3HNSH

Cs-35 fab complex with oligoarabinofuranosyl hexasaccharide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGTVLARPGTSVKMSCKASGYSFTNYWMHWVKQRPGQGLEWIGSIYPGNSDTNYKQKFKGKAKLTAVTSASTAYMEVNSLTNEDSAVYYCTRFGNYVPFAYWGQGTLVTVSAATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsH02
1U8MB 5JW4Q 1TVDA 3F65A 4OLWL 2J6EH 2H3NB 3KS0H 5K9JH 1G6RL 3U48A 1I8KB 4WHYH 4NRXB 3WDJA 4JANA 2FH8A 5IKCA 4NO0A 3QDGA 1FLTX 2AQ2A 3JBG7 5T1KD 3FAWA 3VJ6A 1R5VB 5ICZA 1Z9SA 3INUH 3C5ZD 4GS7C 5GPRA 1U8KA 3WV0A 4PJAA 3T0EC 5DURB 4NZDA 4XNUL 3LSOA 2H8PB 4AEIL 4QGTA 4WO4D 2EC9T 4MJ4A 1CD1A 2EIBA 5D5MB 2XTJB 2NX5A 1CBVL 3WFEL 4JM2C 4U6YB 4YHZL 3NIGF 4LEOB 3DX6A 2VXTL 4ISVB 3D0LA 3MJ9H 2HJLB 3SDXB 5D7JB 1FGVH 3HI6L 1UH2A 5F8RC 4R7DA 3ROLB 3VGGA 3QB7C 2XZCL 1H3PL 2NYYC 4DQOH 1V7NH 4DUWA 2NY1B 1IQDB 2ZCLH 3B43A 5D70H 4U2ZA 1RHHB 1W72H 4HZLA 4W81A 1J88A 1JRHH 5DZNA 2EKSA 1ZT4A 3T08A 3V6FA 2E7BA 5E08L 3ARGA 4MLSA 5D7KD 7CGTA 5D2LE 4JR9H 5HHVL 4LLVA 4FN0A 5DI8A 4NZUL 1R0AH 5MEPA 1PAMA 5TF1H 2R1XA 1O0VA 3O6ML 2VQ1B 3VFVA 4KHTL 3ARSA 1T80A 5FECA 1T4KA 3KLAA 2OK0L 1BD2B 1HHKB 2K3TA 5J9PA 3WFCL 2YEZB 1A3RH 2EC9U 3RPIB 2CKBL 4GKNB 5GS3A 2Y23A 4WFFE 5I74C 3I6KA 1JYWA 4FNLL 2BVUA 4YQXL 5JDSB 3TZVC 3PF2A 5E5UB 4DCQA 5F70A 5L2KB 1LMKA 3ZKXC 4NZRH 2VIRB 4PJ8B 2X4NB 3QJFB 4POYA 4XX1E 2CXKA 3GO1L 3RX8A 4HKZB 5GZND 3ABZA 2QSCH 1Z6JT 1IT9L 2HFFA 2B8OT 2BHYA 4DZBB 1WAAE 3MROB 1YEIH 2RCSH 2Q86A 3PWUB 4XRCB 5FHAH 3RKDC 3LKPB 1AC6A 3IFOB 1A7RL 3AVEA 4ZFGH 4U1GB 1XCTB 2JTDA 3TN0B 4OLYL 4YIQB 1G0DA 2R56H 3VFMB 1CICA 4GW4B 4JO1H 4XPBH 1ZS8A 2VDPH 2JB5L 1KJ2L 2HRPL 3E3QE 3QG7H 2DI9A 4M5ZH 5LAXB 1NSNH 3PJSA 5K9KB 1DBML 1RUKL 4PJEA 1MCPH 2W60A 1T22B 3GJFH 5IB5A 1FNEB 1TNNA 5D7IB 4OT1H 3P73B 2BNQD 4UAOC 4EQ2A 1QYGL 2XXCB 5DRZB 3MV8B 3FB6A 3U4AA 3PGDA 3HNTL 4KROB 1HINH 1EGJH 2A74A 1TQBB 4YHNA 3MOQA 4PRHD 3Q5YA 3QEQE 5DWUH 4PRIB 3NCBB 1E4XL 2UZYB 1OCWL 1KEML 1OLLA 2A77H 4M6MH 1PG7X 1LE9B 5D96B 3NVQA 3RWFA 4AIZB 5B4MC 5C0JB 2PTUA 5HYFA 1FYTA 5L8LB 4NCC1 1CFNA 2WUCH 5FO9B 1ZE3C 1DQJA 3D25B 4HXBL 1FIEA 3ZE1E 3QIWC 4YDLC 1EJ6A 2NCMA 5JW3L 4JAMA 4BQ9A 5DLMH 2VLRE 3NABL 1QG3A 3OKDB 4MDJA 4XBEH 3QT2A 1E4KC 1VGKB 4ZUUA 4BH8A 2OSLA 1HOCB 4OZHF 5C09D 4QY8A 3SGEI 5JPNB 1A3LH 2PYEA 1MHHB 4PJHB 2AK4D 4HS8L 4Z7VE 1DE4B 1AXTH 1DVFC 3UBXB 3ARVA 4PP1C 3V6OC 1RJLA 2HYMA 1N2RA 1P9MC 1OAUL 4HBQA 4OZFA 4HD9A 4M7ZC 15C8H 2YZ1A 3EJYD 2V2XB 2KQMA 1EEYA 4PJ7A 4U6XB 2W9LA 4L8DA 3R8QA 2BDNL 4ZS6C 2R39A 4PJCE 3P4NA 4LVHC 3ISWA 4EDWH 1KCVL 1YEHH 3B4NA 1OP5H 3VXQA 4H25B 5JZ7C 5I75C 4WFHD 2JK5A 5IHLB 1V3LA 3TO4A 1NFKA 1PY4A 1T5WB 1FORL 2BY1A 2J8HA 1UZ6E 5HHPB 4ZOAA 4NFCA 3HN3A 4FABH 3BH9A 4JFDD 5E8DL 4M1GL 2BSRA 3EOTL 1F2QA 3WJLC 4PRBA 1GGIL 1A4JA 5FGRA 4KKCC 5I1IH 3HMWH 4I3RH 1IBGL 1E27A 5GGQL 3MRLB 4M7LL 4TNVF 1BWWA 3ARZA 4XMLH 4ELMA 3T0DA 2Y36L 4WI5A 4QRSA 5HYSA 4F7MB 1SYSB 3CPLA 4JFEB 4N0UE 4U3HA 3V6BR 2OXGA 4PG2A 4LRNL 3QUXD 1CQYA 2R4RL 3FQXA 5F7LB 1RZJH 2A6JA 5I1LB 4RBPH 2CRMA 4NJAL 3X3GH 5JLZA 2D31A 1QBAA 2UWEB 1A7PL 2VLKD 1AR2A 1XF5A 3Q5TA 3FFCB 4YFEA 3K46A 3B9KA 5F7EL 4OM0H 5I8KL 3W9DA 2BJML 3CZJA 4PJXF 3NCEB 5IMKB 3RUGE 1CLZL 1I1AA 4JDVA 4TNWF 1HWHB 4YFLF 5A2FA 1QFHA 3WO4B 3CUPB 1HKFA 3O3DA 4L4TA 3QFJB 5DD1L 4XMKL 4PTUA 2O5XL 3HUJA 3CFBA 4KTEL 3KDMA 1GVIA 3GKWH 3H3PH 2F53B 2V7NA 3CLFH 1CGUA 4OCWL 1FNAA 4CL7A 4RFNB 3OJVC 4W68A 2Z31B 35C8H 3QUZB 5I16B 2G60H 3OJ2C 1J10A 1JWSB 5E1AA 1MEXH 4J7RA 1D5BA 4KUZH 1YEDB 4Q6YA 4QLRA 4LPVA 2EIEA 2EC8A 4MA8H 1FRGH 4LEXL 3THMH 3DBXB 2A9MH 5A43C 1T7VA 5EZLB 4WI2A 5SX5K 5B22A 3DHMA 4H0HB 1FZOA 4X4XB 5ADOH 4LBEB 3QCTL 3GSUB 4KFZC 3C60D 2VTFA 1KTDB 1GGBL 2JCCF 4GRWE 1IC5H 5T3XL 3ZE2E 1AQKL 2NY0B 3OAUH 2P24B 1FZJB 4XXCC 3IU4H 1QZ1A 1I8KA 3NIFF 3C08L 3RBGA 4NP4L 2W91A 4YAQA 4WU5B 5DUML 1IE5A 2AJYH 2P8LB 4K55A 4NIKB 4ZFFB 2PYFA 5D72L 5AG8A 1RZKH 1N5AB 5JNYA 1R5VA 5J12C 3RRQA 3CFDA 3MLUL 3P9LB 1MJJB 3S37X 5IVZA 1RURL 2BNUB 1OTUD 4JO2L 4R2GC 3RIFF 2VWEE 1DQQB 4L3EB 1EUTA 4WWID 5D5MA 2IAND 4UV4L 5AWNH 4P4RB 1T7ZA 1NL0L 4I3SH 1LO4L 4LEOA 3V5HA 3WS6A 1TLKA 1JHTA 2DM2A 2XICA 2X09A 2EYSB 5DJZB 1S7WB 1CG9B 1S8DA 2HJLA 3SDXA 3T8XB 4JFXB 5FYJH 3UJJL 5IB2A 1G9MH 1I7TA 3TFKC 5IG7A 2MJWA 1NANI 4GO6B 4HFUL 4X6CF 3LQMA 1IQDA 1I3RA 3T0ED 5ISZB 4G8GB 1OARH 5IB4B 5FDWB 2EDTA 5GS0H 4V1DD 3IT8D 4M48L 5IJVB 4JM2D 3FCTB 5D7KE 5EZJB 5T3ZL 2VZVA 3MNVB 4KK5C 2IQ9H 3IDYB 4JFZL 3MMEB 3LD8B 4P3DA 1BFVH 5I73C 4LARH 2R2HB 2EO9A 4AEEA 3MODL 5EZOL 5D8JH 5HGGS 2ITCB 2NYYD 1BD2A 1C12B 3HPJA 4LNVA 1HHKA 3QQ9D 1PLGL 4MJ5A 4P2OC 2AI0H 2CRIA 4YXHL 4B53A 1LGVA 2PO6B 5IWLA 3RPIA 4GKNA 1HK6A 3IRZA 2F58H 3CDFA 3B2VH 3NTCL 3GHEL 1AI1H 2L7JA 3U0TB 5L2KA 1JL8A 3FT3B 3QJFA 3UO1L 5EUKB 3ZKMD 1FIGH 2Z8WC 2VLLA 1GH7A 3QWRD 4HKZA 1AHWC 4Z77B 5K59E 5AZ2L 4CDGC 5JXEA 3LKOA 4LLMB 4DZBA 5AZEH 3MROA 1SJEB 4Y8AA 3PWUA 1UEYA 5DVNA 3BPCB 3LKPA 3IFOA 5BS0D 3BQUC 5C8JB 4G9FB 1XCTA 3VFOA 3DUHA 4YIQA 4KJPC 4G80B 1MQKL 5TDNB 1H3VA 1F02I 3SBWC 1YEKH 1QO3A 2IPKA 3CMOH 3IFLH 5LAXA 4YHYC 4H1LG 2ZUTA 5K9KA 