3HNSH

Cs-35 fab complex with oligoarabinofuranosyl hexasaccharide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGTVLARPGTSVKMSCKASGYSFTNYWMHWVKQRPGQGLEWIGSIYPGNSDTNYKQKFKGKAKLTAVTSASTAYMEVNSLTNEDSAVYYCTRFGNYVPFAYWGQGTLVTVSAATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsH02
4LLWB 4X6FB 1SEQH 4PGBA 4H0GA 3RDTB 1FFPB 4Z76A 1FIGL 3QCTH 5FYJL 5DUMH 3KLAB 3MLWH 4IEFB 3PP3H 3VXQB 3DUHA 4ZFGL 4K9EH 5BRZA 1ZGLA 3TT3H 3C09C 3QNYB 2LVCA 4ZFOA 5EOTA 3OKNA 2DS4A 4D9RD 3QXTA 1MI5B 3SDDA 4RFNC 4ODHL 5CUSH 2NXZD 1ZHKA 1VACB 3C5JA 4PGDA 4R90H 1RURH 3RL2A 1UYWH 1T3FA 1F6LL 3SO3B 1DFBL 2DL9A 4MD0A 4U1MA 2DLFH 2HH0L 4UTAH 4ONFL 1LMKA 3FB7A 4BQ6A 4DKDC 3L3GA 4FS0A 3BIKA 3CX2A 4XBEH 5DLML 5HHOE 2ICWI 1QSEA 3CH8A 3VRJA 5IW6B 3UBXG 4GAYB 4BH8A 1S9YB 4ZODA 1OAKH 4PRPA 3IU4L 5KN5B 3WJLC 3MRJB 2CK0L 3MGTB 1YMHA 2MPAL 2XWBA 2WWKO 4YXHL 1MLBB 1U6AL 2AJXL 3QI9D 2CRIA 3WFEH 1FFOB 3WSQH 2ADJB 3LMJH 1URLA 4IMLB 3TJHC 4KRPD 4XPTH 2QADC 4G6AD 3CZFA 2R0WL 5GJSH 5AG9A 2XTJD 3GI8L 3QDGD 2ZJSL 4ISVB 2LQRA 5T5NG 3BMVA 3BZFB 5IEKB 2I07B 4KROB 4QYOB 4JFDB 4F7EB 1GHFH 4NM8H 3U46A 5EO9A 2XYCA 3GSUB 1UWGH 1EGJH 3T1FB 5GGQL 1S9KC 1NCBL 4HFUL 5E1AA 4JZJB 2Y25A 4FQCL 5C0CE 3PWJB 1JGDB 2OTWA 3O2VL 4AT6A 5BQ7B 2D7OA 1KB9J 1U92B 3DVIA 1BQHA 4UBDD 4OV5B 2B4CH 3B2VH 3G6AB 4PP1C 2R39A 4JDVA 5D1QB 1ZVHA 2JJTA 4XCEA 3DOSA 3JV0A 2WINB 1N59B 4M7ZB 4XGZA 3RNQB 2N1KA 2JB6A 3QXWA 3KPMB 4FQIH 2IQ9H 1DBAL 1OW0A 1I8MB 5JOPE 3DGGA 3BH9A 4FQQA 5JW5A 3N1QC 1N6QH 2BVPB 1QRNA 3MRLB 5CGTA 1NEZA 1RK1B 3UXFA 4TRPH 4AQOA 3VW3H 1NMCB 3BEVA 1QA9B 3D6GA 5ETUB 5D71L 3MPCA 4IRSA 5K9KA 1HKLH 5FHAL 1B0RB 2GCYB 3GKWL 2X89A 1V5JA 2YUXA 4U1LA 4JANB 4J3UA 3BAEL 3PHSA 2KZ1B 5E9DA 4O2CA 5DRZA 4XXDB 4APQA 5GGVH 1SYSB 3CK0H 4LBEB 4X6EA 2A74B 4L3CB 4XC1L 1WCBB 3F7RA 3N06B 2OYPA 3O3BB 4ETYA 4QRPB 1D6EA 3TVMB 3B3IB 1FL5B 2HAZA 1FNEA 2NXZC 5C9JA 3EHBD 4WTZA 4JG1H 3ZKXB 3D9AL 2B7DT 2DQDL 3CGTA 3QNZA 2V9TA 3IFPB 5C0DB 4XCYB 1ES0A 5HYJA 4XPAH 4RAVA 4TUKH 4AEHL 3KHQA 5JW3H 1JWMB 3MLXH 4YHYC 5EUOA 3NABH 3BT2L 3W0WB 4D2NA 4XNUH 3UC0L 3KPQB 1DTUA 3WNNA 4ODSH 1WTLA 4FZ8H 3VGAC 4UILH 1CLCA 1NCNA 1F4XH 4N0UE 2YRLA 4HWNA 3BISA 1G9NH 4HUXB 3VI4E 4O4YH 3GSXA 3MRQB 5CJ5A 5ISZB 5F1NA 4JFHD 3QI9C 1QLFA 2Z4QB 3G6JB 3NA4A 1TJGH 4KKAD 3FO9B 1NCDH 4CMHB 3OX8B 4ZAKD 1FVCA 1CL7H 1JK8B 4WGVB 5LXGH 1TJHH 3LPFA 1D5IH 2VISA 4Z6AT 5DEFA 3GBML 4NM4H 5I75C 3GMRA 4ELKB 3OBAA 1HDMB 4R8WL 4CW1B 4JZOA 2D7QA 2MCPL 4X98B 1FYTD 2F8VA 4WUKL 4DKFL 4YLQT 1P4BL 4KMLB 4H8WL 3CFCL 2MFNA 3PG2A 1H8NA 2R8SH 4GW4B 1LHZA 2E7BA 3RFZC 1HSAA 5IQ7L 2R1WB 1XZ0A 3LN9A 1JPFA 4MQ7A 2YUWA 3JV6B 1G7IA 3TT1H 1VERA 2R56L 5JDSA 1A6TA 3BP4A 1SMAA 4OZ4A 3FB6B 1HINL 4UBDC 5D5MA 3EO0B 1S7SA 3GSQB 2PTTB 1UM5L 4X6CB 3IDYC 3FQWB 1IM3B 3I50H 4POZD 1QTYT 1GXEA 1MCCA 5DJZA 2ADGA 3E8UH 1TVHB 2EEBA 1MJJB 4OZIA 2GSGB 4H25A 2CUHA 4LOUD 3WS6A 2MKLC 2Q8AH 1S78D 5E1HB 1GC1C 3PL6C 3GMLB 1KJMA 1MY7A 4JM2F 2J5LB 4HZAA 1S5HA 1OAYL 1FCCA 2EDWA 5FCUH 4HKJA 4XCFH 5FV1L 4TPRH 3S6CA 5JQHC 5L2KA 4PJCE 5BV7C 1ZOXA 4PRAB 1FNGA 1RIUL 1XGQA 1A6WH 5C1MB 1CGXA 4JREB 5CFHA 1S7WA 4PR5B 1EMTL 1EBPA 1MJ8L 1ZHBA 2HFFB 2WIMA 5EBMB 4P9HH 4GBXA 2PUQT 3EKCA 3IAGC 1DQQA 5HI5D 2YC1B 3JXAA 3O4LE 1QSFA 3VXNA 4C55A 1BJMA 1QVOA 3EHBC 4OZGA 2EDDA 3K4DA 4DZ8B 2MJWA 1AQKL 5B8CA 4XPFH 4JO3H 4BZ1L 4F9PC 3SCMD 4ONGH 2NTFB 3VD4A 4RRPA 4TUOB 3ZYZA 5J6HB 3OAYH 5B39A 1AC0A 3U1SH 4M1GL 3HC3H 2YS4A 1F11B 4TSCL 3FT2B 1RUML 4M7LT 5F89A 5AWNL 4MCZA 4HK0A 4S1RL 5D8JL 3E1F1 1BD2E 4JFPA 1UEMA 1AD0B 1CL7I 1YY8B 4KKAC 1HE7A 5C70A 4B41A 1NGQH 3RWFB 1R5IA 1N26A 4ZAKC 4IS6B 2X9YA 1BM3H 2YSSB 2FJGA 2YPVH 3BPNC 4KKLD 4CRPA 3ZE0F 3CVHH 1RUPH 4Y2DD 3IJYB 5DDHB 1ZGLB 1T1WB 2ZUSA 4NKQB 3QWOA 4ZFOB 4I0CC 3MOBH 4RGMB 5EOTB 3BPLC 1A9BA 5LGHH 2LTQB 4XI5C 3SDDB 4DWHA 5KSUB 4JQVA 3K1DA 3T3PE 3O4OC 3C5JB 4PGDB 4HMEA 3QIUC 4PD4J 1XGTA 1T3FB 3DTXA 4M1CD 3RWJA 5KSBE 1UKQA 4MD0B 1IAOA 4U0QB 4PJEE 3D0VA 3HCVA 5E56A 5E5MB 3FB7B 4YDVB 3L3GB 3D0LB 3BIKB 2P45B 1HOCA 2DTMH 1QSEB 3KPRE 5L0QB 4BH8B 4U1NA 5DZNA 5IVNA 3ARWA 4PRPB 5ENWB 2AJUL 5T1KB 4U2ZA 3JWNC 4XH2B 1ITCA 3WE6A 3UPAA 5TF0A 4QRRD 4UI2A 4POZC 2XWBB 1LO4H 5EU7C 5SV3A 1DQLL 3JWDL 5BO1L 4NQEA 4FMFA 3CMOL 5IT2H 4LOUC 5I73C 4CDHA 3M8OL 4H20H 1O5DT 1S78C 4N68A 32C2A 1YEIL 2VABA 4M7KH 1ZLVK 2DIAA 3V4UL 3IAQA 3CXHK 2UWEF 4XNQA 1PQZA 2VXQH 3VH8G 1CXEA 5KW9L 5I76B 3S88H 1KCVH 3N0PB 1KEMH 2L0DA 1HCFX 3U46B 1MCBA 1QKZL 5EO9B 1S8DB 3QSKB 5LGJA 4KC3B 2NY3B 4O58H 1G7HA 1OPGH 2X9WA 5HI5C 2W65B 3GMOA 1FDLH 1J5OH 5E1AB 3QUYB 4MA7H 2ZSWA 4AT6B 5I66A 1ITBB 1BQHB 3EJYC 1QPPA 5C0AD 5DD6A 4LHUG 5D9SA 3TIDA 4Z7VF 5AAMA 3E6FA 1IGML 2DLIA 2JB6B 4P4KA 1FGNL 4I13B 1ZLSL 3SGKC 5EH1A 5JXEA 1KELL 3RZCA 4P48A 4UNUA 3PWNB 3BH9B 2CDFA 5EOCH 4EI6A 4RDQF 3BPCA 1YYMH 5MERB 2NY1D 1OARH 3BEVB 1FE8L 1J05A 1U36A 1X5AA 1DBKH 3CDGB 4PRIA 2CIIA 4Q2ZA 4UUJA 5HYQA 5C07E 4OBSA 1A6AA 1W72B 4KKLC 2F53A 4U1LB 2DQEL 1A1NB 2VE6A 4O2CB 5DRZB 3BZ4A 5EBWA 1YUHB 3W39A 3QQNA 1OGTB 4APQB 4K7PY 4DVBA 4X6EB 3OGCA 3ZSTA 