3R9XB 4UM9B 2WHXA 1V5FA 1HT3A 2H29A 2QSUA 3AEKB 3EGIA 3IKVA 3MT8A 4QJ4A 3RSSA 2PD4A 2XZTA 1TQ8A 4Y6SA 4YJFB 5FPSA 2Z8YM 3OZEA 4F21A 3OKFA 1W0JD 1PEDA 2ORYA 1YAHA 1N2CE 4IHJF 3FLBA 3GFGA 2HA3A 3EXEB 3VZRA 5CBPB 3QX8A 2O9JA 3G5MA 3JD0A 1XWWA 4OHVA 2FE1A 5BSGA 3TIGA 4IMIB 4G2TA 4H3HB 5GZ3A 1YFLA 3DEKA 3RE1A 4MROA 3RFCA 4F2GA 3E9RA 2KB0A 3K9NA 3MRXA 5AW5A 1QK5A 1UBMS 2AMYA 1MUUA 4QPCA 4R9VA 5DIZA 1L7MA 4NE7A 4X5OA 1A8IA 4D8UA 4ONEA 4KQEA 5HUQA 2QSZA 1RWOA 2FOXA 2ZIXA 4S24A 3GX1A 4MLZA 3TQCA 1W5BA 3TNLA 1JJBA 3Q7QA 1KYTA 3MSCA 2DAPA 5JSFA 2ILVA 3TG2A 1QVAA 2B6HA 2FHSA 2DLDA 4JP3A 4KK3A 4FDAA 2R6JA 5C7YA 3N2KB 4BVLA 4RXUA 4C1BA 5A9RA 3ELBA 1MB3A 1TE2A 4LZNA 2IP1A 4MGYR 1BXRB 1XZLA 3GNLA 3WK7A 1ADGA 1RYDA 4BPBA 4RV4A 3A1VA 3EC2A 4AJ1A 4R1UA 4JLSA 3S3TA 5HFNA 5AKGA 2CEKA 1WTAA 5J5CA 4HB0A 3H6GA 3H2GA 3HH8A 3TRFA 2NU8A 1QZZA 1C7EA 1UK9A 2FJUA 4JGIA 5EHQA 4DM4A 3VTKA 4ARAA 4YJGB 2X9VA 4CFYA 1O96B 3QNUA 4BECA 5E0OA 4AWBA 2PRIA 2X4DA 2X8AA 4F6CA 4RVUA 3LGSA 2H2FA 1EP3B 1KO5A 4TLMB 2QMHA 4Q0MA 4BMZA 4DBLC 4DC0A 1DXOA 1CQZA 2I7VA 2R7NA 1GDTA 4UEOA 4C0HA 3O74A 4G9EA 3LFHA 2X8WA 3BWVA 5AICA 4CFZA 4L8FA 4DTCA 4I2NA 1GP2A 4LY3A 3O3OB 4LA4A 5FA5A 3VBEA 4Z4GA 1DC4A 4O2AF 4EA9A 2VPIA 4B9EA 4DBLE 1F8YA 5E6RB 3OURA 2P7IA 2IV3A 3PDJA 1L7XA 1Y3CE 3ZH9B 1K6XA 2CNLA 2CXUA 4LGVA 1RAFA 3WIDA 4BQQA 1XDWA 5KTMA 3HSSA 3WDLA 2FNAA 3RSOA 2BLLA 4R8VA 4Z3DA 1IJBA 2YX1A 2HWWA 5BMVB 5CA1B 1NBOA 2HIHA 1S4MA 4WERA 4QBFA 3DQPA 1N2XA 2BEJA 1VKOA 2H9YA 2NGRA 3ETNA 1A3CA 4OJKA 1BMFA 4H4DA 1UJ5A 3O4IA 1RM0A 3VPBA 1X1BA 3SKYA 5C1OA 3WJ2A 2RHJA 2IHZA 2IS4A 4FJ0A 1D2HA 3GRRA 2PBZA 3TR0A 3PHHA 2ID7A 1KO7A 2PWZA 2IVZA 3RREA 3OWOA 4XD7D 2RBKA 4Q18A 3ESBA 1NI3A 3WK4A 4UE3S 5JQGF 4NV1A 1BGXT 1VKHA 2H9AA 4XGKA 4HZIA 3VNAA 2BBOA 3C7CB 3F73A 3JWPA 2GHIA 3MJSA 1Z7YA 4JB3A 2BFBB 3SQMA 2ADOA 1SKAA 4MUEA 1GPYA 3G2KA 4RF5A 1T35A 3IJPA 2VHTA 2V5UA 4UASA 3S1LA 4LE1A 5ALXA 4D9FA 5M04A 2GTHA 2GHQA 5HGJA 1IQUA 1F4VA 2C7BA 1SUEA 2Y1OA 1WF6A 1QP8A 2QUAA 3BXPA 4JJ6A 4LWQA 5KAPA 3RYFA 4RD0A 4PS1A 4C0LA 5L6MB 1SUDA 2RC6A 3JWIA 3ODGA 1LVGA 2MT9A 3PXBA 2C94A 4P5EA 2Q3BA 1R8JA 1T2EA 3H2ZA 3SR4A 3EX7C 3SBXA 3LC7O 3ME5A 4US1R 5CJ2A 3UWPA 1RVDA 4AZ0A 4DA9A 3M1YA 3ZCRA 4ENQA 3C8UA 3V42A 1FEZA 1PWXA 1ZM2A 5KYYB 2DERA 2NU7B 3IR7A 3L9WA 3U1TA 1CQPA 3DWEX 3LGAA 2B8EA 4KN8A 5CCBA 1U0SY 2I67A 3DEYX 2VXBA 2AL7A 3FOAA 4RZHA 5EE3A 4ANFA 2QD4A 2QDXA 1ODKA 3FBGA 2YW9A 2DFKB 3VKUA 2PJRA 4YMVA 1SG9A 2DTXA 3G1WA 2GPNA 2P9HA 4V38A 1Z2DA 3L8MA 2A9QA 3P2IA 1SU4A 2QIPA 4CM5A 1YVEI 1JHVA 3Q7TA 4HNAB 2FZCA 3LQFA 3UPTA 3KQNA 1P5ZB 2C58A 3I12A 2G83A 2Q4EA 4N49A 1WPQA 2JCGA 1X1QA 1GU7A 3AJDA 1QTIA 3PQ4A 4H9GA 4DADA 4DMFA 2C5SA 1ZM9A 1K7EB 3FM9A 1K98A 1CHNA 1YI0A 2Q7OE 3T1VA 3GLHE 2RGBA 3UW1A 5DWQA 4CKCA 1VLHA 2TMDA 2JC3A 2WG1A 3KB6A 3UG6A 3PU6A 1H0RA 3HRHA 5BW5A 3PHLA 2JKYA 2G63A 5JTUA 2H5LA 5KNCA 2DBQA 2FP3A 3ZTYA 1CYEA 4G97A 2G09A 4QQNA 1R4NB 2I8CA 3P27A 1KH3A 4X84A 1KVUA 3C4VA 3HHEA 4MUGA 4YCNA 2F17A 4RVCA 1R4AA 3L5KA 5ICCA 4NBNA 1KK0A 2OGWA 4TMWA 5IUKC 1GUFA 2IXDA 4YX9A 4IXTA 4GI3A 4I55F 5BQ3A 3O7MA 3H2KA 