3HNYM

Factor viii trp2313-his2315 segment is involved in membrane binding as shown by crystal structure of complex between factor viii c2 domain and an inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
SCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor VIII
publication title Trp2313-His2315 of factor VIII C2 domain is involved in membrane binding: structure of a complex between the C2 domain and an inhibitor of membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 40
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3hnyM00
1JZ5A 2YC4A 1UYYA 3C7EA 2QQLA 3WNNA 5G04L 1UZ0A 3OGVA 4LKSA 4DEQA 1F4HA 2HLEA 5JXIA 3C8XA 1DYOA 2WAOA 3NJVA 2J1TA 2J1EA 4DUWA 2J1RA 3CQOA 4W4ZA 4BXSV 4MOAA 4OMCA 4QB1A 3WNMA 4DXRA 2C26A 1W0NA 5IYYA 3OG2A 2J1UA 1OD3A 3IAPA 2VMEA 3K75B 2V72A 2VL4A 2VZPA 1GNYA 1K42A 2V5DA 2BBAA 4BK5A 2BGPA 2Z4FA 2JKXA 3EYPA 4YPJA 2BGOA 4IUGA 2XQXA 4QX0A 2WAAA 1GOFA 2EIDA 1JHJA 3I2FA 4QPWA 2WZEA 3GDBA 1GOHA 2CDOA 4MGQA 5A1AA 4CU8A 1WKYA 2XHNA 2WDBA 5JXHA 1JZ3A 3F2ZA 2W3JA 4Z2AA 1JYXA 2VZRA 3HJRA 4P08A 3W5NA 3WNLA 2VR4A 4AAXA 3C7FA 5EJZB 2WO3A 4UAPA 1W8NA 3HOBA 3ACGA 4BK4A 3LEIA 4KMQA 5F7UA 4QB6A 2W1UA 3ACIA 1NAEA 3BN6A 3VD7A 3C7GA 3ACFA 4PF1A 4XUPA 1RYYA 2YC2A 3NNGA 4OUEA 5JXJA 1LNSA 4RN5A 3LEKA 3MBWA 4A42A 4DEVA 1PX3A 1OT5A 3T2QA 1XC6A 2W1WA 4HG6B 3OGSA 1TG7A 2VO5A 1JZ8A 2VTFA 4MGSA 1P8JA 2QBXA 5JR2A 1W9SA 5LA0A 3A7QA 2VMCA 2KD7A 4QDRA 3MO4A 1IQDC 2X05A 2VCAA 1W9WA 1JU3A 2W92A 2VZUA 5FUIA 2WBKA 1UXZA 3HNMA 5LA2A 5I0DA 3HEIA 4UI9L 3CIHA 1UYXA 4LHSA 2Y6GA 3MUZ1 4CUAA 4JKMA 2ZEZA 1D7PM 5HXMA 3WNOA 5C70A 5IFTA 2JD9A 2YB7A 3DECA 3VD3A 4DUVA 4A4AA 3I2HA 5EJ1B 2RVAA 3MV01 3WNKA 1CZSA 1UMIA 1UY3A 3AC0A 1CZVA 1US2A 1US3A 1KEXA 3THCA 1BHGA 3SKJE 2VMDA 1NUKA 3K4ZA 1ULPA 1OF3A 1XNTA 3W5MA 3UETA 2EICA 3EB7A 3GGLA 2V4VA 5JUVA 2JE8A 1SDDB 4A3ZA 3BGAA 5DQ0A 4GWJA 1H6YA 3CZUA 2J1SA 3WNPA 4XUOA 2QQMA 1XNAA 5IHRA 4ARYA 2ZEYA 1UX7A 3A22A 5IJRA 1O59A 2B4KA 4W8JA 4BDVB 5B4NA 4CU7A 2WYSA 5CYYA 1R64A 4QX3A 3WEZA 1O8SA 5HPOA 2HYXA 1JZ2A 3CKHA 4DUXA 3I97A 4QX1A 2VJXA 4E8DA 2VZQA 3P1IA 1F4AA 2J1AA 4LQRA 2VZSA 2E32A 3NQHA 3VD5A 4BJ0A 3J7HA 3T08A 1UXXX 3ECQA 5EIYB 3VD4A 2XONA 4XUNA 3LPGA 3OEAA 4UOJA 2EIBA 5B4XA 2WUHA 1H6XA 1W8OA 3ETPA 3OBAA 2W1SA 3DYPA 1XPWA 4CU6A 2W95A 4OYUA 2LW8A 4JX0A 4L0PA 1CIYA 4JKKA 4CUBA 2VZOA 5JXGA 4XURA 4A45A 4KWUA 2XOMA 2W91A 3WF0A 1UWWA 4A44A 3IIIA 3K46A 5LA1A 2Y6HA 3A21A 3DYOA 4JKLA 4ZXEA 1GQPA 4FI9A 3SKVA 4ZZ5A 3VDBA 1OF4A 4ZY9A 5DMYA 3LPFA 2E26A 3IB3A 3SEPA 3I2IA 2X09A 4MADA 5IFPA 2VOTA 1UY2A 4D8MA 3NJXA 2DCJA 4P00B 2BERA 1NKGA 5JMOA 2VCCA 2ZEWA 2VQTA 1W9TA 4MO3M 4QDSA 4QX2A 1T2XA 3MV11 3WF3A 1JYWA 2VCBA 2VQUA 3I3EA 3U37A 3C7HA 4XZUG 3FHQA 4M4RA 2W47A 3UESA 1L7RA 1OH4A 4P5YA 3K4AA 2W9XA 2VZVA 3HNBM 2W5FA 3I3DA 1CZTA 1JU4A 4XVHA 3P6BA 4DXTA 1ULOA 2WN3A 3A23A 5DPNA 2QQJA 2L9LA 3NRUA 2WO1A 2YFUA 1GUIA 2W1QA 3OGRA 3WSOA 1K12A 1PX4A 3OB8A 5CZKA 1SHWB 2W87A 1JZ7A 2JDAA 4D0QA 1SG3A 3HN3A 3E1F1 4JHZA 3JXSA 2ORXA 1MPXA 2ZEXA 1DP0A 1L7QA 3I3BA 2QQIA 2B9VA 4ET7A 2Y8KA 5J1XA 4TTGA 4GZ9A 2RJ2A 3CMGA 3FN9A 4XUTA 1PMHX 3D3AA 2Y6JA 4TXWA 4KI5M 4PT6A 2EIEA 3ACHA 3MUY1 3DYMA 3CDZB 2VMFA 4OMDA 3K4DA 3GXUA 3WF1A 4QDQA 1UY4A 2WZ8A 2ORZA 2C4XA 3C7OA 4E8CA 2WABA 1KGYA 2X10A 1GU3A 4CU9A 2DCKA 2YFZA 3IAQA 3I2KA 3T09A 3T2PA 2VC9A 4GWIA 5C7GA 3I2JA 4W50A 1DLCA 1I5PA 2CDPA 3T0BA 3T2OA 4CVUA 1K45A 1YQ2A 1O8PA 3IDAA 4PQQA 4ARXA 4M4PA 1PMJX 3I2GA 3VDAA 1TVGA 5DN2A 2VZTA 3OEBA 2BZDA 1UYZA 2ZXQA 2WQ8A 5LCWL 1J83A 1EUUA 1W99A 2WN2A 3GM8A 2E31A 1UY1A 4A41A 3CZJA 3PUHA 4XUQA 1JYVA 4RYDA 1GMMA 1JYNA 2QQNA 1K3IA 2VZ3A 2YG0A 3WQBA 4QAWA 3THDA 3ZM8A 2PQSA 4AG4A 2J22A 1HN1A 2OKXA 3FL7A 2J1VA 2DDUA 2VM9A 3LQCA 2QQKA 4OZOA 1NX9A 5C71A 4QB2A 2J7MA 4CUCA 1CX1A 1J84A 3HPNA 2W94A 2R7EB 1UY0A 3ABZA 2Y6LA 2E33A 4DXSA 2C9KA 2W46A 3PUIA 1GOGA 2VZ1A 3LEGA 3K77A 1JI6A 3T0DA 2Y64A 2ID4A 2WO2A 1JZ6A 3WF2A 3HNYM 3WF4A 4P02B 3SEEA 1UMHA 1JZ4A 3VDCA 2Y6KA 2QQOA 3LE0A 5G05L 4A6OA 3T0AA 4ZZ8A 1EUTA 3VD9A 2LS6A 4LPLA 3UNPA 3FHAA 2RV9A 1WCQA
chains in the Genus database with same CATH superfamily
1WA6X 5CG8A 1LU2A 3GZAA 4L8QA 1OKQA 2FD8A 4HKOA 3KCCA 3C7EA 5KC6A 4Z07A 4ATFA 3OGVA 3GCWA 3R4UA 4XFGA 4FT8A 1NA1A 2HBUA 2WZR2 5T50A 4X8NA 4FPYA 2HLEA 2RMU1 2WL1A 1W6QB 3LGRA 1OVPA 3AK0A 5FBZA 1LTEA 3SISA 5JXIA 1RITA 4QX7A 1N3PA 2DCTA 3MHZA 5C3RA 4HXCA 3ZSKA 1M4WA 1R083 2VBDA 1DYOA 4PIXA 4YW5A 4AHZA 2IXKA 2J1TA 1U5ZA 4OZXA 1HV0A 3KVAA 5KHHA 4FBFA 3V0AA 4BXSV 4OMCA 1YJLA 4LIVA 2J1UA 3K3OA 3NV2A 4Z92B 4LJHA 4LBNA 1PIV1 2V72A 1AL21 5FYCA 5F39A 3GZTB 4LK6A 3RNSA 1ND2B 3AP5A 5FBJA 4JCKA 4E2QA 1TME1 4KH9A 2QDNA 1VBC3 2QJVA 2JB8A 3FLPA 4QXKA 4AI3A 4Y4YA 3URFA 2JDKA 2JKXA 3EYPA 4NROA 3J26N 5JSPA 1GOFA 2EIDA 1ZYBA 3U78A 4YARA 5J3UA 1C3HA 5I8SA 1XE7A 4YVSB 2ZX1A 5K7PA 2UY9A 3ZMOA 1O5LA 4DZGA 2D3RA 1OKOA 4Y1ZA 4FPJA 1GOHA 4CDXA 2CDOA 2QTWB 3U11A 4LE4A 3POFA 4CU8A 1YWKA 2QVSB 1WKYA 5KHJA 1OURA 4KGQA 4NRPA 3USSA 1BZWA 4AAPA 4DIQA 5A7NA 3PIJA 1W2OA 1GR3A 1CQ9A 1U12A 4WBBA 1JZ3A 4CSWA 3WLUA 3AZYA 1JYXA 3N9QA 2VZRA 1W3XA 1W9FA 3EHKA 3KV5A 5JAXA 4LO4B 4MXVA 3RYPA 3WNLA 4O7XA 3OY8A 2OZ6A 2DCZA 2NMOA 4K9SA 1K5MC 1YYNA 2C0ZA 4LIUA 1OUXA 1W8NA 1WMEA 4D6RA 2HWB3 1PK6A 4CEYA 3SLIA 4NIDA 4GWNA 5LATA 4NIHA 1COV3 2BVVA 3BN6A 4FXKB 2OYZA 3DKQA 3VD7A 3C7GA 3JZVA 4QGNA 5H9PA 3ZO0B 1QOSA 1QY4A 1OHFA 2WJSA 4ZU7A 5FMCA 1SACA 1LOAA 2VUJA 1HRI2 1LNSA 3N7LA 3RWKX 1HRV2 3ZYHA 4EN7B 1RUNA 4AL9A 2RE9A 1YCIA 4XTMA 4DEVA 2E6VA 1SLIA 1OT5A 4AE2A 4QKFA 2SLIA 3DPRB 3ZKUA 4YGEA 2K9ZA 1QJX2 3JD72 3OGSA 3TN92 1F5FA 1FMD2 1YFXA 1WD3A 2V09A 1YEWA 2YUEA 5L9BA 4IEWA 4RHV3 1F2NA 4XFCA 5T54A 2R042 3SCHA 4MGSA 1YNAA 1VALA 5L19A 1GNHA 1YJKA 3DL3A 3ZOIA 1WW5A 1R1ZA 4J6GA 3H1YA 3M1HA 1VMFA 1QJEA 3GBGA 1ZZ6A 2GZWA 3LZZA 4CCDA 3S7EA 1EAH1 4FFHA 4CCNA 2G9ZA 4LOTA 2X05A 1VJ2A 1MZFA 2ARAA 1JU3A 2W92A 2VZUA 3AZWA 4YYOA 5KR7A 4EE2A 3HQXA 1DZTA 2ZAHA 3I7DA 1HB2A 2P37A 4XXAA 2FQPA 1RUJ2 5GALA 5I0DA 3MIHA 4OI0A 2Y33A 2BNOA 5A1FA 1E57A 5F2WA 3GJAA 2G9FA 5FZ0A 4Z8BA 5HXMA 2FDFA 1AJOA 3DPRC 2V4AA 5I93A 4QPYA 2D97A 1V6OA 2ZOEB 2ZGMA 5FOBB 1KQRA 3GBFA 1G9BA 1PO23 2IC1A 2RVAA 3MV01 5H9QA 3AC0A 1H2KA 1BJQA 1CZVA 1FAYA 1S0DA 2D5FA 4YZ4A 5IK4A 1LGBA 2PMWB 3VBFC 5JSOA 2YU2A 4LO6B 1PO13 5FWEA 2XWBB 1BHGA 1AYN3 1BBT1 2HWD3 2HBTA 1W6QA 4MVTA 5DAPA 3SKJE 4FOQA 3S30A 2DVBA 1TQ5A 3IKWA 3K4ZA 3MF6A 5A70A 1OF3A 1XNTA 3VLBB 1IPJA 2EICA 5A1LA 1VAMA 5KHIA 1UD1A 3TOJA 2X8KA 3KGLA 4XIOA 3SH3A 4AXOA 3QLQA 1XYNA 1JN2P 3LIGA 3OPZA 2JE8A 4MXWA 2MPFA 1SLCA 1K5MA 3BGAA 4CCLA 5DQ0A 3O1OA 1H6YA 1U5XA 2OIIA 1WGPA 4FVVA 3WNPA 1AXZA 1LHVA 4XUOA 5A3PA 2Z69A 5T52A 5IHRA 4ARYA 1XOYA 2GDFA 4ES8A 1UX7A 3A22A 4W6YA 4N43B 3H1WA 3O7OA 1O59A 2B4KA 4H55A 4W8JA 2JDHA 2WRAA 3MIBA 1R64A 4FTEA 3E5QA 3ZYPA 3ME2A 1O8SA 2GN7A 3K48A 3VUOA 5HCFA 3WW3A 1SQ4A 1LOCA 3D4KA 4CXYA 1W6NB 4G3YC 1W6MB 2VNGA 3JBG3 3R0RA 5JWPA 5C5UA 3VBSB 4E8DA 3CEWA 1JBCA 2B46X 4D6SA 1POV3 3DGTA 3NV3A 5FZHA 4LQRA 5FXZA 2VVFA 3IIAA 3QBQA 3T3YA 3ZPOA 4GALA 4YVWB 3NQHA 1NXD1 1XSRA 1YRZA 3EJKA 1AR93 5FXVA 1RHI2 4LUKA 5LRSA 4IV1B 2QQUA 3AFKA 3PTRB 1LOEA 3H7YA 4CDUB 2HEYF 1H8TB 1XYPA 4HSJA 1I1EA 3M3EA 1JH5A 3VKFC 2A75A 5I0TA 5ACA2 5EIYB 4XUNA 2QQPA 3LPGA 3OEAA 5FPLA 1O4TA 3OSDA 3TNQA 4NE9A 5B4XA 2WUHA 1RUC1 1H6XA 3ETPA 4GKYA 2CY6A 4UBHA 3WDXA 1REFA 1LOGA 2P3YA 1XPWA 3N36A 4K20A 4GMP0 4N43C 3LA7A 5JPMB 3PVOA 4OYUA 5FXXA 2LW8A 2HWC2 1VLNA 2WIIB 5ERLA 1ENQA 3WHUA 4HK8A 2R072 1IPKA 3VGIA 4JKKA 1QJZA 3LOIA 2XVKA 4FP2A 1JMUB 4KWKA 4XURA 1ASJ2 1C1LA 1D4M3 2RS31 1NLRA 3AMHA 2DVAA 2VY0A 3VBSC 3DPRA 4AR2A 3IWZA 4LO5B 3GALA 3G6JB 4AF9A 2BPA2 2Y0OA 4AFBA 1ZZBA 1ZRDA 5FZ3A 3A21A 2RMU3 4HN0A 4CDUC 3U10A 2IZWA 2CU5A 1BKZA 2JDZA 2VULA 1H8TC 3H8UA 4FI9A 4I0WB 3LF7A 5LEKA 2IFWA 1OF4A 1QGLA 2D6LX 2D6NA 3N7JA 2ZGOA 3PMEA 4W6XA 3ZYBA 3VDDB 4BXFA 1JUIA 3IB3A 1DHKB 3RJ2X 3I2IA 2X09A 1D4VB 2A5ZA 2ZHLA 4UFLA 1FOD2 3LOBA 2Q1MA 3D8CA 2DCJA 5DDJ2 1PIV3 2BERA 1N1TA 3FFZA 4W6WA 1AL23 4B7EA 4CCOA 4PLOA 1YIFA 1QKQA 1TME3 2HWF3 3BI3A 2XJPA 3NNLA 5FPAA 3VV1A 2Q1ZB 2ZABA 1PMIA 1LEMA 4UBGA 3LA2A 2D40A 2FZ1A 1LU1A 1T2XA 4LMFA 1IOAA 3MIDA 2VCBA 4AWDA 4RGAA 4HOOA 3ES4A 3BTYA 1AR81 5F6KA 3C7HA 4XZUG 3FHQA 4LBLA 1PVC2 3APBA 3IDBB 2GAUA 2W47A 4M4RA 3LDRA 2DUPA 5JOWA 4IEOA 4K8FA 4BPZA 5FWJA 4QHZA 1QJU1 4RD7A 4FPHA 4F83A 2FHRA 2W5FA 3POGA 3I49A 5EYYA 3VDDC 1CZTA 2XBO2 4FPCA 2LALA 1IHMA 3KT7A 2E9QA 1W0OA 4UF0B 1ULOA 2RR11 2WN3A 4FPOB 1O3QA 5FREA 4F8AA 2L9LA 2YFUA 3OGRA 3INAA 3MPPG 1SPPB 4RS5B 5FP9A 1GBGA 5LASA 3WG2A 1HV1A 1QMJA 1UPSA 1PX4A 1YXWA 4QPGB 1GWMA 3J8F1 3PU8A 4TSVA 4NIIA 5J96B 1JZ7A 1C8M2 4PBPA 4D0QA 2RS11 4QQOA 2PAKA 3ZX7A 2R6QA 2IXHA 2RG4A 2XUMA 3J4UH 3MW3A 4XCAA 3Q8BA 2I2SA 4N43A 1RUI1 3JXSA 1QDOA 3MIGA 4JHZA 3MZHA 1J3RA 1LRHA 3I3BA 3VBHC 2PLV2 3FBMA 4JRAA 2JIJA 4WVWA 2OA2A 2JJ6A 4YW3A 3CBNA 2WWJA 1W6NA 2P6CA 1W6MA 3FN9A 1Q43A 4OHWA 2OUHA 3VBSA 3TAYA 4P9XA 1RUD2 4UT5A 1PMHX 3THTA 3KQRA 4MSVA 1Q5OA 3JQWA 5E8AA 4PT6A 1L7LA 1YQ6A 3MYXA 2FMDA 3ZR6A 1W03A 3B9CA 1EAH3 3VZNA 4CDUA 2DF7A 1V6IA 2P5BA 2VU9A 4RS5C 3T30A 1H8TA 1CX4A 2IXCA 5FV3A 3C7OA 4Z1VA 2ES3A 1ZRCA 4MUVA 1KGYA 2XR4A 3OGJA 5CBLA 4I2OA 1GU3A 3BPZA 4AI9A 5F1RA 4BQ5A 1BXHA 1ULEA 2YFZA 3IAQA 4C91A 3T09A 4YZ2A 3BODA 4YG0A 3Q8FA 5A3MA 4GWIA 1EV11 3HN1A 3I2JA 5FR3A 1QU0A 3UL2A 4Y1YA 1W9YA 1I5PA 1SZBA 4GD4A 3T0BA 1W8FA 3T2OA 4PQQA 4PQ9A 4Z2WA 1I6XA 4M3CE 3I2GA 4AHXA 3VDAA 3U0ZA 1TVGA 5DN2A 4NAMA 1QEXA 3UKTA 5C3SA 1Z7S2 3AP7A 1BMV2 3IT8A 1H0BA 5IVEA 1J83A 2AEZA 1EUUA 2ZTNA 3AMQA 3GM8A 2H0VA 4L92A 3WDUA 5EYXA 1BBT3 4H3WA 4Z82A 5GLVA 4K21A 4XUQA 4YGCA 3DN7A 1O5UA 2YBKA 2WZR1 2WLQA 1JYNA 2VXJA 2VH9A 1AX2A 4KG8A 2BU9A 1HXS2 1K3IA 2ZKLA 3FE5A 1SCRA 1ZA4A 4NHLA 5EHDA 4XF4A 3UYJA 2A1XA 3VDDA 1CAUB 3KQ4B 4QAWA 4HT1T 1C8NA 3ZM8A 2PQSA 1S0EA 1LGCA 4PI2A 5DUUA 4AHWA 1HN1A 4XBNA 5LK5A 4DB5A 2NZ9A 4HBNA 4WV8A 4Y5Z0 1S0GA 2QQKA 3BYWA 3VZLA 1LOBA 4AQ2A 4FO9A 4FOYA 4Y4RA 3UKVA 2YBSA 1DYPA 3TB0A 4B29A 2HWE2 4CUCA 1CX1A 4XJ9A 5A7QA 2YZ4A 4NIGA 2E7QA 1O3SA 4Y24A 4H14A 1RXFA 2D44A 2W94A 4XJAA 2FDGA 1D2QA 3ZSEA 4N8MA 4HETA 1AF9A 4DXSA 5J7MA 2C9KA 2RM22 4NRQA 4RGKA 1KXGA 2TEPA 2XDVA 3VBHA 3PJYA 2Z5WA 1ZZ8A 4URTA 2HKXA 2FCTA 2VZ1A 5A3UA 3W21A 1JI6A 1O6UA 1JYCA 1ULGA 5CFDB 4P9WA 5IK5A 4MHUA 3EBRA 5T3NA 1REDA 1V6NA 2ZJCA 5FMBA 4YM0A 3WF4A 4J1WA 1WBFA 3UJQA 3SNMA 4N7IA 1Y9GA 2A3YA 1A3KA 1ND3C 2XL9A 5BNQA 2Z42A 4NHXA 1SFYA 4Q0UA 4UF0A 3PDQA 3USUB 4BWOA 