4CADB 1BLNB 1FNEB 4P4RA 5D2NE 1LE5A 5DMJB 4X4YA 3NIFF 1DDHB 5C7XL 1GGYA 2ESVA 1YJDC 4XBGA 4M1CC 4HPYH 4QXGH 5T1LD 1D5XA 4GMTH 2PW2A 2R2BA 1MRFL 3WIHL 5HYJB 3QXVA 4RAVB 4F9LA 4ELMF 4BSVA 5F1KC 2R4SH 4MNGA 5EUOB 3S35H 4RA3A 2PYED 1JNLL 3G6DL 4DGYL 3VXSE 2GSIA 4BFGA 1OAUL 5BXFB 1WZ1H 3MV11 2PW1B 2C9AA 4KDTC 1UCBH 3ZTJG 1P1ZB 5IJKA 2A77H 2R2CA 4NGHL 3PWPE 2DAVA 4DVRH 2ZCKH 4IMKC 2ARJQ 1V3JA 1FVCB 1K8IA 5C0NC 4KKNA 5E2UL 5C09D 1BBDL 1R3HB 2ZCHL 3BJ91 2Z91B 3PWUB 3RVWD 5BJTB 3UTQA 1J0HA 1KEGH 5I8CB 5JIIA 3FQUA 3CUPA 3T3MF 2FBJL 1JN6A 3QG6A 1JF1A 3SDCC 4HQQH 3DXAB 2XA8L 4NUJA 5D7LB 1J0IA 5HYEA 2OTUB 5C8JB 4FQXB 2BHZA 2EDBA 4P2CG 1HSAB 1YQ2A 4B5EA 4MQ7B 4FFZL 2EC9U 3HRZA 4PBXA 5HHOA 2WQ8A 5L6YH 4LCWA 5JDSB 3BP4B 1RJZA 4CN6A 3DX7B 3NVQA 4OZ4B 5D5MB 1S7SB 3VG0L 5LBSL 2R0KL 3HG1B 3NPZB 1AI1L 4OLWH 5TFSL 5E5UB 4AEEA 4ZPVA 5C0BA 1PG7H 5JZ7D 5JORA 1X6LA 2ADFH 4QOKD 3TO4D 4XNXH 2ADGB 2VLJE 4G8EB 3SN6N 2XWJB 2QBWA 4H25B 2R0ZH 1F5WA 5D1ZA 4OI9A 5CJXA 1S9XA 2NYYD 3MJ7A 4JKPL 1LO5B 2QQQA 3FOLA 1S5HB 2O5XL 2OQJA 1OL0A 3DROA 3QEQE 5IVXB 1P2CA 4WW2C 3D18B 2G75A 1F2QA 4PG2C 4HKJB 1QQDA 2FCBA 3H9SD 5L2KB 2OZ4A 4Z7NF 3QUXD 1VESA 1CBVL 4YC2B 1YEHH 2YD7A 2HYMA 1XGQB 4U1HA 3ULUH 1S7WB 3RPIA 3O6FA 1ZHBB 3SE4C 3KPSE 3QUKA 4GBXB 3L6FB 3WUWA 4M93C 1NCCH 5I74C 2VAJA 2ICES 3DVNA 1CXKA 4JY4A 1TQCC 1QSFB 3VXNB 5FGBA 3MBED 2DQHL 4FQ2H 5I1CH 4OZGB 4WO4D 3I84A 5E00A 5HGAA 5B8CB 3HN3A 3BKJL 1ZLVH 5JHDA 2H6PA 5LQBH 4OLYH 4JFFE 4F8QA 4KTDL 1ERNA 4CJ1A 4PJHF 4P5TA 3EYQD 4C83A 5C6PB 1XMWA 3U0PA 3WIFA 3VXRD 3VJ6A 3Q5YA 4UU9A 1IC5L 3P0YL 4DJMA 1L7TH 4FTVE 2X41A 4HK0B 3VWJD 2HLAB 4TNWF 3RIFF 5I71C 1EIBA 1R5IB 1JBJA 2DM4A 1JNHA 1S9WA 4CU7A 1Z5LA 3CXDL 4NQDA 1JHKL 3MV7E 3GMNB 3MRGA 2F58H 2PETA 4HH9A 1YPZF 1EHLL 3U0TB 3RVWC 3AS3A 5SWZA 1GGBH 1G7MA 3HZMA 2PXYA 3QEUA 3PXHA 3WO4B 3MLTA 5F8QC 1YEJH 2H3NB 2ZCLH 3RX8A 4CVXA 2VZOA 1PZUB 1XIWC 1WZMA 1WUNT 2H2PD 4LMQI 4LLDA 5EZIL 1XGTB 4LRIA 3RWJB 1DL7H 5AZ2H 1IAOB 4TTGA 3WNLA 3MJ8B 4KVNL 3D0VB 2O93L 4P3DA 3NMEA 3EOTL 4DTGL 1IQWH 1CLYH 1I3VA 1OTTD 4U1NB 3TA3D 1KCRL 2NZ9D 2DYPA 2EDTA 1F4AA 2DMKA 5H8DA 3WE6B 4OI7A 4URTB 4DGIH 3O8XA 5JZ7C 1TETH 3MJ6A 3TO4C 2A6DB 3QIBD 3SE3A 5IBTH 2NYYC 3VWKD 2Q3AA 1MCRA 2IG2L 2VABB 4F8TA 5CEXA 1ZANL 4NFCA 3SGJC 4QTIH 4S10A 1IT9H 4ERSH 1PQZB 4M9OA 4PRHE 3SDXF 2Z31C 3MRPA 2P8LB 3QUXC 4PIRF 4NQSA 3QAZC 3FRUA 1BMGA 4M62H 4PJGB 4XPGH 1C5BH 3S5LB 4RSVA 1P7QA 2IBZY 3E0GA 2E9BA 4JB9H 3TCLA 4Y19E 4WFED 1MAMH 3B9KB 3GMOB 4ZO7A 5I9QB 4JFQA 3MBEC 5FF6A 5GGSY 2LAGB 5E2VL 2ZSWB 1IM9D 4WO4C 4HUUA 4NFDA 2ITDA 4KK8D 4OQTL 4JM2A 4KQ3L 4YDKL 4HULB 1GC1L 4E41E 2OMNA 2ZPKH 5D9SB 3TBSB 3TIDB 4L5FH 4L3EE 4I18B 1CK0H 3ARGC 4QY8A 4CL7A 1J18A 2Y06L 5E5RB 1DN2A 1KG0B 1BFVL 1BX2A 3RZCB 1QFWH 1WK0A 4FFYH 2NQCA 5FYKU 5BV7L 3FJTA 2AJ3A 4LSRL 4EI6B 1KC5H 3VWJC 3VFGH 1H0DA 3JV4A 1XGPB 4UNTA 4UZGA 1J05B 3U7YH 4UUJB 4I2XE 4JY5L 2XV6B 1A6AB 2EICA 4F2MA 2AEIT 4BZ2L 5HHMB 4R2GB 1JZ6A 4X6BA 4MA1C 2VE6B 1B2WH 3RI5F 5J9PA 3X3GH 4I0PD 4UMGA 3W82A 2IPKA 2IPTH 4OKDA 4ODVH 2VDPL 4NWUH 2EIEA 2Y5EA 3H42H 4S2SA 4P4RB 3TGXA 3DO7B 1LE5B 4X4YB 4AQ1B 3O9WC 2ESVB 2OR7A 1PKQA 2YEZB 2JCCE 4PJ8A 5F3HA 3QFJB 4K2UH 1D5XB 3BRDA 2PW2B 2R2BB 2R0LL 2CKBB 3QBTB 4HGWA 2ENYA 4WHYH 3MRBB 5I1EH 3KPNB 1IEBA 1S7XA 1JHLL 4MNGB 1EEUA 1HYSD 3ZE1E 1OTTC 2XN9D 5F9WB 5FCSH 1U91B 3QPXH 4JFED 2BCKA 5JA8B 1OGAE 2W9EH 2NZ9C 2GSIB 2JCCF 2WQRA 1T7WA 3RGHA 3GBNH 2VDMH 2XQBH 3FTGB 5D2LB 3ZHKA 1Q38A 3P4OA 3WXWH 5GS1A 3HMWL 1XFPA 1NKOA 1W2KT 1K8IB 3IXAA 5TDOB 3VWKC 4NQCD 3WXVL 3LDBC 3R1GL 3UJJL 1YEFH 5FK9A 3ZKQD 5T3ZE 2VR9A 3VE0A 4M48L 1I7ZA 3FQUB 1N0XH 4NZUL 1JN6B 1S7RB 3QG6B 1JF1B 2F19H 3RWIA 2X4QA 3MZGB 5KSAD 2KUTA 1CFNA 4YXKL 4J3OC 4NUJB 3LCYA 4IDJH 5I16B 5EZOH 4OCYH 5ESQB 3T0XA 2B20A 1K3IA 4MNQD 4EDXB 1KBGH 4P5KB 2BP3A 1EH9A 4LVNB 4QEGA 4BQ9A 4W81A 5EU6E 3MRDA 3VFVB 4EI5A 3OG6B 1BQUA 4NKDA 3HRZB 4RWYH 4PBVC 4B0MM 4LHJB 4XWOD 1D5BA 3MLVL 2GTWA 1RJZB 1JPTL 3WL9B 4KK8C 4G80A 1D9KA 4IJ3C 1AP2B 3WIHA 2UWEA 3I3EA 4EBQH 4UQ3A 2D7NA 2NY6D 3A67L 1AE6L 2WBJD 5C0BB 5JORB 5FGSA 4RGND 3ZE2F 1Z3GH 3UDWC 5C0IA 1PSKH 3BQUB 5HHVH 1CTOA 3C6LC 1MFBH 5D1ZB 3WN5C 1S9XB 4BJLA 3MJ7B 3BGFC 1NPUA 3O41A 5F96L 3RL1A 2AXGA 5DD3L 3FOLB 1F3DJ 2OQJB 3DROB 1P2CB 4F33A 5EA0L 1P84J 2E27H 1A14H 2DQJH 4U1KA 1U8IA 2XNAA 3O3EA 5E8EA 4XVTH 2R1YA 2FX7L 2EYRA 4L4VE 3RPIB 4I0PC 4HEPG 2DOCA 4YH6A 1IGCL 2P42B 3R06B 4YWGL 4Z7VA 5A3IC 2AXFA 5E2TL 2H8PA 1ZA3B 1AGEA 3WUWB 1C08A 4U6XA 3DVNB 3MODH 2KQNA 5INDA 1MIMH 4FQPA 3X14A 2JLLA 1UXSB 2OI9C 4OGXH 3ARFD 4NHCL 5E00B 4U1SA 5HGAB 1U95A 5D72L 1HEZA 2VOTA 3WJLA 3RNKA 3U30C 4YE4H 1YY9D 4KGJA 1UB5B 1RZ8A 2UUDH 3TO2A 2H9GB 4NC2B 3QQ9D 3VJ6B 5CJQH 1G7QA 2IGFL 3SJVD 1RZFL 2V5MA 1PY4A 5T3ZL 4TSBH 1T0MA 3IJSA 4M7LL 4TVPH 1NCUA 4D0CA 4N0FA 5DRNB 3MXVH 1Y0LB 5B3JE 1QBAA 3NACL 1AO7D 3QULB 1EVTC 3FOMB 4JN1L 3D3VE 1JNHB 4XCCL 1Z5LB 4NQDB 5C07D 3MRGB 5ID1B 4NZDA 4HH9B 2AJZA 1HKFA 1WWCA 3KPLA 4U0RB 1YJDL 4ELMA 1BEYL 3HZMB 2F54E 2PXYB 3QEUB 5CZXD 3EIFA 1BPVA 4WW2F 2YUVA 