3HNYM

Factor viii trp2313-his2315 segment is involved in membrane binding as shown by crystal structure of complex between factor viii c2 domain and an inhibitor
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
156
structure length
156
Chain Sequence
SCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor VIII
publication title Trp2313-His2315 of factor VIII C2 domain is involved in membrane binding: structure of a complex between the C2 domain and an inhibitor of membrane binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 40
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3hnyM00
3NQHA 3HEIA 2DCJA 4ARYA 2ID4A 2WYSA 2X09A 1OT5A 1PMJX 2W3JA 2W9XA 1IQDC 1K42A 3IDAA 3ZM8A 3GGLA 2W46A 3LPGA 4A41A 2XONA 3WF0A 2QQKA 3T0AA 3VD5A 1JZ7A 3I2HA 1OF4A 1US2A 5JR2A 2ZEXA 3OEAA 2VZSA 4HG6B 1UWWA 3U37A 4ZY9A 1UY0A 1SG3A 3C8XA 2W91A 4XUOA 3T2QA 4DXSA 4CU6A 5LA0A 3C7HA 2VL4A 2X10A 4BXSV 3THDA 2LS6A 5DMYA 1H6XA 2QQOA 2QQNA 3OG2A 2ZXQA 4BK5A 5JXIA 4A3ZA 3WSOA 3AC0A 4LQRA 2VMCA 2Y6JA 4MGSA 1GOFA 3UNPA 2VCCA 3I2JA 5DN2A 3CZJA 3DYMA 4M4RA 4FI9A 4CUCA 3OGVA 5I0DA 3K46A 1PX3A 1DYOA 3T0BA 3P1IA 3PUHA 4BDVB 2VZPA 2EIBA 3DYOA 2C4XA 3NJXA 3WNLA 4CU9A 3BN6A 1F4AA 3ECQA 4PF1A 1UY2A 2WN2A 1UXZA 1P8JA 2R7EB 4A42A 1EUUA 2YB7A 5EJ1B 5HPOA 4E8DA 5EIYB 1F4HA 1KEXA 1CZTA 2ZEZA 3MV01 4QPWA 2J7MA 4QB2A 3W5NA 4ET7A 4E8CA 4W4ZA 4QX2A 3SKVA 4JHZA 4DEVA 2VQUA 2QQLA 2WABA 1O59A 3THCA 3WNMA 3FHAA 3IIIA 3NJVA 2PQSA 3P6BA 2B9VA 1NKGA 3I3BA 1UMHA 4P00B 1XC6A 3VD9A 2WZEA 3A23A 5JXHA 2VMDA 1W8NA 3SKJE 3EB7A 1LNSA 1K3IA 1XPWA 3K4AA 3F2ZA 4GZ9A 3FHQA 1JZ3A 3LE0A 1CIYA 2WUHA 1W8OA 2VCBA 2WAOA 2Z4FA 3VD3A 3D3AA 4XUTA 3T2PA 2W1SA 2ZEYA 3VD4A 3CKHA 3SEEA 1GMMA 2WN3A 2VZ3A 3GM8A 1D7PM 4DXTA 1PMHX 3WNOA 2BGOA 4DXRA 2E33A 1K12A 3ACHA 3VDBA 3VDAA 1I5PA 5JMOA 1UYYA 3K75B 1SHWB 2VZQA 3DECA 3I2IA 1K45A 2YFUA 3T0DA 2W1UA 4KMQA 4D8MA 2CDPA 3WQBA 3CIHA 2LW8A 1W99A 2BGPA 2W1QA 1YQ2A 2Y8KA 3I2KA 2RVAA 3GDBA 2W5FA 2W95A 3IAQA 4MADA 2J1VA 2Y6LA 4CU7A 5J1XA 4RYDA 5JXJA 1UY4A 3WF2A 2RJ2A 2Y6HA 4YPJA 2W87A 3MBWA 4TTGA 1TG7A 2W47A 2VMEA 4OUEA 4JKLA 5A1AA 4W50A 4AAXA 1US3A 1NUKA 1JYVA 3CQOA 4LPLA 3OGRA 1OD3A 5C70A 4ARXA 4UOJA 2JE8A 5IFTA 3K4DA 1KGYA 1CX1A 1NAEA 3I3DA 5B4NA 1JZ8A 4QDQA 3WF4A 1UYZA 2WO3A 2CDOA 2XQXA 3LEGA 2JKXA 3IAPA 1UXXX 1OH4A 1W0NA 5EJZB 2JDAA 4QX1A 5CYYA 2WAAA 2VZTA 5CZKA 1O8PA 3MUY1 2XHNA 3UESA 5DQ0A 1R64A 3C7EA 2QQJA 3ACGA 