2OXBA 3IZOA 4GULA 4WVZA 1SPPA 4RS5A 4A6OA 4NHYA 1EUTA 4AEKA 4ZU5A 2FDIA 1RUC3 3A0NA 1MVEA 1WCSA 1UAIA 5FQ0B 5CADA 1OI6A 1UYYA 1VBD3 3OBZA 1AHSA 2BUKA 4JGZB 5G04L 2UURA 5FZDA 3ZXDA 5BUVA 4PLNA 3TNPB 2E53A 3AXDA 2DBIA 1ULDA 1HJGA 2RS33 1QWRA 3AVSA 4AW7A 3U1XA 1HRI1 1R092 1OFNA 4MGKE 2ENRA 3VN4A 4D94A 1AVBA 1NA1B 3AMNA 2VOKA 5CFDC 3EMRA 3AZVA 5AC92 2P3KA 4HZFA 3TEWA 1ENRA 2VBPA 1QJX1 3FLRA 2KM2A 2GNMA 2WAOA 3JD71 1FMD1 1MEC3 3NJVA 4IE5A 4M00A 2J1EA 2QQWA 3QCWA 5EQUA 3H8XA 1O3RA 3H8RA 2PXJA 4W4ZA 3CJXA 1SBEA 4WVMA 4ISRA 5JSRA 2WT2A 2CL2A 2JG8B 4UFHA 1GWLA 3NKGA 5IYYA 1OD3A 4XE9A 2CNAA 1WLWA 2VMEA 3K75B 1Z0HA 5FYVA 2BWAA 3ZIWA 2V5DA 2CAVA 1T6BX 3OYWA 4FFGA 3ZFFB 2Z4FA 3ZFGB 4BIOA 4YPJA 2X5IB 2BGOA 2Y6FA 4K3UA 2XQXA 4BYYA 1GSLA 4JGZC 5EFUA 4CDQC 3KVBA 3E6BA 1RUJ1 1S1AA 2FMYA 3CHXA 2D6MA 3RZGA 4OULA 4QPWA 1DGRN 4LKEA 3WP4A 5DUWA 1JODA 4IW3A 4KU7A 4R9CA 4Q8KA 1IZ3A 1GYKA 1OMIA 2VOWA 1AXKA 1S2EA 2P4EA 1RINA 3PIGA 5DXDA 4OI1A 3OUJA 1VMJA 3F2ZA 2W3JA 5J48A 5LK7B 4GH4C 4DINB 1VBE2 4FXGB 3VHRA 1HB1A 4EWEA 1ZZ7A 4Q4X1 4XXPA 3MDPA 1GQHA 4B7KA 2JG8C 5F3EA 5FTTC 2VR4A 4AAXA 4RL7A 1H1IA 3ZXAC 5DZGA 1FYUA 1ZRRA 1RC6A 5HI0A 5JIAA 2W52A 1UL9A 1OUSA 2RR13 1LECA 4JHTA 1S4CA 1XQNA 1G9FA 2C24A 4KMQA 4PHZA 3GYDA 3ACIA 3ZFFC 2OZJA 2JE9A 1CAUA 1HJFA 1ND3A 2D3PA 3ZFGC 1W8WA 5FZEA 2XB6C 2X5IC 3UT0A 4PF1A 5I8TA 5CG9A 1BEV2 1SCSA 2YC2A 2B8MA 3I4IA 1GANA 2UWAA 3J8F3 3NNGA 4OUEA 1ZZ9A 4RR3B 5DUXA 3LEKA 2NLRA 2RS13 4YZ1A 4A42A 2ADDA 4OUSA 4EROA 4B1LA 1ZBE1 3T2QA 5DMYA 1XC6A 3BUCA 3SXWA 2UWBA 2C9AA 2ZKNA 4YLZA 3DXUA 1RUI3 1H2LA 1JZ8A 2DTYA 2VTFA 2QBXA 3R4SA 5JR2A 4Q1PA 4XQWA 1LKNA 3NV4A 1NLQA 2XJQA 3LA3A 2ZZQA 2ZGQA 4CP1A 1XE8A 3LB9A 2KD7A 3RWNA 1PVXA 2Q4SA 4QDRA 5F3IA 5J98B 3ELNA 1VMHA 4QHOA 5CFDA 2ZHMA 3X29B 3KWVA 3ZSLA 1VE0A 3DXTA 2ZBJA 3BU0A 4AFCA 1NG0A 1SDWA 5FP3A 1W9WA 4D3WA 3ZYGA 4AQSA 3V56A 1UU5A 2WBKA 2IXJA 4IDZA 5A3NA 3TN91 2WFF3 4LKDA 1G86A 5LA2A 3HEIA 4CRQA 1RHI1 3USUA 1UYXA 4LHSA 4RA0A 2Y6GA 4META 4QGMA 4RR3C 5F3GA 3LSDA 1EPZA 2ZEZA 4FPFA 2VTXA 4GB32 4JKMA 1D7PM 4XCBA 1GP6A 1JUHA 5ACA1 5FXWA 4Q0VA 4GKXA 1G7YA 4QX8A 1EV13 5FQ0A 3O1SA 4DUVA 1FI2A 5FOJB 4JDNA 5E89A 4LORA 2ZA9A 3I2HA 1C57A 3N9NA 5D21A 5FYUA 4TZDA 4JGZA 1CZSA 3LWCA 4CDQA 3AVRA 3ZYRA 1US2A 5JPNB 2HWC1 2Z2SB 3KMHA 3ZYIB 2R071 3ZFEB 5ANNA 4XYXA 1G8WA 2NM1A 3ZYFA 3QH6A 2ATFA 4JQRA 1YLLA 2ZX4A 3SH4A 2VMDA 1NUKA 1ASJ1 3KSCA 4QXHA 3MLLA 3OPWA 4D69A 3VZOA 2WKKA 4O9EA 5DAWA 1V00A 1G6NA 4GH4A 5FZIA 1V0AA 1OLME 1AJKA 5I91A 4CZSA 1CN1A 3HT1A 4EZ4A 2JG8A 2WZR3 4COWA 1MS4A 3SCFA 2V4VA 5JR7B 2VOXA 2XJVA 1O91A 4KGGA 1QJY2 5T5PA 5FP4A 3RZZA 4GWJA 4ASLA 2J1SA 4LOSA 4MXWB 3BALA 1K5MB 1TMF2 4MLOA 4R4XA 1XNAA 5EJ3A 1ULFA 3DF0A 4IGPA 2ZEYA 2QDRA 3ZFFA 2ZX3A 1H30A 4FPKA 3O0XA 4QQHA 3S6PA 4AVSA 2F17A 5FZ7A 3ZFGA 4BDVB 1X82A 2X5IA 1FOD1 5T55A 4CU7A 5C3OA 5HV4A 3Q8CA 4Y26A 2CHHA 5F2SA 5DDJ1 4TLFA 1X33A 1FV2A 5HPOA 5FYSA 2HYXA 4Q29A 2JDYA 4P14A 2PYTA 3CKHA 3M3QA 2DU1A 1CIWA 2DV9A 3POEA 3WQ7A 3ZFEC 4A2UA 3R4DB 2VJXA 1RL3A 2ZGRA 4W65A 1X9PA 4HN1A 4YGBA 3P1IA 5K0UB 5FY9A 4XJZA 4XFIA 5EP9A 3ALQA 2E32A 3BOWA 1UX6A 3T08A 1IS6A 1PVC1 3QOPA 2DBNA 4EN8B 1GZTA 2FZ2A 2G19A 2JG9C 2O1QA 1N47A 2C5DA 1RVF2 3BTZA 3OBAA 2ET7A 2W1SA 3NAPC 5HCHA 3H7JA 3DYPA 3WVJA 2O8QA 3JCIA 4YZ3A 2WSUA 5IVBA 1YI9A 1AXYA 2VNOA 3VL8A 2CGOA 3OJBA 4L0PA 1W2AX 4LBQD 4AFMA 1CIYA 5IK8A 4RR3A 2VZOA 1FATA 5LRRA 2VW2A 4JZRA 5JXGA 1N1YA 2HWB2 2XOMA 4LBKA 2W91A 1DGWX 1XXNA 2A6ZA 1C8M1 1Y9MA 5AFEA 3A0KA 3FC0A 1X8MA 1CESA 3F95A 5K0UC 3IIIA 4R8HA 2PHRA 5FPVA 4ZXKA 2ZHNA 2Y6HA 2EXJA 3RGBA 1HRI3 1UU4A 3DYOA 1ZA7A 1QH6A 4XDPA 3KLSA 1O3TA 2WR9A 3VDBA 3S0MA 2PLV1 5LY1A 3WHTA 2DVDA 1DU3D 2RHPA 3VBFB 4Y22B 1QJX3 1DZQA 4ZY9A 3TN93 2OQ7A 1FMD3 4KWLA 2A71A 4QWNA 4R9BA 4XAEA 3LPFA 3I8TA 2A3WA 1H1MA 4AI8A 3OGGA 2EXIA 4DY5A 3I3QA 3PVEA 5L73A 5IFPA 5I0UA 1RUD1 1UN1A 2YROA 5IUQA 4LK7A 4NOTA 1DQ0A 1LEDA 1WW6A 1D0HA 4C1WA 4BQWA 5LW9A 2VMHA 5JMOA 2RDSA 1GQGA 4PDWB 4QKBA 1W2TA 4LBJA 3Q8EA 4PI0A 4YG3A 2EVXA 4ES9A 3CLPA 1QH7A 4HSLA 4MO3M 4YZ5A 1UCXA 3HBZA 3B94A 5F5QA 1ENSA 4NWVA 4JVAA 3H42B 1JYWA 4FQZA 4KG0A 3RVHA 1JOPA 2VQUA 1RUJ3 1QHDA 5FY4A 1HB3A 1D0GA 1WCUA 5SV5A 4IEPA 2JDUA 4AVCA 4QPIC 3WUCA 1H1AA 4E2SA 1DF0A 3AYEA 2NPIA 1MVQA 3ZFEA 3K4AA 1OQEA 1FNYA 2W9XA 2VZVA 3CU7A 3AB0A 5F8PA 5C4WB 2PTMA 3HNBM 5BNPB 3RZMA 3BIWE 1JU4A 3LIHA 3J7NA 4J25A 4Q4X3 3D6EA 5CFCC 4AVAA 5FZCA 1RUH2 1ZBA2 4JGYB 4EQVA 2MEV2 1Z7S1 2MHFA 1MZ6A 3A23A 3UKNA 1T6GC 1BMV1 1XU2A 4HKWA 4U2AA 1UOFA 2AACA 4BLJA 2JB4A 2HEWF 1OVSA 1TE1B 3NNFA 4OI2A 3E97A 4PDWC 4WZCA 2BDRA 3C3VA 5CZKA 4MV2A 1XNDA 2VQAA 5JIUA 2VUDA 1GZWB 2JG9A 4JTOA 3HN3A 3POIA 2B45X 2P3IA 3E1F1 1N1SA 3E5XA 4HFSA 4Q0QA 1H9WA 1HXS1 3B3QE 1BVP1 2OPWA 2Y26A 2CAUA 2ZGPA 4NO4A 5JOYA 1RJ8A 1ST8A 3MF9A 4L11A 1OPOA 2ORXA 1OSGA 2ZEXA 1DP0A 4A7YA 1WUVA 4AK3A 4RGGA 1ZBE3 2B9VA 4XHBA 1PGW2 4L2NA 3SITA 4ET7A 5J1XA 2WQ4A 4R52A 1YQ8A 3CMGA 5FK8A 1I5ZA 4XUTA 2KXLA 3L9JT 5CB7A 4UFIA 3RDIA 2R49A 5C4WC 4I3PA 2HWE1 1LJ7A 2A3XA 5K0UA 3WINE 2DFBA 2P3JA 3O0VA 3POWA 1IGOA 1K5JA 2V5YA 4I3GA 4X6RB 4Y5TA 5GKAC 5KBFA 2EIEA 3DYMA 2PAEA 1LHOA 4JGYC 3PNAA 4PLMA 3LFIA 1ZM1A 1BYHA 3OD4A 2A70A 4F7ZA 3WF1A 2RM21 3O0WA 1NCQC 3AYDA 4SBVA 4ISQA 1YI7A 2Q30A 4ZONA 2ZCWA 4E8CA 2WABA 1QIQA 1WBLA 4HK9A 4K1ZA 5A3OA 2C1FA 1LHUA 1RHI3 3M3CA 4JRLA 4HVOA 4N90A 4BQ2A 5FZ4A 3ZPYA 1JS9A 1DCSA 1XNBA 1DLCA 2XJSA 1KRIA 4QXCA 2ZMLA 3KGZA 4ZU4A 1YQ5A 5L36A 1JHNA 2Q8OA 2XQRA 1CJDA 4CP2A 1VR3A 3O1TA 4M4PA 2YU1A 2VZTA 4AHYA 3RZLA 1OOPC 1CJPA 4BH9A 4MH0E 4HL0A 4FPEA 3SHRA 4V2VA 1MACA 3RYKA 3B01A 2ZMNA 3UK9A 2R073 2IXIA 4R9AA 3R05A 2QQVA 1UY1A 1VB4A 1WMXA 4QPIA 4A41A 3C2UA 3CZJA 5A3WA 2UYBA 3PUHA 1A34A 1D4M2 1SLBA 3ES1A 4MX3A 3GZEA 4RFRB 4XFFA 1JYVA 3RZJA 3NL1A 4RYDA 1DQ5A 1GMMA 1R091 3VBFA 5DZFA 1RUF2 1J1LA 3B02A 5FYMA 1OA2A 1S0IA 5D2AA 1FT9A 3PHMA 5AC91 5CFCA 3THDA 2D43A 2VUCA 2WS92 5CKQA 4G9SB 4BB3A 2OKXA 3ZIXA 3E5UA 5ISLA 1JXNA 2J1VA 2DURA 5FIXA 3LD8A 2CSGA 5ANQA 3WG1A 4LBQB 3WUDA 1W8UA 4PDWA 2AH2A 1F35A 4N7UA 5FO9B 2VNRA 3LSEA 2J7MA 2XLAA 1CD3G 3HPNA 1RUE2 2CV6A 3VBOB 3W58A 2JICA 4IETA 2D6PA 1W6OA 3AL5A 5DDJ3 3NVCA 2R7EB 4N9HA 1UY0A 2H6CA 1YFYA 3MIEA 3MPBA 1A78A 2Y6LA 4AVBA 3NSTA 2FCUA 5L9RA 2W46A 1TME2 2HWF2 3KM5A 2VD7A 3AKPA 5LA9A 4K7JA 3VBHB 5E16A 2A6YA 1KD7A 4NHKA 2VVDA 5JZGC 1A8DA 2W39A 1V6MA 4XETA 4FTSA 2AUYA 2WO2A 1X7NA 1HN0A 1V6LA 5JVVA 5C4WA 3WF2A 4R4ZA 3HNYM 5BNPA 4IGQA 4MHRA 3SEEA 4FSJA 1UMHA 2Q5TA 2RS52 1JZ4A 2PHDA 5ABJB 4JGYA 1PVC3 2DUOA 1V9U2 2AZ5A 4JQTA 1A6CA 1BVVA 2Y6KA 5G05L 1KFXL 1VBE1 1ZNPA 5FJHA 4XDOA 1NCQA 4NN0A 3T0AA 4ZZ8A 5FMDA 3VHNA 1QQP2 1UZWA 2NQYA 2UYAA 1GKBA 1CPNA 2LS6A 5KHGA 3RFRA 3FHAA 5FK7A 1GZWA 3QH7A 4OCTA 3WW1A 4KQ7A 1UF2C 3WG3A 4LEJA 3VBOC 1RUG2 4LE3A 1DGWA 4XJ8A 2QQLA 2WWUA 5FPXA 2C6SA 5FYHA 4HPKB 4LKSA 3AKQA 2UY8A 4DEQA 5BNPC 3WDWA 1BEV1 2BJSA 3M3IA 1O4YA 1F4HA 1UPIA 1C8M3 1MZ5A 5CISA 4BMBA 1AR72 3VBRC 3BIEA 4LTAA 3AZZA 3C8XA 1OOPA 3I54A 2N7GA 3KT4A 2JECA 1NYWA 4XF1A 3N7MA 3ILNA 4HONA 2P2KA 4DUWA 4G4FA 3O14A 1CGPA 4MOAA 4BCUA 4XMAA 2PLV3 1VRH1 2W08A 5ABJC 1W0NA 4P9YA 1W05A 4WVMB 4GQ7A 4K1YA 1YQCA 3IAPA 5FAXA 1AL0G 3PUAA 4LR4A 1NXMA 2VL4A 2VZPA 1K42A 3GNEA 4QM8A 3AJZA 3S5QA 1RUD3 2BBAA 4QU1A 2YGMA 4BK5A 5IATA 4JAAA 3V0BB 2XPJA 2BGPA 3FUQA 3H8OA 4JDMA 3OYWB 5LB6A 2PA7A 4GMP1 4IUGA 3I59B 5CEHA 1H4HA 4OVEA 2JKBA 2WAAA 1C4RA 2BYVE 1R1A2 2W0XA 3BPSA 1AR62 2XGXA 3PL0A 2B7YA 3I2FA 1LGNA 2WO7A 2P6HA 3BTAA 4Q27A 3LAGA 1GFF2 1DDLA 2WZEA 3GDBA 4MGQA 4CA9A 5JCTA 5A6QA 5FPUA 2P34A 4GB31 5GZDA 1JYIA 1GP5A 1DG6A 1H4GA 2WDBA 5FY0A 4AVVA 1MZEA 5E6HA 5JXHA 2GSYA 5APAA 4Z2AA 4PIYA 1C28A 3GHNA 2HEVF 4AYUA 4Q0SA 2GMPA 4M3CB 2IUWA 3JQXA 3CJIB 1RTVA 2GH8A 1UU6A 2WYFA 3PMSA 4YG6A 4XFBA 5F3CA 3LFMA 5A80A 1KS4A 2ZACA 4FQ4A 1WCDJ 5EJZB 5F32A 2WO3A 5JZGA 2NMNA 1AYM2 4JTNA 5DAXA 3ACGA 4YGDA 3SC7X 1Z7S3 2J42A 3RMYA 5F7UA 4QB6A 5L9VA 5F6LB 5A6ZA 2VMIA 3B93A 1YUDA 1NAEA 3H1MA 3EQEA 5FYZA 2AGSA 5FZFA 3N9MA 1RYYA 1ND3B 5BNOB 5JXJA 1IKPA 4RN5A 1BQPA 2G9GA 4HMZA 2XJRA 4LBQA 3IMNA 1AZDA 4QGLA 1PX3A 1SMVA 2AENA 4HG6B 1QJY1 2ZGSA 2ERFA 3AP6A 5IAXA 1IPSA 3IDEA 2K46A 1LCLA 5EXOA 3VBOA 1TMF1 5LZ6A 4Y20B 5FY7A 1LODA 1QXJA 3ACLA 4AI1A 1DQ4A 2R0HA 4M3CF 1W9SA 3PVBB 5LA0A 4XACA 4FFIA 1H8VA 2YY1A 4BQ3A 3CJIC 5FZ8A 4M01A 4QD2A 2HWE3 3KV6A 3O1VA 3MO4A 1VBB2 4YM2A 3VBRA 5HV0A 1IQDC 1XYOA 2EAKA 4V1PA 2BTVC 3CO2A 4UW4A 4Y1XA 2KR2A 1IS4A 5FUIA 2R0FA 3VB9A 4DQAA 2DVFA 3AKRA 5A7OA 4HANA 4TLGA 2FDKA 4WVVA 5ABJA 1C5HA 2YXSA 5IK7A 3S5AA 4UI9L 2VECA 5FZGA 3WP3A 2VG9A 1ENXA 4QT6A 5BNOC 1Y4WA 3MUZ1 1KS5A 4ZHNA 3LEMA 5K4LA 3RZKA 4Q4W2 4XF9A 4O65A 5JI9A 5KXEA 3HR9A 5IFTA 5D8AB 2QKDA 4BZ4A 4QXBA 3WXPA 1KJRA 1XNCA 2CTVA 3DECA 3VD3A 2ZX2A 1RMU2 4CPBD 3FX3A 4S2DA 2D6KA 4XILA 1RVF1 4CYDA 2A6VA 4TYSA 5DZEA 2NP0A 1POV0 1X50A 2Q1FA 1UMIA 5CKMA 3ZSJA 4HPKA 3M7AA 4UW3A 4CDQB 1UOJA 3THCA 2DYCA 3O1RA 5FLHA 1PZ7A 4XQDA 3KHBA 1OQDA 1HRV1 2HWB1 1MS8A 1ULPA 1VBD2 3IPVA 3ZXJA 3UETA 1BK0A 4CDWB 2VCMA 5FP7A 3FZ3A 2P1BA 4CUGA 2Y60A 3RPQA 3FUOA 4Q4Y2 2RS32 4GH4B 4UFKA 1LESA 2R062 1R093 5K8SA 2R041 5L7OC 3AMPA 4Y1VA 1OH3A 5AC93 3VBUB 4Q2FA 4NPLA 2OT7A 2ZZJA 1MEC2 5D8AC 3VKMA 3V0BA 5IJRA 2JIGA 1CAWB 5FYBA 1WD4A 5LWBA 2PAMA 1NZIA 3I59A 2R1DA 3KB5A 3WCRA 4HVRA 5FY5A 4Q5OA 3UGFA 4FCAA 1GICA 2P17A 4QU2A 3SMHA 1VB2A 3NW4A 1W8HA 4DUXA 4IERA 3I97A 2ETEA 4QX1A 1PNGA 2XKOA 5IWFA 1WLDA 1Q8PA 2IFRA 2VZQA 1OQ1A 3U14A 1F4AA 4E4ZA 2J1AA 3RZHA 3PVNA 4PBOA 3ZLIA 4AEDC 4CDWC 1AR83 3ZR5A 5FYTA 2JE7A 2D6OX 3ZDVA 4BMEA 2CWSA 4M3CA 2B5HA 4XC9A 3CJIA 1HQLA 4H7MA 4XW3A 4I0BA 3HVDA 3KHCA 3N35A 1S2BA 3LCPA 5KC5A 3POBA 3B69A 3UV9A 4BQ1A 1NY72 3VD4A 4FAGA 3BKZA 1QJU3 2EIBA 3UGHA 3NWKA 2O14A 3VBUC 1FPN2 4NJ4A 1W8OA 1S0CA 1RXGA 4JDOA 1VBA2 2AR6A 1VBE3 4CU6A 1ODNA 5C8WA 4E4DX 3U75A 1RUH1 1ZBA1 3P3NA 1SFPA 2MEV1 2VXRA 4JX0A 4JV4A 5FPBA 4EN0A 5BNOA 2GMEA 4CUBA 3V64A 1J3QA 1VPHA 3MI8A 2WNOA 5F5IA 4Q0PA 2WA3A 4GAZA 4KWUA 1NT0A 4D7SA 3KCXA 4YW1A 2E7TA 5CIRA 4OQ8A 1UWWA 3N9LA 4A44A 1WZXA 2UWCA 4AFDA 2AYHA 4COZA 1BEV3 4XMIA 4Y20A 5DG2A 5LA1A 3B9IA 4UWDA 2GH2A 4Y1UA 5JOXA 1S0BA 1G9AA 4AI2A 5AFBA 1F9KA 3NJYA 5KWRA 3TRSB 3SKVA 4ZZ5A 4ASMB 1HLCA 4FAHA 4CXXA 1PGW1 1UIKA 2QZ3A 5IVJA 2E26A 3SEPA 2YYOA 3JUUA 5CA6A 1B35B 2VOTA 1E5HA 1VRH3 3BCWA 4XQ4A 2Q8CA 4MG2A 3HAGA 5DABA 4CTEA 5FZ1A 2CYFA 5EWSA 3HBKA 5CKNA 3MLKA 1XSQA 5L7OA 4AVTA 4DY3A 3KT1A 4Q4V2 2XJTA 4QDSA 4QX2A 1TNRA 1YHFA 2OPKA 4ZS2A 2D7FA 4GMP3 3K3NA 5D8AA 1JOBA 3WF3A 