1QLRA 4S0TD 2YZ8A 3EZJB 2HRPH 4M6OL 4CVXB 1NMBH 5J89A 4D0DA 5DURD 1OSZA 4B53A 4K94H 4KJWD 3C2AH 4QHLB 2DN7A 2ZOLA 4OCRL 1A7BA 3MROA 1CGTA 3MLUL 1RK0A 1YECH 1FG2B 4Z78B 4XAWH 2NY4B 2AV7A 2QL1A 2RCSL 4LLYA 4BUHA 2BNRE 2DKSA 1FBIH 4YHPA 1FYHB 1RUKH 3EYUH 2DYPB 2G9HA 3VA2C 2FYYA 2W1NA 2VXSH 3EO1B 4UTBL 4TQEL 2NY6C 3QUZD 5GRJL 4YDJA 5E08L 2WBJC 3GSRA 3O8XB 4M61A 4RGNC 1NLDL 3PWPA 4LIQH 4WI8A 1KXTB 3GJEB 3BP7B 5IG7B 3MACL 3MZTA 1EAPA 1NLBL 2BHYA 2EECA 1YZZA 3PHOB 1BVLA 4U6HB 5CEXB 1I9JH 4XP5L 2DLGA 3FFCE 1DBMH 5IB5A 3P40A 3U4AA 2SEBB 4X80L 1DJSA 5TQ0L 2JJSC 3BGMA 3NFNA 3MOQA 5HDOA 3OZ9H 3H2WA 3MRPB 1JV5A 4ZXBD 1A7NH 5DUPL 5L2JA 4NQSB 3ARDB 2CDEA 2DD8L 2GHWB 3JUZA 5D6DC 1TFHA 4DUVA 3IAPA 4MYWB 2CR6A 3T09A 1AXSB 5E8DL 3X3FH 4YHLH 1Z0MA 3I75B 1N2RB 3PGFH 1WT5C 5MENB 3CCHA 4JFQB 4U05A 5FF6B 2UV3A 3PUCA 1Q9LA 3B5TA 3ARFC 5FYJH 5TE4L 2ITDB 5DHXB 4JM2B 4ZFGH 1WEJL 4Y5YC 1I4FA 1YY9C 4PJIF 2P5WB 3FONA 1QFPA 2WWKT 3QI9A 2FIKA 1NL0L 1WITA 5HHPA 3WUZA 1BX2B 1YA5A 2YD6A 2VLJD 5I30L 2AJ3B 1DFBH 1QR4A 1CDUA 1FRGL 2HH0H 4LU5L 1XGRA 4Z5RA 3QDGA 4ONFH 1H0DB 1MLCA 2YHGA 3JV4B 3DX6A 5H2BA 5DLMH 2V5SA 4HV8A 1XAUA 3EFDL 4Y2OA 4FQJL 4FZEL 4F2MB 3IJHA 2EE2A 4RQQB 2VXTL 3IU4H 2E3VA 5HBBA 5ITBL 2YZ1A 3O3DB 1T0NA 5J9PB 1KXQE 2CK0H 3LKPA 2R29H 3TN0D 2MPAH 4YXHH 1A0QL 1B0WA 2AK4B 1U8OB 3MCKB 4PJHA 5CZXC 3VXOA 4S2SB 3IDGA 4KUZL 4LASL 3ARUA 4WUUE 1MH5A 4KJWC 4ZYKA 3BEWB 2Q6WA 1PKQB 4PJ8B 5F3HB 2W9DL 2R0WH 5HDQL 4NO3A 3GI8H 5DSCB 4HGWB 1IVLA 1SJHA 2ZJSH 4D9LL 5FOJA 3TBTA 1IEBB 1T66C 3MSPA 3GSWA 3IDMB 4JFFD 4LPTA 4OFYD 1O0VA 3NZHL 1NCAL 4OQTA 2HJLA 1YPZA 3FKUS 4PGCA 3PL6A 5GGQH 1MEXL 3QUZC 1QP1A 1W0VB 1NCBH 4Z7WB 1HHIA 4JFOA 4U49A 4HFUH 5HSFA 4Z7OE 4LDLB 1S3KL 4FQCH 4NOFA 1BGXL 3O2VH 3DI2B 2A6JA 4KHTL 1U8LA 4U1IA 1CE6A 4MB5A 1JF6A 2DWDA 3MV7D 1AGCA 1I7ZB 3S36L 2GJ6D 5FGRA 2J7LA 4EUPA 5CHNB 4C58B 1K4DA 3AM8C 1DBAH 2X4QB 3NFSL 4ZXBC 2FECI 2YA2A 5L8JB 3OPZL 9CGTA 1CFNB 1NSNL 3OKLA 4JFXA 1EDQA 1M7DB 4X5LA 2R1XA 1RHFA 3D5OF 1N64L 4D9QD 4F9PA 5D71H 4JDZA 1B6DA 1N7ML 3LN5B 4NKDB 1CFVL 4IOIA 5FHAH 5FDWA 2P47B 2YD2A 4QWWD 1WC7A 5JOEA 3R0MA 5J8OA 3BAEH 4G80B 1OM3H 3VRLE 1D9KB 2QSTA 1MPAL 1QSVA 2YKLL 2UWEB 1HWHB 4UQ3B 3ARZA 4XC1H 3SDXA 4HUNB 1RFDL 2VDOL 4PRDA 1JWSB 3C5ZB 4ZAKA 4PJ7E 1E6JL 1A2YA 4Y5XC 5CS7A 2DQDH 3VRLF 5IMOA 1J87A 3RL1B 4AEHH 4GAFB 2X10A 3WFHA 4F33B 1FYTA 2XTLA 4OSUL 3BT2H 4ODTL 2VH5L 3DHMA 3UC0H 2R4RL 1U8IB 2XNAB 5E8EB 5D7IB 2R1YB 3NCYS 4LPWA 1HSBA 3DVGA 3QIUA 3TN0C 4ZOBA 5HYSB 3SE8L 4Z7VB 3CX5K 2AXFB 1AHWC 5F6HI 5T5FL 1HZHL 1CCZA 1C08B 2DL2A 1U3YA 2QQNL 3AS1A 3UTTD 4W6XB 3QDJA 2P8MA 3VGGA 3ULSA 5INDB 1ZS8A 4RIRA 2OZ4H 4XP1L 5LAXB 1PEZA 3X14B 3GBMH 1KLFA 3ZL4L 3RBSA 4U1SB 2AQ2A 4K3DL 1PGRB 4R8WH 5E4EC 1HEZB 1ETZA 1F4HA 1E27A 4YQXL 2MCPH 3RNKB 1YMMB 2ATKA 2DICA 4WUKH 4R4ND 5EU3A 2CDGA 1RZ8B 1P4BH 4H8WH 3CFCH 1VGKB 1WZLA 3TO2B 1II4E 2RFXA 4N8PA 3FHAA 4YIQA 4HIHA 3FT3B 5LGKA 3RA7L 5CIPB 1G7QB 3WLBA 3UPCA 5JO5A 5IQ7H 3BD5A 4D0CB 3KG5A 4OKVB 2VQUA 3NCYP 1X7QA 3V95A 1MUJA 5TH2B 4JLRB 4XWGL 2R56H 4ACPA 4ODXB 1HINH 1LO0L 1YN6A 1XCTA 3ZYIA 2APXA 4AEFA 5IR1A 4L8BA 1UM5H 1E4XL 2VN4A 2ENSA 2AJZB 2OJZL 5J1SC 1FHGA 3UTSB 4J1UA 4LP4A 4EN3C 3IS0X 1S7UB 3W5MA 5F6IC 1QLRB 3FAWA 4WDIA 3T0BA 4D0DB 2HLFC 2JCCA 4PJFE 3SDAB 4QTHA 1OAYH 3UTPD 3MROB 4EOWL 1OTSD 3FN9A 1D6VL 1UWXK 1XGYL 1RK0B 3P0VL 4QKXB 4QWWC 3LQMA 4JVPA 1QRKA 3DYOA 1RIUH 3SGKA 5I1AA 4PB0L 4LLYB 2E7LC 1XR8B 1AKJD 4ZDHA 2DQUL 4KI5C 4YHPB 4EIZC 3TBYA 2G9HB 2FYYB 5F7WC 5JW4R 1OP5H 4GW1A 3BRGC 5GGRB 5CBAA 4GMSL 4YDJB 5H35B 3GSRB 3S4SB 4M61B 4LNVA 3EDJA 1BQLL 1EAPB 1LEIB 4WW1A 5FECA 1BVLB 1AQKH 1XH3A 4OLEA 4Y16D 1LK3L 2VSCA 4BZ1H 5GS0L 5J3HD 5IB5B 4I48A 4NJAL 1Q1JL 3BGMB 1CDCA 1J7VR 4M1GH 1JV5B 1A1OA 1GPOL 2NXZB 3G9VA 1ZT4A 4XHJD 4PTTA 4TSCH 2Q20A 3KDMA 1RUMH 5AWNH 1EFXD 2OBGA 2QHRL 2EEAA 4S1RH 5D8JH 3KYAA 2AS5M 4U31A 1FVEA 1T03L 3T04D 5E8PB 3KYOB 4YHYB 2BNUA 3VGAB 5HI4C 2BMKA 1TZIB 1I4FB 4KDTA 4QRRA 4R4NC 3FONB 4LLQB 3UZVB 4JHZA 4TOYL 3HNTL 3QI9B 4I4WA 2FIKB 3LHPL 3BMWA 5HHPB 4F3FA 1FO0L 4IMKA 1VFAB 3S3PA 1G0XA 4JG0L 4KRPB 3VI3F 2Y4SA 4ONHA 5EIIA 2CXKA 5ESVA 2XTJB 1XGRB 3QDGB 1T89C 3KXFD 1MLCB 3W2DL 2X44D 1SBSL 2FLBT 3DX6B 4RMVA 5LKNA 4HV8B 3SDCA 2BXZA 1ZA6A 4LL9A 2RIKA 3CSYA 3IJHB 4L4VA 3MA7A 3WNMA 4OZHE 2EH8L 2AJUH 2EDNA 2CUIA 5DRXA 1NMAL 4H0HB 3ZMRA 3FN0H 3LKPB 5J13B 2JK5B 1TLKA 1DQLH 2AGJL 3JWDH 4PJHB 1CT8A 5BO1H 1LD9A 3VXOB 5AD0A 7FABL 3MV8D 5T3XE 4MXVF 3M8OH 1L0YA 3IDGB 4J3XA 1PAMA 1YEIH 4XP4L 4UOJA 4OZHF 1MH5B 2LAAA 2Q6WB 3V4UH 1ODAA 4NO3B 1I85A 5C0AA 3IDYB 1E4KC 5KW9H 4XNYL 1EHNA 1R24A 2EH7L 1OTSC 5F1OB 5HGHB 2Y7QA 3FO0L 4CVWA 2CR3A 2PN5A 3NCJL 3STBA 4K8RD 1PVHA 1QKZH 3QH3A 1YPZB 1PYWB 1QFUL 2ED9A 4PGCB 2ZUYA 4JHBA 4POYA 5A2JH 2D0GA 1T1ZA 4JM4L 3WFZA 4WW2A 1EEZA 5L9DL 4PG2A 1JRHH 4CU8A 2A6JB 3CSPA 3QRGL 3K8KA 3K7UA 5J3HC 3FHQA 1A6UL 2OR9L 3BD3A 3JSSA 2DWDB 4PGEA 1AGCB 3SE4A 2VLRD 5C0GB 1IGMH 3GUTA 4EUPB 3Q6FA 1WBZA 4N1EA 1FGNH 4OD2A 1K4DB 4UV4L 1ZLSH 5A2IH 1KELH 4JZJC 1NBZA 2F54D 2P5EE 