3HNYM

Factor viii trp2313-his2315 segment is involved in membrane binding as shown by crystal structure of complex between factor viii c2 domain and an inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
b'SCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor VIII
publication title Trp2313-His2315 of factor VIII C2 domain is involved in membrane binding: structure of a complex between the C2 domain and an inhibitor of membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 40
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3hnyM00
5DPNA 2J7MA 5IJRA 1CZVA 2Z4FA 2W3JA 2DDUA 5A1AA 1JHJA 4D8MA 4QX3A 4W8JA 4ARXA 5CZKA 4ZZ5A 1JZ7A 2J1RA 3OEBA 4ZZ8A 5C70A 4QX2A 3WNNA 2V72A 4OZOA 3LPFA 2ZEWA 4P5YA 4CUBA 2VZOA 4AAXA 2JD9A 3LE0A 1GOHA 1F4AA 3EB7A 5JUVA 1GOGA 4LHSA 1UXZA 2W91A 5LA1A 2RV9A 3HNYM 3MV11 4XURA 3UNPA 1JZ6A 3C7FA 4MGSA 3W5NA 2VZ3A 4MGQA 5LA2A 1WKYA 3OG2A 4CU8A 4KI5M 4M4PA 4RYDA 1DYOA 4QB6A 4JKLA 4UOJA 1W0NA 3CIHA 1US3A 3FHAA 1JZ5A 2BGOA 3CQOA 5G05L 4M4RA 3HNMA 4BXSV 1JU4A 3VDBA 2J1AA 1O8SA 3NRUA 2B9VA 3E1F1 1JYWA 3NNGA 1OF3A 1GU3A 1JZ8A 1KGYA 3GGLA 2VQUA 3WF1A 3FL7A 4W50A 2V4VA 5F7UA 2WDBA 3K46A 2WBKA 1W8NA 2X09A 4E8CA 5J1XA 1UMHA 2C4XA 3HEIA 2QQMA 2CDPA 2Y6GA 1R64A 4QAWA 2VZVA 3FN9A 3T2OA 3K4DA 4E8DA 2ID4A 2VQTA 4GZ9A 5IFPA 5JXJA 1UY2A 1H6XA 4MOAA 4QDQA 3C7OA 4DXTA 3ETPA 4MADA 3VD9A 2YC4A 1UX7A 4OMDA 2VZUA 3T0BA 2VMEA 3ACHA 4DXRA 1UY1A 3LEGA 2Y8KA 1XNTA 3C7EA 3IAPA 3WNKA 2W1QA 3CZJA 1SHWB 3HN3A 2WYSA 5B4NA 1W99A 3DYOA 2YG0A 3I3DA 3DYPA 2WO2A 2VCBA 2LW8A 5DN2A 2QQLA 3UETA 2E31A 3GDBA 3WQBA 2Y64A 2X05A 3IIIA 1BHGA 2B4KA 3I2IA 2WZ8A 3VD3A 1P8JA 4IUGA 1GQPA 2W95A 2XONA 1H6YA 3OEAA 2BERA 2ZEYA 2QQJA 3MV01 3UESA 2JE8A 3HJRA 3K77A 4P00B 2HLEA 3T2PA 3I2GA 1UY0A 5JXIA 4CUCA 5JMOA 2VR4A 1ULPA 2J22A 2CDOA 4Z2AA 4P08A 3GXUA 2RVAA 2EIBA 4LQRA 4XUPA 2WO3A 3BN6A 1J84A 3ACGA 4P02B 1GUIA 1UYXA 1W9SA 3CKHA 4HG6B 1T2XA 3MBWA 5FUIA 5EIYB 5LCWL 1GNYA 2ZXQA 1GOFA 3CMGA 3T08A 1WCQA 2BBAA 2QQNA 4XUOA 2HYXA 4OYUA 2X10A 4BDVB 2VZSA 2YFUA 4XUTA 1TG7A 3I2JA 1CZTA 2VCAA 5G04L 2J1EA 1UYZA 2ZEXA 4LPLA 3F2ZA 2VZPA 3CZUA 3PUHA 2YC2A 2VMFA 3VDCA 2W87A 3I3EA 4FI9A 4XUNA 3J7HA 3VD4A 3WNPA 1JYVA 2QQIA 2C9KA 2VZQA 1UMIA 2VCCA 3JXSA 2KD7A 4GWIA 2VZTA 3WF0A 2QQOA 5I0DA 1PMJX 4GWJA 3HNBM 3LEKA 3SEEA 1O59A 4DEVA 1JU3A 4JKMA 4JKKA 1UY4A 3OGRA 1W9WA 1GMMA 1SG3A 1US2A 2EIEA 1JYXA 4CU6A 1JZ4A 4DUWA 3WNOA 5B4XA 2E32A 4YPJA 2Y6KA 4BK5A 4ZY9A 3FHQA 3MO4A 4CVUA 2JKXA 4TTGA 1JZ2A 4RN5A 3PUIA 4XVHA 4UAPA 1F4HA 1D7PM 3EYPA 2W92A 1K42A 3BGAA 4QB1A 1W8OA 3D3AA 2VTFA 2VZRA 3K4ZA 4A3ZA 2Y6LA 2BGPA 3MUZ1 2ZEZA 2WQ8A 3MUY1 4D0QA 3LEIA 1JZ3A 5LA0A 2OKXA 2XOMA 3ACIA 3WF3A 2J1UA 3WNLA 3IB3A 3CDZB 4DUVA 1K3IA 1XC6A 4QDSA 4CU9A 1OD3A 1K45A 1CIYA 2V5DA 5C7GA 2RJ2A 1I5PA 3THDA 2WAAA 4KWUA 1IQDC 5IFTA 1NX9A 3VD7A 2VMDA 2VZ1A 1ULOA 4QB2A 4LKSA 2XQXA 3HOBA 3A21A 5DMYA 5EJ1B 1MPXA 4A44A 3LQCA 2R7EB 3U37A 4PQQA 3K4AA 5DQ0A 3I2KA 1PMHX 3LPGA 1UWWA 1UZ0A 2DCJA 2W46A 4DEQA 2J1VA 2YFZA 1PX4A 4QPWA 2Y6JA 2E26A 4CUAA 1UY3A 4JX0A 3ECQA 3K75B 2W9XA 3WEZA 1OF4A 1SDDB 4L0PA 3T0AA 3P1IA 3I3BA 4AG4A 2VJXA 3IDAA 3ACFA 5JXHA 5JR2A 2W1SA 1W9TA 2YB7A 1XPWA 3I97A 1OH4A 2WAOA 2L9LA 3DYMA 4MO3M 4OUEA 3T0DA 1UXXX 4ZXEA 2J1SA 2QQKA 4ET7A 2ORZA 5JXGA 4A42A 1JI6A 3WSOA 5CYYA 3WNMA 4DUXA 1RYYA 3GM8A 4OMCA 3T09A 4A41A 3NQHA 3VDAA 5IYYA 3IAQA 2WO1A 2W5FA 3WF4A 3A22A 3A23A 3VD5A 3I2FA 5C71A 2VL4A 3P6BA 2W1WA 4A4AA 1L7RA 1TVGA 3DECA 3I2HA 5EJZB 3SEPA 4PF1A 4DXSA 4KMQA 1EUUA 2DCKA 2VC9A 2E33A 2WN3A 2VMCA 3SKVA 4ARYA 1PX3A 4BK4A 2VO5A 3AC0A 1CZSA 2WUHA 1J83A 3W5MA 1L7QA 2LS6A 5HPOA 2VM9A 4UI9L 4W4ZA 1CX1A 4QX0A 2WABA 4JHZA 2WZEA 1OT5A 2W47A 3ZM8A 3C8XA 1UYYA 1K12A 2JDAA 3C7HA 3THCA 1XNAA 5HXMA 1KEXA 4A45A 2WN2A 3A7QA 4QDRA 1NAEA 1YQ2A 4QX1A 4XUQA 2QBXA 3OBAA 2J1TA 4A6OA 1DP0A 1NUKA 1O8PA 3NJXA 2Y6HA 1HN1A 2ORXA 2C26A 4TXWA 2EIDA 3SKJE 4CU7A 4BJ0A 3OB8A 1EUTA 2PQSA 2W1UA 2VOTA 3ABZA 3C7GA 2XHNA 3NJVA 3WF2A 2BZDA 1DLCA 3HPNA 4PT6A 2W94A 3OGSA 1JYNA 2EICA 3OGVA 1NKGA 4XZUG 5IHRA 1LNSA 3T2QA
chains in the Genus database with same CATH superfamily
5LRSA 3HT1A 1OLME 1MZFA 4YVSC 5DPNA 3ZN6B 4H7LA 2C24A 1RUE1 4INDA 4JDNA 5IJRA 3T3YA 1CZVA 4RQPC 5GLWA 3Q9OA 4K6BA 1V6MA 2W3JA 4HPKB 3B7MA 3BI3A 3FE5A 5A1AA 3N7LA 4DY3A 3AP7A 3PUQA 1XYPA 4GA9A 4W8JA 4IE4A 3ZSLA 1H2LA 5CZKA 2XVKA 2QZ2A 4N7UA 1YUDA 1Z78A 5LW9A 1JBCA 3MYXA 2FDFA 1FMD1 1E5HA 2Q30A 3IMNA 4I0WB 1H8TC 4Q4X1 4RQPA 5A80A 5CFCC 5IVEA 4GD4A 3JD71 2VZOA 3W59A 3DEMA 1K5MC 1HRV2 2JD9A 3WCSA 4BQXA 3EB7A 4DPNA 4LHSA 5I8YA 1UKGA 2W91A 4EYUA 5T50A 3LCPA 5ABJA 5CAZA 2RV9A 1H8TA 2IFWA 4CDQB 4XURA 5IK4A 2LM3A 1JZ6A 2ZGLA 2QKDA 3UNPA 2GMMA 1O3RA 4MGSA 4WM7C 4XACA 3ZXAC 2R041 2DU0A 1K5MA 2RM23 3S30A 2WQZC 4JQTA 2DF7A 2X5IA 1WKYA 1WGPA 3HVDA 4KU8A 3EMRA 4M4PA 4AXOA 1VIWB 4AQTA 4NIIA 1UU4A 4YW4A 4H14A 1YQ8A 4QPGB 4JKLA 4AHZA 1CAVB 2J42A 1PVC1 2VVFA 3RZMA 3A4UA 4PI2A 3H7YA 1ENSA 1G9FA 4YZ4A 1YI9A 1BBT1 4WM7A 3TEZA 1I5ZA 4IE0A 3CQOA 4WM8C 4FPKA 1AR91 5L7OA 4UBHA 4OUSA 4BQ3A 4IGQA 3AYDA 4QGMA 1QJU2 2CV6A 4V2VA 5LK7B 3VDBA 4JC1A 2GC3A 2VVEA 3ILNA 3NRUA 1W6MB 4HKOA 4AEMA 4FSJA 4QQPA 4S2FA 2FDKA 1CAXA 5K8SA 1MS3A 1POQA 2Q8OA 3PL0A 3QD6A 1SZBA 1SLTA 5BNNB 1RUF1 4P9JA 1CPNA 1LEDA 1MS5A 5LATA 3NSTA 3DL3A 1BMV2 1OURA 4JQRA 3FL7A 3NKTA 4W50A 4OI2A 4OHWA 2V4VA 3OD0A 5FWEA 5FXWA 2EVXA 1SLCA 3ZVXA 2VW2A 4IERA 1V6JA 2X09A 4L99A 3FX3A 2C4XA 3HEIA 1XYOA 1A3KA 2ZX2A 3AMQA 2A6ZA 5FP4A 4JZRA 1GZWA 3IT8A 2UWCA 2XKOA 3ZX7A 4FPGA 5K4LA 3AM2A 1JOPA 3K3OA 3K4DA 2A75A 2CU5A 4COWA 3AZZA 5J96B 1ZYBA 1PGSA 2IVJA 1AL21 3CO2A 2EXIA 1WCDJ 2VQTA 1OQDA 1X8EA 4QWNA 1KITA 4BQWA 1NQJA 1HRV3 1VBA1 5E89A 2HEVF 1H2NA 4FXKB 4RHV2 1N3OA 1VBB2 3C7OA 1PK6B 4CCLA 3TAYA 4XW3A 4LNVA 2AC1A 2P1BA 2XJRA 2VZUA 2Y33A 4E4HA 4CP9B 4ASLA 3T0BA 4HSLA 2KM2A 3DKWA 3FJSA 4DXRA 3GBWA 3VBOC 1UIKA 1WD3A 4YARA 3NNJA 2ZX1A 4YG3A 1XNTA 4DZGA 2IUWA 3C7EA 2RR13 1SPPA 3WNKA 2LROA 1RUC1 2XLFA 2RMU1 1QOSA 1DGWA 1Y9MA 3ZXJA 2A3XA 3HBKA 3MHZA 1BQPA 1YWKA 4XJ8A 3MIEA 4UW6A 3VBOA 3ATGA 1QH6A 1RUH1 4RL7A 4LOSA 5EV7A 4S2DA 3I3DA 4DB5A 3E5UA 2LW8A 5DN2A 1H9WA 1C3HA 2QQLA 3O0VA 4LA2A 2OZ6A 3MEPA 1MEC1 3WQBA 3JQXA 2BDRA 2VNGA 2XDVA 3AP4A 4IEOA 4JAAA 4NR1A 2X05A 2PQQA 1BHGA 4LBMA 4DOUA 5I0RA 5J98B 5FZAA 1P8JA 4IUGA 1JTZX 5GLUA 1GQPA 2W95A 3JCIA 5CG8A 3GALA 1H6YA 1PIV1 2ZHLA 4KWKA 5C3RA 2JDNA 3MV01 4LE4A 5FYIA 5DAQA 1ZZ8A 4NWWA 2WFF2 5CVRA 4DINB 4NE9A 5F5QA 3AZVA 5JR7B 1WLWA 5EZWA 5EYYA 3VB9A 5FDBA 5JXIA 3UGGA 2FD8A 2ZHKA 3ZR6A 1ULPA 2KXLA 1NG0A 1VMHA 4LXLA 2PHWA 1W8HA 2I2SA 3WDVA 1D2SA 1I6XA 2JG8B 4DY5A 4B8EA 4JV4A 4XUPA 3BN6A 5F6KA 4XIKA 1SBDA 5KHHA 1J84A 2AGSA 4P9LA 3WP3A 1GUIA 1UYXA 1W9SA 4NVPA 2E63A 4K40A 1RXGA 4KNCA 3ORJA 1MQTA 1SBEA 5FREA 1AR71 1UMZA 1Y9QA 5DZEA 4KBZA 4QM9A 1GNYA 2OPKA 2ZXQA 2YBPA 3CMGA 5A6QA 2F17A 4ZU4A 1VBB3 1O91A 2R043 1LAJA 4LHNA 4R9AA 2VZSA 4FQZA 5FZ9A 2YFUA 5FBJA 4CDUC 5FZMA 2ET1A 3BTZA 4I0AA 4KG0A 3H1MA 2WNOA 3KV9A 4YGEA 1H2KA 1RUG1 2EXJA 5G04L 2ARCA 3F2ZA 4GB31 4AZZA 2B42B 2E7AA 3K2OA 1F15A 4LK7A 4LO6B 5H9SA 1BK1A 2C5DA 4DS0A 5GZCA 4CDUA 1Q8QA 1SBFA 2WL1A 1IS5A 1WCKA 2ENRA 1W6OA 4UFMA 1DZQA 1W90A 1XOYA 1HLCA 2HEYF 1U5YA 2W87A 3N9MA 4FI9A 3OY8A 4HK8A 1D4VB 1U5ZA 2OQ7A 3VD4A 3N9QA 3WNPA 3TRSB 5C4WB 1XXNA 5FR3A 4GJYA 1VBE2 2VZQA 4E4SA 2VCCA 3AMMA 1RGSA 1CAUA 3Q8EA 3NAPA 1LESA 3QH6A 4GWIA 5F5IA 1QH7A 2LUWA 4JGYC 5F32A 5BNOC 1YNAA 3NVCA 4R4XA 4A2UA 1UZZA 4P9WA 4QKFA 1QXJA 1SACA 2UY9A 4R4ZA 3VHNA 3ZFFB 1GNZA 3FC0A 5DUUA 2O14A 3CL1A 3QOPA 3U10A 2WFF3 3O0WA 4C1XA 4CCOA 1GMMA 3DXUA 1XE7A 3OGGA 4AAPA 4B1LA 3TB0A 3BTXA 1JYXA 2BOIA 3U4SA 4YG0A 4QPIB 5C3SA 1GKBA 4YPJA 1XNDA 4LKFA 5A7PA 2QZ3A 2WS92 2QDNA 1NE4A 3EQEA 5ACA2 4E4DX 4AQ6A 2FDHA 1BXHA 1HIXA 2WNVC 1O4YA 3OOXA 3PURA 4FPFA 4KWLA 4RN5A 4XVHA 3B5LB 3LIGA 3GZAA 3U0ZA 4M3CA 3UJQA 1MZ6A 1UNBA 3FLRA 1K42A 4G9SB 5F9TA 1MZEA 4QB1A 4AVSA 3IM0A 4CA9A 1NE6A 5F5CA 1COV2 4ES8A 5FP8A 2IFRA 2O8QA 1S0EA 2ZGUA 2XUEA 5FYZA 3RS6A 4XQWA 1IKPA 1DQ5A 1I9RA 1LHNA 4CEWA 3MUY1 1RITA 3VKMA 3WCRA 5LA0A 1VPHA 3ACIA 3WF3A 4Z92B 4IEQA 3RJ2X 3HQXA 1YRZA 3WX5A 1K3IA 1QHDA 4PDWC 4QDSA 3VHPA 1BJQA 4LLOA 2A6VA 1BKZA 3WUDA 1GBGA 3KHCA 1I5PA 1RUD1 5DZGA 1V6NA 3DXTA 2ZGMA 2JDHA 1W8ZA 4I3GA 1Z0HA 1LOEA 4PBOA 1YQCA 1CD3G 1HB3A 1UOGA 4XDQA 5IFTA 3POEA 5F3IA 4LTAA 1VB2A 3O12A 4YM1A 2BPA2 2V5YA 4FT8A 1FYUA 3BIWE 1NX9A 1ALYA 2ETEA 1MEC3 1R082 4AVAA 2XBO1 5C9AA 3TEYA 2XQXA 1CGPA 4OI0A 4RR3A 2B46X 1UOJA 5DMYA 4Q29A 5GLTA 1MPXA 5H9QA 4A44A 4GMP0 1C57A 1OBNA 3NKGA 3VBRC 1J3PA 3GYDA 2R7EB 1W6PB 3U37A 4FPLA 3GCXA 5JWPA 2DCYA 5DQ0A 2UYAA 3I2KA 4LITA 5JIAA 2C9AA 5BUVA 1UWWA 5K0UC 4TZDA 5FBZA 4LUKA 4A7ZA 1N47A 1WLCA 1IPSA 1RUJ2 1PO22 3VBRA 3Q8FA 1XBFA 3AKSA 5FK8A 2WWJA 3FMGA 3K75B 2ZOEB 3KB5A 4PJYA 3V0BB 2JG9C 4L0PA 3RYRA 3WHTA 2DVAA 1WMEA 1VB4A 3WOGA 2QQPA 1GZTA 2HBUA 2WS93 3PUSA 1FV2A 4AG4A 4XFFA 4CE8A 1FNZA 4N90A 5ACA3 4LORA 2ZGTA 3ACFA 1OH3A 4RD7A 2QFEA 2OX0A 1C8M1 2D7FA 4BOWA 5GZGA 4JDOA 1OH4A 3DYMA 2ZKNA 3RG0A 5EHDA 5JPMB 3ZKUA 3DN7A 1KFUL 1Q56A 3PLQA 5A7WB 2ORZA 3AYEA 1NLQA 4KU7A 2P37A 4AQSA 2HH9A 1JI6A 1FOD1 2ZGOA 1HXS2 3URFA 3FBMA 4BZ4A 4D6RA 4DUXA 4FTSA 4Q4Y3 4NUBA 3N7KA 5JZGA 1VMJA 3KHBA 2NPIA 1F5JA 5IVBA 4XAAA 1RUG3 4XF9A 2VQAA 3RPQA 4A3XA 4OHYA 1XNCA 2QTWB 3J7LA 3VL9A 5L9RA 1H1IA 4CP0A 3SCGA 3THTA 4GB33 4P5HA 3A23A 5D21A 3WP6A 1DQ0A 1Q8SA 3I2FA 5AC92 2YZ4A 2HWD2 4MYEA 4AEJA 3L9JT 1GWLA 4Q4W1 4CCCA 3RNSA 2D6PA 4OULA 3VBUA 2PHXA 3VDDB 2YC0A 4AI1A 3WG2A 4EROA 4PF1A 1U5IA 4ZXKA 1QGLA 2DCKA 2GSYA 1NY72 1YI7A 2BEOA 5CADA 2R072 1QNYA 4CCDA 2WWSA 4QT6A 1RC6A 1LHOA 2VO5A 3RWKX 3I2OA 1VBD1 1X9TA 2ZMNA 3D4KA 3HAGA 5T5JA 3ROUA 5C6CA 1ST8A 3WQ7A 3W5MA 2HWC1 2XB6C 3VBSC 1RUI1 4XFGA 5K7PA 4JRLA 1CX1A 2A70A 4L92A 2HWB2 2WABA 1F31A 2ZGKA 4JHZA 5CKMA 1OT5A 5F3EA 1JMUB 5F8PA 3ELNA 1EP0A 4ATEA 4FO9A 2OYZA 1CJDA 1UYYA 2G9GA 2WNUB 1JH5A 1DBNA 4URAA 4LKDA 3PTRB 5HXMA 2FDGA 3VBSA 1X8MA 1W2TA 4Q4V2 3BOPA 1ND2C 4NIDA 5C33A 3M3OA 1ZBE1 1RUJ3 1PO23 4RFRB 1YQ2A 1D4M1 4LA3A 3R6SA 1LOBA 2F4PA 3OBAA 4A6OA 5KXEA 5CFDB 1TEIA 3GHMA 4CXWA 1NUKA 2LTNA 4XFIA 3VZLA 3C2UA 3UK9A 4F83A 4BJ0A 1CAWB 4QQOA 3UKTA 4KWJA 2WNEA 1A8MA 2MNGA 2VOTA 1MS8A 2IWGB 3ABZA 1E5RA 4CDWB 5KXBA 1DYPA 4JGZC 4Q1PA 5D8AB 2W94A 4AI8A 3OGSA 2WR9A 4EN0A 3VBFA 3TNQA 3NL1A 5FZGA 1HXS3 1SLAA 4HK9A 4LIVA 4QU2A 3UJOA 3WINE 4YVWC 4AK3A 4ASKA 1HQNA 1N1TA 2XLAA 3T2QA 3NV4A 4YRDA 5AFBA 1ULEA 4QXBA 2ZZQA 2G1MA 5GLZA 2VTXJ 