3HNSL

Cs-35 fab complex with oligoarabinofuranosyl hexasaccharide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTIGCRASQDIGSYLNWYQQKPDGAVRLLIYYTSRLHSGVPSRFSGSGSGTHFSLTISNLEQEDIGTYFCHQDTKPPYTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
molecule tags Immune system
total genus 56
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hnsL01
2A2QT 5GGTH 3SKJH 2OJEA 3C2AL 5L6YH 2JKXA 1KCUL 3WFEH 4OCLC 3ARFB 1RZIB 2BNQA 2AI0L 3SDDD 3MV9B 1MOEA 3NCFB 3WBDA 5KAQF 1HH9B 2VITB 3MLUH 3V8CA 3ZKMC 1UEMA 3U4EA 3GB7A 1S7SA 5KOVC 3RJQB 3ROOA 4PJIB 1IM9A 4YBLB 4HWBA 1V3LA 4ELMF 3RVUD 2R8SH 1EK3A 3RWJB 1A7OL 1BQSA 3IDNB 3JXAA 4MNQD 5CBEB 3CDGB 4JDZA 3BW9B 2YD5A 4J23A 1BQUA 2XY2A 2ED9A 4XRCA 5GJTL 3O6FA 3CZFA 5TGBA 5C0DB 5ISZA 3HI1A 1I1FA 3PL6D 1DE4B 4MAUH 3MJ9L 3IDYB 1T5XA 1BFOB 4UUJB 2YR3A 4KY1L 3O45B 4ZPVA 4QRUA 4OB5L 3RVTD 3DLQR 4U6XB 3L7FA 1BM3H 2LQRA 3VMOA 5CD3A 2X70B 1AQKH 4EUPG 3GSNH 1UZ6F 1ZEAL 2IFGA 3RNKB 3BP5B 1VDGA 5J56B 4JFDB 4HMCA 1WITA 5C0NC 5FYKL 5ICZB 3PP4L 5J89A 5F21B 2H6PA 1U0QA 3W2DL 5D7JC 2XQYK 5CEYB 5D7LD 4PRDB 1VEPA 3SPVA 3HZMA 3OAZK 1VFBB 1CQKA 2R23B 3NCYP 1K8DA 3QWOB 5CKAA 5D7SL 5GGSB 1A6AB 2FX9H 1OAQL 4G6FD 4XP4L 1D6EB 1U3HA 4O2CB 3IDXL 4QHLB 5B39A 1ZK9A 3HKFA 4L9LA 3CXHJ 4MVBC 4RAUA 5D7KE 5GZND 2E8YA 5FO7A 5KVFH 3CSGA 4YDLC 4MJ4A 5HI3D 1RAMA 4K23L 1EEZB 1TZHA 3IFNH 4LKXA 3O4OC 2WBKA 4YHLH 5GGRA 4GW4A 2YZ8A 4R97B 3C5ZB 2NY0D 1NDGA 3QIBC 2FL5A 5GRWA 3WMSA 1AJ7L 1K3IA 2YUWA 2K9UA 4WU7A 4PJDF 5JMOC 3ARPA 1F97A 2EIZA 3P9MB 4P4KC 3BP6B 5CP7B 2CO7B 3DVGA 4OBSA 3GIZH 1G9MC 3G08B 2EC9T 1B0RB 4MAYC 4P4RB 5IHUH 4Q0XH 1YYMH 1YPZE 3NN8B 3VG0L 2ATKB 4Y19E 4WNQA 1WZKA 1M7DA 4H0HB 4KZDL 1D9KB 3VXRB 5D70H 5JXAH 3KLHD 1BIIB 1OTSD 4P9MH 1AD0A 1B4JL 3BUTA 3T08A 4G6KH 2D31B 2XFXA 2JE8A 3UDWC 1T04A 1G9EA 2AJUH 3EHBC 2NTSP 5DK3A 2PUQT 2Z35B 1V05A 2FECL 2YN3A 32C2A 3U0WH 4ZQKB 2JJWA 1YMMD 2BY2A 4Y88A 4PJFA 2EH8L 3Q6GH 4EOWL 2J12B 3BXNB 1AHWC 1CE1L 1KYOK 1I1RA 4K3HA 4X7TA 4EIZC 5GRJH 5DRWB 4ZODA 5BXFA 1EAPB 4U6TA 5L2KA 2PXYA 3BAEL 3IXAB 1PZUB 1MF2H 3BSZL 2E7BA 1S9WB 5DMYA 3JWNC 4L8BB 5FKAA 5IIEB 1LO2H 3MV9D 4DFIA 3O41A 4NN5B 5CLWA 1UXSA 3FB5B 1YPZA 5CINH 1E4WL 5EU3B 4WY7L 5C70A 1F4AA 4YHNB 4DGYH 5JHLL 2FGWL 1J8HD 3BX7C 3N1PC 5DEFB 5DHVB 3GBLA 4LPWA 1S9YA 4N0CC 5FUZH 1Z9SA 3TVMA 2I07B 4N5EC 1H3WM 3MRFB 3V6BR 3W11D 4XVUD 1YEIL 1UZ8B 2DWDA 2H2PD 4P5TB 3WFZA 2NW3B 2QEJA 3RWFA 3JWDC 2BVTA 2XTJC 4RIRB 1FBIH 3V4PL 3ALPA 1TTUA 4HUVB 5FM5M 3RAJL 5J1AB 3MRCA 1KGCD 5E7FA 2WQRA 1NEZG 3F7RA 5TE6H 3FOMB 4KK8C 2FZ3B 1XIWD 3DETD 4XCEA 1T2QH 3QWRA 3NABL 1TJHL 3EJJX 2V5TA 1RZJH 4OZFA 4OZIA 1INQA 4YX2H 4N68A 3VWKB 4K7PH 2E3VA 3SDXF 5F96H 3O2WL 1CLZH 5FM8A 3UYRH 1P4LA 2XY1A 4KPHL 4UV4L 5DRZB 1FL6B 4FP8H 3QZWG 1A1OA 3QUZC 1LWRA 1JE6A 1MJUH 2QR0B 1NUFA 1ZGLB 3V9FA 2OYPA 4LAQL 1Y18A 4JQVC 3DHMA 3HZVA 2APVA 4LPYA 3O6ML 1LNUA 5DF0A 5C9JB 2KDGA 3B9KB 5K33A 5I1GL 2OQJB 4RRPA 2PW1B 1OAYL 2EYSA 1Q0XL 1MIML 3VXSB 4HBQA 2YA0A 4Y4HC 1UEYA 3TFKC 4P57B 4DTGH 5FYJE 1WAAE 3GKWH 4ZYKA 3D69A 5C0AB 4HC1L 1CU4L 5CP3H 1JWSA 5EG6C 1NC4D 4I5BB 5DVOA 2N1KA 1CS6A 1HCVA 1F13A 3I9GH 2OJEB 1TCRA 1MCWM 3GMRB 3MSPA 2BNQB 1EDQA 2B0SH 4POZC 3W0WD 4R4ND 1N5YH 2IGFH 4FN0A 5AD0A 3HE6A 3U4EB 2EIDA 1S7SB 3IAQA 4HWNA 4U7KA 3ROOB 1U58A 1IM9B 4G6JH 2ZSWB 4OF3A 3DYOA 5CILL 5C08E 2VXQH 3HUJF 2A6IA 3NZHL 4XRCB 4KKBC 3G5XA 3O6FB 5D71L 3CZFB 5TGBB 4E0RA 5ISZB 1TQBC 3HI1B 3QG6A 1SY6A 1I1FB 4WI3A 1FYHB 3FN0H 4RGNB 5JQHC 1T5XB 5TH2A 2I26N 4FZ8L 3ARZA 2VIRA 2ZUSA 3PUCA 1AH1A 4ZPVB 1KULA 1MELA 5C07A 4OLWL 3VWJC 3ELAT 2F74A 3L7FB 3LQZA 5B3NA 4N1EA 4K3EH 5D72L 3P4LA 1UT9A 1H5BA 3SE3C 2P48B 4ZO6A 2B1AL 1LE5B 2CJUH 3HE7D 1CDCA 3ARGA 4F15C 5DD1L 4BQ9A 3MNVB 1FSKC 2B5IC 3HS0A 5DRXA 5TDNA 5KANI 5I1HL 3RL2A 4G9FE 3K2UL 3MV7E 4PJ8C 4IM8A 4JDTL 3H9ZA 4X7DC 3K3QA 3NH7L 5IK3B 2JJUA 3L3OA 2H6PB 3NCMA 3TA3A 4A6YL 2FJGA 2YPVH 5I8OL 2P8PA 3SPVB 5C08A 3LPGA 3BKCL 1VHPA 3MRLA 4Y16C 1AY1H 5LJYH 2FB4H 3C9NA 3MLSL 4PJIF 2GJ6E 3F6LA 5MEND 2FEEL 1PKQE 4M61A 4M62L 3AVEA 3U7AA 1U3HB 2XT1B 5LGJA 3MODL 4JZJC 1I3RB 5B39B 4L9LB 5GS2D 4RAUB 3C87A 1JZ7A 1EFXA 4YNYA 3MCKA 4ESKA 3FRUB 2AERT 3IRZA 3RY4A 3WFBH 1PSKH 1TZHB 4LKXB 3NOIA 4JANA 5GIRB 4GW4B 3PWNA 3X12A 3EFDL 4TUKL 1NDGB 2PETA 4YXKH 2FL5B 4RGOL 4BSWA 3QUXA 1S3KH 5E95B 4G9FA 4KKAC 3SDAD 3VRIA 3MV7A 5FO8A 4AT6A 4UT7H 4MJ5A 1FZOA 1YNLH 3HC3L 4J3OC 3L95A 2NY6D 4TOYH 1QEWA 5HYQB 1UM6H 2GTZA 2DL2A 5I73B 3T3MF 3HHRB 1TVHB 4AQOA 4WNQB 1M7DB 4YHMH 4W6WB 4G8FA 3C6SB 4F7PA 3W9DA 1A14L 4QRSA 4AEIL 3L5IA 1AD0B 4MQ7A 5F7NC 4DGVH 5JXEC 6FABL 1YC8A 2W91A 4GFTB 2D03L 2XFXB 2ZG2A 3UJIH 1WWWX 2E7LC 4ODTL 4WI4A 5E08H 4MA8H 1BHGA 2K7PA 5JW4M 1KIRA 5KVEL 32C2B 1OAKH 1DSFL 2D7QA 1JPFA 1YYLL 2UZYB 3V7MA 3B9KD 4E41E 1ZT7A 3WIHA 4P2QD 4PJFB 1EGJA 3H2WA 4QCIA 3VXSD 4NM8L 2AK1L 3UPCA 3SJVA 3KPMB 4JFZH 2ARJA 4X7TB 3WS3A 3ZYIA 2BY1A 4ZTOL 2RIKA 5L2KB 3P11H 2PXYB 3WFCH 1QFOA 2YXMA 3CNKA 3ZDXE 2ZUQB 1YEJH 5TE7L 5E2VH 5FKAB 1JIBA 3AY4C 3MCG1 1NBZA 1KJVA 3E6FA 3O41B 1KN4H 1UXSB 1YPZB 