3KPQB 4NWTL 3GDBA 3OGCB 4CJ0A 1CE6B 4FQHB 3U9UB 4RCAA 4F37K 5D7IA 5MP6H 3P73A 1ZHBB 2OR9L 3KPNB 4ONFL 2BNQE 2EDWA 4LCUB 4HWZB 3RA7H 3RKDD 3MV8A 4RA3A 5HI4C 3SE3A 4OF7A 3CFIC 5CILL 3QEGH 4I9WD 2I5YL 2VXQL 5I9QB 3NBNA 1LE5B 1CGVA 3OKKB 5F6HI 4PRIA 4PRHE 1DQTA 5FUZH 5F7WC 3VFRB 2GUOB 1VPOH 4PJGE 1UWXH 2VKXA 3VRLF 1LE9A 2DLFH 3BDXA 3BOVA 4HPOH 5D6DC 4AIZA 1AD9A 1FPTH 1WIOA 1KTKE 1QLRB 3UDWA 3G6AA 1AGDB 4BSVB 1BQLH 4Z7UE 3D25A 4M9PA 2XXMB 3SE8H 4GBXC 1C5CL 1N4XH 5IQ7L 4HLZG 3SDDB 1TTUA 2Q6WB 3MRIB 5FOJA 2NXZB 1BLNB 3UJTL 1VGKA 1JV5B 3HZMA 5JPNA 4N0FA 4PJHA 3RL1B 5C09E 1ED3A 4P9MH 4PREB 3ZHLA 3TF7C 3DRQB 3UBXA 3F7RA 2AK4E 4JQVC 1AC0A 5B4MD 5TFSL 3GMQB 2DTMH 3MXWH 3UTQA 3CSPA 4QHLB 5D2NA 3QDMB 1X6NA 2HLAB 2DIBA 4U6XA 1LEIA 4S1SH 4OCXL 3QIWD 3G6DH 3G04B 2C7UB 1CK0L 1S7RA 4RWYL 3TH3T 2L4OA 1B0RA 3PHOB 4JO3L 4YXKH 3B9AA 4KZDL 4KKLC 4J1UB 4WFHE 1JF5A 4HUMB 1EHXA 5HHPA 2PCPA 3PIQB 3P40A 1L0XA 1DVFD 5E8EB 3HNSL 1Q94B 3IF1B 5DD0L 2VQUA 4PP1D 1UJ3C 5B3JF 4JFDE 1T2JA 1YECH 3K7UA 5IQ9B 3MRLA 4MGXA 4P2QB 2X9XA 2HFTA 3HFML 5EBWB 4LSTL 4TUJB 4O02H 5E2TH 2WBWB 1RZ8A 1SYSA 3REVB 4F7MA 5J0BA 4JFEA 4UT9L 4M5YL 1G7HB 2YA2A 2GTZA 3O3BB 5JZ7D 3V95A 2X42A 4ZTOH 4YGVB 2BVQB 3LEVH 4G7YH 1UVQB 2UWEA 5AYUH 2VLKE 4Y0GA 1FFOB 1YQVH 4MQTB 4S1QL 5FO7B 4XVJL 1HHJB 3VE0B 2XKSA 2IBGA 4CVWA 3EJJX 4P2CG 3CUPA 3RVVC 1TVBB 4OLXH 3ILQC 3ZYZA 5TQ2L 2J2ZA 4KKCD 3QFJA 1HHHB 3NACL 1J5OL 3JUZA 4F7CA 3O6LL 2VXVL 1U8PA 1QR4A 2DWEB 5ITBH 3SKMB 3LKRA 5B38A 5IW1A 1DDHB 4Y19D 4DOHE 3S36X 3MNWB 2CDEB 2VH5L 4JRYB 2Z31A 3QUZA 4WHYG 5I16A 4QCIB 2ZNXA 1JWSA 3CXDH 4PJ5D 1N0XL 4EEEA 4PS4H 3CLEL 5F93C 1BBDH 3HI5L 4QWWD 1JTOA 2ZKHH 5EZLA 3IGAA 2IBZY 3MPCA 4UT7L 3SDYH 1QRNB 4ODVH 3QXUA 5EBLA 3RZCA 4LBEA 1MJUH 3GSUA 4YE4H 1H3WM 1QSED 1J0ZA 5IVXF 5LXGL 2X7LB 1QEWA 1OP3K 2D7QA 4R4NC 3QQ3B 3QCUH 1S7QA 4LKXB 5JPMA 4UILH 3MLRH 1IEBA 4HS3A 5LCVH 5L8JB 1V3KA 4HT1L 5IB1B 4WU5A 1QSFD 2CLVA 4ZFFA 1F4YH 5T3XD 5CGTA 5I1HL 1WBXB 3MLTB 4BZ1L 5DJYB 4HSQA 4OZGB 1J8KA 5FGSA 3T3MF 3I3EA 3IDUA 3G5YA 3P9LA 3F6IA 1SEQL 5DO2C 3WFDL 1NBZB 1YUHB 3L95B 3NAAL 2BNUA 3MJ8B 4EDXB 2OXHA 1MRDH 3VH8A 1BX2B 1DQQA 4PIRF 5GIRB 2XWTB 4P4RA 4PJ7F 4IS6A 2IANE 3VU2A 5HBBA 1AE6L 2O5YL 2YMXH 1MCFA 5ID1A 4NKMB 3RGVA 1S7WA 1CG9A 3OJMB 4H20H 3T8XA 4PGBB 4JFXA 2OL3A 1YNKL 4OF8A 4JB9L 1U58B 1F3RB 5IR1B 4KAQL 1B88A 4XCCH 1NGWB 2VDRL 3RDTD 1QBMH 5ISZA 1X4YA 4HIIB 1C16B 2J88L 2VL4A 4KI1A 3T0EE 3S9DB 2FJGA 2AJZB 4M00A 3ZLQC 43CAA 4MX7B 2APBA 2VR9A 4R2GD 4OLUH 4Q0XH 1ZLSL 3LDBC 4KI5C 4LGRB 3SGEH 3HC3H 5F3HB 2DLHA 3LZFL 3NN8A 4OF6A 5EZJA 5JOPD 3MNVA 3BEVB 3MBEB 3MMEA 2YPKA 3M1BB 4YDJB 1K4CB 1OP9A 3GSXA 5EUOE 3I50L 3HLAB 5FV1L 2D7TL 4WI7A 5KSBE 3MV11 3TFKD 5DEGB 1XFPA 1XEDA 5T3ZD 1CLYH 5I1CH 4QTIH 5BVPL 5GGRB 3TO4C 1RVFH 3TWCL 5IVOA 1EBPA 3ROOA 4G6KH 4ZO6A 6FABL 3HHRB 4QRQB 3H9SB 4YC2C 2QQKL 3U0TA 1JI2A 5JIHA 5DR5L 3U30C 2ATKA 5MEOB 2H45A 3D9AH 4OQTA 5EUKA 3CIQA 4QRTA 4XPAH 3RNQA 4LSRH 4KK5D 3KPRD 3TA3C 1T03L 3MRHB 4Y5YA 1WTLA 4LLMA 5GJSL 1F4XL 3UXFA 3EDEA 3CK0H 2B1AL 3NIGE 4G9FA 1EEUA 4PG2C 4Q2ZB 5DC9B 5ESQA 1N6QL 5BS0E 5KG9A 5TDNA 1NUDA 2KDGA 4HK0B 1LP9B 3MBXL 4PY7B 4GKZB 3LEYL 5GHWL 3T0WA 2DBLL 1D9KB 3NZHH 5F89B 3V9FA 3P0GB 3KPQA 3QHZL 5FCUL 3RWEB 3BN3B 3PGFL 3U9UA 5I76B 1J8HA 3QZWB 1YA5A 3TM6A 4DGYL 1BAFH 4XAWH 4X98B 1B4RA 2YPLA 3C5JA 4LAQH 5TE7L 4J8RB 4MXWH 3U83A 3MGOB 4B5EA 4LCUA 1P7QA 2ZSWB 3G5ZB 3RVXC 4JJHA 5KVMC 1JIBA 2ZUUA 2Z0BA 2NY4C 5JXAL 1B90A 1BMGA 1QLEL 4I9WE 4R8WH 4EOWH 5GS1B 4YZFF 2GUOA 1S9VB 5BV7H 1FFPB 2FEEL 1MFNA 4P2RD 1MPAH 4JHBA 4XNYL 3DXAD 1A4KB 5D5MF 1EHAA 5DJCA 4ESKA 1BWMA 2ZJSL 2KZ1B 2QQNH 4BSVA 3E8UH 4MXQC 2AXJA 4QNPE 1YEEL 3ZHKA 3EOBA 5F6HJ 2DS4A 4XNMA 1ZLUK 2GKIA 4NPYB 2IMNA 1QFUL 1CGYA 2Q6WA 2H1PH 3EFDH 3SDXF 5F97E 5JR1L 3MRIA 2JIXD 1NKRA 2P8MA 3TP4A 1I3VA 4RMQA 1CVSC 4Q9RL 3RL1A 4PREA 3QNZB 3FO9B 1MFAH 4CW1A 3WO3B 3DRQA 1LK2A 4UIMA 4PJFB 4LHUA 5BW7A 3HMXH 5BMFH 4J6RH 4M4RA 3FHQA 3P9WB 1N7MH 3C6SB 3GMQA 1CXFA 3L1OL 1LDPH 4RX4A 4QHLA 3QDMA 4WUUB 5KVEL 3JUYA 1ZTXH 3SE9L 3G04A 2Z91B 4MA3B 4N0YH 3PWVA 2C7UA 2BCKA 3WDHA 4QOKB 1MIMH 1IGYB 3PWJB 2EE9A 3EDFA 5E2WL 2P4AB 4XBGB 3OF6A 3FRUA 4LQFH 3QDGD 4NO0D 4GAJL 4M6AA 3MFFB 1VFAA 4JKPH 1RI8A 2XRAH 3PIQA 4L4VB 4RDQF 1H9VA 4KRNA 5E8EA 1Q94A 1EVTC 3Q1SL 1DQLL 2FHBA 4OI9A 2ITDB 1NANH 2Q1EA 5IQ9A 1CI5A 3TVMA 5EBWA 2NX5D 5ACZB 4TUJA 4OLEA 2V9QA 3REVA 2QADB 1J87A 1G7HA 4ORGA 5BOPA 3O3BA 4UOW0 1MCEA 3S88L 4YGVA 1UCBL 1R6VA 3DX9A 1UVQA 1GC1H 3O0RL 1SJHA 4GUPA 4KKLD 1DBBL 1NC4B 4IMKA 4WHCA 4I5BA 5GGSY 4RGND 5A3IC 1FO0B 3B5TA 2VZ3A 1UA6L 4NQEB 2OMNA 1CLOL 1HHJA 5EOCL 3U46B 3U6RA 5IWLC 5CBAA 1TVBA 3EO0A 4GQ9L 3IKKA 4CADB 4R0LB 1Q9KA 4HK3N 5D7IF 1QPPA 1D5MB 1GGTA 1R3IL 3ARGD 4BK5A 4X9HA 2DWEA 1RFDL 1A14H 3ELAT 3QI9C 3SKMA 2C3WA 2GJJA 3BGAA 4TRPH 1T20A 5JXEC 4L1DA 3E6HB 4FQLL 4OKVA 1OF2B 5HHXH 4Y19E 4PRAA 4JRYA 3H42H 4HIXH 4QCIA 1JPGB 1NMCB 3HC0B 3P30L 4PJ5E 5E8OB 5CIPB 1EK3A 4R97B 4UQ3B 4MD4B 1T83A 3KXFB 5DUPL 4NJ9L 1AXIB 3RVVD 4HW6A 3BYTA 1QRNA 3ILQD 3U2SA 