5L8KB 1PZ5B 4XHJC 4QGTA 3MRIB 5T1LA 2R1XB 3JTSA 1UQSA 1FE8H 1JMXA 3S35X 2X1WL 4IOIB 1KIQA 3DWTA 3V6ZA 3TNNA 5FGCB 4LSDA 1WC7B 4GRWF 2DQEH 1LDSA 2J8OA 3S37X 5HVFB 1NEZG 2FRGP 2J3SA 1QBML 3G5ZA 1CGVA 1MCDA 1EA9C 4ZAKB 4GT7A 5C7XH 1N3NA 1A2YB 5IMOB 1KPRB 4AZ8A 1MRFH 1GZQA 1QHPA 3WIHH 3M17B 5TDPA 3IDIB 4K55A 1FYTB 3FFCD 4CNIA 5BW7C 1JJUA 1JNLH 3BPLB 2V7NA 3G6DH 1UWXH 4DGYH 1T20B 4GO6B 5L88L 4HJGA 3ZDZF 3AMLA 1X44A 1OAUH 2YD4A 4OLUL 4MDJA 1HSBB 3OR6A 1XIWA 3ZKXC 3DVGB 4TNWK 3RIFK 2EIZB 2VZSA 2XKSA 3PWVA 3QCTL 2BY1A 4HWUA 4PJIA 5B22A 4DFHA 3GIZL 4NGHH 4HIEA 5FUZL 4GXUN 3ULSB 1ZS8B 4RIRB 5E2UH 1NBYB 5CLWA 2ZCHH 1RJYA 2GAZB 4N5EC 4JO1L 3PQYE 3PNWA 1ETZB 1E27B 2WAHA 1PG7X 2FBJH 3B9AA 5EU3B 3V6OE 4QOKA 3TO4A 1NDMA 4MSWA 4R9HA 2XA8H 5E94A 4M02A 5IJVA 3ALXA 2CKNA 4K8RC 2RFXB 2AQ1A 4XBEL 4DFIA 4YIQB 4HIHB 3FB5A 5GGTL 1U3HD 3GGWA 1EJ6A 1OAKL 1PDKA 1Q94A 1JRHI 1QO3A 5ACLA 4FFZH 3LVEA 1IMHC 1X7QB 2R2EA 5HHNA 5AEAA 4KKBC 2V9QA 5FYJU 3OB0K 2Z31A 5J06A 3QUXA 1XCTB 1IARB 3VG0H 5LBSH 2R0KH 5IR1B 4L8BB 4LAJH 1AI1H 3H9HA 5IESL 3HI5H 5TFSH 2IF7A 2WANA 2EE3A 1EEYA 4V1DE 4J1UB 1O7SA 2FATL 4PJ5D 2NW2B 1MY5A 1P53A 1XEDA 1TTFA 4GQ9L 2JKXA 3MBEA 1M1SA 4WUUA 4WDIB 3QIWB 4JKPH 4M5YL 4WO4A 1G7PB 1BFOA 4QTHB 1YN7B 2O5XH 4R7DB 2VITA 3SCMB 4ZSOA 1UWGL 2YA1A 1B3JA 3UX9B 3ARGA 3TEUA 1CBVH 4OF0A 1J8KA 2GY7B 5I1AB 4JPIB 4LHUD 3CFEA 4ZDHB 4X0KA 3S34L 2W92A 3FB8B 1AGBA 4GW1B 3VWJA 5CBAB 4L9LC 1T7VA 2FX8L 1OY3B 2ZUWA 4U33A 2WP3O 2YPLE 4MJ4A 5DJ0A 2DQHH 1ACZA 5D1XD 1KTDB 3HKFA 4WW1B 5H37H 4GXUM 1UT9A 1IILE 2F74B 3BKJH 3PIQA 4JREC 4Y2DB 3UTZA 4KTDH 4ZD3L 2H32A 5DYOA 4KK6D 3OJMB 3QDMD 2JELL 4OT1L 4LNRA 1KGCD 1IC5H 3P0YH 3O9WA 5GXBB 3KDMB 2IALA 4QXTA 4IRZL 1FGVL 1NC2D 4RRPG 1FVEB 3DX9A 3GK8L 1A6PA 1MELA 4F7TB 5B39G 2BNUB 3CXDH 1JHKH 2VTFA 3QZWA 1TJIL 3RI5K 1EHLH 4WI6A 4JKKA 2ZWLT 4Z18A 5TE7L 3HA0A 4KI5E 5A16A 1W8OA 4QRRB 3B9DA 5IIEA 5C6TL 4WHCA 3THML 2NNAA 1R5WA 3LKRA 3MCG1 5D7JD 2GK2A 3BP5A 1ONQB 5GSRA 1A4KB 2BNQE 3VWKA 1U3HC 2AW2A 3ZDYE 1XT5A 5EZIH 1ORSA 2HMID 1NBQA 2ZUVA 1JNJA 4ONHB 5EIIB 5ICZB 4KI5F 2AK1L 5ESVB 1FIEA 1CGUA 1FVDA 2ATPA 4HKXB 1UACL 3EOTH 4DTGH 3WEXB 5DFWH 3LN4B 3CMGA 2V9RA 4BKLA 3CSYB 1SEBA 1KCRH 5TF1L 3MV9A 1CL7L 4NP4L 3N85L 1X5KA 4F7PA 3QO0A 3OF6A 3EW3B 4GUPA 1CT8B 3GB7B 5MHSD 3TYFB 1LD9B 5AD0B 4YAQB 4BSWA 3RRQA 5F1IA 1WZKA 4GKZB 3QRFM 4Y1AE 2IG2H 3REVA 3ZDXF 1ZANH 2BJML 4P49A 4HHAA 5C0AB 5K59F 2Q87A 5C0EA 4G3YL 1OB1B 5IM7A 4M4RA 2O5YL 4R7NA 1P4IL 1DBJL 3B4NA 3UDWA 2HFEA 4H1LA 4NO2B 3VCLA 3C6LA 3WN5A 5GGRY 4LSVL 3OB8A 4K3JL 1T4KB 3IVKA 1F3JA 2NY1B 1QHOA 4WW2B 4BUGA 4L4TD 3I50L 5EO1A 1FO0A 1AJ7L 5D1XC 1L7IL 4P2QD 5E2VH 4HPOL 1T83C 2HN7B 3EFFB 3MFGB 1MI5E 4OQTH 1ZLUK 3O81A 1CDHA 4KQ3H 4YDKH 3HS0B 4UT7H 1GC1H 4I0PA 3WIIL 3RHWK 4PYHA 4PGEB 3QJFA 4KK6C 5MEPA 3GUTB 2MOVA 4M93B 3RVTD 2Y06H 3ARPA 3QUYC 1BFVH 2IAND 5FCUL 5BV7H 5FUCC 1MRCL 4TPRL 3F7QA 4LSRH 1QLEL 5HVGB 1U8HA 5T1LB 3QCVL 5T5NF 3JTSB 3OGOE 2NXYD 2O61B 3QWRD 4I5BA 5FIEA 4EUPH 4JY5H 1VDGA 2VLKE 1KIQB 5ESAA 3CH1A 3I3BA 5DJXB 2PYEB 3TNNB 3PDDA 3RBGA 4BZ2H 4KVCL 1YYLL 1ORQA 1HHGB 2Z8RA 3K4ZA 4GW5A 3GZKA 4ZMAT 3HUJF 1S7QA 3P4NA 1IL1A 1FC1A 4XPFL 4Q97A 1EPFA 2VDPH 5I71B 5CEZD 3OJVC 4ONGL 5I8KL 5IHZA 2DM7A 2ICEA 4MJ5A 3RAJL 5GHWL 1N3NB 1L9MA 4B7IA 4R4FL 5C09B 2HMIC 2AKRA 2EE9A 2MTPA 5ALBL 3KNBA 3RIAF 2R0LH 3K0WA 1GZQB 3IFOB 4JFDE 4JCLA 1V7NL 3LEYL 3REWA 1NUFA 5TDPB 1JYXA 1JHLH 1VHPA 2NCMA 4BFIA 3DMMD 4CNIB 3B5HA 3W5NA 4HJGB 4MDJB 4MNQA 3OR6B 4U6YA 3DUUA 2QKIA 4PJIB 3F7YA 4XPBL 4WWKD 5EN2B 2C3XA 1AY1L 3BH8A 4WHTA 3HMWH 4HIEB 2C3VB 4LSQL 4CUCA 4YHKL 3WXVH 3R1GH 3BW9A 3UJJH 2P48B 1RJYB 3HC4L 2EXYC 3HZVB 3PNWB 2FHFA 1C16A 4M48H 5EOCJ 3OR7A 3K2MC 4NZUH 1OWRM 2WBJA 3PWLB 4QOKB 3TO4B 5E94B 5IJVB 5KBNC 3HI6L 4YXKH 4HAFA 4JRYD 4K7PL 3FB5B 6CGTA 3GGWB 2VWEE 5KTEL 2R2HA 3TCXA 1LO2L 3T0ED 2E6QA 1QO3B 3ARED 1I7RA 1TXKA 3MLVH 1LO4L 3H9SB 3MUGA 1UXWA 1JPTH 3QUXB 2X4NA 3QAZB 4OZHA 4QRPE 2ZNWA 1OT2A 5D6DA 3VD9A 5E8NA 1IJ9A 3ZHLA 3H9HB 4IOSD 3V8CA 3DYPA 5DVKA 5I1JL 1LP9F 3A67H 2EC9T 1AE6H 5J6GA 3RVTC 5C71A 3LS5L 4UINL 1WT5A 5ECJE 3BDBA 3MBEB 2L7UA 1CDBA 3W0WE 3ARFA 4NZRL 4WO4B 3BZEA 5F96H 3A6BL 3MA9L 1BFOB 5DD3H 4Y5YA 2VITB 1NJ9B 1BVKA 1IC4L 4GAGL 5EA0H 2NXYC 1VEOA 1FAIL 2X4UA 1MHEA 4NNXA 1ND0B 4LSPL 1KLGB 1HHHA 5ISZE 4N8VA 2BHUA 1A22B 4NYLA 1RY7B 3G6JE 2FX7H 3WJJC 3KWWA 3RWGA 3VXRB 1C7TA 1NCTA 2VERN 2ORBH 3MCLL 3KGRA 1AGBB 1IGCH 3PDGA 4YWGH 4M8VA 2VDRL 3R4DA 5E2TH 3VWJB 4C56E 4TNVF 4OIIL 3VXPB 3P30L 2VL5A 1AO7A 4KUCD 3ES6A 5DJ0B 4LMQE 1K2DA 1NC4D 4WY7L 5GGTA 2NX5D 4NHCH 5KS9B 2W38A 5HVHC 5D72H 1KULA 4MA1B 3PIQB 1J1XL 3GEWB 3UTZB 4MJID 3L3HA 2H32B 3WUWG 3DMMC 5DYOB 3ZKMD 2WK2A 3P4LA 3DGCR 1QUNA 2AERT 3MR9A 3DARA 1RIHH 2IGFH 1RZFH 3QUML 3BXNA 5JA9A 2P5ED 4ZUVB 5T3ZH 2AEPL 2VL4A 1NFDF 2WBWB 4UT9L 4WJ5B 4M7LH 4AK1A 3I9GL 4WWKC 2F5BL 1N8ZA 4OCMC 1MCKA 3NACH 3DX9B 1NGYB 4UIMA 3VDAA 4JN1H 1S7VB 4XCCH 4HFWA 3QZWB 4ENED 4WFFE 3TA3B 2MQ0A 1YJDH 3ULUE 4PLJD 1BEYH 4LLAA 3QUZA 4XC3H 5IIEB 3RVUD 4X6CF 