3WHE0 2NY7H 3QA3A 4ONGH 1OAXL 3U82B 1IM9D 5IOPA 4OLVH 4OTXH 4HWBH 3EZ8A 2XN9B 1A3LH 1QUNA 2DI9A 2NY2D 3QCVH 1EXUB 2HAZA 2DQGL 5C2BH 4Z7UA 1S9YB 3TVMB 4S1QL 3KGRA 1NGPH 5C0IA 4L4VE 4WTZA 3P77A 2NW2A 5ISZD 4ZS7L 2ADFL 2DWDB 4NJ9L 5A2LH 3TJHD 5LKNA 1RIVL 3RWFB 2XZCL 4GRMA 4GJTB 4E41A 3MACL 3RX7A 3QZWA 1F4XL 4P99A 4O02L 3WIFA 1G6VK 3UXFA 4I8DA 1WTGT 1VPOH 4IJ3B 1BAFH 4DKDC 1UYWH 3NTCL 2HFEA 3CZJA 4XCEB 3RDTB 4FQ2L 4OZFB 3MBEC 4OZIB 1INQB 4HWZA 3KWWB 1P4LB 3CX5J 4R7DA 1WIUA 5DLML 5K9KA 3BN3B 5LCVH 1QYGL 4JFYA 2Y5EA 1A6ZA 4DKFL 4KUCD 1BZ9A 4K9EL 2ZCHH 4OCSH 4OLYL 3LB6C 4H1LA 1F42A 1F45A 4GS7C 4LARH 3N06B 3PWVB 3QCTH 1Y18B 4L4VA 1KLFA 4Q6YA 1HYSC 1IJ9A 3GBNH 4N1CA 4J2XA 5ADOH 3H9HA 3V5HA 1LNUB 1OTUD 3RY6C 2NXZB 4OI7A 2YUZA 3DUUB 5D7JA 2EYSB 4IMKA 5KJRH 3L5XL 2NY4B 1BJ1H 1NEUA 3CDFA 3D69B 3ZTNL 3U30B 1CDUA 1YECH 5L88L 1TCRB 4ONOA 1CF8H 3A6CH 3AAZA 1AXIB 3BOVA 3WE6A 1KIUA 1W8NA 5AD0B 1T1WA 3HE6B 1CL7H 1UCBL 3ZT7A 3F7VA 1OL0A 1U58B 3HNVL 3WNMA 4DUXA 3TF7C 2GEEA 4Y89A 1RMFH 1K3ZA 3GJEA 3HNTH 4GSDL 2A6IB 3UAJD 1QLEL 4LSSH 1F3JA 3G5XB 1E4XI 4E0RB 2EDEA 5F6HJ 3QG6B 4P4KA 1IQWL 5K93A 4K7PY 4PJEE 4ZSOA 1E4KC 2YKLH 2VIRB 4XMKH 4DGIL 4NZRL 1SJXA 4D0CA 2CPCA 5D7KD 1MLCA 5C07B 3WS6C 3F6IA 2DKSA 1CGTA 4WUKL 2F74B 4GXVL 4HIXH 3LQZB 1ZTXL 1JGLL 4HXBH 3S36H 1G84A 1WQVT 2HVJA 5DD6A 1JNLH 1H5BB 2A9MH 2Z4QA 3ARGB 3RA7H 2AQ3A 4NZTL 2YBRA 4EXPX 4ZOBA 2DMKA 2MCG1 1B2WH 3HS0B 3G6DL 4OQTA 5DRXB 5TDNB 2GK2A 2GK0A 5GGSY 2APWA 5EU4A 4TULL 2MWCA 2Q3ZA 3O0RL 5D1ZB 3TBSA 1WZ1L 2PXYD 4U0QB 2D2OA 1IAIL 3L3OB 2XTJE 1XZ0A 3TA3B 1FVEA 2FJGB 1V7MH 2P8PB 3AS3A 3QFJE 3TT3L 4KQ3L 3O2DH 1MFDL 1AHWA 3MRLB 4Y19D 3LZFH 1YA5A 3PP3H 3LMJL 1LEGB 4M61B 5IP4A 1YEHH 5LGJB 1NAMA 4PJEA 4F57L 3RZCD 1DL7L 4Y8DC 2X44D 2UZIH 3O6LL 3TVMD 2EDBA 3C6LD 4H0GA 4YNYB 1ZVSA 3MCKB 3LKOB 1BMGA 4MA7L 1OP5K 3RHWF 3UPRA 1F2XK 3MXVL 4NQDE 1K8IA 2DN7A 4B7LA 1YEFH 3U4BL 1T83C 4X6FA 1RJYA 2XQBH 1NBYA 1KB5A 2IPUK 3PWNB 1L9MA 3UX9B 3BZDA 3QR2A 4BSWB 3QUXB 5FDWA 3QUMA 3P0VH 2FJFA 3NZ8A 2KBGA 4XNZC 5F1SA 1ZAGA 3VRIB 3MV7B 5FO8B 4AT6B 3EYFA 2BVOA 4OJFL 1CL7I 3RTQC 1EEQA 4MJ5B 3FT2A 1FZOB 4AMKH 1IGIH 3THML 3CPLA 3MOAH 4UV7H 3BKYL 1EH9A 3IETA 3S9DB 2AS5M 4OZFH 2GTZB 2IQ9L 3QFJA 1OB1A 5DJ8B 5E24E 5MI0C 2H2SD 4PD4J 4FTVE 5JW5A 4G8FB 2PN5A 2Z91A 4EI6A 4ZAKD 4LP4A 4HPOL 3W9DB 4Z7QE 2BVPB 4QRSB 4MQ7B 4GW5A 4OKDA 3RU8L 2OTPA 1CXFA 5I15L 2P44B 2EH7H 1XF3A 1ZLSH 2A77H 4Y5VA 5HHNA 2BRQA 2E7MA 4RNRA 1D5ZA 4NQDA 1JPFB 1HH6A 2GSIA 4HBCH 1ZT7B 2EICA 2BXZA 2CKNA 4QCIB 3WO4B 3SJVB 2ARJB 3HA0A 4O51B 4URTB 1ZWIA 3WS3B 1KCVL 4JQVA 1Z9LA 4NGHL 4KGLA 3UTQA 2EDWA 3GI8H 2VR5A 4BZ2H 3FQWB 4JFEA 5J06A 4ZFFA 1NBZB 4Y4HA 1KJVB 3QHZH 4K2UH 2FJHA 1PAMA 4APQD 4JFHE 2E27H 2VDLH 5IOPB 1Q94A 5E1AA 2JJTA 3FONA 5GRUH 5CUSH 1I7RB 4CU8A 4BH8A 5JZ7D 1ITBB 3HMXL 2DL9A 4Z7UB 2BCKA 4EUPH 2W0KA 3EBAA 5D2NC 4Z8FH 4BFBD 4OF8A 2MPAH 2NW2B 3T77A 3DYMA 1NSNH 2HT3D 1SY6H 3VGBA 4WW2C 5C0JA 15C8H 4IOIA 4YHYB 1QR4A 4FQXA 4OGXL 3D0LA 4GRMB 4E41B 2FEDD 3HMWL 4FHBD 5E8EA 4S11A 4ONFL 3WIFB 4QHUB 4YHOH 3WYRA 5FYJD 3HI5L 5FYJH 5C3TA 4RGMB 2PYEE 1LVEA 2X9XA 3PABA 1ADQA 4M48H 1ONQA 1WZLA 3O3BA 3ARGD 2HFEB 3LEYL 3WUWG 4EN3A 4PJFF 1A7NH 2I5YH 2KH2B 1U9KA 1B0GA 4BQ6A 1PD6A 3P9LB 5I66A 3EYOA 1PBYA 3VWJA 4FZEH 5DD0L 4HFUL 4R7DB 1Z3GH 4G9DA 4JFYB 1A6ZB 3IFPA 1BZ9B 4MQXC 4X6CA 1S7QA 4H1LB 4NQVB 5C08D 1KCSL 4KMTL 3GGWA 1YPZF 5CCKL 1MVFA 4L4VB 4HUWA 4KTEL 5CAYB 4G6AD 4HKJA 3X3GL 1NLDH 1BD2A 3H9HB 3V5HB 1U2HA 4P59H 3M8OH 5SWZE 2DQHL 3WKMH 4R7NB 2AJYL 3C60D 4NUGL 4N5UA 2VSDA 4M7LH 4E5XA 2I9TA 5CJQH 4M7ZC 4DFHA 3LKRA 1OHQA 1EFXD 2ATPA 4Y16A 3OKLB 4CU6A 3SDYH 4M3KB 4ZUWA 1U6AH 1AC0A 3TT1L 5HY9B 2QL1A 3AB0C 4WHTA 1U8NA 1HKLL 2HFGH 5ALCL 5LBSL 5IB2A 1KFAL 5FUOH 1DQML 5DQDH 4JZJA 2P24A 5GGUA 4OD3L 3HR5A 1HCFX 3WE6B 3QUXD 4MS8C 4TSCL 5ERWA 3PGFL 2DLGA 3QSKB 2VQUA 4G9FD 3MV7D 3SKMA 4QRRB 3F7VB 1P69B 3IDIA 1ODAA 5EH1A 3VJ6A 5FA4A 1P53A 2QQLH 5HVHC 1VEMA 2W9EH 3GJEB 4QY8A 2O5YL 4OZIF 3NFNA 1IGJB 4ZO7A 5FYLH 1F3JB 2DQDL 5EOCJ 1RIHH 2ORBL 1KXQE 4P4KB 1MRFH 1DBAL 1VGKA 4K94H 4AEEA 3N85L 2GJ6D 3DYPA 1HSAA 4I2XE 4D0BA 2GQHA 4N0UA 3ULVL 4FFYH 5IW6A 3OHXA 4ZSOB 1FGNL 3VXMA 5DGQA 4R2GB 5D1XC 4D0CB 5IHZB 3J8F7 3UTSE 1UWGH 4Z7VE 1NC2A 2R2CA 3BKJH 5IQ7H 4YWGH 4XWGL 2HVJB 5DD6B 2NZ9D 3GUTA 3HPLA 5HYEA 2Z4QB 5DYOA 1U2CA 4JPWL 1JWMA 2A6DA 3WIHH 5JXEA 1EGJH 5I1CH 3GSUA 1YZZA 3V95A 1AP2A 3V52H 2GK0B 2MJWA 5EU4B 3V0WL 1NKRA 1MQKL 2DQUL 3TBSB 2B4CH 4JR9H 1CDIA 2VAAB 4JREB 5GXBB 3KYKL 3LKNA 4DOHE 1N59A 2ICES 1FRGL 2Q3AA 4FQJH 1W0VA 2EXYC 4YGVA 1FVEB 4I3SH 1F4YL 1IAIM 2DMBA 1JHLL 1AHWB 4WI5A 5DURB 3QUYC 4EVNA 5GGRY 2AK4E 2C3HA 1GRWA 2WSKA 3BPOB 3NAAL 4ELKB 3GDBA 2OI9C 5GHWL 2NXYB 1NAMB 4IS6A 4FQIH 4HQQL 4U0RC 4DZ8B 4QT5A 1SBSH 5FYKE 2P5EA 5T5FH 3HPJA 3IJSA 3MA9L 3UTSA 3QNZA 3ZKMD 2NY5H 1GAFL 7FABL 4X6BA 2X4TA 1QSFE 5E4IA 3KPSE 1K8IB 3X11B 3BO8A 5JW3L 1LQSR 3D6GA 4X6FB 4E41D 1RJYB 4UT9H 4X7CC 4NUJA 2HKHL 3FMGL 1NBYB 5FDWB 3OKYA 3S96A 3QUMB 3MJ9A 2FJFB 4JKPH 2V6HA 3P9WB 3S6CA 4XI5C 1DQJA 