1EO5A 5BOZG 1MCWW 5ANMB 2UYLB 1DL7H 1Z3GH 3L3IB 5HDOA 3E2HB 2X7LA 1R3KB 1QSEE 2X9YA 4XVTH 4XPFL 3QQ3A 3OB0H 4PJ9B 5CZXC 4D9LH 2V5SA 3KJ4C 5C71A 1CF8L 3SPVA 1GJIA 4GSDL 3BUYB 4ZAKC 3WNLA 1NCNA 1Q1JH 4HZAA 1IC4L 4LHJB 4F3FB 2DQCH 5ILTH 2VDOL 4WV1B 1WBXA 3MLTA 2DF3A 1QSFE 4MCZA 4OZGA 5T3XE 4P3CL 4PJHF 4GKOA 3T1FB 1CICD 1NBZA 1YUHA 1BREA 3QUKA 4FFVD 1A5FH 2YUVA 3EO9H 5J4MA 3TESA 5GIRA 4PR5B 3L7EB 4R4ND 2DQEH 3ORJA 3UDWC 3W0WA 4XP4H 2AV1B 5L6YH 4FG6C 4KKNA 1NGXB 4NKMA 1MAKA 1IFHL 4HKBB 4QXWA 5DFTA 1YN6A 1M05B 5HVHC 1JVKA 5IR1A 5HGBB 1YC7A 1TNMA 1NGWA 1OSZB 5FGCB 3UYRL 3V5DA 4U1HB 1FVCB 3JWOL 2AJZA 4AJ0A 4MX7A 3SDAB 5HYIA 1NUNB 4NO5B 1KJVA 4Z6AT 4U33A 3SKOA 1P4BL 1BF2A 3RPKA 3DX8A 1ZAGA 4HULB 4F57L 4X7SL 5F3HA 1FYTD 1ZV5A 2D03L 4I2XE 1NCWL 5C08B 1X5HA 1U8QA 5D2NC 4YDVB 5T33H 3BEVA 3MBEA 5JOPE 1LNUB 3M1BA 1K4CA 4YDJA 2JCCE 4LOUD 1KC5L 2EYTA 5KS9B 2VZ1A 1TJIL 3KWWA 1DN0B 2VOTA 1M7IB 5FYJU 3EYUL 3U36A 2UWEF 5DEGA 2CIKB 3NIFE 3VGFA 3TNNB 5KSAB 5DD6A 4M6OL 2FD6H 5T3ZE 4I13B 1K6QH 1MLCA 3TIDB 2I9LB 2PYED 2MPAL 5L2JA 4K3GA 3N85H 4FQ2H 3H9SA 4DN4H 3I2CL 3QEUB 3VG9B 3QRFM 5MEOA 4KI5D 4UV7H 4PRNA 2YD7A 4POUB 3ULVH 4N8VA 3FN0L 4FS0A 3IRPX 4Y7MA 1A1MB 3RTQB 4JG0H 1RIUH 4Q2ZA 4YDIL 3DLQR 4FZEL 5CEZE 1BGXL 4U3XA 1AGEB 1TXKA 5DVLA 5EORL 1I9IH 3TO4D 1R3JA 1CS6A 3FFDA 4PY7A 1L6ZA 4HWBA 4XPTH 3V2AR 1ZT1A 3EYFA 4M02A 5F89A 5T5NF 1JZ5A 1Q0XL 5HVFB 1WEJL 3FO0L 5I76A 3TT1L 3RQ3A 3QZWA 3X3FL 4TQEL 4JZNB 3F7YA 5DK2B 4N1HB 1D6VL 2P47B 1EJOH 1L9MA 2J5LC 4IIQB 4J8RA 1JF1A 3MGOA 1MCOH 2ZSWA 3G5ZA 5GS2H 3KHQA 2XZAH 5SX4I 1F00I 1R5WA 4ODHL 1MCKA 2O26U 4U6HB 5LGHH 2DL9A 4X6BA 2Z31C 4D3CH 3QNXB 3QUZC 2G2RB 3DMMB 4LASL 4PUBL 2NY6C 4KVCL 5GS1A 3B9KD 3BZDA 2G5BB 3L5HA 1S9VA 2R1YB 2VERN 4YHMH 3NCFB 1I1AD 3GSOB 4R7NB 3K74B 1X5AA 4RQQB 1TETL 1A4KA 4P2RE 2DQJL 3RZCC 4JY4A 4L4TD 2V5YA 4KRPC 4OV6F 3S3SA 2R69L 2HWZH 4H8WH 1HILA 1CD8A 3FL7A 1Q8MA 2Y06H 5I1KL 2B5IC 2VDKH 5DUPH 4HIEB 2XY1A 4WGWB 2AJVL 3RVXD 4CAGA 5JHLL 2E5EA 3P11H 3VG0H 1MVFA 3QXDA 2H26A 4JFPB 4NT6B 3TJHD 3L5JA 2QHLA 3OZ9L 3OKEB 1JMXA 1NAMB 3QNZA 3FO9A 4OTXH 3EYOB 2MCPL 3ZDZF 3MOAH 4PJFA 3CAFA 4YDKL 4I48B 5HVWA 5GS0C 4F58L 3R8BB 3NMEA 4MXQD 1YPZA 3T0BA 3SCMA 4M7KL 4MA3A 3N9GH 3SO5A 1KNOA 2WBJB 4Z7QE 1MHCB 1IGYA 5GGTA 3PWJA 3RGVC 4ZXBB 4NSKB 2LU3A 4WDIA 4PB9H 2HVJB 4IRZH 4XBGA 4UINL 2XZZA 3O6FB 3GSVB 3MFFA 3QDGE 4GXUN 4L4VA 1IZKA 5C0IB 4PJAE 5FYKH 4NO2B 3QEQB 3ZL4L 2ITDA 4PB0H 1HSAA 4BUGA 3VRLE 4AG4L 2OL3L 2XTJD 3PHQB 5DQJB 1QQDA 5ACZA 3JWOH 3SGDH 2HJKA 2WQ8A 4NHCL 2NX5E 3QHFH 5FDYA 4Z0BL 5CD3B 5DYOA 4XPHL 2Q7NA 3GSWB 1BZQK 3LD8C 2YWYA 2XZQH 5CLWA 5C0AA 1BQHG 4LVNB 3JWDH 2MWCA 2R23A 4P3WA 3UTSE 1RJZB 5KVDL 3BPNB 4BELD 5C0DB 2NY1D 4DVBA 4CDHA 2RBLA 4RGNE 1W0YT 1S9YB 4GQPH 4YHOH 4CADA 4MNQA 4PGJA 4R4BB 5CINL 4DGVH 4QYOA 1CZ8L 1FVEB 1XGUA 3CSGA 1HQ4B 2YD8A 4NN5C 4U2YA 5HGAB 5F7DA 3AREB 3X14B 4Y5YC 1OF2A 3QPXH 4M3JA 4HAGA 1C7TA 5HDQL 5E5RB 5IGXL 3VGAB 1EO7A 1FCGA 3UPRA 1AFVH 1JPGA 3HC0A 4PJCB 3I3DA 1BD2D 5A3ID 3RWIB 2X4UB 4OQTL 4WU7B 1IC7L 4JM4H 3UTPD 3KXFA 2D9CA 4NN7C 1TDQA 2QBWA 3WNKA 4MQ7B 2DDQH 4LK4A 1WT5A 4S10A 2UYLA 4X80H 3MCG1 4ODUB 5EORH 5ESVB 1OTSD 5IK3B 5MEQB 5B3JE 4NM4L 3G5VA 1KPVB 1R3KA 2QSQA 1YY9C 1F13A 4OZIA 4MAUH 3CXHK 4O9HL 3IDJB 2EDLA 3VD5A 3WKMH 5JXED 4MCYB 1AJ7L 3QIBB 5DEFB 3WE6B 2VZSA 2X1XR 1W8OA 1Q0YL 4F3FA 5GSRA 3TYFA 2Q7YB 3VXUE 3QWOA 1H3TA 3OAYK 4MXVF 4WWKB 1I8MB 4N0UB 1IKFH 5E1HB 2YD4A 4WRLA 1VDGA 3EYSH 3H7BB 4K3DH 2BXZA 4QXUH 1RUQH 3V52L 1TQCB 4XWOC 1W2KT 5IIEA 5H94B 4GKSA 4KTDH 1KB5H 2EH7L 2X4RA 1NLBH 4PR5A 3RI5K 5I30H 2GSGB 1T66C 4PJEE 4WI8A 5IT2L 1RULH 2QTEA 1INDH 1MFDH 5C0NC 4X6DB 3I84A 4HKBA 3MV8D 2Y5EA 3VI4E 3CC5A 4HC1L 1M05A 2HAZA 4JKMA 4JN2B 2NXZC 3HG1B 5JUEL 2FEDC 5F7MC 3UAJD 2E7LA 1OSZA 4NKOB 4PRID 2V17H 4LMQI 4U1HA 1IM9B 1FVCA 3PV6B 2QR0A 2DQDH 3L7FB 3X12B 3S96B 2R2BB 4OFPA 1NCDL 5A2LH 3SDAA 5IFHH 1J18A 4OCYH 5TQ0H 2ERJB 1FGNL 1QACA 2A9NH 1Q72H 5F7UA 2VC2L 3LIZL 1FQ9C 5TPWH 1GPOL 1FYTE 5IFAH 3LS4H 4UQ2B 1N8ZB 1MIEH 4G6FB 1JCKA 4OD2B 3SJVA 3V0WL 3TBWB 1CFSB 1M7IA 1JZ3A 4Q9BA 1OAYH 3CVIH 3VFWA 5H35A 3GUTA 5CHNB 3TNNA 5HDBF 3GIVB 5KSAA 3A67L 1NUGA 1XF1A 3LN4B 2XACC 1OVZA 2W07A 3BIKB 32C2B 3MRQA 3TIDA 1HCVA 3ZTNH 4WCYL 2PYEE 2A6IB 3MUJA 3RY4A 2A73A 4KI5E 1BEYH 2K7PA 3C5ZB 3R0MA 1NCAL 3TVMC 4BSWB 4L4JA 4K3EH 4PJ7E 3BH8A 4XP1H 3RTQA 1NDGB 5D1QB 4DGIH 4XP6H 1PSKH 1T1ZA 2BVOB 5DQ9B 1AGEA 1G7JA 2W0FB 3BGFB 4PGCB 5T1DL 2H32B 5ALCH 2JELL 4LU5H 3W39B 3QO1B 4N9GA 3TCLB 1RZ7L 3EOAB 4EI6B 3BD5A 4IMKC 3UJIH 4DK3A 3HE6C 2AABH 2BZDA 3MUZ1 4UDUB 4XNXL 3WUZA 2CO6B 3EBAA 4LFHG 4JZNA 3S5LB 3GMNA 4XC3L 1PD6A 2NLJB 2EXWC 4IIQA 3MV9B 2WLYA 4ELME 3OXSA 4JFED 4HX1B 4PLJC 1RIHH 2J7LA 5SWSE 3CDGB 3VWJC 3WIHH 3MRMA 1MCCA 4OZGF 5DJXB 1G9NC 1U8OB 3QNXA 1MCRA 2G2RA 5C0CA 3TYGL 3LQZA 4P46B 4IJ3B 2R1YA 5TGBA 4KV5F 4TUKH 3OKLB 5HI5D 3GSOA 2Q8BL 3F8UB 1T83C 4NNXB 4RQQA 1SYVB 2DI7A 2AQ1A 4FFYH 5I1JL 1MQ8A 1C1EH 4WI6A 5F1IB 3QFJD 2HKHL 4L4TE 5JORB 4QHMA 1G9NL 3A6BH 1SBSH 2ZCHH 3HUJE 3VFGL 