2NNAB 1R5WB 3FRPA 4HS6B 4QRTA 1CXHA 3QIBB 4M6OH 2KL6A 4FP8L 3VWKB 2B2XL 3TBWA 3PXJA 1H8OA 5DXWA 3U2SA 2OJEB 4Q7DA 2NR6D 4OCRH 3D1MC 1KB9K 2ZG1A 2J8UB 3DRQA 1FVDB 3MLUH 1JZ4A 5F1SA 5EFIA 1DQTA 4GKNB 4PY7A 4S1QL 4KDVA 1KN2L 3O2DL 3S98A 3AM8A 4ZXBA 4BKLB 2RCSH 1FV1A 3RKDC 2YN3A 1SEBB 3NIGE 4YHZL 4X83A 4UTBH 4TQEH 4F7PB 3QO0B 5GRJH 4BYHA 1CIUA 5E08H 4EXKA 1NLDH 5I2IB 4NZJA 4U6VL 3MACH 1NLBH 4LEOA 2D0FA 1ZE3C 3MNVB 4HQQL 1IM9B 5J4MA 3L95A 4XP5H 3PQYA 3DSNA 4K8RL 3CFJA 1X5YA 2QV2A 5TQ0H 5IM7B 3OKEB 1I1YB 4R7NB 4YHML 2BSTA 2P7TA 1IAMA 1AXTL 5DUPH 4BQCA 3JTTB 5SWSD 2D7MA 2YUZA 3TNMA 2HFEB 3WN5B 4Y5XA 5E8DH 2J1KA 2A73A 3LRSA 4PGZA 3BGFB 3I6LD 3IVKB 1F3JB 1DQDL 2XRAH 5BVPL 2YD5A 5BRZE 4OCWL 4DOHB 2E9WA 5EO1B 1FO0B 3VFUA 1M7IA 1EERB 3IKKA 5TE4H 2EO1A 2QR0A 5IBUG 2HWZL 5F71A 2QQKL 5KJRL 1X9QA 5HHXL 3RWCA 4I0PB 3TN0A 3ZKMC 1AHWA 5MEPB 1NL0H 5DC4B 3K80A 1P4LB 1E4JA 3B9KC 3OKKA 3CFIC 4V1DD 4MCYB 4NNYB 4MJ2A 2XT1B 3B2UC 1F3RB 1CVSC 3OXRA 4M7JL 5I30H 2OI9B 4ESKA 1QSEE 4XCNB 1FRGH 4LU5H 2X1QA 1U8HB 2VB5A 4XP9L 2RAMA 4PRPE 4NKOB 5DJYB 4X7TA 4PJXF 2BC4A 3BWAA 4I5BB 2H1PL 3U9UA 3EFDH 4I18C 5ESAB 4FQJH 3CH1B 4FZEH 2FBOJ 4KMQA 2XN9B 4A2MA 2VXTH 1ORQB 5ITBH 4JFEB 1ZWIA 2I9LA 4OFIA 4RAUA 4HMCA 1BFSA 2AJVL 4PLJC 5FO9B 3E3QE 1S7QB 1UENA 1A0QH 3P4NB 3RVUC 2C4XA 5IEHA 5IV2A 3RUGF 3N1MC 1BD2B 5FYKD 2FEDD 4KUZH 2ICEB 4LASH 4MJ5B 1OHQA 3WD5L 4NQCB 4AIZA 1DQJB 2W9DH 1H5BB 2XZAL 4R2GC 5HDQH 2NR6C 3T2NL 3PGDA 1XGUA 3GSVA 3IU3A 4D9LH 1LNUA 3CZJA 2JJWA 3REWB 2GJ6A 2E9IA 1L7TL 4JJ5A 1CI5A 5HGBA 4PGJA 4I9WD 2XKNB 5IROC 1KNOA 4LCCB 4EN3A 5KSAB 3NZHH 2YBRB 3ILPA 5DEGA 1NCAH 3KVQA 4MQXC 4X9FA 5HTSA 4ZPTA 1NUDA 4MNQB 4U6YB 4LSTL 1MEXH 2M1KA 3C6SA 3F7VB 1DUYA 3DUUB 4J8RA 5CD3A 3VRIA 1H3VA 3F7YB 3EZ8A 4E42B 1S3KH 2JE8A 5KSBB 3GIVA 1RU9L 1BGXH 1C8PA 3L3DA 3LSOB 4Q9BA 4D3CL 3GJFK 4KHTH 4FQ1L 4X6DF 5F9WC 5GQBA 1T5XB 2E7LA 2IADA 1VADA 1I3RA 3GSOB 1JHTB 2N7BA 3S36H 2OR8A 1FFNB 5I1IL 2NY6B 3LH2L 2WBJB 5JPNB 3NFSH 4YR6A 4NQUA 1T21A 4RGNB 3OPZH 2V2WA 1NSNH 1FAKT 3V4PL 5CZVL 1BWMA 4F7CB 4RMWA 4NO0D 2R2HB 3SKMA 2X4OB 1N64H 1WWWX 3VU2A 3LRGA 1X4YA 3DV6A 1N7MH 4HIIA 5DJAB 4YHIA 5HDBE 1CFVH 2NPLX 1I7RB 2DKUA 2KQMA 1FL3B 3MUGB 1UXWB 2EDYA 2EYSA 4JHWL 5ADPL 2X4NB 5M7QA 4NBZB 2VZTA 3AXLA 5IOPA 1MCQA 4Z0XB 1T80A 4LVNC 3W9EA 2K9UA 4MHHI 1HH9A 2COQA 1RFDH 3WDJA 2VDOH 5E6ID 1BAFL 5HYJE 1HHJA 2QSCH 3VGDA 3FQTA 4YX2L 3UROR 3UTTA 2AABL 4Y1AA 4EEEA 3EDKA 2F8OA 1MRDL 1RZGA 4YHNA 3TFKD 1A9EA 5EUOE 3ARFB 5JNYA 2ILLA 3MGOA 4LKXA 3LOWA 4Y5YB 1BVKB 1OVZA 5CZKA 2B39A 4OSUH 4ODTH 5J1AA 2VH5H 2R4RH 1HHHB 4N8VB 3GSNB 4GRLD 3KWWB 5DVMA 3RWGB 3DVFA 3SJVB 3T8XA 5JPMB 1QFWM 1FFPA 3HE7D 4QRQB 1D5MB 2EO9A 3SE8H 1OQXA 3KLAA 5T5FH 5C3LD 1HZHH 3VXQA 4PD4K 1H15B 1T89A 4Z95L 2QQNH 5IKCB 2B8OT 1RZKC 2VL5B 1AO7B 2FEDC 3ES6B 5EZLB 4XP1H 1HIML 1JP5A 5AYUL 4ZFZB 1WISA 3FL7A 3ZL4H 1FZOB 3DXAE 5C07B 3X13A 4K3DH 35C8L 1B90A 2NW3A 1BHGA 5MEQB 4U3CA 4YQXH 3VXMD 1VACA 5D7LE 4N1CA 4FFYL 1MAJA 4MD5A 2CLVA 4PPTA 1CVRA 4MQTB 1R3IH 3CU1A 4HD9A 4L9DA 4ALAL 1FNSL 5DA0B 3MR9B 4KV5F 4GRWB 5GISL 4PY8J 5DURB 3HE6D 3QXAA 3RA7H 3TZVD 1IFHL 3HUJA 4RDQG 2FH8A 1S9YA 3H0TA 3BXNB 3QPQD 1I1RA 1GGIL 5D5ME 5KN5A 1BECA 3HG1E 2H32H 1NH6A 4XWGH 2XWTA 4YNYB 5E4IA 3S3SA 1E0OB 5GS3A 1LO0H 1GOFA 4HFWB 3OV6A 3IFNL 2VLKD 1SYVB 4MA8L 3QT2A 1AKJA 2ADJA 1W72L 2OJZH 4OZIE 2PO6D 4QXUH 4IMLA 3STZB 3D39D 1XF3B 2VXUH 2ID5A 4HK3N 5GJTL 4QRTB 4ISVA 4UIKL 2BSED 3BZFA 3OXSA 2I07A 5L2KE 1NUNB 4KJPD 1WAAF 4YHOL 3GSUA 2BOCA 3DRQB 4EOWH 1D6VH 1XGYH 3QYCA 3T1FA 2UZIL 2FWOA 5EFIB 3P0VH 2HJFA 3GBNL 2UZXB 5HD8D 1TDQA 1FLRL 5IVXF 2HJKA 1MCOL 4JZJA 4PB0H 2OL3B 2DQUH 1QSFE 5BQ7A 5T33L 1EFXA 4GAJL 1U8JB 4OZGE 5DD1L 5J7CC 4HUVA 4GMSH 5TGBA 2BVTA 4U3HA 3L3OA 1DVFB 2O5ZL 1BZQK 2UYLB 4F7MA 2WINA 4X8JA 1MNUL 1BQLH 4ZS6D 1CFQA 3RNQA 2YXFA 3BGAA 1CQKA 3U4EA 3OAUL 1LK3H 3QUMA 4XTRD 4FRWA 5H37G 4XAKE 3L95B 5B38A 4AENA 1I8MA 1WF5A 3CFJB 4OCYL 5EZOL 4NJAH 1Q1JH 3MRLA 2OCFD 1RK1A 1W8NA 5I17A 5I19L 2ZUUA 2BSTB 5ETUA 2FGWL 4TSAL 4NWTL 2WUBL 3LEVL 2BVOB 1GPOH 3TNMB 2R69L 2GCYA 4GLRH 4Y5XB 2VLJB 2QHRH 2A73B 3LRSB 4JANA 1LP9A 4NC1C 4K07A 3SQOL 4ETQB 3RY4A 5KSVA 3KXFA 1T03H 5JDJA 3BKML 3MRRA 2A74A 5BW7A 4PJBF 1M7IB 4QRPA 1FL5A 3ARDC 2QR0B 4H1LH 3HAEG 3Q5TA 3QEHB 1DZBA 4HDIB 3LKNA 3RWCB 3TN0B 4TOYH 3HNTH 2XG4A 3IFPA 5C0DA 3O2DA 1AHWB 2VLME 1BF2A 5IVOA 3LHPH 5GRUL 3MV8A 1FO0H 2Z92B 3L5JA 3QISA 4LIQE 4LEXH 4JG0H 3TZVC 4J3VA 3L3JB 3SDYL 3OXRB 5DMGD 3QPQC 5JXAL 5E4EB 1U8QB 2BC4B 1EHAA 3GO1H 5ISZA 5ICYB 4DN3L 4LDEB 2FB4H 4JFFB 1MHHB 1DEEB 5CEZL 2NLJB 2ZUQB 2VIRA 2EH8H 5D6CA 1ZWIB 3OX8A 1JK8A 1JGUL 1NMAH 4NQEE 4RAUB 5F7YC 1SJXA 3RQ3A 4IRJB 1TMCB 3F58L 2VLLA 4ELKA 2AGJH 1IGYA 1HDMA 4XPHL 3KS0J 7FABH 1BWWA 2CLRB 2FL5B 4C56D 1T2XA 5IV2B 4X98A 1MCWW 3VXUD 4JRXD 4XP4H 3HNVL 4R26L 4AIZB 1TVBB 4KJPC 5FYJE 4PJGE 4WFHD 4GW4A 3MV7B 4XNYH 2Q86B 2EH7H 3B9VA 4JPKL 4WFGD 5MEOB 2ADIA 2GJ6B 3ULVD 4JJ5B 3FO0H 5HD8C 1DLFL 3NCJH 4OGYL 4KUCF 5DEGB 3ILPB 3MO1A 5F6IB 1SBBA 4KTEL 1QFUH 3BHBA 4ZPTB 