3EYFB 3MLXL 4IOFD 2BVOB 2YPLB 3FT2B 1NCNA 1QSZA 4PJ9A 3CPLB 3IETB 1IEAA 3BRFA 4NC1C 5INCA 1WSST 4NO5B 1NCAH 5J13B 2F8XC 1NL0H 3RX5A 2BVUA 1D6VL 3WXWH 5JW5B 2C3GA 4K9EC 1HIML 2Z91B 4EI6B 5ACZA 3PDOA 4GW5B 4IRJC 2VZTA 4JPKL 2ZCLL 5T33L 4XH2B 4H1LH 4G6ML 4XTRC 1FDLH 2I60H 2R0LH 2JELL 3ZT5A 1FO0A 1VFUA 1QRNA 4L4VD 4Y5VB 5DMJB 1OPGL 4K3JL 5HHNB 3RGVA 4RNRB 4CMHB 5C0ND 3LDBC 3BRGC 2ZJSL 4YDIL 2W0FA 3KPSA 1D5ZB 4NQDB 1HH6B 1OGAE 2EDJA 5BS0E 2GSIB 5TPWL 5D7JD 1DCLA 1UJ3C 2XA8L 1C5BH 4HKBA 4ZXBA 5E8DL 1ZE3C 1MLBA 4HF5L 4OGZA 2MQ3A 3UTQB 1N6QL 2VKWA 3RY6A 1DFBH 1AGCA 4X6DA 4RFEB 4JFEB 4ZFFB 3TBWA 5DJ6A 4H0IA 4MVBD 4PLKC 4JQXC 4LASL 5I1LA 2FJHB 5EUOA 5KSBE 4TQEH 2VAJA 5F8RC 4QXUL 1YNKL 3QULA 1W2KT 5E1AB 3FONB 1DVFA 3GIVB 4NKOA 3WUWA 3N9GH 3QIBD 2BCKB 1NCWL 3T0BA 4PRPB 4TYUA 3HRPA 1FNSH 1P9MC 3RWIA 3VFGH 4KDVA 5C71A 1UM5L 4P4KD 5C0JB 5DZOA 4IOIB 2J4WL 1OGAA 2EE6A 4FQXB 3D0LB 4NKMA 4YK4C 2P5WE 5BS0A 4WWKA 4K71B 4YR6A 4OAWA 4FABL 4MAYD 2FR4B 3TLRA 3SE9H 3MBXH 3QQNA 3EZJB 1Q9LA 2J7LA 2DQEH 1ONQB 4QTIL 1PDKA 1BF2A 3MLZH 4EN3B 2Q1EA 5GGQL 1XMWA 3I85A 3ZL4H 4WUUA 1FAKT 5HGDB 5DR5H 3RBGA 5I66B 4XPGH 3EYOB 3VWJB 1OCWH 5H37G 3EHBD 5KSBA 2DWEA 1CT8A 4G9DB 4Y1AE 3BDXA 3IFPB 1HHHA 5HHOE 4X6CB 4PBWD 4X4ME 5SWQA 1DBMH 2ED7A 4LLAA 3S35L 3FFCE 3MGTB 4PS4H 5FOJA 3GGWB 3RIAF 2O61A 1JTPA 2R39A 1PX3A 4HUWB 2BRRH 4HKJB 1BD2B 4W6XB 3NA4A 1R5IA 4FXGA 3K74B 1KPRA 4LL9A 1NAMH 2DJUA 2P5WA 2CR6A 4XMLL 4ZO8A 2WWMC 4E5XB 2ZUXA 4Z7UF 4AG4H 2W9LA 3WSQL 3K81A 2ATPB 4Y16B 2DLFL 4FQCH 4NC2B 3H3KA 1LDPH 3U7YH 4QRPE 4ZUWB 4D9RE 5IJVA 1A0QL 4XCFL 3JTTA 4WHTB 2X1XR 3BH9A 4QHMA 3ULUC 5IESL 1RHFA 1M7IB 2P24B 1IC7L 1KB5H 5GGUB 3HR5B 3KAAA 4KTYA 2UVFA 3JUYA 4N0CD 1T80A 4RA3A 5ERWB 1Z9MA 1GOFA 4N5ED 1T6WA 1FV1B 3BIKA 3SKMB 3QI9C 3VJ6B 4Y1AA 5FA4B 4WU5A 3JWDH 2Z31C 1T83A 2XTJD 5HHOA 4U1IA 5DI8A 1A7PL 1WIOA 5KSAA 4X4MA 4HZAA 4QY8B 3NFNB 3QFJD 3HLAA 2DM2A 4N8PA 4HUXA 5GRVK 4KVCL 3FT4A 5IKCA 3GBML 4BM7A 2ZUUA 3A67L 2GIYA 2FYYA 1IFHH 1RZKL 2LFGA 5K9JH 1VGKB 2FH8A 1BQHG 4RISL 1HSAB 4NBYB 4D0BB 2DQTL 4N0UB 1DLFL 4JY5H 3OHXB 5IW6B 3VXMB 4H20H 1NFKA 1MPAH 5D93B 3H7BA 4PJGE 3ZT6A 1J5OL 2AJXL 4QRPA 2LU4A 3GUTB 5T1KA 3HPLB 3MLYL 2M2DA 4NQDD 5A43C 2G60L 5DYOB 3GI9L 4XPHL 2A6DB 3ETBF 4JN2A 4OFDA 2QQKL 3GSUB 2D7TH 4ZNCD 3DNKA 1MHPH 1AP2B 2VDOL 5D2NE 4GW1A 3X13A 2MFNA 4XZUA 5EZOH 1F4WH 1N2RB 1X7QA 1SM3L 1T1XA 3LKNB 1NPUA 2Z0BA 3MGOB 4KI5F 2R0ZH 2W9DH 1W0VB 2YD3A 4YGVB 3ZE0F 1PW3A 1FYTA 4Y4HD 4Z7WE 3TFKD 3VW3H 1A6WH 2R29L 3PXJA 4EVNB 4FTVD 1AE6H 2YD4A 3DI3B 4Z0XA 1TNNA 5FM5O 2CLRB 1P4BL 2DBLL 4X83A 4POZD 4JFOA 4QT5B 2E6PA 4XNQA 1GGBH 3NPSB 2P5EB 4PB0H 2V7HA 2HMID 3HPJB 1II4E 3UTSB 4PJGA 3QNZB 4C55A 3MLTA 4X6BB 1X5LA 2X4TB 3UJJL 2DI7A 1FVDA 1PX4A 1RIUH 4NNXA 3L9RA 2LU7A 4NUJB 1I9JL 3LH2H 2NX5A 3F7PC 4XNYL 1U36A 3S96B 5D2NA 4AIOA 3MUJA 1DQJB 3BYTA 4PY8I 2ICEB 3UTPE 1ADQH 5FGSA 3DWTA 4YXHL 1P7HL 1KELL 4TTDC 4PJ9B 5TE4L 1EO8H 1IEAB 4L3EA 4YFEA 5INCB 1U95A 1H8SA 4JHWL 3VWJD 3VFPA 3QXUA 3AS1A 3SKJL 4JFHD 5LXGH 3DUHA 2OR9H 3WFEL 5BJTA 3IU3A 4U3XA 3CFIC 3OKEA 3PDOB 5IFAL 4BQCA 2DTMH 1BEYH 2W0PA 3MLUL 2IG2H 4K7PX 2Y6SD 4KV5E 2YK1H 1FO0B 4PJ8D 1QRNB 4QKXB 4LVHC 3RGVB 2XKNB 2R8SL 4KZEL 1BWMA 2W0FB 4UAOB 5T3XH 3P4NA 1CDYA 5JDSA 4YEEA 5DT1H 1WWAX 4R6UA 4HKBB 4ZXBB 1D7FA 4Y16D 1CGXA 1MLBB 2BHYA 3LHPH 5ADPH 3GO1L 1ORSB 2PYED 4GBXC 1ZLUH 3KDMB 1UADC 3VMPA 4J8RA 4KC3B 5ANME 4X6DB 1C12A 1DUYA 3TBWB 5DJ6B 2VNCA 5JO5A 4GH7B 1G6RA 4FFVC 5I1LB 5BO1H 5EUOB 3NVQA 3QQ3A 4LCYA 5DK0A 4LF3A 2HFTA 3SKNA 4EI5A 5ETUA 3QULB 4JVUA 3EO0A 3VG9B 5F9OH 4XX1G 1DVFB 4NKOB 3VD7A 4RFOH 3DI2B 3PP3K 5L8JB 2VE6A 4LPXA 4KKAD 3RWIB 3ULVC 1ED3B 1GOGA 4C4KT 2XQYG 2VXUH 3BD3A 4OV5A 2HG5A 5SWZD 1KYOJ 4NKMB 5BS0B 1LGVA 5I9QC 3TYGH 4WWKB 1RZ7L 4YR6B 3LS5L 4OAWB 3SGJA 3QIWC 4DVRH 5JLZA 3KLSA 3C2SA 3B5GA 2Y07H 4LSPL 3DX7A 1NC2D 4M8QA 4JHAL 1Q9LB 2FX9L 3N1QC 3MO1A 1I1AC 4X7SL 4BUGA 3EYQD 3K46A 4ZNEE 4CN1A 4OCXL 5JXED 2CDFA 3ARVA 5D1XA 1R3IL 2VDRH 1CFSA 4WUUB 4PV9A 3S98A 5FIEA 4DEPB 2DWEB 3L7EA 3KPNA 1OGTA 1W8OA 1N4XH 5A2KH 3O11A 4N8VA 5BCAA 3IFNL 2EIEA 4U1GB 2A1WL 1ZT4A 4NQSA 1HHHB 5T5NF 2VDML 4WCYH 3G5VA 1BP3B 1A4KA 5IGXH 4PRBA 2DM3A 5MP6L 4MXQC 2O61B 1SEBA 2EDQA 3C2AH 4J7RA 1PZ5A 1KCUH 3WDHA 5EBLA 3BESR 5E2JA 1R5IB 4RMQA 3VU2A 3ZE2F 4FXGB 4ENEC 1KPRB 5IHUL 4Q0XL 3K8KA 2DJSA 5ICXA 4NC1E 1TFHA 5I6XC 5SX5H 1LD9A 3OTTA 4J4PA 3UTSD 1RK1B 1J0JA 5IJVB 43C9A 3QUYA 1ZA3A 3R4DA 2FATH 4ACPA 1E4JA 4QHMB 1ZSDA 1DEEA 4TNVK 4P2RB 1EVTC 4QF1B 2JK5B 3FFDA 1CI5A 1JNJA 1J05B 1MIEL 4BKLA 3I50H 4PR5A 3MJ9H 4ETYA 5IG7B 5DTFA 4GAJH 3NBNA 4KY1H 2V5SA 4OB5H 3SEPA 4Y1AB 4WU5B 3HNSL 4U1IB 5KSAB 5LVEA 4HUXB 5GISL 1G7PB 3FT4B 1S78C 1P7QA 3LS4L 5IKCB 1SYVA 3KXFB 3SE4C 4X98A 1FG2A 4HH8A 4L5FH 2AK4D 3MRMB 4P46B 3FCTA 1PG7W 2UYLA 4PBVC 4X6CF 4G8IA 4LK4A 2UUDH 2H45A 2IEPA 3EYVA 1FZJA 1I7TA 3H7BB 5FYKD 1W72L 5FYKH 5I30L 4UILL 2FIRT 2YPKB 4DGYL 3RGVD 4QRPB 5DUML 3HAEG 4BQ8A 3W2DH 1QSFD 5T1KB 3KPSD 2AV7A 3UPAA 3ZYOA 5E9DE 3WJJC 2CSPA 1FL5A 5FUZL 3VI3E 2WV3A 4OGAC 