4L9LB 1OTTD 1NKOA 3FQRA 5CCKH 4JFPA 4NT6A 2BY2A 2ZUQB 3QCVL 1DQMH 3KHOA 1WITA 1U8LB 4MWFA 3HPLB 2Z31D 1EXUB 3QUZD 3OKEA 4MQXC 1EHNA 4F37F 3EFFB 1NAMA 3ARWA 1IGMH 4FXGB 1E28B 3EYOA 4YK4C 4MJIA 5I71B 3S37H 4P5TB 2OS7A 5CEXB 1MJ8H 1CXKA 1TVHB 3TT3H 2DQUH 3NGBC 4HMDA 4K9EC 2R8SL 3RZCD 4JPKL 4P23C 1QNZL 3D5OF 2R0ZH 4MMXC 4KRPD 5FA3B 3BW9A 2N4IA 4OJFH 2YD3A 4OCSL 3H0TA 4I1NB 2ZPKL 4Z9KB 4JN1H 5E94B 1MHPH 4CNIA 1I1YB 2AERT 2X70B 1MHCA 2UY6A 1JGLH 4ODTH 2HT3C 4ZXBA 1TIUA 4POZC 2HH0L 3ARDA 3DI2B 3O6FA 4S1RH 5ICXA 4K9EL 3GSVA 4AH2A 1GCFA 3MUGB 3WD5L 1VENA 5DHXB 3IS0X 4XZUB 3WKNA 4CMMA 2ZP0T 4JREB 5C0IA 4LSQH 2X4OA 4DZ8B 2ZUXA 4ZTPL 3QXAB 1JWUB 4KDTA 1LVEA 2A2QT 4PJGB 4Y88A 2Q8AL 5DQJA 2ESVA 5D5ME 1RU9L 2MHAB 2XTJE 4YR6A 4WI3A 5CD3A 4LPYA 2VLJA 1U9KA 3ALPA 2QL1A 4KJYB 3TH4T 5TJWK 1SJXA 3RGVD 4Q7DA 4P5KA 4HKJB 3LS5L 3L6FA 3O41B 4MVBC 4XCEA 4OFKA 3SDXE 1LP9F 3WSQL 5C0DA 3KLHC 4OGYH 4YX2H 5D7SL 1KFAH 4U05A 2IWGA 5ISZD 4AQ1B 3DO7B 4XI5C 4JFQA 4J3VA 1JPTL 5DZLA 1NH6A 1U0QA 3ZKNC 2DKSA 1OAZL 5C09B 1FVEA 1HQ4A 4F15C 3HCVB 4GW5B 1F8TH 2AK4B 2NY2B 4WFGD 3VFPB 2WIIB 3BKJH 1DFBL 1ES0B 3AREA 3VMOA 2YXMA 3BP4A 5K93A 3U0WH 1UC6A 1OQOA 3BFOA 2WANA 2FLBT 3IXTA 1EAPA 1UB6A 4BKLB 4ENEC 3GNML 2OJZL 1JTPA 5SX5H 5JW4R 2VDQH 3U7WL 5EU3B 2X4UA 1BD2E 4WU7A 1M71B 1UM6L 2RQ8A 3BKCH 4OFDA 4EUPH 3UTPE 2CJUL 5IF0B 4MQ7A 4BZ2L 4D0BA 3L3HA 4ODUA 5MEQA 4HMEA 5IEHB 4Z95L 5L2KE 1OAKH 3MR9A 1A1OB 5D6CB 4JFDB 5FB8B 3ARFA 5DEFA 2NY5L 3WE6A 1TFHA 3U0PB 1E6OH 1KN2H 4HWBL 2VITB 2M26A 1UCTA 4WWKA 4C4KO 4N0UA 1INQB 4NM8L 3BRDA 1XGQB 4PJFF 1A9EA 1DLFH 3H7BA 5EB9A 1CXHA 3QUXB 1OD7A 3STLB 1VFBB 1C08A 3O8XC 1NPUA 4MZ3A 5H94A 4L29A 3O4OC 4X7TB 1HSBB 2X89A 2VLKB 4LIQL 4BYHA 2I9TA 3TBTB 3O4LE 1J8HD 1YY9D 2GSGA 1QA9B 2CR6A 2YPLD 1MCWM 2H9GA 5EWIL 2EZ0C 5D7IE 1FDLH 1B0GA 3VXNB 1CFQB 3PWLB 4X6DA 1P7QD 5CZKA 4XVSH 1Q38A 3K8LA 3MV8E 4JN2A 2EE6A 1T3FA 3HG1A 4PD4K 1C5BL 1D5IH 4ZYKB 1RK0B 5T1MB 4GXVL 4NKOA 5E6ZA 1VHPA 4NRZA 3NA9H 4PRIE 3PV6A 4KQ4H 3L7FA 3X12A 3S96A 2R2BA 4XWOD 4J2XA 1WTGT 2FX9L 4M61A 4ZNEA 2QV2A 1V3JA 3ZDXF 1IGIH 3AM8A 4ZOEA 3L3JB 1IGCL 5F3BB 1SM3L 4FFZH 5C0ND 3S35L 5IW6B 3SCMC 1Y0LB 4IDJH 3TBWA 1CFSA 4D0DA 1MJ7H 3C60B 3IDXH 3H7LA 2NXZD 3GIVA 3NFPB 4RAHA 3AU1B 1AKJB 4X4ZA 2ICES 1GC1C 3BIKA 1EERB 1ORQB 32C2A 1EMTH 1CE1H 3GBNH 4NQUA 2YPVH 2ZOKA 3JTTB 1ZHNB 5HHOB 3WXVL 1KBGH 4PJHE 3QA3B 5HY9A 4ONHA 4UDTB 4LHUD 4YPGB 2KQNA 2DM7A 3DRTB 5I1DA 1ULVA 1I8LA 4I77H 4ODXA 1OGAB 1A6VL 1RQ5A 1EFQA 5KJRL 5GGTL 4Z8FH 1G6RB 2NQCA 2RFXB 4RX4D 3DYOA 3QDMD 4NKIL 3MCKB 5D2NE 3IDMB 4G3YH 2Z93A 1NDGA 4JLRB 1JNHA 4AT6B 5D1QA 5EU6E 1RPQA 3QH3A 2IANB 4UTBH 2W0FA 4PGCA 1JYVA 2H32A 2NXYC 1GGUA 1DQDH 3OF6D 4TULH 2DLGA 3W39A 3EOAA 1JGUH 4EI6A 5CSZB 4ZFZB 2EO1A 5TE4L 3IFPB 4UDUA 2G9HA 1KCUH 4NUJB 2JJTA 1KJ3H 3DARA 2EE3A 1QSZA 4URTB 4RDQG 5SV4A 2OCFD 4DFIA 4GS7B 4C83A 4KY1L 1XGYH 1QKZH 3MV9A 3TVMD 3K2UL 2BC4B 3FMGH 5DT1L 2EECA 5FUCC 4HX1A 3S36H 3O2VL 1KN4L 4JFEE 5E70A 1ORSB 1EA9C 1PEZA 3LHPH 2BOCA 1U8OA 4JM2B 3ZT7A 5EIIA 2PNDA 4H88L 4P46A 2UWEE 4TVSa 3V4VH 3SOBH 5GJTL 5EUOB 3HE6D 5F9DC 3OKLA 1N59B 3TO2A 4AL8H 5KSBB 4NNXA 1SYVA 2YUZA 4IRJB 2ADFH 1J0HA 4TNVK 1UACH 3UCRA 4EQ3A 1G0YR 1WT5C 5LBSL 5JORA 3QFJE 3E2HC 1J1OH 1TZGL 4IEFB 2DB8A 1S7SB 1CT8B 5ETUA 4L9LA 4PLJD 4QF1B 4LSVH 4Y4HC 25C8L 4XHJC 1I4FB 2F5AH 1DSFL 5DVMA 5L9DH 3W2DH 4JRYD 1P5UA 1X5JA 2HN7B 2B2XH 1MI5A 3CNKA 3EFFA 1NBYA 1FNSH 1E28A 4FXGA 5J1SC 5ERWB 5KW9L 2PW1B 4P5TA 3W11C 4RISL 1TVHA 1UFUA 3P2TA 4BQ6A 3BE1L 4F8TA 4RRPA 4ETYA 4TSBL 1QRND 3B9DA 3TBVB 4PFEA 4HQQL 1ZWIB 1WBYB 4I8DA 5I2IA 4KKBC 1PYWB 5J6GA 2XQYG 1IAIM 1FFRA 3KYMB 2SEBA 3HE7C 5I74B 5KS9F 1AXSB 3TZVB 1I1YA 3IJSB 2R0WL 3ZKXB 4OM1H 5C0FB 4LSUL 5IBTH 4MQXD 1KJ2B 4M62L 1UJTA 2E9JA 5DJ0A 1T7XA 3HRZB 4M93C 4XZUA 1DR9A 2E7LC 3N1PC 5B39B 3WYRA 1II4E 4XH2B 1CTNA 1NDMA 1INEH 1N64L 2BSSB 1QD0A 1SVZA 3QXAA 3O9WB 4P5MA 4TVPL 1JWUA 2AJXH 4GRMA 2WLZA 3GMRA 5D1XB 3FQWA 3FN9A 4OIIH 2E9BA 1U93B 2MHAA 3NCCB 3W0WD 4KZEH 3C2AH 2EH8H 2VXUH 3QISA 3ULVC 4KJYA 3VI3F 1U8JA 3MCLL 4HKJA 3MRCB 1OWRM 3GI8H 3MYZA 4LLDB 1OAXH 1RUPH 4XGZA 1HIML 5FGBA 3S4SB 4UAOB 3UPAA 5HTSA 5KSAC 3BAEL 2GK0A 3CX5K 3GMLA 4FQCH 2Z8RA 4UNUA 4GAYB 2F8OA 4PBVC 3PP3K 1PGRB 3DO7A 1KIRA 2CDGB 2Y9RT 5DHVB 5ISZE 4NZTL 5FYKU 2Z8SA 2UZIL 3QO0B 1F4HA 3MO1A 5EOQL 1W0VA 1ZEAH 3WBDA 3VDBA 4U1MB 1AR1C 4ZO9A 2CDFB 1F6LL 3VFPA 3BWUC 4WFGE 1ES0A 5I1GL 3MBED 1VEPA 3BZFB 4YWGL 1QBLH 1ITBB 4ZUVB 4MA7L 3RWCB 4F7TA 5F1SA 4OB5L 1BJ1J 4BKLA 3KLHD 1WZMA 5EU3A 3QIWB 3GZKA 4YDLB 1J1XL 3O11B 4L8BA 1E4WL 1M71A 2W9EH 4PJDA 2GYSA 2HA1A 5IF0A 1OP3H 4ZUSB 1EDQA 3ZKND 3FT2A 2JLLA 3H9SD 4MD5B 1EZVY 5IEHA 1I8IB 5CSBA 2IALB 5EU4B 3KR3L 1EZVX 1MFBL 5BVJA 5EIVA 1UXSA 3GMPB 4TSAL 4CGTA 3KPLB 1WBZB 5EBGA 1A1OA 5D6CA 3M17B 1I9JH 5FB8A 1WFOA 4IIQC 1JNLH 4H8WC 4YXLH 4NGHH 4K3JL 3HNVH 1XMWA 2EDJA 1CFVH 4GMSH 3B2UC 2VITA 4M7ZB 1FLRH 3LAFA 5JDJA 3SKNB 5JW4M 4JHAL 4P59L 3ZMRA 3A6CL 1CLCA 4XTRC 4OSUL 1PKQB 4LVHB 1XGQA 5FM5M 2Q87A 1FO0H 2YOCA 4JRWA 3Q6GH 