3FB6A 3EO0A 1VPOL 3C6SB 4PJGF 5CD3B 3VRIB 1RJCA 2PTTA 4MLIA 4X6CA 4JM4H 3FQWA 4ZS6C 2DQGL 5L9DH 4FXKA 3LRHA 1XF4A 5FA4B 3L3DB 4G6FD 5J1TC 3J7HA 4XTRC 3QRGH 5EORL 1MJJA 2CJUL 4JE4B 3TH2T 2IADB 1VADB 2XOTA 1A6UH 2OR9H 4WVRA 1I3RB 3ZKNC 4K94L 3GMLA 3C2AL 4L9LA 4XVSL 4UV4H 5DHYA 4Q9QL 1T21B 4GLRI 2Y5TB 1TQBC 2V2WB 2N4IA 3O6LL 4W4OC 2OTPA 2XKUA 4RNRA 1E28B 1A7RL 2HKFL 3OKYA 3LQAC 1F13A 5HHME 4KK5C 3SKMB 4NFBA 5D7KD 4U1GC 1B9ZA 2DBJA 4Y8AA 3DV6B 1GJIA 2HFFA 1EBAA 3BWUC 3KLSA 4YHIB 2DQCL 3TJEL 1RI8A 4KAQL 4EJ1C 2DMBA 5IK3A 2VUOA 4Z9KB 3AXLB 4LAQL 4DZ8A 3QQ3A 3LV3B 4FA8A 5GGSA 5F7DA 2ESVE 5DGRA 4NBXB 3W9EB 1QBMH 4NN7C 4HC1L 2Q8BL 4YO0A 1U8KB 1HHJB 2NTFA 1B0GB 3FQTB 5J6HA 4YHNB 4TTDD 4NQXA 4MNGE 3OZ9L 4ODWA 1OP3K 3LAFA 5DMYA 3MLRL 3STLA 2FECL 3HTLX 1I9EA 1X5HA 5J1AB 2EEDA 1YY8A 5L88H 4PREB 3C5ZC 4IS6A 4OLUH 2YSSA 1MJUL 2Q7NA 3KAAA 3T8XB 2DQFA 5F9AC 2Z93A 5E7BA 4MX7A 3GIZH 2VZVA 3IJYA 3QJHA 5GRYA 5DDHA 5FV2A 1T1WA 2X5PA 5FUZH 1VB9A 2I5YH 5FM8A 2C3HA 1M6OA 5D2LF 3L3IA 3DUSB 4YK4C 2KH2B 5I8EB 1JFQL 5KSUA 4JO1H 3O6ML 3X13B 2NW3B 3ROOB 3HFML 5LWYL 4PJXA 3ULVC 4MD5B 2CLVB 2B1HL 4PJ5A 4RMUA 4MS8D 3EAKA 5BS0D 2X9XA 2Z8WC 3QR2A 5E5MA 5GRXG 4YDVA 3D0LA 4X4XA 3O3UN 5IB1B 3QXAB 5GGTH 5E99L 4LCWE 3HUJB 5JOFB 3LKOB 3H0TB 1HHKA 5ENWA 1UJ3C 3W81A 5T1KA 4XH2A 4WI3A 4XBPA 1MCFA 2Q3ZA 4NT6A 3S96A 2R29L 2XWTB 3RUGA 5FB8A 2DWEB 5JIPA 5C0BE 4GRWH 3JWOC 3V0VA 1AKJB 2HTKD 5IESH 1X5ZA 3E6HA 5IHBA 4AL8L 1NGPL 4J7RA 2FATH 2OS7A 3MJGX 4ZNEA 1A7QL 4X5XA 2IAMB 1KIRA 3BRFA 2WP3T 4GQ9H 4KY1L 5C08D 1BQSA 3V0AC 1RIVH 1KYOJ 5D1XA 3WYRA 5I76A 3OXSB 4M5YH 4Y16B 3OAZH 1T83A 1RZ7L 2V2XA 1UZ6F 2IPUG 1S8DA 1XF1A 2BOCB 4OD1L 1QG3A 2FH6A 2VDNL 2FWOB 2HJFB 4ZFFA 2YXMA 2CKBL 1JYVA 1J1OL 2W65A 2HJKB 4NUGL 1BZ9A 3QUYA 1I8KB 3TBVB 3S34H 4N0YH 3FO2B 1EFXB 4TULL 1EAJA 4HUVB 3SDAC 3I85A 5TGBB 3L3OB 1JZ8A 2FX8H 2H41A 2IEPA 1NC2A 3VFSB 4F7MB 4X8JB 5JHDE 4PV8B 1X5JA 1CFQB 2BRQA 1OTUD 4TTDC 1MCNA 3MYJA 1RJLA 3U4EB 3QUMB 2YOCA 3IFLL 4N90D 4FFVC 5B38B 4DK3A 4AENB 3ZT6A 2D7PA 3PWNA 1F97A 4ZD3H 3V6BR 2CSPA 3DECA 5I17B 2JELH 5MERA 1IGTB 4L8SC 4NOBA 4OT1H 3WFBL 4JHAL 3CDGA 1CXFA 1QRND 1QNZL 1W72A 4KZDL 3KPOB 3WNPA 4CVZA 2RB8A 2BDNL 2CMRL 4IRSD 1A1NA 1LP9B 4NQDE 4OM1L 1OM3L 4IRZH 1FGVH 5KSVB 3KXFB 1CQYA 1YUHA 3GK8H 3LZFL 4MA3A 1OGTA 1VFOA 1WGOA 4K7FB 5SWZE 3MRRB 4X4MA 4YFLF 5E9DD 3KLHD 1BJ1H 4CADA 1TJIH 1BLNA 1JZ2A 2P43B 5TE7H 4D0BB 1DDHA 3T08A 3LKNB 2VDLL 2BX5A 2PKDA 5C6TH 1AXIB 2HRLA 4NKMA 3THMH 4MS8C 4O02L 2KZWA 3MV8B 1QR1A 1RVFL 1OT1A 2NY0D 1E4WL 4RBPK 4PP2A 5I6XB 3O2WL 3RIAK 4IHOA 1ZVSA 3TV3L 2AK1H 4PV9B 4YUEL 5ACZA 3CSGA 5BXFA 2PW1A 3LD8C 4PTUB 1XR9B 1UACH 3NAAL 2MNUA 4BK4A 1GGCL 3IKCA 2DM3A 1P1ZA 4PJDB 1RZKL 5TF1H 5FYKL 1JUFA 2VIRB 5D6CB 2IH3A 4NP4H 3N85H 2OZ4L 1IGFL 1D5ZB 1R3HA 4KRPC 5EBGA 2VLLB 4G6AC 3S3JA 1IGYB 2XTJC 2Z91A 3PWUA 4NC1E 4X99A 5BJTA 5BOZG 1RSFA 5I8CA 3INUL 5IVZA 4Y4FD 4P2QA 4CU6A 2ED7A 3DXAA 3VDCA 2BJMH 1GOGA 3K2UL 1T7ZA 5D7LA 1AGDA 1NFDB 3CDFA 3ZHDA 5FA3A 2IFFL 5KVFH 2OTUA 1OP3H 5C8JA 1Q8MA 1ZT1A 4FQXA 4G3YH 2VLRB 5J13C 1A6ZA 2O5YH 2ADIB 4O5LH 5F7KC 3OG4B 1P4IH 1DBJH 3P9LB 2LU4A 3MO1B 1EEQA 1OP9A 2F54B 2IANA 4OM0L 3BUTA 1RAMA 4KWUA 5MENE 3WHXA 3BHBB 4LSVH 4H26A 3DX7A 4JJHA 4K3JH 2YD1A 3HRPA 1W0WA 3G9AB 5IW1B 3HG1A 2GI7A 3QWQB 4HGMA 1KB5B 1T6WA 3QWRA 3VFMA 1AJ7H 4FXKB 3D69B 1L7IH 1XF4B 2P5WE 1LILA 1OTUC 2LVEA 4HPOH 4HWBL 5J0BA 1DSFL 2C3GA 4G8EA 3WJJA 2XWJA 4MMXC 2Z9TA 3WIIH 1WAAA 2D31B 1LO5A 5FKAA 1PJ9A 1E6OH 4L9LB 1UA6L 3RJQB 5DHYB 5IVXA 4MHHG 3D18A 4Y4HD 2RQ8A 1MRCH 4M3KB 5GS2D 5B21A 1G7LA 4RNRB 1PFCA 1HCVA 3WHE1 1QLEH 3F7PC 2MQ3A 3QCVH 4MAUL 2R9HD 1Y18A 1EO7A 1LWRA 4OUUB 2EDKA 4E0RA 3FFCB 1TNNA 3DMMA 3L6FA 3GRWL 2IWGA 4KVCH 1YYLH 2AK4E 4MZ2A 5DEZA 1PG7W 4NQVB 4OCLC 5IK3B 1KENL 3QIWD 5I0DA 3QNXB 2YPKA 3QQ3B 4TNVK 5GGSB 5F7DB 4K71C 1PKQE 4WWKA 4M43H 3QP3A 4YO0B 1A6VL 5I8KH 1PW3A 2NY0C 3RAJH 5GHWH 3EUUA 4R4FH 4TVPD 1GAFL 4NQXB 4AM0B 5ALBH 1NAML 4ODWB 3MREA 2V7HB 3ZE0E 2H26A 1V7NH 3LEYH 5FHBL 3STLB 2HLAA 1U2CA 4PJBA 4Z7WE 1H3WM 4KRLB 5FYLD 4JRYA 2RR3A 4R3SB 1U3HB 3EDEA 3GMNA 3PGCB 3LPWA 2DQFB 5ANMA 4XPBH 4U4BA 3U0TA 2Z93B 1JTPA 1AY1H 4MX7B 3QJHB 4JN2A 4YZFF 1B4RA 3TLRA 4LSQH 4Z7WF 4NN5C 4Y4FC 1M6OB 4YHKH 3L3IB 5D96C 3HC4H 2H3NA 1ZMYA 2L7JA 5DUBA 3SO5A 2AEWA 3HPLB 2YWZA 3F12A 5DJCA 4PJXB 1VGEL 4PJ5B 3L7FB 2XPGA 3MJ8A 1KV3A 3HI6H 4LP5A 4JQIL 1DBBL 4X4XB 4MAYD 4CKVX 4K7PH 4XP6L 2ZOKA 3WMSA 4YPGA 5KTEH 5LJYH 1HHKB 3B83A 2DJ4A 1LO2H 5A2LH 4HC1A 4QHNB 2D03L 2UWEE 4XBPB 4NT6B 5F7LB 3S96B 3FN0L 4S1SL 3A6OA 5FB8B 3RUGB 1WFUA 2Z35A 2OSLA 5ID0A 2A6DA 5DJDB 1P5VA 1U8MA 1KCLA 4LHUB 3V0VB 3C2SA 5T1MA 2A1WL 3U82B 5DHVA 3E6HB 5I1JH 1XF2B 3GM0A 5EUKA 4PRNB 1MCEA 4NQED 1PKOA 1X4XA 1VFMA 1AQDA 4X5XB 4MD4B 1KIRB 3LS5H 4UINH 1CWVA 4Y4HC 3M1BA 2VZ1A 4KTYA 3MC0A 5D1XB 2P8LA 4NZRH 4RBPH 3A6BH 3MA9H 2V2XB 4PJGA 5D7IE 3FAXA 4LKCA 4MWFA 3S5LA 2R9HC 2DMCA 3P73A 1C12B 1IC4H 2D7TL 4GAGH 4MJIA 2PCPA 5EG6C 3VFTA 1FAIH 2W60A 4LSPH 1MJ7L 3S7GA 3QDMB 1J8HD 4Z7VE 4CMMB 4ZFFB 4OZFA 