4Q00A 3KQSA 3CPHA 4DE5A 4XWTA 4D8YA 1U7WA 2FFBA 4M1SA 4MAMA 3ZYCA 4Q6WA 1VE3A 2Q1XA 4M83A 4D44A 3ZZNA 3CW8X 2VHVA 1E2HA 1H3NA 2PLFA 3N07A 4H16A 4L7VA 2YYZA 5EZYF 7MDHA 3AIIA 1EH5A 1FTQA 1L4HA 1T9ZA 2WTNA 1KQPA 3KAQA 4X20A 4N9WA 4NKRA 2GJ9A 4W9RA 4RL6A 4ZZ2A 4EHJA 2IFTA 1TKCA 4U7HA 1MD9A 5KYXB 4O2BB 3S29A 4ZVTA 4QRHA 5FV4A 4MPTA 4PG6A 4XQCA 2VJCA 3SDBA 2O0LA 3IV9A 2WWFA 4QQ8A 2C7QA 4L15A 2D62A 2UYQA 4B8WA 4DDTA 1Z7GA 1VIVA 4F6LA 2ECFA 3R5FA 2VF7A 3DE6X 3EOZA 4OU4A 2QJFA 3DL2A 1S7GA 3R77A 3FTQA 5JSHA 2PZGA 2V96A 3D6JA 3ND7A 5DVZA 4BNGA 2ENUA 2P2GA 1GJRA 5ABPA 5B6JA 3NWEA 4LXYA 2WHEA 3M6FA 3NHLA 3PNSA 4BAGA 2ZAOA 2WJWA 3W8DA 2TMYA 3PI6A 3D1JA 2XKKA 2H4YA 1GGHA 4DJAA 1XXLA 1TPZA 4NG4A 1KYYA 3EF3A 3Q7RA 5LD2B 3JASA 1NPTO 1ZYUA 4JB8A 4IDGA 2HN9A 1PG0A 3TZBA 1M2VA 2JAQA 2WSSA 3BGOS 4IQ4A 3BRQA 4KVFA 4WT7A 4YECA 2QYTA 3RIEA 1Z5VA 2GX6A 2C0PA 2O05A 2ZCUA 3ZWYA 2QMUA 4DQKA 4CNQA 5KWIA 3PS9A 4RTRA 3OTGA 1NVVQ 3IMKA 3UMRA 3DWFA 1BC5A 3RNOA 3SHFA 3JY6A 1N57A 1V96A 3DUFA 3MWGA 5FOVA 4WZBE 5IJ9B 1LBHA 5A5EA 1IEXA 2W2TA 3DB2A 2Y0DA 3V34A 3D7RA 1QGUB 3PNBA 3Q6IA 3FVWA 1RCUA 2WFMA 3GHYA 3OQPA 1GZ3A 1QHHA 5K20A 5HNKA 2XZLA 5LPNA 4XFJA 1UJ2A 2P40A 4KQJA 1GZ6A 4CKEB 4HBZA 1J0AA 3DOHA 3M5PA 4PAQA 1Y8CA 3RV4A 3NHBA 1GAJA 1JW9B 3IAM1 2GA8A 3J7TA 3MBKA 3I23A 3OIGA 4HNSA 4W9NA 3KR9A 4RAQA 4X95A 3BXOA 2X5KO 4Z9XA 4U6QA 1HDIA 4N0QA 1J2RA 4TL8A 5AXBA 3KOZA 5ELXA 3IQIX 4D0LB 2VJBA 1Z7WA 3T3DA 2GR9A 2Y0PA 3ZU2A 4D25A 5KDOA 1NLZA 1G63A 1WMFA 4W5TA 3KJFA 3OQHA 2CLCX 2O1EA 1O94D 2RCYA 2Z9DA 2RD2A 1G0OA 1HETA 1U3VA 3B7PA 4JU9A 4B2YA 1RHRA 1XZFA 4HT3B 2IHKA 3IC5A 3QLVC 1PHPA 1XRQA 3AUUA 1W2HA 2MINB 4NV3A 4OXKA 3M34A 4E6EA 1SC6A 2JGDA 1FU7A 1DEAA 1OLXA 3ZHBA 2QOEA 2OSBA 1ZR2A 5K3FA 3MPUA 1ELOA 4GC5A 4I55B 3TOZA 5BSHA 1E9DA 2GN9A 3CVXA 2OORA 2V45A 2CLDX 2P9ZA 1NJFA 2GRJA 2ZJAA 1H4VB 9LDTA 5HOQA 2O6LA 2Q1TA 3FAZA 2C78A 1BFUA 4LDQA 4F2HA 4MA4A 4KMOA 1DG1G 5JXWA 1L4GA 4IDDA 1TU0A 3LDUA 3U4QA 4ISCA 3UCXA 3PNMA 2XF8A 4HLCA 4R05A 3V8PA 2Y8EA 1LNQA 4EVSA 3PQCA 4FEEA 4LQ4A 3RS3A 1JNXX 1A9OA 1ZMTA 2DULA 4YBZA 1CFJA 1VHQA 4MYRA 4E31A 4NDZA 2X1LA 3LA6A 4UU7A 2Z5FA 3IOEA 4GOND 1FRVA 1OXTA 1P3Y1 2VSYA 1CUDA 2OFOA 3FCOA 2C88A 2JEOA 3MWEA 3NTLA 1F2UB 4QQFA 1XIVA 2VR1A 2R00C 4PGAA 5JXJA 3SYTA 4CDRA 1AURA 1MJGM 2C2HA 3HBLA 5B57C 3QFHA 3AGQA 4O2RA 5DLDA 4FN4A 4XR9A 1LWNA 3W90A 4BMPB 1SCBA 3TQOA 3TN7A 4B85A 2PZJA 2M6RA 2QRVB 5LCXA 4P2GA 2HY7A 2R2AA 4QT0A 4OKSA 1FBNA 1X74A 4GKKB 4EL0A 1T8RA 1VP3A 5JXIA 3OMWA 4OP1A 5AW3A 3FSJX 1GL6A 3SVLA 5DTMA 3UOGA 4EY8A 5G0UA 1QOQB 3I9V1 4YMWA 5JFOA 3DZBA 3WI7A 3TNJA 2WICA 3H18A 1G19A 2FEAA 2IJGX 1UKEA 2FV8A 4OUKX 1RACA 1BWRA 5H83A 4GRDA 1YTUA 2D0DA 1GNPA 1N8TA 1QFZA 4B3XA 1N0WA 2JLRA 1RYZA 4RVHA 3RGWS 1UINA 1LEHA 1BROA 3ZWMA 4E5UA 1N8NA 1R16A 2O7RA 4X7BA 2EJWA 2FF5A 3CEJA 3DGFC 4ERNA 1MQ8B 3WL7A 5LL6P 1X7DA 4MW4A 4ENTA 3HS3A 4LJ5A 4CGYA 3S8MA 1NQVA 1OA0A 5LJLA 1Z6ZA 1YMVA 2H3HA 4HDMA 4Y2PA 1MR3F 2JASA 5FR2A 1IXRC 4R1MA 5DJ5A 2RAUA 3TINA 1JDBB 1KMNA 3PA6A 4BNNA 4DA8A 1ADBA 4LYDA 4K0RA 5HX7A 1WXEA 3BWXA 1UZNA 5KNBA 3Q2OA 3AFOA 1RSZA 