3STLA 5I75B 2BX5A 1R5IB 2DTSA 4X7TA 4M03A 1YEFL 2IC2A 3SE4A 4NKDB 3BEWB 5F9AC 1QA9A 2FATL 1J8HE 1CGWA 4KVNH 2FJHB 2GAZA 2YK1L 2YPLE 1A7NH 3VXNA 4JPIB 5J11C 1CFQA 1WWAX 3PWLA 5ITFB 3CMGA 1A6UL 3VWKC 3MLSL 5F6IC 3D0VA 2V7HB 3O45A 2R4SL 2R2EB 5E2UL 4I0PC 1LK3L 4P4KC 3BPLC 3BSZL 2C4FT 4LVEA 5DFWH 4FA8A 4ZYKA 1RK0A 5J7CC 4PRDB 4Y19B 4DVRH 4Z7NE 2LU4A 2B0SL 5CIPH 2IH1B 2BRQA 5J06A 1MOEA 1I1FB 3KYKH 3NFSH 4NQTA 4Q6IB 3B3IA 2DMCA 4PJ5B 5TE6L 3WJJC 4P9HH 4LVOC 2OTWA 1DUYB 4L5FL 1IAIH 5DVKA 4Y2DA 8FABB 4G6JL 5F3BA 1MUJB 5JIIA 1AY1H 3OMZA 1NAML 3HAEA 1ACYH 1QSEB 3L3GB 4ZXBC 3NFPA 3ARDC 3AU1A 1AKJA 3O6FC 3PQYA 3VD9A 1ORQA 3RZWA 5IEKA 5HHOA 1ZK9A 1A7QL 3R06B 1A6WL 1FAIH 5GGSB 3WNOA 4UDTA 5DDHA 2A83B 2XY2A 4YPGA 3X17A 1QSFB 2YKLH 4QRUB 1T1XA 3EGSB 1HH6A 5I15L 1OGAA 5GGVH 1BZ9B 1XCQB 4MJ6A 3F58L 1ADQH 4KDTC 1JZ2A 2J3SA 1RZGB 3BDYL 1ETZA 3QDME 1OAQL 3SCMD 2IFFH 4JLRA 3ALWA 4XP9L 2P5EA 4KXZI 2P5WB 1OSPH 4LVNC 4HJJH 4D9RD 4PJCF 3SQOL 1SVCP 4Q74A 3WS3A 5I8OL 1KPRA 4OGXH 4L4VD 5CSZA 4ZFZA 5HXMA 4JFHD 1PZ5B 3IFPA 5F1NB 1SQ2N 3CFCL 4X0KB 4NUJA 1UZ6F 2VN4A 1S5IH 5C1MB 4QRRB 2NTFB 3CZFB 4HPYL 1FL5B 1DANT 4IBLT 3QSKB 3U7AA 1BJ1H 4KC3B 5AUMA 4ACPA 3RL2A 2QADD 4R2GB 3MLXL 2VDLL 1MCQA 1YYLH 4R90H 5IV2A 2WP3O 4KHXL 4U7KA 5C0AD 4I2XB 1M6OA 2NXYD 1LO0L 2Z35A 2ICEA 1M4KA 2NY7H 3AMLA 1N59A 4OLZL 2YD9A 2APVA 3DWTA 4IRJA 4X9GA 2FBJH 4MNQD 3RAJL 8CGTA 1ZLUH 5FM8A 1KEGL 4HUWB 3TJEL 4ZDHB 5CJXC 5IM7A 1MHEB 3V0VB 4X6DF 1K2DB 2R9HC 4QF1A 1HXMB 3JV0A 3KYAA 4FZ8H 3ARFC 3R1GL 2VABA 1I4FA 4G8EB 5F21B 2HN7A 1PG7L 1VFMA 1S7UB 4F80A 5KVGL 3C6LA 4JPWH 4L8SA 1IAOA 5ERWA 1RMFL 1WZ1L 4K3JH 5FO8B 3SKJL 3KXFD 1MFEH 1PY9A 3TBVA 5ALBL 1DANU 3CFEB 1OY3B 1QRNE 1MFCL 4X9BA 5DSCB 4P0DA 5JIPA 1PYWA 1GAFH 4P2OB 5C6TL 2QQQA 1NFDA 3DETC 3KYMA 3LKNB 1AXSA 3TZVA 3IJSA 1QFPA 2ADJB 1FE8H 3MJ7A 1R3LB 2Z4QB 5CSGA 3ZE2F 2XWBB 1AHWB 3U79A 2IGFH 3P0YH 1B4JL 1NMBH 3HRZA 4JEGB 4OLVH 4RGOH 1BZ7A 1BJ8A 3W11D 1DBKL 5JTWA 4LCYB 3BQUB 3AY4A 4IM8A 2BSSA 4TOYL 3O9WA 3G9AB 3ZKSD 3DPBA 4KKBD 5FYLL 3ZYJA 4BH7B 5D1XA 3PG2A 1A2YB 1B9ZA 4YHYB 1CL7H 4MSWB 4PY8I 1KENL 3CDCA 4FQIH 4YHLL 2E6QA 3W0WE 4D2NA 1F58H 1Z2KA 4G43A 4TVPD 4YEEA 5IMMA 1FJ1A 3P77B 4XMPL 3QUYB 1HQRA 1EH9A 2BSTB 4AM0B 4QHNB 2CDGA 3HA0A 4N8CH 5IUSA 3GGWB 3SDAD 3QO0A 4M43H 1JHKH 4XC1L 4EUPG 4WHDA 4U1MA 1I8LC 1D6EA 3WNNA 4P49A 3QDAA 1JP5A 1IL1B 4Z0XA 3BZFA 1ZT7A 3OXRB 5E8NA 2Z92A 3TPUB 3RWCA 4JVWA 3SJVD 1JGDB 5ACMA 5D1QC 5EIQA 3TV3H 3B6SB 3GSNH 4GBXB 3V7AG 1CU4L 5KSAD 4CUCA 5CP3A 4JE4B 1GIGL 3CD4A 2MSPA 4XPGL 3WLBB 4ZUSA 4JANB 1E4KA 1HI6B 4MD5A 2DQGH 1I8IA 3H9SE 2IALA 2JJTC 5J13B 1GZQB 1OWWA 2WWMC 5IHUH 5ICZB 4O5LL 3KPLA 3LH2H 4Q97A 4PJAB 3V6OA 2AJUL 4ZMAT 3IS1X 3RTQD 3SKNA 4ZS7H 5F96L 4JCMA 4YUEL 4EN3A 3WDIA 4QRPA 4OIBA 1BOGB 3PV7A 2PR4L 2Y25A 1PKQA 2EIZA 3O2DA 4TPRL 2ARJA 2DJUA 5T5FL 5EA0H 3JXAA 3D0LB 4OIAA 3UTSB 1R5IA 3ULUC 5C9KA 4G5ZH 3BEWA 4JO4L 1TMCB 2BFVL 4K7PL 5L7XH 3CH8A 1BFSA 2FX8L 1UJ3B 4OKDA 4HZLB 1MWAB 1OM3H 5E99H 3D39A 3B2UD 3MRJA 2V7HA 3CVHL 4PRPB 4OGAC 3VXPB 2EKSB 2FX7H 2R2EA 4LIQE 5DHYB 3V6FB 5DD3H 2GIYA 5GISL 1SY6H 2Z9TA 3ULUL 3LVEA 4XTRD 4JGJA 4BFEA 5DI8B 4PRDA 5C0CD 4TN9A 5DK0B 1ODAA 3VFVB 5I71C 4R6UA 2G75B 4Q6IA 3KLAB 3O6KH 4KTYA 3VGEA 5ESAB 2F9BT 4LSSH 4PJGF 1XF4A 2A38A 2R0LH 3N1QC 1EO8L 3U9PH 2CUIA 1FV1B 1DUYA 2FGWL 5TH2B 3W9EB 4E42B 3OKMB 5EZIH 3D85B 4IRSA 8FABA 1DBAH 4OCRL 5C7XL 2PXYA 4F33B 5IESL 1P4IL 5CLTA 4O58L 4DCQB 4DKAA 4FQQB 3L3GA 4N9OB 5DRWA 1WV7T 2MMXA 3AB0B 1GOGA 3T4YB 3L3DB 3RI5F 1YEJH 1U6AL 1FCCA 5BO1L 1KSRA 2Q3ZA 2HFFB 4F2MA 3R06A 4M6NH 4MJID 5GGSA 5L0QC 5JMRA 2A83A 3VXUB 4FQJL 2FH6A 4PJFE 5CJQH 1BZ9A 1XCQA 4LCIH 5JA9A 3V4PH 4Z78B 2ZSVA 2X41A 1RZGA 5I17A 1KCSH 1YPZE 3M8OH 4B50A 4ZFOB 1NGPH 4Z7OE 1PX4A 3O2WL 5CKAA 5DRXB 2E8YA 2P5WA 12E8H 4PJEB 4ZXBD 1I7UA 3ARDD 2W60B 5IB5B 3O6FD 3DVGA 4D9RE 1JK8A 5FGBC 4HCRA 1MRFL 3BUTA 2W9DH 1KCRH 2AEPL 4L4VE 3VD7A 1FG2B 4UT6L 3FB6B 4JFHE 4WUKH 4E41B 3QAZC 3ARBC 4QRRA 3OHXA 3CZFA 2YHGA 4U6VL 2R29H 2VL5A 4MNHA 1VADA 3CXHJ 3HS0B 5GRUL 2ESVD 3E6FA 2NY2C 4FQPA 3FQTA 2VLJD 3FZUD 3IAPA 3G08A 2C3XA 3T2NH 4I2XA 3BZ4A 4GRWH 1FYTB 5C0AE 5CUSH 3UPCA 5IROA 2APWA 1F4WH 1I75A 5ADPH 2VAAB 4HXAL 1JF6A 2DD8L 5AD0A 4OQ1A 1REIA 4RFOH 3GJFK 3AXLB 2Y5TB 3S3PA 5BRZE 4MDJB 1XZ0B 2B1HL 3HZYA 4MNQE 5E7FA 4ZUUB 2P42B 2OSLB 4ZDHA 1A9BB 1MNUH 4ALAH 1QFWL 1J0YA 5L88L 1KTLB 1S3KL 1MHEA 1IGFH 5FUOL 4GRLC 2BVTA 1HXMA 3ARED 5C0BA 2B4CL 3MRBA 5FUCE 1Y6KR 2E9WA 1RJLB 3LDBB 3H3BC 2EEAA 1JFQH 4JKWA 2CMRH 1GHFL 1S7UA 2FGZA 1NBVH 1QFWM 4L8DB 1LO2L 1YYMH 5FO8A 3GBMH 3FO2A 2HFGL 2X5PA 1XF2B 1FH5H 2EICA 1W0WB 4BUHA 3KXFE 4WEBL 3WFBL 1YMMB 2AK1H 4J3OC 2WUBL 3NPSB 1S9WA 2FWOB 3TO4B 1NAKH 4P2OA 4DKEL 1QRKA 3IYLW 2VDNL 2R9HD 3BH9B 4OZIE 3ARFD 3B9EA 4M8VA 4PRBB 2WAHA 1YNLH 1X4ZA 3CGTA 1AHWA 2EEBA 3TA3B 4FQ1H 4ELMB 4WWKD 4KMTL 4QRSB 5J57B 2AVGA 5SWSB 3ESUF 3BQUA 2C1PA 1KT2A 4JDTL 5CJOH 5LQBL 2CK0H 1L7IH 5GRZA 1UWGH 3FQXB 3P0VH 1KIPB 3S34L 4CBPA 1VGEL 2X89D 3DETD 5EPMB 1MREL 1LO3H 5E9DA 4K94H 3ESVF 