3HNSL

Cs-35 fab complex with oligoarabinofuranosyl hexasaccharide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTIGCRASQDIGSYLNWYQQKPDGAVRLLIYYTSRLHSGVPSRFSGSGSGTHFSLTISNLEQEDIGTYFCHQDTKPPYTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
molecule tags Immune system
total genus 56
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsL01
2ITCA 1KJMA 5C0AA 3GMMA 1YEEH 4F7PA 3P4MA 1F45A 4G9FD 3P3YA 4P5TC 4LBEA 1C5DB 2CJUL 1FFPA 2P8MA 3GSQB 3BZFB 2RJMA 4LHUD 4ZFZB 5I8KH 4W81A 5TE7L 1U8IB 2CPCA 5CEXB 3LRHA 2GIYA 1J0YA 4YGVA 5FA3A 2WUBL 3O45A 1I1RA 1JWSB 1QTYT 2D31B 3I2CL 3KS0J 4YBLC 4XZUB 4L4VE 4QHMA 4E0RB 3IDYC 5EU7E 2Z4QA 1BFOB 4KKCD 1N6QH 1CU4H 2NTSP 2IH1A 1A6UL 4C57C 2IPUK 3EJZD 2R2BB 1FE8H 2DJUA 4GQPH 1OP9A 4K23H 3QUYB 3RJQB 5L6YL 1CIDA 3QQ3A 4KFZC 5I1KL 4Q2ZB 4TVPE 1UJ3C 2Z8RA 2PO6A 1RUML 5INCB 2C4FU 5LG1A 2FIKA 4Q9CA 1JHKL 4ODSL 1NGPH 1D5MA 2QQKL 4P4RB 5JQ6L 1PDKA 4G5ZH 3I02A 5EU5A 2YD4A 1OGAB 1I75A 4NQSB 1YC8A 3L7EB 2BVUA 1MVUA 5BOPA 5MERB 1SHMA 3STBA 4R96A 1FORH 2YEZA 2JLLA 4JHWL 3AROA 1CBVL 2Q1EA 1HH9B 1NC2D 3SDXB 1JF1A 1INQB 3WFCH 3VXTB 1P6AB 4FFWC 4GKZB 4JZJA 4P23D 4LGPB 5EIIB 1LGVA 3AM8A 3EYUH 1AJ7L 4G8GD 4K3JL 2HN7B 1ORQB 5EZIL 4PJBE 2HFEB 5BV7B 5D7JC 2P24B 3THMH 4U7SA 3O41B 5HYJE 4XCCH 2OTWA 4WW1B 3S4SG 1JV5A 1OTSD 4TYUA 2MQCA 5HI5C 2J8OA 3CK0L 2DWDB 4S1RL 3W5MA 1FL5A 5IG7B 3QWOB 5ILTH 1INDH 5E5RB 1J0ZA 3CFKA 5KSAC 5A43C 4ZUTB 4HKJA 4JFFD 2AKRA 4GXVL 1ZA3A 1WBXB 1G6RB 1V5JA 4JREB 3BDYH 2R1WA 2F58H 4DKAA 3KGRA 2CLZB 2PXYD 2D7OA 1I3UA 4G6JL 3HZKA 4PLNC 1K8DB 4GG6F 4OUUB 5ICZA 3QPXH 1QSZA 2Y6SC 1BAFL 2GJZB 3BKJH 5C08A 1NDMB 1CDYA 4K2UL 4NO5B 5DLML 4ACPA 4DGVH 3LQAL 5M95B 3QDJB 1WGOA 5B38A 1IGTB 5JXAL 1A3RH 4NT6B 4R7DA 1BOYA 4ZYKA 2CK2A 1G7MB 3GBML 1ERNA 1NLDL 3TO4C 1P53A 2C9AA 3FT4B 1WQVT 2AJVH 4JFDB 3T08A 4NNPH 5E4EB 1FP5A 4Z95H 4FFYH 1OPGL 1ZHLB 4IRZH 1ULVA 3LKNA 1SVCP 4O02L 3VFGL 5KVDL 3HFML 4UNUA 4JY4B 3CSBA 2WK2A 3SE9L 4CDGC 4GAYB 4ORGB 2DQCL 4XVJL 4NKIL 3MACH 1X5FA 5JR1H 2K9UA 3IETA 3BH8B 1HSAB 4TOYH 4KY1H 3SCMA 1GPOL 3OGCB 3S37H 1IQDB 3O11A 4QXTA 5DSCB 5GRZA 2XA3A 5GHWL 2FZ3A 1VPOL 4N0UB 5KTEL 4ZQKA 4ODHL 4M43L 4E5XA 1DDHA 4DVBA 1SY6A 2HFGL 3O3EB 1T20A 3VXSE 1R5WA 1E4WH 4NZRH 2J1KA 4KTYA 1YNTB 3JWDL 3B2UD 1MCRA 2X4OA 2Z8VC 5GRJL 4LPUA 1NEZA 3EDJA 2YA1A 4RZCA 3VH8A 1CG9A 4OIBA 1OAYH 5L0QC 1DFBH 4H8WC 2P5EA 5F6HJ 4MNQE 5HHOB 5FM4A 3T0AA 3G9AB 2F54A 3DXAE 3QHFH 3P9MA 2ARJQ 4PJAF 3QRFM 2EYRB 4S1SH 1YYMH 4F37K 4QHUA 3RL1B 1KSRA 3O4OB 4F37F 4PJXF 1TJHH 1HKFA 4JO2L 2I60H 3P40A 4L4TB 5CP7B 1ACYL 1EGJL 1MFEL 2BOCA 2WQ8A 4I8DA 2MSPA 5CEZD 4J3UA 4X6FB 4J4PA 3QG7H 1A2YB 1RIHL 1XR8A 2HRPH 3EUUA 1KJMB 4NZDA 5C0CB 3FQWB 4YHYB 1J86A 3VDBA 3HR6A 2W1NA 4OGZA 4F7PB 2DAVA 4PJ9A 3B3IA 2ESVB 5GISH 1FFPB 3VE0A 3GDBA 4OF5A 4YHKL 5EIQA 4EDXA 5A2IH 1FNLA 2A73B 2LTQB 3EHBC 4JN2B 1R24A 4OFDA 1DLFL 4O9HL 4OBRA 4Y4KA 1KEGL 5FO8B 4FQLL 3I6LE 3DYPA 2XWJB 4HS6A 4Y2DD 3RVTC 5BW7C 1IMHC 3QUZC 2DTML 3OSKA 3UDWC 3VXMD 5B3JE 3UX9B 3C5ZD 1WCBB 2Z4QB 2N4IA 2R4SL 3LPFA 3MLSL 2MCPL 3U83A 1F4YH 3FQRA 5E2VH 5BRZE 3ULVD 1YEGL 3HR5A 1P9MC 2Z8SA 1DN2A 5CJ5A 5KVFL 2R0WL 2C3XA 4OCXL 3MRBB 3BISA 3T09A 1AGDA 3CX2A 5F96L 3VXNA 5DUPL 3QQ3B 1H8NA 3H0TB 4HWNA 3C8HA 4NN5C 1F02I 1MCCA 1YUHB 3ARBA 3CFDA 5EIVA 3BQUA 3BZ4A 1D5MB 1I7RA 3WIFB 4J23A 5C9JA 5FB8B 3I02B 3QIUC 4GMSH 3D69A 4ZUVB 4R8WH 3IDGA 4YZFF 3RNKA 4L1DA 2V17H 3EFDL 2Y9RT 4PJEB 3MRIA 1JNJA 4PG2C 1PY4A 3D3VD 4P9HC 4ZOAA 1WAAE 1H8OA 4R96B 1KTLB 4LL9A 4WI3A 1NGWA 2DBLL 5DMGC 1P7HL 1J05A 1EK3A 2BY2A 5F7NC 3PHOB 4YJZL 1JF1B 3GHEL 1HHIA 5JUEH 2EDKA 3N1MC 5TDOB 4YX2L 1MEXH 2YUZA 2XXMB 2C26A 4PB0H 4JN1H 1B0GA 3BHBB 1RUAL 1BP3B 4PTTA 3WFBH 4G6KH 2HH0H 3UROR 4JKKA 5FM8A 3MLPA 1JV5B 2X9YA 5I75C 3MNZA 4HGMA 1KXVC 1FL5B 3MFFA 4HUUA 4MQSB 3HN3A 1T1ZA 2HJKB 3ARXA 3GHBH 2AVGA 4DN4H 1HI6B 3D39D 4FXKB 4UNVA 3ZZ1A 4CMMA 3O6FA 1ZA3B 4Y5XA 2JK5A 5EBLB 1D6EB 5F7KC 5CWSA 1G9NH 4PJGB 3RDTC 5E00A 5CD5C 1W2KT 3ARZA 2YK1L 4PJIF 5JXEA 4RFNC 3QEQE 1J1PL 4TUJB 1P4IL 5C0IA 2EZ0C 5ICZB 3EOBB 4GG8A 4R97B 1CXFA 3TN0D 3VFUA 3BT2L 4YC2B 1HQ4A 4QHKJ 4GRWB 5CJOH 2LFGA 3ULUD 3HAEG 2PUQT 4MNHB 4OF8A 4RFOH 5C0JB 2UYLB 3FT3A 5C09A 5B38B 4XCYA 3K1DA 3NIFF 1A9BA 2VDOL 3GSNH 3NA4A 4TPRL 1BMGA 3MRJB 4ZYKB 4ZUWA 2D3VA 2VUYA 2R0ZH 4OLZH 2YXFA 3ULVH 2H32B 1N5YL 3IRZA 3B2VL 4DQOH 3S36H 1NGZB 3GNML 4JY6A 4K7FA 3SJVB 4WEBH 1GGIL 5HJ3B 2J6EA 2QQLH 3Q6GH 3I3BA 2WBKA 2X40A 1RURL 3QAZB 1V7NL 2FHCA 3BUTA 5HSFA 3ARFA 3ZDYE 1F6LL 5IB3A 2CDFB 2W0LA 2JTDA 3DV6B 3PWPB 4YPGA 3EO9L 4BZ1H 2BXYA 5D7LE 5ENWA 1NCBH 3LZFH 3FQTA 3SCMB 1UKSA 3LVEA 4QXTB 4Z8FH 4WU5B 4BQCA 2EXWD 4J6RH 5IVXB 1UM6H 2DQFA 2VLJA 5F7UA 1IC7L 1EDQA 2X4SB 3N1GC 2G9HB 5B39B 4NQCE 3CNKA 1A8JH 3V5DA 3SE3A 5ABDE 4CJ0A 5ADPH 3VH8B 1CG9B 3H2WA 4B53A 5JIHA 4N0CC 3C6LD 3P2TA 4JFEB 2PYEB 2XNAB 1TETH 5HGDA 2VDRL 3HMXA 1VEPA 3L3HA 5T5FL 5BV7C 1PZ5A 2FX9H 2E27H 3C6SA 4XP1H 2YN3A 3KPSA 5F1KC 3EIFA 1FGNL 1T0PB 4FQQB 1I7TA 1DSFL 1B2WH 5DFTA 5C07D 3KDMA 2YMXL 4I13B 4XNZB 3ULVF 3RGVA 