2PQ6A 2YXLA 5AM0A 3U60B 1GPKA 4JUCA 2GAOA 1XTIA 2UAGA 4X61A 1SCQA 4GXQA 2QAIA 2JA2A 3R4VA 1MX1A 3FKSA 2WHPB 2IIBA 1IVYA 1T9AA 3L7YA 4GYKA 2V0CA 2OSVA 4I9NA 4LOLA 5FTNA 2I4RA 3U0BA 4BCBA 2P30A 2WJJA 1FP2A 4EJSB 1GR1A 2WILA 3KSUA 4M8KA 1DVRA 4UHCA 3V97A 2RARA 4R81A 1GPH1 1YV9A 3A32A 4FWBA 4JVMA 3SKXA 4RHCA 2GFQA 5AK6A 1VL6A 1TZBA 3Q3EA 1N2HA 1PK7A 3OZ7A 2O6HA 2OGTA 3P96A 3WGJA 5IH7A 2YJ3A 1N1MA 1W25A 2ZDGA 1IG3A 1YE3A 4QG7A 4TSFA 9ABPA 1Q7GA 1W46A 2A5DA 3NM4A 3AUTA 3F0TA 5JVDF 3LT2A 3DB1A 4HEA1 4IBOA 4YI3A 4AIIA 3EULA 5CX1B 3IFSA 3A9WA 1UANA 1V8BA 3KXDA 3BYZA 3PX2A 5HTKA 3WL3A 3H2YA 1L7EA 2A5GA 4MAFA 1GPUA 2R8ZA 3VO8A 3OBBA 2OUIA 1TYZA 1V8FA 4K9QA 4RIFA 3GGPA 1I6MA 3K2BA 3CRZA 4J03A 3M0EA 2I62A 3ZHQA 2QRVA 2O4UX 5L3VA 4OXNA 4WNIA 3GLGA 1YVPA 2J33A 4MWCA 5KCMA 3D8TA 3DTNA 1QGAA 2FRDC 3LUDA 1H8HD 2V55B 1OU0A 3OCWA 1B0AA 1ZL2A 2ZAYA 3EA0A 1KL7A 3LKDA 5DM60 3NBFA 5A3JA 2IUFA 3LT4A 2QZPA 1XZGA 1RLOA 2A0YA 2ZRQA 3DEFA 4ZANA 3ZXSA 2ZOSA 4PX9A 4ALNA 4J2HA 1XU7A 4EZBA 1RWPA 4FS3A 2IH5A 2RKBA 2VTKA 3QUAA 4CDNA 3EMDA 1IZYA 2ZJ7A 1NBME 1H5QA 1B00A 4Q47A 4RIHA 3HJUA 3AG6A 5B55A 4HDKA 4NEQA 1A7JA 3E1KA 3BSWA 3WNZA 2GPSA 3Q7SA 3KZ1E 4PZPA 2FUEA 3D8UA 1T91A 3AV0B 2RHHA 5ALTA 3V1LA 4WWHA 6NULA 4B82A 5KQMA 2W6IA 1QOPB 2WU3A 5E1MA 3RCBA 1KVRA 4IINA 2GCGA 1YF3A 2J7KA 4F38A 2R97A 4MRPA 2BGKA 1NR5A 5DOVA 1MC1A 4EGSA 1WDMA 3GJZA 5KVQA 4NZZA 1DX4A 2AVNA 5BOSB 2BBSA 1RBMA 3D3KA 1V1JA 3ID6C 4K1XA 1J23A 1L5HB 3IHTA 3WNBA 3QLUA 2PKEA 2JS7A 4N5DA 5LMUB 4J3JA 2XRZA 3LK7A 4QZVA 1DE0A 3DNMA 1G21E 1UJNA 2W6JA 3N6RA 2AEMA 3CC8A 1EFRA 3TBFA 2GZMA 3LHSA 1JEQB 1CZKA 1KRHA 1GZUA 4UVDA 3S99A 4OYLA 3VC7A 4LWOA 1NT4A 2UVPB 1JNYA 5JJ5A 2H51A 4HB3A 4WNAA 3QUQA 5KYUA 2HTEA 3FNFA 1O97D 5D2CA 5DGXA 3AP2A 3SD7A 2CN1A 4CWAA 2WSBA 2BJHA 4G5RA 3O9MA 3WFZA 3WIOA 1FYXA 4DWWA 4L07A 1CG6A 1BX1A 4BYGA 1IWBB 1Y8RA 1ZN9A 5EJ4A 2LD4A 1YRYE 5H8WA 4GZLA 4C5AA 5FI3A 1IN8A 1KDZA 5F3WB 4FWIB 5B53A 1YRBA 3FAKA 1J9GA 3JS5A 1H94A 4KE8A 1OXVA 4L9AA 5REQB 3TJRA 2IH4A 5EFZA 3ZD9A 1QRRA 3JD2A 3N5KA 3DEAA 4U39A 1L4NA 2NT3A 4O5AA 3M3DA 2ZVPX 3V9AA 4I4TA 1KFCB 5FBHA 2BFWA 3DKKA 2ZUEA 3D0OA 3F5DA 1Z8DA 3ZE0B 3MJHA 4LSGA 3IRVA 4A0SA 1FU4A 2RI1A 3TLXA 5D86A 1VBMA 4YPOA 3BWYA 1WPXA 1DIOB 5ELLA 2FRXA 2VDWA 1PJQA 3OZIA 4B6GA 4RK4A 4GI1A 1G8GA 4EQ6A 2VWPA 3U4MA 3VGPA 3RYIA 1FRZA 1RZVA 1EX7A 3TB4A 5BW4A 4D3YA 2RGYA 3CLUC 2Z5GA 3REFA 6GPBA 2ZBGA 3WMWA 1RS0A 4DYVA 5BYAA 1JZTA 2ZWVA 3JD4A 2OP0A 2HRRA 4MB2A 1NV8A 2XA9A 2XNDA 1JB9A 3OQVA 1QHFA 2J4DA 4E0BA 1F5SA 3NM6B 4ZT4A 1IHXA 4DUZB 2BRUC 1KARA 1ZUD1 4A8JC 4F72A 3KZXA 2G0NA 1MRZA 3DBOB 3AWDA 1FTSA 1NL3A 4RENA 2N46A 3A0RB 4RAOA 4KR9A 4P34A 5JDIA 3PDIA 5F21A 1EXWA 3AP1A 2CCKA 4EDHA 4XPZA 1GTJ1 4LRUA 1E9AA 4ZICA 1TKBA 5EUBA 2DHQA 2RGGA 4BV8A 1M2KA 2BHLA 3ZWXA 4URXR 2AMJA 2HBQA 1H4TA 1ZS9A 4Q37A 3UJBA 3WRVA 2CYAA 1CZLA 4KFSA 3R9IA 5CD1A 3L8YA 3NAQA 3RUAA 2W22A 3IP8A 4WINA 3PF9A 3C39A 2E82A 2Z2YA 1ODJA 4YQFA 1Z63A 2VPYA 2Z2ZA 1QH0A 4CCSA 1MVLA 3ONNA 1E2FA 3A6LA 3DAFA 4BFWA 5L9AA 1Z73A 1ZGHA 4IYJA 5F12A 1WB5A 5IDXA 2WAXA 4R2HA 3UMVA 1O95C 3E7DA 3EFEA 