4MSWA 4LPXA 2HMIC 1CGSL 4QXGL 4JDVB 3NPZB 3OQ3B 3MFGB 3I9GH 4Y2DC 1B2WH 4IOSD 3RY6C 3TC9A 3LQAH 3P77A 4TVPE 5FYLD 3O3DB 3BJ91 3QUYA 3UTTB 4XCFH 3MACH 3HG1D 4FP8H 1WQVT 3HUJB 3U1SL 4QHNA 3QFDB 3BZEB 3C87A 5FGCE 2NY4B 4PY8J 1WFTA 3BN9D 4FTVA 2KBGA 3GMMB 4YHKL 3QDHA 1T04A 3X11B 1Y18B 5E1AB 5IBUB 2VUYA 1UM5L 4LF3B 4OD1H 3DTXA 3O3EB 2VKWA 5JQHC 1D5BB 5TDPA 1S9XB 2X9WA 1IL1A 4PP2A 1QP1A 3ULVE 1L0QA 3TPUA 1CDJA 2VYRE 1DBJH 4G6FD 3EHBC 1A6PA 1JGDA 1FC1A 4JM2F 2ICWB 1CWVA 3B6SA 4JQXC 3SJVE 4GBXA 3Q5OA 5EUOF 3TNMA 4ZSOB 5KSBF 3U4BH 3PP4L 2OX5A 1U8NA 4KXZH 3WLBA 1AP2B 4JHWH 1HI6A 2ADGA 4MYWB 4YAQB 5C9JB 3BKML 4YFLI 1AH1A 2PYFB 1GZQA 4RGMC 1A6AB 5JNYB 1UWEH 4D0CB 4M1DH 3CFDB 2AGJH 4JQVA 2X1PA 3IB4A 5IVZB 5DJ6A 4NBZB 3VXOB 3FRPG 3OAYH 1HKLL 1I9RH 1TZIB 1ZANL 4CVXB 2FECL 2VB5A 2CK2A 5D1QD 1BOGA 3MLYL 5H37H 1I7ZB 3VI3E 4CN4A 4D8PB 3PABA 3B5GA 3R0NA 5E56A 5FFLA 4HIHB 4NHUB 2N56A 3V5HB 1JHTB 3VXMB 3RU8H 1S8DB 4NZJA 2UZXB 4UNVA 3UTSA 1FFNB 5D71L 2MTPA 2DQHH 2DLIA 3NIDE 2VAJA 5IB2B 1I7TB 4HUXA 4IRJC 5IG7B 2WWMD 3LMJH 1UZ8B 4GOSA 1BM3L 2A6KA 2LFGA 1F5WA 1I3RB 3MREB 2NPLX 3MV9D 5EH1A 1UJ3A 4A6YH 1MWAA 1HNGA 4EVNB 4PRPA 5KVFH 4DKFH 3VXPA 3DSFL 5DHYA 2MKWA 3H2WA 1KELL 1RZFL 4C58B 3JTSB 4R96B 1QFWH 1JZ4A 4JJ5B 1TJHH 1D7FA 4UIKL 1T2QL 1IQWL 3C6LC 2ZCKL 4NN6C 4P46D 1NGQH 4BM7A 5DK0A 4L8SC 5C0CE 3HRPA 1YJDH 4G6ML 5HGHA 4P3DB 1MRCH 2G75A 4NBYB 4N68A 3ULUD 5ESAA 4LCWA 3KG5A 3K2MC 4Y4KC 5EOTB 1C8PA 4GAGL 3HPJB 3EDJA 1FV1A 4MJ5B 3W9EA 5TH2A 4E42A 3OKMA 3D85A 3GBLA 3LPGA 4KDWA 4RAUA 4F33A 4E0RB 3OPZL 3K8MA 3WIIL 4OGAD 2F74A 4QNPF 5DD5H 2V5TA 4FQQA 2O5ZH 4U1IA 3ETBF 3T4YA 3L3DA 2GITA 3GJFB 2VLLB 3QI9B 1H15A 3FAXA 3C8HA 1MI5D 1P1ZB 4KWUA 3LKOB 4HGKC 4NQDB 4JPVL 4NOFA 4P5TD 2DYPA 3MXVH 4MJIE 3VXUA 1X5FA 4QEGA 3BVNB 3T65A 3AY4C 4UB0H 2DQTL 3VFOB 3U7YH 3LPFA 3ES6B 1VFOA 1Z9OA 3O9WC 4Z78A 1OT1A 4H1LA 1QO3B 2XPGB 2Y07H 5D1XC 2IPKB 4HBCH 2CIIB 4K23L 1Z0NA 3ZYOA 4ZFOA 3PL6B 4RMRA 5DRXA 3O4LB 4HEME 4HFWB 4XBPA 4QHKJ 4Q9QH 5C6WH 1AD0A 2RGSA 1RIVL 1K3IA 2XA8L 2DL2A 2WMPA 2ORBH 4U1JB 5GRJH 1CGXA 4NQXA 3KJ4B 4AEHH 5LWYL 3REWA 2VDML 2HP4A 4M9OA 1X4XA 4PBXA 1H0DB 4P57A 4ZAKB 1VKXA 3JV6B 5DTFB 1FG2A 3GJEB 5IBLC 3QPQC 4E41A 4O4YL 4NQCD 1L7TH 1TCRB 3HS0A 3UC0H 1X6LA 1XAUA 1GGCL 2ESVE 4F9LA 4JVPA 1NLDH 4R4FH 1NCBH 2VLJE 4DN3H 1AD9B 1JHLH 2PN5A 4PLNC 3G6AB 3GIZL 4MA1B 2MNUA 3IDNB 3MV01 1FSKB 2WP3T 1JPSL 4JY5H 3ZE0E 3IVKA 2VAAA 1N5YH 3DYPA 3FO1A 4N1CA 1T89C 1CDGA 3UYOD 4PJIE 5HVHB 1JUFA 3NH7L 3AXLA 2A1WL 2Y5TA 4JFOB 1XZ0A 1CN4A 3RVWC 5LVEA 1A9BA 3HZMB 4OLWH 4YBLC 1G9EA 2IPUK 4S1DC 4N0FB 1SEBB 3GKZA 5E2JA 1ED3B 1G6RH 1KTLA 1RD6A 2NY2D 4OF5A 4X4YB 3H3KA 3MA9L 1HZHL 3BT2L 4NCDA 4PD4J 3T4AA 4G6AC 2V2TB 3UTQB 2FLRT 4N5EC 5D2NB 1A02N 4EN3C 2X4PA 2GJ6A 3Q48A 1LEIB 2APTA 4XNUH 2J4WL 5EU6B 1XF2A 2BRRL 4AEIH 1W0WA 1S7RB 4NUGL 4ZOBA 1YMMA 4HKXB 4BQ8A 1CBVH 2X6MA 3WFEH 2FWOA 1B0RB 2OZ4A 2OP4L 4YHZH 4XXDA 2OR8A 2VXTH 3DIFB 2PCPB 1ZGLA 2AEIT 2D0GA 2VE6B 2X1QA 1RUAL 5MHSD 2APXA 3O2DL 4O2FA 3HI6H 2G5RA 3QBTB 2P7TA 2XZCH 4TUOB 1H3PH 3BP7A 5M7QA 3TA3A 5DJ2B 5HPOA 4XX1G 4IOIB 4DW2L 1GOHA 1RZ8B 5SWSA 1LEGA 1CYGA 2MFNA 3I75B 2GTZB 1CIDA 5E08H 4HH9B 1KIPA 5EN2A 1A7OL 4Q6IC 5HHVH 2VZOA 4U31A 4NZUH 4EJ1C 4KUCD 5EPMA 1IZJA 3O6MH 3JV5A 3GRWA 4KHTH 1OPGL 1QHPA 1CFTA 4IRSC 5CWSA 2PXYC 2VQTA 1UM4L 4J3SA 4WW1B 3QR2A 1TJGL 2GJZA 1G84A 2OK0H 1EEZA 1Y6MR 4X6DE 5INDB 5FYLE 3WFCH 2C1OB 2BNRA 4OCMC 3UTTA 4F7CB 2J5LB 3VXRA 1U8PB 4I4WB 4HJ0C 1ZLWK 2CKBH 3HG1E 3QFDA 3BZEA 1BP3B 2J6EA 3LKRB 5B38B 1NEUA 5IW1B 4FNLH 4YQXH 4N5UA 1EHLL 4QGYA 4NNPL 1B6UA 3HB3D 3GMMA 5KTEL 5E2VL 3X11A 3K0WA 1Y18A 3GO1H 2NY6B 4OFVA 4W6WB 4LF3A 1IT9H 1M1SA 3O3EA 4S2SB 4ZNEE 2IJ0C 3MLZL 1S9XA 5GXBB 2AKRB 2HTLC 4Y2DD 5J89A 1A7RH 2WK2A 3IGAB 3EYQD 1I3GL 3RZCB 5EBLB 4OLYH 2W0KA 1IAMA 5DQDL 3R4DA 2ICWA 4KRPB 4EBQL 1F6AB 1XH3B 3W82A 3RVUC 2B5IB 2CQVA 2JB5H 1QEWB 1KJ2H 1KTRL 1AKJD 2HRPH 4ZSOA 3PQYD 1S7QB 2V2WB 2NY3C 4OZ4A 5HHOD 5JPMB 4KJQC 5HHMD 1DBMH 2CLZB 1RUKH 1IEBB 4HS3B 1AP2A 3MJ9A 3V4UL 5C9JA 2F54A 3HC4L 3MSPA 4QKXB 5CD5C 2CLVB 1XIWB 5E00B 1A6AA 1K3ZA 1OGAD 4IDLA 3G5XA 3P4MB 4PGZA 4D0CA 1QYGH 3G5YB 3FB8B 5F8QC 3K81A 1KYOK 3VXOA 4K71C 3HNTH 5A40E 5FCSH 1TZIA 5FKPA 3VH8B 4HCRL 2FR4A 4CVXA 2P5ED 3BIAX 5FHBL 3BKYL 1I7ZA 3L5XL 4D8PA 1QPXA 1E4XH 1OCWH 4IS6B 1KEMH 1CR9L 4HIHA 4NKQB 1X5XA 4NHUA 3I6GA 5J6HB 5IROC 3I6LD 5ID1B 3RGHA 3RIAF 3VXMA 3RGVB 5I1EL 1FFNA 5DHVH 2OL3B 2QSVA 4HXBH 1D3CA 1UZ8A 1S5HB 1LEKB 5C0GB 3MREA 5FIEA 5JW3H 3MX0A 2FJGB 3MV9E 4EVNA 3NABH 43CAB 5DJAB 5I19L 5FA4A 3CDYA 5ECJE 2FB4L 3JTSA 1MAML 4M1CC 4R96A 4JJ5A 3NN8B 1O7SA 2D4FA 4HS8H 4NC2B 3WNMA 2R0KL 2DICA 1DZBA 2YPKB 3L5IA 4Y1AA 3RFZC 3GSXB 3OV6A 1OAUH 1EV2E 4O2CA 1HZHH 3EJZC 3V7MA 2DKMA 5LGJA 3ULUE 4IRJD 1BIIB 3CSYA 5EOTA 3IETB 1NFIB 4CU7A 5AEAA 4J12A 4JG1L 2BDNH 2FRGP 2X2YA 3WMSA 4G42B 3W5NA 1KCVH 3D18B 4E0RA 4TTDC 3ROOB 2N1KA 5HYJB 3MLWL 4YGAB 3C8KA 5JQ6L 4HMCA 2QQLL 4ONGL 2ATKB 3HR5B 1X5YA 1MY7A 5T1LA 1FORH 5F7NC 4ZQKA 4NN5B 5CEZL 3AS3A 4MJ2A 5DMIL 