3VXQA 1S7XB 3FAXA 3ARRA 1FO0L 2WW8A 1QLEH 3C60D 1DBJH 1QKZH 1JHLL 3IDMA 3I9GL 4X6DA 1JK8B 1UM5L 4NBYB 5E6ZA 3S6CA 1N64H 4JREC 1YNLL 2AV1B 3TCLB 4YQXL 4EDXB 5DGRA 3ULUH 4M9OA 4UDTB 2Q7NA 4Y4KB 4X6CB 1J10A 1MQ8A 4HS6B 1UQSA 3QXTA 3WL9A 1IFHH 5IQ9B 5D1ZD 2VSDA 2V7HB 3C2AL 4OFKA 1NMCB 1MIEH 5FGBA 1BJMA 3W39A 4QTHB 4B41A 1CK0L 4ODBD 4CW1A 5GZOD 3HHRB 2NY7H 5FYJL 1DBKL 4PTUA 1IGYA 4K7PL 2XYCA 1UCBL 1S7QA 3H9SD 1T0MB 3OZ9L 1IZJA 4JG1L 3KNBA 3BPLB 3QNXA 2Q3AA 2R29L 4PGJA 2Z0BA 3DMMA 1B90A 4XPFH 3K4DA 5DJCB 5JW5A 1Z9LA 1JNNH 3BQUB 1MWAL 3B9KD 3BZ4B 3OKMA 5E4EC 2G60H 4H25A 3UJJL 3D69B 3MJ9A 3CCHB 3KPMA 5MENB 3D1MC 3RNKB 3W81A 2OZ4H 1A4JB 3MRIB 4X4YB 3WJLA 1YPZA 4J2XA 1NMAH 1NCWL 2ICES 1NGWB 1VFMA 3IDXL 1J05B 4PJDE 2VXQL 4YHOL 4KK6C 5DMIL 3GZKA 3SGJA 2DDQL 2I25N 5BJTA 3H8NA 4YDLB 1Q9LA 5JW3H 1TTFA 4KI1A 2YWZA 4LNRA 4OCSH 5DD3L 1ES0A 1RZJL 5DEGB 4MX7B 3CC5A 2G2RB 4M61A 3QXAA 3HTLX 4H1LH 3ZE2E 3MNZB 3U7WL 3VRLE 4XMKL 2Q8AL 5TJWK 3ULUF 1CGUA 4CADA 4UV7L 3L1OL 1DL7H 2ICEB 2P8LB 2XTJB 3PQYA 3QJHA 3S5LB 3TT1H 4XWOD 4CMMB 4QRUB 3BAEH 4JQVC 4ZFOA 1S3KH 3RI5K 1VKXB 4ZSOA 4NQED 2R2CA 3V52L 2X4RB 2CR3A 3RI5F 5E00B 3O4OC 4QF1A 1UWXK 4CRPA 4GKSB 4KV5F 5I8OH 2MPAL 4K55A 1HOCA 3ZKMC 3VG9B 3QO1B 3QFJA 2FECI 5GRXG 1OVZA 4KJQC 4YHYC 4H8WL 4RWHA 2XZCL 4X5WA 3RWIA 4UV4H 5TFSL 2NY5L 1LMKA 4L8BA 3KS0H 5DVLA 3O2DL 5DJZA 1CD1A 4TVPH 4MJ4A 1RZFH 4NIKB 4XCYB 5KS9E 3MLTA 35C8L 1CVSC 3F7VB 3DGGA 3WMSA 4PS4H 5E6ID 1FYTB 1GZQA 4PRAB 2BMKA 2X7LA 4HIXL 1QFUL 5L2JA 4HMDA 4AL8H 5HHPB 1BVZA 4WEUD 4LLUA 2MKLC 2VDPH 2VZ3A 2X44D 4RRPA 2ATPA 3LS4H 2QADB 3FOLA 4JY5H 3Q6FA 3S88L 1EEUA 4MCZA 4JY6B 4K7FB 2W59A 5DT1H 5E24E 2IBGA 4Z7VE 1PAMA 4M1GH 4C56A 1PG7H 3ARDD 2MQ3A 2Q6WB 3ARFB 3RPIB 3KYOA 3FB6A 3KLDA 5HPMB 3E0GA 3LN9A 1OAZL 2BVOA 1DANU 1MUJB 5J56B 5TH2B 5H35B 3WHXB 4NN7B 4PY8I 3FO2B 5KSUA 1Q94B 5JIIA 3RBGA 5HYIA 2QHRH 3FQTB 2E9WA 2CUHA 4MMZC 5BXFA 4XC3H 4MNQD 5JOFA 2F9BT 1AQDA 1QSFD 4B0MM 3ET9F 4X7DC 4HBCH 3QZWG 4KHTL 5DJAB 1XF1A 4E41E 1DVFB 2DQFB 2VLJB 1OP3H 3DVGA 1S78C 3MNWB 2ZG3A 1TCMA 1TJIL 3N9GH 1NFKA 3BZEA 4D0CA 2XKNA 3V5DB 4K07A 2KPNA 2FO1A 5DEFA 1U3HA 1F4AA 5FDYA 1B4JL 3H42H 4BSVB 4L4JA 5E2JA 3MV9E 4LARH 5GS3A 5HGDB 5HDQL 1H3TA 2IQAA 3TWCH 1AXSA 3HNSL 3PHSA 4U33A 4GSDH 3CFJA 1PZ5B 4B7LA 1A1NB 4K8RD 4ODTH 4Y16A 3MREA 2CLVB 4P9HL 5GJSL 2AABH 3OKKA 4LSRH 4M48L 5JHDE 4LIQL 1LEIB 3FN0H 1AKJB 4JJHA 3FQUA 4PREB 5F7FA 3RGVB 3VXQB 4DJMA 2FLRT 1Z2KA 4X6DB 2O5YL 3JTTB 2JF1A 3PWUA 5HHXL 1MHPH 3G6JE 1Q0YL 4BKLB 1VESA 4OZFA 2C1OA 4TSBH 5FM5O 5KVEL 4L8SB 1YEFH 4LASL 4OFYD 1SBSH 4JANB 3JWNC 4K7PX 5EZJB 5DD1L 4HPOL 4R97C 5ICYB 1M6OA 4PJ7E 3BW9A 5D7IB 5FYLE 4P2RE 2GJ6A 3LMJH 5K59E 4OM0L 3EYSL 2NNAB 3KR3L 1F6FB 1W0VA 4PTUB 4U6VH 1OP3K 1S7QB 5SWZA 1DP0A 4DTGH 2XN9D 3ARPA 4XVUC 5CJXA 1P5UA 3AREB 3BN9D 4UIMB 3DUUA 4LSSH 5EOCL 4NQXA 3MV7A 3DO3A 3VXPB 3V0VB 5DMYA 4A2LA 3FFCE 3L3JA 5EO1A 3QNXB 3KJ6H 4CVWA 3FRPG 1JPSL 4JM4L 5EPMA 3AC0A 4LPTA 3V5KA 1K4CA 1NAMH 1YJDL 4WI4A 3QAZC 5FHBL 5FO9B 1RVFH 5ECJE 1NUDA 5DD6A 5FOBA 3O4LD 4TQEL 4WNQB 4WJ5A 2Y07L 3G5YB 3KWWA 4NQUA 2Y4SA 4XMLL 1F3JA 3PL6D 3RY4A 1G9MH 5D6DC 3AS3A 5GGVL 1QPXA 2DTSA 2OI9C 3M8OL 1NAKH 4NC1C 4XC1H 4XNYH 2CO7B 3V7MA 1OTUD 2FBJL 5BJTB 2AEPL 3ARGB 4IOIB 1G7JB 4F7EA 2RIKA 3UJIL 2WIIB 4LNRB 4JFZL 3VMPA 5DD5L 4HIIB 4APQD 5IB2B 4HFUL 1A7RH 4GAGL 1B3JA 1DZBA 1A7PL 3C09B 1JPTL 4YPJA 1R6VA 3P11H 5E7FA 1E4KC 1DN0A 3SPVA 4V1DE 5ITBL 4LSPL 4M61B 4KTDH 3IJSA 4RBPH 2ZUSA 3W0WE 4F8QA 3O8XD 2J8UF 1D5XB 5GGSB 2VXVH 2JB5H 3QJHB 2H2SD 2NY1D 3CIQA 3QQ4A 3OXRB 2VSCA 4ZFOB 5IFJB 3LRGA 3R1GH 1IEAB 1LE9B 3F58L 4CU7A 4GJTB 1HYRC 3LKPA 4PP1C 4IIQB 4JG0L 1FH5H 4PG9B 1FAKT 1MH5A 4QRRD 4FQXB 5LGJA 4YAQA 1YA5A 4MSWA 3VFMB 1T21A 4A6YH 4YHMH 5C2BH 2NCMA 1Y6KR 4PB9L 3ILPB 5ESAB 4XNUH 3MODH 1KPUA 3B8YA 3QFJB 5IQ7L 3CZJA 5AZEL 1T1XB 4XNZC 4YDKL 2AI0H 2GYSA 1R5VB 2Y06H 3MLRL 3RWIB 2ZSWB 3REWB 3GSVA 1KPRB 3QFDA 4GS7B 3UBXA 3FQXA 3ZHKA 2P1YA 2LU4A 3CMGA 2EDOA 2H9GB 3MLXH 5BV7L 3STLA 1Z5LB 4NYLA 4Y19A 1PW3A 3KPOB 3MRLA 1CWVA 5F72S 4PRHA 5GIRB 3HNTL 4UZGA 3NN8A 3W9DB 4YHPA 1JGDA 3ZTJG 1UGNA 5JOPE 3BKYH 3FZUC 4WWKB 4QTIH 3X3FH 3TIEA 1CGTA 1RUQH 2ATPB 2XQYK 5L9DH 2UVEA 3FOLB 1RIUL 4Q9BA 2HT2C 4RAHA 3VXRA 1TQCB 1NMCC 2BSTA 1EFXB 1H8SA 2CMRH 2FO4B 1LILA 4K3EL 4R2GC 1DBBL 3TPKA 4C56B 3O3BA 3VA2C 1G6RL 4S1QH 3D2UD 3BWUC 1PLGH 2NY3B 3KYOB 3QCTH 1PKQA 2J88L 4RBPK 4LSUH 2BVOB 1AGFA 3LEYH 5CGYC 1V3JA 3RZCB 3VFNA 3QJFA 1HYSD 5I18L 3BPLC 4IMLB 4N5EC 2VL5A 3LEVH 1U93B 4OIIL 5EC2B 5L2KE 4R0LA 2HFTA 5GRUL 5JOFB 1MCWM 1RJYB 4K71C 2BFVL 2NY6B 4FRWA 1EHLL 2BVPA 2MKWA 1YYLL 3NH7L 3DVGB 3QQ9D 4D9RD 4XTRC 5C7XH 5B3JF 1AXTH 4JQIL 1CLYL 1R3IL 1RUPH 2XKNB 4X83A 5FYKE 4ZAKB 4WTZG 5ISZB 5LCVL 2Z8WC 3P30L 5BS0E 2AS5M 2XRAL 4YDLC 1KTRL 3HZMA 3O6MH 1FNHA 1I8LC 1EHAA 3MPCA 3QXUA 1BFSA 5CUSL 2IQAB 4IOFC 1E4XI 2GK0A 2XA8L 3GGWA 4AMKH 3RP1A 4HUKB 4LVHC 1ZEAH 4BFEA 1KG0B 2EICA 4ZUSB 8CGTA 5T1KB 4LDOB 3OKKB 4UILL 4JO3H 2X4TA 3MA7A 4M7JH 5LBSL 4FQIH 3JTSB 4AENA 2VB5A 1LO2H 3HLAA 1JPGB 