3TQQA 2O3TA 3LRPA 2H00A 1JT2A 4P4GA 4RVGA 3RS8A 4GKJB 3W3AA 1ZIYA 4C0JA 3CWCA 4WK2B 1E3QA 2GRUA 4CN9A 3OZUA 5FL7D 3WWZA 3QLEA 1I5RA 2ZAGA 4DARA 3HY3A 1Q1QA 2VZ0A 4G0YA 1L5GB 5IANA 2GAIA 2XGOA 2WIBA 3EUEA 3H1EA 4GOKA 3ROEA 4CKZA 1H2YA 2I2XB 3BE4A 4QC2A 2Y4OA 3TUZC 1A71A 1FSSA 4JV5B 2CE7A 3LAWA 3TIVA 4XDGA 5JYDA 3U62A 5I3CA 4ZRMA 1WU8A 2PV0A 4KAAA 4GBGA 3ZWQA 1DOHA 2Q1SA 4ZDWA 3S28A 4UTRA 4CV1A 3ZNPA 3D4OA 2XECA 3CRNA 4MWGA 3EEIA 3G8BA 5CTJA 3CVVA 1WRBA 1P9OA 1C8KA 1RM3A 3OF5A 4BQOA 5LB4A 1Q0UA 2OPBA 3DMRA 4G65A 1WKVA 3RSLA 2Q41A 3R3XA 1YKSA 2ORED 2Q49A 1LSOA 3KBOA 4C3UA 2AB0A 1ZW6A 4U7GA 4C6HA 4FFVA 4DIUA 5I7VA 3P0IA 3CLSC 1FP6A 3R6GA 4PO1A 1Z0KA 1F0NA 3C8MA 2CD9A 4XTCS 2AFIA 3DTYA 3VYTB 1JMVA 3MCZA 4MDHA 3E5HA 4O63O 3W5DA 2NO7A 3A0UA 3IP1A 3FA2A 4S2EA 5C52B 1E94E 2PDAA 5EWJB 4C0AC 1VJRA 4WCFB 2XBUA 3QXHA 4IVRA 4XPIB 1K3UB 4UCFA 3ANMA 1S89A 1B43A 4FI3C 4XQEA 5ARCA 4L9RA 1ZCAA 3F4BA 2MU1A 2ICAA 5GM2A 2F3TA 1V11A 3QVOA 5JS2A 3U49A 2C2WA 4XDHA 2Q3DA 3GC6A 2CB9A 4UAJA 4DLNA 2WV7A 3GEPA 1FFXA 3V32A 4HWPA 1NG9A 2WE7A 3OE7D 4IIYA 1I7NA 3CR8A 1M6HA 2HX1A 2YMQA 1D9XA 3N70A 4KMMA 5A4FS 4JVSB 2EGUA 1TYCA 1KAOA 4I1VA 5A4MS 2F3UA 2I65A 3HN2A 2A67A 2GBGA 4BMOB 2C8KA 1QGED 2I03A 3LZ6A 3I73A 2YYAA 5FQNA 3UJ8A 5CB4F 1T8TA 3LDGA 2JAHA 1V0JA 5TEWA 2C7RA 2B7BA 2D00A 2OFXA 1FFBA 5JHGB 1JHMA 1E7SA 3W5CA 1KBZA 3KDAA 3PQEA 3W9UA 3U3JA 1CR0A 3DMDA 3ML1A 3MBIA 4KNYA 1A5ZA 4OUDA 2FPGB 4BLPA 4RA6A 1I80A 1JXOA 2VC2B 1TJYA 2B94A 1V26A 4KAXA 4MVJE 5C34B 2QRQA 5CVEA 4P2BA 1LY1A 5I9TA 2PGXA 3HNPA 2C3PA 3BRWA 3ITNA 4MXDA 4DSOA 1A27A 4GM0A 4BTEA 2XUJA 4AY3A 2OCLA 1AGPA 4NBLA 2RHDA 3HWRA 3IIEA 1TECE 4PIMA 1DIGA 1RLUA 1FQJA 5CFMA 1K8YB 1UPFA 4I3GA 2V6BA 2BSXA 1ORDA 2VJMB 2V58A 5KYWA 4W5JA 3FPSA 1KPGA 1OE0A 3OZAA 5EYPA 2OCDA 3NEYA 2IZ1A 3PJGA 3KS9A 3PEFA 4EVQA 4R1LA 4YJKA 3S81A 1GG2A 3WBJA 3ZD6A 1XOIA 3LMKA 5JS1A 1HO3A 1J9ZA 1AM4D 3LS2A 4MULA 3PENA 3DTVA 1V1MB 1ZINA 4A3SA 3V8BA 1N36B 3TAXA 2JFHA 2ZE7A 3AP3A 1RXUA 2PV7A 4MKXA 5HCNA 3GRZA 3K20A 4WZAE 1EUDA 4PYKA 4FKBA 3IS3A 4YAWA 4DFDA 5CYGA 5G02A 4D0SA 5KX5B 1TC2A 3BTSA 5KYNA 5L3ZA 3I83A 2D8MA 3IJEB 2H1WA 2QN2A 4M7OA 4WH0A 4MJLA 4CG0A 1PFUA 2FSSA 3A9RA 2JEZA 3S2UA 4C87A 2DPYA 3UMBA 1YIOA 1T5OA 2YWXA 1W4RA 3O4GA 4LCJA 2R4UA 5AKEA 5EWLB 4E88A 3DE4X 4TLLB 2K87A 2C84A 5CK5A 3VDXA 1VXOA 3VX4A 4F92B 3WISA 5KMGA 4NXNB 2H17A 2BTEA 1G8YA 3C5HA 1DAKA 1O54A 2ZBEA 1GZHB 4MLDA 1KAMA 2YHBA 1WCWA 3AI7A 4QXOA 4CJXA 4D4JA 1E0DA 2Z09A 2DKNA 5A1TA 3I9FA 1WSAA 1GHTA 4M1QA 3ZVKA 2MDTA 3PR3A 4I81A 5C5IA 4JLBA 3EPKA 1X0XA 4I5DA 1SEPA 4CLHA 1VPWA 1J2UA 3ASVA 4KREA 2Q5OA 2X5NA 4GLBA 1BEZA 3OMXA 3THOA 4ECAA 5LZ4A 4NY1A 1VL8A 1JIJA 2X7HA 4KGZA 3WDKA 1MG0A 3LDAA 2IEBA 1PL0A 3RS9A 3KIPA 3H0CA 4HUJA 1TEZA 1H8ED 1Z2NX 1KO1A 2FEWB 1JZSA 4PLTA 3KKQA 4MVJP 4KB5A 3B3QA 3MLEA 2E2WA 3DUFB 3CCBA 3MB8A 1CKEA 4HQRA 4LQLA 4LC1A 1O96A 4TMZA 1SZJG 3QX3A 4Y0VA 2H63A 3A6FA 1RWVA 1G64A 2CXPA 4JQSA 2VQDA 2O59A 4CHTA 3DV9A 5K8JB 4Y6QA 4QJ3A 1HE2A 1IATA 1WKCA 4DLXA 4E4TA 3LRTA 4MYDA 3SJZA 5HGXA 3NC4A 2D8AA 5I5GA 2XB9A 2ZWOA 4K9RA 2JAOA 1F0KA 1T1IA 