3ON7A 1CPMA 3IN9A 2WFF2 4PF5A 3I2DA 5GZFA 4BQXA 3I3EA 3U37A 3J7MA 4RFT0 1ZZCA 2I45A 2XLGA 1F8VA 4GJZA 5FZAA 1XRUA 2BGCA 2WQZC 3T4VA 4CP9B 2ZGNA 1L7RA 4GB33 1OH4A 1OPMA 3CF6E 2UU8A 4UFJA 2D93A 4C1XA 5C3PA 1LB2A 4FP3A 3ITQA 2EALA 5A7SA 4MGYE 1EPWA 5FZBA 5DUVA 3U07A 5BNNB 5F37A 3KF5A 3I3DA 3ZXLA 2VW0A 2RJKA 2XHKA 2YV8A 4DXZA 2W68A 4GA9A 1B35C 5FZ9A 1QDCA 4AEDA 2HH9A 2WA4A 5DPNA 4CDWA 3O1UA 2RDNA 3ETQA 3T2TA 2WO1A 1MS5A 3OBTA 2PQQA 1QXRA 2LROA 3WSOA 2GC0A 3IDCB 5J09A 1K12A 2TBVA 3ZXEA 1UZYA 1NE4A 2PHLA 1ZX5A 2B39A 1SHWB 3ILFA 3RMXA 2BP6A 5JDBA 2JDAA 1D4M1 2YPDA 2DUQA 4K40A 1DQ1A 3LDBA 2WLPA 3VBUA 5GZCA 2JG9B 4QX5A 3T1MA 1RUF1 4ATEA 5JLVA 1F15A 4BQYA 3E6CC 1R082 3AP9A 4OHXA 4FTBA 3ZN6B 1X8EA 3N4MA 1CAWA 3NAPB 3SCGA 2ARCA 2WS91 1L7QA 3H3UA 4EV0A 5GZGA 3O1PA 4MGZE 1BLZA 4MZUA 4LA3A 3ORJA 4XOGA 4TTGA 4GZ9A 1QJY3 5A33B 4XHXA 1NCRB 5DAQA 1H2NA 5CVRA 4OQ9A 3WDVA 1E5SA 1TMF3 1WLTA 1C1FA 2X29A 2Q8DA 3ZXFA 5BNNC 1VBC2 2Y6JA 4TXWA 1RUE1 2OQ6A 2NYYA 3RRDA 1V6JA 4LO8A 3ACHA 3RI9A 1X36A 3NJZA 3MUY1 3CDZB 4QQPA 5JI7A 1JYTA 4IEUA 5A6YA 2YDEA 3WV6A 2PHWA 3ZSMA 5FZOA 1HB4A 2XWJB 2HWF1 3GF6A 5IVYA 1ZVFA 1E5RA 2ZS6B 3AYAA 4LBOA 2ORZA 3AJYA 2WNVC 1UOBA 5FO8B 4XZPA 3PUQA 4L99A 3JB8A 4UXAA 2YHJA 3NV1A 2X10A 1FX5A 1MR5A 2VGDA 3BB6A 3VKNA 4CU9A 4EYUA 5KHKA 1CAXB 5T5LA 4JC1A 3R6SA 3WT3A 4NHMA 4X8PA 4P9IA 1KDKA 3T2PA 2VC9A 3SQOA 1XJAA 5C7GA 1Y9QA 5C8CB 4W50A 2RS51 3WP5A 1RIRA 2XBO1 2CDPA 1V9U1 1OXCA 2VPVA 1ULCA 4CVUA 1YQ2A 4CCCA 4OLLA 4MYEA 1PMJX 2ARBA 1NCRC 1QQP1 3WR0A 1RVF3 2FDJA 1UIJA 3OEBA 5FPZA 2ET1A 2ZXQA 2WQ8A 3OBRA 4KU8A 3PUSA 1WCKA 1COV2 1W99A 2JXAA 5EZWA 5TSWA 4BIFA 3GHMA 1RUG1 4YW6A 4LHKA 1VAKA 3KV9A 2E31A 4Q1RA 3ZYJB 1UO9A 5FMOL 3HMYA 5IVVA 1LENA 1VRBA 1ND2C 2SBAA 1HRV3 2VMGA 4QPIB 1W3VA 3VZKA 2FCVA 4DRRA 2ZGUA 1VP6A 3MGUA 4WM7B 2ZPXA 5IVFA 2YBPA 1AR71 3JD73 1IQAA 2YG0A 3WQBA 4K8RB 1B35A 2B42B 4RHV2 1TZOA 1V6KA 3RJRA 4ASKA 1DGRA 2R043 3FL7A 5CFCB 4XBQA 2F6BA 4YVSC 3KS7A 2LUWA 2DDUA 2XJUA 3LQCA 3POSA 1OLQA 4OZOA 1PGL2 5C8CC 1U0AA 2ZGTA 2GNBA 4P9GA 5CNAA 2QUOA 5C71A 4YM3A 4IEZA 4IE6A 4EN9B 4IEVA 1LAJA 1STMA 3WDYA 4AEJA 1F5JA 4B4RA 4BE3A 3RS6A 1ONAA 2PHFA 3H0OA 1N3OA 1TNFA 5CU1A 1PNFA 3RI8A 4LO7A 2VAUA 5SV8A 1W6OB 2E33A 5LBEA 5FFOC 3VL9A 2QFEA 4HLTA 4CCEA 2OX0A 1R1A1 3K77A 2BV4A 1AR61 4A6SA 4CP9A 4IGOA 4RSUA 3T0DA 2Y64A 1DQ6A 3OPTA 1OLRA 3ASIA 4I30A 3N9OA 4KBBA 4OFGA 5A7PA 4COUA 5C9AB 4LT5A 1L3JA 4XFAA 3LDKA 5J37A 1F31A 3WOGA 4N53B 2IWGB 4WM7C 5BNNA 2BOJA 4LITA 3EO6A 1AX1A 2AC1A 5B2GB 5A3LA 5BV6A 4YWAA 3DCQA 4LKFA 1PO22 1S0FA 3VDCA 2QQOA 3LE0A 1LHWA 3WQ1A 3MICA 1N3QA 5FUNA 3SH5A 3AL6A 2NN8A 1MS0A 1NCQB 1PO12 2DFCA 2WNVA 3H3LA 3VD9A 1IG0A 1Q8VA 4LPLA 2HWD2 1OLMA 1AYN2 4E4SA 1JW6A 4FOVA 4Q4X2 1JZ5A 1AYM1 1RUH3 1ZBA3 2YC4A 3IM0A 2MEV3 1Y7BA 5FZ6A 2TNFA 4A7ZA 4BQ4A 3HQUA 3WNNA 2GALA 1ALYA 3ZN6A 4CPBA 1BK1A 1UZ0A 3NAPA 1DYKA 1DQ2A 3OF1A 4YNIA 4X6QB 1DGLA 5A33A 1NCRA 1NLSA 5C9AC 2G1MA 2I07B 2VNVA 2G4IA 2WINB 5T5JA 5HCAA 4N53C 1OOPB 5FLIA 3ZXGA 1GWKA 2GP5A 2J1RA 3CQOA 4IQPA 2E63A 1JTZX 2R32A 3AZXA 1ZBE2 4QB1A 3KF3A 1C5IA 3WNMA 2C26A 4DXRA 1J58A 3OG2A 1WWYA 1ND2A 1KFUL 2O0OA 1SLAA 3BU7A 2JDMA 1GNYA 3POYA 3HD8B 2B9UA 2QE3A 5FKBA 1XB9A 1RGSA 3JBG2 1KITA 5F5AA 2Q8EA 1O4ZA 5IW0A 3OUHA 1VBB1 1I9RA 4NPMA 5AVAA 4QQLA 2BOIA 1CAXA 4DMIA 5FMOS 2PHUA 4QX0A 4YVSA 3NNMA 4YW4A 1AR92 1JHJA 3A4UA 4XDQA 2VVEA 4FFFA 5C8CA 5H9RA 4I0AA 3KCYA 4E9KA 2BWCA 5H9SA 1OBNA 4F3JA 2A6WA 5LBBA 2EF6A 4Y3OA 4CCKA 5ACA3 2YC0A 1LR5A 5A1AA 2AEYA 4Q4W1 1U5YA 2RDRA 2XHNA 1FV3A 4WM8B 1W2UA 3K51A 4NMIA 2IVJA 4AOCA 2IXLA 1RMU1 3ILRA 4IEQA 2WT0A 1W28A 3UGGA 4P08A 3HJRA 3AKSA 3GBWA 4V2WA 3ENRA 3W5NA 5LBCA 2HWC3 3ZN4A 2F4PA 4C0HA 2VBBA 1UZZA 3C7FA 3TEYA 4UAPA 3HOBA 5JZGB 4D7YA 1ASJ3 4BK4A 3LEIA 4EWDA 4WM7A 2TUNA 4IL7A 2W1UA 1VBD1 2GNTA 3PURA 5IVCA 2ZGLA 4XUPA 3ACFA 2ARXA 5F5CA 2K0GA 5FRAA 3N9PA 4P9LA 2VUAA 1W8ZA 3OUIA 2RMU2 2BVBA 2DCYA 4Q4Y1 4NRMA 3MBWA 1D2SA 2R061 5FLJA 1RUF3 3L2HA 4H2AA 3ZXKA 4INDA 1UYPA 4IE4A 3THPA 2W1WA 3J9SA 2YGLA 3AM2A 1POQA 4BA6A 1TG7A 2VO5A 1LHNA 1PM7A 2WS93 4YVWC 2XG3A 2HJIA 2VQ0A 2HYKA 1MEC1 4WM8C 4YM1A 4C90A 2ADEA 2QNKA 1P8JA 2R1BA 3CL1A 1FOD3 3CNAA 4IV1C 4NPRA 3VZMA 3WDTA 2VE1A 1PIV2 2RDQA 3A7QA 1W6PB 1AL22 4ONUA 2VMCA 3UJOA 1IS5A 5FUPA 1HIXA 4S2HA 1RUE3 3WQ0A 4Y22A 1MQTB 4XPVA 4OUMA 5C9AA 4I02A 3B00A 2VCAA 3VBRB 3GZUC 4N53A 4R9DA 4YFWA 4C8DA 4E27A 3AYCA 1UXZA 2PFWA 3FLTA 3M3OA 4AGVA 4ZKTB 5KXDA 2ZMKA 3HNMA 4IE0A 5BPXA 4D7TA 4CCJA 3CIHA 4DFSA 3PJQA 2LTNA 4DO0A 1DBNA 4CUAA 1ZREA 5EPAA 2DWRA 3WNOA 2OUJA 5C70A 5FY1A 2CGPA 2BBVA 2VW1A 2PHTA 4AFAA 2JD9A 2YB7A 5KXCA 1NY71 1Y43B 4BLIA 1YO8A 2QZ2A 1CVNA 1YIPA 5FKCA 5LY2A 2RS53 3KZ4C 4A4AA 2XBO3 4KWJA 1FPN1 1LULA 1V9U3 5EJ1B 4O61A 2WZPP 2DVGA 3WNKA 3BVCA 1UY3A 1VBA1 3MFCA 4C0BA 1M06G 1KDMA 3G7DA 3B7MA 4YFZA 3N3HA 4K6BA 4CE8A 1QQP3 1US3A 1KEXA 5CAZA 4B1MA 4KL1A 4UYBA 1OFSA 3O12A 2OW4A 3I3MA 3ROUA 1MQTC 1BCXA 4KBZA 1RUG3 2ZX0A 3U4XA 3W5MA 3S57A 3VHOA 3IPVB 1SLTA 3D0SA 3MW2A 1WW4A 4AI0A 1PHMA 2DTWA 2WNUB 1YC61 3EB7A 3GGLA 3IBMA 4O9GA 4WZFA 1U5IA 3J7LA 4KNCA 3L2YA 1MS3A 2WT1A 5GJ6A 4CEWB 4UFMA 5JUVA 1QOOA 1W2NA 1AUYA 1AR73 1SDDB 2Z79A 4A3ZA 4B3NA 2F4LA 3CZUA 2DU0A 5DG1A 2QQMA 3H9AA 4HKLA 5HBAA 3S7IA 4AQTA 1HKDA 2RJLA 5B4NA 1REEA 1H2MA 1QJFA 2WYSA 4N9IA 4B4PA 5CYYA 2OS2A 4QX3A 5FZMA 3WEZA 3FHIB 1A8MA 2A73B 1EAH2 1JZ2A 2ZGKA 4XBLA 4DPNA 1W04A 3OD0A 4QMAA 4P5HA 4AGRA 4GJYA 4NAOA 3NO8A 4Q4V1 2CWMA 4OHZA 2R16A 5C5TA 3GCXA 4M0HA 4YVWA 4XEZA 1NZCA 2VZSA 4PIZA 4WM8A 5FYIA 1JOJA 4S2GA 2JWPA 5GLTA 4IV1A 2E51A 1R1A3 2PHXA 1AR63 5FZLA 3VD5A 2WFF1 4BJ0A 1YFWA 3J7HA 2WNUC 4NR1A 4LNVA 1GLHA 1XE0A 5HCBA 4QPGC 5C33A 1UXXX 4XTPA 1UMZA 3MEPA 1CR7A 4CEWC 3ECQA 4FPGA 1SBDA 4A3XA 2XONA 5FP8A 1OA4A 4UOJA 3D82A 2Y34A 3TEXA 5T5OA 4A7KA 1UZVA 5GM0A 3ZVXA 3P3PA 5I0SA 1PZ9A 3AX4A 1GNZA 3TWIA 2W95A 4GXLA 4GIQA 5GLUA 5BXXA 4D6QA 5A7WB 1HX6A 2EIGA 2GC1A 2BNNA 3OCPA 4P9JA 1NE6A 1SBFA 1CONA 1BBT2 1VIWB 4TWTA 1WW7A 1X9TA 1AYM3 3KV4A 1S2KA 4A45A 5F9TA 1IKQA 1QOTA 1SFNA 1NQDA 1SEFA 2JD4A 4I01A 3WF0A 5A32B 1B09A 5FCCA 1HXS3 1GP4A 3PTYA 4Y33A 4I09A 4YRDA 4AEMA 3K46A 4IESA 4URAA 1R081 4XAAA 1EYBA 3QACA 2WWSA 4LXLA 4JKLA 4ZXEA 3MFAA 4CCMA 1PGSA 1GQPA 1W6PA 3WX5A 5LBFA 1DFQA 1RB8G 3WY6A 2EXKA 1LOFC 1V70A 3OOXA 4LUMA 4XIKA 5DAVA 2IVIB 4IEYA 1MQTA 4MADA 1UY2A 4D8MA 1PZ8A 4NVPA 1DLLA 3GJBA 3NJXA 1VBC1 4IXLA 4YW2A 4P00B 3M4FA 1IG3A 5LEJA 2BEOA 1H9PA 4DRVA 1NKGA 2XXZA 1FXZA 2JDNA 4XFHA 3WW4A 1QF3A 2RM23 2VCCA 2VQTA 2ZEWA 3T1LA 1W9TA 3WG4A 2EAAA 1VBB3 5EV7A 3ZKYA 3ZDSA 1OD5A 4L97A 5L7OB 2XUEA 1OC1A 5K9YA 1HW5A 1S55A 4NWWA 1W0PA 1CAVB 3FFQA 3MV11 1I3HA 5IAVA 2ILMA 2K2SA 4PJYA 4SLIA 4S2FA 4CP0A 3H50A 3TEZA 3AXEA 3WW2A 3MW4A 3OTFA 5GLWA 3UESA 5BY5A 4EN6B 1YFUA 4P5YA 4Q4W3 1IS3A 3H3ZA 3E6DA 3NKTA 4IV3B 5GLZA 4QQ2A 3ZMNA 1ODMA 1RUC2 2GC2A 4RQPB 1Q8SA 1Q8OA 1RMU3 4CXWA 1DIWA 3AKTA 4LHLA 4BHPA 4EZHA 4XVHA 5BYNA 5E88A 3N7KA 3QD6A 3P6BA 5E1RA 3VKLA 4DXTA 5C3QA 4DOUA 3TBDA 1J3PA 2QQJA 3NRUA 5FDBA 4AEDB 2Q0AA 1GUIA 2W1QA 2WNUA 1COV1 3O1MA 5C6CA 4LHNA 4ZS3A 3V65A 1DZRA 4QPGA 4GWMA 4EWAA 4E2GA 2MNGA 1APNA 2JX9A 2BRTA 4CEWA 3OB8A 3BOPA 4QKDA 2BQPA 3JB4C 2W87A 4AGGA 1SG3A 2GC3A 4MGTA 4IEXA 2WC2A 3T4HB 3DUIA 4LLOA 4NUBA 4Q4Y3 4UW5A 5IT6A 1MPXA 3M70A 4RHV1 4DS0A 1UQXA 2R063 2VOVA 4BU2A 2XKPA 4OI4A 4J1XA 2QQIA 3FJSA 3EXUA 4M0NA 2BFUL 4U36A 2Y8KA 4XF0A 4EJRA 1PGL1 2E7AA 3D0JA 4Q8LA 1MS1A 2RJ2A 4XF3A 2H6BA 1W39A 4IV3C 4Q26A 2O8OA 1RUOA 4DNYA 3D3AA 4RQPC 1Q8QA 1OA3A 3ATGA 1GZCA 5FYYA 4KI5M 3V0AB 1EY2A 2YMZA 2BNMA 2A6XA 1WMFA 4AQ6A 5GZEA 4IE7A 1TEIA 2VMFA 1O7FA 3POJA 4QM9A 1HQWA 1HQNA 4OMDA 2GNDA 1Y3TA 3DKWA 3GXUA 3K4DA 3Q8AA 4QDQA 4NIAA 2QCSB 1UY4A 5FZOB 2WZ8A 2XL7A 1UW8A 1LOFA 1W8TA 3HIFA 2C4XA 1URXA 3RG0A 5I0RA 2R30A 1G9CA 1QNYA 2I74A 1W06A 2EXHA 3D5OA 3DEMA 3KD4A 5AVPA 2DCKA 1AR82 1J59A 1QXPA 2D5HA 3I2KA 5FJKA 4Y5SA 3NMBA 1GV9A 2WNEA 1N1VA 3HQRA 4OHYA 1AX0A 3WZ1A 1WA4A 3AP4A 1E5IA 1Z78A 5A7WA 3PLQA 5KXBA 1PO21 3DV8A 1K45A 1NA1C 1ZRFA 4CDXB 3RYRA 1O8PA 1QJU2 3IDAA 4ITCA 4ORFA 4ARXA 5FY8A 2XH6A 1UNBA 1HDKA 2D3SA 1FPN3 1PO11 3M8LA 4BISA 2W2IA 5FZKA 5A32A 2PELA 2RR12 1VBA3 1AYN1 1NQJA 2BZDA 2HWD1 2X53S 1UYZA 2XVGA 5HXVA 3IMMA 3HT2A 5LCWL 5I8YA 3P5BA 2WN2A 1GZ9A 3NNJA 3J8F2 3OY8B 2CGNA 3PU3A 1WMDA 3WCSA 5A3TA 2RS12 1XU1A 2AREA 2JENA 4FPLA 4UW6A 1SLLA 1EP0A 1PK6B 2LM3A 2QQNA 1XBFA 4LULA 4CEYB 5A6XA 3AFGA 1Q3EA 1G9DA 2JEMA 2VZ3A 5JMCA 1RUI2 4LA2A 2YPJA 5J36A 3TYJA 4AG4A 2J22A 1WLCA 3K2OA 2D98A 1ZRIA 1Q56A 2XMLA 4BOWA 2VM9A 3FBYA 1RJ7A 3RQ0A 1S0JA 4B4QA 4YW7A 2FDHA 1UKRA 1NX9A 1XNKA 2BW8A 1QNWA 2XLFA 2ZAAA 3B5LB 3MLJA 3MIFA 4ZPIA 3HWJA 2WSVA 4QB2A 4L9BA 3VKOA 5JOZA 4CDXC 4COVA 2Y0IA 1CWPA 1J84A 3BTXA 1VRH2 3JBG1 4PCRA 2GN3A 5D1IA 4QKNA 1ACCA 1CAVA 1MS9A 1VAVA 4YSFA 3FWEA 2PN5A 4FOWA 2OVUA 3Q9OA 1POV1 2EA7A 2GMMA 3ABZA 3WP6A 2VTXJ 1NOVA 4E4HA 3VZJA 2JDPA 4MGIE 3PUIA 1J1TA 4COYA 1GOGA 2A7AA 1W90A 2XVLA 4H7LA 3VHPA 3LEGA 1AR91 1UKGA 4Q4V3 2KA3A 2LRPA 3W59A 3WNXA 1FNZA 2GP3A 4XJWA 3ZN5A 4LBMA 2FBEA 5M0TA 4B8EA 2ID4A 4IV3A 2GU9A 1JZ6A 2V73A 4TN7A 1PK6C 4RQPA 2H0BA 3AMMA 4CEYC 2WFPA 1KJLA 4LLFA 4P02B 4HVQA 1EV12 4OHVA 4BM8A 2BFUS 1UOGA 3FMGA 3LKJA 3M2MA 3ST7A 1PM4A 2ZHKA 4XJUA 4AZZA 3RSJA 4XABA 3W9AA 2Y38A 3O5SA 3JU9A 3W20A 4QHBA 5FO7B 3UNPA 2RV9A 3U4SA 2WNVB 3I2OA 1WCQA 3WD5A
chains in the Genus database with same CATH topology