1H3GA 4DGYH 4LRIC 5FUZL 4GRMA 3EKCA 8FABB 3KG5A 1A6PA 3G5ZA 3VGEA 4OZFB 1GCFA 1T83A 4B50A 5IT2L 4DZBA 1CR9H 2D03H 3WKML 4XCEB 5B8CB 3WYRA 4G9FA 1BQLH 3GSWA 2JJSC 3VG9C 1C5CH 2DJ4A 1M6OB 2KZ1B 1SMOA 3BW9B 5AD0A 3BE1L 4NFCA 1S7WA 1OAUH 4PJAA 4U1LA 3MV8E 1U8LA 3SQOL 3F5WA 3O2WH 1W0VB 3JSSA 4JB9H 2ZCKH 5E1AA 5SWZB 3ZSTA 4WO4B 3EYOA 4PJXA 3HMWL 4I2XE 4NQXB 3MV7B 2WZPD 1YY9D 5D9SA 3L3JB 2ZSVA 3HKFA 4NPYA 4NQDE 4CVXA 5E5MA 1RZ8B 5DWUL 2MCG1 4KH2A 1K5NB 3FRUA 4OM1L 1K4CB 1HIMH 3PWLA 5I1HH 1HHHB 3LKQA 5DD6B 5FOBB 1F4XH 3RVUD 1MQKH 3SY0A 4RMVA 3IJYB 4CN4A 1LP9F 2ZG2A 3KWWB 3DX8B 5C3TA 3DUHA 3SOBH 1F3JB 2MWCA 4Z7QF 2YBRB 2X4QB 1BQHG 1GC1C 3LH2H 3D85A 1KCUH 2FGZA 1UA6H 1VA9A 3IFPA 4F7EB 1KCRL 5BO1H 2G5RA 1MPAL 4M1DL 3VMNA 5JIKA 5FF6A 1NC2A 5C0BE 1KJ3H 5E95B 4X4XA 1F58H 2CKBB 2JIXD 1U8QA 3TJEH 1DVFC 3GKWL 2NX5D 2EH8H 5CZKA 4G8EB 4P23A 3IXAA 3IJSB 2QL1A 4G8GA 1YY8A 5EUKA 1C7TA 4B5EA 3SE3C 2FYYB 1Q38A 4O5LL 2WUCL 3VMOA 1NGXA 1AD0B 1J0HA 3D25B 2YKLL 1H3XA 1NCDL 3L5WB 5JMOC 2OP4L 3KLHD 4M7KL 3QQ4B 1A4KB 1CFBA 1TNNA 5EU7C 5DRXA 1U2HA 5GSVB 3L3IB 3ZDYF 4PJ5B 3LN5A 5T1LD 2XOTA 1AHWA 2PR4H 4PJCF 3HNVL 5J9PB 3LKPB 2FEDC 1U41A 4WUUE 4OGYH 4ZODA 2GITA 5MP6L 4YAQB 4H5SA 1T22B 3KPNB 4PRDA 1T21B 4AT6B 4KC3B 1S9VB 5SWSB 1E28B 4M7ZB 4QHLB 4YNYA 4RFEA 5IHUL 3MXVH 1HQRB 5JW4M 5C0GB 4EOWL 2X4UA 5I1EH 4O58L 1A7NH 5EZOL 4HIHA 1EIBA 3UTSE 3K8LA 4WI7A 3GSVB 4RAUB 1IGIL 3A0OA 3FQXB 4LKXA 3INUL 3L7FA 5KW9H 3Q48A 5ID0A 4OF6A 4AYFA 4L8SC 3CMOL 3RY6A 1KJ2H 1QFPA 3NN8B 4GBXD 1JGDB 2Z92A 5C0ND 3T4AB 3CLFH 3TIEB 4RAVA 4Y1AB 2DQIL 3E6HA 3BYTA 5E8OB 4C59B 4LSVL 1L0XA 2X5PA 1R5IB 3U9PL 4PJIA 5E2UL 3DJ9A 4JM2B 4KRPB 1I9EA 1PKQB 1T5WB 5ESQA 3AREC 1J8KA 3DVFA 3QJFB 2L7JA 1S7UB 3MXWL 1MHHA 3LKOA 1KELL 2QR0A 4R0LB 3ILQD 43CAA 3FO1A 2BNRA 5E0QA 2F15A 2F5BL 1BIIB 1VSCA 1E6OL 4D94A 3C5JA 5IHZB 1AI1L 3WJLC 4HEME 4HMCA 4D9LL 3VGDA 4YR6B 1VHPA 5CBEA 1P4LA 2VIRB 1FGVL 1XGYL 4XI5C 3C08H 5H37G 4EI5D 6CGTA 1IGJA 3OF6A 5E5UB 1BJ1J 1Q0XH 2YD3A 1CS6A 5E2TL 3ARGC 3OKNA 4HKXA 4IRSD 1TZHB 2D9QB 1A6WH 5ADOL 1CQKA 1QPPA 1WSST 2W38A 3CZFB 2NY2B 4QRPD 4HX1B 4ZOEA 4G6FB 5I1GH 1H3PH 2GK0B 3GGWB 4BFGA 3BEVB 1JPFB 4WDIB 1UB5A 1E4JA 1K2DB 5GRVK 1JN6B 4YIQA 4G6MH 3I85A 1XR9A 3BPNB 4Y4FD 2GSGB 3MA7B 1TVHA 4KI5C 3IGAA 4AENB 4LOUC 4IS6A 5IJVA 5I66A 1ZVSA 4GLRH 3VWKD 1DQJA 5D4QA 3T2NL 3ZTNL 1MCEA 1RULL 5GS1C 1T2XA 3G5ZB 4IIQC 4FQXC 4LHQB 4KZDL 2IANB 2EDLA 3S98A 4DZBB 3QIWC 1C5BH 5IVNA 3GSWB 1FVCB 4GFTB 3QDMD 1ZLSH 4LHUB 4XP4L 5C8JB 4OLUL 2I07B 4UTAL 5AD0B 2AK1L 4HQQH 4TRPL 1NEZG 2Z35A 4QOKD 1VGEH 3LRSB 4Y2DA 4GS7C 4PJHE 4U1LB 5GGRB 1U8LB 3NAAL 4DZ8B 3BGFB 3QPQD 3PGFH 1MHEA 3VXMA 4RX4D 2A6KA 3OB8A 3C5ZA 4UOW1 5E1AB 1YNKL 5DJYB 3VRLF 1FG2A 4PJXB 3GSNA 4HXAH 3R06B 1ZWIA 3KPRA 5IFHH 2GKIA 3ZE0E 4PLKD 1FFNB 3BD3A 5D9SB 5E8DL 4WWKC 4G6AC 4NPYB 2CGRH 2HG5B 4G9DB 1Q72L 2AJSH 1CGWA 2WBJB 3GMLA 4F57H 1MF2L 2FJHA 3PWLB 4N1CA 2NY3C 5MI0B 5C0DA 1JIBA 2V9QA 1DQTA 4JFYA 1MOEA 2EXYC 4G80A 4Y5VA 3RZCC 2QSVA 4HEPG 3SE8H 3W0WD 3FO9A 3U4BH 1KEML 1WWAX 4LDEB 4QXWA 3QP3A 5KS9F 4MA1B 1I8IA 3UJTL 4P2OC 5CILL 3PWNA 1QFWH 5CHNB 2NY6C 2YHGA 2UY6A 3CVIH 2VLKE 4OZGB 1I1FA 2H3NA 5ALCL 1A3LL 2OJZL 3MLZL 5I8CB 3VRJA 3UTTE 1YY8B 4LCYB 4ZAKC 1IAKB 2XWBA 3PDGA 4Z7VF 2QSCL 1YN6B 4ORZC 2YA0A 2VAAA 3DYMA 3X12B 1N59A 3HE7B 1BVKA 1S9WA 4G7YH 1TTUA 2DLFL 3LN5B 4XMPL 2HYMA 1MRDL 5CIPH 3PXHA 5AZ2H 2GITB 3D39A 5DFVC 5IF0A 4H5SB 3O9WC 4I18C 1ZTXL 3VGAB 2E7HA 5D6CA 2YA2A 4JFFB 4K3HA 4YNYB 2X1QA 3CPLA 4HIEA 4RCAA 3U4EA 2HFFA 4OLYH 5F3BB 1URLA 2VXUH 3VI3E 3JWOH 4H88H 3RWHB 3PHQA 5KSBE 2WM0A 2X4UB 1MY5A 2PXYB 3DRTB 2GY7B 1AD9A 5IBTL 5A2KH 1AO7E 5K9OB 4U31A 4P3CL 4JQXA 1D5ZB 1NLBH 5I8EB 1IAMA 1CD9B 2FD6L 4OGAC 3TN0A 5ID0B 3EBAA 4G7VH 3DSNA 3VWJD 4M02A 4Q9QL 5SX4H 3F6LA 2X10A 5DJ0B 2CXGA 3GMOA 5B8CC 4UT6L 4P2QE 4P46D 5D8JL 1RAMA 4KWUA 5LGKA 1U8JA 3BKCL 3WXWH 2R56H 1BZ7B 4TVSa 5T1DL 4R6UA 2BJMH 3QG6A 3WFDH 1U95B 1WIOA 4OKVA 2F19H 5L2KD 3WCYA 1GHFL 4NZTL 4GQ9H 3FOMA 3M45A 4PJIB 2APBA 2VC2H 1P5VA 4WO4C 5KN5B 3QI9D 3CSPA 4RMQA 4HG4J 2CK0L 4KUZL 4NJAH 1JZ4A 4QCIB 2H45A 4ZO6A 4FQ1L 3SDDD 1A21A 5C0RL 1HK6A 1MHHB 2V2WB 4GXUM 3A6CL 1I9IL 4F33A 1I3VA 4MNGA 5EBWA 3FO1B 4HGWB 4JAMA 3M1BA 1CLOH 3G6JB 5HDOA 4X9FA 3RWEA 4BELD 2OZ4A 1FAIH 1MJUH 4LSDA 2ICWA 2ITDA 1P4LB 4PJ7F 4X6EB 5DA0B 3QUKA 1WFNA 5C1MB 1FPTL 3ARYA 5K59F 1IGJB 4JGUA 5KJRH 1J1XH 1NL0L 1IEHA 5HHVH 2J6EL 5HGGS 1OAKH 2FL5B 1NCCL 2XY1A 4MAYD 2AV7B 3ZL4H 1A7QL 4XPBH 4POYA 3GMRB 2UWEF 3LEXB 1I7UA 4NWUH 3MZGB 4K9EL 2YRZA 4LCIL 1UB5B 3T0ED 4G42B 3NPZB 1IAOA 2ATKA 4QRTB 3RWJA 5KOVC 4H1LA 4YIQB 3WDHA 3V6OE 4HIJA 5JW4N 3IS0X 1BGXL 1YEJL 2VDNL 3U48A 2IFFH 4DKFH 3IGAB 5DK0A 4NO0B 1NFDE 1Y18A 4RISL 1U6AL 1F3DH 2VQ1B 4AIZB 3G08A 1IAIM 2FJFA 1IC5L 1CCZA 1C8PA 2VTFA 1IARB 4IDJL 3MMEB 2C3VB 4OGXH 5INDA 4UIKL 4L4VA 3SN6N 1HINL 3C60A 3IU4H 4G43A 5FKPB 3NVQA 3RHWK 1X7QB 4Z7OE 4M7ZC 2X1WL 1MCHA 3MBEA 4K3DH 4F58L 4NRZA 3SGDI 3B6SA 1G6VK 1I9RL 3RHWF 3FN9A 1MJ8H 3JV6B 5GGQL 3MV11 4X9IA 3ZDZE 4M6NL 1A47A 4Y2DB 