4E2SA 1RUD3 4QGNA 2QQWA 4FTBA 3GZTB 4PCRA 4ARXA 1GP4A 3KT7A 3WHUA 3OEBA 1T6GC 5FLHA 2EIGA 2R073 5FO7B 2V72A 4ZZ8A 3ETQA 4OZOA 2ZEWA 1WMDA 1OPMA 3FWEA 1ODNA 4P5YA 2RM21 2A6WA 3MIFA 5BPXA 4XFHA 3WG4A 1QKQA 1WCUA 3JZVA 1J1LA 1BEV2 4I3PA 4AW7A 1XE8A 1AL0G 5FUPA 5FKBA 3D82A 5T5LA 3AFGA 4GMP3 1ZRCA 2HWB3 1W05A 3ZXKA 1GNHA 4HETA 1TMF2 5FZOA 2XJVA 3W5NA 3R0RA 4RS5C 2A6XA 1RINA 4RGAA 1WLDA 3PDQA 5FPAA 3E6DA 1NCQB 3OG2A 4XBQA 4Q4V3 2DCZA 1QMJA 3USUA 1NZCA 5FPBA 3ES4A 2D97A 5JSOA 1GV9A 4F3JA 4ZHNA 1FXZA 3CIHA 2XVLA 2I74A 2D98A 1AR82 3KF5A 3WDXA 4LHKA 5E6HA 3W21A 1XB9A 1G9AA 2R6QA 4BXSV 1JU4A 2AREA 1O8SA 4NHLA 1WD4A 4ZONA 3QH7A 5LBFA 2YV8A 4UFLA 2VNVA 4E9KA 2JE9A 1FOD3 4YM2A 1NA1B 3VBHC 2XGXA 4IL7A 5CISA 2HWE2 5LBEA 4Y1ZA 2FMYA 5FYUA 2QJVA 3NW4A 1EAH2 4XCBA 2UWBA 4EN6B 3MPBA 4NHMA 1OLQA 2OVUA 4M3CF 3AYAA 3ZDSA 4IEVA 3LOBA 2QUOA 3K3NA 4QX5A 3M8LA 1H1AA 3N9LA 4Y3OA 3CJIC 1W8WA 4HXCA 3UGFA 3ZIXA 1OOPB 4E8CA 2JIJA 2EA7A 3O7OA 4W65A 1ZA4A 1HRV1 1QEXA 4EWDA 2Y6GA 4FPJA 3D6EA 1R64A 1GP5A 4X8NA 3H7JA 3V0AA 3FN9A 5A32B 4E8DA 3SC7X 3CJIA 4IV3C 2Y6FA 5FZ8A 3H8XA 1VBD3 3DPRC 3BKZA 4YG6A 1C5IA 2A73B 2P3YA 2CTVA 2HWC3 4GALA 2OPWA 2WT0A 4GZ9A 5JXJA 1BEV3 4YLZA 1JS9A 1QJEA 3MFCA 2CGNA 3WW4A 1F9KA 1Q8PA 3MLLA 4KQ7A 3W20A 3BTAA 4N43B 3WG3A 1VBC2 1H6XA 4Q27A 4CXYA 2RR11 4MOAA 4QDQA 4DIQA 2B7YA 2Y0IA 3DPRA 4OCTA 4HKWA 3OYWA 2ZTNA 4PF5A 4GJZA 1TMF3 4NRQA 1UU6A 2FCTA 2VG9A 3PU8A 5A6ZA 5FAXA 1LODA 1QJU1 5FYTA 1OFSA 4XIOA 1AYM2 4ISQA 3ACHA 4QGLA 4LJHA 5CKQA 1NCRC 4SBVA 3S5AA 3LEGA 4IESA 4OI1A 4CCKA 3IAPA 2ZPXA 4BYYA 3M7AA 4NPRA 3IN9A 5JLVA 3M2MA 3WUCA 3LSDA 1AR83 5GJ6A 4HBNA 4OQ9A 5C3PA 1LB2A 5I91A 1URXA 4CEYB 1HQWA 2MHFA 4XOGA 1ND3C 1NCRA 1D0HA 3KVBA 2WYSA 3OD4A 1W99A 1QDCA 1LOCA 2VCBA 1H4GA 2GP3A 3UETA 5LA9A 1SLLA 2E7QA 1AYN2 1R1A2 3JUUA 1WMXA 1QXPA 2PLV2 2W08A 3P3PA 2Y64A 5CNAA 3SH5A 1DQ1A 4DNYA 3I2IA 1W0OA 2HWE3 5C8CB 1W3XA 1ND3A 2BNNA 4NN0A 4WVVA 1EAH3 3AMNA 3DCQA 3LSEA 4Q26A 5BNPB 4QM8A 1XRUA 2D5HA 5ABJC 4WV8A 5L73A 4YVSB 3S7IA 3ZN6A 1OA2A 3J9SA 2GDFA 3UESA 3VHOA 2JE8A 4UW4A 4NPLA 4HPKA 3CU7A 3I2GA 3S0MA 2X5IC 4YZ1A 2AENA 4CUCA 3ZFEB 1W2AX 4OHZA 1OQEA 2YBKA 2V4AA 4K9SA 4BLJA 2G9ZA 2XKPA 2CDOA 2GU9A 2DVDA 2VAUA 3ST7A 4J1XA 4CP1A 4IE5A 4RHV1 2RVAA 1UPIA 1VBB1 4CRQA 2EIBA 4LQRA 5EJ3A 1KXGA 1NLRA 5CFCB 3ACGA 3WNXA 4P02B 2VGDA 3PUAA 5L7OC 3ES1A 4YZ5A 3AMHA 2WC2A 2ZX0A 5HCFA 1YQ5A 3SH3A 4K8RB 4QX8A 5FPXA 1E5SA 1AX0A 1VBC3 1WCQA 2CAVA 2BBAA 4Z8BA 4XUOA 3WDWA 4DMIA 4OYUA 2D93A 2A7AA 4AVCA 2VW0A 1NXD1 2XH6A 1UIJA 4XBLA 2ES3A 2WZR2 2D6LX 5IVCA 4CTEA 5CIRA 3DF0A 3I2JA 1DGRN 2VCAA 3USSA 4LEJA 1RJ7A 3PNAA 3N9OA 4QPGA 4B29A 1CAVA 1UYZA 4FFFA 3H8UA 4HKLA 1ULDA 4IV1C 4LPLA 1BVP1 2G19A 3VV1A 4FFGA 4AVTA 2VCMA 3JU9A 1GSLA 4YW6A 3PUHA 2R32A 2IXHA 3WQ1A 2OQ6A 3QACA 4BH9A 4WM8B 3G7DA 3HQUA 5F5AA 3ZSMA 2E6VA 5KC5A 3H42B 1M4WA 2QQVA 2R16A 2A6YA 2P3KA 5A7QA 3I3EA 4BB3A 4IV1A 4D7YA 1GR3A 3LD8A 5C3OA 1HN0A 1W6MA 4XUNA 2WA3A 1J3QA 5KHIA 1R092 3B9IA 5LEKA 1W2NA 3RI9A 4WVMB 2WFF1 1AYN3 2QQIA 2YROA 3FUOA 5FXVA 2PLV3 2CY6A 4XJWA 4AI2A 4IGPA 5BNNA 4EN8B 2JDMA 2X8KA 2FZ2A 5SV5A 3WZ1A 3J26N 4IDZA 4XJUA 5FFOC 1QF3A 1HKDA 1PMJX 5FKCA 4LT5A 5EXOA 3HNBM 5FYCA 2NN8A 1HB1A 4DEVA 4EWEA 1JU3A 3AVSA 4JKKA 1UY4A 5AVAA 1W9WA 1SG3A 3MDPA 5A3NA 1SFYA 2PELA 2UURA 4K1YA 4Y5SA 4IXLA 2NQYA 2Q0AA 5FQ0B 4CSWA 4HOOA 2AR6A 3ZYHA 1ASJ2 1QJFA 2E32A 4CCMA 4BCUA 1KQRA 1Y7BA 4B1MA 4L8QA 4BMBA 3E6CC 4CDXB 1XNBA 3TOJA 3RZZA 4ZY9A 1JYIA 1FMD2 3FHQA 3MO4A 4HN1A 5T3NA 3M70A 4AI9A 4QQLA 3D0SA 2D3RA 3ZPYA 1JZ2A 1VR3A 1KRIA 1UZYA 3B9CA 5F2SA 3EYPA 5I93A 3OGJA 4G3YC 4K8FA 1Q3EA 1OUXA 1L7LA 2VH9A 3NNMA 4D94A 4XFCA 1LGBA 3D0JA 1PK6A 4MUVA 3O5SA 4C91A 1H8VA 2VZRA 3LAGA 1AR62 3K4ZA 2K2SA 1GP6A 2LRPA 2Y6LA 2ZZJA 4R9DA 2PAKA 1ACCA 3MUZ1 4CP9A 2ZEZA 1QJU3 4NHXA 2BRTA 3RRDA 5HCAA 1AF9A 3AL5A 4BLIA 2CAUA 4QXCA 2ZBJA 3U78A 2OKXA 1JZ3A 2RS12 2XOMA 1PO12 2J1UA 5FLIA 3WNLA 5IT6A 3PMSA 4DUVA 5EFUA 5JOYA 1FPN2 4C0HA 2IXLA 4CU9A 1X36A 1YFUA 4BQYA 3BYWA 2V5DA 4MVTA 2RJ2A 3J4UH 1X9PA 1HJFA 2RDSA 4PIYA 4BM8A 4HVOA 1IPJA 3IIAA 3RWNA 1IQDC 1Z7S2 2SLIA 5T55A 5JOZA 3E97A 5ANNA 1R093 1V9U2 2D3PA 3DGTA 5JOXA 2VMDA 3H3LA 4XJZA 1JYCA 4QB2A 4LKSA 3ON7A 4MV2A 4GKYA 4QKDA 3AKTA 1YEWA 1YFYA 4Y22B 1MQTC 3SLIA 1RUF2 3LQCA 4AHXA 4LBLA 4COZA 4Y1YA 3AJZA 2CGPA 2VMGA 1AXZA 4M0NA 2H0BA 4K21A 4W6YA 1GICA 5A3PA 3AKQA 4AFAA 4YFZA 5LB6A 4Z1VA 4YFWA 4ZU7A 2V73A 5FYBA 2WS91 1PMHX 1REDA 3LPGA 3VKLA 2RS32 1C28A 4MZUA 5ACA1 1UZ0A 5IATA 3W9AA 3UKNA 1DF0A 4DEQA 1GFF2 1V00A 2B8MA 4QPWA 2AH2A 1DIWA 4FBFA 1U12A 3WP4A 1OA4A 3U75A 5E88A 1XQNA 4RHV3 1V6OA 1GWMA 1LEMA 2JG8A 1N1VA 1ZZBA 3OTFA 4GAZA 4KH9A 4TYSA 1B35B 2ZAHA 4XBNA 1COV1 4LO4B 1RHI2 4WZFA 4Q0PA 2R1DA 5DUVA 2K0GA 4Q4Y1 1NXMA 5FZIA 3OCPA 4CXXA 5JXHA 1POV0 1HV0A 2BUKA 2ZA9A 4DXZA 4ZU5A 5FY8A 4RFT0 1POV1 1UPSA 1XPWA 1Y4WA 2YB7A 2WAOA 3BU7A 3I97A 1DYKA 4MGYE 1UXXX 3RYPA 4ZXEA 1OVSA 1RTVA 2J1SA 4EE2A 3H3ZA 4XMAA 3GBFA 4DO0A 3ZOIA 3KCYA 1AR63 2XUMA 5CYYA 2R30A 5FZBA 3NAPC 3WNMA 4B4RA 4HZFA 1D0GA 2JE7A 3GM8A 5J09A 4I02A 2WLQA 4CDUB 4D6SA 5L19A 3OSDA 1RUOA 4A41A 4NO4A 5F6LB 1ZZCA 1J58A 4FPHA 3MI8A 3AKRA 2WO1A 3VDAA 2W5FA 4O61A 4UXAA 5FZ1A 5HV0A 2RS13 5KBFA 1IS3A 1PO13 3A22A 1RMU2 4NHYA 1VP6A 3HD8B 2WO7A 1QY4A 1R081 1FPN3 5FY0A 1RUC2 3P6BA 5FZFA 3I2HA 5EJZB 3ZMOA 2RDRA 2TEPA 1G8WA 4V1PA 3B00A 3SEPA 4DXSA 2BTVC 2BWAA 3I54A 4NIAA 2VC9A 2E33A 2PMWB 1UD1A 3OBZA 5FP7A 4NMIA 3PMEA 2VMCA 4BK4A 1TME2 1WLTA 5EQUA 5BYNA 2PHLA 3MLJA 3H1YA 1Z7S3 2BVBA 3ASIA 1CZSA 4FFHA 1WA6X 4ORFA 5GLVA 4AWDA 1V9U3 2DV9A 2Z42A 5T5PA 1YXWA 1IGOA 1UN1A 3BOWA 4AYUA 3I3MA 5A33B 1BYHA 4UBGA 5HPOA 1RUJ1 1PO21 2VM9A 3L2HA 4UI9L 5IVYA 4QX0A 4Q5OA 1UCXA 4JGYB 4B7EA 1GYKA 5BNOB 5FOJB 2W47A 3ZM8A 3ZFFA 1K12A 1I3HA 5C4WA 4ZS3A 4CCNA 4R9BA 1XNAA 5A7NA 3IKWA 3ZN4A 5CB7A 2WIIB 2PAEA 2E51A 5A7SA 1HX6A 4CEWC 1L3JA 4GH4B 4XXAA 4A45A 1LGNA 4X6QB 3SMHA 1YIPA 2EXKA 2XJSA 1W2OA 4Z82A 1PGL2 4K7JA 4LE3A 5GM0A 3NJXA 2PN5A 3O14A 1NQDA 1PGW2 2C26A 1HXS1 3GNEA 2CSGA 2WNVB 2W1UA 3MIDA 2C6SA 2O1QA 4YGDA 3WF2A 1QOTA 4XYXA 5DAVA 2DCTA 3AYCA 2BZDA 3HPNA 4W6XA 3KM5A 4MHRA 2JB4A 2YHJA 3B94A 4AI0A 2D6MA 2MPFA 2EICA 2VNRA 5AC91 4LO5B 1W9YA 1N3PA 2DWRA 2EAKA 2GP5A 3M3EA 4NOTA 4QHBA 4XPVA 3T4VA 3M1HA 5C9AC 4RR3C 2O8OA 1LJ7A 1NOVA 4META 4LKEA 1NKGA 5IHRA 1XNKA 4YZ3A 4K20A 2R071 3MPPG 4AQ2A 3SXWA 1LOAA 2WZPP 1RMU3 3AZWA 1VBE3 4Q0SA 4PDWB 1HRI2 3POJA 2QCSB 2OW4A 1LOFC 3SITA 1JHJA 4D8MA 5CA6A 4K1ZA 1O5LA 3OPTA 4C0BA 4ZZ5A 4GMP1 2J1RA 3THPA 2HWB1 3ZSKA 4AR2A 5IAXA 1JZ7A 2HJIA 1W6NB 4BPZA 2YU1A 4QX2A 4IEZA 3PVOA 3WNNA 4GKXA 1S0IA 3IDCB 3LPFA 4CZSA 3F95A 3R4DB 2NP0A 1OLMA 1YYNA 4MGTA 5E16A 1LOFA 3TN92 2B5HA 1GWKA 1W04A 3PJQA 1GOHA 4Q4V1 1DZTA 1PM7A 1S0JA 2R1BA 4LBOA 1NT0A 4I0BA 5JUVA 1GOGA 1QU0A 1W6PA 3HWJA 4O65A 4RA0A 3VBRB 1UXZA 4MGZE 5LA1A 3HNYM 1QJX2 1IHMA 3MV11 4XJ9A 1REFA 5FXXA 1MS1A 3C7FA 4XEZA 3LA2A 1APNA 1KFXL 3A0KA 2DBIA 3IDBB 3V65A 3VKOA 5JZGC 5K0UB 1UU5A 2IXKA 1VAMA 3RYKA 5IK7A 3T1MA 1HJGA 2JJ6A 4RYDA 1XYNA 5HCBA 2JENA 1DYOA 4QB6A 4MH0E 4KGGA 4UOJA 1OKQA 1W0NA 3V0BA 1DQ2A 3HIFA 2JG9B 4IE6A 2XXZA 1COV3 4OHXA 1JZ5A 1JYTA 1XSQA 2VMHA 5D1IA 5JAXA 4X8PA 2PHUA 2YDEA 2WSUA 3VBUC 4XTPA 1RB8G 3PVNA 1DLLA 4L97A 4CYDA 5BNQA 4XF0A 4GWMA 4BE3A 2DBNA 1GQGA 1X82A 1POV3 2J1AA 5EYXA 1PHMA 2YMZA 3FHIB 3LFIA 3Q8CA 1QJY2 2Q1MA 3ZYIB 2B9VA 3E1F1 5FOBB 3VZJA 5A7WA 3NNGA 3O1TA 1OKOA 3RGBA 4Y33A 2X29A 1OF3A 3T4HB 2CHHA 3E5XA 1W8TA 5DABA 1JZ8A 1ODMA 5DAPA 1KGYA 3AX4A 2VQUA 3KV6A 1QQP2 3ZKYA 1LHUA 5F7UA 2OT7A 2WDBA 3K46A 1R083 5A3MA 1F2NA 1W8NA 4K3UA 3SH4A 5FZHA 5J1XA 2W52A 5FZEA 1YJLA 1BEV1 1HRI3 3KWVA 2QQMA 3KZ4C 1BCXA 5AVPA 5IK5A 1N1SA 3U14A 5GZFA 4C1WA 5FJHA 4E4ZA 1F5FA 4UWDA 1RVF2 4XHBA 4QAWA 3T2OA 1XU2A 1ZBA2 3POGA 2ID4A 4ASMB 4BMEA 1TMF1 2HBTA 2GNTA 2WWUA 5DG1A 4Y20B 2TNFA 5FP9A 3ZPOA 5FLJA 3I8TA 5F1RA 1CWPA 3J8F2 3BIEA 1LU2A 1VAVA 3TN93 3VBSB 3EHKA 5EWSA 1UY2A 2VY0A 5EP9A 1TQ5A 3HBZA 4IQPA 3WD5A 1IS6A 2GALA 3ZN5A 1QXRA 1D2QA 3VKFC 5A1LA 3H0OA 3ETPA 3SNMA 3VBFC 1ULFA 3PVEA 1QJX3 1AR81 2YC4A 2WNUA 2VBBA 2K46A 2XL7A 4FFIA 3VD9A 3O1UA 2W68A 2IZWA 3KV5A 2VULA 3CF6E 2VMEA 5JMCA 5JPNB 3NV2A 4IEYA 1ND2B 3IPVB 4R52A 4FCAA 1EV12 2VBDA 4FXGB 3AKPA 1ZNPA 2WA4A 2Y8KA 4YZ2A 3AFKA 5D8AC 3POIA 4D7SA 5L9BA 5CFDA 2DUOA 3CZJA 1BZWA 1OQ1A 4J1WA 3FLPA 4QPYA 1CAWA 2ZMLA 2HWE1 4A7YA 2Q5TA 1ONAA 2OA2A 5A3LA 1EAH1 5TSWA 1DZRA 5M0TA 4AGVA 2W39A 5B4NA 4CDWA 2XPJA 2YU2A 2YG0A 4XF4A 5D8AA 1UZWA 4BQ2A 4JGZB 1LULA 1QJY3 4HLTA 1H2MA 3HQRA 4XQ4A 5AC93 2E9QA 2E31A 3GDBA 2HWD3 4YWAA 1DGRA 4YM0A 2GMEA 2ZX4A 1S4CA 2TUNA 1KDMA 3IIIA 2B4KA 2WZ8A 1GLHA 3VD3A 1W6QB 3E5QA 1CN1A 4YVWB 3CNAA 2XONA 5FMCA 4UF0B 2R0FA 1X50A 2BERA 2ZEYA 2QQJA 1IOAA 4OI4A 2FCUA 3WXPA 4P00B 3T2PA 2ZCWA 5C3QA 2HWF2 4E2GA 4A7KA 3KCXA 5E8AA 1A34A 4I2OA 2GAUA 2VR4A 3KSCA 4Q4W2 5FCCA 2J22A 3ZR5A 2AYHA 2BQPA 1VBC1 1V6IA 4Y1UA 1RVF3 2PXJA 3GXUA 4OFGA 4P9IA 4AE2A 4BQ4A 1EYBA 5FXZA 1SEFA 1ZBA3 2WO3A 2XLGA 3N36A 5FY9A 2UY8A 1XSRA 1JHNA 3CKHA 1G6NA 3N9PA 3J8F3 1LU1A 3JBG2 3BALA 1AYM1 5DUWA 5FUIA 3MBWA 5EIYB 2FDJA 2JXAA 4H7MA 4XC9A 2P4EA 2HYKA 3T08A 3VZNA 1G9BA 4EN9B 3ILFA 4D3WA 1FX5A 1Y3TA 2HYXA 1MS0A 1CJPA 5APAA 4BDVB 4YYOA 2RG4A 4RS5B 1AHSA 1IQAA 1NCQA 1SFNA 1RXFA 4XUTA 1TG7A 4XF1A 1CZTA 1VALA 4EQVA 2YGMA 1EV13 2EALA 2JWPA 3NV3A 1Q5OA 4YW3A 1ZREA 1F35A 1W03A 3KT1A 2VZPA 4ITCA 2YYOA 4XE9A 1AUYA 1AYN1 1R1A1 1QIQA 1SLIA 3JQWA 1WBFA 3GF6A 4OZXA 2EAAA 3CEWA 1YQ6A 2PLV1 2P6HA 4AI3A 4N53B 2JKBA 5D2AA 3D8CA 3IMMA 3VDCA 3HN1A 4LBNA 3BTYA 1WW4A 3PIGA 5HBAA 4PLMA 2A3WA 5DDJ2 4FPYA 1O3SA 4Y5Z0 1ULGA 1UL9A 2NLRA 2XL9A 3ZXGA 1JYVA 4U36A 1WZXA 5IAVA 1UMIA 1NA1A 3VBHB 3WG1A 2BNOA 4MHUA 3I59B 2VZTA 3LDBA 5F39A 1DFQA 2YUEA 3WF0A 3RZGA 3VZOA 4DQAA 5I0DA 4O7XA 5FRAA 4Q8KA 4E27A 3KMHA 2DVGA 4NJ4A 4W6WA 1OVPA 2G4IA 2VUAA 2ZACA 4Y4RA 3LEKA 3RFRA 4M3CE 1O59A 3SEEA 1S55A 2EF6A 3CJIB 3LIHA 2ZABA 4WBBA 3PIJA 1O4TA 3OGRA 1JODA 1OOPA 4QKBA 4BQ5A 1ZRIA 5T54A 1US2A 2IXIA 3W58A 4LK6A 4FOYA 4LBKA 2QVSB 1X7NA 4CU6A 4DUWA 2IVIB 3QBQA 2XWBB 4S2HA 1PZ8A 2DUPA 4PQ9A 5BXXA 2JDYA 5A32A 3N7JA 4BK5A 2CNAA 3MW3A 4KL1A 4IV3B 1WCSA 2GC1A 3BCWA 3DPRB 3H1WA 4AEDB 1SMVA 1WUVA 3OYWB 4CVUA 1FATA 2JKXA 2DTYA 1IZ3A 3BPSA 4TTGA 2PHTA 3PUIA 2WJSA 1UAIA 1F4HA 2WZR1 1D7PM 2XJTA 3NNFA 4LBQB 1MVQA 3FLTA 4XJAA 3QCWA 3D5OA 4N43A 1HB4A 5FP3A 1W8OA 5FY4A 1VLNA 1IKQA 4RSUA 1J3RA 1STMA 1GANA 2VTFA 4IEWA 2D43A 2GH2A 4A3ZA 1LENA 1SLBA 2ILMA 4MXWB 5KXDA 4JHTA 2BGPA 1YLLA 