3N8NA 3UKJA 3V33A 2WJIA 2Y1GA 4YCDA 1YVRA 3IT3A 4RS3A 5D3QA 3TW8B 1GT91 2A9VA 4EHBA 3UH0A 4IR7A 1MHTA 1TK2A 2C07A 1SN7A 5ARBA 2NVUB 3RV3A 1C0PA 1KDTA 1P7CA 1CS4C 2KPOA 3AZOA 3X1WA 3I6YA 5ICMA 4MV3A 1R1DA 3B6IA 3ZCTA 4BMVA 2P2LA 4DV3B 2P9FA 3M9LA 1NW9B 3H5WA 4ABTA 3HYCA 3ICPA 2EZ8A 1SIUA 1P4RA 2CC2A 2WYHA 2W2XA 3QKUA 4ID3A 5F2OA 3EXG1 1ANKA 5TSDA 3KSBC 4W7SA 4GVLA 3LP5A 4TLBA 3O73A 5I6DA 1NN5A 3QPDA 4E5PA 2RHGB 3F9RA 2DB3A 5E8RA 4D4KA 1ZOIA 5TT0A 4V02A 3H1BA 5KOJB 4QPZA 1I5OA 2R8RA 5GONF 4DRYA 3VNVA 5JC8A 4B31A 1VSVA 3ULKA 2QT0A 4TQ9A 4ILKA 1NBMD 2ID9A 4CQMA 4KITB 5JBNA 5T7BA 1E1CB 1TMKA 1XROA 1ZQ9A 3DD5A 3U9LA 1WP4A 1J22A 2J45A 4KU4A 3T9AA 3UV7A 2OZLA 5KTKA 4GMDA 2AR7A 2QVLA 2CJWA 3C8ZA 4AY4A 1C9EA 1NOKA 3VOBA 1FS4A 5K8LA 4OIMA 4LY9A 2ZETA 3UJPA 4FX2A 1XZHA 4IDFA 4QYTA 4V2IA 2VSNA 4QA9A 4IMPA 1OIXA 5I8PA 1H1DA 2BJWA 5J23A 1WLYA 2FKNA 3DBRB 1GGNA 1GG5A 1GYRA 1RJ9A 1JS1X 4Q4AA 2ZSHA 4L28A 3AY0A 3ZD7A 1JI3A 2O0KA 5ED4A 2VWHA 1E2KA 3ESAA 2ZVQX 2ZS7A 3LRXA 3PUXA 5FAKA 5KOHA 2ZTVA 2OB2A 4BNHA 3HP1A 1ISRA 3W1EA 2IU4A 5A71A 1EVLA 1DC6A 1V8ZA 1EAMA 2H2HA 4S1OA 1EP2B 2PVSA 2MSCB 1XAHA 5E7IA 2W90A 4US0R 3ZYZA 3B7WA 4C30A 1HX7A 2RSLA 4CV2A 2LIVA 1KI1A 2A7XA 4UUOA 4JEHA 4U8GA 4B76A 3N75A 3TAHA 2RHRA 2GVDC 3B53X 3T3OA 4RM2A 1FMTA 5I9BA 3W9YA 3KJGA 2E4WA 2UVQA 2QTZA 5HF6A 4AI6A 3ET4A 1JR3E 1EG2A 3DCJA 2XDYA 2JLCA 4CMEC 5JI3E 3CNEA 3CZ9A 3H4MA 3TF5A 1FW6A 3LY8A 5E8JA 2IP2A 1KGDA 1O9HA 1WY5A 3KTDA 3PXGA 1AKUA 3AHGA 1JJIA 5CPFA 1IN4A 5C1PA 2EIHA 1O9BA 1C3LA 1HSZA 1WXIA 5T5QA 2J3MA 3RU9A 1E3SA 2RC5A 4LDNA 4Y67A 5F2EA 3SCZA 3UPDA 3ZE9A 3G8YA 4GEKA 3L0ZA 4YV1A 2LR0A 5TT1A 3ZJ5A 1RQNA 5K0LA 4Z3OA 3ANNA 4CF6A 5HIAA 4ER7A 4DAEA 4TL7A 2D1SA 4NK5A 5BVHA 2XYGA 2I7XA 5WRFA 1HSOA 2XIJA 1KFEB 5KZMB 4TVKA 2PE5A 1W2GA 2RGWA 2Q3CA 3BGVA 1NQWA 3GLUA 5ENZA 4YMGA 3BMQA 2YWBA 4OGKA 2NMVA 5LNK1 2WSIA 1RWBA 5LIPA 4A8PA 4RPCA 3KQWA 5D5PA 3K1AB 3TVDA 1XYYA 4C7BA 1Y42X 4MEJA 1WDTA 1ZEJA 3PUJA 1MAWA 1F2UA 1MN6A 4JJZA 2HH9A 3CLVA 5C4MA 1J2YA 2C2ZA 1Q0ZA 3T0FA 3E53A 2XYVA 5KVCA 5EKDA 2XWQA 1CUWA 3D7MA 3R5TA 5AW7A 4P7GA 4IXDA 5BUSA 2O8FB 1BHSA 3TOCA 4DUGD 4HN4B 3OIFA 3RHTA 3I3SR 4KYVA 4D9CA 1EM8A 1MDBA 4N03A 1QNLA 2PSEA 3KQMA 4G0MA 3PITA 4AJOA 4DLVA 4PRLA 5KVVA 4DNQA 1ZR4A 4BJ6A 1NW4A 4XR4A 1P1FA 5B6PA 1KO8A 3OESA 3DONA 2DT8A 4RPJA 4HVAA 5ALZA 3KQKA 5AW4A 3CHYA 2QX8A 1RLIA 1S01A 1U0FA 2YJ4A 2YWGA 1KDRA 1FFAA 1Z12A 3KHTA 4BY9E 5BXYA 1NQAO 2IF2A 5J9FA 2AOUA 2PL9A 3BULA 4KQKA 3U4HA 3W77A 4YUWA 5JLJA 2QVGA 2CBXA 4UC0A 5F4BA 1C0KA 5J40A 4N41A 5DBIA 4G85A 7ABPA 4JQCA 1X38A 4AJLA 2C4MA 5J4LA 3GGSA 4UTOA 4D6YA 5AFSA 3NONA 2NTJA 1N0IA 4IHQA 1H23A 1M34E 1G5QA 1R0SA 2O8DB 1CVIA 1AZWA 1ETUA 2R4TA 4DPKA 3JWHA 1XVIA 4Y6LA 2HU2A 5SY6A 3MJVA 2XA1A 4CM9A 3FETA 1JQLB 2C1EA 3PVSA 3QX7A 4NS4A 5IEBA 5JAOA 1ZVKA 1YBFA 4XIGS 3U7QB 1JJVA 4O1MA 1YZYA 2DU8A 1BU8A 1DQYA 2PZBA 1HGXA 3PQ8A 3IUPA 1WUIS 2F1IA 2I8AA 5EPUA 3U7JA 4JJEA 1G5PA 1RT9A 2DGDA 2WTEA 4QDJA 3AL2A 1P60A 2XE6A 4I7EA 4HXFB 4Y2QA 1NVEA 3ONWA 4TKMA 5LLSA 1YOBA 1S5PA 4DV7B 2I4LA 5L53A 1Q0TA 2G4VA 5G4KA 1TQ2A 2WNHA 3SQLA 5B3JC 