3S5LA 5D7SH 3VGFA 1QRKA 1I8LC 4GW1B 1OAQH 3X13B 4XP4H 1NMCC 4XZUB 1HYSD 1X7QB 4HPYH 3IDXH 1T1XB 3HB3C 4X7EC 3BIAX 1CICA 3L3JA 4XXCC 3BMVA 5FHAL 1RUPL 1FYTB 1I85C 5FECA 1LO0L 2AP2A 1UA6L 4K23H 1FNAA 1Q9KA 4GAYA 4DKEL 3WN5C 5C0BA 4Z0XB 1KTKE 1A6UL 1T2QL 3GSWA 1AJ7H 1RZJL 2HJKA 4KK5C 3S37X 5F6HI 4TUOA 4JFOB 4YX2L 3QDJE 3SO5A 4XNQB 1MY7A 2XWJA 4J3SA 5B38A 3D39E 1CLZL 3UYRL 4PJGB 3DMMA 3MRNA 3MLTB 2IF7A 2J1KA 3GM8A 3MCLL 1OGAD 5BS0D 3L9RB 4NPYA 4XX1E 4X9FA 5L7XL 2HJLA 1I3GH 2NX5B 1JRHL 3J7HA 2V2WA 1G0YR 5F9AC 4NN6B 1BZ7A 1N7MH 2IQAA 4HK3J 3VDBA 1X4YA 3LSOA 5F7WC 5IV2A 5GSRA 2CIKA 5DWUL 4L3EB 4P2CG 1U95B 4KRPB 2NY1C 2BERA 3T0EC 4YQXL 1CK0L 1BX2A 5BJTB 3ZO0A 2DLEA 4A2LA 1T4KB 3OKEB 4EOWH 1CE1H 4O9HH 4RBPH 3QDJA 4NC0B 3BAEH 1JPSH 1BGXL 4X7FC 3BSZH 1GYAA 5BMFL 3FQRA 3TWCL 3P4NB 5JDSB 1J1XH 5IEKA 1XF1A 2A6JA 3C09C 4W4NA 1E4WH 1ULVA 1TQCC 2P5WD 4NQEA 5I74C 5E5MA 4WY7H 1X5ZA 1OARH 3VXUB 3TBTB 5JHLH 4HK0B 1IAOA 2FGWH 2YD8A 3BI9X 1XCQB 1D5BA 1ES0A 3FN0L 4ZFOA 1HZHH 3TBYA 4W70A 12E8L 4CN4A 4LLMB 2C1OA 4KHTH 3BPNB 1C12B 1DUYB 4LVOC 1E27B 5CSBA 5JO5B 3V8OA 3FQTB 1G6RB 1U92A 4FFWC 4J3XA 4LCYB 5DK0B 3TP4A 3KPTA 4LF3B 2H1PL 2CJUL 3SKNB 4EI5B 5CMAA 5ETUB 4BH7A 4Y1AD 3EO0B 3RAJH 3RIAK 5HHOD 1G7MB 2VLJB 3GSRA 1RZKC 3FFCD 3V4VL 5TQ2L 3OX8A 2VE6B 2O5ZL 5DMKA 3BMWA 4HV8A 3TBVA 3NABH 3RP1A 4OV5B 1OQXA 2HG5B 2YPVL 5D6DC 5E2TL 2AV1A 2Z31A 2WP3T 4W4OC 2RAMA 1FC1A 3JV0A 3O2WH 5JLZB 1AY1L 3P2TA 4UV4H 3DX7B 5IR1A 4K8RL 3VMNA 4D9RD 2EE3A 3BP4A 4QRPD 1CXLA 3DSFH 3MO1B 5T1KD 3KYMA 3I6LE 2CDFB 4LAQH 1CFSB 3S8WA 4PV9B 4Y4FB 4OM1L 3D18A 4H25A 4KDTA 3O6MH 2FECI 3L7EB 4DUVA 2V9TA 3B3IA 3S36X 3KPNB 1OGTB 4GRLA 3T04D 5I1GH 3QDGA 1R24B 3O11B 4MXVF 2QADC 4N8VB 4Y2OA 1OAYH 2B20A 3IU4L 1Q0XH 1MIMH 4Q97A 1ZT4B 4NQSB 5FEBA 5A2IH 3MRBA 4X6DF 5L0QB 1CU4H 1EERB 3TO4C 1S3KL 2HWZL 3FO0L 3G5VB 3MNZA 4PRBB 2OL3A 2I25N 5EUOF 1SEBB 4UT7L 3WHXA 4LLVA 3RPIA 5EBLB 3ISWA 1F90L 1MCFA 5JIKA 4Y5YA 4DKAA 3TIEA 2IMNA 2X4RB 3CVHL 1AGDA 2ESVB 5ICXB 3EOTH 1LD9B 4YHML 5HGGS 1G1CA 3ABZA 4EBQL 3VI4F 3OB0H 5CILH 4Y5XC 5EORL 43C9B 5DMGC 5A40E 1J0YA 2OK0H 3QIUA 5L8KB 1ZSDB 1DEEB 5E6YA 5I18H 1T2JA 3UJIL 5I75C 4L4TE 5E08L 4MA8L 2F15A 3FFDB 3F58L 4JRYE 4BKLB 1ITCA 4M93C 4PR5B 5DTFB 1XF2B 3VFRA 4HLZH 4F8TA 1PJ9A 4L3ED 4X4XA 4XVJL 5D72H 1P7QB 3DPBA 5IHLB 1CD1A 3WFCL 4XP9H 5I0DA 5DD1H 4ZTPH 1JGEA 4X98B 1FG2B 3DARA 1FN4A 2H26A 2X7LA 3FCTB 1KN4L 1C5CH 1KJMB 2VLRE 4G8IB 4KFZC 3EYVB 1FZJB 1I7TB 3RVUC 2F8VA 2Z8VC 5C0CE 1FFQA 4RZCA 4OTXL 3K80A 4HWBL 3W82A 2GJJA 4A6YH 1AKJA 5I8OH 1SMOA 5KG9B 1H8NA 5T3ZL 3BKCH 1FL5B 3BWAA 1JF1B 4D0DA 3L3HB 4LLQA 4MJ6A 3MLSH 3S5LB 2F19L 3KR3L 2Y06L 5DEZA 3ULVE 4M62H 2BHUA 4H26A 5ALBL 3RVTC 3FN3A 4YH6A 1OAUL 5DRNA 3UTPD 2A38A 3I02A 1CICB 4DJMA 3L3JB 2DDQH 3BJ91 3LD8B 4WEMB 4H88H 1G6RH 2YSSA 5FECB 4IRZH 1GZPB 1ZHLA 2J3SA 5IJKA 4LQ1A 1IEHA 1Q9KB 4IDLA 2OSLA 5KAQG 1HK6A 1UYWL 5C0BB 3EFDH 3BGFC 1EHNA 4RGOH 1SJVA 2HJKB 4TUOB 2VLRA 2XWJB 1RQ5A 5B38B 2JIXD 4MZ3A 3BISA 3UBXG 3DMMB 3MRNB 4K7FA 5H37H 4KK6C 5C09B 4NHUB 3QEQA 1TZIA 4WV1A 4QO1A 4NPYB 4F9LA 1HHGA 4HAGA 2HJLB 2KZ1B 1A14H 3BUYB 4LEOA 5ADOL 1EHXA 4S1SH 1BZ7B 3T1FA 5GZNC 5IB3A 6FABH 2IQAB 1XGPA 2D03H 1GC1H 2D0HA 5AWNL 4S2SA 3LSOB 4OZ4B 5KJRL 2LTQB 4ODTH 5IV2B 4KJWC 5GSRB 2CIKB 5D1XD 2O5XL 2VLKB 1AI1H 3ARDC 5KVEH 1DSFH 1YYLH 1YECL 4KJYA 2NY0C 4P23C 4QOKE 1BX2B 4U1JA 4QHKI 3A6CL 5HDOA 2OBGA 4NM8H 1MI5E 2AK1H 2RGSA 1H0DA 3GMMB 4X5LA 3VH8G 1QSVA 4ZTOH 3QDJB 3K4AA 3C8HA 3Q6FB 3WJLA 1A6TA 1EHLL 2EDTA 3FQRB 4WHYH 3BDYL 5IEKB 2A6JB 3SO3C 2EXYD 4NQEB 5E5MB 1ACZA 1OAXH 1T20A 4PJGF 3QUYD 4ZFOB 1D5BB 1ES0B 2VH5L 3AREA 1AQDA 2FEEI 3TBYB 4GUPA 2DQGH 2X4SB 2SEBA 2YWYA 2PR4H 1A2YA 2C1OB 3NFPA 4S1QH 5BVJA 5F88A 1F11A 4OF6A 5MERA 1U92B 5E56A 4NJ9H 5J57B 5F9WC 1JNLL 1RIVH 2XZCH 2A9ML 3B2VL 3BQUB 4X6EA 1WISA 1F58L 4QOKA 5CMAB 1F4XH 4ZD3L 4BH7B 4KKCC 1KJ2A 4O02H 4WI8A 1MI5A 2YRPA 2AEIT 2G75A 4U1LA 2YRLA 3GSRB 3HG1E 1A3RL 3ARFC 3OX8B 4PV8A 1FFNB 4XI5D 3NTCH 5DMKB 4LSVH 4OIBA 3TBVB 1T89C 4K55A 3SQBA 4JPVH 3V4UH 3QDME 5LAXA 1MJ8L 2AV1B 4JB9L 3P4OA 1GOHA 1RU9L 4L8DA 4YBLC 1K5NA 1QBLH 3SBWA 5DLMH 3R0MA 2G5RA 5IR1B 3BP4B 1CZ8L 4LCWA 1CGWA 4K9EH 4M3JA 3ZMRA 4BK4A 1XF4A 1YEHL 1ZKAA 3KYMB 5I1EH 4IRJD 2UZIL 3IYLW 4XVUC 2Z93A 1NMBL 3IDYC 4XTRD 3D18B 4H25B 2VZOA 3B3IB 3OXRB 4GRLB 3QDGB 3FQXA 3GSOA 4E42B 4TPRH 1QG3A 4DK6A 2IPUG 3L5XH 4HMEA 5F7HA 4CU7A 3MRBB 4M8VA 3ZTNH 3P0VL 4JY4B 3MNZB 1P5VA 4UI2A 3DRQA 2EDFA 2OL3B 3ES6A 3D0VA 3DECA 3T0DA 4BZ1L 1A7BA 3WHXB 4LLVB 1RZJC 2JCCA 4RFNB 4Y5YB 3TIEB 4UV7L 2WIIA 1AO7E 1AGDB 3QDMA 1QFHA 1QA9A 1RJLA 5SWSE 1UCBH 4PLKD 2GSGA 3T0EE 3HNVH 3DMMD 2R15A 2ARJQ 2F53E 3QIUB 1I1YA 4GSDH 5E9DD 1QLEH 1ZLSL 2A77L 4ZFZA 4ELME 3GMQA 3MRKA 1ZLUK 1Y6MR 1IQWH 4ORGA 5HYFA 1C5DA 1U3JA 4DGIH 4NZRH 4F7EB 5F6IB 2ADJB 1PGRB 3VFRB 3AROA 3S34L 1CFVH 1ZTXH 1JGLH 4X4XB 4DAGL 4G80A 2IH1A 4UOW1 1CD1B 4R97C 5IROC 3VFTA 3C5ZC 1U8QA 3EUUA 1JGEB 4NZTH 4O58L 4R4NC 4U4BA 4HXAL 1FN4B 1OLLA 2H26B 1XT5A 3G6DH 1MCHA 5CZVL 1GIGL 1F2QA 4TULH 4H8WH 