3WNKA 3TPUB 1B6DA 3NBNA 3HMXL 2HT4D 1G7LB 5E9DE 3GSXB 5ICXA 4ZNEE 5D1ZA 5E8PA 3F6IA 2A6KB 3C5ZB 3TBTA 1KBGH 4L9LC 4LF3A 2DQEH 1JHTB 3FFDA 1IKNA 1OARL 3L3KB 5EOQH 1Y0LA 4XVSL 1NFIB 3VJ6A 1BEYL 5K9KA 2EYTA 2XXCB 3OBAA 5D71L 3H9SA 2EIBA 5SX5K 5HI3D 4KPHH 3P0VH 3QDGD 3GUTB 4PIRF 3GMLB 3ZKSD 2FJHB 3S97C 4BFBD 1EJ6A 5FYKH 3MGAA 4JM2C 4KRPC 5C0DB 1A7OH 1Q9KA 2KQMA 3ZHDA 3QT2A 3NZ8B 2DQTH 4Y5VB 1AR2A 3T8XA 3DECA 2XZAL 2YS4A 3HI1A 5F9WB 3FO9B 5I1LA 5CS7A 3D3VB 1FRGL 4R26L 1LEKB 1UWEL 1BLNB 4UTBH 3Q0HA 4R0LC 2OL3B 3ESVF 4ODXA 5FAAA 4GW4B 4XP9L 1I8IB 2EIZB 3LHPL 1E0OB 4IJ3C 4LHJB 3TNMA 2IPKA 4XPTH 3NCCB 4XP5H 1N0LA 4LQ1A 3DX6A 4KZEH 1D9KD 4H20L 4XAWH 1I1FB 2H3NB 1YECH 4WUUD 2CUIA 5DO2C 3SHSA 1Q9OA 2Z31C 3RKPA 3VFWB 4UT9L 3W11D 4KK8C 5HYSA 4LMQE 5EH1A 4XB8A 2DQJL 4N0FA 4F7MA 1QFOA 2Z93B 3OJDA 3UC0L 3HG1D 3KHQA 3K4AA 5EN2B 1BVKB 5EWIL 1KIRA 1LK3L 4JPVH 3UTSD 2NY2C 4RGOL 3MJ9L 4NBXB 1W72B 4RDQG 1OSPH 2XZQH 4DW2L 2BSSB 5IF0B 4IMKC 1CXLA 3RQ3A 1SMAA 3OKOB 3S34L 1P7KB 5C0AD 1ED3B 3A6OA 4HIEB 4JDTL 4JPWH 4NQEA 3SBWA 4EDWH 2DS4A 2HFFB 3JBG7 1L4IA 1YMME 3VXOA 2R2EB 3FN3A 3T0BA 4RMTA 1AD9B 4FTVB 1Y6MR 1INEH 1WT5C 4P99A 4YH6A 3Q1SH 2VKXA 3BWAB 4NUJA 3CXDH 4ZPTA 4EZMA 5T3XD 1A0QH 1PY9A 2YD7A 2FBOJ 3GJFK 2NLJA 2J8UA 3GKZA 3SGEI 3FJTA 4NGHL 3V8CA 1MCLA 1BJ8A 1UWGL 1EMTH 5BZDB 3ULSB 4KDWA 1IGML 5E6IA 3QG6B 4PJFB 4NZUL 2XI9A 5TGBA 4ZFOL 4OKVB 1FZKA 2VE6A 1XIWC 2KDGA 5GQBA 1KB5B 3DX7A 5EU3A 1GGUA 3BGFC 3KYMB 4WENB 5FYJE 3V4VH 1U3YA 2B1AL 2RBLA 1X5XA 1KENH 3S4SA 4UI2A 2Q87A 4LLWB 4E9LA 3DO7A 2PO6D 3MRFB 4LEXH 3TGXA 1P1ZA 4HH9A 3UBXI 2AJ3A 3PNWA 2OX5A 2D7PA 4NM4H 3EJZC 4MLIA 7FABL 2C5DC 4MXQD 3PE9A 5KSVA 2R1XA 4DCQB 4F33B 1NCTA 2WBJC 3WE6A 4CVZA 5J13B 4FQHA 2UZXB 1WEJL 2A77L 4U1NB 2DL2A 3G9VA 1NAMA 1A1OB 4XH2A 1N0XL 5JW4Q 2AK4E 2V9TA 4LCWE 5MI0C 3BVNA 4XAKE 1KFAH 4JKLA 3MJ7B 5DRNA 2ITDB 3M07A 5FGCB 1MFCL 2ZUVA 4MNQA 1QSFA 4X7EC 4HPYL 3DXAA 1MNUL 3EOTL 1BM3L 1JYXA 1JNHB 4NQVA 2DLIA 4U1IB 1KIQB 5HPOA 4HF5H 1LDPL 4WFGE 1Q1JH 1SM3L 1QBAA 2ZJSL 4MA1C 5CKGA 4JLRA 2XKSA 5F71A 3ZYOA 5HGHB 1NCAL 3OL2A 1DBAH 3P0YL 2R0KH 1YEKL 4NCC1 5JW4R 1DEEA 1XT5A 3OAYH 1FFOA 1NCUA 2A6JA 4U1MA 2YUXA 1BZ9A 3C6LB 4D0DB 2IMMA 1RZKC 4KJYB 1HEZA 4O51B 3NFPB 3WSQH 3MLWL 4ODVH 3HE7C 1L6XA 2FJFB 3DVNA 1YQVL 4GUPA 3DETC 5C07B 5I1AA 3RUGE 2P5WE 4FZEH 4MJ6A 3C60B 3VGAC 5BVJB 7CGTA 1MSPA 4PR5B 4POUB 5AUMA 1QSEE 4A6YA 1MI5D 1BBDL 3GMNA 4XCNB 3NZHL 5C08D 4CGTA 2X89A 1Z0MA 3MCLL 3MGTA 2XG4A 1FLRL 5T3XH 5BRZA 5LXGH 1XF4A 4Z76B 5DTFA 2PXYC 1IC4H 1HH6B 4YXKH 4I3SL 4OFYA 4Q6IA 4QHNB 4WFEE 3SKUD 1EAPA 3WO3B 3CLEH 4LSTL 5L6YH 3I3EA 2MFNA 4BZYA 2K7QA 3WFHA 5E8PB 4XBEL 3FKUS 5ESVB 3W2DH 4J1UB 5DMKB 1EVTC 1JHKH 2VDML 4ODSH 2QQKH 4GXUN 3WO4C 2EYTB 4NCC2 5K9KB 3FO0L 1IEBA 1EVUA 1PYWA 5D2LF 3UTQA 3NPSB 3WKNA 4LQFH 4QY8A 4JHWH 5F1OB 1GIGL 1A64A 5JQHC 1IGCL 4NHUB 1AY1L 4OCRL 3SO5A 4JKWA 3OAYK 3L5XL 2R0LL 3B9KB 4X7TA 3WHE1 3G6DH 1QA9B 5DR5L 1KCSH 1KTDB 3U46A 5EZIH 2IBZY 1HSBB 3IKCA 1ZSDB 3UTTD 3HI1B 3EAKA 1NC4D 3O4LA 1LDSA 5I1LB 4PLJC 2R23A 5JO5B 2KKQA 5LAXA 3N85L 5D1XB 1MCOL 1KLUB 5K9JL 3MTRA 4URTB 5EC1B 5FYKU 5F7EL 4L5FL 3DX6B 4I9WE 3KXFB 3TVMD 1PJ9A 4RWYL 5HHNA 1ZA6B 2WAHA 4JDZA 4GOSA 2GUOA 4APQA 4Q7DA 2NZ9C 1F97A 2F54D 4J3WA 4F7MB 1NGYA 5F9OL 2COQA 2WWMD 1G0DA 1DUYA 5EU6E 3OJDB 3RKDC 2EKSA 4G6JH 1CL7H 3QEQA 2NW3A 2DWEB 3O8XA 1NDGA 2EH7H 2CR6A 1LP9A 2HLAB 5DVKA 3L3OA 1OT2A 5IJKA 2HLFD 3OX8A 1ZT4B 4PFEA 4J4PD 4M4PA 1OP5H 1LO4L 2QKIB 2F8OA 1WIPA 1T6VN 1EO7A 4LIQE 2HTKD 2L4OA 1S9YA 3MX0A 4RIRA 5FDWA 3RWGA 4PJ9D 4QRRA 4OIAA 4MJID 5I17B 2OK0L 1XGUB 2ZNXA 4U6TA 3RL2B 1L7TH 3GBMH 4WI2A 5D1QC 3GSUA 4D8PA 4NUJB 2X41A 3IFNL 2VXTL 1V7MH 2AEQH 1BZQK 2R4RL 5J6HB 43C9A 1P7QD 4I3RH 5MEOA 1EJOL 3BP6A 3SO3B 5CMAB 5H37H 3RWCB 2J8UB 5EOCJ 5I2IB 4HS8H 3V4PH 2IPUG 2BSRA 3HC4L 3BD5A 4LLYB 2H2PD 1BOGA 1KPVA 1KIUA 3AY4C 4O02H 2Y25A 5KVDH 1ZS8A 5E6IB 5GJTH 2HTLD 4NKMB 4WI9A 2IH3A 3SE9H 4PJCA 2DQCH 5EU3B 2QQNH 4NKIH 5D7SH 1BD2B 5D7LA 5IB5A 2EDTA 4PRBA 3W82A 1CDJA 3CSYA 4JRYE 2ZCHL 4CKVX 3BPCB 1KN4H 2XIDA 1CIUA 2VLLB 2VDKL 5E70A 4ZXBA 4I77L 2AJ3B 3ARDB 4NP4H 5KTEH 1I7ZA 1QFWM 3GSOA 2PW2A 2HFGH 1E4XH 4OD1L 4HJGA 2R1XB 5KSVB 4NC2B 1FFQA 4CVZB 2PNDA 1FSKB 5DVMA 1QLFB 4FQHB 1YEEL 4PRIB 5EZLA 3UAJD 5GZND 3UBXG 1MREH 3ALPA 4LAJH 4R90H 5I8KL 5TPWH 5FOJA 3IDUA 4BFIB 4KKAC 3F62A 5L88L 3VD9A 4HZAA 3IT8D 4M5ZH 1QSFB 1H5BC 1P69B 5E94A 1CGSH 2IPTH 1I85A 5F88A 4PJHF 2CKNA 1U9KA 2OM5A 3NCMA 3T4YA 4TSCH 2G75A 1CU4L 3TFKD 5TE4L 4LU5H 1RJLA 4CMHB 3V79C 4PV8B 2IC2A 4TSAL 1DEEB 1FE8L 3DI3B 5I1JH 2O61B 5BOZG 5EA0H 4K23L 4U1KA 3DROB 1AP2B 3O6FD 1DUZA 1FFRA 3MO1A 1VFBB 2NY4D 3C8DA 2WSKA 1DLFH 4IHOA 5KAQG 1V8HA 1NGPL 4FQLH 4BYHA 5JXED 1OGAE 3QIBB 1EEZB 1K9TA 5AEAA 2DTMH 4NNYA 1QRNB 3WUWA 5GGUB 1CICD 3C8KA 3HE6B 9CGTA 4A6YB 2MCPH 3J8F7 1X9QA 2NXZD 2GFBB 2LABA 2E7LC 2HRLA 1JPST 5DTFB 2FX7L 5C09D 4AK1A 1TVBB 4Q6IB 5F7HA 3R8BB 3WFCL 5DUPH 3IF1B 3TYGH 1KCVH 5MEPB 1NMBH 1X4XA 4MDJB 4NCDA 1JI2A 1G7PA 3EYUL 3BJLA 2JELL 4JFOA 3THML 4Y5YA 4N8VG 