1NCCL 4QRTB 3GJFA 3QI9A 5I18L 3CX5J 1BVLB 3RNQB 4ODSL 1CDCA 1P1ZA 3C6LD 4Y5YB 4NQDA 5E8DH 4M1GH 1MI5E 3EOTH 3HZKB 2NR6C 1GGIH 4BK4A 3BVNA 2ENSA 5EU5B 1IBGH 5GGQH 5ESQB 1EGJA 4M7LH 3ES6A 2DQIL 5KG9B 3WHE1 2Y36H 2IG2L 2XPGA 4NN7B 2CIIA 1ZVHA 1FBIL 1BFOB 2VRAA 4XCNA 5E7BA 3K8KA 4LRNH 1KLUB 2J8UA 3NCJL 1J1PL 1VEOA 2R4RH 3PL6A 3E3QC 4U7MA 3TZVD 4NJAH 3O4LA 3UZEA 4HFWA 1A7PH 4NFBA 3C5SB 1J8HB 5F7EH 5I8KH 1IAKA 2BJMH 2GTWB 2XT1B 2YPLB 3C5JB 4U1JA 4Z7QF 3QUYC 1CLZH 4DTGL 2BY0A 3IKCB 5DA0B 3WUWB 1H0DA 4ZAKA 5CZVL 1P7QB 3JV6A 5DTFA 4TSCL 2XQBL 3GJEA 4ZD3L 5DD1H 1MSPA 2ZG2A 2E6PA 4XMKH 2HKFL 3O9WD 2O5XH 1P4LA 4LDEB 4NQCE 1TCRA 4KTEH 4FFWC 5D1XD 3A0OA 4MNGB 4PJAF 1SJVA 3UTOA 2FEEI 4OCWH 4BSJA 3EZ8A 2QSTA 2L7UA 5K9QG 4LSDA 1FNLA 1YMHA 1U3HA 2VO5A 5DJCB 4O51A 1F90L 4X6EA 3K4AA 2AJSL 3IDNA 5HDLA 5I6XC 4LEXH 3EOBB 3Q2CA 4XNMB 1V7ML 3ZSTA 4UOJA 4G7VL 3QPQD 3QCTH 1X5IA 5C2UB 1A6TA 1GGBH 3W81A 1Q9LA 4JFOA 3STBA 2P8MB 2CRYA 5T3XH 1QSVA 1AQKH 2W38A 5C2BL 1SEBA 2GCYA 4NBXB 5J13C 2F5BL 2DLTA 2Y6SC 4CW1B 1HNFA 3FONB 3C08H 1LK2B 1B0WA 4UIMB 4LHUB 3S5LG 4NP4H 4X4YA 5IOPB 5DUMH 5DGRA 1MLBB 4HWNA 5D72H 4RMVA 2V2TA 4MB5A 5I0DA 3MLUH 3PUCA 4AMKL 4JQIL 4OV5A 5BZDB 2OLDA 3ARXA 1TTGA 1RURH 1UG9A 5EU6A 3PWVB 2BCKB 4JO2H 2ID5A 5E8PB 5F9OL 4PJDE 4UV4H 4HKXA 3RVWD 5H8DA 1NL0H 3FRUB 4K3HA 2HLFC 4LPWA 4NWUL 1LO4H 1L9NA 1VFAB 4F9PA 3DIFA 3BO8A 3BI9X 2VE6A 2RB8A 4U1NA 2AEQL 5C07B 1HXYB 1H8NA 3UJJH 2ICCA 5MHSE 4TUOA 4HFUH 4G6AD 3QEHA 3PHSA 2HRLA 4N5ED 1XR9B 1CD9B 5DJ2A 4EN3D 4QRPD 5F72S 3TVMB 1XGPA 4L9DA 2RJMA 4ZS6D 4EKXA 4IOIA 4H0IA 4K8RC 4ETQA 3DGGA 1BQHB 3I75A 4ORGB 4XWGL 2QHRL 4HH9A 3DX9B 4ERSL 4M48H 1MWAL 1SJHB 4GUPB 5T3ZH 4ELKB 4JFZH 3DVIA 4I5BB 4RRPG 3HE6B 4LQ1A 2FL5A 1JNNL 2J1KA 5HYEA 3U6RB 2XNAA 4K8RL 3OWEA 4L3AA 5CBAB 3EO0B 4WW1A 3DHJA 4KMLB 4PJEF 3D39D 3MODH 5EZOH 1Q9KB 5INDA 1PLGH 2C1OA 1LQSR 3PP3H 1I3UA 1E0OB 4I4WA 4OUOA 4YXHH 2K7QA 3AB0C 1URLA 3MGTB 3VI4F 1V5JA 3NTCH 3GHEH 4APQB 1T20B 2OJEB 4R26L 4HF5L 4M7JL 4OKVB 3VWJB 3HZVA 2J12B 4KPHL 4PRAB 3UO1H 1S9KC 4Y5VC 1KOAA 3GI9L 5AZ2H 4S2SA 5GGRY 3KYNB 2AKRA 4IRSD 4S0SD 2PXYD 1A22B 1VFUA 4KQ3L 2I60L 3U2SB 3T0AA 4ZG1A 5MENA 3DYMA 1MQKH 1MF2L 4NRYB 3RNKB 1F6AA 1XH3A 3D1MC 4HJ0D 2YS4A 4Y4FB 2P46B 4YPJA 5H37G 2V2WA 3PQYE 3RHWF 2AXGB 4NWTH 1A1NA 1KB9K 3SPVB 2CLZA 3T0XA 1G7PA 5HHOE 5D7LA 1UKTA 5HHME 1UYWL 4ZFOL 2RAMA 5E03A 3GHBL 4WW2B 1XIWA 2OR9H 5E00A 5HHNA 4MCZB 3I02B 5DRNB 4ONFH 4YK4B 3P4MA 4ONOA 1OGAE 3FB8A 2VNCA 2HG5A 2GK2A 4Y5XC 5CILH 3QUKB 3NGBB 2I5YH 2VXQH 4KI5F 1KUMA 4P23B 2E8ZA 1XF3B 4F9LC 1MCDA 2P5WD 2P5EE 2VWEC 5DF0A 3AMKA 3W0WB 5J6HA 1FNFA 2FJFA 1E6JL 4HV8B 3RWGB 3VW3L 4KJQD 3I6LE 1YEGL 1NEZG 1JGVL 3QRGL 1YN6B 1TITA 2EE2A 3UP1A 2XG4A 3QDJA 1C5CH 4QRRD 3KJ6L 1S5HA 1JNJA 3FTGA 5IQ7H 1LEKA 5C0GA 3V5DB 5D9SB 3SGDI 1SHMA 2EDXA 1WFUA 3GSQB 3MUY1 5DJAA 3SN6N 1UEMA 3IFNL 3UJTH 3GK8L 2Q20A 4RFEA 1KJVB 2IQAB 3SKOB 1NC2B 4DAGL 3DX8B 2DBJA 4OFIA 4ELMF 4Y89A 2E9IA 1A0QL 1U8QB 4U1LA 5E4EC 2EYTB 1VA9A 5TFSH 3KLSA 3KWWB 3DVFA 4DFHA 1RSFA 3UBXI 3U36B 1G0XA 1BIIA 3IETA 1NFIA 3SO3C 1R24A 5DD6B 1WCQA 3S7GA 4OCXH 5CP7B 3NPSC 2HVKA 4UTAL 5DFVC 1MLCB 4G42A 3D18A 4X9FA 1CK0H 6CGTA 4OZHA 5F9OH 5L2JB 1J0IA 4RIRA 5HYJA 5EBMA 4XP5L 4OF0A 4KK6C 1FN4A 4RWYH 3O3AA 3BWAB 5C0BD 1ZVSB 2PETA 4JO3H 5C0RL 3HR5A 4RSVA 4KZDH 4F15B 1BVKA 4PRNB 2E27L 4M1CD 2JJVA 3HUJF 3ECBB 1BVLA 3IAQA 1QUNA 4N8VB 1RUML 3HNSH 5DD0H 2OZ4L 3HZKA 5EU5A 2I24N 5CEZD 5GRVL 5IMLB 4X9IA 3NA4A 3HFMH 5CFHA 4LSPL 4LSTH 4HWEL 1R3JB 3FFDB 4P2OD 1BFOA 2Q76A 3D3VB 4M5YH 4UT9H 4TTDD 1KLUA 1ZT1B 3EYFB 1QTYT 1NFDE 2LABA 3QUML 1MWAH 4UUJB 3C5SA 5EC2B 2GTWA 3F7YB 4OD3L 5FKAB 7FABL 1K85A 4S1QH 3TLRA 3WXWL 4X4MA 3ULSA 4XVJH 4AZ8A 1YNTB 3IKCA 1JF1B 4K2UL 3WUWA 1S7XB 3CJJA 5LGKA 1Q9WA 3LRHA 5TQ2H 3VRJA 3M45A 3BQUD 3LN5A 1R5WB 2F19L 3GRWL 3NACH 1P69B 1J5OH 3O6LH 4KJPD 2VXVH 4EIGB 4C56A 4X6BB 1UH3A 1WUNT 2Y4SA 1BPVA 4I18A 4MNGA 4WY7L 2VXSL 4UBDC 5E9DD 3RJDA 4HC1A 3O8XB 3H8NA 2VH5H 3O4OB 4PJXA 2J6EL 1GOFA 5B3NA 5K9JL 1N0XH 2CR3A 4JY4B 2BMKA 3QUYD 3CLEH 4C57C 2C4XA 4PBWD 1HILB 2YD2A 1UB5B 3HI5H 2XG5A 2FO4A 4Z7WB 1AGBB 2Y7QB 4UT7H 5HI4D 2EEDA 3INUL 3QXDB 2H26B 5ABDE 4MDIB 4FTVD 3VXTB 5LXGH 3QP3A 4FFWD 3ZDYE 4N90D 5GRXG 3EIFA 3FONA 4HT1H 3LKQA 5IOPA 1E4JA 1MLBA 5DJDA 3QQNA 5I1HH 1VESA 5E6IA 4BZ1H 4V2BA 4YO0B 4Z76B 3MJ9L 1YPZB 1SEQH 4GBXD 3WFDH 5BZDA 3NAAH 3EJYC 1FGVL 3SCMB 3PGCB 3DUSB 2AAVA 4DQOL 1V7NL 1KNOB 5K33A 5E8PA 2C3GA 1J9CT 2ZCLL 4YHIB 5D70L 1YJDC 4WDIB 2ARJQ 3IU3A 4R3SA 1AE6H 2O5YH 1JRHL 1YQ2A 1U3YA 4Y16A 2Y6SD 2IH3B 5FV2A 3LB6C 4JR9L 4WEUD 5C07A 1I7RB 4BFIA 1HXYA 2ADIA 1YNKH 1R0AL 3OR6A 5GGVY 3V6OE 4JB9H 3PDGA 5TF1L 1HSAB 4KAQH 2BOBB 1XR9A 2VDRH 3KYOA 3OKNA 1AQDB 1QQDB 4QRPE 2J88H 4FHBD 2HJKB 2CXGA 2COQA 5I8EB 4PYHA 1PDKA 1BQHA 5DYOB 1PKQE 2ZUVA 2K1MA 5C0AB 4RNRB 3C2SA 1ZLSH 1K5NB 5A2KH 1A3RL 5DS8A 4A2MA 3UTSD 1EFXA 2NXYB 2R23B 3LZFH 4ELKA 3JZ7A 1ZLVH 1QLFB 1WIPA 3HE6A 4DVBB 1PKOA 4NZRL 4X6CA 3GM8A 4NC1C 3I50H 2QJDA 5BRZB 5L8KB 2GT9A 2D7TH 4MNQB 