4C58B 3O0RH 1P5UA 2YS4A 4K2UL 2UV3A 3LIZL 1D5MA 3QDJD 5SWSA 1WZ1H 2E27L 4JKWA 3D39D 2CLVA 2VDLL 1IAIH 5J6HA 1BVKA 2JJSA 2XKUA 1UZ6E 4RZCB 1V3MA 1CG9B 5GRUL 1JYNA 1YNTA 5CUSL 4YFLI 1AKJB 2F53A 3MYJA 5AZ2L 3TT3H 3ZHKA 4KQ3H 1CFQB 5DJDA 1P2CA 3BWAB 4MSWA 5JPMB 1RZFL 1D9KC 1KXVC 4D0DB 5DD5H 4ELMA 4LLQB 4WO4A 4JHBA 3MV11 1NSNL 3F8UB 3E6HA 4U1KB 4H26B 1B9ZA 1E6JL 4E9LA 5I17B 4F57H 3DVIA 5DSCA 3RWCA 4ZO9A 1DL7H 5IB1A 3I02B 4YHOL 1C7TA 1FPTL 2WWMD 4QRQA 4MA7H 4QXTA 5DJAA 3O8XA 2YSSB 3UC0L 4ODSH 1ZHLB 3MXVH 4M48L 3U4BH 3JWOL 2AEWA 2VISA 3KPRE 5AAWA 2I5YL 3UTZA 4NHCH 2FBJL 2V2TA 4JZOB 4FZEL 1DLHA 2DM7A 4OJFH 1F8TL 1MRCL 1A02N 3QI9D 1J88A 3KYAA 4NN5C 1DN0B 3QEQB 1TZIB 4PJDE 4CNIA 2Z31D 4S0SD 4WV1B 1U3ZA 1NH6A 3U0PA 1JNHA 1HHGB 4K8RC 3HZYA 3CXDL 4D3CL 1NLDL 4LEOB 4YFLF 3MLWL 3WKML 3T1FB 5IB3B 1U8JA 2VLLA 5I15H 1XGPB 4YJZL 4M7KH 5M7QA 3AS2A 4M7LL 4PGDA 4S2SB 4W4OA 3LCYA 1Q9OA 1K85A 1N5AA 4P5TC 3ILQD 3RNQA 3SDYL 3CFKB 3UYOD 4KROB 4FXLA 4KJYB 5BOPA 2YUXA 2R0KL 5FB8B 4U1JB 4WI7A 5FUOL 5D2LB 3KPRA 1TVBA 1J12A 2VXVL 3IGAA 3RI5F 1KENL 1KCVH 4JVPA 3RWGA 1FNGA 3SKUD 3S7GA 1A6VL 2OL3H 1A6TB 4J3UA 2J8UB 4Y4KB 3CK0L 3UMTA 4X80H 4GG6B 4ODUA 5IW1A 1IAII 1NLBL 4D9LH 5EN2A 2UUDK 1R3KB 3VWKC 2W9EL 4WFHE 1WFNA 4C4KO 1NCTA 1TPXB 5FYLL 1M4KA 3RWDA 3V5DB 1T20B 2JJVA 2VKXA 2YHGA 5F8QC 3AREB 1AQDB 2VQTA 1S9XB 4AQ1B 3GK8L 4GUPB 2SEBB 1INEL 3QIUD 3VXPA 1OP3H 3I6LD 3NFPB 2PW2A 4X9BA 5F88B 1F11B 3VI3F 1BOYA 5MERB 3B9KC 3LN9A 3U4AA 5IQ7L 1MWAA 4I77L 1NUGA 4MMZC 3HMWH 4JDVA 4QOKB 3L3KA 1EGJL 4I0PA 5CJOL 3UZQA 1KJ2B 1UQSA 5JTWA 1MI5B 4GRWE 2G75B 5IWLA 4U1LB 2N56A 4HIJA 2B4CL 2HTKC 4PV8B 1T1YA 1DP0A 3BWUC 4JR9L 5ACMA 1X6NA 4FQJL 1N6VA 1ZHNB 5HYIA 3H42L 5LAXB 3WL9A 3OPZL 4TTDD 2K7QA 3ESVF 2PF6A 3EOAA 3P4OB 5F1NA 1UB5A 4XPAL 4HFUH 4L8DB 3U9UA 1K5NB 4OZHB 1MNUL 1B88A 4OLEA 4Y0GA 1FC2D 4LCWB 4B5EA 1IGYA 1XF4B 2NYYC 4FQIL 4C57C 3O6FC 3SDXE 2PTTB 1FHGA 4YHIB 5T5FL 5CCKH 2Z93B 4BSVA 1TJIL 4L4TD 1WBYA 4RGNC 2NY5L 1A21A 5B4MD 4JRYD 5K9QG 4WHDA 2AJYH 2OTWA 1RULH 4X8JA 1I75A 4M1DL 2IMMA 1JV5A 1L6ZA 2FX8H 1NGYB 1H3GA 4M6OL 2YD6A 4G3YH 2DM4A 3VGAB 3TT1H 4AM0A 1HKLH 3PF2A 1GHFL 1I4FA 1QZ1A 3KYNA 4XHJC 4PRHA 2JCCB 1KFAH 1DQMH 4RBPK 1B0WA 4OD3H 2WIIB 1I9IL 3QDMB 2YN5A 3WCYA 1HXYA 3V6OC 3PGFH 2Y23A 1QA9B 1RJLB 1NCAL 2VLRD 5CKGA 4FFVD 2GSGB 5FK9A 1UB6A 5DO2C 5C0CD 4NNYA 1JGVL 1J0IA 3JTSA 4HIIA 2WBWB 4Q9CA 3SKOA 1DQTA 4N0YH 2C4FT 2O5YH 1I1YB 3SDXA 1RJCA 1FDLL 1S7XA 3GMQB 3MRKB 2ORBH 1U3HC 4ORGB 1GGTA 3N85H 1QP1A 3ULVD 3ULVH 1NCUA 1C5DB 4L9LC 3HUJE 2G2RA 2R4RL 2OM5A 2QKIA 3QIWD 4Q74A 2D4DA 3VFMA 4G80B 1I7UA 2IH1B 2Q87A 5T1DL 4PB9H 2X4UA 1QFUL 3V0WH 3TZVA 1MQKH 3FRPA 1D5MB 3ARDA 2DQUH 2NY1B 1MCPH 3KYKH 1BVKB 1FRGH 2EDNA 2OLDA 1YNTB 5I73C 1F4YH 3LY6A 3UAJC 5H2BA 3IDJA 1JHLH 5DJDB 3N9GL 1P2CB 4MSWB 3OJMB 1FNSL 4WO4B 4LRNL 4MXQD 3NAAH 4XCYB 5DA0B 5GHWH 2V17H 3DUSA 2R56H 3E6HB 1HQ4A 3HUJA 4WEBL 3RWCB 5DSCB 4MMXC 5IB1B 1WTLA 4ENED 4MGXA 5C2UB 1KTDA 3MA9H 1HDMA 4PJIE 4QRQB 4QXTB 1GAFH 5DJAB 3O8XB 3MBXL 5CZXC 5HYJA 4P3CL 2VXSL 5JW3H 1OLZA 3MLZL 2HKHH 4QOKD 2VISB 5C6TL 2Q20A 3EO1A 1MI5D 3ZL4L 3UTZB 4M6AA 4OQTL 2IWGA 3QFDA 5DR5L 1XCTA 3LEXA 2PXYC 1OCWL 1YC7A 5JR1L 2V2TB 1DLHB 3IFLL 3MLXH 3OXSA 1KPVA 2ZUQC 1SJHB 3MUHL 4ZUUA 1S8DA 2J6EA 4NBXB 4PJXE 4OV6F 4CNIB 1DBML 3WXVL 4PREA 3OB0K 3U0PB 3R8QA 1JNHB 1D6VH 3HZYB 1HIMH 2BRRL 1DZBA 1VA9A 1RZIA 3ARFA 5BV7B 1T89A 1U8JB 4JPKH 2VLLB 3TVMC 1NAML 4JFDE 2XPGB 1W72A 4PGDB 1E6OH 4G6MH 4AG4L 1Q9OB 1N5AB 1OPGH 4K3JH 5DQJA 2BVQA 3RNQB 4EJ1C 4FQCL 5HPMB 2ZJSH 4YDIH 3RWJA 3OMZA 4HUMB 2ICWA 1RUMH 3IDNA 1CFTA 2DLTA 5F1KC 3KVQA 5CWSA 2EDRA 4G42A 4NZUH 3M45A 5TPWH 3K7UA 5A16B 1TVBB 5C0DA 1CFNA 3IGAB 4IJ3C 2HLFC 4MJ2A 3FKUS 1DE4A 3QUML 3RWGB 1FNGB 3HG1D 4HS3A 1WZMA 5E94A 3RDTC 3D87B 1N6QH 4UUJA 5TFSH 2ILLA 4ODUB 5IW1B 1EIBA 4PJXA 3EDEA 2X09A 5EN2B 3HB3D 2X4PA 3VGGA 3QDMD 3UCRA 3AC0A 3LN4B 3RWDB 5DJXB 1PY4A 2WP3O 4QXUH 4EDXB 1YNKH 3BP5A 4OI8A 3QG7H 1KN2L 4F9PC 1NCWH 3VXPB 4NN7B 3FO9A 1MPAL 2PW2B 4KK5D 4PTTA 3EJZC 5MEPA 2NXZC 1MWAB 2J4WH 4ONHA 5KOMC 2NY4C 3EAKA 3FAXA 5E70A 1QBMH 4HFWA 3L3KB 4FABH 4I0PB 1UQSB 3U30C 3ARSA 3VXRE 1I1CA 1A6AA 4WRLA 2VDQH 4HIJB 1RUAL 2ITDA 4QTIH 3MRDA 1K4DA 1T1YB 4CAGA 4XPFL 5GGQH 4JVWA 3BFOA 5D2LF 3WL9B 1EVUA 1AO7D 1H3VA 3HE6C 3KJ6L 3QNXA 3EOAB 4QNPF 5F1NB 3VW3L 3U9UB 5SWSD 1J86A 2NY1D 3RRQA 2XNAA 1OVZA 1AE6L 2J8UF 4GG6F 4W68A 5I2IB 1IGYB 1JYXA 3SCMB 1U3YA 4MB5A 3S35H 2F53D 3MFGB 1XGUA 2WQ8A 1GGBL 2F5AH 3WV0A 1FZKB 4BSVB 5CP7A 1MCEA 1UWEL 4FRWA 4OLUH 4WO4D 5B39G 1IM3A 3G08A 1LO3L 2AQ2A 1B0RA 5I19H 2OTWB 4X8JB 2RFXA 5GS3A 3NN8A 4GKOA 4CKVX 1JV5B 4M5ZH 4XC1H 2D3VA 3WSQH 5C0FB 4GRWB 2DLFH 4DN3H 1D9KA 1H5BC 3JWOC 4AM0B 4LHUA 5KN5A 5DEGB 1A0QH 3FB8B 4XCFH 1I4FB 3SDCA 4CMMA 5IESH 1VERA 4PRHB 2CGRH 4NZJA 5D1ZC 1HXYB 2EZ0C 5FK9B 5I76B 1UB6B 2YMXL 4NNYB 5LXGL 1F02I 4FFWD 3TA3C 2OR9L 1FNEA 4HIIB 1FNLA 2ZUWA 3JTSB 5C0GB 4JKMA 4YEFA 2PNDA 4LSTH 1A9EA 5A3IC 4KVCH 5DRWA 4Q9QL 2H3NA 3GBMH 1UACL 1S7XB 2YK1L 3A67H 4L8SB 1WUNT 4OZHF 4RCAA 