4WI6A 4DFIA 4XCCL 4XBGA 2Y5TA 4W4OC 4XB7A 1KJ2A 3OKEA 4X5LA 5ERWB 4Z7NE 3FTGA 3EFDH 5E99H 1IEBB 2XN9B 4KKBD 5ILTL 3RZWA 1INDL 3QBTB 3UTQB 1WITA 3MBXH 4OZHB 5CSZA 3IDJB 4Z78A 2DBLH 5KANI 1MAKA 4EUPB 4PY8J 3BDYL 4JPKH 1JMZA 2F74A 4R7NB 4XXCA 1PSKH 4H0HB 4RQQA 3U0WL 3L3DA 3QPXL 1ZXQA 5F1IA 1J8HB 5C71A 3O4LB 2M2DA 1QO3B 4MAUH 4M62H 1Z3GH 5A16A 5J13C 3BKJL 3PL6B 3F7QA 1BREA 4DGVL 3PGCA 3QDJE 1NSNH 1KLFA 4F9LA 1WZLA 5HHNB 2HMID 1A3RL 2PW1A 3IFLH 4C83A 3U9UB 5FK9B 5D2NA 5A2FA 1FZMA 2APTA 2EXWC 5BQ7B 4DUWA 4Y4HA 2BY1A 3WUZA 1NGYB 2JIXA 1MCJA 4JFDE 2RR3A 5AYQA 5IW1B 1YMMD 2YK1H 3V5HA 3UYOD 5IMMA 4OF3A 5FEBA 3KPSD 4FFWD 4Z95L 3O8XB 4HUVA 4FFYL 5A40E 1NDGB 5IBLD 3MRQB 3QEGH 1MJ7H 1ONQA 2UV3A 4DN3H 5D7JD 2NY1B 2YWYA 3C6LC 5FA4A 4P5MA 2MHAA 4O2CA 1S9YB 5FDWB 4HK3N 3LQZA 4QRRB 25C8H 3K3QA 3MACL 5JR1L 2OXHA 3IRPX 3ECBA 2PCPB 4TPRH 2BVQA 5DRZA 4HG4K 5KS9A 3R4DA 1T7XA 1S7RA 3WNLA 4KY1L 2X42A 1U92B 4ZFFA 2V5MA 3S37L 1VADA 5KSAD 3LD8B 4N0UE 5GS2D 4AG4H 1WBYA 3FT2A 1M71A 2A83A 3S3SA 4ISVB 1IQWH 5E2WH 3GNMH 5MEOB 5DXWA 1E4WL 2YC1A 4HV8A 4NZRL 4Z7VA 4UQ3B 1KACB 1RZKL 1XH3A 2CDGA 1BOGB 1KPVB 1YZZA 2Y6SD 1ZS8B 1MAML 2ZUTA 1OAYL 1DFBL 5HHOE 3F7RA 4W6XB 1CN4A 4GBXA 3WV0A 4Z6AT 4PJCB 5L8LB 3V2AR 3VFVA 3QHFL 4PYHA 4WCYH 4S1SL 5AAMA 1EO8H 1YYML 3GBNH 2GTZA 4PRBB 4C4KT 1WK0A 1DQQA 1NFDF 5J1AB 4L4TE 2JB6B 1VEOA 4TULH 3RX5A 2I60L 3D2UB 2GSIA 3GSOB 2WLYA 4JZOB 2VITA 1T4KB 1J88A 2DLTA 2DQDH 5C0CE 3QG7L 4HJGB 1IC7H 2HRPL 2EDNA 4Z18A 1FJ1A 1QP1A 4WFGD 1QHPA 2ESVE 4U3HA 5GISL 1FIGL 1G9EA 2DRUA 4UBDD 3AMKA 3B9KC 4U6HB 4HDIA 4XXDA 2L0DA 4NRXB 5CJQH 4LKCA 4WY7L 5AAWA 3ZDZF 4R4BB 3MYZA 3TNNA 3SQBA 1F3RB 5T5FH 1NBZB 4KU1A 5F88B 3AS0A 3QHTC 2FH8A 1R3HB 3CU7A 3HAEB 5F89B 1Z9MA 1PG7W 3EGSB 3RIFF 5D1XC 3T4YB 5I73B 1FGNH 4OBSA 1EEQA 2IADB 4EI5A 5EO0A 2DM2A 1F4YL 2FIRT 1FNAA 5JHDA 3MRRA 2O26U 5E2VL 2YMXH 2EDYA 5DJDA 1FC1A 2Q86A 4MYWB 2XACC 2P5WD 3PQYD 1T04B 4RA3A 1LK2B 3AUVA 4MD0A 1QSED 4QRPA 3U7YH 4ENED 1FNSL 2A9NH 4HFWB 4Z77A 1ADQH 3SKJH 2ICWI 3TJHC 3V4UL 5JTWA 4Z0XA 1WCQA 32C2B 3EZJB 1XCTA 5HY9A 3H9HB 1FG9C 2OR8A 4PJEE 1F5WA 5CIPA 1K8IB 2V17L 3O2VH 3CFEB 3VWKA 2FB4H 3LIZL 3CFBA 5GS2H 1CK0H 2VJXA 4IRJA 4K7PH 5DVOA 3MZTA 4R4NC 2PTTB 5JUEL 3MRMB 3I6GA 4W70A 1MEXL 3MRHB 4J12A 4JG1H 4LLMA 4NM8H 2UWEA 5F1NA 4U3CA 4JRXD 2J7LA 3WS6A 4PB0L 3QDMA 4JZNB 1X5ZA 4JN1L 1ETZA 5FO7B 4OZ4B 3LSOB 3OR7A 5ITFA 5CBAB 1H0DA 5F8RC 5I30H 1UC6A 3JZ7A 3SO3C 1MWAH 3LDBB 4QOKA 1SJEA 2HH0L 4M00A 3OPZH 3BO8B 5DQ9B 3WIIH 3RVTD 3QEUA 3QUZD 3EO1B 5JNYB 3GHBL 3ARSA 1RUKH 3LKRA 1MCDA 3IDIA 5CSZB 3DNKA 4LLVA 1AGCB 2OXGA 4PJGE 2VXQH 1G9NL 2ENSA 5CEZL 4JFXA 5B39G 3BP4A 4KDVA 5DMIH 5H2BB 2VR9A 4NDMB 3CX5J 3QCUL 5J6GB 2X1PA 3MJ6A 1OF2A 4I9WD 4YHIA 2F74B 3DV4B 5K9QG 1RK0A 1KT2A 3V7AG 15C8H 3ARDC 4RQQB 4JDVA 2YPVL 2A1WH 5F1IB 1A02N 3F7PC 1S7SA 4OLEA 3UPRB 4EBQL 1OAXL 5A16B 2ADIA 4GRWE 1FSKC 4OLWH 1FO0B 1WFTA 4WEMB 5CJOL 2DKUA 1OWRM 4HC1L 2AXGB 3QIUD 3W0WA 5J12B 1CLZH 4UV7H 3RAJH 3FB5B 2GHWB 2GI7A 1ZT1B 2IALA 3ROOA 2VL4A 5TQ2H 2YPKA 3GSNL 2PW1B 3SE4A 4AQ1B 1CFQA 5D2NB 1U3HD 2R0ZL 4OLZL 4S0SD 3CJJA 3ULVL 4HUMB 2A6DB 2JIXB 2DI8A 4RMUA 5CZXC 2NX5B 3EW3B 1WZMA 4DQOL 3S36L 1UXWA 3SJVE 2P43B 1IL1A 5IMMB 3IAPA 5BMFL 4FNLH 3MRPB 1W0YT 2QQLL 5CD3A 4PGDA 3BUYA 1OD7A 3Q6GL 4HUVB 4CMHC 1EXUB 2V2XB 1ONQB 3MUZ1 3K2UH 3JXAA 4I0CC 4H8WH 3PWPE 3S37X 4S2SA 1M7DB 2X70B 4P5MB 3WXVH 5TFSH 5T1LB 4LK4A 3PWJB 3O2DH 5HHMD 4OCYH 4NC1E 4BZ1L 4LCUA 1U8MA 1UJTA 3DX9B 3ECBB 1NCBL 5DRZB 5D5MB 4K8RC 4JHBA 3LZFL 3PG2A 4TTGA 3VXUD 4Z8FL 4YO0A 3QIBC 5JLZA 2IQ9H 2PTUA 1U8NA 3B9EA 4YWGH 3FT2B 3D18B 1D5BA 5IVXE 1PQZB 1TIUA 4MQ7B 1T2QH 4OZIB 1MLCA 3RDTD 1VGKB 3BESR 3GMPA 3HE6C 1PZUB 1A1MB 1QVOA 4HWZA 5CD5D 1K3IA 3UZEA 4U1SA 2ZPKL 2GJ6D 2ZOLA 4F80A 1SYVA 5DYOA 3CH1A 2EZ0D 2DYPD 3V6BR 3VWJA 2Z91A 2SEBA 2VLRB 5ADPL 5E8NA 5F70A 2H26A 1IM9D 4KRNA 4ONHA 2W91A 4JFEE 2PYEE 3SDYH 1TETL 2GTZB 3FQNA 3QCVL 3GO1H 3MUGA 2E27L 1CE6A 1SEQL 5FFLA 5L2KA 1U8KA 1S9XA 3JWDC 1B2WL 2VITB 4NC0B 3QI9A 5GS0D 4HUNB 2ZKHH 3MJ8B 4KVCL 3BN9C 4S1DC 1QLEL 1QKZL 3RUGF 4OD3L 5EU4B 2VNCA 1FNGA 4W6YB 5IW3A 1N64L 1VFAA 1XF3A 3O6LH 2ZCLH 4X6CE 3UO1L 3ULUL 2D7QA 3TNNB 3LQMA 3VI4E 4FQ2H 4BJLA 1AGEB 1BECA 4I5BA 1T89C 2OMBA 1ZT7B 4BSWB 2E7MA 1I1YA 4P9HH 4KHXL 4X99A 3PL6C 1MIEL 1P84J 5DHVB 1KGCD 4M48H 4NKQB 5EO0B 2XKUA 3KPPB 1KB5L 1PFCA 2RFXB 1OGAD 3MRRB 1A6TB 2NY7L 1MFBH 1CD8A 4IRSB 4MAYA 4L3ED 4QRPB 5CSBA 4EN3B 4I0PC 5EDXA 3MOBH 1RPQA 3T0EA 3VFSA 3H9YA 4Z77B 5KVEH 4XPFL 4X7FC 3MGOB 3LV3B 1F42A 3NOIA 4Y4FB 1XCTB 1LO0H 3VCLB 2IAMA 1FNEA 2G60L 1V05A 1JTOA 3F7YB 4F9PC 4LLAA 5E56A 1CGYA 5MENE 1T0NA 5IB4A 2OZ4L 4TTDC 4MD4A 1BBJA 3MRCA 3FL7A 5IVOA 1YN7A 3D0VB 2EIEA 4UQ2B 1NMAL 3CFBB 3P73A 5LKNA 2WNGA 5C0FA 4JHZA 5KBNC 3MV8A 4ELMB 1M7IB 3VFRA 5FKAB 3WS3B 5F7YC 1DE4B 2YXMA 3G5XB 2X2YA 2J12B 5F6HI 4Y19D 4P5KB 1FYHB 4OCSL 2UWEB 2YSSB 3QZWB 2FHFA 3LD8C 1C16B 3QDMB 2Q8BH 1ETZB 2EE3A 2P45B 5JA8B 3OR7B 5ITFB 1H0DB 3HZVB 4JM4H 1T3FA 1ZHBB 3QNYB 4KTEL 4XNMA 1EZVX 4QOKB 1SJEB 1X4ZA 4QKXB 