1W2UA 2ET7A 1BMV1 1JUIA 1Q43A 2WQ8A 3WW3A 3ZFGB 3ZYBA 1UX6A 4GIQA 4D0QA 3K51A 3LEIA 4Y4YA 1XU1A 3PU3A 3IBMA 1NCRB 1UOBA 3WDYA 3IWZA 4U2AA 3IB3A 4XETA 5FZCA 3RMXA 1R091 3NWKA 1AZDA 2PHFA 2OS2A 2OUJA 4J6GA 1W8FA 3WVJA 1OD3A 1U5XA 3HR9A 4J25A 3O1OA 2EXHA 5C7GA 3GBGA 2C0ZA 4XXPA 2JDPA 3KQ4B 4CEYA 2YPJA 1AJKA 1Y43B 3THDA 2WAAA 1YFWA 4Q1RA 4RQPB 2Q8CA 2XJPA 1W9FA 4UW3A 1H30A 2NM1A 1ULOA 2VZ1A 4TLFA 2Y34A 1VRH2 2JIGA 2ARBA 4FQ4A 1H9PA 1LKNA 2YY1A 3E6BA 4FP2A 3ZFEC 5C8CA 4O9EA 4BXFA 4X6RB 5FZLA 4I30A 3MIHA 5A6YA 1ASJ1 2PA7A 3OPZA 5BNPA 1V6LA 4PQQA 4XILA 1YFXA 5ABJB 4YVSA 4CDQC 4NROA 1H8TB 5ISLA 1OLRA 3S7EA 1RL3A 4EZ4A 2SBAA 4IE7A 2W46A 4QMAA 1K5MB 1OHFA 4M0HA 1WW5A 2YFZA 2X5IB 3ZFEA 1E57A 3I2DA 4HT1T 4YW1A 2Y6JA 5FUNA 5LEJA 4CUAA 1UY3A 4QPGC 4YM3A 5FY7A 1S0FA 4F8AA 3ECQA 2W9XA 2DVFA 3WEZA 1OF4A 1LR5A 5J37A 4CDQA 2IC1A 2RS52 3SISA 4XAEA 2VXJA 1N1YA 5FMOS 3ZYFA 5FMDA 3VHRA 3I3QA 1AR61 3P1IA 4WM7B 5CFCA 1W06A 1S0BA 5L7OB 4E2QA 5FPUA 5JR2A 2W1SA 4DRRA 1AYM3 1PM4A 2QDRA 4N9IA 1W9TA 1OFNA 4UT5A 5DAWA 3U4XA 3U11A 4AVVA 5ANQA 2RS11 1YHFA 2L9LA 1PO11 3LF7A 4MO3M 4OUEA 5I8SA 1HB2A 4RGKA 1O5UA 2WLPA 4QQ2A 1CAXB 2ERFA 2RR12 3R4UA 3ZO0B 1FPN1 4A42A 2Q4SA 2DTWA 3WSOA 1UF2C 5I0SA 3TNPB 1K5JA 3B02A 1LECA 5BNNC 1RYYA 3OBRA 3A0NA 3P5BA 4OMCA 2O0OA 4R8HA 3TEXA 3T09A 2ARAA 1IPKA 1A6CA 1KS5A 3NQHA 3TBDA 5IYYA 4QXKA 3LB9A 4S2GA 1Q8OA 1W0PA 4Y26A 4IV1B 1Z7S1 2D5FA 3WF4A 3SCFA 5FYMA 1R1A3 5SV8A 3RMYA 1V9U1 4I09A 1UOFA 5C71A 2VL4A 1HW5A 3UGHA 5J36A 2W1WA 4A4AA 4WM8A 5FK7A 3DECA 2OXBA 1ZRRA 4LLFA 4B4QA 1GZWB 3I49A 2R062 2NMNA 5CEHA 1GQHA 2BFUS 2MEV2 1GZCA 4PI0A 1SCRA 2WN3A 3AZYA 3SKVA 3VL8A 4AF9A 5A6XA 1OC1A 1RIRA 1RUE2 3O1MA 1JOBA 4AGRA 4WVMA 3EO6A 2RS31 4XABA 3INAA 4IEXA 2XQRA 2DFBA 2DUQA 4HN0A 1VRH3 3KCCA 4AEKA 4W4ZA 1NLSA 5FV3A 5JDBA 4P9GA 2WT1A 3MICA 2UU8A 3JB4C 4OQ8A 5IUQA 1PK6C 2DYCA 2Y38A 4FPOB 3KVAA 4Q4X2 1Y9GA 1RHI1 2JDAA 3C7HA 4IETA 4CDXC 2H0VA 3JD72 3THCA 5FPLA 3TWIA 4N8MA 4QHOA 4QX7A 5DXDA 5KWRA 4NAOA 4GQ7A 3GJBA 1KEXA 5J7MA 2DU1A 2FZ1A 5FQ0A 2WN2A 1QNWA 3LOIA 3NJZA 1X33A 3A7QA 4QDRA 1NAEA 4GWNA 4JTOA 4KBBA 4LOTA 4Z07A 3DV8A 1W28A 4MXVA 4BA6A 2J1TA 1SPPB 1DP0A 2RS53 2ADEA 4CDXA 1VRBA 2Y6HA 3BUCA 1XJAA 1HN1A 3RJRA 1JN2P 2EIDA 1O7FA 2R042 5FYVA 3OB8A 1SFPA 2NMOA 3DKQA 2E7TA 2WZR3 5LBCA 1G7YA 2G9FA 3VBOB 3KGLA 4WVZA 1O3TA 1AJOA 1FNYA 1YIFA 1KJLA 1PVC2 2XJUA 4ONUA 4PT6A 4QXHA 4XQDA 5FZDA 1RMU1 1VBE1 2GC2A 2Q1ZB 1BBT2 1CVNA 3WW1A 2R0HA 1MACA 1EPZA 3R4SA 4NHKA 5LY1A 1OPOA 1AR92 2GNDA 4RGGA 4TWTA 1VMFA 1O4ZA 4XZUG 4XTMA 4NIGA 1LNSA 4CPBD 2VQ0A 2IXJA 4CCEA 4IW3A 1TME1 2JECA 2J7MA 1RJ8A 5GKAC 2WFPA 2YGLA 4IEUA 3T30A 3UT0A 3JB8A 2AUYA 1CX4A 2BNMA 2Z4FA 1B09A 2DDUA 2OUHA 4LIUA 3RZJA 2I45A 4LBQD 1TZOA 3C3VA 5LASA 2P6CA 2BP6A 2B39A 5FZ0A 4QX3A 1YC61 2VPVA 4MGIE 4OHVA 4LBJA 5FZKA 2R063 5L36A 3O1RA 2W0XA 2GH8A 2MEV3 2JG8C 3BODA 5C70A 4FOQA 5A1FA 2GN3A 1RUE3 1ZZ6A 3BU0A 1PMIA 1S0CA 2AEYA 2YXSA 3FFZA 1OA3A 3MF9A 4HSJA 4CUBA 5A70A 3RZKA 4FOWA 1DU3D 4JDMA 4YW2A 4AAXA 4JCKA 3LZZA 2E53A 3LE0A 4Y22A 1F4AA 3AXDA 1HDKA 1MQTB 3AP5A 4I01A 3AB0A 1ASJ3 3I4IA 1G9CA 2H6BA 4AFCA 4XFBA 5A3OA 4UFJA 1PGL1 1ZM1A 2VE1A 4DRVA 1FMD3 1IG3A 1B35C 4CP2A 1PGW1 1AL22 4Q4X3 2VZ3A 4ISRA 4Q0VA 4HANA 3JD73 3MIBA 4MGQA 5LA2A 4CU8A 1VBA2 1EPWA 4KI5M 3RDIA 1RUNA 3M3IA 1CIWA 1US3A 3N7MA 3FHAA 1B35A 2BGOA 1WW6A 4HVQA 5FPVA 2CWSA 4B7KA 5G05L 4M4RA 1LHWA 1MS9A 4EJRA 2TBVA 2WT2A 5FIXA 3GZEA 2VBPA 1W6OB 5JVVA 1I1EA 3HNMA 3APBA 4QKNA 3OBTA 5A7OA 1XE0A 1UQXA 2XVGA 3P3NA 1ENRA 4QU1A 5FZ6A 5HV4A 2K9ZA 3OY8B 4V2WA 3H8OA 1W8UA 1HV1A 3ZSEA 2ZGRA 1PVC3 5J48A 1JYWA 1VE0A 5F3GA 2PFWA 4COYA 2RMU2 2BYVE 4ZS2A 1BBT3 2JICA 1DG6A 1HRI1 5IVJA 1CAUB 1AR93 2Z2SB 3NAPB 2OIIA 1BK0A 1GU3A 2VOWA 3CJXA 2A5ZA 3NNLA 1IG0A 1S2KA 4FOVA 3GGLA 3RZLA 1RUH2 3KT4A 4XDPA 3WF1A 2ZHNA 1H1MA 2H6CA 3IDEA 2ZGSA 3ZFFC 5A3TA 2CWMA 5ERLA 5C4WC 4L2NA 5LWBA 3ZYJB 1R1ZA 2GC0A 2JD4A 2WBKA 1MEC2 1UMHA 3H50A 1JOJA 3AVRA 3UL2A 3TN91 2JX9A 4G4FA 5K9YA 4N9HA 2CDPA 1RUF3 4QPIC 5F37A 4ZPIA 5JI7A 4FAGA 2D6NA 4EWAA 1AXKA 5BY5A 3MW4A 1AXYA 5IK8A 1PIV2 2VZVA 3NO8A 1LRHA 1QJX1 4KGQA 3ZYPA 1G9DA 5F3CA 4JRAA 2RS33 3O1PA 2A71A 3M3QA 2KR2A 5BV6A 5J3UA 2ATFA 1WMFA 5JI9A 3H8RA 5IFPA 4QPIA 1ZRFA 5A33A 4M3CB 3CLPA 2ZKLA 4D7TA 4GH4C 4L9BA 2P5BA 4JGYA 3NJYA 1FI2A 4MG2A 1QWRA 5BNOA 1BLZA 2XHKA 4A6SA 2LALA 1V0AA 4N7IA 4DXTA 2NYYA 1ZZ7A 4MADA 3ZYRA 4BIOA 1RHI3 3WDTA 1UX7A 4OMDA 1YJKA 4UFHA 3SCHA 3ALQA 3ITQA 1AL23 4IGOA 2BJSA 3POFA 3ACLA 3S57A 2QE3A 1S0DA 4GH4A 1VBA3 2BVVA 3RQ0A 4CEWB 1AR72 1UY1A 4P9YA 2P34A 1A8DA 1QJY1 4BIFA 5H9PA 2F4LA 5FYYA 2VOKA 2BWCA 2HWD1 2W1QA 5JIUA 3UV9A 2VOXA 4F7ZA 5FTTC 1SHWB 4Q8LA 4P9XA 2WNVA 2VMIA 1ENXA 3FUQA 4Q4Y2 4C8DA 4EZHA 1NY71 4FP3A 4MLOA 3MIGA 3HN3A 1RUG2 1UW8A 4OLLA 2XR4A 3DYOA 4B4PA 1QQP1 4AHYA 3DYPA 2WO2A 3MLKA 4R9CA 3ZXFA 2B45X 4GULA 4GB32 3K48A 2PAMA 1LHVA 1REEA 3MGUA 3POYA 4YSFA 3N3HA 1RUC3 5FPZA 1SQ4A 5LRRA 3WLUA 2RMU3 2WRAA 1S1AA 5C9AB 1ULCA 2IXCA 3KV4A 4RR3B 1SDWA 1NYWA 1T6BX 3AMPA 3RZHA 3LWCA 5HI0A 4PBPA 2QQUA 3GJAA 4EV0A 5KC6A 4BWOA 1RVF1 3WV6A 1RUH3 2AEZA 2WQ4A 1TME3 1N3QA 3OEAA 3T1LA 4FAHA 1ZBA1 1FAYA 2Z69A 2D40A 2A3YA 1YO8A 4MX3A 3PTYA 3HJRA 3G6JB 3K77A 2HLEA 4PDWA 2Z79A 1UY0A 4CCJA 3J8F1 3AZXA 5JMOA 1LTEA 2JEMA 1OXCA 5A3WA 3N4MA 3B93A 5KHGA 2DVBA 3GCWA 2RJKA 3ZLIA 5KR7A 3RI8A 4Z2AA 5LY2A 1W6NA 2BBVA 4P08A 1PIV3 2BGCA 4XHXA 1WW7A 4HL0A 2A1XA 3O1SA 2PYTA 1WWYA 5I0TA 4D6QA 3O0XA 5LBBA 2DURA 3LDRA 3POBA 1VJ2A 3TYJA 1C1LA 4FPEA 5H9RA 4AGGA 5LK5A 5KHJA 4HG6B 1EV11 1T2XA 1DQ6A 5LCWL 3B01A 1GOFA 3I7DA 4BU2A 2ZAAA 1JUHA 3H3UA 2QQNA 2VUDA 2ZS6B 2X10A 1KS4A 4SLIA 1LCLA 5K0UA 3WDUA 1C4RA 5JZGB 2FHRA 3ILRA 2F6BA 2VUJA 2D6KA 3R05A 1TNRA 4YW7A 4AVBA 1AX1A 3POSA 4PLOA 1WA4A 1CESA 2J1EA 4Z2WA 5CU1A 1AR73 3S6PA 1W3VA 2ZEXA 1PNGA 2JG9A 2WYFA 4WZCA 2GMPA 4OUMA 2HKXA 1OI6A 2VNOA 3CZUA 3H9AA 5I0UA 2D6OX 5DUXA 2FDIA 5T52A 1CONA 2VECA 3EXUA 3VLBB 2YC2A 2ZGPA 4AFDA 4ZKTB 3VDDC 5CG9A 3VBUB 1CR7A 1M06G 1S2EA 2VMFA 2P2KA 2VW1A 3AJYA 4AL9A 4LULA 3ZIWA 3ME2A 1YCIA 5HCHA 1U0AA 3J7HA 4QHZA 2Q8EA 3SHRA 3OUJA 3N9NA 1CQ9A 2BV4A 3GHNA 3SQOA 2C9KA 2HWF1 5FYSA 3VDDA 1RUD2 1MVEA 3JXSA 2KD7A 3U07A 2QQOA 1DHKB 1J59A 2DFCA 2Q8DA 2GNMA 1Q8VA 5DZFA 5C5TA 5B2GB 4M01A 4GWJA 2BOJA 1KDKA 5F2WA 5JOWA 1O3QA 3KD4A 2RDNA 1C5HA 2WKKA 2WNUC 4JKMA 5GZEA 2KA3A 3QLQA 5IW0A 2XBO2 2YBSA 4NIHA 3N35A 2EIEA 3JBG1 1PNFA 1JZ4A 1JW6A 1PZ7A 2WINB 2Y26A 3WNOA 5B4XA 2ZJCA 2GNBA 3LGRA 3LFMA 5KHKA 3TEWA 2JDUA 4Y1VA 5CFDC 2I07B 5CKNA 3EJKA 2Y6KA 1NZIA 4TN7A 4Y20A 2NZ9A 2VU9A 2ZX3A 3NMBA 1C8NA 4UAPA 3M3CA 3MZHA 3KLSA 5L9VA 1O6UA 3FFQA 1DDLA 2ARXA 4CDWC 3L2YA 5KXCA 2W92A 4AFMA 2RHPA 2WSVA 3BGAA 3KS7A 5FZ7A 1ZZ9A 3VZMA 1DGWX 3LKJA 4AFBA 1OD5A 3S5QA 2GZWA 1C1FA 3D3AA 3VBFB 2VUCA 4ATFA 3OUHA 4YGBA 3ZDVA 5AFEA 2JDZA 1MS4A 4AOCA 4JVAA 1C8M2 1JXNA 1ND2A 3IPVA 4Y24A 1J1TA 4H2AA 4XF3A 2Q1FA 3VGIA 1DQ4A 3EBRA 3KF3A 1QDOA 4UYBA 2ZHMA 5DDJ1 3IZOA 2V09A 1H0BA 3DUIA 4NWVA 4YGCA 3CDZB 5IWFA 4LR4A 3KQRA 2QNKA 3Q8BA 4YNIA 1XC6A 3UYJA 2P3IA 3HT2A 4H55A 4MSVA 1K45A 1CIYA 1FOD2 1TNFA 2XWJB 3Q8AA 4GXLA 5FZ3A 4OVEA 5IVVA 2W2IA 2D44A 2BU9A 3CBNA 3LEMA 5GZDA 1FT9A 1ZRDA 1OMIA 3UKVA 4H3WA 4HFSA 2UWAA 1DCSA 3J7MA 3V64A 1QQP3 2XG3A 4KWUA 4JGZA 4ES9A 2JDKA 3ZXEA 1V6KA 3ZXLA 2PHRA 3OF1A 3VD7A 1QJZA 4PHZA 3BVCA 4LO7A 4LUMA 4PLNA 2D3SA 1UYPA 4PIZA 1ZVFA 3HOBA 3A21A 3POWA 4O9GA 3X29B 5EJ1B 3AL6A 4COVA 5FO8B 1W6QA 2FMDA 4YVWA 4CUGA 5E1RA 1TE1B 4UF0A 4UW5A 3K4AA 3WT3A 2Y60A 5FZOB 1VBD2 3RVHA 4YW5A 3T2TA 1F8VA 1V70A 2DCJA 1AVBA 3LDKA 1H4HA 4UFKA 2XBO3 1NCQC 2HWC2 2J1VA 4PIXA 1RUI2 4XFAA 1PX4A 2UYBA 2ZMKA 4M00A 2N7GA 3OPWA 4TLGA 3USUB 2E26A 4LMFA 1DGLA 4JX0A 3FZ3A 2JB8A 4Q2FA 2ZGQA 2Y0OA 1SDDB 3T0AA 1BVVA 1SCSA 5FYHA 3AK0A 3ZMNA 3I3BA 1MZ5A 4WVWA 2VJXA 3IDAA 3WQ0A 3O1VA 4FTEA 2Z5WA 3WR0A 2B9UA 1HQLA 3BPZA 2AACA 1S2BA 1ZBE2 4UFIA 1PVXA 2ADDA 1D4M2 3J7NA 2VOVA 3T0DA 5FZ4A 3AXEA 3WY6A 2YPDA 4BISA 1VAKA 2QQKA 4ET7A 5JXGA 3ZFGC 1NA1C 5C8WA 1ZX5A 1S0GA 2VD7A 2VXRA 4RS5A 3VN4A 4XZPA 5FWJA 4QD2A 2OZJA 4N53C 5FMOL 4EN7B 4HONA 2PTMA 3WP5A 1C8M3 1E5IA 3IAQA 1A78A 2P3JA 2VVDA 5DG2A 4B3NA 3VUOA 3VD5A 1OOPC 4XCAA 4HVRA 5FY5A 1EY2A 3LA7A 3NV1A 4URTA 1L7RA 1ENQA 1TVGA 1VRH1 2BW8A 4N53A 2XMLA 3RSJA 4D69A 4Q0UA 3B69A 4KMQA 1IS4A 3WW2A 1EUUA 4NRMA 5JCTA 1AX2A 1FV3A 2XJQA 3MF6A 4NPMA 5C5UA 3V0AB 4ARYA 1PX3A 1WBLA 2P17A 1LOGA 2CGOA 3MFAA 3FBYA 4FPCA 5JSRA 3AC0A 4NRPA 2FBEA 4AHWA 2HWF3 2WUHA 1J83A 5HXVA 3ENRA 2X53S 3VBHA 1GZ9A 3ZSJA 4Q4W3 3I59A 1L7QA 2LS6A 4XDOA 1UO9A 1G86A 4JTNA 2RJLA 4N43C 4XMIA 4P14A 5IVFA 2AZ5A 2WZEA 4IEPA 1UZVA 2RS51 3PJYA 1QOOA 5FO9B 4HMZA 4COUA 3HMYA 3C8XA 2FCVA 4QQHA 5T5OA 5LZ6A 2BFUL 4FVVA 2RM22 4NAMA 1OSGA 4AEDC 3GZUC 1OUSA 3JBG3 1UKRA 4KG8A 1CPMA 1RUI3 3LA3A 3B3QE 4MGKE 5JSPA 4LHLA 3ZYGA 1KJRA 3MW2A 4QX1A 2PHDA 4XUQA 4CPBA 2QBXA 2VTXA 3AP6A 5CBLA 1LGCA 1MR5A 2CL2A 1O8PA 4IV3A 5GALA 1PZ9A 4AEDA 2R49A 1ZA7A 2ORXA 3PHMA 4TXWA 5I8TA 4L11A 3SKJE 3U1XA 3V56A 2ZGNA 4TSVA 5FY1A 3VKNA 4BQ1A 4CU7A 1W39A 2GN7A 2RE9A 1EUTA 2C1FA 2PQSA 3BB6A 3CHXA 4CEYC 4C90A 2HEWF 4Y5TA 4LBQA 2FQPA 3C7GA 5DAXA 2XHNA 3NJVA 5FJKA 3OJBA 3VZKA 1ZBE3 3ZXDA 5FMBA 4BHPA 1DLCA 1D4M3 2RDQA 5A3UA 1JYNA 2CYFA 4Y1XA 4DFSA 5EPAA 4MXWA 3AP9A 3OGVA 1KD7A 5C8CC 4Q0QA 3OUIA 1ND3B 5BNPC 3ZFGA 2R061 3M4FA 3KGZA 3PVBB 4LO8A 5DDJ3 2MEV1
chains in the Genus database with same CATH topology