2QSCL 4PRPD 4WTZG 3RJQB 3D39E 1G1CA 1YEIL 4QYOB 2RCSL 5BVPH 1XGUB 4OZFH 5FHAL 2FIRT 3TWCH 4ZFGL 3D69B 3MGTA 6FABH 4APQA 2OJEA 4PPTA 5F7DB 2C5DC 2R56L 1ZKAA 3VWJA 2QQKH 4JO1L 5DR5H 4XPBL 2VDPL 5EOCJ 5SWZA 4WTXA 3VD4A 2E27H 3QG7L 4M5ZL 5B39G 3T3PE 4LCWD 3UPRB 5FOBB 1ZA3A 1NSNL 5J3HC 1T03H 3KYNA 3MQIA 1DTUA 5GJSH 5GGUA 5KANG 1F4XH 1IMHC 3D85D 1MCPL 2B1AH 5KSUB 4OT1L 1N6QH 3CFKB 3PL6C 1H3XA 3PDOB 4NRYA 3RNKA 3MRNA 2E3VA 4FQXA 4NQSA 3T0VA 3MBXH 3G5VB 2BP3A 3S97C 1HINL 3LEYH 4Y4FA 2VISB 1EGJL 5GHWH 2DBLH 3SDCA 4OZIB 3QHZH 2AXGA 1LDSA 5FCUH 4Y4HB 5DWUL 3GMOA 3S4SG 2D9QB 4CMHB 3PGFH 4GW1B 2DYPD 1QBBA 5GSRB 3TYFB 2EDOA 3VXUD 4DGYH 2A77L 4M6ML 4WW2A 2AXFB 3I02A 3QWOB 5DRNA 5TE7H 4AIOA 5HJ3A 2VZUA 1UT9A 2WUCL 1JPST 2EYRA 1D5ZA 5JXAH 4P23A 2LAGB 1XF3A 1QLEH 5IIEB 1NGYA 2CH8A 4DWHA 4GKSB 1OB1B 1S7VB 2X4RB 1OTUC 1U3HC 2P5WE 1MCNA 3HE7B 4GJTB 5DLML 1ZA6A 4MA1C 4HV8A 3RWGA 4XBEL 1FSKC 2E7HA 4XNYH 5BJTA 2NNAB 1FVDA 1A3LL 3CC5B 2ZJSH 4G8FA 4E41D 5CJ5A 1AXTL 1W8NA 2BVPB 2AXHA 1UKQA 3MNZA 4M93B 1YEEH 3B9VA 5D1ZA 4QO1A 4XHQA 5DO2D 4QRRE 5D9SA 4HUUB 1QFUH 15C8L 2QR0B 2CUMA 2WBKA 3GSQA 5JR1H 2X1OA 4QXTA 4U6TA 2VZTA 3G6JE 2IQAA 1NC2A 4Q9RH 4EDWL 3GFUA 1YEHL 3L3KA 3MRRA 4ZPVB 4L8CA 1A3QA 4AQOA 2JB6B 3WNPA 1U91A 1EIBA 2XA3A 3SJVB 2IEPA 2H6PA 3L1OH 3VFWB 1ZSDA 4BJLA 4FABL 4RZCA 5H35B 3GUTB 5KVEH 1RZJC 5CP7A 1KGCD 3SE9H 4LCCA 4M7LT 3MRQB 3EDKA 5I1IL 3HMWL 4I3RL 3F62A 4F9PC 3QQ9C 4B7LA 4XMLL 2FIKA 5E2WH 3SGKC 3WHXB 3MV7A 3UTZA 3BWAA 1ZVSA 2NZIA 4CVUA 3VRIB 5C0BE 4GAJH 3P4OA 2A73B 3ECBA 2PW2A 1RZJL 1FNHA 3Q1SH 3EO1A 1F97A 3X3GL 1DQLH 3ZKMC 2GJ6D 3BH8B 4OM0L 5AYQA 4GT7A 3VFUB 5IMLA 1T1ZB 1YMMD 1G7JB 2GHWB 5DFVD 4N9GB 1XR8A 3D3VA 3X13A 4X7CC 2R1WA 4D94A 5CEYB 1UXWB 3VFSA 3S88H 1UCBH 4KK6D 5INCA 3TGXA 2EDBA 5DMJB 3O0RH 3P9MB 2VLMD 4UUJA 3GKWL 3H3PL 3F5WB 4YNYB 1DBBH 3CLFL 5EC2A 4LL9A 2EDQA 5FKAA 1T6WA 4NDMA 3GMNB 3F7VA 3PE9A 1UA6H 3TA3D 1CLOH 3GSRB 4LPTA 1YNTA 5EOCH 35C8L 1S7XA 4XT1C 2G60L 3WCYA 2OI9C 4GQ9H 5SWSD 1U92A 1MEXL 3OXSB 2YWZA 4KUZL 4MA8L 1FRGL 1R3IH 3THML 2X4TB 2F15A 3MRMB 2A9ML 1MY5A 1JZ8A 1RFDH 5ADOL 5C0CB 1C5DA 3DUUB 5EO1B 3LQZB 1RZKC 4HK3J 4FQLH 5TGBB 3O8XA 1JWMA 2CGRL 2V9RA 5E9DE 4XB8A 1IC5L 3HMXA 3OAUL 2WWKO 3FJTA 4CN1A 3PWPB 4X7FC 3IU4L 3P30H 1BECA 2BNRD 3UTTD 4QHMB 4WNQA 3VXRD 1LWRA 2ZOLA 3P4LA 1UB5A 2AJYL 2N7AA 5J11B 3H6JA 1YDPB 1MCJA 4NJ9H 5CBEA 4Z7WA 3VWKB 3DOSA 5F6IB 1AGBA 2Y7QA 1RZKL 3FQRB 4GAFB 2NY4D 1CD0A 4I0PB 4MDIA 3VXTA 4X8JA 4P4KB 3BPLB 4MWFB 3FB7B 4FTVE 4XPFH 1HH9A 2MQ0A 1XIWC 1G9MC 4UBDD 2VSDA 4MJIB 1CF8H 4GSDH 2KKQA 4N90E 5AWNL 1IC4H 3ARQA 4I3SL 2VDOH 3VFNA 4YO0A 4LVOB 4P3CH 3D48R 4Z76A 3BW9B 5F88A 5FYJL 2X1WL 4E9LA 1G9ML 3PGCA 3DUSA 3H0TB 5ENWA 5IVXA 2XOTA 4CNIB 4YHIA 3KPSA 1CFBA 3ARDB 1OARL 5ICXB 2F54D 2FNBA 5J1TC 5GS0L 4AH2B 4GH7B 1EEQA 2I27N 3KPOB 2IH3A 4CMMB 1IFHH 1M7XA 1I7RA 3VFTB 2IQ9L 3N50A 2X4OB 1DUZB 1FNGA 3ZO0A 2BOBA 1BFVL 3UYRH 1AQDA 2YC1A 4LARL 2ESVB 5I8EA 4YR6B 2F8XC 5D8JL 2VLJB 4JFYB 3S8WA 3VXMD 2YZ8A 3F7QA 4RNRA 1K5NA 1P4BH 4BZYA 1JE6A 2AI0L 4P5KB 2V9TA 4F57H 3V79C 4X7SH 3L6FB 2D03H 1NCWH 2F58L 3B2VL 4XCEB 4ZUTB 1QLFA 1AI1L 1KC5H 4PJIB 1TJIH 3LB6D 1FIGL 4MD0B 4JFQB 5BRZA 3EYUH 3V8OA 1IVLA 1ZHLA 5AZEL 4PRPE 4M6OH 5JMOC 1BIHA 2FHCA 3DI3B 5D4QA 2MPAH 3D69A 5DEZA 1JGEA 4XNZC 4HGMA 5CKGA 4EI5A 3I2CH 4WFED 1F3JB 1YEKL 4Y1AD 3BP4B 3VXSB 2OM5A 3CMOL 1T0NB 3IFLL 5MERA 1DJSA 3IXTB 2P45B 5FOBA 1EAPB 4Z7NF 1UB6B 3FN0H 4LCWE 1AIFB 1H8SA 4KRLB 5KSUA 5MP6L 4FMKA 3CFKA 4YDIH 3FB5B 4D0BB 3PDOA 4FZEH 1BGXH 3I3BA 4QWWC 4G9DA 3L3HB 2JKXA 3RA7L 3B5HA 1KB5B 5T1LD 3QEGL 2VISA 3MR9B 3QI9D 1ONQB 5F7YC 1RJYB 1DEEB 4Y4HA 1Q0XH 4NQDD 3ARFB 3KPTA 4RMSA 1WEJH 1QOKA 3FO0H 1AO7A 3V5KA 5F9JB 4GW1A 3TT1H 4FOMA 5FUZL 4TQEH 3X3FH 1VPOL 1D6VH 2FBOJ 1JN6A 1G7MA 2AXFA 3PNWA 2GFBA 2H41A 5J3HD 2LV4A 3VDAA 5ID0B 2DLFL 4HPOL 1NJ9B 1FPTL 2DLEA 3FOMB 1A9EB 4I18C 4ODHH 1BQLL 1C08B 4RA0C 3SE8L 3PL6D 1N4XL 1DCLA 4ZOCA 4L29B 3O4LD 4HG4K 1OB1A 1S7VA 4LASH 4PUBH 4KVCH 2I9TB 3HE7A 4H26A 2CGRH 2H9GB 5CZXD 1V05A 1U8MA 1B0GB 2EDDA 4ZO8A 4ZAKD 2NNAA 3SGJA 1TETH 2H3NA 2DQJH 4P9ML 5DC0A 4F7PB 3Q3GB 3VD3A 4K7PY 2BVPA 4NRXA 2R69H 3RP1A 1T3FB 5I1KH 4K7PX 4E41E 1K8IB 5A16B 3AC0A 4NRZB 2AJVH 1TENA 2DTML 4HUUA 5JHLH 3MXWL 1HN1A 3BMWA 2EDFA 1PVHA 1NMAL 2J8OA 3ME0A 3RDTC 3UZQA 4S1SL 1SBBA 5JA8B 3EDDA 3FT4B 2XFXB 3EW3B 3G6DL 3OZ9H 4M61B 3LOWA 1U3HD 2JJUA 2H8PA 4BA8A 3U82B 5E6IC 2WNGA 4ZPVA 2MCPH 4FG6D 3FHAA 1RZIB 1FHGA 1IM3B 4YDKH 1PEWA 2JB6A 4U6YA 4YXKL 5J8OA 4D0DB 4UU9B 4F58H 4ISVA 3HKFA 5CGMA 4YJZL 5EU7C 3RWDB 3EZJB 5D7JA 3ROLA 1WF5A 4M7KH 5LG1A 1YECL 3WN5B 4ZO7A 1KGCE 2ED7A 2ZOKB 4Y16C 4QT5B 4PJBB 5HY9B 4ONHB 3WHXA 1OGTB 4QHUB 1RHHA 3QXWA 4UINH 4O02L 5E2TL 3VRIA 5I1DB 4DUXA 4ODXB 4GG6B 3IDGB 4ZTOL 1XGRB 3LEVL 4G7YL 4GXUM 5AYUL 2Z93B 2ZUWA 2GJ6E 5EU6D 2FYYB 3P3YA 4YBQC 3CCHB 3ZL4H 1JNHB 1YQVL 2VQ1A 3VFUA 3QH3B 2P44B 4AG4H 1WVZA 2OL3H 4NHCH 1YMME 4OLXL 5KN5B 3T2QA 4Z0BH 4W4NA 3OBAA 1RY7B 4XPHH 4OCNC 5CEYA 1UXWA 1ITCA 2YEZA 2RR3A 4CU8A 2G9HB 3P9MA</