1GZPA 1MCIA 4GRLD 4P59L 3L3GA 1X6NA 4H1LG 2XTJE 1HCVA 4TQEH 1KN2L 4O2EB 4HD9A 3TT1L 1REIA 3BAEL 3IDIB 4I3GA 2NR6C 5GGVH 1S3KL 1D5IH 4CU6A 3BP4B 4Q9RH 2E5EA 2I26N 1DQDH 4FXGA 3LKSA 1X5KA 1TDQA 3QDGA 3UJIH 5J3HC 5D93B 5DD5H 4HZLB 1QSVA 4HFUH 3V6OC 1A7PH 5DD0H 3OMZA 1JPTH 5MHSE 1S7SB 4JFDD 4P3WA 3STZB 4LSPH 2ADIB 2YZ1A 2FDBP 3TBWB 3GRWL 4EEEA 4ZD3H 3WN5A 5DJ2B 4UV4L 1HYSC 1HXMA 4JCLA 2HT3D 3AB0B 1RZFL 3ROOB 2ARJA 3S36X 3AS1A 4YK4B 4NNXA 1FYTE 4NFDA 4KKLC 4WV1A 4LRNL 4TUOA 4FG6D 3IU3A 4HUWA 4YBQC 5D2LA 1D9KA 4XX1E 4AL8L 2AXJA 2HKFH 2FNBA 3QWRD 2VDPL 4WUUA 4KK6D 3LS4L 4JY5L 2GAZB 3QQ9C 4NKOA 4V2BA 1UG9A 4QWWC 5DT1L 5CD3B 3BUYB 4M1GL 5IQ7H 1PG7L 1DTUA 3KYAA 4CNIB 3BEWB 1CF8H 4F2MA 2HVJB 1JJUA 1FVDB 4POZD 5EFIB 2P8PA 2IWGA 3MLRH 2E7BA 1RJCA 1I9JH 3QWQB 5IM7B 1Z0NA 3UTSA 3S8WA 3I3DA 3QXVA 2PKDA 2OJEA 4IDLA 1IGFH 2GJJA 4PP2B 3IFOB 4EVNB 2DLHA 4H26A 4XWGH 2QHRL 1YDPB 4NOFA 1NKRA 1ZAGA 2D7NA 5HHOD 3ROLA 1OHQA 4LCCB 4WW2C 4XC3L 3MYJA 4Z0BH 1A14L 1U8PA 1A6ZA 1D5BB 1W0WA 3BX7C 2VLJE 4MQTB 4X5XA 3E2HB 2BNQD 2D0GA 1QVOB 3G5VB 4U1SB 2W60A 1CD0A 2BHZA 2D4FA 2ZOLB 1BQHA 4L8CA 3N9GL 3ZKMD 2Z91B 2SEBB 5HYSG 1MCNA 2OS7A 3HPJA 3OR6A 3H42L 2BNUB 3CAFA 4Z9KB 1ZK9A 3LB6C 1X3DA 3HI5H 4L3CA 4P46B 1U2CA 2B1HH 4LARL 5SV3A 3Q3GB 1XGRA 2ESVD 3TWCL 4EIGB 3MUGB 1TCRB 4GSDL 4F7TA 3LDBC 5J8OA 4J3VA 1EAJA 4XGZB 4ODTL 4KGLA 5GRUH 1U8KB 2AABL 3ES6A 3PABA 4OV5B 3EOAB 3SGKA 1YYLH 2OCFD 3QI9B 4ETQB 3IXTB 4GKNA 4QHKI 4ZTPL 4X6DE 1CFVL 1YY9C 1I4FA 1R3IH 4Y8DC 4KJPC 1JGVH 1MHPL 3SDDB 2OR9H 1S7VB 1VFAB 3ABZA 3D85D 4TSBL 4WRLA 1XGQA 3SDXF 3W9EB 1YEFL 1SBSL 5IMOB 2NXYD 4ZMAT 5CUSH 1K4DB 3RVUC 4QNPF 5D7IE 3U6RB 4I5BB 4F7CA 4JCMA 1I1YB 4X99B 5KG9B 4MA3A 3LMJL 1SJVA 3ARVA 3QRGH 1YQ2A 1JFQH 4LLDA 5DZLA 4M1CC 4U6VL 3BH9B 4DTGL 3EYFA 3K8KA 4Z7NF 3D0LA 1HDMB 1S78D 2IBBA 4P3DB 2LU3A 4AM0A 4LVNB 4U1GB 1KNOB 4XBPB 5CINH 3UYPA 3T0EB 3KJ6L 2M8XA 3QH3A 2AJZA 4HT1H 1GGTA 1TXKA 1R0AH 5IHBA 1CXIA 4N1EA 4LVOB 1N3NA 5IB4B 1RVFL 4MMXC 3OAUH 5B3NA 1BBJB 1OB1B 2FGWH 1NBVH 1QYGH 2ZUUA 3P73B 3BKMH 1G9ML 5JHLH 4PJHA 5I74C 5C0FB 3TV3H 4XC1L 1NAKL 3RGHA 2YN5A 3HPLB 3NABH 1LO3H 2F53B 2W9DH 3RWFA 3JV0A 1MI5A 3WJJC 5KAQF 4Z7WA 4LPXA 1CZ8H 3H3PH 2XQYG 4U7MA 1F11A 4M8VA 1A7RL 4I4WA 1T3FB 2FR4A 3P11L 3ZE1E 5C9KA 1ZGLB 1C12A 1PD6A 2F5AH 1AFVH 1G7QA 4KTDL 1JZ7A 2Z9TA 2J2ZA 4KI5E 2WP3O 3C2SA 2VXVL 2PF6A 4K8RL 4XT1C 3SDAB 4YHNA 3OB0K 1EUTA 1JWMA 3U79A 5IEHA 5ANMA 3SDCC 3ETBF 1CFSA 1KTKE 3R1GL 1C1EH 5C0NC 5EUOB 2PTVA 4MA8H 4ZS7H 1RZJC 3Q5TA 2E9JA 1GOFA 4FXGB 3LKSB 3IJHB 2BOBB 3QDGB 3EFFB 1NQBA 2LE9A 4XVUD 1OD9A 4HXBH 4A6YL 4YHML 1N5AA 1MPAH 1NUGA 5C2BL 3QUXC 3GMQB 3QFJE 4XNUL 2W0FB 2BNRD 5IEKB 2VLKA 3K2MC 4HUXA 2AI0L 1FC2D 1KULA 2Y06L 3NTCH 2OSLB 3CDGA 1OM3H 2WUCH 4MA7L 3UTTA 2V5RA 1NC4A 4NN6B 4DVRL 1GGCH 3MLXL 2OP4H 2ARJB 3OF6D 1B9ZA 1WJ3A 4NNXB 5HTSA 3FB8A 4TUOB 4D9QD 2FCBA 3PWPD 3QXDA 1PG7X 2G5BA 2DQGH 3PJSA 3HNVH 1XF2A 2QEJA 3BKYL 2BDNH 5D2LB 1NANH 4QTIL 3X3FL 3TA3C 3TO2A 3TVMA 1RUQL 1T7WA 4E42B 2NYYD 2CMRL 3REVA 2IEPA 4C56E 5CCKH 4U1JA 2Q7YA 3MRGB 4OSUH 4KGJA 4KROC 5DRWB 2FWOB 2NY5C 4Z7UB 3S96A 4AIOA 5ID1A 4JO4H 1KXTB 3GB7B 4F2MB 4IRSC 1PLGL 3F8UB 3HG1B 4PRPB 1DQMH 5HI4D 3QCTL 2P8PB 5D70H 4JFHE 1HHKB 3GIZL 5F3HB 3HUJF 4LSUL 3X13A 3L6FA 1YEDB 3LEYL 1WISA 4EN3C 1OLLA 2OJEB 5B4MD 3GSRB 4QLRA 2AW2A 3C87A 3LEVL 3O6KH 2ITCB 4QXGH 5C0AB 1HXYA 3GMMB 3P9WB 3UTPE 4Y4FC 3P4MB 4JFED 2WQRA 4FQCH 4MJIA 4D0BA 4LBEB 2A6IA 2P8MB 1HHJA 4KRLB 4PP1D 5FV2A 2K1MA 2IJ0C 4HKZA 4PJ8C 3QA3A 1PX3A 4HKBA 5C7XL 1AXTL 1BQHB 3JV4A 4YGVB 5FA3B 3F12A 3V6FA 1DQLH 1UEYA 3O45B 1P7QA 2EO1A 5IMKA 3VD4A 5ISZE 1O5DT 3HPJB 4QHMB 3NCBB 3OR6B 3SKMA 3U36A 3L95A 3O6ML 3JV5A 3RVXC 4L3CB 2J3SA 3WS6C 3A67H 1LE5A 3KPRD 3JVGA 4O4YH 2DMKA 3UZVB 3RTQC 1QQDA 2IH1B 1XGRB 5IOPA 5DQJA 2R8SL 4AMKL 4JO1H 1MHCA 1KELH 4N0YH 4GRWH 4GLRI 2VZUA 4K94C 5EOTA 3PABB 1OGTA 3RJDA 4JO3L 4Z5RA 3FZUD 3T1FA 2OBGA 4M7JL 3BJ91 4FQIL 2C4FT 2GT9A 1LO2L 3NGBB 2PO6B 5TQ0H 4DGYL 2FIKB 1MCSA 1UB6A 4PJEF 1AC0A 1I4FB 4MVBD 4PLKC 4R2GD 2H32H 1HHGA 4HWUA 5EU5B 3TM6A 2RCSL 1AGBA 4KJWC 5GPRA 3H6JA 1IJ9A 5A3ID 5MEQA 4B7IA 1MVUB 4LEOA 3OG4B 4X0KA 1BQLL 2YEZB 3K4ZA 4RGND 2OTPA 1C5CL 2GEEA 4MD5A 4N5ED 1FV1A 4F7CB 2HJLA 1XGTA 1OAUL 1N6UA 3FAWA 1CFTA 3T0WA 4JZJB 3D9AL 4LLQA 3PDDA 1BVLA 5D7KE 3O2WL 5SWZE 1SVZA 2YPLD 1CVRA 1NFDA 2ZCKL 3BRFA 2W0PA 3I50H 5IROA 3SE4C 2OTWB 4M5YH 3MV7E 4XTRD 4WFFE 4GAJH 2XTLA 5T5NG 4RMWA 3MC0A 4GAFB 4UNTA 3EOYG 5T1MA 2AJZB 1I8MA 4MWFA 2JJTA 2C7UA 4ZOCA 4PJGF 4WUKH 1TTGA 1WLHA 2AEWA 3CFKB 3NCJH 4HKJB 1HIML 2AKRB 2FH6A 1EEYA 1N3NB 4M8QA 4XP4H 5FUOL 4OLUH 5I1HL 4ZDHA 4Q97A 2R1WB 2ZNWA 1MQKL 3Q5OA 1UYWH 2A0LC 4M6AA 1M7XA 5F6IC 3GM8A 5JPNA 3HZKB 3VG0H 3NAAH 1MRFH 4GRWF 3SKNA 3CX5K 5E9DA 5HGBA 1QFWI 1CICA 3LH2L 1YNKH 1KCUL 3RWFB 1MI5B 5C08B 1X5JA 4JFQA 4LCCC 4Z7WB 5BO1L 1YJDC 2E9IA 1FN4A 1XMWA 4MCYA 1F58L 1EX0A 3TJEL 3E2HC 1C12B 4NWTH 4R7DB 2IG2H 1ND0A 1MF2H 4P5TA 4PGEA 4ZPVA 1MCQA 4BH7A 5MHSD 4DK3A 4EXKA 5IEHB 5ANMB 4PJ5E 4P46C 4HGKC 2PR4L 3NCYP 3WLWC 