3B9KA 3F6LA 4X6DB 1BZ9B 4ZUSB 3QIWC 1JRHL 4HT1L 3MCLH 4P2OD 3EGSA 5D7IF 2VDRH 1MFAL 4QXWA 4OIIH 3P30H 4KRNA 4M6NL 1NC2B 3SCMC 3G08A 3ULVF 3TBSA 1YMME 5I8OL 4WY7H 2ZUXA 4I18A 1CZ8L 3WNOA 3MYJB 1RJLB 3ZO0A 1KG0A 1J1XH 1F4YL 2LABA 4EVNB 4JCMA 4P4KD 3LQAL 2CXGA 4I3RH 5JXED 4DN4L 5KG9B 1XGPA 4I8DA 5D7JB 5DVOA 3FFDB 2P1YA 3QUMH 4X7SL 2AEPH 4CVZB 4UT9H 3G04A 4PRID 5HYFA 3I9GH 4EQ3A 3NIFE 4HJJL 4NSKA 2F5BH 3MYZA 3WDIA 4Y2DC 3IS1X 3EJJX 4MA3B 4I3SL 5GZOD 2F53D 4HIJA 2NMSA 3UTSE 4ELME 4YFEA 3FT4A 2FR4B 4KPHL 4KRMB 4OLVL 3NZ8B 2GTZB 3DO7A 2HT3D 4M3JA 4RZCA 2YEZA 5C86A 3QFJA 4NKMB 2CKBA 5DFTA 1JZ7A 3MRBA 1QFHA 3KPNA 4G8GD 2CO7B 1QR1B 1NGZB 1OLLA 4MAYC 4FP8H 2B2XH 3QZWG 4PP2B 1R3KB 4JRWA 1U91A 1MVUB 1ZVSB 4IHOB 5DTFA 3UYOD 4G9FD 2Y9RT 4G7VL 5ACZB 4W6WB 4S1QH 1KN2H 3O2DH 1FNHA 2QEJA 3IYLW 3FTGA 4RWHA 5D2LA 3IKCB 3T3ME 1TTUA 4P2RD 4YHZH 1JUFB 5ERWA 5TDOA 2IH3B 2ARWA 2BRRL 5EC1A 1VEPA 4UAOC 3PV7A 2PTVA 1CF8L 1KJ3L 4X99B 4U6VH 3C5SA 3ULVL 2W0KA 4L4TB 4S0SD 1WCQA 2XI9A 1S7RA 5IVZB 4P2QB 5D93C 1U41A 4DZBA 3OJDB 4D9RE 5I16A 4K8RH 1UJTA 1AGDB 5FUOL 5ESQA 5FA3B 4LSSL 3DX8A 5KZCD 4D94A 4EDXA 4P5KA 1ZT1B 3BP6B 3B5GA 1A6ZB 4HCRL 4YHMH 4HF5L 1AXTH 3VFVA 2VO5A 4FXLA 2IANB 3WHXB 2YR3A 4J6RH 4P2OC 4H26B 4WNQB 3SKNA 5BVJA 2W59A 5F9OL 3JWOL 3WL9A 1I7UA 2JIXD 4M6ML 5IF0A 5HHOD 1W0WB 4NKIL 1AP2A 2X09A 1DQDH 4LCWD 2PYFA 5BVPH 4BFEA 1RUAL 4OCWH 2NXYB 3HI5L 3VFMB 3MLSL 3QQ4A 5E2WL 1MWAB 5CKGA 1TZHA 1IAIM 4H1LG 2HWZH 4ONOA 5LVEA 4Z7NE 3BQUA 2QQKH 5KJRH 5HHXH 2A38A 1FZKB 3NIDF 4IBLT 3AS2A 5FKAB 4XB8A 1T1YA 2NY1C 5KVDL 2XTJE 1Z6JT 3IDUA 3QDGE 4OGAD 5EU4A 1CIDA 3G5YA 4JKLA 1CDJA 4M7JH 1G7LB 4FN0A 1ZTXL 2C26A 4HXBL 5HVHB 2C7UB 4XP9H 1EZVX 1HQRA 1Y18B 2GW5A 5GZOC 2H1PH 3R06A 4E0RB 2ZNXA 3DMMB 1ZA3A 5IB4A 3BN9D 2X4RB 4PJHE 3O6FD 2DM2A 1V7ML 2AJVH 1UXSA 2YPKB 5C0CD 2HKHL 4WWKB 2KPNA 5KOVC 1J0YA 1UB5A 2XZQL 3WD5H 2EC8A 5JHDD 3QXDA 1I8LC 1VFBA 5B3NA 2H9GA 2XZAH 5F70A 5CKAA 3T2NH 3AS0A 3MREB 4A6YL 5D70L 2HVJA 2H26B 1YPZE 4HUKB 5JOPD 1A7PL 1P5UA 3TP4A 5DRNA 1Y0LA 4HWBA 4PJBB 2BSSB 4R0LC 5DMIL 3QULA 4M8QB 3FOMA 4JRYB 5A40E 4YBQD 3V2AR 2R23A 4LSTH 2EDQA 1EUTA 4IM8A 5ANMB 5ID1A 3NCBB 3T0EB 3A0OA 3L1OL 1H3XA 3AREB 4J12A 1RU9H 4JN2B 4G6JL 4D3CH 4FQ1H 5SWZD 4BSJA 5DUBB 5IBLD 2VSDA 3BFOA 2E8ZA 4PLOB 3F12B 5JIKA 5DJCB 5I1IH 4QHLA 3VXTB 3LH2H 1WBXA 2IBGA 4U3XA 3GRWA 2XPGB 1F02I 1I9IL 4UV7L 1P6AB 3V4PH 5CZVH 4MXQD 1FG2A 4IOFD 2ZOKB 4Z78A 4YPGB 4WHDA 1U8PA 1HK6A 3EO1A 8FABA 4JGUA 3C9NB 2ICCA 5CEYA 3QHFL 3F65A 5T1DL 2Z35B 3KYNA 4JHWH 1UADC 3SDXE 5ADPH 2OSLB 5ID0B 1G1YA 3CC5A 2A6IB 1NAMA 3BP7A 3GJEA 5CWSA 4RAHA 5IG7A 2F9BT 1U8MB 4LGRB 5T1MB 3PHOA 4U6HA 5DHVB 2XXCB 5EUKB 1R3LB 5E0QA 5C2UB 1EZVY 1AQDB 1BAFH 1P9MC 3BPOB 4YX2H 4OGAC 1FC2D 1CFSA 2AABH 2SEBA 3M1BB 1MRDH 1NC4B 1FYTE 1FH5H 2NX5B 4R96B 5CJOL 3ARDA 5J12C 3VXMA 4LKCB 4I77L 4MWFB 3P73B 4L1HA 1AXSA 4MJIB 2PCPB 1HQ4B 3ECBB 4NPYB 3VFTB 3I75A 4F15C 2W60B 12E8L 4P57B 4BH7B 1NKRA 1N2RA 4OZFB 1M7XA 5MENA 2E9JA 4LPUA 3TWCL 2X70A 3TZVA 3QDJE 5A1AA 4FXGA 1AFVL 2P5EB 3EGSB 3VFWB 4Z95H 1CS6A 4ZOAA 4UT7L 3G08B 1SJVA 1FNAA 2P5WA 3BJLA 2IH1A 2D3VA 4N8VG 1HIMH 2L4OA 2X1PA 5AYUH 3EYQC 2P4AB 5EU7E 3UJIL 2AQ3A 4GXVL 2V2TB 35C8H 5GRVL 1HWGB 3T65B 2MHAB 4NC0B 4YXLL 5MI0C 3D39A 1PX3A 4GG6F 3VD3A 2J4WL 4ALAH 3Q3GB 3WCYA 1FNSH 1EO8L 2CO6B 3L5XL 5GISH 3V7AE 4XZUB 4D8PA 2FX9L 3L5IA 1Q9KA 5E70A 1IFHH 4Y5VC 4RGOL 3SPVB 4RQQA 4PUBL 1GGIH 3H3PL 3G04B 4QRUB 2EDOA 4NSKB 3O3DA 4OFPA 5INCB 3LS4L 4HIJB 1KTLA 2AK4A 3MCKA 1U8OA 1CG9A 3IFNH 3FT4B 1CTNA 4MA8H 5HYIA 1W72H 3ZTJH 4Y88A 3O4LD 2H2PC 3BEWA 4MB4A 3LIZL 4RZCB 4M1DL 4NN6B 2A9NL 5DSCA 5HPMA 5GJTH 3SGEH 2Y6SD 5L7XL 4UIKH 3PP3K 4NO5A 1UVQB 2APBA 1AIFA 3IDMA 4MXQC 4IOFC 4KFZC 1MCPL 2CIKB 1YC8A 2XICA 3HB3D 5KVMC 4BFBD 2WIIA 3TA3C 5DTFB 4CJ0A 4PRBA 4YHOH 1R3JB 2WUCL 2UZIH 4Y4KD 1W0VA 4Z7WA 3FRPG 1FLRH 4KHXL 5TE6L 1MCOH 1J9CT 3QIBC 5SWSB 5I18H 3TF7C 1BD2D 4W4OA 4LFHD 5ERWB 3CDCA 4GOSA 4JEGB 5IHUL 5T33H 4GAJH 5DD1H 5EC1B 3S9DB 4TUJB 3TIEA 2RHEA 4ZOEA 2O5ZH 3V4VL 4AY0A 1MNUH 1L6XA 2PR4L 3C5SB 4YBHA 5DVNA 4Z7UB 5CHNA 2Z8SA 3OAUH 4RISH 3RWEB 4DZBB 3LY6A 3T4AB 3DX8B 4KJQD 4WEBL 2FO4A 1FJ1A 1T2QL 3DETD 1M7DA 3WHE0 5I19H 3U4BL 1WVZA 3ETBF 4MDIB 2FGWH 4TSAH 4NWTH 2WUBH 3LEVH 1GYAA 3MXWL 4V1DB 3LN5A 4LSUL 1GZPA 3ZE2E 4RFEA 2R69H 4OIAA 4FFWD 3LB6D 3SKNB 4EI5D 5BVJB 1I7UB 5IF0B 2VR5A 4I3GA 5EPMA 3SQOH 3KPRD 2E6PA 4HSQA 2PYFB 3VFPA 2DJUA 3BKMH 1TVDA 4QRRE 3QQ4B 3RHWF 3BIAX 1G0YR 2CRZA 5CINL 4XMPL 1TZHB 5JHLL 1TIUA 2GFBA 1JWSA 3C5ZA 2NY2D 4X9HA 4P9ML 4KI1A 1YDPA 1T1YB 3DIFB 1MHPL 5GRUH 4LK4A 1X4ZA 1VA9A 5EU4B 3VXUA 4NJ9L 1A21A 2D4DA 3G5YB 3SDYH 1JWUA 1I1FB 5JXAH 1OCWL 5DA4A 1RD6A 3ZSSA 5D7IA 2BVQA 3U36B 1HQRB 2ORBL 1WLHA 1U93B 5HYSA 2G5BA 4HKZA 4DN3H 1MFCL 5DJ8B 5CEZH 5IB4B 2EDLA 4UDUA 1N4XL 5DRWB 2VMFA 4UT6L 5I1DA 1JGUH 4ZUTA 1PEWA 5FM5M 3WFDL 3D25A 5LAXA 3F58H 3AC0A 3SGEI 4H0IA 3WO3B 4HCRA 1UJ3A 4XPHH 1YMMA 4R97C 5C0AE 1JGEB 1OAZL 2FO1A 3HNVH 1HYSC 5E7FA 3ARBD 4R26H 3QXDB 1VFBB 3HB3C 3QXUA 1VGKA 