5DPNA 2J7MA 5IJRA 1CZVA 2Z4FA 2W3JA 2DDUA 5A1AA 1JHJA 4D8MA 4QX3A 4W8JA 4ARXA 5CZKA 4ZZ5A 1JZ7A 2J1RA 3OEBA 4ZZ8A 5C70A 4QX2A 3WNNA 2V72A 4OZOA 3LPFA 2ZEWA 4P5YA 4CUBA 2VZOA 4AAXA 2JD9A 3LE0A 1GOHA 1F4AA 3EB7A 5JUVA 1GOGA 4LHSA 1UXZA 2W91A 5LA1A 2RV9A 3HNYM 3MV11 4XURA 3UNPA 1JZ6A 3C7FA 4MGSA 3W5NA 2VZ3A 4MGQA 5LA2A 1WKYA 3OG2A 4CU8A 4KI5M 4M4PA 4RYDA 1DYOA 4QB6A 4JKLA 4UOJA 1W0NA 3CIHA 1US3A 3FHAA 1JZ5A 2BGOA 3CQOA 5G05L 4M4RA 3HNMA 4BXSV 1JU4A 3VDBA 2J1AA 1O8SA 3NRUA 2B9VA 3E1F1 1JYWA 3NNGA 1OF3A 1GU3A 1JZ8A 1KGYA 3GGLA 2VQUA 3WF1A 3FL7A 4W50A 2V4VA 5F7UA 2WDBA 3K46A 2WBKA 1W8NA 2X09A 4E8CA 5J1XA 1UMHA 2C4XA 3HEIA 2QQMA 2CDPA 2Y6GA 1R64A 4QAWA 2VZVA 3FN9A 3T2OA 3K4DA 4E8DA 2ID4A 2VQTA 4GZ9A 5IFPA 5JXJA 1UY2A 1H6XA 4MOAA 4QDQA 3C7OA 4DXTA 3ETPA 4MADA 3VD9A 2YC4A 1UX7A 4OMDA 2VZUA 3T0BA 2VMEA 3ACHA 4DXRA 1UY1A 3LEGA 2Y8KA 1XNTA 3C7EA 3IAPA 3WNKA 2W1QA 3CZJA 1SHWB 3HN3A 2WYSA 5B4NA 1W99A 3DYOA 2YG0A 3I3DA 3DYPA 2WO2A 2VCBA 2LW8A 5DN2A 2QQLA 3UETA 2E31A 3GDBA 3WQBA 2Y64A 2X05A 3IIIA 1BHGA 2B4KA 3I2IA 2WZ8A 3VD3A 1P8JA 4IUGA 1GQPA 2W95A 2XONA 1H6YA 3OEAA 2BERA 2ZEYA 2QQJA 3MV01 3UESA 2JE8A 3HJRA 3K77A 4P00B 2HLEA 3T2PA 3I2GA 1UY0A 5JXIA 4CUCA 5JMOA 2VR4A 1ULPA 2J22A 2CDOA 4Z2AA 4P08A 3GXUA 2RVAA 2EIBA 4LQRA 4XUPA 2WO3A 3BN6A 1J84A 3ACGA 4P02B 1GUIA 1UYXA 1W9SA 3CKHA 4HG6B 1T2XA 3MBWA 5FUIA 5EIYB 5LCWL 1GNYA 2ZXQA 1GOFA 3CMGA 3T08A 1WCQA 2BBAA 2QQNA 4XUOA 2HYXA 4OYUA 2X10A 4BDVB 2VZSA 2YFUA 4XUTA 1TG7A 3I2JA 1CZTA 2VCAA 5G04L 2J1EA 1UYZA 2ZEXA 4LPLA 3F2ZA 2VZPA 3CZUA 3PUHA 2YC2A 2VMFA 3VDCA 2W87A 3I3EA 4FI9A 4XUNA 3J7HA 3VD4A 3WNPA 1JYVA 2QQIA 2C9KA 2VZQA 1UMIA 2VCCA 3JXSA 2KD7A 4GWIA 2VZTA 3WF0A 2QQOA 5I0DA 1PMJX 4GWJA 3HNBM 3LEKA 3SEEA 1O59A 4DEVA 1JU3A 4JKMA 4JKKA 1UY4A 3OGRA 1W9WA 1GMMA 1SG3A 1US2A 2EIEA 1JYXA 4CU6A 1JZ4A 4DUWA 3WNOA 5B4XA 2E32A 4YPJA 2Y6KA 4BK5A 4ZY9A 3FHQA 3MO4A 4CVUA 2JKXA 4TTGA 1JZ2A 4RN5A 3PUIA 4XVHA 4UAPA 1F4HA 1D7PM 3EYPA 2W92A 1K42A 3BGAA 4QB1A 1W8OA 3D3AA 2VTFA 2VZRA 3K4ZA 4A3ZA 2Y6LA 2BGPA 3MUZ1 2ZEZA 2WQ8A 3MUY1 4D0QA 3LEIA 1JZ3A 5LA0A 2OKXA 2XOMA 3ACIA 3WF3A 2J1UA 3WNLA 3IB3A 3CDZB 4DUVA 1K3IA 1XC6A 4QDSA 4CU9A 1OD3A 1K45A 1CIYA 2V5DA 5C7GA 2RJ2A 1I5PA 3THDA 2WAAA 4KWUA 1IQDC 5IFTA 1NX9A 3VD7A 2VMDA 2VZ1A 1ULOA 4QB2A 4LKSA 2XQXA 3HOBA 3A21A 5DMYA 5EJ1B 1MPXA 4A44A 3LQCA 2R7EB 3U37A 4PQQA 3K4AA 5DQ0A 3I2KA 1PMHX 3LPGA 1UWWA 1UZ0A 2DCJA 2W46A 4DEQA 2J1VA 2YFZA 1PX4A 4QPWA 2Y6JA 2E26A 4CUAA 1UY3A 4JX0A 3ECQA 3K75B 2W9XA 3WEZA 1OF4A 1SDDB 4L0PA 3T0AA 3P1IA 3I3BA 4AG4A 2VJXA 3IDAA 3ACFA 5JXHA 5JR2A 2W1SA 1W9TA 2YB7A 1XPWA 3I97A 1OH4A 2WAOA 2L9LA 3DYMA 4MO3M 4OUEA 3T0DA 1UXXX 4ZXEA 2J1SA 2QQKA 4ET7A 2ORZA 5JXGA 4A42A 1JI6A 3WSOA 5CYYA 3WNMA 4DUXA 1RYYA 3GM8A 4OMCA 3T09A 4A41A 3NQHA 3VDAA 5IYYA 3IAQA 2WO1A 2W5FA 3WF4A 3A22A 3A23A 3VD5A 3I2FA 5C71A 2VL4A 3P6BA 2W1WA 4A4AA 1L7RA 1TVGA 3DECA 3I2HA 5EJZB 3SEPA 4PF1A 4DXSA 4KMQA 1EUUA 2DCKA 2VC9A 2E33A 2WN3A 2VMCA 3SKVA 4ARYA 1PX3A 4BK4A 2VO5A 3AC0A 1CZSA 2WUHA 1J83A 3W5MA 1L7QA 2LS6A 5HPOA 2VM9A 4UI9L 4W4ZA 1CX1A 4QX0A 2WABA 4JHZA 2WZEA 1OT5A 2W47A 3ZM8A 3C8XA 1UYYA 1K12A 2JDAA 3C7HA 3THCA 1XNAA 5HXMA 1KEXA 4A45A 2WN2A 3A7QA 4QDRA 1NAEA 1YQ2A 4QX1A 4XUQA 2QBXA 3OBAA 2J1TA 4A6OA 1DP0A 1NUKA 1O8PA 3NJXA 2Y6HA 1HN1A 2ORXA 2C26A 4TXWA 2EIDA 3SKJE 4CU7A 4BJ0A 3OB8A 1EUTA 2PQSA 2W1UA 2VOTA 3ABZA 3C7GA 2XHNA 3NJVA 3WF2A 2BZDA 1DLCA 3HPNA 4PT6A 2W94A 3OGSA 1JYNA 2EICA 3OGVA 1NKGA 4XZUG 5IHRA 1LNSA 3T2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPN A;  2J7M A;  5IJR A;  1CZV A;  2Z4F A;  2W3J A;  2DDU A;  5A1A A;  1JHJ A;  4D8M A;  4QX3 A;  4W8J A;  4ARX A;  5CZK A;  4ZZ5 A;  1JZ7 A;  2J1R A;  3OEB A;  4ZZ8 A;  5C70 A;  4QX2 A;  3WNN A;  2V72 A;  4OZO A;  3LPF A;  2ZEW A;  4P5Y A;  4CUB A;  2VZO A;  4AAX A;  2JD9 A;  3LE0 A;  1GOH A;  1F4A A;  3EB7 A;  5JUV A;  1GOG A;  4LHS A;  1UXZ A;  2W91 A;  5LA1 A;  2RV9 A;  3HNY M;  3MV1 1;  4XUR A;  3UNP A;  1JZ6 A;  3C7F A;  4MGS A;  3W5N A;  2VZ3 A;  4MGQ A;  5LA2 A;  1WKY A;  3OG2 A;  4CU8 A;  4KI5 M;  4M4P A;  4RYD A;  1DYO A;  4QB6 A;  4JKL A;  4UOJ A;  1W0N A;  3CIH A;  1US3 A;  3FHA A;  1JZ5 A;  2BGO A;  3CQO A;  5G05 L;  4M4R A;  3HNM A;  4BXS V;  1JU4 A;  3VDB A;  2J1A A;  1O8S A;  3NRU A;  2B9V A;  3E1F 1;  1JYW A;  3NNG A;  1OF3 A;  1GU3 A;  1JZ8 A;  1KGY A;  3GGL A;  2VQU A;  3WF1 A;  3FL7 A;  4W50 A;  2V4V A;  5F7U A;  2WDB A;  3K46 A;  2WBK A;  1W8N A;  2X09 A;  4E8C A;  5J1X A;  1UMH A;  2C4X A;  3HEI A;  2QQM A;  2CDP A;  2Y6G A;  1R64 A;  4QAW A;  2VZV A;  3FN9 A;  3T2O A;  3K4D A;  4E8D A;  2ID4 A;  2VQT A;  4GZ9 A;  5IFP A;  5JXJ A;  1UY2 A;  1H6X A;  4MOA A;  4QDQ A;  3C7O A;  4DXT A;  3ETP A;  4MAD A;  3VD9 A;  2YC4 A;  1UX7 A;  4OMD A;  2VZU A;  3T0B A;  2VME A;  3ACH A;  4DXR A;  1UY1 A;  3LEG A;  2Y8K A;  1XNT A;  3C7E A;  3IAP A;  3WNK A;  2W1Q A;  3CZJ A;  1SHW B;  3HN3 A;  2WYS A;  5B4N A;  1W99 A;  3DYO A;  2YG0 A;  3I3D A;  3DYP A;  2WO2 A;  2VCB A;  2LW8 A;  5DN2 A;  2QQL A;  3UET A;  2E31 A;  3GDB A;  3WQB A;  2Y64 A;  2X05 A;  3III A;  1BHG A;  2B4K A;  3I2I A;  2WZ8 A;  3VD3 A;  1P8J A;  4IUG A;  1GQP A;  2W95 A;  2XON A;  1H6Y A;  3OEA A;  2BER A;  2ZEY A;  2QQJ A;  3MV0 1;  3UES A;  2JE8 A;  3HJR A;  3K77 A;  4P00 B;  2HLE A;  3T2P A;  3I2G A;  1UY0 A;  5JXI A;  4CUC A;  5JMO A;  2VR4 A;  1ULP A;  2J22 A;  2CDO A;  4Z2A A;  4P08 A;  3GXU A;  2RVA A;  2EIB A;  4LQR A;  4XUP A;  2WO3 A;  3BN6 A;  1J84 A;  3ACG A;  4P02 B;  1GUI A;  1UYX A;  1W9S A;  3CKH A;  4HG6 B;  1T2X A;  3MBW A;  5FUI A;  5EIY B;  5LCW L;  1GNY A;  2ZXQ A;  1GOF A;  3CMG A;  3T08 A;  1WCQ A;  2BBA A;  2QQN A;  4XUO A;  2HYX A;  4OYU A;  2X10 A;  4BDV B;  2VZS A;  2YFU A;  4XUT A;  1TG7 A;  3I2J A;  1CZT A;  2VCA A;  5G04 L;  2J1E A;  1UYZ A;  2ZEX A;  4LPL A;  3F2Z A;  2VZP A;  3CZU A;  3PUH A;  2YC2 A;  2VMF A;  3VDC A;  2W87 A;  3I3E A;  4FI9 A;  4XUN A;  3J7H A;  3VD4 A;  3WNP A;  1JYV A;  2QQI A;  2C9K A;  2VZQ A;  1UMI A;  2VCC A;  3JXS A;  2KD7 A;  4GWI A;  2VZT A;  3WF0 A;  2QQO A;  5I0D A;  1PMJ X;  4GWJ A;  3HNB M;  3LEK A;  3SEE A;  1O59 A;  4DEV A;  1JU3 A;  4JKM A;  4JKK A;  1UY4 A;  3OGR A;  1W9W A;  1GMM A;  1SG3 A;  1US2 A;  2EIE A;  1JYX A;  4CU6 A;  1JZ4 A;  4DUW A;  3WNO A;  5B4X A;  2E32 A;  4YPJ A;  2Y6K A;  4BK5 A;  4ZY9 A;  3FHQ A;  3MO4 A;  4CVU A;  2JKX A;  4TTG A;  1JZ2 A;  4RN5 A;  3PUI A;  4XVH A;  4UAP A;  1F4H A;  1D7P M;  3EYP A;  2W92 A;  1K42 A;  3BGA A;  4QB1 A;  1W8O A;  3D3A A;  2VTF A;  2VZR A;  3K4Z A;  4A3Z A;  2Y6L A;  2BGP A;  3MUZ 1;  2ZEZ A;  2WQ8 A;  3MUY 1;  4D0Q A;  3LEI A;  1JZ3 A;  5LA0 A;  2OKX A;  2XOM A;  3ACI A;  3WF3 A;  2J1U A;  3WNL A;  3IB3 A;  3CDZ B;  4DUV A;  1K3I A;  1XC6 A;  4QDS A;  4CU9 A;  1OD3 A;  1K45 A;  1CIY A;  2V5D A;  5C7G A;  2RJ2 A;  1I5P A;  3THD A;  2WAA A;  4KWU A;  1IQD C;  5IFT A;  1NX9 A;  3VD7 A;  2VMD A;  2VZ1 A;  1ULO A;  4QB2 A;  4LKS A;  2XQX A;  3HOB A;  3A21 A;  5DMY A;  5EJ1 B;  1MPX A;  4A44 A;  3LQC A;  2R7E B;  3U37 A;  4PQQ A;  3K4A A;  5DQ0 A;  3I2K A;  1PMH X;  3LPG A;  1UWW A;  1UZ0 A;  2DCJ A;  2W46 A;  4DEQ A;  2J1V A;  2YFZ A;  1PX4 A;  4QPW A;  2Y6J A;  2E26 A;  4CUA A;  1UY3 A;  4JX0 A;  3ECQ A;  3K75 B;  2W9X A;  3WEZ A;  1OF4 A;  1SDD B;  4L0P A;  3T0A A;  3P1I A;  3I3B A;  4AG4 A;  2VJX A;  3IDA A;  3ACF A;  5JXH A;  5JR2 A;  2W1S A;  1W9T A;  2YB7 A;  1XPW A;  3I97 A;  1OH4 A;  2WAO A;  2L9L A;  3DYM A;  4MO3 M;  4OUE A;  3T0D A;  1UXX X;  4ZXE A;  2J1S A;  2QQK A;  4ET7 A;  2ORZ A;  5JXG A;  4A42 A;  1JI6 A;  3WSO A;  5CYY A;  3WNM A;  4DUX A;  1RYY A;  3GM8 A;  4OMC A;  3T09 A;  4A41 A;  3NQH A;  3VDA A;  5IYY A;  3IAQ A;  2WO1 A;  2W5F A;  3WF4 A;  3A22 A;  3A23 A;  3VD5 A;  3I2F A;  5C71 A;  2VL4 A;  3P6B A;  2W1W A;  4A4A A;  1L7R A;  1TVG A;  3DEC A;  3I2H A;  5EJZ B;  3SEP A;  4PF1 A;  4DXS A;  4KMQ A;  1EUU A;  2DCK A;  2VC9 A;  2E33 A;  2WN3 A;  2VMC A;  3SKV A;  4ARY A;  1PX3 A;  4BK4 A;  2VO5 A;  3AC0 A;  1CZS A;  2WUH A;  1J83 A;  3W5M A;  1L7Q A;  2LS6 A;  5HPO A;  2VM9 A;  4UI9 L;  4W4Z A;  1CX1 A;  4QX0 A;  2WAB A;  4JHZ A;  2WZE A;  1OT5 A;  2W47 A;  3ZM8 A;  3C8X A;  1UYY A;  1K12 A;  2JDA A;  3C7H A;  3THC A;  1XNA A;  5HXM A;  1KEX A;  4A45 A;  2WN2 A;  3A7Q A;  4QDR A;  1NAE A;  1YQ2 A;  4QX1 A;  4XUQ A;  2QBX A;  3OBA A;  2J1T A;  4A6O A;  1DP0 A;  1NUK A;  1O8P A;  3NJX A;  2Y6H A;  1HN1 A;  2ORX A;  2C26 A;  4TXW A;  2EID A;  3SKJ E;  4CU7 A;  4BJ0 A;  3OB8 A;  1EUT A;  2PQS A;  2W1U A;  2VOT A;  3ABZ A;  3C7G A;  2XHN A;  3NJV A;  3WF2 A;  2BZD A;  1DLC A;  3HPN A;  4PT6 A;  2W94 A;  3OGS A;  1JYN A;  2EIC A;  3OGV A;  1NKG A;  4XZU G;  5IHR A;  1LNS A;  3T2Q A; 
#chains in the Genus database with same CATH topology
 5LRS A;  3HT1 A;  1OLM E;  1MZF A;  4YVS C;  5DPN A;  3ZN6 B;  4H7L A;  2C24 A;  1RUE 1;  4IND A;  4JDN A;  5IJR A;  3T3Y A;  1CZV A;  4RQP C;  5GLW A;  3Q9O A;  4K6B A;  1V6M A;  2W3J A;  4HPK B;  3B7M A;  3BI3 A;  3FE5 A;  5A1A A;  3N7L A;  4DY3 A;  3AP7 A;  3PUQ A;  1XYP A;  4GA9 A;  4W8J A;  4IE4 A;  3ZSL A;  1H2L A;  5CZK A;  2XVK A;  2QZ2 A;  4N7U A;  1YUD A;  1Z78 A;  5LW9 A;  1JBC A;  3MYX A;  2FDF A;  1FMD 1;  1E5H A;  2Q30 A;  3IMN A;  4I0W B;  1H8T C;  4Q4X 1;  4RQP A;  5A80 A;  5CFC C;  5IVE A;  4GD4 A;  3JD7 1;  2VZO A;  3W59 A;  3DEM A;  1K5M C;  1HRV 2;  2JD9 A;  3WCS A;  4BQX A;  3EB7 A;  4DPN A;  4LHS A;  5I8Y A;  1UKG A;  2W91 A;  4EYU A;  5T50 A;  3LCP A;  5ABJ A;  5CAZ A;  2RV9 A;  1H8T A;  2IFW A;  4CDQ B;  4XUR A;  5IK4 A;  2LM3 A;  1JZ6 A;  2ZGL A;  2QKD A;  3UNP A;  2GMM A;  1O3R A;  4MGS A;  4WM7 C;  4XAC A;  3ZXA C;  2R04 1;  2DU0 A;  1K5M A;  2RM2 3;  3S30 A;  2WQZ C;  4JQT A;  2DF7 A;  2X5I A;  1WKY A;  1WGP A;  3HVD A;  4KU8 A;  3EMR A;  4M4P A;  4AXO A;  1VIW B;  4AQT A;  4NII A;  1UU4 A;  4YW4 A;  4H14 A;  1YQ8 A;  4QPG B;  4JKL A;  4AHZ A;  1CAV B;  2J42 A;  1PVC 1;  2VVF A;  3RZM A;  3A4U A;  4PI2 A;  3H7Y A;  1ENS A;  1G9F A;  4YZ4 A;  1YI9 A;  1BBT 1;  4WM7 A;  3TEZ A;  1I5Z A;  4IE0 A;  3CQO A;  4WM8 C;  4FPK A;  1AR9 1;  5L7O A;  4UBH A;  4OUS A;  4BQ3 A;  4IGQ A;  3AYD A;  4QGM A;  1QJU 2;  2CV6 A;  4V2V A;  5LK7 B;  3VDB A;  4JC1 A;  2GC3 A;  2VVE A;  3ILN A;  3NRU A;  1W6M B;  4HKO A;  4AEM A;  4FSJ A;  4QQP A;  4S2F A;  2FDK A;  1CAX A;  5K8S A;  1MS3 A;  1POQ A;  2Q8O A;  3PL0 A;  3QD6 A;  1SZB A;  1SLT A;  5BNN B;  1RUF 1;  4P9J A;  1CPN A;  1LED A;  1MS5 A;  5LAT A;  3NST A;  3DL3 A;  1BMV 2;  1OUR A;  4JQR A;  3FL7 A;  3NKT A;  4W50 A;  4OI2 A;  4OHW A;  2V4V A;  3OD0 A;  5FWE A;  5FXW A;  2EVX A;  1SLC A;  3ZVX A;  2VW2 A;  4IER A;  1V6J A;  2X09 A;  4L99 A;  3FX3 A;  2C4X A;  3HEI A;  1XYO A;  1A3K A;  2ZX2 A;  3AMQ A;  2A6Z A;  5FP4 A;  4JZR A;  1GZW A;  3IT8 A;  2UWC A;  2XKO A;  3ZX7 A;  4FPG A;  5K4L A;  3AM2 A;  1JOP A;  3K3O A;  3K4D A;  2A75 A;  2CU5 A;  4COW A;  3AZZ A;  5J96 B;  1ZYB A;  1PGS A;  2IVJ A;  1AL2 1;  3CO2 A;  2EXI A;  1WCD J;  2VQT A;  1OQD A;  1X8E A;  4QWN A;  1KIT A;  4BQW A;  1NQJ A;  1HRV 3;  1VBA 1;  5E89 A;  2HEV F;  1H2N A;  4FXK B;  4RHV 2;  1N3O A;  1VBB 2;  3C7O A;  1PK6 B;  4CCL A;  3TAY A;  4XW3 A;  4LNV A;  2AC1 A;  2P1B A;  2XJR A;  2VZU A;  2Y33 A;  4E4H A;  4CP9 B;  4ASL A;  3T0B A;  4HSL A;  2KM2 A;  3DKW A;  3FJS A;  4DXR A;  3GBW A;  3VBO C;  1UIK A;  1WD3 A;  4YAR A;  3NNJ A;  2ZX1 A;  4YG3 A;  1XNT A;  4DZG A;  