4Q7KA 3SEZA 1Z6YA 4CETA 4D7AA 1FDRA 1NUHA 1W19A 2AIRA 1XP8A 2FWRA 1JYSA 3AETB 3L82B 3N74A 3QFFA 4WXEA 2DKOA 1AKRA 3UWOA 5KCZA 1Q1GA 1MABA 1VE6A 2QD2A 5F2KA 2VKTA 5AVKA 2BSQA 3BJZA 3TLYA 2FSVA 1SPXA 1K8QA 2QRPA 3FG9A 4KQCA 4OXXA 5T67A 1F38A 4OHZA 3T7KA 4JENA 2VOJA 3KTAA 3NV9A 4V3BA 4IDBA 2BISA 4WFJA 4TTTS 5CW1A 3HKDB 1X7WA 5I4KA 2XRFA 1B74A 3FYUB 4G0ZA 1V6CA 1PP4A 1YE5A 1RHUA 2O07A 4PX5A 4IW3B 3VAYA 1J0EA 1S9DA 2H85A 3JSXA 3P2MA 3RDPA 3OFSA 3DWGA 4PC6A 3K70B 1XJ5A 3INYA 1M7GA 3GFSA 5BUZA 4MW5A 1G3RA 3OT1B 4IWXA 5KC9A 4TN5A 4PTLA 1R0YA 1KOLA 4RDHA 1WUHS 4ITUA 2C59A 4X1IB 2DFDA 2WKPA 4LJRA 5CIYA 1MX9A 4BZQA 2YVQA 1IHDA 1WCV1 1YQQA 1GU1A 3QVXA 5AKLA 1OZ0A 4YV2A 4A0HA 5FLEX 1QPBA 2HIAA 4OUDB 3QEMA 4PCVA 5E4JA 3O3NB 2JJQA 2N1BA 5JSYA 5KU7A 1T3SA 1WUKS 4CDMA 5KNDH 4LOHA 3BSSA 3QV2A 3VU8A 2ADFA 3SYKA 2HKIA 3IP3A 1YR9A 2FB9A 3BMNB 4QBHA 2AX4A 3BM5A 5G3YA 5TQ2A 3WQBA 1YB4A 5C8YB 3PGXA 4JC4A 1T9KA 2ZU6A 4OB7A 1VLVA 1ESMA 4KFTA 5AI9A 4HZUB 4UM5A 3HFSA 1JQ5A 2G9NA 1DOAA 4HVTA 3E1GA 1FMFA 3DV2A 4JZYA 2XBMA 5TJHA 1QH8B 1G8PA 1SXHA 2GTPA 3FSEA 4DUPA 2Z6VA 1X7HA 2C61A 4NWIA 1QTNA 1QJCA 2W70A 3U9SA 4NYMR 3TE6A 4BLRA 2HGSA 4TS3A 3T9EA 4I5GA 4U7TB 5DASA 3HB1A 1JMYA 3LLMA 5IDWA 4EJSC 4CM3A 2XQKA 3CBQA 3KALA 4HWGA 3QXCA 1QHXA 2HCBA 1GUYA 1Q0RA 3A3NA 3M6VA 4CIDA 2V03A 3IHWA 4M1WA 2EWWA 1JLLB 1H05A 4JMPA 5CP8A 2IYWA 5CDFE 1U4SA 5K3SA 4IH9A 3NATA 1ESDA 2NNLD 3DYIA 4QQKA 1VIDA 1KMQA 1OREA 2MR6A 1Q3HA 4EKDA 1PV1A 1FFWA 1HFWA 1XSEA 4YAFA 3SFZA 3HG7A 4AXXA 4DIFA 1KP2A 3GCDA 4IF4A 1PT8A 1UC4B 4CL2A 3PKIA 4D82A 4ZAGA 5FWXB 1C2YA 1KU6A 2IYFA 1R7RA 3UKOA 1UJBA 3PE6A 3H9JA 4HDRB 1NMEA 2VL7A 2NTEA 1T4CB 3UUEA 1FXWA 4R5HA 1BCRA 4FILA 3HZRA 2FEKA 5CFOA 3ABQB 4G1VA 4EHFA 1EFLA 3BTVA 3O5AA 1CUFA 4L95C 4O8ZA 3O4JA 1X7ZB 2O50A 4H7FA 1U1EA 5BR4A 1UT6A 4U5XA 2VQFB 4DLWA 3S2YA 3AM4A 2R1TA 3I58A 1U98A 3ZXUB 1E5TA 2EYQA 2VH1A 2Z95A 2C96A 1D1SA 3B6JA 1PHRA 2ZG6A 2Q46A 3D8HA 3MILA 3PXAA 4KO4S 1ODTC 1RQ7A 5F5LA 1XD2B 4OFZA 3H05A 4FP9A 5KWSA 3D3QA 4MS1B 1VLQA 4RMJA 4C05A 2WMNB 4XYBA 4TWBA 1NRXA 3FFWA 3NASA 1PNVA 2PVPA 2VK1A 3PNYA 4GVPA 2J9ZB 4MVJF 2FR8C 1RC0A 2FR8A 2ZUSA 1ZVQA 4JL8A 3TGLA 2ZUFA 3DKPA 3EQ9A 1PJBA 1VZ3A 1NUQA 3B3GA 1T4MA 1CJBA 1U6IA 1B41A 1GCUA 2QRLA 1E7QA 3C48A 4A73A 4YR7A 4BLTA 4EKIA 1WZIA 1Z0IA 5I7AA 2LIPA 2IYNA 3RC1A 4NYJQ 1YULA 1JEYB 3O1IC 1GAXA 2FXIA 1E2IA 3OCYA 3UT6A 1QH1A 3Q8LA 1HYGA 3RFVA 1X8LA 2WPDD 1U8YA 1YNSA 2P9JA 3W9SA 2EKBA 3LNCA 1YHNA 1D07A 2NAFA 2IY7A 2VT2A 3L7OA 4HH1A 4RANA 4ZCQA 3LHDA 1CQIB 3UPUA 4QDTA 2JBAA 1QQ7A 1WAMA 2ODQA 3A9SA 3R3JA 1BVYF 1ZQ1A 3S2EA 2ATVA 2HJWA 3D3WB 3QKWA 3O03A 4LSMA 1E92A 2VDOB 4CIAA 3NVKI 1HI9A 1S6YA 2WF7A 3WDMA 3WGIA 1R8XA 1SOMA 2QLNA 1I2DA 3EBOA 1L7AA 3FWHA 3TI9A 3GG9A 3NP7A 5F7XA 3GBPA 4CEJA 3OT1A 2JD2A 4UD6A 1N33B 1RPJA 3HUEA 2J31A 4OHUA 2VF5X 1QKIA 4OMCA 2Q6VA 1BVUA 1GU0A 4NAHA 2UUBB 4KSBA 5TPWB 1BXGA 1O2DA 1NRJB 1VTKA 1KK2A 2BJVA 1L1QA 1YCHA 1BJTA 1ORIA 2B1JA 4PQYA 4QSMA 4OK6A 3MWFA 4RMHA 4HRAA 2GBPA 1ZKDA 5THQA 4MVYA 1WVIA 4MPDA 3ROFA 4C4ZA 2IEIA 3AY6A 5BURA 5H82A 4WRRA 2G88A 1VFNA 4DG8A 4JYAB 