5BCAA 5FYLL 4JZNA 1EJOL 3RP1A 3FT3A 1RIHL 1RMFL 1Q0XL 2HVJB 4JPKH 5CIPA 3V0WL 4Y4KC 4DGVL 5CLTA 3IETA 1DLFH 4OGYH 4MXWL 1V8HA 4OKVA 2FHBA 3TJHD 5TH2A 4JLRA 2QADD 4KTEH 5F44A 5SV4A 4ODXA 3HMXL 1VPOH 2R23B 1LEKB 1H5BC 4NO0B 1ZKAA 5FAAA 3T77A 2DQGH 1KTKE 3UTSA 3C8KA 1U3ZA 4XC3L 4M03A 1UM6L 4LCCC 5KSAC 5EORH 1S7UA 1TPXB 2CJUH 2WWMD 1VKXB 1LQSR 1KIPA 3MRMA 4Q6YA 3ZTNL 3SDAA 2C3WA 2Z8VC 1WBXB 4XVSH 4Q9QH 5E6IB 5D7SL 3O6LH 4PP1D 4XWOC 4FFWC 3LB6C 5DMKA 1A7RH 2HKFH 4EI5C 2J8HA 2PYEE 2VQ1A 1U8PB 1XR8A 4Q0XL 1S7TB 3JVGC 1ADQL 8FABB 3VXSD 5GGRA 5CEYB 2DQCH 3IDJB 3TJEH 5H35A 1R0AL 3P9WB 3S4SA 3KYNB 3F6IA 4KAQH 1OAXL 3GMQA 4WCYL 3CC5B 4GRLB 5CWSB 1NAMB 1FCGA 2NY2C 4LAQH 1LEIA 4A6YA 5IQ9A 3PWPD 3HE7B 3HNSL 3BX7C 2DLTA 2AVGA 4HC1H 2Q8BH 5ADOL 2APVA 5HPOA 1CFSB 3RKPA 3TYGL 4H5SA 3CFDA 1T22A 3V5DA 1A3LL 3MLRH 3VXMB 5DHVH 4XVJH 2G2RB 2K7QA 4G8FB 4ZNCD 3HC0B 1UH3A 4PJIE 1DVFD 5BS0A 1RULL 4RMRA 1VFUA 2XRAL 5E8PA 3KYOA 3HE6B 3H3BC 4KGLA 2X70B 4QCIA 3TZVB 1MJUH 4A2LA 4F37K 1F00I 2AJYL 3GHEL 3ORJA 3SBWC 4FXGB 1Y6KR 1TZIA 4HS8L 3P9MB 1X3DA 4LLQA 1H3PL 2IH1B 4OF6A 3HR6A 4OZFH 4MVBD 3ARBC 4EZMA 1JFQH 4QOKE 2VLKB 3O6MH 1MSPA 1VFAA 3QQ9C 3GFUA 3HFMH 5LWYH 2PO6B 4JPVH 4UDTA 4WWID 3V6FA 2B1HH 3D39B 4WTXA 1NAKL 5C08A 3V7MA 3R8QA 5KAQF 2K1MA 4D8PB 1FZMB 1Q9KB 3QEQD 4HLZH 5E99H 1FP5A 4WEMB 1DANU 3H9SE 3NH7L 3OAYK 3I3DA 3BO8A 3HLAA 1BJ8A 5EIQA 2JK5A 1EV2E 1WBYA 1KTLB 1Q0YH 3TH4T 1CG9B 4OCSL 2WWMC 4OUOA 3C60D 3KPSD 2E7CA 4AL8H 1NGPH 5D2NC 1A7QH 1G9MC 1A5FL 2VKXA 1H3TA 5HPMB 4KY1H 1BBJB 1AGFA 2WNGA 4FG6D 4NO5B 4ZSOE 5HGHA 1C5DA 1AIFB 1RZ7H 3BESR 5JW4Q 5GRZA 3CDYA 3I6KA 3PABA 2WIIB 3O11A 4B7LA 4PRBB 1PYWA 3PHQA 4G5ZH 4OD1H 4IRJD 3VXRE 3U6RA 2UVEA 2VDNH 5HHQA 5EWIL 4WI9A 2CKBH 1J1OH 5CAYB 2X4SA 4NUGH 4FTVD 1TQBB 1FFRA 3PL6D 1IC7H 3P4MA 1DP0A 4TULH 1G1CA 1DLHA 1GSMA 3DHJA 5HGDA 5LG1A 3TIEB 1YEEL 5KS9E 4OI8A 4U1GB 4DAGL 3U79A 1MOEA 4G6ML 5C0GA 2V17L 4G8IB 2GT9B 3B43A 3IFLH 2B1AL 2FZ3A 3ZLQC 1PZ5A 1CD1B 5KS9F 2FO4B 1FJ1B 4LF3A 4HBCL 3MRIA 3D85D 4NN7B 1DVFC 1OF2A 5DJ2B 3WFBH 4JHAH 2EDEA 2A83B 2AI0L 1KJ2L 1QNZH 3DPBA 4KZDH 1GZPB 3OWEA 1V05A 4RFEB 4G7YL 3P77A 5EZJB 5B38G 2DBLL 2BDNH 2CMRH 1INQA 4OM1H 5EPMB 4B50A 4TN9A 3LZFH 3FQXA 3VFPB 4P23B 2W0FA 1VEMA 4MVBC 5CP7A 4KXZH 5EBLB 2GFBB 2HA1A 2QSCL 5CSZA 4AIXA 1XCQB 2BVEA 1YDPB 2VDLH 3UEZA 1KPRA 4LLUA 3M17A 2WW8A 4O02H 4C56B 3Q1SL 2J8UE 3IDIA 5CBEB 1RVFH 1E4WH 4Y4FA 3VXUB 3VI4F 4JRXB 1MQKL 3O2WH 1JWUB 1T20A 3QA3B 1GGTA 1RUQL 4OLZH 1SQ2N 4YK4B 4PRHD 3TV3H 5CGMA 2BVQB 1VENA 4LLVA 2X4TB 3A6CL 4YUEH 5C9KA 3MV9E 3IDXL 1AC6A 2YRZA 3BI9X 4XI5D 2EIZA 3E2HC 3NAAH 2G5BB 4HKZB 1GIGL 1GGCH 2J8UF 1QSZA 2XIDA 1L0XA 1RZKH 3QIUD 3NCCB 4WFEE 3C60C 4UDUB 5FYKH 5C3TA 5DF0A 5I1DB 3FQRA 1TENA 4Y19D 4ZUTB 1IGFH 1NBYA 3D25B 1UM4L 1OLZA 2GAZA 4OTXL 3QDJD 4KKCD 4GG6A 1UJ3B 2ARJA 4JQXC 3INUH 2MKWA 4FG6C 3SY0A 4UQ2B 5C0JA 5DK0A 5F97E 3T0VA 4G6FB 3ESVF 4DKEL 4E41D 4Z7QE 1ZHNB 1R3IL 3N1GC 3PV6B 4L29A 1RPQA 3K2UH 2ZUQC 1NCWL 2NY5C 4L3ED 4JZNB 2IFFH 3IXTB 3RWHB 2FEEL 1XF5A 4UB0L 5DFVD 1HH6A 4IRJC 2HVKB 4HEME 4HIXL 4O2FB 3IETB 4FQHB 1OAQH 5GGVY 5DQJB 4Y4HA 2AV1B 4OM0H 4GG8B 4QHUA 4YGVB 4P59L 5GSVA 3DI3B 5HY9A 4Z7QF 4DOHE 2DJSA 3NGBC 1A3RL 1BZ7A 4LARL 1F58L 4WI2A 4G42B 3T77B 3MRHB 4QXUL 3C8KB 3RJDA 4AMKL 2X42A 2NW2A 4HWBH 3I6GA 2VXUL 1DSFH 5DI8B 3CIQA 2BFVH 4BM7A 3QIWA 3AUVA 1KIPB 2EIDA 3MRMB 5JIHA 2ERJC 4PJAB 4GS7C 1G7PA 2OM5A 1YN7A 2CPCA 1UA6H 4PJCF 4R7DA 4LCUB 3SCMA 2W9LA 2OLDA 4HWZB 4N0CD 5DGQA 3EJYD 3SKOA 4LLMA 3AB0C 5DMKB 3BE1L 2XZCL 1B88A 2XN9E 3V52L 2VQ1B 4JPIA 4JFEE 4MAUH 5TPWL 1KFAL 3FB8A 4HUWA 3MNWA 1DN0B 3H7BA 3UYRL 1OGAD 4KXZI 2ITCA 3GRWH 2OK0L 1ZHLB 2IAMD 3NPSC 4L8SB 3D2UD 3GMQB 3PP4H 3FMGL 1KENH 3IRPX 4DK6A 3MUY1 1KTDA 4A6YB 5IQ9B 4NQCE 1HI6B 2AEQL 2F74A 4JVUA 4Y2DA 2QSVA 1LEGA 1A6VH 4PGBB 2PNDA 1AD9A 4Z76B 2M26A 5T3ZD 4H5SB 1N0LA 3CFDB 1GAFH 3HMXA 3MLPA 1NAMH 5BRZB 4NRXA 1T22B 3V5DB 3LPGA 1BF8A 5MP6L 3OKNB 3RVVD 3ROLA 3QHZL 5FHBH 4IDLA 3MLYL 4MNQE 3V9FA 4PS4L 2ICWJ 4XXCC 5BS0B 1ZHKB 4K7PX 1A4JA 1RZJC 2IMNA 3RL2B 4F7TA 2YMXL 4MAYA 5EU6D 4U1MB 4XMLL 4QCIB 3GMPA 3QG7L 2X2YA 4KKCC 1R6VA 1IKFL 4G9DA 3VI3E 3VRJB 3NTCL 3LD8B 3T3PF 2DQIL 2XACC 3MBXL 5C92A 5KSBF 2XG5A 5DWUL 4ORZC 4RGNE 3AAZA 4PJEF 1ONQA 1YMHB 2NZIA 1A4KA 5DFVC 4LEXL 3BUYA 1ADQA 1L4IA 4UDTB 1U8NA 1VGEH 3V6FB 5ICZA 1MCIA 5C0ND 4JQIH 1DBBH 5C08B 1GH7A 4HKXA 4O9HL 1I1AD 3WEXA 4ZTOL 4XP6H 5IGXL 3CZFB 3GO1L 3LN4A 2FB4L 4MXVE 1YNLL 3BO8B 5FKPA 3QO1A 3SDCD 4YDLB 1NUGA 3DBXA 8CGTA 3HLAB 2D03H 4YFLI 4S1SH 4PLKD 4L4VD 1J8HA 1WBYB 2V5TA 3GB7A 3TYFA 3KLDA 4YAQA 1MHCA 1UH4A 2A1WH 1Y6MR 1V3MA 4GKZA 3K46A 4P2OA 3O6KL 3RX5A 3PE9A 3U7WL 2OTWB 2GJZA 4N0CC 1AGFB 1OB1A 1B4JL 4J3SA 4JDVB 1C5DB 4XCEB 1J11A 1SY6L 4XGZB 3I6KB 4NO2A 1JPST 3PABB 3O11B 1C5CL 2D7TH 3PHQB 3U6RB 2MSPA 2VXVL 4M4PA 3SJVE 5HHQB 5JUEL 1MJ7H 5E6ZA 4P46D 1JYNA 1T4KA 1GRWA 4YEEA 3DJ9A 2IAMC 3DGGB 4FQQB 5JW5B 2X4SB 4F80A 5C6WH 1JMZA 1QRNB 3VMOA 1NEZB 3GKZA 4HT1H 1AO7E 5CP3A 2XQYK 3P4MB 4Y16C 4YJZL 2HN7A 3EFFA