2IUW A;  3C7E A;  2RR1 3;  1SPP A;  3WNK A;  2LRO A;  1RUC 1;  2XLF A;  2RMU 1;  1QOS A;  1DGW A;  1Y9M A;  3ZXJ A;  2A3X A;  3HBK A;  3MHZ A;  1BQP A;  1YWK A;  4XJ8 A;  3MIE A;  4UW6 A;  3VBO A;  3ATG A;  1QH6 A;  1RUH 1;  4RL7 A;  4LOS A;  5EV7 A;  4S2D A;  3I3D A;  4DB5 A;  3E5U A;  2LW8 A;  5DN2 A;  1H9W A;  1C3H A;  2QQL A;  3O0V A;  4LA2 A;  2OZ6 A;  3MEP A;  1MEC 1;  3WQB A;  3JQX A;  2BDR A;  2VNG A;  2XDV A;  3AP4 A;  4IEO A;  4JAA A;  4NR1 A;  2X05 A;  2PQQ A;  1BHG A;  4LBM A;  4DOU A;  5I0R A;  5J98 B;  5FZA A;  1P8J A;  4IUG A;  1JTZ X;  5GLU A;  1GQP A;  2W95 A;  3JCI A;  5CG8 A;  3GAL A;  1H6Y A;  1PIV 1;  2ZHL A;  4KWK A;  5C3R A;  2JDN A;  3MV0 1;  4LE4 A;  5FYI A;  5DAQ A;  1ZZ8 A;  4NWW A;  2WFF 2;  5CVR A;  4DIN B;  4NE9 A;  5F5Q A;  3AZV A;  5JR7 B;  1WLW A;  5EZW A;  5EYY A;  3VB9 A;  5FDB A;  5JXI A;  3UGG A;  2FD8 A;  2ZHK A;  3ZR6 A;  1ULP A;  2KXL A;  1NG0 A;  1VMH A;  4LXL A;  2PHW A;  1W8H A;  2I2S A;  3WDV A;  1D2S A;  1I6X A;  2JG8 B;  4DY5 A;  4B8E A;  4JV4 A;  4XUP A;  3BN6 A;  5F6K A;  4XIK A;  1SBD A;  5KHH A;  1J84 A;  2AGS A;  4P9L A;  3WP3 A;  1GUI A;  1UYX A;  1W9S A;  4NVP A;  2E63 A;  4K40 A;  1RXG A;  4KNC A;  3ORJ A;  1MQT A;  1SBE A;  5FRE A;  1AR7 1;  1UMZ A;  1Y9Q A;  5DZE A;  4KBZ A;  4QM9 A;  1GNY A;  2OPK A;  2ZXQ A;  2YBP A;  3CMG A;  5A6Q A;  2F17 A;  4ZU4 A;  1VBB 3;  1O91 A;  2R04 3;  1LAJ A;  4LHN A;  4R9A A;  2VZS A;  4FQZ A;  5FZ9 A;  2YFU A;  5FBJ A;  4CDU C;  5FZM A;  2ET1 A;  3BTZ A;  4I0A A;  4KG0 A;  3H1M A;  2WNO A;  3KV9 A;  4YGE A;  1H2K A;  1RUG 1;  2EXJ A;  5G04 L;  2ARC A;  3F2Z A;  4GB3 1;  4AZZ A;  2B42 B;  2E7A A;  3K2O A;  1F15 A;  4LK7 A;  4LO6 B;  5H9S A;  1BK1 A;  2C5D A;  4DS0 A;  5GZC A;  4CDU A;  1Q8Q A;  1SBF A;  2WL1 A;  1IS5 A;  1WCK A;  2ENR A;  1W6O A;  4UFM A;  1DZQ A;  1W90 A;  1XOY A;  1HLC A;  2HEY F;  1U5Y A;  2W87 A;  3N9M A;  4FI9 A;  3OY8 A;  4HK8 A;  1D4V B;  1U5Z A;  2OQ7 A;  3VD4 A;  3N9Q A;  3WNP A;  3TRS B;  5C4W B;  1XXN A;  5FR3 A;  4GJY A;  1VBE 2;  2VZQ A;  4E4S A;  2VCC A;  3AMM A;  1RGS A;  1CAU A;  3Q8E A;  3NAP A;  1LES A;  3QH6 A;  4GWI A;  5F5I A;  1QH7 A;  2LUW A;  4JGY C;  5F32 A;  5BNO C;  1YNA A;  3NVC A;  4R4X A;  4A2U A;  1UZZ A;  4P9W A;  4QKF A;  1QXJ A;  1SAC A;  2UY9 A;  4R4Z A;  3VHN A;  3ZFF B;  1GNZ A;  3FC0 A;  5DUU A;  2O14 A;  3CL1 A;  3QOP A;  3U10 A;  2WFF 3;  3O0W A;  4C1X A;  4CCO A;  1GMM A;  3DXU A;  1XE7 A;  3OGG A;  4AAP A;  4B1L A;  3TB0 A;  3BTX A;  1JYX A;  2BOI A;  3U4S A;  4YG0 A;  4QPI B;  5C3S A;  1GKB A;  4YPJ A;  1XND A;  4LKF A;  5A7P A;  2QZ3 A;  2WS9 2;  2QDN A;  1NE4 A;  3EQE A;  5ACA 2;  4E4D X;  4AQ6 A;  2FDH A;  1BXH A;  1HIX A;  2WNV C;  1O4Y A;  3OOX A;  3PUR A;  4FPF A;  4KWL A;  4RN5 A;  4XVH A;  3B5L B;  3LIG A;  3GZA A;  3U0Z A;  4M3C A;  3UJQ A;  1MZ6 A;  1UNB A;  3FLR A;  1K42 A;  4G9S B;  5F9T A;  1MZE A;  4QB1 A;  4AVS A;  3IM0 A;  4CA9 A;  1NE6 A;  5F5C A;  1COV 2;  4ES8 A;  5FP8 A;  2IFR A;  2O8Q A;  1S0E A;  2ZGU A;  2XUE A;  5FYZ A;  3RS6 A;  4XQW A;  1IKP A;  1DQ5 A;  1I9R A;  1LHN A;  4CEW A;  3MUY 1;  1RIT A;  3VKM A;  3WCR A;  5LA0 A;  1VPH A;  3ACI A;  3WF3 A;  4Z92 B;  4IEQ A;  3RJ2 X;  3HQX A;  1YRZ A;  3WX5 A;  1K3I A;  1QHD A;  4PDW C;  4QDS A;  3VHP A;  1BJQ A;  4LLO A;  2A6V A;  1BKZ A;  3WUD A;  1GBG A;  3KHC A;  1I5P A;  1RUD 1;  5DZG A;  1V6N A;  3DXT A;  2ZGM A;  2JDH A;  1W8Z A;  4I3G A;  1Z0H A;  1LOE A;  4PBO A;  1YQC A;  1CD3 G;  1HB3 A;  1UOG A;  4XDQ A;  5IFT A;  3POE A;  5F3I A;  4LTA A;  1VB2 A;  3O12 A;  4YM1 A;  2BPA 2;  2V5Y A;  4FT8 A;  1FYU A;  3BIW E;  1NX9 A;  1ALY A;  2ETE A;  1MEC 3;  1R08 2;  4AVA A;  2XBO 1;  5C9A A;  3TEY A;  2XQX A;  1CGP A;  4OI0 A;  4RR3 A;  2B46 X;  1UOJ A;  5DMY A;  4Q29 A;  5GLT A;  1MPX A;  5H9Q A;  4A44 A;  4GMP 0;  1C57 A;  1OBN A;  3NKG A;  3VBR C;  1J3P A;  3GYD A;  2R7E B;  1W6P B;  3U37 A;  4FPL A;  3GCX A;  5JWP A;  2DCY A;  5DQ0 A;  2UYA A;  3I2K A;  4LIT A;  5JIA A;  2C9A A;  5BUV A;  1UWW A;  5K0U C;  4TZD A;  5FBZ A;  4LUK A;  4A7Z A;  1N47 A;  1WLC A;  1IPS A;  1RUJ 2;  1PO2 2;  3VBR A;  3Q8F A;  1XBF A;  3AKS A;  5FK8 A;  2WWJ A;  3FMG A;  3K75 B;  2ZOE B;  3KB5 A;  4PJY A;  3V0B B;  2JG9 C;  4L0P A;  3RYR A;  3WHT A;  2DVA A;  1WME A;  1VB4 A;  3WOG A;  2QQP A;  1GZT A;  2HBU A;  2WS9 3;  3PUS A;  1FV2 A;  4AG4 A;  4XFF A;  4CE8 A;  1FNZ A;  4N90 A;  5ACA 3;  4LOR A;  2ZGT A;  3ACF A;  1OH3 A;  4RD7 A;  2QFE A;  2OX0 A;  1C8M 1;  2D7F A;  4BOW A;  5GZG A;  4JDO A;  1OH4 A;  3DYM A;  2ZKN A;  3RG0 A;  5EHD A;  5JPM B;  3ZKU A;  3DN7 A;  1KFU L;  1Q56 A;  3PLQ A;  5A7W B;  2ORZ A;  3AYE A;  1NLQ A;  4KU7 A;  2P37 A;  4AQS A;  2HH9 A;  1JI6 A;  1FOD 1;  2ZGO A;  1HXS 2;  3URF A;  3FBM A;  4BZ4 A;  4D6R A;  4DUX A;  4FTS A;  4Q4Y 3;  4NUB A;  3N7K A;  5JZG A;  1VMJ A;  3KHB A;  2NPI A;  1F5J A;  5IVB A;  4XAA A;  1RUG 3;  4XF9 A;  2VQA A;  3RPQ A;  4A3X A;  4OHY A;  1XNC A;  2QTW B;  3J7L A;  3VL9 A;  5L9R A;  1H1I A;  4CP0 A;  3SCG A;  3THT A;  4GB3 3;  4P5H A;  3A23 A;  5D21 A;  3WP6 A;  1DQ0 A;  1Q8S A;  3I2F A;  5AC9 2;  2YZ4 A;  2HWD 2;  4MYE A;  4AEJ A;  3L9J T;  1GWL A;  4Q4W 1;  4CCC A;  3RNS A;  2D6P A;  4OUL A;  3VBU A;  2PHX A;  3VDD B;  2YC0 A;  4AI1 A;  3WG2 A;  4ERO A;  4PF1 A;  1U5I A;  4ZXK A;  1QGL A;  2DCK A;  2GSY A;  1NY7 2;  1YI7 A;  2BEO A;  5CAD A;  2R07 2;  1QNY A;  4CCD A;  2WWS A;  4QT6 A;  1RC6 A;  1LHO A;  2VO5 A;  3RWK X;  3I2O A;  1VBD 1;  1X9T A;  2ZMN A;  3D4K A;  3HAG A;  5T5J A;  3ROU A;  5C6C A;  1ST8 A;  3WQ7 A;  3W5M A;  2HWC 1;  2XB6 C;  3VBS C;  1RUI 1;  4XFG A;  5K7P A;  4JRL A;  1CX1 A;  2A70 A;  4L92 A;  2HWB 2;  2WAB A;  1F31 A;  2ZGK A;  4JHZ A;  5CKM A;  1OT5 A;  5F3E A;  1JMU B;  5F8P A;  3ELN A;  1EP0 A;  4ATE A;  4FO9 A;  2OYZ A;  1CJD A;  1UYY A;  2G9G A;  2WNU B;  1JH5 A;  1DBN A;  4URA A;  4LKD A;  3PTR B;  5HXM A;  2FDG A;  3VBS A;  1X8M A;  1W2T A;  4Q4V 2;  3BOP A;  1ND2 C;  4NID A;  5C33 A;  3M3O A;  1ZBE 1;  1RUJ 3;  1PO2 3;  4RFR B;  1YQ2 A;  1D4M 1;  4LA3 A;  3R6S A;  1LOB A;  2F4P A;  3OBA A;  4A6O A;  5KXE A;  5CFD B;  1TEI A;  3GHM A;  4CXW A;  1NUK A;  2LTN A;  4XFI A;  3VZL A;  3C2U A;  3UK9 A;  4F83 A;  4BJ0 A;  1CAW B;  4QQO A;  3UKT A;  4KWJ A;  2WNE A;  1A8M A;  2MNG A;  2VOT A;  1MS8 A;  2IWG B;  3ABZ A;  1E5R A;  4CDW B;  5KXB A;  1DYP A;  4JGZ C;  4Q1P A;  5D8A B;  2W94 A;  4AI8 A;  3OGS A;  2WR9 A;  4EN0 A;  3VBF A;  3TNQ A;  3NL1 A;  5FZG A;  1HXS 3;  1SLA A;  4HK9 A;  4LIV A;  4QU2 A;  3UJO A;  3WIN E;  4YVW C;  4AK3 A;  4ASK A;  1HQN A;  1N1T A;  2XLA A;  3T2Q A;  3NV4 A;  4YRD A;  5AFB A;  1ULE A;  4QXB A;  2ZZQ A;  2G1M A;  5GLZ A;  2VTX J;  4E2S A;  1RUD 3;  4QGN A;  2QQW A;  4FTB A;  3GZT B;  4PCR A;  4ARX A;  1GP4 A;  3KT7 A;  3WHU A;  3OEB A;  1T6G C;  5FLH A;  2EIG A;  2R07 3;  5FO7 B;  2V72 A;  4ZZ8 A;  3ETQ A;  4OZO A;  2ZEW A;  1WMD A;  1OPM A;  3FWE A;  1ODN A;  4P5Y A;  2RM2 1;  2A6W A;  3MIF A;  5BPX A;  4XFH A;  3WG4 A;  1QKQ A;  1WCU A;  3JZV A;  1J1L A;  1BEV 2;  4I3P A;  4AW7 A;  1XE8 A;  1AL0 G;  5FUP A;  5FKB A;  3D82 A;  5T5L A;  3AFG A;  4GMP 3;  1ZRC A;  2HWB 3;  1W05 A;  3ZXK A;  1GNH A;  4HET A;  1TMF 2;  5FZO A;  2XJV A;  3W5N A;  3R0R A;  4RS5 C;  2A6X A;  1RIN A;  4RGA A;  1WLD A;  3PDQ A;  5FPA A;  3E6D A;  1NCQ B;  3OG2 A;  4XBQ A;  4Q4V 3;  2DCZ A;  1QMJ A;  3USU A;  1NZC A;  5FPB A;  3ES4 A;  2D97 A;  5JSO A;  1GV9 A;  4F3J A;  4ZHN A;  1FXZ A;  3CIH A;  2XVL A;  2I74 A;  2D98 A;  1AR8 2;  3KF5 A;  3WDX A;  4LHK A;  5E6H A;  3W21 A;  1XB9 A;  1G9A A;  2R6Q A;  4BXS V;  1JU4 A;  2ARE A;  1O8S A;  4NHL A;  1WD4 A;  4ZON A;  3QH7 A;  5LBF A;  2YV8 A;  4UFL A;  2VNV A;  4E9K A;  2JE9 A;  1FOD 3;  4YM2 A;  1NA1 B;  3VBH C;  2XGX A;  4IL7 A;  5CIS A;  2HWE 2;  5LBE A;  4Y1Z A;  2FMY A;  5FYU A;  2QJV A;  3NW4 A;  1EAH 2;  4XCB A;  2UWB A;  4EN6 B;  3MPB A;  4NHM A;  1OLQ A;  2OVU A;  4M3C F;  3AYA A;  3ZDS A;  4IEV A;  3LOB A;  2QUO A;  3K3N A;  4QX5 A;  3M8L A;  1H1A A;  3N9L A;  4Y3O A;  3CJI C;  1W8W A;  4HXC A;  3UGF A;  3ZIX A;  1OOP B;  4E8C A;  2JIJ A;  2EA7 A;  3O7O A;  4W65 A;  1ZA4 A;  1HRV 1;  1QEX A;  4EWD A;  2Y6G A;  4FPJ A;  3D6E A;  1R64 A;  1GP5 A;  4X8N A;  3H7J A;  3V0A A;  3FN9 A;  5A32 B;  4E8D A;  3SC7 X;  3CJI A;  4IV3 C;  2Y6F A;  5FZ8 A;  3H8X A;  1VBD 3;  3DPR C;  3BKZ A;  4YG6 A;  1C5I A;  2A73 B;  2P3Y A;  2CTV A;  2HWC 3;  4GAL A;  2OPW A;  2WT0 A;  4GZ9 A;  5JXJ A;  1BEV 3;  4YLZ A;  1JS9 A;  1QJE A;  3MFC A;  2CGN A;  3WW4 A;  1F9K A;  1Q8P A;  3MLL A;  4KQ7 A;  3W20 A;  3BTA A;  4N43 B;  3WG3 A;  1VBC 2;  1H6X A;  4Q27 A;  4CXY A;  2RR1 1;  4MOA A;  4QDQ A;  4DIQ A;  2B7Y A;  2Y0I A;  3DPR A;  4OCT A;  4HKW A;  3OYW A;  2ZTN A;  4PF5 A;  4GJZ A;  1TMF 3;  4NRQ A;  1UU6 A;  2FCT A;  2VG9 A;  3PU8 A;  5A6Z A;  5FAX A;  1LOD A;  1QJU 1;  5FYT A;  1OFS A;  4XIO A;  1AYM 2;  4ISQ A;  3ACH A;  4QGL A;  4LJH A;  5CKQ A;  1NCR C;  4SBV A;  3S5A A;  3LEG A;  4IES A;  4OI1 A;  4CCK A;  3IAP A;  2ZPX A;  4BYY A;  3M7A A;  4NPR A;  3IN9 A;  5JLV A;  3M2M A;  3WUC A;  3LSD A;  1AR8 3;  5GJ6 A;  4HBN A;  4OQ9 A;  5C3P A;  1LB2 A;  5I91 A;  1URX A;  4CEY B;  1HQW A;  2MHF A;  4XOG A;  1ND3 C;  1NCR A;  1D0H A;  3KVB A;  2WYS A;  3OD4 A;  1W99 A;  1QDC A;  1LOC A;  2VCB A;  1H4G A;  2GP3 A;  3UET A;  5LA9 A;  1SLL A;  2E7Q A;  1AYN 2;  1R1A 2;  3JUU A;  1WMX A;  1QXP A;  2PLV 2;  2W08 A;  3P3P A;  2Y64 A;  5CNA A;  3SH5 A;  1DQ1 A;  4DNY A;  3I2I A;  1W0O A;  2HWE 3;  5C8C B;  1W3X A;  1ND3 A;  2BNN A;  4NN0 A;  4WVV A;  1EAH 3;  3AMN A;  3DCQ A;  3LSE A;  4Q26 A;  5BNP B;  4QM8 A;  1XRU A;  2D5H A;  5ABJ C;  4WV8 A;  5L73 A;  4YVS B;  3S7I A;  3ZN6 A;  1OA2 A;  3J9S A;  2GDF A;  3UES A;  3VHO A;  2JE8 A;  4UW4 A;  4NPL A;  4HPK A;  3CU7 A;  3I2G A;  3S0M A;  2X5I C;  4YZ1 A;  2AEN A;  4CUC A;  3ZFE B;  1W2A X;  4OHZ A;  1OQE A;  2YBK A;  2V4A A;  4K9S A;  4BLJ A;  2G9Z A;  2XKP A;  2CDO A;  2GU9 A;  2DVD A;  2VAU A;  3ST7 A;  4J1X A;  4CP1 A;  4IE5 A;  4RHV 1;  2RVA A;  1UPI A;  1VBB 1;  4CRQ A;  2EIB A;  4LQR A;  5EJ3 A;  1KXG A;  1NLR A;  5CFC B;  3ACG A;  3WNX A;  4P02 B;  2VGD A;  3PUA A;  5L7O C;  3ES1 A;  4YZ5 A;  3AMH A;  2WC2 A;  2ZX0 A;  5HCF A;  1YQ5 A;  3SH3 A;  4K8R B;  4QX8 A;  5FPX A;  1E5S A;  1AX0 