4Q9RL 3BN9C 2OR7A 4RISH 5DVMA 5BV7H 3QDAA 2DQTH 4L8BA 1DLFH 5T3XL 4LCIL 3BPLB 5E2WL 3LRHA 4XNUL 3MV8E 5DT1L 3CSPA 1CR9L 5EU3A 3OF6A 4GMTL 1J5OH 2BNUA 1MREL 4QXGL 5IQ9A 3VFMB 1A47A 4Z5RA 4J6RL 1I7UB 2G60H 4FQPA 5DHVA 5CJ5A 2IC2A 1YEGL 3QUXC 2QQKH 4N9GB 3ZE1E 1IGFH 3KPRD 2VDOH 5E6ZA 1HHKB 3FTGA 5BO1L 3TZVB 1UZ8A 2NW3A 1SM3H 4KQ4L 2VERN 4M7LT 4GQPH 5CBAB 1N8ZA 1SHMA 2JCCF 2QADD 5ESQA 4LSRL 3MROA 5C0AE 5H2BB 3IDJB 3DJ9A 1WFOA 3TO4D 1T21A 2FZ3A 3E0GA 2PTUA 3Q3GA 2BNQE 1U93A 3CVHA 3DUSB 2DD8L 1P4BH 4ZPTA 2DBLH 1HQ4B 3G6AA 5DGRA 3TYGL 3MV8A 3VWKA 3UBXI 3IDMA 5AEAA 1KTDB 3V6ZA 1HDMB 5DRZA 2NZ9C 3Q2CA 4IHOA 2YA2A 5HYJB 1MWAH 5T3ZE 5DMGD 2QR0A 4YPGA 3QISA 4EKXA 3WO4C 1JTOA 3PV7A 5J9PA 3A6BL 1I9JH 5HHQA 4MJIE 3QFDB 5IBUB 2B4CC 1XCTB 3LEXB 1OAZL 2R2EA 4RGNE 1IARB 1KPVB 1N4XL 2OQJA 2W0LA 4MDJB 1ERNA 1ZHBB 4OZFG 1ZLWH 4ZUUB 1S8DB 1KELH 4JRXE 4YXHH 5TE4H 1Z2KA 3GHEL 2FLRT 2ERJB 5CEZL 2LAAA 5DXWA 4P2OA 4WCYL 4JHWH 4PREB 4WFHD 3ZKXB 2X42A 4OD1L 2ARWA 4X0KA 3GMRA 3RZWA 2QLVB 3HC4L 4JM2A 4BA8A 5IVXA 5IFAH 4X9IA 2WBJC 5TDPA 1W72B 3V6OE 2NY5C 3MOBL 1CCZA 4HLJA 1VADA 3RVWC 4WFFE 4JO3H 1MHEA 2ZSWA 4RRPG 5DQJB 2BVQB 2BSRA 4YHYC 4KZEH 4KUZL 1ZVHA 1QKZL 1KXTB 2FATL 2ICWB 1CFTB 2JF1A 5CWSB 4G42B 4YHPA 4FQLL 1NGWA 3PHSA 1FFOB 1CFNB 4RGMC 1Z0NA 2VUYA 4MJIA 3WHE1 4RWYL 4IOFC 4GRWH 5JPNA 2XZQL 3I50L 3GO1H 4HS3B 4QTHA 3F62A 4GAJL 5E94B 1AXTL 3SOBL 4M6ML 4JRXA 4PJXB 5IEHA 3NCEB 2X4PB 1ACYL 5FF6A 5C8JA 1SVCP 4UBDC 2GJZA 2FNBA 1MH5A 1S7WA 2VQ1A 4M9PA 3S88L 3ALXA 1LE5A 1NCDL 4NQTA 2BY3A 3MNVA 4L5FL 3JV4A 3MGAA 3MRJA 1YY8A 5FYJU 2DKUA 1K6QL 1J0KA 1XGQB 4XB7A 4MLSA 3FO9B 3V6OA 5C6WH 1ORQA 4LFHG 4MZ2A 4PTTB 4V1DB 1BVLB 1FO0L 5IK3A 5MEPB 4ONHB 4IMKC 3ZZ1A 4KK6D 4LGSB 4HFWB 1RZ7H 3LS5H 5F7KC 2UZXB 4LSPH 1JZ4A 1QPPA 4TNWK 2MQ0A 4JHAH 3PGDA 2ITDB 4DWHA 4KI5C 1KLGA 1YEEL 1K4DB 2NY3B 3MRDB 4HPYL 4X7SH 1OSPL 3B9DA 1I3RA 1YQ2A 3IB4A 4OCXH 5EZJB 2XTLA 1R3IH 3AU1A 4NP4L 3FRUA 3QNXB 4KJWD 3P30H 1BFVL 3PWPA 4CRPA 3ARDD 4MLIA 3H9SA 2XNAB 4PJFE 2H9GA 2A1WH 5GIRA 5C92A 5E8NA 3L1OL 2BSTA 4GMSL 4P23D 2Q86A 2C4XA 2VDMH 1KG0A 3RUGA 1XGUB 4ALAL 4UOJA 5MP6H 5L2KE 1HE7A 2F54A 5I71B 1IM3B 4D2NA 2R2BA 2C7UA 4R2GC 1N64H 5HYQA 2RFXB 1FAIH 1TVHA 4XPBL 1OT1A 1I3GL 5CSGA 2XWBA 3ECBA 3C6SA 1C8PA 1GPOL 2XN9E 2CO6B 4XBEL 1OW0A 4LHUB 5KN5B 4LPTA 1N7ML 3O2VL 3SDCB 4CMMB 1S5HB 2VN4A 5IMMA 5FGBC 3F7YB 1MIEH 5EA0L 1I8KA 4JREC 5T1LA 4BFIA 4ZUTA 2WUCH 1FNEB 2GTWA 1JMZA 2J6EH 3HNSH 1TMCB 3RIFF 1PG7X 3CFCL 5GRXG 2IALA 4O9HL 1UVQA 3KPMA 1A9EB 4KKCD 3STLB 1A8JH 5GISH 3LS4H 2H3NB 3OKMA 3BPOC 1JPSL 4PY7A 3BHBB 5IM7A 2NXYC 3ARFD 4PLJD 1OP3K 5I8EA 1P4IH 3RX8A 1J1XL 3T0WA 4TN9A 4OZIE 1EBPA 5EBGA 1W72H 5I30H 4UILH 4LLWA 1OARL 3DX6A 1YMHA 3ARWA 2BNUB 4JG1L 5DUMH 2XN9A 4JRWA 5IQ9B 4Z5RB 1HZHL 1EXUA 3A6OA 1XR8A 2EO1A 4KHTL 1BLNB 2Q8AL 5H8DA 4GRWF 3K8MA 1OF2A 3FTGB 3DURA 5E00B 4Z78B 2KL6A 2E9JA 1CDBA 1N8ZB 5ESQB 5FHAH 4KJPC 1RUPH 3MROB 5J13C 1PEZA 1LO0H 1UA6H 4U1SA 1L6XA 1T21B 5F7DB 2EDHA 4DKEH 1KJ3H 4PLOB 3Q3GB 3RDTA 2VRAA 1A6UH 3G9AB 3DGGA 1U93B 3CVHB 2LV4A 4ZPTB 2XXMB 5JUEH 1PY9A 4WTZG 3G6AB 3MV8B 4OCRL 4HCRL 3IDMB 3KWWA 3V7AG 4JFDD 1JGDB 4Y5VC 4CMHC 3V6ZB 5EDXA 1EA9C 4IHOB 5EBMA 3WFDL 1L0QA 1N0XH 4K07A 3MCLH 4NQCA 3DSFL 4NT6A 3NGBB 4N9OB 2E9IA 4YPGB 2DTSA 3VDAA 1JNNL 5L7XH 5EU6E 4F9PA 3PWVA 5J9PB 5HHQB 1JRHH 1I3VA 2EXWD 2BP3A 5HBBA 2R2EB 3ET9F 1MJJA 3DUUA 5GS0H 1L7IH 4YUEH 5HHMB 1OT2A 1X6LA 4G7VL 5C07E 5DWUH 3L3GA 4M7JL 1CIDA 4P2OB 1MCLA 1QOKA 3MRQB 2YC1A 4YQXH 1CK0H 5INDA 2JJTC 4X0KB 2QQQA 4H1LG 1JN6A 1CGVA 2J2ZA 4IEFB 4JM2B 5IVXB 3C5ZD 1J1PL 2HMIC 5TDPB 1SQ2N 2BXYA 3UJTL 1VADB 3EOTL 1MHEB 2B39A 1BGXH 2BSRB 2EC9U 5BMFH 3TWCH 5IMOA 4FQXC 1Z0MA 3NFSH 4K71C 3WNLA 2OK0L 4YHPB 1M7XA 2ICWI 5I18L 2BSED 1NGWB 2MKLC 4IRSA 5GQBA 5EU6A 1RI8A 4LDEB 4MJIB 1MCJA 5JPNB 1D9KD 3QRGL 3VXRD 4RAVA 1NCBL 4LHUD 4QTHB 4EN3C 12E8H 1H9VA 3PIQA 3ARBA 1MCSA 4PIRF 3SDCD 4JO4L 4JRXB 5IEHB 1TETH 5FF6B 5C8JB 1T03L 2F58H 2V9RA 5D5ME 2GJZB 1IBGL 5BRZA 5CD5C 4B41A 1MH5B 1S7WB 3TPUA 5EU5A 2VQ1B 3GMOA 3VD5A 2H1PH 2W1NA 2Y1VA 4XP9L 4ZTPL 3U79A 1J10A 3M17A 3JV4B 35C8L 3MRJB 1YY8B 4PY8J 3IVKA 2Y6SC 5DZLA 1C5CL 4GKSB 5D1ZA 2IBBA 4FMKA 3V4VH 5TQ2H 1ORQB 5D8JL 2O5ZH 5E7BA 1XH3A 2DYPA 1RD6A 5E2TH 4NQXA 3I75A 5FYLE 3WEXB 3O9WA 3HTLX 3OF6D 3MLRL 4NIKB 5J3HD 4K8RD 1JRHI 4K8RH 1NFIA 1LEGA 3PGDB 1IGML 1KLGB 3G6JA 5DHVH 2W65B 2PKDA 4JFPA 2DDQL 3AU1B 5K9QI 3IT8D 4OM1H 4UQ2A 3LKOA 5D5MA 5CFHA 4H88L 1G6RL 4F37F 4IRZL 2LU3A 2X1QA 3PWPB 4P5TD 1R0AH 5LWYH 5HDBF 3KLAA 3H9SB 2Z8RA 3IU4H 5HVWA 2H9GB 4XP6H 5E8NB 3STZB 3IDGA 2BSTB 4PJXF 2Q86B 1DANT 5ABDE 3SJVE 4LCCA 1KG0B 2HWZH 3FO0H 3RUGB 1AIFB 1AXSA 3VXOA 4JN1H 4KMQA 3U0TA 2F54B 2ZPKH 1F90H 3GHBH 1IGTA 2R2BB 2C7UB 3CVHH 3NCJH 4YDKL 5D93C 4RMWA 1E28A 5DJ8A 4R3SA 3MV8D 3VWKD 4IBLT 4W81A 4EBQH 1YUHA 2XWBB 3ECBB 4J12A 5EORH 3BGMA 4YGAB 3EYQC 2BVPA 4S1SL 3QXVA 4NJAH 1FH5L 1Z5LA 1GC1L 4Z7UE 4NO0B 3TH4T 4FG6D 1KV3A 5IMMB 1ZXQA 1CXKA 3F58H 3V7AE 1CDGA 1AI1L 3KLDA 5BW7A 4O5LL 3CLFL 1I8KB 5T1LB 3HRZA 4XP1H 