2VLME 4AZ8A 3U1SL 4V2CB 3LKNB 4OGYL 5SWSE 1U8HA 1CI5A 3WUWG 1FYTD 1J11A 1ZLVK 1CTOA 1J87A 3K81A 3QUYC 3VGGA 3DIFA 3MXVL 4NJ9H 1GGBL 2VISA 2XPGA 3QI9C 5IK3A 3IETB 5I1EL 1A7NL 5SX4I 4TUKL 4YDVA 4XPAH 5IVXF 3O11B 3V0AC 4KQ3H 3KPTA 1KLGA 3SDDC 2FZ3B 5F9AC 1NC4B 4ZQKB 1UJ3A 4E5XB 1DDHB 4DVBB 4Y0GA 1T20B 3FB8B 1R5WB 3EDKA 3O0RH 4MDIA 1WWBX 1KJ2L 5GRVL 5I1IL 1KC5H 2X4OB 4Y1AE 3CLFL 1HKLL 3TVMB 1NEZB 4RZCB 3EJYD 3D5OF 1PBYA 3MUY1 5IVZA 2ADFH 1OSZA 1A9EA 2P5EB 3REVB 3RVVD 5HGAA 1T03H 2F54B 3U2SA 2JCCF 2L7UA 2AJXL 2ZOKA 3P9MB 5F7MC 1YMMA 4XVTL 4QHUB 1PKQE 1DVFD 5IBTH 4AEIH 5FHAH 3TBYA 4PV9A 1KUMA 2Q20A 4L9DA 5LWYH 2FD6H 4U1GC 1PVHA 1S5IH 4BH8A 2BOCB 4KMLB 5D7JA 3T0EC 2YRLA 2ZUXA 5I1CL 1XR8B 1ADQA 4L4VD 1HXYB 4PD4J 4OQ1A 5HVHB 3PGDA 4X6CF 4PJ9B 3B3IB 3MRDA 4MJIB 3MBED 4D0BB 5T1DH 3VE0B 2FEDD 3VI4F 4HKZB 3QA3B 5KSAA 1R24B 1GHFH 1OAQH 3V6FB 3C08L 4QRSA 5IMKB 2EIDA 4OJFH 1Q0XL 1ZHKA 1IM3A 4X98A 4TVPD 5J1SC 4OI8A 2UY7A 1A6WL 3MR9A 2VN7A 4Q6YA 3FB7A 1QQDB 3FQRB 3RX8A 5I1GL 5DQJB 3X11A 4L29A 3CVHH 3HR5B 1H3PL 5HXMA 1MHCB 1P84K 1U8OA 3BD4A 3X3GL 1MWAA 4R9HA 1MY7A 4WU7A 1UWXH 1OGTB 1AGDB 1PEZA 4QRQA 1I8KA 4G6ML 3VXNB 1EERB 4U49A 1T5XA 4Z5RB 2CLRA 3VGBA 1P2CA 3SDAC 1ACZA 3MV01 3ARBB 3CFDB 4LAQH 1UB6B 1WBZA 4KKNA 1I7RB 4HK3J 5C9JB 1RMFH 3TO4A 4FFZH 3IDGB 2IANE 4D2NA 3AU1A 2R69H 1CQYA 4J7RA 4LSQL 5GGTH 5MEQB 5HYJD 3CH8A 3ARED 4XHJC 3BYYA 4PBXA 1C5BL 4X0KB 4FHBD 4EIZC 4PBWD 1RFDH 2R2HA 3U7AA 1ZLSL 4XP6H 1FV1B 1G7HA 4HQQL 1HHIB 3V9FA 2HJLB 1ITBB 2QQQA 3I6KA 3QULA 2WINA 4LLQB 1BVLB 4NKDA 1GC1H 5ALBH 3PGFL 1B0GB 4RISH 2P42B 4PJXE 1UCTA 5KZCB 4PTTB 1P4BH 2QV2A 4HXAL 1IC5H 4ALAH 5IFHL 3OKLA 2FX8H 4XI5D 3ESUF 3MFFB 4HUUB 5I9QB 3B5TA 4RMRA 5T1MB 1T1ZB 5T3ZE 4MWFB 2CGRL 3RUGA 2C7UB 2AJSL 2P5WA 3W5NA 4HLJA 1IT9H 3O6FB 1QSEA 4HWBH 4F57L 4Y5XB 2JK5B 2LVCA 2KZWA 1U58A 1LNUA 3KPQA 4U6YA 5CWSB 5L7XH 5AYUL 4FFVC 4G3YH 2BRRH 5JPNB 3LCYA 5BVPH 1EV2E 4LPYA 2DD8H 1V3KA 3O2DA 1T80A 5TF0A 5C0IB 1J0KA 4GG8B 4KI5D 1CICB 3SE8L 4ZTOL 4OUOA 2J5LB 3VFUB 1T1WA 3MLVH 1HQ4B 4JFQB 2NXZB 1OARH 4CN1A 3GI9H 5IB1A 3HA0A 1LD9A 4OZGE 1ZGLM 5F21B 3FT3B 5C09B 3CVIL 5EO9A 1A9BB 4FQXD 1M05A 3EYQC 3VRIA 2LTQC 3PP4H 3ARUA 4JRXA 4MJ5A 4XNQA 3QIWD 1FZOA 4ZUWB 5I71B 2W0KA 4PGEB 4ZPVB 4L8DA 1G0XA 1CLCA 4HHAA 4XRCA 2DQUL 4G7YL 2W65A 5BW7A 1SYSA 2XZAH 3QUZA 4AEHH 1IKFL 3UDWA 4JKPH 5AZ2L 4KK5C 4JFFE 5IB3B 4ESKA 3VXSD 2EDXA 4XP9H 1GOHA 4YPGB 3PWVA 3DLQR 3DIFB 4OLYL 1U36A 1RJZA 2VXUL 2XPGB 5ENWB 4H88L 1P9MA 1JNLL 4OB5L 4G6AD 2PO6C 1TZGH 3EO0A 2DKMA 1KLGB 1NLBL 1MFDH 1F00I 3DXAD 4MXQC 3VDCA 3UC0H 4G7VL 2NY3D 2A74A 1YEHH 4K94L 4XCFH 1I3RA 1BX2A 1LK3H 2VQUA 2EXYD 3QIUA 4RGOH 3T1WA 3C5SA 1K6QH 2R56L 1CFNA 5IVZB 1F4WL 4BUHA 4PG2A 2BJML 1FL3A 3S34H 1OSZB 5DUMH 2Q76A 1MCBA 3WFDL 1OWWA 4JZJC 1JF5A 4ODUA 3MROA 2F19L 3UTPD 3AM8C 4PJIE 4BZ2L 4P2OD 3L3HB 1WICA 4M03A 1LHZA 3C6SB 2YOCA 3D48R 3KPSB 4NJAL 3S7GA 4M6OH 1I7TB 3I6LD 4ZAKD 4BH8B 4KQ4H 5E08H 3PP3H 3RU8L 3KDMB 4NHCH 5ACZA 3VDAA 3VFPA 1YEIH 3IDMB 1UM4H 1RHHA 2VZSA 2X89D 3MRKA 1CLOL 3ZMRA 5BRZD 1ZMYA 3QR2A 1MJUL 3O9WD 1DR9A 1R3LA 3VXUA 5D7IF 4ELKA 3TEUA 3K80A 3P4OA 1VFOA 5DZOA 1UQSB 3QSKB 1N7MH 1QD0A 4U3XA 3WL9B 4DKDC 3FCTA 3PDOA 3RDTA 1IM3B 5KJRL 1J1XL 3E6FA 4KAQH 2NW2A 4YC2C 2EE6A 4PJBF 5HHVL 3MR9B 1OAKL 4HWEH 3W39B 3ZL4L 4CW1B 4XPBL 3FB7B 2DYPA 1JGUH 5DS8A 2WWKO 5JOEA 4OGAD 4NWUL 1IM9A 1BHGA 1IGYB 4WVRA 3RVWD 4M4RA 1WEJH 4D3CH 1II4E 4QRQB 2UUDH 3QQNA 3KNBB 3EDDA 3D87B 5F97E 5FCSH 1C5DA 2IFFL 3GSQA 3BZFA 1J5OH 1P2CB 3TBVA 4WTXA 3DMMB 1U8IA 4W68A 5JW5B 1MFCH 5CEXA 1WBZB 2EEBA 3OKMB 1MNUH 3T0DA 1JWSA 2AXFA 4H25B 5CEZE 2D31A 2LU7A 4XZUA 3KPMB 4OGXL 5D7KD 3T0XA 4WO4D 5AG8A 1LDPH 3OTTA 1CXEA 3IU4L 3T2QA 1YPZB 5I15H 2J8HA 1L0QA 4K3DL 4TNVK 1CE1L 3PP3K 5C6PB 1MJ8L 2R2BA 1G7HB 1Q9LB 3SCMC 1C08A 4GO6B 4TNVF 4QYOA 1UEMA 3RWDA 1ES0B 2QSQA 2WINB 3MNVA 4NO3A 5F93C 3ZE1F 4PGBA 4Q2ZA 4NKDB 5DC4B 5INCA 4KI5F 3CC5B 2DQEL 4MB4A 4UT7H 3QXAB 1QBMH 3TF7C 1YQVH 3OKLB 3ULVE 1OGAA 5EOQL 4YXLH 5D96B 3QEQD 4CADB 3TVMC 1MIMH 2JJVA 3L7EA 5LQBL 2EDQA 1O7SA 1WZ1L 3PQYB 2VXSH 4KPHL 3P0VL 5MERA 4L3EA 1FBIH 1M4KA 1EPFA 5FYKL 4ZSOB 5HYFA 3SDXA 1INQA 3VXTA 5CKAA 4QF1B 1KV3A 2GK2A 4AEFA 4GKZA 1JE6A 2UUDK 3WD5H 1HOCB 2DQTL 4DOHB 5C0EA 5EIIA 5JPMA 3UTOA 3KVQA 2HN7A 1ORQA 2HLFC 3O41A 3D3VE 4J4PC 3P9LA 4WW1A 1T1WB 4YLQT 4UTBL 3U82B 3NIDE 4X5WB 3WNOA 4FZ8H 5HVHC 4PJ5D 5IB1B 2P7TA 4PJ9C 4L8BB 4XPTL 3HI6L 4XP5L 2ZZUT 1CD1B 5DJZB 5IV2A 3FO0H 4KZEL 3QWOA 2FECL 3MLTB 1GRWA 2J4WL 1M05B 1YECL 1ZANH 3DGGB 1CL7I 4Y4KC 4ZUTA 4JRXB 4MJ5B 5SWSD 1GZQB 2BMKB 1IGCH 2X7LB 1IAIH 1WBXA 3MA9H 5L2JB 3IB4A 3WNPA 1QNZL 4KK9D 3RIAK 5D7LD 4LLUB 4BQ9A 2CLZA 2R0LH 3Q6FB 5FV1L 4XRCB 4MCZB 2Y5EA 1KIPA 4GRLA 1NH6A 5HDBE 2W65B 1K8DA 4JPVL 1SYSB 4ZXBD 3PV6A 3D39E 3OQ3B 2GY5A 2HTLC 3FB6B 1NDMA 4NO5A 1DANT 5K9JH 4GG6A 3HB3C 4GMTL 4JPWL 3MRNA 4EDWL 4CBPA 4ZUUA 5KSUB 4FP8H 4NQCD 3TH3T 4Y1AD 4FTVE 4NT6A 2GQHA 3ARBC 2JE8A 1INEL 1WWCA 3ZSSA 3BQUC 1E6JL 2KQNA 3WLBA 2E7CA 5BXFB 5LGHL 3Q1SL 5SWQA 1AQDB 1H3WM 2VDLH 