A;  1VBC 3;  1WCQ A;  2CAV A;  2BBA A;  4Z8B A;  4XUO A;  3WDW A;  4DMI A;  4OYU A;  2D93 A;  2A7A A;  4AVC A;  2VW0 A;  1NXD 1;  2XH6 A;  1UIJ A;  4XBL A;  2ES3 A;  2WZR 2;  2D6L X;  5IVC A;  4CTE A;  5CIR A;  3DF0 A;  3I2J A;  1DGR N;  2VCA A;  3USS A;  4LEJ A;  1RJ7 A;  3PNA A;  3N9O A;  4QPG A;  4B29 A;  1CAV A;  1UYZ A;  4FFF A;  3H8U A;  4HKL A;  1ULD A;  4IV1 C;  4LPL A;  1BVP 1;  2G19 A;  3VV1 A;  4FFG A;  4AVT A;  2VCM A;  3JU9 A;  1GSL A;  4YW6 A;  3PUH A;  2R32 A;  2IXH A;  3WQ1 A;  2OQ6 A;  3QAC A;  4BH9 A;  4WM8 B;  3G7D A;  3HQU A;  5F5A A;  3ZSM A;  2E6V A;  5KC5 A;  3H42 B;  1M4W A;  2QQV A;  2R16 A;  2A6Y A;  2P3K A;  5A7Q A;  3I3E A;  4BB3 A;  4IV1 A;  4D7Y A;  1GR3 A;  3LD8 A;  5C3O A;  1HN0 A;  1W6M A;  4XUN A;  2WA3 A;  1J3Q A;  5KHI A;  1R09 2;  3B9I A;  5LEK A;  1W2N A;  3RI9 A;  4WVM B;  2WFF 1;  1AYN 3;  2QQI A;  2YRO A;  3FUO A;  5FXV A;  2PLV 3;  2CY6 A;  4XJW A;  4AI2 A;  4IGP A;  5BNN A;  4EN8 B;  2JDM A;  2X8K A;  2FZ2 A;  5SV5 A;  3WZ1 A;  3J26 N;  4IDZ A;  4XJU A;  5FFO C;  1QF3 A;  1HKD A;  1PMJ X;  5FKC A;  4LT5 A;  5EXO A;  3HNB M;  5FYC A;  2NN8 A;  1HB1 A;  4DEV A;  4EWE A;  1JU3 A;  3AVS A;  4JKK A;  1UY4 A;  5AVA A;  1W9W A;  1SG3 A;  3MDP A;  5A3N A;  1SFY A;  2PEL A;  2UUR A;  4K1Y A;  4Y5S A;  4IXL A;  2NQY A;  2Q0A A;  5FQ0 B;  4CSW A;  4HOO A;  2AR6 A;  3ZYH A;  1ASJ 2;  1QJF A;  2E32 A;  4CCM A;  4BCU A;  1KQR A;  1Y7B A;  4B1M A;  4L8Q A;  4BMB A;  3E6C C;  4CDX B;  1XNB A;  3TOJ A;  3RZZ A;  4ZY9 A;  1JYI A;  1FMD 2;  3FHQ A;  3MO4 A;  4HN1 A;  5T3N A;  3M70 A;  4AI9 A;  4QQL A;  3D0S A;  2D3R A;  3ZPY A;  1JZ2 A;  1VR3 A;  1KRI A;  1UZY A;  3B9C A;  5F2S A;  3EYP A;  5I93 A;  3OGJ A;  4G3Y C;  4K8F A;  1Q3E A;  1OUX A;  1L7L A;  2VH9 A;  3NNM A;  4D94 A;  4XFC A;  1LGB A;  3D0J A;  1PK6 A;  4MUV A;  3O5S A;  4C91 A;  1H8V A;  2VZR A;  3LAG A;  1AR6 2;  3K4Z A;  2K2S A;  1GP6 A;  2LRP A;  2Y6L A;  2ZZJ A;  4R9D A;  2PAK A;  1ACC A;  3MUZ 1;  4CP9 A;  2ZEZ A;  1QJU 3;  4NHX A;  2BRT A;  3RRD A;  5HCA A;  1AF9 A;  3AL5 A;  4BLI A;  2CAU A;  4QXC A;  2ZBJ A;  3U78 A;  2OKX A;  1JZ3 A;  2RS1 2;  2XOM A;  1PO1 2;  2J1U A;  5FLI A;  3WNL A;  5IT6 A;  3PMS A;  4DUV A;  5EFU A;  5JOY A;  1FPN 2;  4C0H A;  2IXL A;  4CU9 A;  1X36 A;  1YFU A;  4BQY A;  3BYW A;  2V5D A;  4MVT A;  2RJ2 A;  3J4U H;  1X9P A;  1HJF A;  2RDS A;  4PIY A;  4BM8 A;  4HVO A;  1IPJ A;  3IIA A;  3RWN A;  1IQD C;  1Z7S 2;  2SLI A;  5T55 A;  5JOZ A;  3E97 A;  5ANN A;  1R09 3;  1V9U 2;  2D3P A;  3DGT A;  5JOX A;  2VMD A;  3H3L A;  4XJZ A;  1JYC A;  4QB2 A;  4LKS A;  3ON7 A;  4MV2 A;  4GKY A;  4QKD A;  3AKT A;  1YEW A;  1YFY A;  4Y22 B;  1MQT C;  3SLI A;  1RUF 2;  3LQC A;  4AHX A;  4LBL A;  4COZ A;  4Y1Y A;  3AJZ A;  2CGP A;  2VMG A;  1AXZ A;  4M0N A;  2H0B A;  4K21 A;  4W6Y A;  1GIC A;  5A3P A;  3AKQ A;  4AFA A;  4YFZ A;  5LB6 A;  4Z1V A;  4YFW A;  4ZU7 A;  2V73 A;  5FYB A;  2WS9 1;  1PMH X;  1RED A;  3LPG A;  3VKL A;  2RS3 2;  1C28 A;  4MZU A;  5ACA 1;  1UZ0 A;  5IAT A;  3W9A A;  3UKN A;  1DF0 A;  4DEQ A;  1GFF 2;  1V00 A;  2B8M A;  4QPW A;  2AH2 A;  1DIW A;  4FBF A;  1U12 A;  3WP4 A;  1OA4 A;  3U75 A;  5E88 A;  1XQN A;  4RHV 3;  1V6O A;  1GWM A;  1LEM A;  2JG8 A;  1N1V A;  1ZZB A;  3OTF A;  4GAZ A;  4KH9 A;  4TYS A;  1B35 B;  2ZAH A;  4XBN A;  1COV 1;  4LO4 B;  1RHI 2;  4WZF A;  4Q0P A;  2R1D A;  5DUV A;  2K0G A;  4Q4Y 1;  1NXM A;  5FZI A;  3OCP A;  4CXX A;  5JXH A;  1POV 0;  1HV0 A;  2BUK A;  2ZA9 A;  4DXZ A;  4ZU5 A;  5FY8 A;  4RFT 0;  1POV 1;  1UPS A;  1XPW A;  1Y4W A;  2YB7 A;  2WAO A;  3BU7 A;  3I97 A;  1DYK A;  4MGY E;  1UXX X;  3RYP A;  4ZXE A;  1OVS A;  1RTV A;  2J1S A;  4EE2 A;  3H3Z A;  4XMA A;  3GBF A;  4DO0 A;  3ZOI A;  3KCY A;  1AR6 3;  2XUM A;  5CYY A;  2R30 A;  5FZB A;  3NAP C;  3WNM A;  4B4R A;  4HZF A;  1D0G A;  2JE7 A;  3GM8 A;  5J09 A;  4I02 A;  2WLQ A;  4CDU B;  4D6S A;  5L19 A;  3OSD A;  1RUO A;  4A41 A;  4NO4 A;  5F6L B;  1ZZC A;  1J58 A;  4FPH A;  3MI8 A;  3AKR A;  2WO1 A;  3VDA A;  2W5F A;  4O61 A;  4UXA A;  5FZ1 A;  5HV0 A;  2RS1 3;  5KBF A;  1IS3 A;  1PO1 3;  3A22 A;  1RMU 2;  4NHY A;  1VP6 A;  3HD8 B;  2WO7 A;  1QY4 A;  1R08 1;  1FPN 3;  5FY0 A;  1RUC 2;  3P6B A;  5FZF A;  3I2H A;  5EJZ B;  3ZMO A;  2RDR A;  2TEP A;  1G8W A;  4V1P A;  3B00 A;  3SEP A;  4DXS A;  2BTV C;  2BWA A;  3I54 A;  4NIA A;  2VC9 A;  2E33 A;  2PMW B;  1UD1 A;  3OBZ A;  5FP7 A;  4NMI A;  3PME A;  2VMC A;  4BK4 A;  1TME 2;  1WLT A;  5EQU A;  5BYN A;  2PHL A;  3MLJ A;  3H1Y A;  1Z7S 3;  2BVB A;  3ASI A;  1CZS A;  4FFH A;  1WA6 X;  4ORF A;  5GLV A;  4AWD A;  1V9U 3;  2DV9 A;  2Z42 A;  5T5P A;  1YXW A;  1IGO A;  1UN1 A;  3BOW A;  4AYU A;  3I3M A;  5A33 B;  1BYH A;  4UBG A;  5HPO A;  1RUJ 1;  1PO2 1;  2VM9 A;  3L2H A;  4UI9 L;  5IVY A;  4QX0 A;  4Q5O A;  1UCX A;  4JGY B;  4B7E A;  1GYK A;  5BNO B;  5FOJ B;  2W47 A;  3ZM8 A;  3ZFF A;  1K12 A;  1I3H A;  5C4W A;  4ZS3 A;  4CCN A;  4R9B A;  1XNA A;  5A7N A;  3IKW A;  3ZN4 A;  5CB7 A;  2WII B;  2PAE A;  2E51 A;  5A7S A;  1HX6 A;  4CEW C;  1L3J A;  4GH4 B;  4XXA A;  4A45 A;  1LGN A;  4X6Q B;  3SMH A;  1YIP A;  2EXK A;  2XJS A;  1W2O A;  4Z82 A;  1PGL 2;  4K7J A;  4LE3 A;  5GM0 A;  3NJX A;  2PN5 A;  3O14 A;  1NQD A;  1PGW 2;  2C26 A;  1HXS 1;  3GNE A;  2CSG A;  2WNV B;  2W1U A;  3MID A;  2C6S A;  2O1Q A;  4YGD A;  3WF2 A;  1QOT A;  4XYX A;  5DAV A;  2DCT A;  3AYC A;  2BZD A;  3HPN A;  4W6X A;  3KM5 A;  4MHR A;  2JB4 A;  2YHJ A;  3B94 A;  4AI0 A;  2D6M A;  2MPF A;  2EIC A;  2VNR A;  5AC9 1;  4LO5 B;  1W9Y A;  1N3P A;  2DWR A;  2EAK A;  2GP5 A;  3M3E A;  4NOT A;  4QHB A;  4XPV A;  3T4V A;  3M1H A;  5C9A C;  4RR3 C;  2O8O A;  1LJ7 A;  1NOV A;  4MET A;  4LKE A;  1NKG A;  5IHR A;  1XNK A;  4YZ3 A;  4K20 A;  2R07 1;  3MPP G;  4AQ2 A;  3SXW A;  1LOA A;  2WZP P;  1RMU 3;  3AZW A;  1VBE 3;  4Q0S A;  4PDW B;  1HRI 2;  3POJ A;  2QCS B;  2OW4 A;  1LOF C;  3SIT A;  1JHJ A;  4D8M A;  5CA6 A;  4K1Z A;  1O5L A;  3OPT A;  4C0B A;  4ZZ5 A;  4GMP 1;  2J1R A;  3THP A;  2HWB 1;  3ZSK A;  4AR2 A;  5IAX A;  1JZ7 A;  2HJI A;  1W6N B;  4BPZ A;  2YU1 A;  4QX2 A;  4IEZ A;  3PVO A;  3WNN A;  4GKX A;  1S0I A;  3IDC B;  3LPF A;  4CZS A;  3F95 A;  3R4D B;  2NP0 A;  1OLM A;  1YYN A;  4MGT A;  5E16 A;  1LOF A;  3TN9 2;  2B5H A;  1GWK A;  1W04 A;  3PJQ A;  1GOH A;  4Q4V 1;  1DZT A;  1PM7 A;  1S0J A;  2R1B A;  4LBO A;  1NT0 A;  4I0B A;  5JUV A;  1GOG A;  1QU0 A;  1W6P A;  3HWJ A;  4O65 A;  4RA0 A;  3VBR B;  1UXZ A;  4MGZ E;  5LA1 A;  3HNY M;  1QJX 2;  1IHM A;  3MV1 1;  4XJ9 A;  1REF A;  5FXX A;  1MS1 A;  3C7F A;  4XEZ A;  3LA2 A;  1APN A;  1KFX L;  3A0K A;  2DBI A;  3IDB B;  3V65 A;  3VKO A;  5JZG C;  5K0U B;  1UU5 A;  2IXK A;  1VAM A;  3RYK A;  5IK7 A;  3T1M A;  1HJG A;  2JJ6 A;  4RYD A;  1XYN A;  5HCB A;  2JEN A;  1DYO A;  4QB6 A;  4MH0 E;  4KGG A;  4UOJ A;  1OKQ A;  1W0N A;  3V0B A;  1DQ2 A;  3HIF A;  2JG9 B;  4IE6 A;  2XXZ A;  1COV 3;  4OHX A;  1JZ5 A;  1JYT A;  1XSQ A;  2VMH A;  5D1I A;  5JAX A;  4X8P A;  2PHU A;  2YDE A;  2WSU A;  3VBU C;  4XTP A;  1RB8 G;  3PVN A;  1DLL A;  4L97 A;  4CYD A;  5BNQ A;  4XF0 A;  4GWM A;  4BE3 A;  2DBN A;  1GQG A;  1X82 A;  1POV 3;  2J1A A;  5EYX A;  1PHM A;  2YMZ A;  3FHI B;  3LFI A;  3Q8C A;  1QJY 2;  2Q1M A;  3ZYI B;  2B9V A;  3E1F 1;  5FOB B;  3VZJ A;  5A7W A;  3NNG A;  3O1T A;  1OKO A;  3RGB A;  4Y33 A;  2X29 A;  1OF3 A;  3T4H B;  2CHH A;  3E5X A;  1W8T A;  5DAB A;  1JZ8 A;  1ODM A;  5DAP A;  1KGY A;  3AX4 A;  2VQU A;  3KV6 A;  1QQP 2;  3ZKY A;  1LHU A;  5F7U A;  2OT7 A;  2WDB A;  3K46 A;  1R08 3;  5A3M A;  1F2N A;  1W8N A;  4K3U A;  3SH4 A;  5FZH A;  5J1X A;  2W52 A;  5FZE A;  1YJL A;  1BEV 1;  1HRI 3;  3KWV A;  2QQM A;  3KZ4 C;  1BCX A;  5AVP A;  5IK5 A;  1N1S A;  3U14 A;  5GZF A;  4C1W A;  5FJH A;  4E4Z A;  1F5F A;  4UWD A;  1RVF 2;  4XHB A;  4QAW A;  3T2O A;  1XU2 A;  1ZBA 2;  3POG A;  2ID4 A;  4ASM B;  4BME A;  1TMF 1;  2HBT A;  2GNT A;  2WWU A;  5DG1 A;  4Y20 B;  2TNF A;  5FP9 A;  3ZPO A;  5FLJ A;  3I8T A;  5F1R A;  1CWP A;  3J8F 2;  3BIE A;  1LU2 A;  1VAV A;  3TN9 3;  3VBS B;  3EHK A;  5EWS A;  1UY2 A;  2VY0 A;  5EP9 A;  1TQ5 A;  3HBZ A;  4IQP A;  3WD5 A;  1IS6 A;  2GAL A;  3ZN5 A;  1QXR A;  1D2Q A;  3VKF C;  5A1L A;  3H0O A;  3ETP A;  3SNM A;  3VBF C;  1ULF A;  3PVE A;  1QJX 3;  1AR8 1;  2YC4 A;  2WNU A;  2VBB A;  2K46 A;  2XL7 A;  4FFI A;  3VD9 A;  3O1U A;  2W68 A;  2IZW A;  3KV5 A;  2VUL A;  3CF6 E;  2VME A;  5JMC A;  5JPN B;  3NV2 A;  4IEY A;  1ND2 B;  3IPV B;  4R52 A;  4FCA A;  1EV1 2;  2VBD A;  4FXG B;  3AKP A;  1ZNP A;  2WA4 A;  2Y8K A;  4YZ2 A;  3AFK A;  5D8A C;  3POI A;  4D7S A;  5L9B A;  5CFD A;  2DUO A;  3CZJ A;  1BZW A;  1OQ1 A;  4J1W A;  3FLP A;  4QPY A;  1CAW A;  2ZML A;  2HWE 1;  4A7Y A;  2Q5T A;  1ONA A;  2OA2 A;  5A3L A;  1EAH 1;  5TSW A;  1DZR A;  5M0T A;  4AGV A;  2W39 A;  5B4N A;  4CDW A;  2XPJ A;  2YU2 A;  2YG0 A;  4XF4 A;  5D8A A;  1UZW A;  4BQ2 A;  4JGZ B;  1LUL A;  1QJY 3;  4HLT A;  1H2M A;  3HQR A;  4XQ4 A;  5AC9 3;  2E9Q A;  2E31 A;  3GDB A;  2HWD 3;  4YWA A;  1DGR A;  4YM0 A;  2GME A;  2ZX4 A;  1S4C A;  2TUN A;  1KDM A;  3III A;  2B4K A;  2WZ8 A;  1GLH A;  3VD3 A;  1W6Q B;  3E5Q A;  1CN1 A;  4YVW B;  3CNA A;  2XON A;  5FMC A;  4UF0 B;  2R0F A;  1X50 A;  2BER A;  2ZEY A;  2QQJ A;  1IOA A;  4OI4 A;  2FCU A;  3WXP A;  4P00 B;  3T2P A;  2ZCW A;  5C3Q A;  2HWF 2;  4E2G A;  4A7K A;  3KCX A;  5E8A A;  1A34 A;  4I2O A;  2GAU A;  2VR4 A;  3KSC A;  4Q4W 2;  5FCC A;  2J22 A;  3ZR5 A;  2AYH A;  2BQP A;  1VBC 1;  1V6I A;  4Y1U A;  1RVF 3;  2PXJ A;  3GXU A;  4OFG A;  4P9I A;  4AE2 A;  4BQ4 A;  1EYB A;  5FXZ A;  1SEF A;  1ZBA 3;  2WO3 A;  2XLG A;  3N36 A;  5FY9 A;  2UY8 A;  1XSR A;  1JHN A;  3CKH A;  1G6N A;  3N9P A;  3J8F 3;  1LU1 A;  3JBG 2;  3BAL A;  1AYM 1;  5DUW A;  5FUI A;  3MBW A;  5EIY B;  2FDJ A;  2JXA A;  4H7M A;  4XC9 A;  2P4E A;  2HYK A;  3T08 A;  3VZN A;  1G9B A;  4EN9 B;  3ILF A;  4D3W A;  1FX5 A;  1Y3T A;  2HYX A;  1MS0 A;  1CJP A;  5APA A;  4BDV B;  4YYO A;  2RG4 A;  4RS5 B;  1AHS A;  1IQA A;  1NCQ A;  1SFN A;  1RXF A;  4XUT A;  1TG7 A;  4XF1 A;  1CZT A;  1VAL A;  4EQV A;  2YGM A;  1EV1 3;  2EAL A;  2JWP A;  3NV3 A;  1Q5O A;  4YW3 A;  1ZRE A;  1F35 A;  1W03 A;  3KT1 A;  2VZP A;  4ITC A;  2YYO A;  4XE9 A;  1AUY A;  1AYN 1;  1R1A 1;  1QIQ A;  1SLI A;  3JQW A;  1WBF A;  