1JZ5A 2YC4A 1UYYA 3C7EA 2QQLA 3WNNA 5G04L 1UZ0A 3OGVA 4LKSA 4DEQA 1F4HA 2HLEA 5JXIA 3C8XA 1DYOA 2WAOA 3NJVA 2J1TA 2J1EA 4DUWA 2J1RA 3CQOA 4W4ZA 4BXSV 4MOAA 4OMCA 4QB1A 3WNMA 4DXRA 2C26A 1W0NA 5IYYA 3OG2A 2J1UA 1OD3A 3IAPA 2VMEA 3K75B 2V72A 2VL4A 2VZPA 1GNYA 1K42A 2V5DA 2BBAA 4BK5A 2BGPA 2Z4FA 2JKXA 3EYPA 4YPJA 2BGOA 4IUGA 2XQXA 4QX0A 2WAAA 1GOFA 2EIDA 1JHJA 3I2FA 4QPWA 2WZEA 3GDBA 1GOHA 2CDOA 4MGQA 5A1AA 4CU8A 1WKYA 2XHNA 2WDBA 5JXHA 1JZ3A 3F2ZA 2W3JA 4Z2AA 1JYXA 2VZRA 3HJRA 4P08A 3W5NA 3WNLA 2VR4A 4AAXA 3C7FA 5EJZB 2WO3A 4UAPA 1W8NA 3HOBA 3ACGA 4BK4A 3LEIA 4KMQA 5F7UA 4QB6A 2W1UA 3ACIA 1NAEA 3BN6A 3VD7A 3C7GA 3ACFA 4PF1A 4XUPA 1RYYA 2YC2A 3NNGA 4OUEA 5JXJA 1LNSA 4RN5A 3LEKA 3MBWA 4A42A 4DEVA 1PX3A 1OT5A 3T2QA 1XC6A 2W1WA 4HG6B 3OGSA 1TG7A 2VO5A 1JZ8A 2VTFA 4MGSA 1P8JA 2QBXA 5JR2A 1W9SA 5LA0A 3A7QA 2VMCA 2KD7A 4QDRA 3MO4A 1IQDC 2X05A 2VCAA 1W9WA 1JU3A 2W92A 2VZUA 5FUIA 2WBKA 1UXZA 3HNMA 5LA2A 5I0DA 3HEIA 4UI9L 3CIHA 1UYXA 4LHSA 2Y6GA 3MUZ1 4CUAA 4JKMA 2ZEZA 1D7PM 5HXMA 3WNOA 5C70A 5IFTA 2JD9A 2YB7A 3DECA 3VD3A 4DUVA 4A4AA 3I2HA 5EJ1B 2RVAA 3MV01 3WNKA 1CZSA 1UMIA 1UY3A 3AC0A 1CZVA 1US2A 1US3A 1KEXA 3THCA 1BHGA 3SKJE 2VMDA 1NUKA 3K4ZA 1ULPA 1OF3A 1XNTA 3W5MA 3UETA 2EICA 3EB7A 3GGLA 2V4VA 5JUVA 2JE8A 1SDDB 4A3ZA 3BGAA 5DQ0A 4GWJA 1H6YA 3CZUA 2J1SA 3WNPA 4XUOA 2QQMA 1XNAA 5IHRA 4ARYA 2ZEYA 1UX7A 3A22A 5IJRA 1O59A 2B4KA 4W8JA 4BDVB 5B4NA 4CU7A 2WYSA 5CYYA 1R64A 4QX3A 3WEZA 1O8SA 5HPOA 2HYXA 1JZ2A 3CKHA 4DUXA 3I97A 4QX1A 2VJXA 4E8DA 2VZQA 3P1IA 1F4AA 2J1AA 4LQRA 2VZSA 2E32A 3NQHA 3VD5A 4BJ0A 3J7HA 3T08A 1UXXX 3ECQA 5EIYB 3VD4A 2XONA 4XUNA 3LPGA 3OEAA 4UOJA 2EIBA 5B4XA 2WUHA 1H6XA 1W8OA 3ETPA 3OBAA 2W1SA 3DYPA 1XPWA 4CU6A 2W95A 4OYUA 2LW8A 4JX0A 4L0PA 1CIYA 4JKKA 4CUBA 2VZOA 5JXGA 4XURA 4A45A 4KWUA 2XOMA 2W91A 3WF0A 1UWWA 4A44A 3IIIA 3K46A 5LA1A 2Y6HA 3A21A 3DYOA 4JKLA 4ZXEA 1GQPA 4FI9A 3SKVA 4ZZ5A 3VDBA 1OF4A 4ZY9A 5DMYA 3LPFA 2E26A 3IB3A 3SEPA 3I2IA 2X09A 4MADA 5IFPA 2VOTA 1UY2A 4D8MA 3NJXA 2DCJA 4P00B 2BERA 1NKGA 5JMOA 2VCCA 2ZEWA 2VQTA 1W9TA 4MO3M 4QDSA 4QX2A 1T2XA 3MV11 3WF3A 1JYWA 2VCBA 2VQUA 3I3EA 3U37A 3C7HA 4XZUG 3FHQA 4M4RA 2W47A 3UESA 1L7RA 1OH4A 4P5YA 3K4AA 2W9XA 2VZVA 3HNBM 2W5FA 3I3DA 1CZTA 1JU4A 4XVHA 3P6BA 4DXTA 1ULOA 2WN3A 3A23A 5DPNA 2QQJA 2L9LA 3NRUA 2WO1A 2YFUA 1GUIA 2W1QA 3OGRA 3WSOA 1K12A 1PX4A 3OB8A 5CZKA 1SHWB 2W87A 1JZ7A 2JDAA 4D0QA 1SG3A 3HN3A 3E1F1 4JHZA 3JXSA 2ORXA 1MPXA 2ZEXA 1DP0A 1L7QA 3I3BA 2QQIA 2B9VA 4ET7A 2Y8KA 5J1XA 4TTGA 4GZ9A 2RJ2A 3CMGA 3FN9A 4XUTA 1PMHX 3D3AA 2Y6JA 4TXWA 4KI5M 4PT6A 2EIEA 3ACHA 3MUY1 3DYMA 3CDZB 2VMFA 4OMDA 3K4DA 3GXUA 3WF1A 4QDQA 1UY4A 2WZ8A 2ORZA 2C4XA 3C7OA 4E8CA 2WABA 1KGYA 2X10A 1GU3A 4CU9A 2DCKA 2YFZA 3IAQA 3I2KA 3T09A 3T2PA 2VC9A 4GWIA 5C7GA 3I2JA 4W50A 1DLCA 1I5PA 2CDPA 3T0BA 3T2OA 4CVUA 1K45A 1YQ2A 1O8PA 3IDAA 4PQQA 4ARXA 4M4PA 1PMJX 3I2GA 3VDAA 1TVGA 5DN2A 2VZTA 3OEBA 2BZDA 1UYZA 2ZXQA 2WQ8A 5LCWL 1J83A 1EUUA 1W99A 2WN2A 3GM8A 2E31A 1UY1A 4A41A 3CZJA 3PUHA 4XUQA 1JYVA 4RYDA 1GMMA 1JYNA 2QQNA 1K3IA 2VZ3A 2YG0A 3WQBA 4QAWA 3THDA 3ZM8A 2PQSA 4AG4A 2J22A 1HN1A 2OKXA 3FL7A 2J1VA 2DDUA 2VM9A 3LQCA 2QQKA 4OZOA 1NX9A 5C71A 4QB2A 2J7MA 4CUCA 1CX1A 1J84A 3HPNA 2W94A 2R7EB 1UY0A 3ABZA 2Y6LA 2E33A 4DXSA 2C9KA 2W46A 3PUIA 1GOGA 2VZ1A 3LEGA 3K77A 1JI6A 3T0DA 2Y64A 2ID4A 2WO2A 1JZ6A 3WF2A 3HNYM 3WF4A 4P02B 3SEEA 1UMHA 1JZ4A 3VDCA 2Y6KA 2QQOA 3LE0A 5G05L 4A6OA 3T0AA 4ZZ8A 1EUTA 3VD9A 2LS6A 4LPLA 3UNPA 3FHAA 2RV9A 1WCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZ5 A;  2YC4 A;  1UYY A;  3C7E A;  2QQL A;  3WNN A;  5G04 L;  1UZ0 A;  3OGV A;  4LKS A;  4DEQ A;  1F4H A;  2HLE A;  5JXI A;  3C8X A;  1DYO A;  2WAO A;  3NJV A;  2J1T A;  2J1E A;  4DUW A;  2J1R A;  3CQO A;  4W4Z A;  4BXS V;  4MOA A;  4OMC A;  4QB1 A;  3WNM A;  4DXR A;  2C26 A;  1W0N A;  5IYY A;  3OG2 A;  2J1U A;  1OD3 A;  3IAP A;  2VME A;  3K75 B;  2V72 A;  2VL4 A;  2VZP A;  1GNY A;  1K42 A;  2V5D A;  2BBA A;  4BK5 A;  2BGP A;  2Z4F A;  2JKX A;  3EYP A;  4YPJ A;  2BGO A;  4IUG A;  2XQX A;  4QX0 A;  2WAA A;  1GOF A;  2EID A;  1JHJ A;  3I2F A;  4QPW A;  2WZE A;  3GDB A;  1GOH A;  2CDO A;  4MGQ A;  5A1A A;  4CU8 A;  1WKY A;  2XHN A;  2WDB A;  5JXH A;  1JZ3 A;  3F2Z A;  2W3J A;  4Z2A A;  1JYX A;  2VZR A;  3HJR A;  4P08 A;  3W5N A;  3WNL A;  2VR4 A;  4AAX A;  3C7F A;  5EJZ B;  2WO3 A;  4UAP A;  1W8N A;  3HOB A;  3ACG A;  4BK4 A;  3LEI A;  4KMQ A;  5F7U A;  4QB6 A;  2W1U A;  3ACI A;  1NAE A;  3BN6 A;  3VD7 A;  3C7G A;  3ACF A;  4PF1 A;  4XUP A;  1RYY A;  2YC2 A;  3NNG A;  4OUE A;  5JXJ A;  1LNS A;  4RN5 A;  3LEK A;  3MBW A;  4A42 A;  4DEV A;  1PX3 A;  1OT5 A;  3T2Q A;  1XC6 A;  2W1W A;  4HG6 B;  3OGS A;  1TG7 A;  2VO5 A;  1JZ8 A;  2VTF A;  4MGS A;  1P8J A;  2QBX A;  5JR2 A;  1W9S A;  5LA0 A;  3A7Q A;  2VMC A;  2KD7 A;  4QDR A;  3MO4 A;  1IQD C;  2X05 A;  2VCA A;  1W9W A;  1JU3 A;  2W92 A;  2VZU A;  5FUI A;  2WBK A;  1UXZ A;  3HNM A;  5LA2 A;  5I0D A;  3HEI A;  4UI9 L;  3CIH A;  1UYX A;  4LHS A;  2Y6G A;  3MUZ 1;  4CUA A;  4JKM A;  2ZEZ A;  1D7P M;  5HXM A;  3WNO A;  5C70 A;  5IFT A;  2JD9 A;  2YB7 A;  3DEC A;  3VD3 A;  4DUV A;  4A4A A;  3I2H A;  5EJ1 B;  2RVA A;  3MV0 1;  3WNK A;  1CZS A;  1UMI A;  1UY3 A;  3AC0 A;  1CZV A;  1US2 A;  1US3 A;  1KEX A;  3THC A;  1BHG A;  3SKJ E;  2VMD A;  1NUK A;  3K4Z A;  1ULP A;  1OF3 A;  1XNT A;  3W5M A;  3UET A;  2EIC A;  3EB7 A;  3GGL A;  2V4V A;  5JUV A;  2JE8 A;  1SDD B;  4A3Z A;  3BGA A;  5DQ0 A;  4GWJ A;  1H6Y A;  3CZU A;  2J1S A;  3WNP A;  4XUO A;  2QQM A;  1XNA A;  5IHR A;  4ARY A;  2ZEY A;  1UX7 A;  3A22 A;  5IJR A;  1O59 A;  2B4K A;  4W8J A;  4BDV B;  5B4N A;  4CU7 A;  2WYS A;  5CYY A;  1R64 A;  4QX3 A;  3WEZ A;  1O8S A;  5HPO A;  2HYX A;  1JZ2 A;  3CKH A;  4DUX A;  3I97 A;  4QX1 A;  2VJX A;  4E8D A;  2VZQ A;  3P1I A;  1F4A A;  2J1A A;  4LQR A;  2VZS A;  2E32 A;  3NQH A;  3VD5 A;  4BJ0 A;  3J7H A;  3T08 A;  1UXX X;  3ECQ A;  5EIY B;  3VD4 A;  2XON A;  4XUN A;  3LPG A;  3OEA A;  4UOJ A;  2EIB A;  5B4X A;  2WUH A;  1H6X A;  1W8O A;  3ETP A;  3OBA A;  2W1S A;  3DYP A;  1XPW A;  4CU6 A;  2W95 A;  4OYU A;  2LW8 A;  4JX0 A;  4L0P A;  1CIY A;  4JKK A;  4CUB A;  2VZO A;  5JXG A;  4XUR A;  4A45 A;  4KWU A;  2XOM A;  2W91 A;  3WF0 A;  1UWW A;  4A44 A;  3III A;  3K46 A;  5LA1 A;  2Y6H A;  3A21 A;  3DYO A;  4JKL A;  4ZXE A;  1GQP A;  4FI9 A;  3SKV A;  4ZZ5 A;  3VDB A;  1OF4 A;  4ZY9 A;  5DMY A;  3LPF A;  2E26 A;  3IB3 A;  3SEP A;  3I2I A;  2X09 A;  4MAD A;  5IFP A;  2VOT A;  1UY2 A;  4D8M A;  3NJX A;  2DCJ A;  4P00 B;  2BER A;  1NKG A;  5JMO A;  2VCC A;  2ZEW A;  2VQT A;  1W9T A;  4MO3 M;  4QDS A;  4QX2 A;  1T2X A;  3MV1 1;  3WF3 A;  1JYW A;  2VCB A;  2VQU A;  3I3E A;  3U37 A;  3C7H A;  4XZU G;  3FHQ A;  4M4R A;  2W47 A;  3UES A;  1L7R A;  1OH4 A;  4P5Y A;  3K4A A;  2W9X A;  2VZV A;  3HNB M;  2W5F A;  3I3D A;  1CZT A;  1JU4 A;  4XVH A;  3P6B A;  4DXT A;  1ULO A;  2WN3 A;  3A23 A;  5DPN A;  2QQJ A;  2L9L A;  3NRU A;  2WO1 A;  2YFU A;  1GUI A;  2W1Q A;  3OGR A;  3WSO A;  1K12 A;  1PX4 A;  3OB8 A;  5CZK A;  1SHW B;  2W87 A;  1JZ7 A;  2JDA A;  4D0Q A;  1SG3 A;  3HN3 A;  3E1F 1;  4JHZ A;  3JXS A;  2ORX A;  1MPX A;  2ZEX A;  1DP0 A;  1L7Q A;  3I3B A;  2QQI A;  2B9V A;  4ET7 A;  2Y8K A;  5J1X A;  4TTG A;  4GZ9 A;  2RJ2 A;  3CMG A;  3FN9 A;  4XUT A;  1PMH X;  3D3A A;  2Y6J A;  4TXW A;  4KI5 M;  4PT6 A;  2EIE A;  3ACH A;  3MUY 1;  3DYM A;  3CDZ B;  2VMF A;  4OMD A;  3K4D A;  3GXU A;  3WF1 A;  4QDQ A;  1UY4 A;  2WZ8 A;  2ORZ A;  2C4X A;  3C7O A;  4E8C A;  2WAB A;  1KGY A;  2X10 A;  1GU3 A;  4CU9 A;  2DCK A;  2YFZ A;  3IAQ A;  3I2K A;  3T09 A;  3T2P A;  2VC9 A;  4GWI A;  5C7G A;  3I2J A;  4W50 A;  1DLC A;  1I5P A;  2CDP A;  3T0B A;  3T2O A;  4CVU A;  1K45 A;  1YQ2 A;  1O8P A;  3IDA A;  4PQQ A;  4ARX A;  4M4P A;  1PMJ X;  3I2G A;  3VDA A;  1TVG A;  5DN2 A;  2VZT A;  3OEB A;  2BZD A;  1UYZ A;  2ZXQ A;  2WQ8 A;  5LCW L;  1J83 A;  1EUU A;  1W99 A;  2WN2 A;  3GM8 A;  2E31 A;  1UY1 A;  4A41 A;  3CZJ A;  3PUH A;  4XUQ A;  1JYV A;  4RYD A;  1GMM A;  1JYN A;  2QQN A;  1K3I A;  2VZ3 A;  2YG0 A;  3WQB A;  4QAW A;  3THD A;  3ZM8 A;  2PQS A;  4AG4 A;  2J22 A;  1HN1 A;  2OKX A;  3FL7 A;  2J1V A;  2DDU A;  2VM9 A;  3LQC A;  2QQK A;  4OZO A;  1NX9 A;  5C71 A;  4QB2 A;  2J7M A;  4CUC A;  1CX1 A;  1J84 A;  3HPN A;  2W94 A;  2R7E B;  1UY0 A;  3ABZ A;  2Y6L A;  2E33 A;  4DXS A;  2C9K A;  2W46 A;  3PUI A;  1GOG A;  2VZ1 A;  3LEG A;  3K77 A;  1JI6 A;  3T0D A;  2Y64 A;  2ID4 A;  2WO2 A;  1JZ6 A;  3WF2 A;  3HNY M;  3WF4 A;  4P02 B;  3SEE A;  1UMH A;  1JZ4 A;  3VDC A;  2Y6K A;  2QQO A;  3LE0 A;  5G05 L;  4A6O A;  3T0A A;  4ZZ8 A;  1EUT A;  3VD9 A;  2LS6 A;  4LPL A;  3UNP A;  3FHA A;  2RV9 A;  1WCQ A; 
#chains in the Genus database with same CATH topology
 1WA6 X;  5CG8 A;  1LU2 A;  3GZA A;  4L8Q A;  1OKQ A;  2FD8 A;  4HKO A;  3KCC A;  3C7E A;  5KC6 A;  4Z07 A;  4ATF A;  3OGV A;  3GCW A;  3R4U A;  4XFG A;  4FT8 A;  1NA1 A;  2HBU A;  2WZR 2;  5T50 A;  4X8N A;  4FPY A;  2HLE A;  2RMU 1;  2WL1 A;  1W6Q B;  3LGR A;  1OVP A;  3AK0 A;  5FBZ A;  1LTE A;  3SIS A;  5JXI A;  1RIT A;  4QX7 A;  1N3P A;  2DCT A;  3MHZ A;  5C3R A;  4HXC A;  3ZSK A;  1M4W A;  1R08 3;  2VBD A;  1DYO A;  4PIX A;  4YW5 A;  4AHZ A;  2IXK A;  2J1T A;  1U5Z A;  4OZX A;  1HV0 A;  3KVA A;  5KHH A;  4FBF A;  3V0A A;  4BXS V;  4OMC A;  1YJL A;  4LIV A;  2J1U A;  3K3O A;  3NV2 A;  4Z92 B;  4LJH A;  4LBN A;  1PIV 1;  2V72 A;  1AL2 1;  5FYC A;  5F39 A;  3GZT B;  4LK6 A;  3RNS A;  1ND2 B;  3AP5 A;  5FBJ A;  4JCK A;  4E2Q A;  1TME 1;  4KH9 A;  2QDN A;  1VBC 3;  2QJV A;  2JB8 A;  3FLP A;  4QXK A;  4AI3 A;  4Y4Y A;  3URF A;  2JDK A;  2JKX A;  3EYP A;  4NRO A;  3J26 N;  5JSP A;  1GOF A;  2EID A;  1ZYB A;  3U78 A;  4YAR A;  5J3U A;  1C3H A;  5I8S A;  1XE7 A;  4YVS B;  2ZX1 A;  5K7P A;  2UY9 A;  3ZMO A;  1O5L A;  4DZG A;  2D3R A;  1OKO A;  4Y1Z A;  4FPJ A;  1GOH A;  4CDX A;  2CDO A;  2QTW B;  3U11 A;  4LE4 A;  3POF A;  4CU8 A;  1YWK A;  2QVS B;  1WKY A;  5KHJ A;  1OUR A;  4KGQ A;  4NRP A;  3USS A;  1BZW A;  4AAP A;  4DIQ A;  5A7N A;  3PIJ A;  1W2O A;  1GR3 A;  1CQ9 A;  1U12 A;  4WBB A;  1JZ3 A;  4CSW A;  3WLU A;  3AZY A;  1JYX A;  3N9Q A;  2VZR A;  1W3X A;  1W9F A;  3EHK A;  3KV5 A;  5JAX A;  4LO4 B;  4MXV A;  3RYP A;  3WNL A;  4O7X A;  3OY8 A;  2OZ6 A;  2DCZ A;  2NMO A;  4K9S A;  1K5M C;  1YYN A;  2C0Z A;  4LIU A;  1OUX A;  1W8N A;  1WME A;  4D6R A;  2HWB 3;  1PK6 A;  4CEY A;  3SLI A;  4NID A;  4GWN A;  5LAT A;  4NIH A;  1COV 3;  2BVV A;  3BN6 A;  4FXK B;  2OYZ A;  3DKQ A;  3VD7 A;  3C7G A;  3JZV A;  4QGN A;  5H9P A;  3ZO0 B;  1QOS A;  1QY4 A;  1OHF A;  2WJS A;  4ZU7 A;  5FMC A;  1SAC A;  1LOA A;  2VUJ A;  1HRI 2;  1LNS A;  3N7L A;  3RWK X;  1HRV 2;  3ZYH A;  4EN7 B;  1RUN A;  4AL9 A;  2RE9 A;  1YCI A;  4XTM A;  4DEV A;  2E6V A;  1SLI A;  1OT5 A;  4AE2 A;  4QKF A;  2SLI A;  3DPR B;  3ZKU A;  4YGE A;  2K9Z A;  1QJX 2;  3JD7 2;  3OGS A;  3TN9 2;  1F5F A;  1FMD 2;  1YFX A;  1WD3 A;  2V09 A;  1YEW A;  2YUE A;  5L9B A;  4IEW A;  4RHV 3;  1F2N A;  4XFC A;  5T54 A;  2R04 2;  3SCH A;  4MGS A;  1YNA A;  1VAL A;  5L19 A;  1GNH A;  1YJK A;  3DL3 A;  3ZOI A;  1WW5 A;  1R1Z A;  4J6G A;  3H1Y A;  3M1H A;  1VMF A;  1QJE A;  3GBG A;  1ZZ6 A;  2GZW A;  3LZZ A;  4CCD A;  3S7E A;  1EAH 1;  4FFH A;  4CCN A;  2G9Z A;  4LOT A;  2X05 A;  1VJ2 A;  1MZF A;  2ARA A;  1JU3 A;  2W92 A;  2VZU A;  3AZW A;  4YYO A;  5KR7 A;  4EE2 A;  