2EDDA 4BFIB 5F9DC 4ZUTB 5DD3H 2GTWB 1I9RL 2PO6C 2IALB 2YD2A 1UVQB 4UNVA 4O51A 3KPLA 4XVJH 5C0AD 5HXMA 3OKMB 5JOFA 4NOFA 4PY7B 3ZDYF 3FQWA 5IM7B 3EFFA 2HTKD 2LE9A 3P0YH 2BNQD 1WK0A 4B0MM 5I8EB 1V7NH 5B22A 3NPSC 2VSCA 3PWUB 2OTUA 4YIQA 3IKKA 5HYSB 2GAZA 5FGRA 1QBAA 1BBDL 3ILPB 2HRLA 4KAQL 4LLWB 2X1OA 3DX6B 1YMHB 2OJZL 4U6VL 2YOCA 3UTTB 1LEKA 1I7RA 3OJVC 3F5WA 4YPJA 1XR8B 1P84K 5T3ZD 5T3ZH 2IJ0C 2EKSA 5KZCB 2PR4L 4LPUA 2WBJA 4KK9C 2NYYD 1L4IA 1CE6A 3O6FD 1GJIA 2F19H 3KR3H 4MJID 2Y06H 4OFKA 3KPQA 1MEXH 3MC0A 1OF2B 3DURB 1RVFL 1YN7A 4RGND 5T5NG 2ZG1A 5ALBH 1OAUH 4PJ9C 4B7IA 4RMUA 4F58H 4JRXD 3O6KH 4PGCA 4QHUA 5D6CB 1S5IL 2CK2A 1MCBA 4P0DA 1KCKA 3EJYC 1G9NL 4U1SB 5HGHA 4YC2B 1T3FA 2Q8BL 4KI5E 4LSVL 3IKCA 3DGGB 1N6UA 3MLVH 2AJZA 2C9AA 3ZE0E 4XHJD 4JPVL 3V4UL 5E2UL 3P9LA 1HINL 3OG4B 3RGVC 1BECA 1QBLL 4QRRE 4WFFD 1NMAL 5DFVC 5EBMB 4UAOC 5DO2D 4NQCB 3QDHA 4NT6B 4Y2DA 3OWEA 4NQVA 4PJAE 5I1EL 4ZXBC 3FAWA 1Z6JT 4X4YA 3X14A 4C56E 1J1OL 1WBZB 4LRIA 1JGUH 4Z7OE 1JFQL 2HRPL 5F7FA 2YA1A 4R7NA 1U3HD 4ZSOE 4OGYH 5AWNH 5GS1B 1MJJB 1JJUA 4TPRL 4AH2A 3W9EA 3QH3A 2NPLX 2DIAA 2B7DT 2O5XH 4NKQB 3L3GB 2CDEA 3L5HA 3OKLA 4GLRH 1HILA 4MHHG 2YC1B 5HY9A 25C8L 5DJ2A 5INDB 3MLPA 1HEZA 4HDIA 3VG9C 1JN6B 1DVFC 1EFQA 2EYTA 4PJ7A 4MXWH 4QRRA 4JQIL 3GM0A 1EHLH 5IMOB 2ZKHL 3VRLF 3BDYH 3CVIL 3DVNA 4WWKC 1JVKA 1IGJA 4PJAA 1C16A 4X9HA 3WD5H 2FSEA 1AGFB 4IRSB 5EU6B 4JFXA 4C56A 4Z7NF 1I8IA 4RAVB 1EZVY 2VH5H 3TH3T 1X5KA 1OD7A 2CKBA 3PIQB 3ARBB 3QXAB 5IHZA 2MTPA 1VFMA 4DEPC 3ZE1F 1CFVL 3RWEA 4POYA 1H3PL 3B4NA 1CWVA 2GCYA 3S4SB 5BRZB 5IBTL 4YE4L 4C83A 4M6NL 3TPUB 4U1GC 5EU5B 3B2VH 3GMOB 4TTGA 2VZ3A 1F58H 3PL6A 5CZXD 4LHQB 3M17B 4ZD3H 2WLZA 3B8SA 1I8MA 3IVKB 2M1KA 5CS7A 1KEGL 4H8WL 4JY6A 4X5XA 5FGBA 1QD0A 5DJZA 3G04B 2AJ3A 3ROLA 1A3RH 2EO9A 3O4LE 5L2KD 2AXFA 2VAAA 2YPLE 1RHHA 1XH3B 3LN5A 2DYPB 1DDHB 3MJ7A 4JM2F 5IVXF 1MJ8H 3MRHB 3U7WH 2FLBT 2YXFA 4JB9H 4NQXB 7CGTA 3I75B 1RU9H 1Y6NR 3LRGA 3O9WB 4GQ9L 4GG8A 4AEFA 5DD5L 5SX4H 5K59F 4OLXL 4ELKA 1CZ8H 1NFIB 2XN9D 4AK1A 5HI5D 4ZFOL 5E6IC 1QLFB 1UH2A 3G6JB 4DZ8A 3H3BC 2C26A 3SGDH 1JP5A 1UKQA 5KZCD 1OY3B 4JFPB 5D7LA 1JPST 1NMBH 4UQ2B 4F7MA 5D5MB 3BD4A 1ZLWK 4GLRI 3F12A 4ODSL 5FCUL 5L9DH 3RIFK 3X11A 3KLAB 4OD2A 3D2UB 4UB0H 1VKXA 3SGEH 2IADA 1TZGL 3E3QC 3IDGB 1M6OA 5KSAC 5F3BA 1CLCA 4LCCB 3K1DA 4NHCL 3VXOB 1AXSB 5CGYC 1VB9A 2HLFD 3MQIA 1JI2A 1MFAL 2MMXA 3O4LA 4NBZB 3U0TB 4BZ1H 4U3CA 2C5DC 2YPLA 3FT3A 1IL1A 5C3LD 1K2DA 2EECA 4JFEE 4P46C 1IGTB 3RDTD 3QWRD 1J11A 5DDHA 3KHQA 4ODWA 5IMLA 1E28B 3G9VA 4R3SB 4NO5A 1NFDA 5JMRA 4HS6A 4R26H 1YUHB 3BGMB 2KUTA 3ZE2E 1B3JA 2D7MA 3NIGF 2DMCA 4NQCD 4HWUA 2BJML 1TCMA 1VCAA 1Z5LB 4XH2A 3CX2A 4M7KL 4O4YH 4PRPE 5JQ6L 1AFVL 1CBVH 1X9QA 3QO0A 1QVOA 1P7KA 4M9OA 3EJZD 3LQAH 5JHDE 1C1EL 1EBAA 3HRZB 3TM6A 2NXZD 4OCWL 5FYKU 1BFTA 1HWGB 2NY4D 5ECJE 5HDLA 3S34H 2GT9A 3IJHA 3KPLB 3TV3L 4DAGH 1BOGA 5JOFB 2OL3L 4O58H 4HXAH 4JO1H 4X80L 4NCC1 2ZNXA 4QGTA 3EFFB 3MPCA 4RFEA 4D9LL 1AGEA 2X4NA 5CZVH 4FOMA 4NWTH 1GIGH 4AEHL 2VMFA 5B8CA 2OTUB 4YIQB 3LIZH 2DF3A 3RUGF 2GAZB 1GL4B 2ZP0T 3HE6D 2VJXA 1T7WA 1ZMYA 4UT6H 5SX4I 2VABA 4J1UA 3X17A 1LEKB 2GKIA 4KVNL 4X6CE 4WWID 3F5WB 5AZ2H 3DVFA 3GIVA 2EKSB 1IKFL 4KMLB 3JZ7A 1MAKA 4PRPA 3SGDI 1RZFH 4XP5H 2WBJB 4IRSD 1JWUB 5EU6D 1CE6B 4NN6C 1IKNC 5HHXL 2ZZUT 3KPQB 1RUQH 1BD2E 2D0GA 5T3XE 4XHQA 1TENA 4UDTA 4RWHA 5JHDA 1YN7B 3BZEA 4LFHD 1E6JH 2CQVA 4HEME 1J8HA 2QTEA 4UIKL 3SGEI 1Q0YH 5C07D 4KRPC 4PGCB 2FR4A 1FPTH 1RK0B 3FQUA 1J87A 5EC2B 3UC0H 3T0VA 1MCRA 5HGHB 1IAMA 1T3FB 4QLRA 1S7VB 3PDDA 3FQNA 5F7MC 3JWOH 5I8CA 2KZWA 3IKCB 4I9WE 2AJZB 5HGDA 2FBJH 4MNHB 5D7IB 3QJFA 8CGTA 1PKOA 3IJYA 4HSQA 3HI6L 5D1ZD 1U8LA 5TF0A 2F8OA 2X4QA 2EZ0D 1F8TH 3T65A 1MRCH 2HJFA 4LPVA 1E0OB 2DBJA 5IF0B 3TA3D 4Y2DB 3MGTA 4X4YB 4NWUL 2FRGP 2FHBA 3CD4A 1U91A 3CXDH 4OLZL 3X14B 3BYYA 5A3ID 4OSUL 3FN9A 2Y25A 5C0RL 3NACL 4D3CH 4U6YB 2BC4A 3MLWH 3GEWB 4N0UE 5FGCB 2BNRA 2YD9A 3VXME 5CJXA 3BPNC 3BN9D 1RULL 4LSDA 1U8HA 4AH2B 3W9EB 5FA3A 3QH3B 4S1RH 1YEDB 3OR6A 3QAZB 2FX8L 2CDEB 3I3DA 3MRIA 3QQ9C 1F6LL 1HILB 4G3YL 1OTTD 4I48A 5EIIA 4EI5C 2EDYA 1JZ5A 2HH0L 1DBKL 3EYSL 5DJ2B 1UWXH 2R0KH 1HEZB 4HDIB 1FCCA 2D7NA 1M7IA 2EYTB 3JVGC 3CIQA 4PJ7B 2VXVH 4NQUA 2OP4L 1KENH 3L3IA 1X5FA 4Y7MA 4CVWA 1FV1A 1A6VH 4LSUH 4ZOCA 1JL8A 4WI2A 5CP3A 4JFQB 3CK0H 1FORH 5CEZE 1NLBH 1CGSL 3DVNB 3SGJC 4N0YL 4PJAB 1C16B 2FSEB 3W0WA 1T5WA 5FYLD 3SDDB 4JFXB 4C56B 5HI4C 1I8IB 1MCOL 2VOTA 4IIQA 1G7IA 1GC1C 1JZ8A 2CKBB 1BREA 3GK8H 3H8NA 1INEH 1IGCL 2EDLA 2P5EE 5EU7E 5D1QA 4Y4FC 4F37K 3A0OA 4PP2B 2WUBL 4MNQB 3RVXC 3RWEB 3MXWH 2B1HL 2GCYB 4UDUA 1G7QA 4I77H 4C83B 3DHJA 5F89A 1LK2A 3PL6B 4U1MA 4TUJA 5CJOH 5L0QC 1BJ8A 1T66C 1I8MB 1OWWA 4PB9L 4AY0A 2J5LB 3SJVD 4JY6B 4X5XB 4OUUA 3IXTA 5DJZB 2AJ3B 1N2RA 3ROLB 1KACB 4U1HA 1KCLA 1MCPL 2AXFB 3MGOA 3BZ4A 1RHHB 5DC0A 3LN5B 4KKLC 1FNHA 3MJ7B 2VLME 2DQCL 1FLRH 3H42H 3HE7A 3OPZH 1IZKA 3NCCB 5F44A 4JHZA 2PO6A 1A22B 3GSNB 4QHKJ 4XPAH 4J4PC 1PQZA 1MNUH 4GG8B 3FB7B 5IHBA 4X99A 3WNPA 2V17L 2CLRA 1ETZA 2R56L 