3GF6 A;  4OZX A;  2EAA A;  3CEW A;  1YQ6 A;  2PLV 1;  2P6H A;  4AI3 A;  4N53 B;  2JKB A;  5D2A A;  3D8C A;  3IMM A;  3VDC A;  3HN1 A;  4LBN A;  3BTY A;  1WW4 A;  3PIG A;  5HBA A;  4PLM A;  2A3W A;  5DDJ 2;  4FPY A;  1O3S A;  4Y5Z 0;  1ULG A;  1UL9 A;  2NLR A;  2XL9 A;  3ZXG A;  1JYV A;  4U36 A;  1WZX A;  5IAV A;  1UMI A;  1NA1 A;  3VBH B;  3WG1 A;  2BNO A;  4MHU A;  3I59 B;  2VZT A;  3LDB A;  5F39 A;  1DFQ A;  2YUE A;  3WF0 A;  3RZG A;  3VZO A;  4DQA A;  5I0D A;  4O7X A;  5FRA A;  4Q8K A;  4E27 A;  3KMH A;  2DVG A;  4NJ4 A;  4W6W A;  1OVP A;  2G4I A;  2VUA A;  2ZAC A;  4Y4R A;  3LEK A;  3RFR A;  4M3C E;  1O59 A;  3SEE A;  1S55 A;  2EF6 A;  3CJI B;  3LIH A;  2ZAB A;  4WBB A;  3PIJ A;  1O4T A;  3OGR A;  1JOD A;  1OOP A;  4QKB A;  4BQ5 A;  1ZRI A;  5T54 A;  1US2 A;  2IXI A;  3W58 A;  4LK6 A;  4FOY A;  4LBK A;  2QVS B;  1X7N A;  4CU6 A;  4DUW A;  2IVI B;  3QBQ A;  2XWB B;  4S2H A;  1PZ8 A;  2DUP A;  4PQ9 A;  5BXX A;  2JDY A;  5A32 A;  3N7J A;  4BK5 A;  2CNA A;  3MW3 A;  4KL1 A;  4IV3 B;  1WCS A;  2GC1 A;  3BCW A;  3DPR B;  3H1W A;  4AED B;  1SMV A;  1WUV A;  3OYW B;  4CVU A;  1FAT A;  2JKX A;  2DTY A;  1IZ3 A;  3BPS A;  4TTG A;  2PHT A;  3PUI A;  2WJS A;  1UAI A;  1F4H A;  2WZR 1;  1D7P M;  2XJT A;  3NNF A;  4LBQ B;  1MVQ A;  3FLT A;  4XJA A;  3QCW A;  3D5O A;  4N43 A;  1HB4 A;  5FP3 A;  1W8O A;  5FY4 A;  1VLN A;  1IKQ A;  4RSU A;  1J3R A;  1STM A;  1GAN A;  2VTF A;  4IEW A;  2D43 A;  2GH2 A;  4A3Z A;  1LEN A;  1SLB A;  2ILM A;  4MXW B;  5KXD A;  4JHT A;  2BGP A;  1YLL A;  1W2U A;  2ET7 A;  1BMV 1;  1JUI A;  1Q43 A;  2WQ8 A;  3WW3 A;  3ZFG B;  3ZYB A;  1UX6 A;  4GIQ A;  4D0Q A;  3K51 A;  3LEI A;  4Y4Y A;  1XU1 A;  3PU3 A;  3IBM A;  1NCR B;  1UOB A;  3WDY A;  3IWZ A;  4U2A A;  3IB3 A;  4XET A;  5FZC A;  3RMX A;  1R09 1;  3NWK A;  1AZD A;  2PHF A;  2OS2 A;  2OUJ A;  4J6G A;  1W8F A;  3WVJ A;  1OD3 A;  1U5X A;  3HR9 A;  4J25 A;  3O1O A;  2EXH A;  5C7G A;  3GBG A;  2C0Z A;  4XXP A;  2JDP A;  3KQ4 B;  4CEY A;  2YPJ A;  1AJK A;  1Y43 B;  3THD A;  2WAA A;  1YFW A;  4Q1R A;  4RQP B;  2Q8C A;  2XJP A;  1W9F A;  4UW3 A;  1H30 A;  2NM1 A;  1ULO A;  2VZ1 A;  4TLF A;  2Y34 A;  1VRH 2;  2JIG A;  2ARB A;  4FQ4 A;  1H9P A;  1LKN A;  2YY1 A;  3E6B A;  4FP2 A;  3ZFE C;  5C8C A;  4O9E A;  4BXF A;  4X6R B;  5FZL A;  4I30 A;  3MIH A;  5A6Y A;  1ASJ 1;  2PA7 A;  3OPZ A;  5BNP A;  1V6L A;  4PQQ A;  4XIL A;  1YFX A;  5ABJ B;  4YVS A;  4CDQ C;  4NRO A;  1H8T B;  5ISL A;  1OLR A;  3S7E A;  1RL3 A;  4EZ4 A;  2SBA A;  4IE7 A;  2W46 A;  4QMA A;  1K5M B;  1OHF A;  4M0H A;  1WW5 A;  2YFZ A;  2X5I B;  3ZFE A;  1E57 A;  3I2D A;  4HT1 T;  4YW1 A;  2Y6J A;  5FUN A;  5LEJ A;  4CUA A;  1UY3 A;  4QPG C;  4YM3 A;  5FY7 A;  1S0F A;  4F8A A;  3ECQ A;  2W9X A;  2DVF A;  3WEZ A;  1OF4 A;  1LR5 A;  5J37 A;  4CDQ A;  2IC1 A;  2RS5 2;  3SIS A;  4XAE A;  2VXJ A;  1N1Y A;  5FMO S;  3ZYF A;  5FMD A;  3VHR A;  3I3Q A;  1AR6 1;  3P1I A;  4WM7 B;  5CFC A;  1W06 A;  1S0B A;  5L7O B;  4E2Q A;  5FPU A;  5JR2 A;  2W1S A;  4DRR A;  1AYM 3;  1PM4 A;  2QDR A;  4N9I A;  1W9T A;  1OFN A;  4UT5 A;  5DAW A;  3U4X A;  3U11 A;  4AVV A;  5ANQ A;  2RS1 1;  1YHF A;  2L9L A;  1PO1 1;  3LF7 A;  4MO3 M;  4OUE A;  5I8S A;  1HB2 A;  4RGK A;  1O5U A;  2WLP A;  4QQ2 A;  1CAX B;  2ERF A;  2RR1 2;  3R4U A;  3ZO0 B;  1FPN 1;  4A42 A;  2Q4S A;  2DTW A;  3WSO A;  1UF2 C;  5I0S A;  3TNP B;  1K5J A;  3B02 A;  1LEC A;  5BNN C;  1RYY A;  3OBR A;  3A0N A;  3P5B A;  4OMC A;  2O0O A;  4R8H A;  3TEX A;  3T09 A;  2ARA A;  1IPK A;  1A6C A;  1KS5 A;  3NQH A;  3TBD A;  5IYY A;  4QXK A;  3LB9 A;  4S2G A;  1Q8O A;  1W0P A;  4Y26 A;  4IV1 B;  1Z7S 1;  2D5F A;  3WF4 A;  3SCF A;  5FYM A;  1R1A 3;  5SV8 A;  3RMY A;  1V9U 1;  4I09 A;  1UOF A;  5C71 A;  2VL4 A;  1HW5 A;  3UGH A;  5J36 A;  2W1W A;  4A4A A;  4WM8 A;  5FK7 A;  3DEC A;  2OXB A;  1ZRR A;  4LLF A;  4B4Q A;  1GZW B;  3I49 A;  2R06 2;  2NMN A;  5CEH A;  1GQH A;  2BFU S;  2MEV 2;  1GZC A;  4PI0 A;  1SCR A;  2WN3 A;  3AZY A;  3SKV A;  3VL8 A;  4AF9 A;  5A6X A;  1OC1 A;  1RIR A;  1RUE 2;  3O1M A;  1JOB A;  4AGR A;  4WVM A;  3EO6 A;  2RS3 1;  4XAB A;  3INA A;  4IEX A;  2XQR A;  2DFB A;  2DUQ A;  4HN0 A;  1VRH 3;  3KCC A;  4AEK A;  4W4Z A;  1NLS A;  5FV3 A;  5JDB A;  4P9G A;  2WT1 A;  3MIC A;  2UU8 A;  3JB4 C;  4OQ8 A;  5IUQ A;  1PK6 C;  2DYC A;  2Y38 A;  4FPO B;  3KVA A;  4Q4X 2;  1Y9G A;  1RHI 1;  2JDA A;  3C7H A;  4IET A;  4CDX C;  2H0V A;  3JD7 2;  3THC A;  5FPL A;  3TWI A;  4N8M A;  4QHO A;  4QX7 A;  5DXD A;  5KWR A;  4NAO A;  4GQ7 A;  3GJB A;  1KEX A;  5J7M A;  2DU1 A;  2FZ1 A;  5FQ0 A;  2WN2 A;  1QNW A;  3LOI A;  3NJZ A;  1X33 A;  3A7Q A;  4QDR A;  1NAE A;  4GWN A;  4JTO A;  4KBB A;  4LOT A;  4Z07 A;  3DV8 A;  1W28 A;  4MXV A;  4BA6 A;  2J1T A;  1SPP B;  1DP0 A;  2RS5 3;  2ADE A;  4CDX A;  1VRB A;  2Y6H A;  3BUC A;  1XJA A;  1HN1 A;  3RJR A;  1JN2 P;  2EID A;  1O7F A;  2R04 2;  5FYV A;  3OB8 A;  1SFP A;  2NMO A;  3DKQ A;  2E7T A;  2WZR 3;  5LBC A;  1G7Y A;  2G9F A;  3VBO B;  3KGL A;  4WVZ A;  1O3T A;  1AJO A;  1FNY A;  1YIF A;  1KJL A;  1PVC 2;  2XJU A;  4ONU A;  4PT6 A;  4QXH A;  4XQD A;  5FZD A;  1RMU 1;  1VBE 1;  2GC2 A;  2Q1Z B;  1BBT 2;  1CVN A;  3WW1 A;  2R0H A;  1MAC A;  1EPZ A;  3R4S A;  4NHK A;  5LY1 A;  1OPO A;  1AR9 2;  2GND A;  4RGG A;  4TWT A;  1VMF A;  1O4Z A;  4XZU G;  4XTM A;  4NIG A;  1LNS A;  4CPB D;  2VQ0 A;  2IXJ A;  4CCE A;  4IW3 A;  1TME 1;  2JEC A;  2J7M A;  1RJ8 A;  5GKA C;  2WFP A;  2YGL A;  4IEU A;  3T30 A;  3UT0 A;  3JB8 A;  2AUY A;  1CX4 A;  2BNM A;  2Z4F A;  1B09 A;  2DDU A;  2OUH A;  4LIU A;  3RZJ A;  2I45 A;  4LBQ D;  1TZO A;  3C3V A;  5LAS A;  2P6C A;  2BP6 A;  2B39 A;  5FZ0 A;  4QX3 A;  1YC6 1;  2VPV A;  4MGI E;  4OHV A;  4LBJ A;  5FZK A;  2R06 3;  5L36 A;  3O1R A;  2W0X A;  2GH8 A;  2MEV 3;  2JG8 C;  3BOD A;  5C70 A;  4FOQ A;  5A1F A;  2GN3 A;  1RUE 3;  1ZZ6 A;  3BU0 A;  1PMI A;  1S0C A;  2AEY A;  2YXS A;  3FFZ A;  1OA3 A;  3MF9 A;  4HSJ A;  4CUB A;  5A70 A;  3RZK A;  4FOW A;  1DU3 D;  4JDM A;  4YW2 A;  4AAX A;  4JCK A;  3LZZ A;  2E53 A;  3LE0 A;  4Y22 A;  1F4A A;  3AXD A;  1HDK A;  1MQT B;  3AP5 A;  4I01 A;  3AB0 A;  1ASJ 3;  3I4I A;  1G9C A;  2H6B A;  4AFC A;  4XFB A;  5A3O A;  4UFJ A;  1PGL 1;  1ZM1 A;  2VE1 A;  4DRV A;  1FMD 3;  1IG3 A;  1B35 C;  4CP2 A;  1PGW 1;  1AL2 2;  4Q4X 3;  2VZ3 A;  4ISR A;  4Q0V A;  4HAN A;  3JD7 3;  3MIB A;  4MGQ A;  5LA2 A;  4CU8 A;  1VBA 2;  1EPW A;  4KI5 M;  3RDI A;  1RUN A;  3M3I A;  1CIW A;  1US3 A;  3N7M A;  3FHA A;  1B35 A;  2BGO A;  1WW6 A;  4HVQ A;  5FPV A;  2CWS A;  4B7K A;  5G05 L;  4M4R A;  1LHW A;  1MS9 A;  4EJR A;  2TBV A;  2WT2 A;  5FIX A;  3GZE A;  2VBP A;  1W6O B;  5JVV A;  1I1E A;  3HNM A;  3APB A;  4QKN A;  3OBT A;  5A7O A;  1XE0 A;  1UQX A;  2XVG A;  3P3N A;  1ENR A;  4QU1 A;  5FZ6 A;  5HV4 A;  2K9Z A;  3OY8 B;  4V2W A;  3H8O A;  1W8U A;  1HV1 A;  3ZSE A;  2ZGR A;  1PVC 3;  5J48 A;  1JYW A;  1VE0 A;  5F3G A;  2PFW A;  4COY A;  2RMU 2;  2BYV E;  4ZS2 A;  1BBT 3;  2JIC A;  1DG6 A;  1HRI 1;  5IVJ A;  1CAU B;  1AR9 3;  2Z2S B;  3NAP B;  2OII A;  1BK0 A;  1GU3 A;  2VOW A;  3CJX A;  2A5Z A;  3NNL A;  1IG0 A;  1S2K A;  4FOV A;  3GGL A;  3RZL A;  1RUH 2;  3KT4 A;  4XDP A;  3WF1 A;  2ZHN A;  1H1M A;  2H6C A;  3IDE A;  2ZGS A;  3ZFF C;  5A3T A;  2CWM A;  5ERL A;  5C4W C;  4L2N A;  5LWB A;  3ZYJ B;  1R1Z A;  2GC0 A;  2JD4 A;  2WBK A;  1MEC 2;  1UMH A;  3H50 A;  1JOJ A;  3AVR A;  3UL2 A;  3TN9 1;  2JX9 A;  4G4F A;  5K9Y A;  4N9H A;  2CDP A;  1RUF 3;  4QPI C;  5F37 A;  4ZPI A;  5JI7 A;  4FAG A;  2D6N A;  4EWA A;  1AXK A;  5BY5 A;  3MW4 A;  1AXY A;  5IK8 A;  1PIV 2;  2VZV A;  3NO8 A;  1LRH A;  1QJX 1;  4KGQ A;  3ZYP A;  1G9D A;  5F3C A;  4JRA A;  2RS3 3;  3O1P A;  2A71 A;  3M3Q A;  2KR2 A;  5BV6 A;  5J3U A;  2ATF A;  1WMF A;  5JI9 A;  3H8R A;  5IFP A;  4QPI A;  1ZRF A;  5A33 A;  4M3C B;  3CLP A;  2ZKL A;  4D7T A;  4GH4 C;  4L9B A;  2P5B A;  4JGY A;  3NJY A;  1FI2 A;  4MG2 A;  1QWR A;  5BNO A;  1BLZ A;  2XHK A;  4A6S A;  2LAL A;  1V0A A;  4N7I A;  4DXT A;  2NYY A;  1ZZ7 A;  4MAD A;  3ZYR A;  4BIO A;  1RHI 3;  3WDT A;  1UX7 A;  4OMD A;  1YJK A;  4UFH A;  3SCH A;  3ALQ A;  3ITQ A;  1AL2 3;  4IGO A;  2BJS A;  3POF A;  3ACL A;  3S57 A;  2QE3 A;  1S0D A;  4GH4 A;  1VBA 3;  2BVV A;  3RQ0 A;  4CEW B;  1AR7 2;  1UY1 A;  4P9Y A;  2P34 A;  1A8D A;  1QJY 1;  4BIF A;  5H9P A;  2F4L A;  5FYY A;  2VOK A;  2BWC A;  2HWD 1;  2W1Q A;  5JIU A;  3UV9 A;  2VOX A;  4F7Z A;  5FTT C;  1SHW B;  4Q8L A;  4P9X A;  2WNV A;  2VMI A;  1ENX A;  3FUQ A;  4Q4Y 2;  4C8D A;  4EZH A;  1NY7 1;  4FP3 A;  4MLO A;  3MIG A;  3HN3 A;  1RUG 2;  1UW8 A;  4OLL A;  2XR4 A;  3DYO A;  4B4P A;  1QQP 1;  4AHY A;  3DYP A;  2WO2 A;  3MLK A;  4R9C A;  3ZXF A;  2B45 X;  4GUL A;  4GB3 2;  3K48 A;  2PAM A;  1LHV A;  1REE A;  3MGU A;  3POY A;  4YSF A;  3N3H A;  1RUC 3;  5FPZ A;  1SQ4 A;  5LRR A;  3WLU A;  2RMU 3;  2WRA A;  1S1A A;  5C9A B;  1ULC A;  2IXC A;  3KV4 A;  4RR3 B;  1SDW A;  1NYW A;  1T6B X;  3AMP A;  3RZH A;  3LWC A;  5HI0 A;  4PBP A;  2QQU A;  3GJA A;  4EV0 A;  5KC6 A;  4BWO A;  1RVF 1;  3WV6 A;  1RUH 3;  2AEZ A;  2WQ4 A;  1TME 3;  1N3Q A;  3OEA A;  3T1L A;  4FAH A;  1ZBA 1;  1FAY A;  2Z69 A;  2D40 A;  2A3Y A;  1YO8 A;  4MX3 A;  3PTY A;  3HJR A;  3G6J B;  3K77 A;  2HLE A;  4PDW A;  2Z79 A;  1UY0 A;  4CCJ A;  3J8F 1;  3AZX A;  5JMO A;  1LTE A;  2JEM A;  1OXC A;  5A3W A;  3N4M A;  3B93 A;  5KHG A;  2DVB A;  3GCW A;  2RJK A;  3ZLI A;  5KR7 A;  3RI8 A;  4Z2A A;  5LY2 A;  1W6N A;  2BBV A;  4P08 A;  1PIV 3;  2BGC A;  4XHX A;  1WW7 A;  4HL0 A;  2A1X A;  3O1S A;  2PYT A;  1WWY A;  5I0T A;  4D6Q A;  3O0X A;  5LBB A;  2DUR A;  3LDR A;  3POB A;  1VJ2 A;  3TYJ A;  1C1L A;  4FPE A;  5H9R A;  4AGG A;  5LK5 A;  5KHJ A;  4HG6 B;  1EV1 1;  1T2X A;  1DQ6 A;  5LCW L;  3B01 A;  1GOF A;  3I7D A;  4BU2 A;  2ZAA A;  1JUH A;  3H3U A;  2QQN A;  2VUD A;  2ZS6 B;  2X10 A;  1KS4 A;  4SLI A;  1LCL A;  5K0U A;  3WDU A;  1C4R A;  5JZG B;  2FHR A;  3ILR A;  2F6B A;  2VUJ A;  2D6K A;  3R05 A;  1TNR A;  4YW7 A;  4AVB A;  1AX1 A;  3POS A;  4PLO A;  1WA4 A;  1CES A;  2J1E A;  4Z2W A;  5CU1 A;  1AR7 3;  3S6P A;  1W3V A;  2ZEX A;  1PNG A;  2JG9 A;  2WYF A;  4WZC A;  2GMP A;  4OUM A;  2HKX A;  1OI6 A;  2VNO A;  3CZU A;  3H9A A;  5I0U A;  2D6O X;  5DUX A;  2FDI A;  5T52 A;  1CON A;  2VEC A;  3EXU A;  3VLB