3HQX A;  1DZT A;  2ZAH A;  3I7D A;  1HB2 A;  2P37 A;  4XXA A;  2FQP A;  1RUJ 2;  5GAL A;  5I0D A;  3MIH A;  4OI0 A;  2Y33 A;  2BNO A;  5A1F A;  1E57 A;  5F2W A;  3GJA A;  2G9F A;  5FZ0 A;  4Z8B A;  5HXM A;  2FDF A;  1AJO A;  3DPR C;  2V4A A;  5I93 A;  4QPY A;  2D97 A;  1V6O A;  2ZOE B;  2ZGM A;  5FOB B;  1KQR A;  3GBF A;  1G9B A;  1PO2 3;  2IC1 A;  2RVA A;  3MV0 1;  5H9Q A;  3AC0 A;  1H2K A;  1BJQ A;  1CZV A;  1FAY A;  1S0D A;  2D5F A;  4YZ4 A;  5IK4 A;  1LGB A;  2PMW B;  3VBF C;  5JSO A;  2YU2 A;  4LO6 B;  1PO1 3;  5FWE A;  2XWB B;  1BHG A;  1AYN 3;  1BBT 1;  2HWD 3;  2HBT A;  1W6Q A;  4MVT A;  5DAP A;  3SKJ E;  4FOQ A;  3S30 A;  2DVB A;  1TQ5 A;  3IKW A;  3K4Z A;  3MF6 A;  5A70 A;  1OF3 A;  1XNT A;  3VLB B;  1IPJ A;  2EIC A;  5A1L A;  1VAM A;  5KHI A;  1UD1 A;  3TOJ A;  2X8K A;  3KGL A;  4XIO A;  3SH3 A;  4AXO A;  3QLQ A;  1XYN A;  1JN2 P;  3LIG A;  3OPZ A;  2JE8 A;  4MXW A;  2MPF A;  1SLC A;  1K5M A;  3BGA A;  4CCL A;  5DQ0 A;  3O1O A;  1H6Y A;  1U5X A;  2OII A;  1WGP A;  4FVV A;  3WNP A;  1AXZ A;  1LHV A;  4XUO A;  5A3P A;  2Z69 A;  5T52 A;  5IHR A;  4ARY A;  1XOY A;  2GDF A;  4ES8 A;  1UX7 A;  3A22 A;  4W6Y A;  4N43 B;  3H1W A;  3O7O A;  1O59 A;  2B4K A;  4H55 A;  4W8J A;  2JDH A;  2WRA A;  3MIB A;  1R64 A;  4FTE A;  3E5Q A;  3ZYP A;  3ME2 A;  1O8S A;  2GN7 A;  3K48 A;  3VUO A;  5HCF A;  3WW3 A;  1SQ4 A;  1LOC A;  3D4K A;  4CXY A;  1W6N B;  4G3Y C;  1W6M B;  2VNG A;  3JBG 3;  3R0R A;  5JWP A;  5C5U A;  3VBS B;  4E8D A;  3CEW A;  1JBC A;  2B46 X;  4D6S A;  1POV 3;  3DGT A;  3NV3 A;  5FZH A;  4LQR A;  5FXZ A;  2VVF A;  3IIA A;  3QBQ A;  3T3Y A;  3ZPO A;  4GAL A;  4YVW B;  3NQH A;  1NXD 1;  1XSR A;  1YRZ A;  3EJK A;  1AR9 3;  5FXV A;  1RHI 2;  4LUK A;  5LRS A;  4IV1 B;  2QQU A;  3AFK A;  3PTR B;  1LOE A;  3H7Y A;  4CDU B;  2HEY F;  1H8T B;  1XYP A;  4HSJ A;  1I1E A;  3M3E A;  1JH5 A;  3VKF C;  2A75 A;  5I0T A;  5ACA 2;  5EIY B;  4XUN A;  2QQP A;  3LPG A;  3OEA A;  5FPL A;  1O4T A;  3OSD A;  3TNQ A;  4NE9 A;  5B4X A;  2WUH A;  1RUC 1;  1H6X A;  3ETP A;  4GKY A;  2CY6 A;  4UBH A;  3WDX A;  1REF A;  1LOG A;  2P3Y A;  1XPW A;  3N36 A;  4K20 A;  4GMP 0;  4N43 C;  3LA7 A;  5JPM B;  3PVO A;  4OYU A;  5FXX A;  2LW8 A;  2HWC 2;  1VLN A;  2WII B;  5ERL A;  1ENQ A;  3WHU A;  4HK8 A;  2R07 2;  1IPK A;  3VGI A;  4JKK A;  1QJZ A;  3LOI A;  2XVK A;  4FP2 A;  1JMU B;  4KWK A;  4XUR A;  1ASJ 2;  1C1L A;  1D4M 3;  2RS3 1;  1NLR A;  3AMH A;  2DVA A;  2VY0 A;  3VBS C;  3DPR A;  4AR2 A;  3IWZ A;  4LO5 B;  3GAL A;  3G6J B;  4AF9 A;  2BPA 2;  2Y0O A;  4AFB A;  1ZZB A;  1ZRD A;  5FZ3 A;  3A21 A;  2RMU 3;  4HN0 A;  4CDU C;  3U10 A;  2IZW A;  2CU5 A;  1BKZ A;  2JDZ A;  2VUL A;  1H8T C;  3H8U A;  4FI9 A;  4I0W B;  3LF7 A;  5LEK A;  2IFW A;  1OF4 A;  1QGL A;  2D6L X;  2D6N A;  3N7J A;  2ZGO A;  3PME A;  4W6X A;  3ZYB A;  3VDD B;  4BXF A;  1JUI A;  3IB3 A;  1DHK B;  3RJ2 X;  3I2I A;  2X09 A;  1D4V B;  2A5Z A;  2ZHL A;  4UFL A;  1FOD 2;  3LOB A;  2Q1M A;  3D8C A;  2DCJ A;  5DDJ 2;  1PIV 3;  2BER A;  1N1T A;  3FFZ A;  4W6W A;  1AL2 3;  4B7E A;  4CCO A;  4PLO A;  1YIF A;  1QKQ A;  1TME 3;  2HWF 3;  3BI3 A;  2XJP A;  3NNL A;  5FPA A;  3VV1 A;  2Q1Z B;  2ZAB A;  1PMI A;  1LEM A;  4UBG A;  3LA2 A;  2D40 A;  2FZ1 A;  1LU1 A;  1T2X A;  4LMF A;  1IOA A;  3MID A;  2VCB A;  4AWD A;  4RGA A;  4HOO A;  3ES4 A;  3BTY A;  1AR8 1;  5F6K A;  3C7H A;  4XZU G;  3FHQ A;  4LBL A;  1PVC 2;  3APB A;  3IDB B;  2GAU A;  2W47 A;  4M4R A;  3LDR A;  2DUP A;  5JOW A;  4IEO A;  4K8F A;  4BPZ A;  5FWJ A;  4QHZ A;  1QJU 1;  4RD7 A;  4FPH A;  4F83 A;  2FHR A;  2W5F A;  3POG A;  3I49 A;  5EYY A;  3VDD C;  1CZT A;  2XBO 2;  4FPC A;  2LAL A;  1IHM A;  3KT7 A;  2E9Q A;  1W0O A;  4UF0 B;  1ULO A;  2RR1 1;  2WN3 A;  4FPO B;  1O3Q A;  5FRE A;  4F8A A;  2L9L A;  2YFU A;  3OGR A;  3INA A;  3MPP G;  1SPP B;  4RS5 B;  5FP9 A;  1GBG A;  5LAS A;  3WG2 A;  1HV1 A;  1QMJ A;  1UPS A;  1PX4 A;  1YXW A;  4QPG B;  1GWM A;  3J8F 1;  3PU8 A;  4TSV A;  4NII A;  5J96 B;  1JZ7 A;  1C8M 2;  4PBP A;  4D0Q A;  2RS1 1;  4QQO A;  2PAK A;  3ZX7 A;  2R6Q A;  2IXH A;  2RG4 A;  2XUM A;  3J4U H;  3MW3 A;  4XCA A;  3Q8B A;  2I2S A;  4N43 A;  1RUI 1;  3JXS A;  1QDO A;  3MIG A;  4JHZ A;  3MZH A;  1J3R A;  1LRH A;  3I3B A;  3VBH C;  2PLV 2;  3FBM A;  4JRA A;  2JIJ A;  4WVW A;  2OA2 A;  2JJ6 A;  4YW3 A;  3CBN A;  2WWJ A;  1W6N A;  2P6C A;  1W6M A;  3FN9 A;  1Q43 A;  4OHW A;  2OUH A;  3VBS A;  3TAY A;  4P9X A;  1RUD 2;  4UT5 A;  1PMH X;  3THT A;  3KQR A;  4MSV A;  1Q5O A;  3JQW A;  5E8A A;  4PT6 A;  1L7L A;  1YQ6 A;  3MYX A;  2FMD A;  3ZR6 A;  1W03 A;  3B9C A;  1EAH 3;  3VZN A;  4CDU A;  2DF7 A;  1V6I A;  2P5B A;  2VU9 A;  4RS5 C;  3T30 A;  1H8T A;  1CX4 A;  2IXC A;  5FV3 A;  3C7O A;  4Z1V A;  2ES3 A;  1ZRC A;  4MUV A;  1KGY A;  2XR4 A;  3OGJ A;  5CBL A;  4I2O A;  1GU3 A;  3BPZ A;  4AI9 A;  5F1R A;  4BQ5 A;  1BXH A;  1ULE A;  2YFZ A;  3IAQ A;  4C91 A;  3T09 A;  4YZ2 A;  3BOD A;  4YG0 A;  3Q8F A;  5A3M A;  4GWI A;  1EV1 1;  3HN1 A;  3I2J A;  5FR3 A;  1QU0 A;  3UL2 A;  4Y1Y A;  1W9Y A;  1I5P A;  1SZB A;  4GD4 A;  3T0B A;  1W8F A;  3T2O A;  4PQQ A;  4PQ9 A;  4Z2W A;  1I6X A;  4M3C E;  3I2G A;  4AHX A;  3VDA A;  3U0Z A;  1TVG A;  5DN2 A;  4NAM A;  1QEX A;  3UKT A;  5C3S A;  1Z7S 2;  3AP7 A;  1BMV 2;  3IT8 A;  1H0B A;  5IVE A;  1J83 A;  2AEZ A;  1EUU A;  2ZTN A;  3AMQ A;  3GM8 A;  2H0V A;  4L92 A;  3WDU A;  5EYX A;  1BBT 3;  4H3W A;  4Z82 A;  5GLV A;  4K21 A;  4XUQ A;  4YGC A;  3DN7 A;  1O5U A;  2YBK A;  2WZR 1;  2WLQ A;  1JYN A;  2VXJ A;  2VH9 A;  1AX2 A;  4KG8 A;  2BU9 A;  1HXS 2;  1K3I A;  2ZKL A;  3FE5 A;  1SCR A;  1ZA4 A;  4NHL A;  5EHD A;  4XF4 A;  3UYJ A;  2A1X A;  3VDD A;  1CAU B;  3KQ4 B;  4QAW A;  4HT1 T;  1C8N A;  3ZM8 A;  2PQS A;  1S0E A;  1LGC A;  4PI2 A;  5DUU A;  4AHW A;  1HN1 A;  4XBN A;  5LK5 A;  4DB5 A;  2NZ9 A;  4HBN A;  4WV8 A;  4Y5Z 0;  1S0G A;  2QQK A;  3BYW A;  3VZL A;  1LOB A;  4AQ2 A;  4FO9 A;  4FOY A;  4Y4R A;  3UKV A;  2YBS A;  1DYP A;  3TB0 A;  4B29 A;  2HWE 2;  4CUC A;  1CX1 A;  4XJ9 A;  5A7Q A;  2YZ4 A;  4NIG A;  2E7Q A;  1O3S A;  4Y24 A;  4H14 A;  1RXF A;  2D44 A;  2W94 A;  4XJA A;  2FDG A;  1D2Q A;  3ZSE A;  4N8M A;  4HET A;  1AF9 A;  4DXS A;  5J7M A;  2C9K A;  2RM2 2;  4NRQ A;  4RGK A;  1KXG A;  2TEP A;  2XDV A;  3VBH A;  3PJY A;  2Z5W A;  1ZZ8 A;  4URT A;  2HKX A;  2FCT A;  2VZ1 A;  5A3U A;  3W21 A;  1JI6 A;  1O6U A;  1JYC A;  1ULG A;  5CFD B;  4P9W A;  5IK5 A;  4MHU A;  3EBR A;  5T3N A;  1RED A;  1V6N A;  2ZJC A;  5FMB A;  4YM0 A;  3WF4 A;  4J1W A;  1WBF A;  3UJQ A;  3SNM A;  4N7I A;  1Y9G A;  2A3Y A;  1A3K A;  1ND3 C;  2XL9 A;  5BNQ A;  2Z42 A;  4NHX A;  1SFY A;  4Q0U A;  4UF0 A;  3PDQ A;  3USU B;  4BWO A;  2OXB A;  3IZO A;  4GUL A;  4WVZ A;  1SPP A;  4RS5 A;  4A6O A;  4NHY A;  1EUT A;  4AEK A;  4ZU5 A;  2FDI A;  1RUC 3;  3A0N A;  1MVE A;  1WCS A;  1UAI A;  5FQ0 B;  5CAD A;  1OI6 A;  1UYY A;  1VBD 3;  3OBZ A;  1AHS A;  2BUK A;  4JGZ B;  5G04 L;  2UUR A;  5FZD A;  3ZXD A;  5BUV A;  4PLN A;  3TNP B;  2E53 A;  3AXD A;  2DBI A;  1ULD A;  1HJG A;  2RS3 3;  1QWR A;  3AVS A;  4AW7 A;  3U1X A;  1HRI 1;  1R09 2;  1OFN A;  4MGK E;  2ENR A;  3VN4 A;  4D94 A;  1AVB A;  1NA1 B;  3AMN A;  2VOK A;  5CFD C;  3EMR A;  3AZV A;  5AC9 2;  2P3K A;  4HZF A;  3TEW A;  1ENR A;  2VBP A;  1QJX 1;  3FLR A;  2KM2 A;  2GNM A;  2WAO A;  3JD7 1;  1FMD 1;  1MEC 3;  3NJV A;  4IE5 A;  4M00 A;  2J1E A;  2QQW A;  3QCW A;  5EQU A;  3H8X A;  1O3R A;  3H8R A;  2PXJ A;  4W4Z A;  3CJX A;  1SBE A;  4WVM A;  4ISR A;  5JSR A;  2WT2 A;  2CL2 A;  2JG8 B;  4UFH A;  1GWL A;  3NKG A;  5IYY A;  1OD3 A;  4XE9 A;  2CNA A;  1WLW A;  2VME A;  3K75 B;  1Z0H A;  5FYV A;  2BWA A;  3ZIW A;  2V5D A;  2CAV A;  1T6B X;  3OYW A;  4FFG A;  3ZFF B;  2Z4F A;  3ZFG B;  4BIO A;  4YPJ A;  2X5I B;  2BGO A;  2Y6F A;  4K3U A;  2XQX A;  4BYY A;  1GSL A;  4JGZ C;  5EFU A;  4CDQ C;  3KVB A;  3E6B A;  1RUJ 1;  1S1A A;  2FMY A;  3CHX A;  2D6M A;  3RZG A;  4OUL A;  4QPW A;  1DGR N;  4LKE A;  3WP4 A;  5DUW A;  1JOD A;  4IW3 A;  4KU7 A;  4R9C A;  4Q8K A;  1IZ3 A;  1GYK A;  1OMI A;  2VOW A;  1AXK A;  1S2E A;  2P4E A;  1RIN A;  3PIG A;  5DXD A;  4OI1 A;  3OUJ A;  1VMJ A;  3F2Z A;  2W3J A;  5J48 A;  5LK7 B;  4GH4 C;  4DIN B;  1VBE 2;  4FXG B;  3VHR A;  1HB1 A;  4EWE A;  1ZZ7 A;  4Q4X 1;  4XXP A;  3MDP A;  1GQH A;  4B7K A;  2JG8 C;  5F3E A;  5FTT C;  2VR4 A;  4AAX A;  4RL7 A;  1H1I A;  3ZXA C;  5DZG A;  1FYU A;  1ZRR A;  1RC6 A;  5HI0 A;  5JIA A;  2W52 A;  1UL9 A;  1OUS A;  2RR1 3;  1LEC A;  4JHT A;  1S4C A;  1XQN A;  1G9F A;  2C24 A;  4KMQ A;  4PHZ A;  3GYD A;  3ACI A;  3ZFF C;  2OZJ A;  2JE9 A;  1CAU A;  1HJF A;  1ND3 A;  2D3P A;  3ZFG C;  1W8W A;  5FZE A;  2XB6 C;  2X5I C;  3UT0 A;  4PF1 A;  5I8T A;  5CG9 A;  1BEV 2;  1SCS A;  2YC2 A;  2B8M A;  3I4I A;  1GAN A;  2UWA A;  3J8F 3;  3NNG A;  4OUE A;  1ZZ9 A;  4RR3 B;  5DUX A;  3LEK A;  2NLR A;  2RS1 3;  4YZ1 A;  4A42 A;  2ADD A;  4OUS A;  4ERO A;  4B1L A;  1ZBE 1;  3T2Q A;  5DMY A;  1XC6 A;  3BUC A;  3SXW A;  2UWB A;  2C9A A;  2ZKN A;  4YLZ A;  3DXU A;  1RUI 3;  1H2L A;  1JZ8 A;  2DTY A;  2VTF A;  2QBX A;  3R4S A;  5JR2 A;  4Q1P A;  4XQW A;  1LKN A;  3NV4 A;  1NLQ A;  2XJQ A;  3LA3 A;  2ZZQ A;  2ZGQ A;  4CP1 A;  1XE8 A;  3LB9 A;  2KD7 A;  3RWN A;  1PVX A;  2Q4S A;  4QDR A;  5F3I A;  5J98 B;  3ELN A;  1VMH A;  4QHO A;  5CFD A;  2ZHM A;  3X29 B;  3KWV A;  3ZSL A;  1VE0 A;  3DXT A;  2ZBJ A;  3BU0 A;  4AFC A;  1NG0 A;  1SDW A;  5FP3 A;  1W9W A;  4D3W A;  3ZYG A;  4AQS A;  3V56 A;  1UU5 A;  2WBK A;  2IXJ A;  4IDZ A;  5A3N A;  3TN9 1;  2WFF 3;  4LKD A;  1G86 A;  5LA2 A;  3HEI A;  4CRQ A;  1RHI 1;  3USU A;  1UYX A;  4LHS A;  4RA0 A;  2Y6G A;  4MET A;  4QGM A;  4RR3 C;  5F3G A;  3LSD A;  1EPZ A;  2ZEZ A;  4FPF A;  2VTX A;  4GB3 2;  4JKM A;  1D7P M;  4XCB A;  1GP6 A;  1JUH A;  5ACA 1;  5FXW A;  4Q0V A;  4GKX A;  1G7Y A;  4QX8 A;  1EV1 3;  5FQ0 A;  3O1S A;  4DUV A;  1FI2 A;  5FOJ B;  4JDN A;  5E89 A;  4LOR A;  2ZA9 A;  3I2H A;  1C57 A;  3N9N A;  5D21 A;  5FYU A;  4TZD A;  4JGZ A;  1CZS A;  3LWC A;  4CDQ A;  3AVR A;  3ZYR A;  1US2 A;  5JPN B;  2HWC 1;  2Z2S B;  3KMH A;  3ZYI B;  2R07 1;  3ZFE B;  5ANN A;  4XYX A;  1G8W A;  2NM1 A;  3ZYF A;  3QH6 A;  2ATF A;  4JQR A;  1YLL A;  2ZX4 A;  3SH4 A;  2VMD A;  1NUK A;  1ASJ 1;  3KSC A;  4QXH A;  3MLL A;  3OPW A;  4D69 