1Y9ZA 3E35A 2VJPA 2C5EA 1M66A 3ZBQA 2QDKA 2WWIA 3UB4A 1QV6A 3TTSA 3LQ1A 2ONZA 2J9FA 4RTSA 1K2VN 2A9KA 3AEZA 2JNWA 3E18A 1KAQA 3GA7A 4K3UA 1U2ZA 2CVPA 2ZIFA 3LBNA 4BV9A 1PWHA 1SY7A 3GRYA 2H0AA 2DWUA 3C5CA 1SH7A 1Y7HA 3PBKA 4P7FA 4FSHA 1C9JA 1JFRA 1YU9A 1SXQA 1ZONA 3SS7X 1C4XA 4JGBA 2VRNA 2GMWA 2Q5JA 2OYCA 1SUBA 1ZM4A 3OTQA 3AJEA 3IBGA 1G7CA 1KFKB 2PL5A 4N18A 4UOZA 3N0WA 4RZXA 3OHMA 1MB2A 4D9BA 4IGFA 3TAUA 4U3JA 2PR7A 2H92A 4GMGA 1P4AA 2Z98A 3U3OA 2IVFA 4ZCSA 4DR5B 2V7QD 2ZYWX 3N1UA 1B0PA 2XGSA 1JHRA 2I1LA 3BZBA 1E3WA 4KJXA 1DEHA 2JH3A 1TVEA 2X76A 1E3TA 1MCZA 4WFKA 5BWMA 2Z9CA 4Z9AA 3OSUA 2BF7A 4EBBA 4Z9FA 1CERA 4LRQA 3LK6A 4LF6B 3VKHA 4A2PA 1WHTB 4C78A 1T9DA 1V2GA 1Z68A 1YR8A 4OFXA 1AK9A 4PRYA 4BFTA 4EHKA 3LBYA 2O1WA 3TTWA 3K0EA 3L8FA 1MV5A 1RKVA 3C1UA 3PCRB 5KJEA 2CLKB 5LMCA 1NWHA 2H4WA 3I6IA 4PVDA 4CKWB 3NWPA 2FETA 5HJEA 5LOVA 3E5MA 1JA9A 5DBGA 5ITWA 3KZOA 1KI3A 1GAWA 2XTJA 3RPEA 2XRMA 4KIWA 1DKOA 4F86A 3HN6A 4EAQA 5K3EA 3GLIB 1YMUA 4IO0A 2HBRA 2QW1A 3DO5A 3JU3A 4HS9A 1P2FA 2HO4A 5FI0B 1GGEA 1EWKA 4D5EA 3RF6A 4NMHA 5GGYA 3EZLA 3FNRA 4J1SA 4LJ8A 3H87A 2HYDA 4IV8A 5IC5A 1MGOA 2RAFA 3K6SB 1U2DA 1D2AA 1GA1A 1ZVVA 1YSCA 1XP5A 4BO8A 1RKUA 2G5PA 2H3EA 2Q5LA 2ZXEA 3HBAA 5DM70 3OZFA 2P78A 2XZPA 4E94A 1XA0A 2O2JA 2EGGA 1L7DA 4GPTA 3NUGA 3CGWA 3CISA 2IQIA 4OH7A 3WB9A 1SOWA 2QP9X 2P5YA 2NYAA 2V7QA 4TGLA 1JAYA 4K88A 2HMAA 3QHPA 3P52A 2R68A 3DHNA 4FMDB 4YRPA 5F73A 3L1KA 2D0OB 3O75A 4EX7A 1ZHOA 1TA9A 1HR0B 4RADA 4Y9UA 1D7AA 1GITA 3DAHA 1G1AA 5DK6A 5LQSA 5JD4A 1V7PC 3QXSA 1YR1A 3C6XA 3L46A 1GQFA 2IW3A 1H6AA 2VJLA 2QNBA 3K0KA 3NDRA 4JP1A 4HNQA 3B3FA 2PMCA 3ZY2A 1YL5A 3CONA 4YIHA 3I6MA 1NBIA 5ES3A 1UH5A 2BMAA 4RHEA 5JCOA 1EFPB 4B3DA 2EZTA 1PTKA 2R6CA 2ROQA 2XD9A 1WW2A 1H1LA 2C0CA 2QZZA 5BT8A 1AV6A 1EE1A 2FUCA 3EFOB 2WW8A 1LPPA 3R3SA 4IPTA 5CBKA 3DW3X 3D3JA 1MT3A 2H2WA 3CX6A 4LJSA 1JQAA 1Z5GA 2OQ2A 5CAEB 5EXSA 4KHPB 3CW9A 4C0WA 1Z0AA 2N9UA 4FGZA 3RJMA 4CIWA 2GK3A 3ZNOA 3DLHA 3B85A 1PR4A 3SX2A 3DOFA 1Z37A 1PFGA 1XALA 3EEQA 1U6KA 5AJTA 4R8SA 4LYGA 1JDTA 2XBLA 4FGJA 4EGFA 3ANLA 5E9JA 1UPBA 3G6WA 1FNBA 2P90A 1LW7A 3BDAA 3IJRA 3KYDB 4JIGA 4YDRA 5TV2A 4YRZA 5IVHA 3SXPA 1EUCA 2RB4A 3DXXA 1LU9A 2GKSA 3BAFA 3GLVA 1R3DA 3MXTA 2CNWD 2YXBA 1HRKA 4I1SA 4ND8A 4GC9A 3JQAD 3H17A 2R44A 2QPOA 4IL5A 3O8BA 5K3CA 1UAGA 1TGVA 2B7CA 3L8EA 3LQYA 3MJ4A 1QGZA 3GLRA 2J9FB 4ROTA 1U31A 2Y1EA 5DV9A 3L8DA 4QARA 3HMKA 5HF9A 1F0PA 1OUMA 5KNBH 1E2JA 1YRWA 1CD5A 5K0GA 3W4JA 1Q0PA 1SJ9A 3W8EA 2JGJA 1HMPA 1O1YA 2HW8A 5CT4A 2V74B 3QPBA 3DZHA 4BQFA 2PUEA 3WHKA 5LFAA 1L3BA 2IYPA 2JJ1A 1GPJA 1NSYA 1NVKA 1XCLA 3D6HA 3Q87B 4MAAA 4UUAA 4ZO4A 3FTFA 1PJTA 1RD4A 2NX2A 4MUXA 2XWJI 4JI5B 2C99A 1CY2A 3I28A 4TRMA 2HK9A 2PKRA 3I9NA 3JV7A 4RTJA 4NMLA 2OYRA 3RYFB 1ORWA 3LPAA 1C8VB 5DN6A 3SHTA 3WB1A 3PHGA 2ZQZA 5TMPA 1OIWA 3SQOA 1JAZA 3B9BA 2W6PA 4HFJA 4MVCA 5CA0B 4MIKA 1G9SA 4QVIA 5U1PA 2HZ7A 4KTVE 1AKNA 3K9HA 1GGFA 1QHYA 1U8FO 3TR6A 2WUDA 4K28A 3GLGE 4OHOA 1WZEA 1J2EA 4DWVA 4TLDA 3D4BA 5CT9A 1RRCA 2D1FA 3CX3A 4ENRA 2IDJA 1NUUA 1NVUQ 1J0XO 3M2TA 4V0KA 4Y2XA 3AGPA 4UHBA 5ILQA 3HRKA 