B;  2YC2 A;  2ZGP A;  4AFD A;  4ZKT B;  3VDD C;  5CG9 A;  3VBU B;  1CR7 A;  1M06 G;  1S2E A;  2VMF A;  2P2K A;  2VW1 A;  3AJY A;  4AL9 A;  4LUL A;  3ZIW A;  3ME2 A;  1YCI A;  5HCH A;  1U0A A;  3J7H A;  4QHZ A;  2Q8E A;  3SHR A;  3OUJ A;  3N9N A;  1CQ9 A;  2BV4 A;  3GHN A;  3SQO A;  2C9K A;  2HWF 1;  5FYS A;  3VDD A;  1RUD 2;  1MVE A;  3JXS A;  2KD7 A;  3U07 A;  2QQO A;  1DHK B;  1J59 A;  2DFC A;  2Q8D A;  2GNM A;  1Q8V A;  5DZF A;  5C5T A;  5B2G B;  4M01 A;  4GWJ A;  2BOJ A;  1KDK A;  5F2W A;  5JOW A;  1O3Q A;  3KD4 A;  2RDN A;  1C5H A;  2WKK A;  2WNU C;  4JKM A;  5GZE A;  2KA3 A;  3QLQ A;  5IW0 A;  2XBO 2;  2YBS A;  4NIH A;  3N35 A;  2EIE A;  3JBG 1;  1PNF A;  1JZ4 A;  1JW6 A;  1PZ7 A;  2WIN B;  2Y26 A;  3WNO A;  5B4X A;  2ZJC A;  2GNB A;  3LGR A;  3LFM A;  5KHK A;  3TEW A;  2JDU A;  4Y1V A;  5CFD C;  2I07 B;  5CKN A;  3EJK A;  2Y6K A;  1NZI A;  4TN7 A;  4Y20 A;  2NZ9 A;  2VU9 A;  2ZX3 A;  3NMB A;  1C8N A;  4UAP A;  3M3C A;  3MZH A;  3KLS A;  5L9V A;  1O6U A;  3FFQ A;  1DDL A;  2ARX A;  4CDW C;  3L2Y A;  5KXC A;  2W92 A;  4AFM A;  2RHP A;  2WSV A;  3BGA A;  3KS7 A;  5FZ7 A;  1ZZ9 A;  3VZM A;  1DGW X;  3LKJ A;  4AFB A;  1OD5 A;  3S5Q A;  2GZW A;  1C1F A;  3D3A A;  3VBF B;  2VUC A;  4ATF A;  3OUH A;  4YGB A;  3ZDV A;  5AFE A;  2JDZ A;  1MS4 A;  4AOC A;  4JVA A;  1C8M 2;  1JXN A;  1ND2 A;  3IPV A;  4Y24 A;  1J1T A;  4H2A A;  4XF3 A;  2Q1F A;  3VGI A;  1DQ4 A;  3EBR A;  3KF3 A;  1QDO A;  4UYB A;  2ZHM A;  5DDJ 1;  3IZO A;  2V09 A;  1H0B A;  3DUI A;  4NWV A;  4YGC A;  3CDZ B;  5IWF A;  4LR4 A;  3KQR A;  2QNK A;  3Q8B A;  4YNI A;  1XC6 A;  3UYJ A;  2P3I A;  3HT2 A;  4H55 A;  4MSV A;  1K45 A;  1CIY A;  1FOD 2;  1TNF A;  2XWJ B;  3Q8A A;  4GXL A;  5FZ3 A;  4OVE A;  5IVV A;  2W2I A;  2D44 A;  2BU9 A;  3CBN A;  3LEM A;  5GZD A;  1FT9 A;  1ZRD A;  1OMI A;  3UKV A;  4H3W A;  4HFS A;  2UWA A;  1DCS A;  3J7M A;  3V64 A;  1QQP 3;  2XG3 A;  4KWU A;  4JGZ A;  4ES9 A;  2JDK A;  3ZXE A;  1V6K A;  3ZXL A;  2PHR A;  3OF1 A;  3VD7 A;  1QJZ A;  4PHZ A;  3BVC A;  4LO7 A;  4LUM A;  4PLN A;  2D3S A;  1UYP A;  4PIZ A;  1ZVF A;  3HOB A;  3A21 A;  3POW A;  4O9G A;  3X29 B;  5EJ1 B;  3AL6 A;  4COV A;  5FO8 B;  1W6Q A;  2FMD A;  4YVW A;  4CUG A;  5E1R A;  1TE1 B;  4UF0 A;  4UW5 A;  3K4A A;  3WT3 A;  2Y60 A;  5FZO B;  1VBD 2;  3RVH A;  4YW5 A;  3T2T A;  1F8V A;  1V70 A;  2DCJ A;  1AVB A;  3LDK A;  1H4H A;  4UFK A;  2XBO 3;  1NCQ C;  2HWC 2;  2J1V A;  4PIX A;  1RUI 2;  4XFA A;  1PX4 A;  2UYB A;  2ZMK A;  4M00 A;  2N7G A;  3OPW A;  4TLG A;  3USU B;  2E26 A;  4LMF A;  1DGL A;  4JX0 A;  3FZ3 A;  2JB8 A;  4Q2F A;  2ZGQ A;  2Y0O A;  1SDD B;  3T0A A;  1BVV A;  1SCS A;  5FYH A;  3AK0 A;  3ZMN A;  3I3B A;  1MZ5 A;  4WVW A;  2VJX A;  3IDA A;  3WQ0 A;  3O1V A;  4FTE A;  2Z5W A;  3WR0 A;  2B9U A;  1HQL A;  3BPZ A;  2AAC A;  1S2B A;  1ZBE 2;  4UFI A;  1PVX A;  2ADD A;  1D4M 2;  3J7N A;  2VOV A;  3T0D A;  5FZ4 A;  3AXE A;  3WY6 A;  2YPD A;  4BIS A;  1VAK A;  2QQK A;  4ET7 A;  5JXG A;  3ZFG C;  1NA1 C;  5C8W A;  1ZX5 A;  1S0G A;  2VD7 A;  2VXR A;  4RS5 A;  3VN4 A;  4XZP A;  5FWJ A;  4QD2 A;  2OZJ A;  4N53 C;  5FMO L;  4EN7 B;  4HON A;  2PTM A;  3WP5 A;  1C8M 3;  1E5I A;  3IAQ A;  1A78 A;  2P3J A;  2VVD A;  5DG2 A;  4B3N A;  3VUO A;  3VD5 A;  1OOP C;  4XCA A;  4HVR A;  5FY5 A;  1EY2 A;  3LA7 A;  3NV1 A;  4URT A;  1L7R A;  1ENQ A;  1TVG A;  1VRH 1;  2BW8 A;  4N53 A;  2XML A;  3RSJ A;  4D69 A;  4Q0U A;  3B69 A;  4KMQ A;  1IS4 A;  3WW2 A;  1EUU A;  4NRM A;  5JCT A;  1AX2 A;  1FV3 A;  2XJQ A;  3MF6 A;  4NPM A;  5C5U A;  3V0A B;  4ARY A;  1PX3 A;  1WBL A;  2P17 A;  1LOG A;  2CGO A;  3MFA A;  3FBY A;  4FPC A;  5JSR A;  3AC0 A;  4NRP A;  2FBE A;  4AHW A;  2HWF 3;  2WUH A;  1J83 A;  5HXV A;  3ENR A;  2X53 S;  3VBH A;  1GZ9 A;  3ZSJ A;  4Q4W 3;  3I59 A;  1L7Q A;  2LS6 A;  4XDO A;  1UO9 A;  1G86 A;  4JTN A;  2RJL A;  4N43 C;  4XMI A;  4P14 A;  5IVF A;  2AZ5 A;  2WZE A;  4IEP A;  1UZV A;  2RS5 1;  3PJY A;  1QOO A;  5FO9 B;  4HMZ A;  4COU A;  3HMY A;  3C8X A;  2FCV A;  4QQH A;  5T5O A;  5LZ6 A;  2BFU L;  4FVV A;  2RM2 2;  4NAM A;  1OSG A;  4AED C;  3GZU C;  1OUS A;  3JBG 3;  1UKR A;  4KG8 A;  1CPM A;  1RUI 3;  3LA3 A;  3B3Q E;  4MGK E;  5JSP A;  4LHL A;  3ZYG A;  1KJR A;  3MW2 A;  4QX1 A;  2PHD A;  4XUQ A;  4CPB A;  2QBX A;  2VTX A;  3AP6 A;  5CBL A;  1LGC A;  1MR5 A;  2CL2 A;  1O8P A;  4IV3 A;  5GAL A;  1PZ9 A;  4AED A;  2R49 A;  1ZA7 A;  2ORX A;  3PHM A;  4TXW A;  5I8T A;  4L11 A;  3SKJ E;  3U1X A;  3V56 A;  2ZGN A;  4TSV A;  5FY1 A;  3VKN A;  4BQ1 A;  4CU7 A;  1W39 A;  2GN7 A;  2RE9 A;  1EUT A;  2C1F A;  2PQS A;  3BB6 A;  3CHX A;  4CEY C;  4C90 A;  2HEW F;  4Y5T A;  4LBQ A;  2FQP A;  3C7G A;  5DAX A;  2XHN A;  3NJV A;  5FJK A;  3OJB A;  3VZK A;  1ZBE 3;  3ZXD A;  5FMB A;  4BHP A;  1DLC A;  1D4M 3;  2RDQ A;  5A3U A;  1JYN A;  2CYF A;  4Y1X A;  4DFS A;  5EPA A;  4MXW A;  3AP9 A;  3OGV A;  1KD7 A;  5C8C C;  4Q0Q A;  3OUI A;  1ND3 B;  5BNP C;  3ZFG A;  2R06 1;  3M4F A;  3KGZ A;  3PVB B;  4LO8 A;  5DDJ 3;  2MEV 1; 
#chains in the Genus database with same CATH homology
 5DPN A;  2J7M A;  5IJR A;  1CZV A;  2Z4F A;  2W3J A;  2DDU A;  5A1A A;  1JHJ A;  4D8M A;  4QX3 A;  4W8J A;  4ARX A;  5CZK A;  4ZZ5 A;  1JZ7 A;  2J1R A;  3OEB A;  4ZZ8 A;  5C70 A;  4QX2 A;  3WNN A;  2V72 A;  4OZO A;  3LPF A;  2ZEW A;  4P5Y A;  4CUB A;  2VZO A;  4AAX A;  2JD9 A;  3LE0 A;  1GOH A;  1F4A A;  3EB7 A;  5JUV A;  1GOG A;  4LHS A;  1UXZ A;  2W91 A;  5LA1 A;  2RV9 A;  3HNY M;  3MV1 1;  4XUR A;  3UNP A;  1JZ6 A;  3C7F A;  4MGS A;  3W5N A;  2VZ3 A;  4MGQ A;  5LA2 A;  1WKY A;  3OG2 A;  4CU8 A;  4KI5 M;  4M4P A;  4RYD A;  1DYO A;  4QB6 A;  4JKL A;  4UOJ A;  1W0N A;  3CIH A;  1US3 A;  3FHA A;  1JZ5 A;  2BGO A;  3CQO A;  5G05 L;  4M4R A;  3HNM A;  4BXS V;  1JU4 A;  3VDB A;  2J1A A;  1O8S A;  3NRU A;  2B9V A;  3E1F 1;  1JYW A;  3NNG A;  1OF3 A;  1GU3 A;  1JZ8 A;  1KGY A;  3GGL A;  2VQU A;  3WF1 A;  3FL7 A;  4W50 A;  2V4V A;  5F7U A;  2WDB A;  3K46 A;  2WBK A;  1W8N A;  2X09 A;  4E8C A;  5J1X A;  1UMH A;  2C4X A;  3HEI A;  2QQM A;  2CDP A;  2Y6G A;  1R64 A;  4QAW A;  2VZV A;  3FN9 A;  3T2O A;  3K4D A;  4E8D A;  2ID4 A;  2VQT A;  4GZ9 A;  5IFP A;  5JXJ A;  1UY2 A;  1H6X A;  4MOA A;  4QDQ A;  3C7O A;  4DXT A;  3ETP A;  4MAD A;  3VD9 A;  2YC4 A;  1UX7 A;  4OMD A;  2VZU A;  3T0B A;  2VME A;  3ACH A;  4DXR A;  1UY1 A;  3LEG A;  2Y8K A;  1XNT A;  3C7E A;  3IAP A;  3WNK A;  2W1Q A;  3CZJ A;  1SHW B;  3HN3 A;  2WYS A;  5B4N A;  1W99 A;  3DYO A;  2YG0 A;  3I3D A;  3DYP A;  2WO2 A;  2VCB A;  2LW8 A;  5DN2 A;  2QQL A;  3UET A;  2E31 A;  3GDB A;  3WQB A;  2Y64 A;  2X05 A;  3III A;  1BHG A;  2B4K A;  3I2I A;  2WZ8 A;  3VD3 A;  1P8J A;  4IUG A;  1GQP A;  2W95 A;  2XON A;  1H6Y A;  3OEA A;  2BER A;  2ZEY A;  2QQJ A;  3MV0 1;  3UES A;  2JE8 A;  3HJR A;  3K77 A;  4P00 B;  2HLE A;  3T2P A;  3I2G A;  1UY0 A;  5JXI A;  4CUC A;  5JMO A;  2VR4 A;  1ULP A;  2J22 A;  2CDO A;  4Z2A A;  4P08 A;  3GXU A;  2RVA A;  2EIB A;  4LQR A;  4XUP A;  2WO3 A;  3BN6 A;  1J84 A;  3ACG A;  4P02 B;  1GUI A;  1UYX A;  1W9S A;  3CKH A;  4HG6 B;  1T2X A;  3MBW A;  5FUI A;  5EIY B;  5LCW L;  1GNY A;  2ZXQ A;  1GOF A;  3CMG A;  3T08 A;  1WCQ A;  2BBA A;  2QQN A;  4XUO A;  2HYX A;  4OYU A;  2X10 A;  4BDV B;  2VZS A;  2YFU A;  4XUT A;  1TG7 A;  3I2J A;  1CZT A;  2VCA A;  5G04 L;  2J1E A;  1UYZ A;  2ZEX A;  4LPL A;  3F2Z A;  2VZP A;  3CZU A;  3PUH A;  2YC2 A;  2VMF A;  3VDC A;  2W87 A;  3I3E A;  4FI9 A;  4XUN A;  3J7H A;  3VD4 A;  3WNP A;  1JYV A;  2QQI A;  2C9K A;  2VZQ A;  1UMI A;  2VCC A;  3JXS A;  2KD7 A;  4GWI A;  2VZT A;  3WF0 A;  2QQO A;  5I0D A;  1PMJ X;  4GWJ A;  3HNB M;  3LEK A;  3SEE A;  1O59 A;  4DEV A;  1JU3 A;  4JKM A;  4JKK A;  1UY4 A;  3OGR A;  1W9W A;  1GMM A;  1SG3 A;  1US2 A;  2EIE A;  1JYX A;  4CU6 A;  1JZ4 A;  4DUW A;  3WNO A;  5B4X A;  2E32 A;  4YPJ A;  2Y6K A;  4BK5 A;  4ZY9 A;  3FHQ A;  3MO4 A;  4CVU A;  2JKX A;  4TTG A;  1JZ2 A;  4RN5 A;  3PUI A;  4XVH A;  4UAP A;  1F4H A;  1D7P M;  3EYP A;  2W92 A;  1K42 A;  3BGA A;  4QB1 A;  1W8O A;  3D3A A;  2VTF A;  2VZR A;  3K4Z A;  4A3Z A;  2Y6L A;  2BGP A;  3MUZ 1;  2ZEZ A;  2WQ8 A;  3MUY 1;  4D0Q A;  3LEI A;  1JZ3 A;  5LA0 A;  2OKX A;  2XOM A;  3ACI A;  3WF3 A;  2J1U A;  3WNL A;  3IB3 A;  3CDZ B;  4DUV A;  1K3I A;  1XC6 A;  4QDS A;  4CU9 A;  1OD3 A;  1K45 A;  1CIY A;  2V5D A;  5C7G A;  2RJ2 A;  1I5P A;  3THD A;  2WAA A;  4KWU A;  1IQD C;  5IFT A;  1NX9 A;  3VD7 A;  2VMD A;  2VZ1 A;  1ULO A;  4QB2 A;  4LKS A;  2XQX A;  3HOB A;  3A21 A;  5DMY A;  5EJ1 B;  1MPX A;  4A44 A;  3LQC A;  2R7E B;  3U37 A;  4PQQ A;  3K4A A;  5DQ0 A;  3I2K A;  1PMH X;  3LPG A;  1UWW A;  1UZ0 A;  2DCJ A;  2W46 A;  4DEQ A;  2J1V A;  2YFZ A;  1PX4 A;  4QPW A;  2Y6J A;  2E26 A;  4CUA A;  1UY3 A;  4JX0 A;  3ECQ A;  3K75 B;  2W9X A;  3WEZ A;  1OF4 A;  1SDD B;  4L0P A;  3T0A A;  3P1I A;  3I3B A;  4AG4 A;  2VJX A;  3IDA A;  3ACF A;  5JXH A;  5JR2 A;  2W1S A;  1W9T A;  2YB7 A;  1XPW A;  3I97 A;  1OH4 A;  2WAO A;  2L9L A;  3DYM A;  4MO3 M;  4OUE A;  3T0D A;  1UXX X;  4ZXE A;  2J1S A;  2QQK A;  4ET7 A;  2ORZ A;  5JXG A;  4A42 A;  1JI6 A;  3WSO A;  5CYY A;  3WNM A;  4DUX A;  1RYY A;  3GM8 A;  4OMC A;  3T09 A;  4A41 A;  3NQH A;  3VDA A;  5IYY A;  3IAQ A;  2WO1 A;  2W5F A;  3WF4 A;  3A22 A;  3A23 A;  3VD5 A;  3I2F A;  5C71 A;  2VL4 A;  3P6B A;  2W1W A;  4A4A A;  1L7R A;  1TVG A;  3DEC A;  3I2H A;  5EJZ B;  3SEP A;  4PF1 A;  4DXS A;  4KMQ A;  1EUU A;  2DCK A;  2VC9 A;  2E33 A;  2WN3 A;  2VMC A;  3SKV A;  4ARY A;  1PX3 A;  4BK4 A;  2VO5 A;  3AC0 A;  1CZS A;  2WUH A;  1J83 A;  3W5M A;  1L7Q A;  2LS6 A;  5HPO A;  2VM9 A;  4UI9 L;  4W4Z A;  1CX1 A;  4QX0 A;  2WAB A;  4JHZ A;  2WZE A;  1OT5 A;  2W47 A;  3ZM8 A;  3C8X A;  1UYY A;  1K12 A;  2JDA A;  3C7H A;  3THC A;  1XNA A;  5HXM A;  1KEX A;  4A45 A;  2WN2 A;  3A7Q A;  4QDR A;  1NAE A;  1YQ2 A;  4QX1 A;  4XUQ A;  2QBX A;  3OBA A;  2J1T A;  4A6O A;  1DP0 A;  1NUK A;  1O8P A;  3NJX A;  2Y6H A;  1HN1 A;  2ORX A;  2C26 A;  4TXW A;  2EID A;  3SKJ E;  4CU7 A;  4BJ0 A;  3OB8 A;  1EUT A;  2PQS A;  2W1U A;  2VOT A;  3ABZ A;  3C7G A;  2XHN A;  3NJV A;  3WF2 A;  2BZD A;  1DLC A;  3HPN A;  4PT6 A;  2W94 A;  3OGS A;  1JYN A;  2EIC A;  3OGV A;  1NKG A;  4XZU G;  5IHR A;  1LNS A;  3T2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...