A;  3VZO A;  2WKK A;  4O9E A;  5DAW A;  1V00 A;  1G6N A;  4GH4 A;  5FZI A;  1V0A A;  1OLM E;  1AJK A;  5I91 A;  4CZS A;  1CN1 A;  3HT1 A;  4EZ4 A;  2JG8 A;  2WZR 3;  4COW A;  1MS4 A;  3SCF A;  2V4V A;  5JR7 B;  2VOX A;  2XJV A;  1O91 A;  4KGG A;  1QJY 2;  5T5P A;  5FP4 A;  3RZZ A;  4GWJ A;  4ASL A;  2J1S A;  4LOS A;  4MXW B;  3BAL A;  1K5M B;  1TMF 2;  4MLO A;  4R4X A;  1XNA A;  5EJ3 A;  1ULF A;  3DF0 A;  4IGP A;  2ZEY A;  2QDR A;  3ZFF A;  2ZX3 A;  1H30 A;  4FPK A;  3O0X A;  4QQH A;  3S6P A;  4AVS A;  2F17 A;  5FZ7 A;  3ZFG A;  4BDV B;  1X82 A;  2X5I A;  1FOD 1;  5T55 A;  4CU7 A;  5C3O A;  5HV4 A;  3Q8C A;  4Y26 A;  2CHH A;  5F2S A;  5DDJ 1;  4TLF A;  1X33 A;  1FV2 A;  5HPO A;  5FYS A;  2HYX A;  4Q29 A;  2JDY A;  4P14 A;  2PYT A;  3CKH A;  3M3Q A;  2DU1 A;  1CIW A;  2DV9 A;  3POE A;  3WQ7 A;  3ZFE C;  4A2U A;  3R4D B;  2VJX A;  1RL3 A;  2ZGR A;  4W65 A;  1X9P A;  4HN1 A;  4YGB A;  3P1I A;  5K0U B;  5FY9 A;  4XJZ A;  4XFI A;  5EP9 A;  3ALQ A;  2E32 A;  3BOW A;  1UX6 A;  3T08 A;  1IS6 A;  1PVC 1;  3QOP A;  2DBN A;  4EN8 B;  1GZT A;  2FZ2 A;  2G19 A;  2JG9 C;  2O1Q A;  1N47 A;  2C5D A;  1RVF 2;  3BTZ A;  3OBA A;  2ET7 A;  2W1S A;  3NAP C;  5HCH A;  3H7J A;  3DYP A;  3WVJ A;  2O8Q A;  3JCI A;  4YZ3 A;  2WSU A;  5IVB A;  1YI9 A;  1AXY A;  2VNO A;  3VL8 A;  2CGO A;  3OJB A;  4L0P A;  1W2A X;  4LBQ D;  4AFM A;  1CIY A;  5IK8 A;  4RR3 A;  2VZO A;  1FAT A;  5LRR A;  2VW2 A;  4JZR A;  5JXG A;  1N1Y A;  2HWB 2;  2XOM A;  4LBK A;  2W91 A;  1DGW X;  1XXN A;  2A6Z A;  1C8M 1;  1Y9M A;  5AFE A;  3A0K A;  3FC0 A;  1X8M A;  1CES A;  3F95 A;  5K0U C;  3III A;  4R8H A;  2PHR A;  5FPV A;  4ZXK A;  2ZHN A;  2Y6H A;  2EXJ A;  3RGB A;  1HRI 3;  1UU4 A;  3DYO A;  1ZA7 A;  1QH6 A;  4XDP A;  3KLS A;  1O3T A;  2WR9 A;  3VDB A;  3S0M A;  2PLV 1;  5LY1 A;  3WHT A;  2DVD A;  1DU3 D;  2RHP A;  3VBF B;  4Y22 B;  1QJX 3;  1DZQ A;  4ZY9 A;  3TN9 3;  2OQ7 A;  1FMD 3;  4KWL A;  2A71 A;  4QWN A;  4R9B A;  4XAE A;  3LPF A;  3I8T A;  2A3W A;  1H1M A;  4AI8 A;  3OGG A;  2EXI A;  4DY5 A;  3I3Q A;  3PVE A;  5L73 A;  5IFP A;  5I0U A;  1RUD 1;  1UN1 A;  2YRO A;  5IUQ A;  4LK7 A;  4NOT A;  1DQ0 A;  1LED A;  1WW6 A;  1D0H A;  4C1W A;  4BQW A;  5LW9 A;  2VMH A;  5JMO A;  2RDS A;  1GQG A;  4PDW B;  4QKB A;  1W2T A;  4LBJ A;  3Q8E A;  4PI0 A;  4YG3 A;  2EVX A;  4ES9 A;  3CLP A;  1QH7 A;  4HSL A;  4MO3 M;  4YZ5 A;  1UCX A;  3HBZ A;  3B94 A;  5F5Q A;  1ENS A;  4NWV A;  4JVA A;  3H42 B;  1JYW A;  4FQZ A;  4KG0 A;  3RVH A;  1JOP A;  2VQU A;  1RUJ 3;  1QHD A;  5FY4 A;  1HB3 A;  1D0G A;  1WCU A;  5SV5 A;  4IEP A;  2JDU A;  4AVC A;  4QPI C;  3WUC A;  1H1A A;  4E2S A;  1DF0 A;  3AYE A;  2NPI A;  1MVQ A;  3ZFE A;  3K4A A;  1OQE A;  1FNY A;  2W9X A;  2VZV A;  3CU7 A;  3AB0 A;  5F8P A;  5C4W B;  2PTM A;  3HNB M;  5BNP B;  3RZM A;  3BIW E;  1JU4 A;  3LIH A;  3J7N A;  4J25 A;  4Q4X 3;  3D6E A;  5CFC C;  4AVA A;  5FZC A;  1RUH 2;  1ZBA 2;  4JGY B;  4EQV A;  2MEV 2;  1Z7S 1;  2MHF A;  1MZ6 A;  3A23 A;  3UKN A;  1T6G C;  1BMV 1;  1XU2 A;  4HKW A;  4U2A A;  1UOF A;  2AAC A;  4BLJ A;  2JB4 A;  2HEW F;  1OVS A;  1TE1 B;  3NNF A;  4OI2 A;  3E97 A;  4PDW C;  4WZC A;  2BDR A;  3C3V A;  5CZK A;  4MV2 A;  1XND A;  2VQA A;  5JIU A;  2VUD A;  1GZW B;  2JG9 A;  4JTO A;  3HN3 A;  3POI A;  2B45 X;  2P3I A;  3E1F 1;  1N1S A;  3E5X A;  4HFS A;  4Q0Q A;  1H9W A;  1HXS 1;  3B3Q E;  1BVP 1;  2OPW A;  2Y26 A;  2CAU A;  2ZGP A;  4NO4 A;  5JOY A;  1RJ8 A;  1ST8 A;  3MF9 A;  4L11 A;  1OPO A;  2ORX A;  1OSG A;  2ZEX A;  1DP0 A;  4A7Y A;  1WUV A;  4AK3 A;  4RGG A;  1ZBE 3;  2B9V A;  4XHB A;  1PGW 2;  4L2N A;  3SIT A;  4ET7 A;  5J1X A;  2WQ4 A;  4R52 A;  1YQ8 A;  3CMG A;  5FK8 A;  1I5Z A;  4XUT A;  2KXL A;  3L9J T;  5CB7 A;  4UFI A;  3RDI A;  2R49 A;  5C4W C;  4I3P A;  2HWE 1;  1LJ7 A;  2A3X A;  5K0U A;  3WIN E;  2DFB A;  2P3J A;  3O0V A;  3POW A;  1IGO A;  1K5J A;  2V5Y A;  4I3G A;  4X6R B;  4Y5T A;  5GKA C;  5KBF A;  2EIE A;  3DYM A;  2PAE A;  1LHO A;  4JGY C;  3PNA A;  4PLM A;  3LFI A;  1ZM1 A;  1BYH A;  3OD4 A;  2A70 A;  4F7Z A;  3WF1 A;  2RM2 1;  3O0W A;  1NCQ C;  3AYD A;  4SBV A;  4ISQ A;  1YI7 A;  2Q30 A;  4ZON A;  2ZCW A;  4E8C A;  2WAB A;  1QIQ A;  1WBL A;  4HK9 A;  4K1Z A;  5A3O A;  2C1F A;  1LHU A;  1RHI 3;  3M3C A;  4JRL A;  4HVO A;  4N90 A;  4BQ2 A;  5FZ4 A;  3ZPY A;  1JS9 A;  1DCS A;  1XNB A;  1DLC A;  2XJS A;  1KRI A;  4QXC A;  2ZML A;  3KGZ A;  4ZU4 A;  1YQ5 A;  5L36 A;  1JHN A;  2Q8O A;  2XQR A;  1CJD A;  4CP2 A;  1VR3 A;  3O1T A;  4M4P A;  2YU1 A;  2VZT A;  4AHY A;  3RZL A;  1OOP C;  1CJP A;  4BH9 A;  4MH0 E;  4HL0 A;  4FPE A;  3SHR A;  4V2V A;  1MAC A;  3RYK A;  3B01 A;  2ZMN A;  3UK9 A;  2R07 3;  2IXI A;  4R9A A;  3R05 A;  2QQV A;  1UY1 A;  1VB4 A;  1WMX A;  4QPI A;  4A41 A;  3C2U A;  3CZJ A;  5A3W A;  2UYB A;  3PUH A;  1A34 A;  1D4M 2;  1SLB A;  3ES1 A;  4MX3 A;  3GZE A;  4RFR B;  4XFF A;  1JYV A;  3RZJ A;  3NL1 A;  4RYD A;  1DQ5 A;  1GMM A;  1R09 1;  3VBF A;  5DZF A;  1RUF 2;  1J1L A;  3B02 A;  5FYM A;  1OA2 A;  1S0I A;  5D2A A;  1FT9 A;  3PHM A;  5AC9 1;  5CFC A;  3THD A;  2D43 A;  2VUC A;  2WS9 2;  5CKQ A;  4G9S B;  4BB3 A;  2OKX A;  3ZIX A;  3E5U A;  5ISL A;  1JXN A;  2J1V A;  2DUR A;  5FIX A;  3LD8 A;  2CSG A;  5ANQ A;  3WG1 A;  4LBQ B;  3WUD A;  1W8U A;  4PDW A;  2AH2 A;  1F35 A;  4N7U A;  5FO9 B;  2VNR A;  3LSE A;  2J7M A;  2XLA A;  1CD3 G;  3HPN A;  1RUE 2;  2CV6 A;  3VBO B;  3W58 A;  2JIC A;  4IET A;  2D6P A;  1W6O A;  3AL5 A;  5DDJ 3;  3NVC A;  2R7E B;  4N9H A;  1UY0 A;  2H6C A;  1YFY A;  3MIE A;  3MPB A;  1A78 A;  2Y6L A;  4AVB A;  3NST A;  2FCU A;  5L9R A;  2W46 A;  1TME 2;  2HWF 2;  3KM5 A;  2VD7 A;  3AKP A;  5LA9 A;  4K7J A;  3VBH B;  5E16 A;  2A6Y A;  1KD7 A;  4NHK A;  2VVD A;  5JZG C;  1A8D A;  2W39 A;  1V6M A;  4XET A;  4FTS A;  2AUY A;  2WO2 A;  1X7N A;  1HN0 A;  1V6L A;  5JVV A;  5C4W A;  3WF2 A;  4R4Z A;  3HNY M;  5BNP A;  4IGQ A;  4MHR A;  3SEE A;  4FSJ A;  1UMH A;  2Q5T A;  2RS5 2;  1JZ4 A;  2PHD A;  5ABJ B;  4JGY A;  1PVC 3;  2DUO A;  1V9U 2;  2AZ5 A;  4JQT A;  1A6C A;  1BVV A;  2Y6K A;  5G05 L;  1KFX L;  1VBE 1;  1ZNP A;  5FJH A;  4XDO A;  1NCQ A;  4NN0 A;  3T0A A;  4ZZ8 A;  5FMD A;  3VHN A;  1QQP 2;  1UZW A;  2NQY A;  2UYA A;  1GKB A;  1CPN A;  2LS6 A;  5KHG A;  3RFR A;  3FHA A;  5FK7 A;  1GZW A;  3QH7 A;  4OCT A;  3WW1 A;  4KQ7 A;  1UF2 C;  3WG3 A;  4LEJ A;  3VBO C;  1RUG 2;  4LE3 A;  1DGW A;  4XJ8 A;  2QQL A;  2WWU A;  5FPX A;  2C6S A;  5FYH A;  4HPK B;  4LKS A;  3AKQ A;  2UY8 A;  4DEQ A;  5BNP C;  3WDW A;  1BEV 1;  2BJS A;  3M3I A;  1O4Y A;  1F4H A;  1UPI A;  1C8M 3;  1MZ5 A;  5CIS A;  4BMB A;  1AR7 2;  3VBR C;  3BIE A;  4LTA A;  3AZZ A;  3C8X A;  1OOP A;  3I54 A;  2N7G A;  3KT4 A;  2JEC A;  1NYW A;  4XF1 A;  3N7M A;  3ILN A;  4HON A;  2P2K A;  4DUW A;  4G4F A;  3O14 A;  1CGP A;  4MOA A;  4BCU A;  4XMA A;  2PLV 3;  1VRH 1;  2W08 A;  5ABJ C;  1W0N A;  4P9Y A;  1W05 A;  4WVM B;  4GQ7 A;  4K1Y A;  1YQC A;  3IAP A;  5FAX A;  1AL0 G;  3PUA A;  4LR4 A;  1NXM A;  2VL4 A;  2VZP A;  1K42 A;  3GNE A;  4QM8 A;  3AJZ A;  3S5Q A;  1RUD 3;  2BBA A;  4QU1 A;  2YGM A;  4BK5 A;  5IAT A;  4JAA A;  3V0B B;  2XPJ A;  2BGP A;  3FUQ A;  3H8O A;  4JDM A;  3OYW B;  5LB6 A;  2PA7 A;  4GMP 1;  4IUG A;  3I59 B;  5CEH A;  1H4H A;  4OVE A;  2JKB A;  2WAA A;  1C4R A;  2BYV E;  1R1A 2;  2W0X A;  3BPS A;  1AR6 2;  2XGX A;  3PL0 A;  2B7Y A;  3I2F A;  1LGN A;  2WO7 A;  2P6H A;  3BTA A;  4Q27 A;  3LAG A;  1GFF 2;  1DDL A;  2WZE A;  3GDB A;  4MGQ A;  4CA9 A;  5JCT A;  5A6Q A;  5FPU A;  2P34 A;  4GB3 1;  5GZD A;  1JYI A;  1GP5 A;  1DG6 A;  1H4G A;  2WDB A;  5FY0 A;  4AVV A;  1MZE A;  5E6H A;  5JXH A;  2GSY A;  5APA A;  4Z2A A;  4PIY A;  1C28 A;  3GHN A;  2HEV F;  4AYU A;  4Q0S A;  2GMP A;  4M3C B;  2IUW A;  3JQX A;  3CJI B;  1RTV A;  2GH8 A;  1UU6 A;  2WYF A;  3PMS A;  4YG6 A;  4XFB A;  5F3C A;  3LFM A;  5A80 A;  1KS4 A;  2ZAC A;  4FQ4 A;  1WCD J;  5EJZ B;  5F32 A;  2WO3 A;  5JZG A;  2NMN A;  1AYM 2;  4JTN A;  5DAX A;  3ACG A;  4YGD A;  3SC7 X;  1Z7S 3;  2J42 A;  3RMY A;  5F7U A;  4QB6 A;  5L9V A;  5F6L B;  5A6Z A;  2VMI A;  3B93 A;  1YUD A;  1NAE A;  3H1M A;  3EQE A;  5FYZ A;  2AGS A;  5FZF A;  3N9M A;  1RYY A;  1ND3 B;  5BNO B;  5JXJ A;  1IKP A;  4RN5 A;  1BQP A;  2G9G A;  4HMZ A;  2XJR A;  4LBQ A;  3IMN A;  1AZD A;  4QGL A;  1PX3 A;  1SMV A;  2AEN A;  4HG6 B;  1QJY 1;  2ZGS A;  2ERF A;  3AP6 A;  5IAX A;  1IPS A;  3IDE A;  2K46 A;  1LCL A;  5EXO A;  3VBO A;  1TMF 1;  5LZ6 A;  4Y20 B;  5FY7 A;  1LOD A;  1QXJ A;  3ACL A;  4AI1 A;  1DQ4 A;  2R0H A;  4M3C F;  1W9S A;  3PVB B;  5LA0 A;  4XAC A;  4FFI A;  1H8V A;  2YY1 A;  4BQ3 A;  3CJI C;  5FZ8 A;  4M01 A;  4QD2 A;  2HWE 3;  3KV6 A;  3O1V A;  3MO4 A;  1VBB 2;  4YM2 A;  3VBR A;  5HV0 A;  1IQD C;  1XYO A;  2EAK A;  4V1P A;  2BTV C;  3CO2 A;  4UW4 A;  4Y1X A;  2KR2 A;  1IS4 A;  5FUI A;  2R0F A;  3VB9 A;  4DQA A;  2DVF A;  3AKR A;  5A7O A;  4HAN A;  4TLG A;  2FDK A;  4WVV A;  5ABJ A;  1C5H A;  2YXS A;  5IK7 A;  3S5A A;  4UI9 L;  2VEC A;  5FZG A;  3WP3 A;  2VG9 A;  1ENX A;  4QT6 A;  5BNO C;  1Y4W A;  3MUZ 1;  1KS5 A;  4ZHN A;  3LEM A;  5K4L A;  3RZK A;  4Q4W 2;  4XF9 A;  4O65 A;  5JI9 A;  5KXE A;  3HR9 A;  5IFT A;  5D8A B;  2QKD A;  4BZ4 A;  4QXB A;  3WXP A;  1KJR A;  1XNC A;  2CTV A;  3DEC A;  3VD3 A;  2ZX2 A;  1RMU 2;  4CPB D;  3FX3 A;  4S2D A;  2D6K A;  4XIL A;  1RVF 1;  4CYD A;  2A6V A;  4TYS A;  5DZE A;  2NP0 A;  1POV 0;  1X50 A;  2Q1F A;  1UMI A;  5CKM A;  3ZSJ A;  4HPK A;  3M7A A;  4UW3 A;  4CDQ B;  1UOJ A;  3THC A;  2DYC A;  3O1R A;  5FLH A;  1PZ7 A;  4XQD A;  3KHB A;  1OQD A;  1HRV 1;  2HWB 1;  1MS8 A;  1ULP A;  1VBD 2;  3IPV A;  3ZXJ A;  3UET A;  1BK0 A;  4CDW B;  2VCM A;  5FP7 A;  3FZ3 A;  2P1B A;  4CUG A;  2Y60 A;  3RPQ A;  3FUO A;  4Q4Y 2;  2RS3 2;  4GH4 B;  4UFK A;  1LES A;  2R06 2;  1R09 3;  5K8S A;  2R04 1;  5L7O C;  3AMP A;  4Y1V A;  1OH3 A;  5AC9 3;  3VBU B;  4Q2F A;  4NPL A;  2OT7 A;  2ZZJ A;  1MEC 2;  5D8A C;  3VKM A;  3V0B A;  5IJR A;  2JIG A;  1CAW B;  5FYB A;  1WD4 A;  5LWB A;  2PAM A;  1NZI A;  3I59 A;  2R1D A;  3KB5 A;  3WCR A;  4HVR A;  5FY5 A;  4Q5O A;  3UGF A;  4FCA A;  1GIC A;  2P17 A;  4QU2 A;  3SMH A;  1VB2 A;  3NW4 A;  1W8H A;  4DUX A;  4IER A;  3I97 A;  2ETE A;  4QX1 A;  1PNG A;  2XKO A;  5IWF A;  1WLD A;  1Q8P A;  2IFR A;  2VZQ A;  1OQ1 A;  3U14 A;  