1ZOXA 2AGJH 4JFDA 3CXDL 3DHMA 4JM2D 1A0QL 3N1FC 3ULUE 3UTZA 4ZG1A 2N7AA 2ADJA 1BX2B 4XNXH 3UAJC 3QIUB 1ZHLA 4JKMA 4D0CB 1Z6JT 3BZEB 3C5SB 4UINH 1EMTL 5DEFB 1ZLUH 4PJFE 4JY4A 1U3HB 4MZ3A 5DURB 3UMTA 4ORGA 3QWRA 4KV5E 3V4VL 4N8VA 2WV3A 1KENL 3BH8A 1AXSB 1HSAA 5IROC 3CFJB 1F8TH 3OGCA 2ICWJ 1CGXA 5DO2D 4Y16B 3MREB 4LEXL 3TFKC 5DSCA 2Z31D 2APVA 4MXVE 2R4RH 1MELA 5I9QC 5J06A 2CKBH 1J1OL 4NM4L 2EC8A 3O3EA 4YHZH 1EJOH 3FQUB 2F8VA 2DF3A 2XTJC 5DJXA 3FHQA 3VFPB 3O6FC 3UPCA 1YNTA 5HHMB 3GBLA 4Y5XC 3PWUB 4OQTH 2N1KA 1RHHB 2NY2D 5GRWA 1RZGA 1WAAF 2C1OB 1KFAL 5FGCE 3VXUB 5HHOA 3RA7H 5JXEC 1B0WA 4JQVA 4ELKB 3CXHJ 2HWZH 3P4OB 3FCTB 1CICC 3OGOE 3PDOB 3RL1A 3GIVA 1XEDA 2J5LC 2O93L 2BNQA 2CUMA 4HF5L 4RFNB 2GJ6B 1Q1JL 4I77H 4FQPA 3BOVA 4NOBA 2DYPB 4LDLB 4X6FA 1DBAL 2R0KL 1IM9B 3U4AA 3HUJA 4OD1H 1A2YA 5CZVH 2Y36L 5C0CA 4X4ME 3FQWA 2AP2A 2IAND 4HMEA 2JKXA 2UZIL 3DUUB 1IC1A 2R9HD 2VMFA 4KMTH 5I71C 4JR9H 2ESVA 2EC9T 5EO1B 1ZLUK 3TBVB 1OTTD 2QADC 5L88H 2A73A 4JN2A 5EPMB 3WSQL 4ODVL 1BPVA 5FO8A 3V5KB 1O0VA 2VRAA 3KYKH 2XWJA 4PUBH 1RU9H 2AXFB 5C07E 1XIWD 1BIHA 3MQIA 4KKBC 2X1OA 3OAZH 4K9EC 3ARFC 1WCBA 2APXA 4FZEL 5D72H 4WJ5B 5TE4H 2P4AB 1I3GH 4NN7C 1LWRA 5T3XL 3DSFH 5CSGA 2X05A 4TSAH 5LXGL 5IW6A 3OHXA 1IC4L 5F44A 3MRBA 5T3ZD 1EBPA 4YXKL 1C08B 4QYOB 2WBJD 4M7LL 5E8EA 2OYPA 3RWDB 3CLEL 4NO3B 4I48A 3MNVB 3H0TA 4OCNC 4IOSD 4PGBB 3OKYA 3MOAH 4Y4HD 2XWTA 4FQJH 4X7SH 4U2YA 1HN1A 1N6VA 1YUHA 2KBGA 3W2DL 1LQSR 1DN0B 3SPVB 3RPKA 3WIFA 5FB8A 2MQ0A 4ZUVA 1UH4A 4HS3A 3H9SE 5DUBA 2HMIC 4PJEA 1JRHH 1X6LA 4LQFL 1W8NA 2YD8A 4L3EB 1KTLA 4NFBA 1OCWL 3IVKA 1JCKA 5C2UB 2FX7H 3PHOA 5FM5M 1MH5B 5LGJB 5TDOA 4MSWB 2EKJA 3G6DL 2D7TH 5C0EB 5JPMB 1KCSL 5IBLC 5T5NF 3BHBA 1KPUB 2JELH 2H6PA 3OWEA 3P9LB 3RGVC 3HE7D 1RV6X 3R0MA 3QFDB 3AS2A 2P7TB 3UBXB 4LNVA 3KXFE 4JE4B 5CLTA 3DETD 3OAZK 5IV2B 2HJKA 4JGMA 1EHXA 2P44B 3MLYH 3STLB 4OFPA 1HI6A 4FXKA 4NYLB 4Y19B 3MRLB 4PRHB 5EBLA 1D6EA 4YHPB 3K8MA 4PJGA 5TF1L 1J0IA 2XFXA 12E8H 2EDWA 3VXRB 2APFA 1KIPB 2BSTB 4JM2F 3ZKXB 1CL7L 4GRLB 5FGBC 2DJSA 4TUJA 3U0WH 1RZ7H 1JZ2A 3EOBA 3O3BB 2EH7L 3PV6B 3CDYA 1NKOA 5EORH 4E41D 3KLSA 5CP3H 4GG6B 4NQEE 3VFTA 3NIGE 1AGFB 4MNHA 3MRNB 5C0JA 5DK2A 4ZUUB 3VFNB 2UYLA 2I9LA 1T7YA 4JHAH 3GM0A 4KRMB 2VL5B 2B0SH 2QJDA 1Z9OA 3DMMC 3I75A 5E03A 3MRJA 3CDCA 3WLBB 1MLBA 1L7TL 1F2QA 5H8DA 3KPLA 3NMEA 2H32A 5SWQB 3CDFA 1V7ML 3MV9D 2AEQL 3ZKND 5IBUG 5T3ZH 2BVPB 4I3RL 4PD4K 1NGZA 4UOW0 3UTZB 2J8UE 3SJVA 1JGLL 2ADJB 5HJ3A 4HS8L 3V4PL 1BWMA 1WUNT 1TVDA 4UBDC 5JHDD 3SGJC 4PLJD 2CDFA 3HZMB 5GJTL 3DV6A 3PWPA 5D6DA 2VH5H 4UB0L 1BD2E 4DUVA 4J8RA 4KDTA 4AJ0A 4HJ0C 1F4HA 2QQNL 5D7SL 2RB8A 4N8VB 1JBJA 3C09C 5EBMA 3WIHH 3L5HA 3KAAA 3PIQA 1D7FA 4F15B 1VEMA 1D6VH 1KN4L 4WU5A 1UFUA 4OLVL 5J11B 3N1QC 4NP4L 4LMQI 2NZ9D 5D96C 5AWNH 2X4TB 2FSEA 2WIMA 5IVXA 1E4XL 3HLAB 5DJXB 1E4KA 3RKDD 4MHHI 2X4SA 4PRIE 1AR1D 2G9HA 5FYLD 4GRMB 4ENEC 5B39A 4P2RD 1RZKH 2CD0A 4IRJD 1RZGB 4OAWA 2QBWA 4OTXL 1MAMH 1SY6L 1MREL 4R90L 5A2JH 5TPWL 2WBWB 4NUGH 4PJDF 1QSFE 4WTWA 4JFEA 4M5ZL 2PYEA 2XNAA 4U7KA 1VACA 4G9FB 1CGSL 1NUFA 2IPTL 2O5XL 3H7LA 1B6UA 1SJHA 3GIVB 1NJ9A 4EUPG 4NO0D 2BNQB 3FFCD 1PX4A 1TJGH 2A9MH 1S7WB 2JCCA 4PJAB 3QXWA 4TSCL 3O3UN 4FQQA 4MXWH 1GAFH 5D1QD 1L9MA 3K7UA 4LU5L 2KUTA 3F5WB 1MJJA 2AJYH 4RA0C 3ZE2F 1LVEA 3HUJB 1S7XA 3EYOB 3GFUA 4BSJA 5I1JL 5EA0L 1JK8A 4DAGH 3RX7A 4ERSL 4UMGA 2ZSVB 2AV1A 1FIGH 3TCLA 3C9NA 2D2OA 4M6MH 4CVXB 4WHYG 4OLXH 5E5MB 4Q0XH 4UDTA 1TQCC 1H3UA 4WY7H 4X6CA 4YDIH 5H94A 1DJSA 5FUCC 2XQBH 3FRUB 1QRNE 2E6QA 5IQ9A 2BY0A 3BMWA 4JPIA 3LKQB 2V7HA 4X8JA 5FGRA 2BY3A 3SY0B 4X9BA 2OR7A 4P57A 4V1DD 4QTHA 4CDHA 1A6AA 1X4YA 4C4KO 2UZYB 3D85B 5TE6H 5IW6B 3OHXB 4M93B 1T0MA 4X9HA 4OZGF 3IFPB 2I27N 5E8EB 3BSZH 4JRWA 2NXYB 2ERJB 1FNSH 1KCVL 1NCNA 4I48B 3TYGL 1NMBL 3WFEH 2XWTB 1NC2B 3DWTA 5FF6B 4X4XB 1U8QB 5DJCA 3V4UH 4KKAD 4P23B 2VZTA 3IXAB 1AQKL 1JP5A 3LS5H 4G8GB 3CCHA 5EUKB 1MFAL 4HS3B 5GRYA 5MENA 5DUBB 2YPLA 2XN9E 5F1SA 1NGXB 2FEEI 1A4JA 5E99L 2BSED 4X4YA 3LIZH 1U3HC 2WANA 4OZHE 3MBXL 5DRXB 4MGXA 3BGAA 5KVGH 2EEDA 3IVKB 5KOMC 1AHWB 2AERT 4LVEA 1BQSA 4JPKL 2IGFH 3DPBA 1UACH 5FYLH 4PRDB 3FMGH 4Y16C 1I8LA 4RFEB 1PSKL 5DEGA 1J8HE 1KYOJ 4ONGH 3O4LE 2H6PB 5JOPD 4MX7A 4MAUL 3T0VA 4M62L 1Z3GL 2G2RA 3L9RA 4OCWL 4HIHB 4XPGH 3PF2A 1WFOA 1NSNL 4LKXB 3L7FB 2ICEA 2P8LA 5IESH 3S5LA 5F7WC 4LRIA 4QRUA 3IFLL 2XT1B 1VKXA 4P2YA 1AE6L 2Z92B 1NGQH 5CEZH 3QCUH 1MFNA 2X4RA 4RAVB 2XFXB 5IFAL 4QGTA 3E6HB 4FTVD 4GKSA 2VQTA 1Q8MA 2H1PH 2YPVH 4YUEH 2JJSA 1LP9E 3QO1A 1DBML 1WZKA 2E8YA 3K1KC 3E8UL 1SQ2N 3QEGL 1MJ7L 1OAXH 4EBQH 3CVHA 4Z7QE 4MQXD 4DN3L 1JZ3A 3VW3H 3GK8L 5CJXC 5ESQB 4YXHH 5CFHA 3VFTB 4HC1H 5LVEA 5DK2B 4QRRE 3LN4A 2I9LB 1N4XH 25C8L 5FYKD 4HLZH 2CXKA 3I75B 4ETYA 3F7VA 3G6JF 3LKOB 5BS0D 1FYTA 1MLBB 4PRAA 2QR0B 3KPLB 3UYRH 43CAB 2B4CC 2BNRB 4AG4L 5HHPA 5GS0C 3V6ZA 3NACH 3C5JB 1IQWL 5E2WL 4P9MH 3QHZH 5BMFH 5GGTA 5CBEB 2AJUH 2Q6WA 4YFLF 3RPIA 1UZ8A 2VABA 2EE9A 4S11A 1QBLH 4RNRA 3U0PA 2EE2A 4HCRH 3OKNB 1F2XK 1X44A 1XZ0A 2VO5A 4HKXB 5HPMA 4PJCE