4YP5A 4O4JF 4Q1DA 1W1IA 2PO7A 3UJDA 4IDQA 2Q3MA 3V2GA 3MHPA 3I42A 1I5EA 1UOQA 2HOQA 4HDRA 1P7ZA 3FPFA 5ER6A 4N4AA 4Z4IA 5HBGA 2GDJA 2OGZA 2WPNA 2XHEA 4I50A 4KE9A 2D0IA 2VLBA 4JP8A 4IUYA 1LDMA 1CEEA 1O3YA 4E13A 1CUCA 4YUAA 1M1YA 4HDMB 3C6KA 2VNAA 3U61B 1UEIA 5B58T 4EB3A 2X8JA 4YTEA 4M7PA 1SU8A 4X44A 4BWGA 3GNSA 3OJWA 5EIBC 3PNKA 4XGQA 2ZU0C 4XWYA 4R1OA 1XRNA 1YIAA 1ZOPA 5DNYB 2VPPA 4MS1A 5C9ZA 2B1QA 5EXTA 4Y18A 3ETLA 1UOEA 4L4XA 5K3DA 1U2EA 3AONB 3CS3A 1N4AA 5JAIA 2YICA 2IKSA 3S2FA 4KQ6A 2GN8A 4FR2A 1SC1A 1K68A 3VXKA 2KSQA 4QNNA 3SJBA 2P6PA 3F1LA 4EPRA 4GGMX 4RY2A 4UZEA 3IH5A 4QYXA 4WW0A 3OO0A 2EW1A 3JRWA 1BOOA 1UJ4A 5HJ7A 1NUPA 1ZCZA 1J99A 1QH8A 2V6IA 3ED1A 4QQRA 3L0PA 4MR9B 5YASA 3WZMA 5D5QA 3DDOA 3P20A 1RADA 3F6CA 1KWGA 4LZJA 4TT8A 4KVGA 1ACLA 3LX8A 2IHUA 4LMPA 1Y89A 2O0JA 3V5NA 1YZHA 2IOFA 3K0FA 4JI6B 3WYBA 4DR2B 1GADO 3HB9A 1FY2A 1I7PA 1UKZA 2A9RA 2HA2A 4J49A 1XGKA 2QRNA 3QJYA 1R5OA 1Z17A 5JEEA 1HE3A 1E99A 3C85A 2X0JA 3FCXA 1IDN1 1UDBA 2FUG6 1M2OA 1P4GA 2ZJ2A 1O03A 4NH4A 4JH0A 1NULA 1GRVA 2Y0CA 3UAWA 2I6QA 4DA6A 2QORA 2C04A 3PQ3A 2PGLA 4EUEA 2IUSA 1G5IA 4Q7JB 3CE9A 2YOHA 1YCGA 3GPLA 3MUFA 2GEVA 3A6KA 1GQOA 5ALQA 4LN1A 3HYLA 4OM8A 3F74A 5E7MA 3K92A 3VPGA 2JATA 1F4LA 1YR2A 4PF1A 4EMBA 2W9XA 3EA4A 3CUSA 4MQ6A 3HGMA 2XMGA 2Q1YA 2L2QA 1ZGCA 1ATZA 4NENB 5LIRA 3N6XA 4NECA 1QHSA 3EK2A 4M46A 2XOXA 2WA1A 4OMUA 3UANA 2G1UA 4WK4B 2P67A 3D6NB 5IM4F 1C1DB 2AWNA 4M0MA 1N7IA 1UBUS 2YY6A 3CWQA 2GSWA 1GZSA 1O94A 1UF9A 1N3YA 1MA0A 3JQGA 3OKAA 5DZSA 2YMMA 4G5GA 3C87A 1YQXA 1XRMA 2GZHA 4NTZA 2CV2A 2ZZKA 1QFMA 3VYSB 1N8SA 4KYIB 5ITZB 3ZHXA 3AJAA 4N3AA 4MHOA 3ZHTA 1LPSA 1XTBA 2DUMA 1VRWA 4FYWA 1RI2A 3CLRD 1E8MA 1O5IA 4PSCA 4YP9A 2XIQA 2XQVA 4YDQA 2JJMA 4IG9A 4PHTA 4ALMA 4LOIA 1R6DA 1E3WB 1V48A 2H6EA 3GT7A 4PG7A 4P4SA 3VVLA 5ARDA 3UHAA 3HUFA 1CJMA 2WHRA 3BG5A 5EMNA 3SY8A 2OESA 3C24A 5ADUS 2PYZA 2CXSA 4PLGA 4XA8A 3WBBA 4JBLA 2EVWX 4Z2AA 2HLDD 5REQA 2PWYA 4NCXA 4WMLA 1QCDA 4F8EA 5IVPA 2ONJA 3KNZA 4F3KA 3AEUA 1RJEA 5TVGA 2FSFA 3GLKA 2F1OA 3EFHA 2E6KA 2F1HA 4N40A 4BX9A 2Q0SA 1II0A 2C98A 3HPRA 1WULS 1BXGB 2GO7A 3A4MA 2OCKA 2QLLA 5I8WA 3C7DB 4R16A 3KQLA 2G5GX 3QEAZ 3T7CA 2VK2A 3N2NA 4QVGA 4E12A 3BT7A 5KAMA 1EB9A 2GDZA 2Q2WA 3AC0A 3BIJA 1IQRA 1N9ZA 1YKGA 2QI9C 1IIBA 5LA6B 3R76A 5DI9A 4C4SA 1P8AA 4MGHA 1D2RA 4IQGA 4CFSA 2V7EA 3AX6A 1MJNA 4I08A 2R5WA 4BLSA 1UAAA 4ZARA 3UQZA 2YRWA 5AVVA 3EIUA 1ZNXA 3A1SA 1KI8A 1FYFA 1O6BA 3PFHA 4PGHA 3HKCB 5FHQA 4ZCRA 3HXMA 2EEZA 2IXBA 2IKQA 2FZWA 2JIRA 3VVBA 4P7BA 4R6WA 1Y4AE 2A0UA 3VR1A 5EGSA 2IELA 1JDNA 2ABWA 3SR3A 4MI3A 2CYCA 4TLAA 2R8BA 1KSHA 2I6SA 1DDOA 2K6GA 3LHKA 3I6BA 4GLFA 2YCLA 2O2IA 4MKGA 4C14A 4B32A 2AHRA 1H5UA 3CLKA 1EDEA 2JF0A 3BILA 3A37A 5DSZA 3EGVA 1LK0A 5JRJA 1R6VA 1L5KA 4Q1BA 2PGNA 2PWAA 2V6MA 4OQZA 1EK0A 1KERA 2B83A 2JHGA 1Y9AA 1QS0A 1GZ7A 4U4AA 4JOCA 1C8LA 4CKYA 5IS2A 3UYLA 5DCUA 4YJ3A 5DM2A 2AD1A 1N9GA 1RC1A 3PA8A 1M72A 4XM1A 3DDNA 3UG7A 1R12A 3CT6A 4CM1A 5LD2C 5BSMA 4AG6A 2EGHA 1PLLA 2XUPA 1EXMA 2B2XA 1JE0A 3F9CA 4IFBA 2ZWMA 1XTJA 3GFOA 2OCIA 1HTWA 3AEUB 3EAQA 5DB4A 3D3WA 4TQGA 2CNDA