1F4A A;  4E4Z A;  2J1A A;  3RZH A;  3PVN A;  4PBO A;  3ZLI A;  4AED C;  4CDW C;  1AR8 3;  3ZR5 A;  5FYT A;  2JE7 A;  2D6O X;  3ZDV A;  4BME A;  2CWS A;  4M3C A;  2B5H A;  4XC9 A;  3CJI A;  1HQL A;  4H7M A;  4XW3 A;  4I0B A;  3HVD A;  3KHC A;  3N35 A;  1S2B A;  3LCP A;  5KC5 A;  3POB A;  3B69 A;  3UV9 A;  4BQ1 A;  1NY7 2;  3VD4 A;  4FAG A;  3BKZ A;  1QJU 3;  2EIB A;  3UGH A;  3NWK A;  2O14 A;  3VBU C;  1FPN 2;  4NJ4 A;  1W8O A;  1S0C A;  1RXG A;  4JDO A;  1VBA 2;  2AR6 A;  1VBE 3;  4CU6 A;  1ODN A;  5C8W A;  4E4D X;  3U75 A;  1RUH 1;  1ZBA 1;  3P3N A;  1SFP A;  2MEV 1;  2VXR A;  4JX0 A;  4JV4 A;  5FPB A;  4EN0 A;  5BNO A;  2GME A;  4CUB A;  3V64 A;  1J3Q A;  1VPH A;  3MI8 A;  2WNO A;  5F5I A;  4Q0P A;  2WA3 A;  4GAZ A;  4KWU A;  1NT0 A;  4D7S A;  3KCX A;  4YW1 A;  2E7T A;  5CIR A;  4OQ8 A;  1UWW A;  3N9L A;  4A44 A;  1WZX A;  2UWC A;  4AFD A;  2AYH A;  4COZ A;  1BEV 3;  4XMI A;  4Y20 A;  5DG2 A;  5LA1 A;  3B9I A;  4UWD A;  2GH2 A;  4Y1U A;  5JOX A;  1S0B A;  1G9A A;  4AI2 A;  5AFB A;  1F9K A;  3NJY A;  5KWR A;  3TRS B;  3SKV A;  4ZZ5 A;  4ASM B;  1HLC A;  4FAH A;  4CXX A;  1PGW 1;  1UIK A;  2QZ3 A;  5IVJ A;  2E26 A;  3SEP A;  2YYO A;  3JUU A;  5CA6 A;  1B35 B;  2VOT A;  1E5H A;  1VRH 3;  3BCW A;  4XQ4 A;  2Q8C A;  4MG2 A;  3HAG A;  5DAB A;  4CTE A;  5FZ1 A;  2CYF A;  5EWS A;  3HBK A;  5CKN A;  3MLK A;  1XSQ A;  5L7O A;  4AVT A;  4DY3 A;  3KT1 A;  4Q4V 2;  2XJT A;  4QDS A;  4QX2 A;  1TNR A;  1YHF A;  2OPK A;  4ZS2 A;  2D7F A;  4GMP 3;  3K3N A;  5D8A A;  1JOB A;  3WF3 A;  3ON7 A;  1CPM A;  3IN9 A;  2WFF 2;  4PF5 A;  3I2D A;  5GZF A;  4BQX A;  3I3E A;  3U37 A;  3J7M A;  4RFT 0;  1ZZC A;  2I45 A;  2XLG A;  1F8V A;  4GJZ A;  5FZA A;  1XRU A;  2BGC A;  2WQZ C;  3T4V A;  4CP9 B;  2ZGN A;  1L7R A;  4GB3 3;  1OH4 A;  1OPM A;  3CF6 E;  2UU8 A;  4UFJ A;  2D93 A;  4C1X A;  5C3P A;  1LB2 A;  4FP3 A;  3ITQ A;  2EAL A;  5A7S A;  4MGY E;  1EPW A;  5FZB A;  5DUV A;  3U07 A;  5BNN B;  5F37 A;  3KF5 A;  3I3D A;  3ZXL A;  2VW0 A;  2RJK A;  2XHK A;  2YV8 A;  4DXZ A;  2W68 A;  4GA9 A;  1B35 C;  5FZ9 A;  1QDC A;  4AED A;  2HH9 A;  2WA4 A;  5DPN A;  4CDW A;  3O1U A;  2RDN A;  3ETQ A;  3T2T A;  2WO1 A;  1MS5 A;  3OBT A;  2PQQ A;  1QXR A;  2LRO A;  3WSO A;  2GC0 A;  3IDC B;  5J09 A;  1K12 A;  2TBV A;  3ZXE A;  1UZY A;  1NE4 A;  2PHL A;  1ZX5 A;  2B39 A;  1SHW B;  3ILF A;  3RMX A;  2BP6 A;  5JDB A;  2JDA A;  1D4M 1;  2YPD A;  2DUQ A;  4K40 A;  1DQ1 A;  3LDB A;  2WLP A;  3VBU A;  5GZC A;  2JG9 B;  4QX5 A;  3T1M A;  1RUF 1;  4ATE A;  5JLV A;  1F15 A;  4BQY A;  3E6C C;  1R08 2;  3AP9 A;  4OHX A;  4FTB A;  3ZN6 B;  1X8E A;  3N4M A;  1CAW A;  3NAP B;  3SCG A;  2ARC A;  2WS9 1;  1L7Q A;  3H3U A;  4EV0 A;  5GZG A;  3O1P A;  4MGZ E;  1BLZ A;  4MZU A;  4LA3 A;  3ORJ A;  4XOG A;  4TTG A;  4GZ9 A;  1QJY 3;  5A33 B;  4XHX A;  1NCR B;  5DAQ A;  1H2N A;  5CVR A;  4OQ9 A;  3WDV A;  1E5S A;  1TMF 3;  1WLT A;  1C1F A;  2X29 A;  2Q8D A;  3ZXF A;  5BNN C;  1VBC 2;  2Y6J A;  4TXW A;  1RUE 1;  2OQ6 A;  2NYY A;  3RRD A;  1V6J A;  4LO8 A;  3ACH A;  3RI9 A;  1X36 A;  3NJZ A;  3MUY 1;  3CDZ B;  4QQP A;  5JI7 A;  1JYT A;  4IEU A;  5A6Y A;  2YDE A;  3WV6 A;  2PHW A;  3ZSM A;  5FZO A;  1HB4 A;  2XWJ B;  2HWF 1;  3GF6 A;  5IVY A;  1ZVF A;  1E5R A;  2ZS6 B;  3AYA A;  4LBO A;  2ORZ A;  3AJY A;  2WNV C;  1UOB A;  5FO8 B;  4XZP A;  3PUQ A;  4L99 A;  3JB8 A;  4UXA A;  2YHJ A;  3NV1 A;  2X10 A;  1FX5 A;  1MR5 A;  2VGD A;  3BB6 A;  3VKN A;  4CU9 A;  4EYU A;  5KHK A;  1CAX B;  5T5L A;  4JC1 A;  3R6S A;  3WT3 A;  4NHM A;  4X8P A;  4P9I A;  1KDK A;  3T2P A;  2VC9 A;  3SQO A;  1XJA A;  5C7G A;  1Y9Q A;  5C8C B;  4W50 A;  2RS5 1;  3WP5 A;  1RIR A;  2XBO 1;  2CDP A;  1V9U 1;  1OXC A;  2VPV A;  1ULC A;  4CVU A;  1YQ2 A;  4CCC A;  4OLL A;  4MYE A;  1PMJ X;  2ARB A;  1NCR C;  1QQP 1;  3WR0 A;  1RVF 3;  2FDJ A;  1UIJ A;  3OEB A;  5FPZ A;  2ET1 A;  2ZXQ A;  2WQ8 A;  3OBR A;  4KU8 A;  3PUS A;  1WCK A;  1COV 2;  1W99 A;  2JXA A;  5EZW A;  5TSW A;  4BIF A;  3GHM A;  1RUG 1;  4YW6 A;  4LHK A;  1VAK A;  3KV9 A;  2E31 A;  4Q1R A;  3ZYJ B;  1UO9 A;  5FMO L;  3HMY A;  5IVV A;  1LEN A;  1VRB A;  1ND2 C;  2SBA A;  1HRV 3;  2VMG A;  4QPI B;  1W3V A;  3VZK A;  2FCV A;  4DRR A;  2ZGU A;  1VP6 A;  3MGU A;  4WM7 B;  2ZPX A;  5IVF A;  2YBP A;  1AR7 1;  3JD7 3;  1IQA A;  2YG0 A;  3WQB A;  4K8R B;  1B35 A;  2B42 B;  4RHV 2;  1TZO A;  1V6K A;  3RJR A;  4ASK A;  1DGR A;  2R04 3;  3FL7 A;  5CFC B;  4XBQ A;  2F6B A;  4YVS C;  3KS7 A;  2LUW A;  2DDU A;  2XJU A;  3LQC A;  3POS A;  1OLQ A;  4OZO A;  1PGL 2;  5C8C C;  1U0A A;  2ZGT A;  2GNB A;  4P9G A;  5CNA A;  2QUO A;  5C71 A;  4YM3 A;  4IEZ A;  4IE6 A;  4EN9 B;  4IEV A;  1LAJ A;  1STM A;  3WDY A;  4AEJ A;  1F5J A;  4B4R A;  4BE3 A;  3RS6 A;  1ONA A;  2PHF A;  3H0O A;  1N3O A;  1TNF A;  5CU1 A;  1PNF A;  3RI8 A;  4LO7 A;  2VAU A;  5SV8 A;  1W6O B;  2E33 A;  5LBE A;  5FFO C;  3VL9 A;  2QFE A;  4HLT A;  4CCE A;  2OX0 A;  1R1A 1;  3K77 A;  2BV4 A;  1AR6 1;  4A6S A;  4CP9 A;  4IGO A;  4RSU A;  3T0D A;  2Y64 A;  1DQ6 A;  3OPT A;  1OLR A;  3ASI A;  4I30 A;  3N9O A;  4KBB A;  4OFG A;  5A7P A;  4COU A;  5C9A B;  4LT5 A;  1L3J A;  4XFA A;  3LDK A;  5J37 A;  1F31 A;  3WOG A;  4N53 B;  2IWG B;  4WM7 C;  5BNN A;  2BOJ A;  4LIT A;  3EO6 A;  1AX1 A;  2AC1 A;  5B2G B;  5A3L A;  5BV6 A;  4YWA A;  3DCQ A;  4LKF A;  1PO2 2;  1S0F A;  3VDC A;  2QQO A;  3LE0 A;  1LHW A;  3WQ1 A;  3MIC A;  1N3Q A;  5FUN A;  3SH5 A;  3AL6 A;  2NN8 A;  1MS0 A;  1NCQ B;  1PO1 2;  2DFC A;  2WNV A;  3H3L A;  3VD9 A;  1IG0 A;  1Q8V A;  4LPL A;  2HWD 2;  1OLM A;  1AYN 2;  4E4S A;  1JW6 A;  4FOV A;  4Q4X 2;  1JZ5 A;  1AYM 1;  1RUH 3;  1ZBA 3;  2YC4 A;  3IM0 A;  2MEV 3;  1Y7B A;  5FZ6 A;  2TNF A;  4A7Z A;  4BQ4 A;  3HQU A;  3WNN A;  2GAL A;  1ALY A;  3ZN6 A;  4CPB A;  1BK1 A;  1UZ0 A;  3NAP A;  1DYK A;  1DQ2 A;  3OF1 A;  4YNI A;  4X6Q B;  1DGL A;  5A33 A;  1NCR A;  1NLS A;  5C9A C;  2G1M A;  2I07 B;  2VNV A;  2G4I A;  2WIN B;  5T5J A;  5HCA A;  4N53 C;  1OOP B;  5FLI A;  3ZXG A;  1GWK A;  2GP5 A;  2J1R A;  3CQO A;  4IQP A;  2E63 A;  1JTZ X;  2R32 A;  3AZX A;  1ZBE 2;  4QB1 A;  3KF3 A;  1C5I A;  3WNM A;  2C26 A;  4DXR A;  1J58 A;  3OG2 A;  1WWY A;  1ND2 A;  1KFU L;  2O0O A;  1SLA A;  3BU7 A;  2JDM A;  1GNY A;  3POY A;  3HD8 B;  2B9U A;  2QE3 A;  5FKB A;  1XB9 A;  1RGS A;  3JBG 2;  1KIT A;  5F5A A;  2Q8E A;  1O4Z A;  5IW0 A;  3OUH A;  1VBB 1;  1I9R A;  4NPM A;  5AVA A;  4QQL A;  2BOI A;  1CAX A;  4DMI A;  5FMO S;  2PHU A;  4QX0 A;  4YVS A;  3NNM A;  4YW4 A;  1AR9 2;  1JHJ A;  3A4U A;  4XDQ A;  2VVE A;  4FFF A;  5C8C A;  5H9R A;  4I0A A;  3KCY A;  4E9K A;  2BWC A;  5H9S A;  1OBN A;  4F3J A;  2A6W A;  5LBB A;  2EF6 A;  4Y3O A;  4CCK A;  5ACA 3;  2YC0 A;  1LR5 A;  5A1A A;  2AEY A;  4Q4W 1;  1U5Y A;  2RDR A;  2XHN A;  1FV3 A;  4WM8 B;  1W2U A;  3K51 A;  4NMI A;  2IVJ A;  4AOC A;  2IXL A;  1RMU 1;  3ILR A;  4IEQ A;  2WT0 A;  1W28 A;  3UGG A;  4P08 A;  3HJR A;  3AKS A;  3GBW A;  4V2W A;  3ENR A;  3W5N A;  5LBC A;  2HWC 3;  3ZN4 A;  2F4P A;  4C0H A;  2VBB A;  1UZZ A;  3C7F A;  3TEY A;  4UAP A;  3HOB A;  5JZG B;  4D7Y A;  1ASJ 3;  4BK4 A;  3LEI A;  4EWD A;  4WM7 A;  2TUN A;  4IL7 A;  2W1U A;  1VBD 1;  2GNT A;  3PUR A;  5IVC A;  2ZGL A;  4XUP A;  3ACF A;  2ARX A;  5F5C A;  2K0G A;  5FRA A;  3N9P A;  4P9L A;  2VUA A;  1W8Z A;  3OUI A;  2RMU 2;  2BVB A;  2DCY A;  4Q4Y 1;  4NRM A;  3MBW A;  1D2S A;  2R06 1;  5FLJ A;  1RUF 3;  3L2H A;  4H2A A;  3ZXK A;  4IND A;  1UYP A;  4IE4 A;  3THP A;  2W1W A;  3J9S A;  2YGL A;  3AM2 A;  1POQ A;  4BA6 A;  1TG7 A;  2VO5 A;  1LHN A;  1PM7 A;  2WS9 3;  4YVW C;  2XG3 A;  2HJI A;  2VQ0 A;  2HYK A;  1MEC 1;  4WM8 C;  4YM1 A;  4C90 A;  2ADE A;  2QNK A;  1P8J A;  2R1B A;  3CL1 A;  1FOD 3;  3CNA A;  4IV1 C;  4NPR A;  3VZM A;  3WDT A;  2VE1 A;  1PIV 2;  2RDQ A;  3A7Q A;  1W6P B;  1AL2 2;  4ONU A;  2VMC A;  3UJO A;  1IS5 A;  5FUP A;  1HIX A;  4S2H A;  1RUE 3;  3WQ0 A;  4Y22 A;  1MQT B;  4XPV A;  4OUM A;  5C9A A;  4I02 A;  3B00 A;  2VCA A;  3VBR B;  3GZU C;  4N53 A;  4R9D A;  4YFW A;  4C8D A;  4E27 A;  3AYC A;  1UXZ A;  2PFW A;  3FLT A;  3M3O A;  4AGV A;  4ZKT B;  5KXD A;  2ZMK A;  3HNM A;  4IE0 A;  5BPX A;  4D7T A;  4CCJ A;  3CIH A;  4DFS A;  3PJQ A;  2LTN A;  4DO0 A;  1DBN A;  4CUA A;  1ZRE A;  5EPA A;  2DWR A;  3WNO A;  2OUJ A;  5C70 A;  5FY1 A;  2CGP A;  2BBV A;  2VW1 A;  2PHT A;  4AFA A;  2JD9 A;  2YB7 A;  5KXC A;  1NY7 1;  1Y43 B;  4BLI A;  1YO8 A;  2QZ2 A;  1CVN A;  1YIP A;  5FKC A;  5LY2 A;  2RS5 3;  3KZ4 C;  4A4A A;  2XBO 3;  4KWJ A;  1FPN 1;  1LUL A;  1V9U 3;  5EJ1 B;  4O61 A;  2WZP P;  2DVG A;  3WNK A;  3BVC A;  1UY3 A;  1VBA 1;  3MFC A;  4C0B A;  1M06 G;  1KDM A;  3G7D A;  3B7M A;  4YFZ A;  3N3H A;  4K6B A;  4CE8 A;  1QQP 3;  1US3 A;  1KEX A;  5CAZ A;  4B1M A;  4KL1 A;  4UYB A;  1OFS A;  3O12 A;  2OW4 A;  3I3M A;  3ROU A;  1MQT C;  1BCX A;  4KBZ A;  1RUG 3;  2ZX0 A;  3U4X A;  3W5M A;  3S57 A;  3VHO A;  3IPV B;  1SLT A;  3D0S A;  3MW2 A;  1WW4 A;  4AI0 A;  1PHM A;  2DTW A;  2WNU B;  1YC6 1;  3EB7 A;  3GGL A;  3IBM A;  4O9G A;  4WZF A;  1U5I A;  3J7L A;  4KNC A;  3L2Y A;  1MS3 A;  2WT1 A;  5GJ6 A;  4CEW B;  4UFM A;  5JUV A;  1QOO A;  1W2N A;  1AUY A;  1AR7 3;  1SDD B;  2Z79 A;  4A3Z A;  4B3N A;  2F4L A;  3CZU A;  2DU0 A;  5DG1 A;  2QQM A;  3H9A A;  4HKL A;  5HBA A;  3S7I A;  4AQT A;  1HKD A;  2RJL A;  5B4N A;  1REE A;  1H2M A;  1QJF A;  2WYS A;  4N9I A;  4B4P A;  5CYY A;  2OS2 A;  4QX3 A;  5FZM A;  3WEZ A;  3FHI B;  1A8M A;  2A73 B;  1EAH 2;  1JZ2 A;  2ZGK A;  4XBL A;  4DPN A;  1W04 A;  3OD0 A;  4QMA A;  4P5H A;  4AGR A;  4GJY A;  4NAO A;  3NO8 A;  4Q4V 1;  2CWM A;  4OHZ A;  2R16 A;  5C5T A;  3GCX A;  4M0H A;  4YVW A;  4XEZ A;  1NZC A;  2VZS A;  4PIZ A;  4WM8 A;  5FYI A;  1JOJ A;  4S2G A;  2JWP A;  5GLT A;  4IV1 A;  2E51 A;  1R1A 3;  2PHX A;  1AR6 3;  5FZL A;  3VD5 A;  2WFF 1;  4BJ0 A;  1YFW A;  3J7H A;  2WNU C;  4NR1 A;  4LNV A;  1GLH A;  1XE0 A;  5HCB A;  4QPG C;  5C33 A;  1UXX X;  4XTP A;  1UMZ A;  3MEP A;  1CR7 A;  4CEW C;  3ECQ A;  4FPG A;  1SBD A;  4A3X A;  2XON A;  5FP8 A;  1OA4 A;  4UOJ A;  3D82 A;  2Y34 A;  3TEX A;  5T5O A;  4A7K A;  1UZV A;  5GM0 A;  3ZVX A;  3P3P A;  5I0S A;  1PZ9 A;  3AX4 A;  1GNZ A;  3TWI A;  2W95 A;  4GXL A;  4GIQ A;  5GLU A;  5BXX A;  4D6Q A;  5A7W B;  1HX6 A;  2EIG A;  2GC1 A;  2BNN A;  3OCP