4UINL 3MRRB 5D7LB 1TJIH 2WBJD 2ZG3A 1QRNE 3CJJA 4O2EA 4WFGE 4YDJA 4F7MB 4MD4B 2OXHA 3ZHLA 4M02A 1OP9A 3RVWD 1GCFA 5J11B 2VZUA 5ID0A 3F12B 4OCYL 4LCUB 2P4AB 3EDFA 4OD2B 4M1DH 2BK8A 1VKXB 2IADB 4G6FB 5MENA 4LKCA 1BQLL 1M6OB 1G9NC 5GJSH 5F3BB 1S7RB 1KJ2L 4M6OH 5FAAA 1OWRM 4ZUSB 3LRSB 2FCBA 4MXVE 2NCMA 4XAKE 2ICEA 1GHFH 2VZ1A 3O4LB 4ZUVA 3FT3B 1IL1B 2I9LB 4X6DE 1K2DB 2A6KA 1I9IH 1F00I 5DDHB 3B5HA 4JO2H 4ODWB 5IMLB 4F2MA 5CGTA 5EUOE 2VDPL 1NFDB 4P3DA 1MFNA 3B8YA 4OFPA 4JJ5A 2QSVA 4UBDD 4HS6B 5HHVH 1KB9K 1Z9OA 5J7CC 2GUOA 2R0WH 3SDAA 3CCHA 1JGVH 4BZYA 4HUUB 1E6OL 1S7UA 3VI4E 3QO0B 2XKNA 1QVOB 3LEVL 1P7KB 4M4RA 4HLZG 4PJHA 4FQQB 3GRWL 1CICC 1RUML 4PUBL 2UY7A 5HJ3A 2R4RH 3G6JF 4NZUL 3LD8C 2GYSA 1MUJB 1O5DT 2GT9B 3IJHB 3VDCA 4I18A 5D5MF 1BOGB 5ELIA 1ORSA 4PPTA 3GMLA 3KDMA 3BJLA 5T1DH 5GGVY 5TFSL 4KI5D 5H94A 3QEUA 1IC5H 1YMMB 5K9OA 1AGEB 1MFBH 2X4NB 4WUUE 1QFUH 3ZDZF 4OM0L 4PFEA 2VC2H 3LKPA 4WTWA 3V0VA 5B8CB 3SGKA 3DMMC 5JOEA 2C1PA 4QRRD 3ARTA 2X05A 2VABB 4J1UB 3QXDB 3QG7L 3K4ZA 4MA1B 1MCWW 3CFJA 1QO3B 4C56D 1ED3A 4LNVA 4LRNH 4Q6IA 4UDTB 5JHDB 3BZEB 3CMOL 4WEBH 2CKBH 2BHZA 2LTQC 1VACA 1QBML 4R2GD 1J8HB 2E9WA 1JZ6A 2XV6B 5IMKA 1HN1A 2L4OA 3FQUB 3ZTJH 3O3DA 5IFJB 4P3CH 2VDQL 2VXSH 2X2YA 4OBRA 1BFSA 1L0YA 3FQNB 5I8CB 5EOQH 4P2RE 5C6TH 4H8WC 3U2SB 2CUIA 1QSEE 4OQTH 3QJFB 3MZGB 3G5YA 3IJYB 5JR1H 1A1MA 3IFLH 1U8LB 6CGTA 2X4QB 4Z9KB 2V2XA 3T65B 2HJFB 3LQMA 4YXLL 5DUPL 8FABA 1XIWB 4XBPA 3E3QE 2W60A 4NYLA 2XIDA 3WXVH 4U33A 5GRYA 1S9VA 2F5AL 1U91B 3P40A 5DURD 1XAUA 3KXFE 2HTLC 4OLUL 4XMPH 3NIDF 2BC4B 2BNRB 5I19L 2NXYD 1U8HB 1CGUA 5FA3B 4DQOL 4CVZA 4M5ZL 2NMSA 3OR6B 4XC1L 3KJ4B 4D9QE 4N8VG 1RK1A 3MRIB 4DN3L 3FZUC 4KDWA 4I48B 1L7TL 3BQUC 5EIIB 1ZV5A 5DHYA 1NJ9A 2ZSVA 4LEXH 2BMKA 5E6IA 3VFOA 1WWBX 4P2RA 5E4EB 2CGRL 2AW2A 4OT1L 4QF1A 2JK5A 1QSEA 3L3IB 1T7VA 1J05A 4NNPH 3QUMH 5IG7A 2A73A 4WHYG 4PGBA 3O4LD 1NC4B 1J8KA 3O3AB 1BBJA 4XPTL 2YPLD 1TITA 2JTDA 4LSTL 1FYTE 4L29A 5D7IF 5EIQA 2H32A 4KJPD 1T0NA 3W0WB 1T5WB 1G7PA 3CDCA 1MAMH 4F7CA 2CXGA 3KXFA 4F7TA 1LE9A 5KS9E 2D7OA 1CQYA 4IIQB 2P42B 1G7IB 5BV7L 1D5IH 3MRMA 3VRJA 4RDQF 4P46A 1KN2H 5HTSA 4HCRA 2C3VB 3ILQC 5D1QB 3RHWK 4P5KA 4KDTC 2YPKA 4UDUB 1G7QB 4GRLC 1IE5A 2C3WA 4MB3A 1GVIA 5KSVA 5F89B 4JM4L 1LK2B 3AS0A 4PYGA 2WK2A 3C8DA 4U1MB 4TUJB 3RPKA 1C7SA 3UROR 1EPFA 1IGFL 2NX5E 4P48A 4EQ3A 5A2JH 4OUUB 3IXTB 1RUAH 1CTOA 4U1HB 4RFNC 5BOZG 2HVKA 4Y5YC 1DQDL 4XPFH 1XGRB 3BZ4B 1FP5A 4NM4H 3O3EA 4LNRA 4JFED 4L3EE 2IBGA 3HE7B 2N7AA 3KJ6H 4PJ7F 2Y7QA 4EQ2A 2PO6B 4Z0BH 3GFUA 4ZOEA 5HSFA 1PQZB 3HN3A 5EZIL 3Q1SH 5KS9A 4M43L 1T7YA 4X99B 1ROWA 1U8OB 3QIUC 1ETZB 1A7RH 3B5TA 4L9DA 5D9SA 3S5LG 2OS7A 4PJAF 3CH8A 4PRPD 3S3PA 1KBGL 1UWEH 4O2EB 4YDJB 3EYUL 3O2DA 1LO3H 4Z7OF 5ID0B 2HYMA 4Y19A 1GXEA 1MWAL 5JHDD 4I4WA 5F6IC 2E8ZA 4FQXD 3HZKA 3WNKA 2A9NL 4HJGA 5MENB 1DBJL 4LKCB 1FL3A 2WZPD 3DROA 3VXUE 1UM4H 3RZCA 1Q72L 1K9TA 1IKNA 3DX8A 4UTBL 2XWTA 3C6LA 2VZSA 1FE8L 4ZUVB 3QHFL 2Y4SA 4EN3D 2ZUTA 3T2PA 3I84A 5B38G 2A6KB 1X5YA 2QQNL 2QV2A 3H6JA 4R90L 4F2MB 3TCXA 1J7VR 4P3DB 4TSAL 4JJ5B 1LEIA 5ILTH 2YMXH 5CD5D 5JOPE 2GUOB 3SDAB 3CCHB 2PTVA 5AYUL 1T4KA 1CN4A 1W0YT 43CAB 3TYFA 2ITCA 3RWHA 2VLJE 1EZVX 4DN4L 5JDJA 3TEUA 4Q9QH 1UACH 5B4MC 1S7UB 2NY6B 4LGPB 2M26A 4JO3L 3QEHA 3GSXA 4Q9RH 2BOBA 1BD2D 4G5ZL 5T3XD 4NCDA 4LCIH 4PJHB 2BNRD 4Z95H 5E2WH 4XNUH 4ZAKA 5HJ3B 1CR9H 1A7QH 1YJDL 1BZQK 1B90A 1P6FA 2J88H 4GMTH 3VXUA 3T3PF 3TBTA 4I18B 4HK0A 1MREH 4JE4B 4AZ8A 5IJKC 4QXGH 1XCQA 4WHCA 1MRDL 4J6RH 3GMLB 4LLMA 1OSZB 5HD8C 4XWOC 1YEGH 5CJ8A 5H94B 3QEUB 4H5SA 3WLBA 5K9OB 1H3UA 4I9WD 1E27A 2AKRA 4IDJH 4XVTL 2L7JA 3NA9H 4P2QB 3FQTA 2IAMA 3LKPB 3V0VB 4LLYB 3PQYE 4POUB 3ULSA 2X1PA 4CGTA 1SYSA 4KQ4H 5KVGH 2C1PB 3CMGA 4TRPH 2VXTL 4I3RH 5DC9B 3Q5YA 1CLOL 4LSRH 5F1OB 4XVSH 4WV1C 1G7MA 3JVGA 4F9LC 5F7EL 2VLJA 3OKDA 2AGJH 1NFDF 2L0DA 4HWEH 3LOWA 5EOCL 4FQHA 3CFJB 3R06A 2CUMA 3R0NA 4JAMA 4Q6IB 1SVZA 4LQFL 4P49A 2NNAA 4APQA 2DD8H 2AABL 5JNYA 3GB7B 2ESVE 4GOSA 1VACB 3VXMD 3W5NA 3PV6A 3QCUH 5FUCC 2NY2B 3QEGL 3QPXL 5D1QD 5IMKB 5EB9A 2FIKA 3OBAA 4JDZB 3O3DB 4EUPA 1TVDA 4KROC 5C6PB 2Q7YA 4LHJB 2HT2C 1A5FL 5EO1A 1DQLL 1EJOH 2R9HC 1NKOA 3A6BH 4Y4FA 1V8HA 1OAZH 3WJLC 3G5YB 4QRUB 3HFML 3P30L 1XF5A 4Y4KC 1A1MB 3PQYA 1RJZA 1R5VA 1O7VA 1R24A 2V2XB 1WAAA 1VGEL 5J1SC 3GHEH 2Y36L 3MX0A 5CEZD 5CEZH 4GAGL 5CD3B 2QHRL 5BVPH 8FABB 1NBVL 4MHHI 4XBPB 2W60B 1TPXC 2FH6A 4NYLB 2PO6D 2H41A 4G7YL 2M8XA 2R69H 5DJYA 1S9VB 4OF7A 2OXGA 4OD1H 2DICA 3AREC 2ZOLA 3HC4H 5F70A 1QFWL 2X4RA 3DXAE 1N64L 2ESVA 1FAIL 1F6FB 3MOBH 4CVZB 2P5ED 2CRIA 3AM8A 4R0LA 5JIHA 2IANE 3HZMB 4KUZH 1LMKA 1QKZH 1UKTA 5DHYB 1NJ9B 2ZSVB 3M1BA 1K8DB 1WBXA 2BMKB 5E6IB 3VFOB 4FQLH 2Q76A 1NGZA 3C60A 4RWYH 3QHTC 1QSEB 2XZQH 2V5MA 1FIEA 3ZKNC 4KK9D 5GS2H 2A73B 5FO7B 1WJ3A 1AXTH 3SOBH 4PGBB 4M6MH 1BBJB 1XF2A 2WUCL 2J6EL 4PJ9D 4WW1A 2BX5A 1ACYH 2VLMD 4L29B 5F71A 5ESVA 2H32B 5GGRB 3SBWC 1T0NB 2GW5A 1PG7L 2HP4A 3S88H 4F7CB 1NCDH 4F7TB 1LE9B 3EJYD 5C0BE 4WU7B 1F3DH 4HGMA 2EIZB 3WLWD 1P4IL 1K6QH 3VRJB 3DXAA