A;  4P9J A;  1NE6 A;  1SBF A;  1CON A;  1BBT 2;  1VIW B;  4TWT A;  1WW7 A;  1X9T A;  1AYM 3;  3KV4 A;  1S2K A;  4A45 A;  5F9T A;  1IKQ A;  1QOT A;  1SFN A;  1NQD A;  1SEF A;  2JD4 A;  4I01 A;  3WF0 A;  5A32 B;  1B09 A;  5FCC A;  1HXS 3;  1GP4 A;  3PTY A;  4Y33 A;  4I09 A;  4YRD A;  4AEM A;  3K46 A;  4IES A;  4URA A;  1R08 1;  4XAA A;  1EYB A;  3QAC A;  2WWS A;  4LXL A;  4JKL A;  4ZXE A;  3MFA A;  4CCM A;  1PGS A;  1GQP A;  1W6P A;  3WX5 A;  5LBF A;  1DFQ A;  1RB8 G;  3WY6 A;  2EXK A;  1LOF C;  1V70 A;  3OOX A;  4LUM A;  4XIK A;  5DAV A;  2IVI B;  4IEY A;  1MQT A;  4MAD A;  1UY2 A;  4D8M A;  1PZ8 A;  4NVP A;  1DLL A;  3GJB A;  3NJX A;  1VBC 1;  4IXL A;  4YW2 A;  4P00 B;  3M4F A;  1IG3 A;  5LEJ A;  2BEO A;  1H9P A;  4DRV A;  1NKG A;  2XXZ A;  1FXZ A;  2JDN A;  4XFH A;  3WW4 A;  1QF3 A;  2RM2 3;  2VCC A;  2VQT A;  2ZEW A;  3T1L A;  1W9T A;  3WG4 A;  2EAA A;  1VBB 3;  5EV7 A;  3ZKY A;  3ZDS A;  1OD5 A;  4L97 A;  5L7O B;  2XUE A;  1OC1 A;  5K9Y A;  1HW5 A;  1S55 A;  4NWW A;  1W0P A;  1CAV B;  3FFQ A;  3MV1 1;  1I3H A;  5IAV A;  2ILM A;  2K2S A;  4PJY A;  4SLI A;  4S2F A;  4CP0 A;  3H50 A;  3TEZ A;  3AXE A;  3WW2 A;  3MW4 A;  3OTF A;  5GLW A;  3UES A;  5BY5 A;  4EN6 B;  1YFU A;  4P5Y A;  4Q4W 3;  1IS3 A;  3H3Z A;  3E6D A;  3NKT A;  4IV3 B;  5GLZ A;  4QQ2 A;  3ZMN A;  1ODM A;  1RUC 2;  2GC2 A;  4RQP B;  1Q8S A;  1Q8O A;  1RMU 3;  4CXW A;  1DIW A;  3AKT A;  4LHL A;  4BHP A;  4EZH A;  4XVH A;  5BYN A;  5E88 A;  3N7K A;  3QD6 A;  3P6B A;  5E1R A;  3VKL A;  4DXT A;  5C3Q A;  4DOU A;  3TBD A;  1J3P A;  2QQJ A;  3NRU A;  5FDB A;  4AED B;  2Q0A A;  1GUI A;  2W1Q A;  2WNU A;  1COV 1;  3O1M A;  5C6C A;  4LHN A;  4ZS3 A;  3V65 A;  1DZR A;  4QPG A;  4GWM A;  4EWA A;  4E2G A;  2MNG A;  1APN A;  2JX9 A;  2BRT A;  4CEW A;  3OB8 A;  3BOP A;  4QKD A;  2BQP A;  3JB4 C;  2W87 A;  4AGG A;  1SG3 A;  2GC3 A;  4MGT A;  4IEX A;  2WC2 A;  3T4H B;  3DUI A;  4LLO A;  4NUB A;  4Q4Y 3;  4UW5 A;  5IT6 A;  1MPX A;  3M70 A;  4RHV 1;  4DS0 A;  1UQX A;  2R06 3;  2VOV A;  4BU2 A;  2XKP A;  4OI4 A;  4J1X A;  2QQI A;  3FJS A;  3EXU A;  4M0N A;  2BFU L;  4U36 A;  2Y8K A;  4XF0 A;  4EJR A;  1PGL 1;  2E7A A;  3D0J A;  4Q8L A;  1MS1 A;  2RJ2 A;  4XF3 A;  2H6B A;  1W39 A;  4IV3 C;  4Q26 A;  2O8O A;  1RUO A;  4DNY A;  3D3A A;  4RQP C;  1Q8Q A;  1OA3 A;  3ATG A;  1GZC A;  5FYY A;  4KI5 M;  3V0A B;  1EY2 A;  2YMZ A;  2BNM A;  2A6X A;  1WMF A;  4AQ6 A;  5GZE A;  4IE7 A;  1TEI A;  2VMF A;  1O7F A;  3POJ A;  4QM9 A;  1HQW A;  1HQN A;  4OMD A;  2GND A;  1Y3T A;  3DKW A;  3GXU A;  3K4D A;  3Q8A A;  4QDQ A;  4NIA A;  2QCS B;  1UY4 A;  5FZO B;  2WZ8 A;  2XL7 A;  1UW8 A;  1LOF A;  1W8T A;  3HIF A;  2C4X A;  1URX A;  3RG0 A;  5I0R A;  2R30 A;  1G9C A;  1QNY A;  2I74 A;  1W06 A;  2EXH A;  3D5O A;  3DEM A;  3KD4 A;  5AVP A;  2DCK A;  1AR8 2;  1J59 A;  1QXP A;  2D5H A;  3I2K A;  5FJK A;  4Y5S A;  3NMB A;  1GV9 A;  2WNE A;  1N1V A;  3HQR A;  4OHY A;  1AX0 A;  3WZ1 A;  1WA4 A;  3AP4 A;  1E5I A;  1Z78 A;  5A7W A;  3PLQ A;  5KXB A;  1PO2 1;  3DV8 A;  1K45 A;  1NA1 C;  1ZRF A;  4CDX B;  3RYR A;  1O8P A;  1QJU 2;  3IDA A;  4ITC A;  4ORF A;  4ARX A;  5FY8 A;  2XH6 A;  1UNB A;  1HDK A;  2D3S A;  1FPN 3;  1PO1 1;  3M8L A;  4BIS A;  2W2I A;  5FZK A;  5A32 A;  2PEL A;  2RR1 2;  1VBA 3;  1AYN 1;  1NQJ A;  2BZD A;  2HWD 1;  2X53 S;  1UYZ A;  2XVG A;  5HXV A;  3IMM A;  3HT2 A;  5LCW L;  5I8Y A;  3P5B A;  2WN2 A;  1GZ9 A;  3NNJ A;  3J8F 2;  3OY8 B;  2CGN A;  3PU3 A;  1WMD A;  3WCS A;  5A3T A;  2RS1 2;  1XU1 A;  2ARE A;  2JEN A;  4FPL A;  4UW6 A;  1SLL A;  1EP0 A;  1PK6 B;  2LM3 A;  2QQN A;  1XBF A;  4LUL A;  4CEY B;  5A6X A;  3AFG A;  1Q3E A;  1G9D A;  2JEM A;  2VZ3 A;  5JMC A;  1RUI 2;  4LA2 A;  2YPJ A;  5J36 A;  3TYJ A;  4AG4 A;  2J22 A;  1WLC A;  3K2O A;  2D98 A;  1ZRI A;  1Q56 A;  2XML A;  4BOW A;  2VM9 A;  3FBY A;  1RJ7 A;  3RQ0 A;  1S0J A;  4B4Q A;  4YW7 A;  2FDH A;  1UKR A;  1NX9 A;  1XNK A;  2BW8 A;  1QNW A;  2XLF A;  2ZAA A;  3B5L B;  3MLJ A;  3MIF A;  4ZPI A;  3HWJ A;  2WSV A;  4QB2 A;  4L9B A;  3VKO A;  5JOZ A;  4CDX C;  4COV A;  2Y0I A;  1CWP A;  1J84 A;  3BTX A;  1VRH 2;  3JBG 1;  4PCR A;  2GN3 A;  5D1I A;  4QKN A;  1ACC A;  1CAV A;  1MS9 A;  1VAV A;  4YSF A;  3FWE A;  2PN5 A;  4FOW A;  2OVU A;  3Q9O A;  1POV 1;  2EA7 A;  2GMM A;  3ABZ A;  3WP6 A;  2VTX J;  1NOV A;  4E4H A;  3VZJ A;  2JDP A;  4MGI E;  3PUI A;  1J1T A;  4COY A;  1GOG A;  2A7A A;  1W90 A;  2XVL A;  4H7L A;  3VHP A;  3LEG A;  1AR9 1;  1UKG A;  4Q4V 3;  2KA3 A;  2LRP A;  3W59 A;  3WNX A;  1FNZ A;  2GP3 A;  4XJW A;  3ZN5 A;  4LBM A;  2FBE A;  5M0T A;  4B8E A;  2ID4 A;  4IV3 A;  2GU9 A;  1JZ6 A;  2V73 A;  4TN7 A;  1PK6 C;  4RQP A;  2H0B A;  3AMM A;  4CEY C;  2WFP A;  1KJL A;  4LLF A;  4P02 B;  4HVQ A;  1EV1 2;  4OHV A;  4BM8 A;  2BFU S;  1UOG A;  3FMG A;  3LKJ A;  3M2M A;  3ST7 A;  1PM4 A;  2ZHK A;  4XJU A;  4AZZ A;  3RSJ A;  4XAB A;  3W9A A;  2Y38 A;  3O5S A;  3JU9 A;  3W20 A;  4QHB A;  5FO7 B;  3UNP A;  2RV9 A;  3U4S A;  2WNV B;  3I2O A;  1WCQ A;  3WD5 A; 
#chains in the Genus database with same CATH homology
 1JZ5 A;  2YC4 A;  1UYY A;  3C7E A;  2QQL A;  3WNN A;  5G04 L;  1UZ0 A;  3OGV A;  4LKS A;  4DEQ A;  1F4H A;  2HLE A;  5JXI A;  3C8X A;  1DYO A;  2WAO A;  3NJV A;  2J1T A;  2J1E A;  4DUW A;  2J1R A;  3CQO A;  4W4Z A;  4BXS V;  4MOA A;  4OMC A;  4QB1 A;  3WNM A;  4DXR A;  2C26 A;  1W0N A;  5IYY A;  3OG2 A;  2J1U A;  1OD3 A;  3IAP A;  2VME A;  3K75 B;  2V72 A;  2VL4 A;  2VZP A;  1GNY A;  1K42 A;  2V5D A;  2BBA A;  4BK5 A;  2BGP A;  2Z4F A;  2JKX A;  3EYP A;  4YPJ A;  2BGO A;  4IUG A;  2XQX A;  4QX0 A;  2WAA A;  1GOF A;  2EID A;  1JHJ A;  3I2F A;  4QPW A;  2WZE A;  3GDB A;  1GOH A;  2CDO A;  4MGQ A;  5A1A A;  4CU8 A;  1WKY A;  2XHN A;  2WDB A;  5JXH A;  1JZ3 A;  3F2Z A;  2W3J A;  4Z2A A;  1JYX A;  2VZR A;  3HJR A;  4P08 A;  3W5N A;  3WNL A;  2VR4 A;  4AAX A;  3C7F A;  5EJZ B;  2WO3 A;  4UAP A;  1W8N A;  3HOB A;  3ACG A;  4BK4 A;  3LEI A;  4KMQ A;  5F7U A;  4QB6 A;  2W1U A;  3ACI A;  1NAE A;  3BN6 A;  3VD7 A;  3C7G A;  3ACF A;  4PF1 A;  4XUP A;  1RYY A;  2YC2 A;  3NNG A;  4OUE A;  5JXJ A;  1LNS A;  4RN5 A;  3LEK A;  3MBW A;  4A42 A;  4DEV A;  1PX3 A;  1OT5 A;  3T2Q A;  1XC6 A;  2W1W A;  4HG6 B;  3OGS A;  1TG7 A;  2VO5 A;  1JZ8 A;  2VTF A;  4MGS A;  1P8J A;  2QBX A;  5JR2 A;  1W9S A;  5LA0 A;  3A7Q A;  2VMC A;  2KD7 A;  4QDR A;  3MO4 A;  1IQD C;  2X05 A;  2VCA A;  1W9W A;  1JU3 A;  2W92 A;  2VZU A;  5FUI A;  2WBK A;  1UXZ A;  3HNM A;  5LA2 A;  5I0D A;  3HEI A;  4UI9 L;  3CIH A;  1UYX A;  4LHS A;  2Y6G A;  3MUZ 1;  4CUA A;  4JKM A;  2ZEZ A;  1D7P M;  5HXM A;  3WNO A;  5C70 A;  5IFT A;  2JD9 A;  2YB7 A;  3DEC A;  3VD3 A;  4DUV A;  4A4A A;  3I2H A;  5EJ1 B;  2RVA A;  3MV0 1;  3WNK A;  1CZS A;  1UMI A;  1UY3 A;  3AC0 A;  1CZV A;  1US2 A;  1US3 A;  1KEX A;  3THC A;  1BHG A;  3SKJ E;  2VMD A;  1NUK A;  3K4Z A;  1ULP A;  1OF3 A;  1XNT A;  3W5M A;  3UET A;  2EIC A;  3EB7 A;  3GGL A;  2V4V A;  5JUV A;  2JE8 A;  1SDD B;  4A3Z A;  3BGA A;  5DQ0 A;  4GWJ A;  1H6Y A;  3CZU A;  2J1S A;  3WNP A;  4XUO A;  2QQM A;  1XNA A;  5IHR A;  4ARY A;  2ZEY A;  1UX7 A;  3A22 A;  5IJR A;  1O59 A;  2B4K A;  4W8J A;  4BDV B;  5B4N A;  4CU7 A;  2WYS A;  5CYY A;  1R64 A;  4QX3 A;  3WEZ A;  1O8S A;  5HPO A;  2HYX A;  1JZ2 A;  3CKH A;  4DUX A;  3I97 A;  4QX1 A;  2VJX A;  4E8D A;  2VZQ A;  3P1I A;  1F4A A;  2J1A A;  4LQR A;  2VZS A;  2E32 A;  3NQH A;  3VD5 A;  4BJ0 A;  3J7H A;  3T08 A;  1UXX X;  3ECQ A;  5EIY B;  3VD4 A;  2XON A;  4XUN A;  3LPG A;  3OEA A;  4UOJ A;  2EIB A;  5B4X A;  2WUH A;  1H6X A;  1W8O A;  3ETP A;  3OBA A;  2W1S A;  3DYP A;  1XPW A;  4CU6 A;  2W95 A;  4OYU A;  2LW8 A;  4JX0 A;  4L0P A;  1CIY A;  4JKK A;  4CUB A;  2VZO A;  5JXG A;  4XUR A;  4A45 A;  4KWU A;  2XOM A;  2W91 A;  3WF0 A;  1UWW A;  4A44 A;  3III A;  3K46 A;  5LA1 A;  2Y6H A;  3A21 A;  3DYO A;  4JKL A;  4ZXE A;  1GQP A;  4FI9 A;  3SKV A;  4ZZ5 A;  3VDB A;  1OF4 A;  4ZY9 A;  5DMY A;  3LPF A;  2E26 A;  3IB3 A;  3SEP A;  3I2I A;  2X09 A;  4MAD A;  5IFP A;  2VOT A;  1UY2 A;  4D8M A;  3NJX A;  2DCJ A;  4P00 B;  2BER A;  1NKG A;  5JMO A;  2VCC A;  2ZEW A;  2VQT A;  1W9T A;  4MO3 M;  4QDS A;  4QX2 A;  1T2X A;  3MV1 1;  3WF3 A;  1JYW A;  2VCB A;  2VQU A;  3I3E A;  3U37 A;  3C7H A;  4XZU G;  3FHQ A;  4M4R A;  2W47 A;  3UES A;  1L7R A;  1OH4 A;  4P5Y A;  3K4A A;  2W9X A;  2VZV A;  3HNB M;  2W5F A;  3I3D A;  1CZT A;  1JU4 A;  4XVH A;  3P6B A;  4DXT A;  1ULO A;  2WN3 A;  3A23 A;  5DPN A;  2QQJ A;  2L9L A;  3NRU A;  2WO1 A;  2YFU A;  1GUI A;  2W1Q A;  3OGR A;  3WSO A;  1K12 A;  1PX4 A;  3OB8 A;  5CZK A;  1SHW B;  2W87 A;  1JZ7 A;  2JDA A;  4D0Q A;  1SG3 A;  3HN3 A;  3E1F 1;  4JHZ A;  3JXS A;  2ORX A;  1MPX A;  2ZEX A;  1DP0 A;  1L7Q A;  3I3B A;  2QQI A;  2B9V A;  4ET7 A;  2Y8K A;  5J1X A;  4TTG A;  4GZ9 A;  2RJ2 A;  3CMG A;  3FN9 A;  4XUT A;  1PMH X;  3D3A A;  2Y6J A;  4TXW A;  4KI5 M;  4PT6 A;  2EIE A;  3ACH A;  3MUY 1;  3DYM A;  3CDZ B;  2VMF A;  4OMD A;  3K4D A;  3GXU A;  3WF1 A;  4QDQ A;  1UY4 A;  2WZ8 A;  2ORZ A;  2C4X A;  3C7O A;  4E8C A;  2WAB A;  1KGY A;  2X10 A;  1GU3 A;  4CU9 A;  2DCK A;  2YFZ A;  3IAQ A;  3I2K A;  3T09 A;  3T2P A;  2VC9 A;  4GWI A;  5C7G A;  3I2J A;  4W50 A;  1DLC A;  1I5P A;  2CDP A;  3T0B A;  3T2O A;  4CVU A;  1K45 A;  1YQ2 A;  1O8P A;  3IDA A;  4PQQ A;  4ARX A;  4M4P A;  1PMJ X;  3I2G A;  3VDA A;  1TVG A;  5DN2 A;  2VZT A;  3OEB A;  2BZD A;  1UYZ A;  2ZXQ A;  2WQ8 A;  5LCW L;  1J83 A;  1EUU A;  1W99 A;  2WN2 A;  3GM8 A;  2E31 A;  1UY1 A;  4A41 A;  3CZJ A;  3PUH A;  4XUQ A;  1JYV A;  4RYD A;  1GMM A;  1JYN A;  2QQN A;  1K3I A;  2VZ3 A;  2YG0 A;  3WQB A;  4QAW A;  3THD A;  3ZM8 A;  2PQS A;  4AG4 A;  2J22 A;  1HN1 A;  2OKX A;  3FL7 A;  2J1V A;  2DDU A;  2VM9 A;  3LQC A;  2QQK A;  4OZO A;  1NX9 A;  5C71 A;  4QB2 A;  2J7M A;  4CUC A;  1CX1 A;  1J84 A;  3HPN A;  2W94 A;  2R7E B;  1UY0 A;  3ABZ A;  2Y6L A;  2E33 A;  4DXS A;  2C9K A;  2W46 A;  3PUI A;  1GOG A;  2VZ1 A;  3LEG A;  3K77 A;  1JI6 A;  3T0D A;  2Y64 A;  2ID4 A;  2WO2 A;  1JZ6 A;  3WF2 A;  3HNY M;  3WF4 A;  4P02 B;  3SEE A;  1UMH A;  1JZ4 A;  3VDC A;  2Y6K A;  2QQO A;  3LE0 A;  5G05 L;  4A6O A;  3T0A A;  4ZZ8 A;  1EUT A;  3VD9 A;  2LS6 A;  4LPL A;  3UNP A;  3FHA A;  2RV9 A;  1WCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...