4QDSA 2W92A 3DYPA 2WBKA 3HOBA 1CZSA 3MO4A 1CZVA 2C26A 2J1AA 3K4ZA 3T2OA 3WNKA 2L9LA 1TVGA 4QB6A 4CU8A 2BBAA 1H6YA 4CVUA 4QB1A 1EUTA 2WO2A 2W1WA 4A45A 4CUBA 3SEPA 4OZOA 2QQIA 3HJRA 1GU3A 4OMDA 5B4XA 2WDBA 2KD7A 4P5YA 3WF1A 1ULPA 5LCWL 2VZUA 4XURA 3HNMA 3FN9A 3OEBA 1UY3A 1UX7A 4DEQA 1BHGA 1JU4A 3LEIA 3LPFA 3A21A 1OF3A 1GQPA 1UZ0A 3WEZA 2YFZA 3C7GA 4A4AA 1J84A 2J1EA 1RYYA 3PUIA 1JU3A 5LA2A 3A7QA 2VJXA 3ACIA 3NRUA 5C7GA 3ACFA 3MV11 2X05A 3WNNA 1ULOA 1UMIA 2Y64A 3I2GA 2YC4A 4P08A 3VDCA 4A6OA 4QX3A 3FL7A 2VC9A 4KWUA 4P02B 5IHRA 5FUIA 4L0PA 4Z2AA 2QQMA 1JZ2A 3HN3A 3WNPA 1SDDB 2J22A 4LHSA 4ZXEA 2EIEA 1JZ6A 4GWJA 1JYNA 2ZEWA 4QAWA 2VZOA 2V72A 4RN5A 5C71A 4A44A 2E31A 2J1UA 4MOAA 2WZ8A 1O8SA 2VM9A 2BERA 1GNYA 2J1SA 4XVHA 3NNGA 1JYXA 4D0QA 1JYWA 3OGSA 2J1RA 4JX0A 2VTFA 2VOTA 5F7UA 2YG0A 3HNBM 3A22A 3OB8A 4M4PA 3I97A 1GOGA 1GUIA 3BGAA 2XOMA 3CDZB 4JKKA 3T08A 1DP0A 2VCAA 5IFPA 1GOHA 2VZRA 2HYXA 4XUPA 2VMFA 2V5DA 2VZ1A 5DPNA 1WCQA 2YC2A 2E32A 5G05L 3HNYM 2E26A 3ETPA 4ZZ8A 1L7RA 3J7HA 2B4KA 3IB3A 5JXGA 5LA1A 2JD9A 2BZDA 3WF3A 2ORZA 4PQQA 2Y6KA 4QX0A 4BJ0A 3UETA 1L7QA 2RV9A 4TXWA 1XNTA 3E1F1 5G04L 3LEKA 3I3EA 1JZ4A 3HPNA 2VQTA 3K77A 2ORXA 1DLCA 5JUVA 2QBXA 4JKMA 1W9WA 2EICA 1J83A 3MUZ1 4UI9L 3T09A 4PT6A 2C9KA 5HXMA 2EIDA 3W5MA 4CUAA 1W9TA 5IJRA 2V4VA 3GXUA 4ZZ5A 4OYUA 4QDRA 1MPXA 1UY1A 4KI5M 4DUXA 3LQCA 5IYYA 4XZUG 3CZUA 3ABZA 1JHJA 4XUQA 1XNAA 4GWIA 2WO1A 4OMCA 2VZVA 3C7FA 4UAPA 2W94A 1WKYA 2OKXA 3I2FA 2WQ8A 1JI6A 3JXSA 4DUVA 4W8JA 4BK4A 4DUWA 3OBAA 4MO3M 3CMGA 4LKSA 1UYXA 2Y6GA 1PX4A 1T2XA 2J1TA 1JZ5A 2VO5A 4MGQA 2VR4A 4AG4A 2DCKA 3C7OA 4XUNA 3EYPA 1NX9A 4IUGA 1W9SA 2DDUA 3VD7A 2HLEA 1HN1A
chains in the Genus database with same CATH superfamily
5IK4A 3KS7A 5K8SA 3NQHA 3PLQA 3HEIA 4ARYA 5FLJA 2BGCA 1OKOA 2EIGA 4IEUA 2X09A 4Y1VA 2EALA 3LIHA 2AC1A 3O0WA 2W9XA 4LKDA 3RSJA 3IDAA 1XJAA 1X36A 3ZM8A 4I01A 1LOFC 3IPVA 4P9GA 4B7KA 1D2QA 2ENRA 1DGWX 4HN1A 4AFCA 3LPGA 1S2EA 1W2OA 2JG8B 2ZJCA 3WF0A 3ZSMA 1NZCA 2QQKA 4D94A 1C8M1 2PHLA 1ULGA 4AHZA 5ABJA 1US2A 5JR2A 1N1TA 2ZEXA 3A0NA 2VZSA 3U1XA 1UWWA 5DAPA 2ZGOA 5JLVA 4M0HA 1BEV1 3FX3A 4C90A 5ERLA 1AR72 2JG8C 1ND2C 2GU9A 3HD8B 4GH4A 5BNPB 5C8CA 1V6LA 2R061 2VL4A 4Q4V1 4ISRA 4XF4A 4QX5A 1H1MA 2LS6A 1AJOA 2G1MA 2QQNA 1C57A 4CCNA 3ZMNA 4BK5A 4HK9A 2A1XA 1V9U3 3GCWA 1NCQB 1ENRA 4IEQA 2VMCA 2Y6JA 1W2NA 4IW3A 2WT0A 5L9RA 1GOFA 3AZWA 3LSEA 1QQP1 1UZWA 3I2JA 3EO6A 3Q8EA 2VBPA 3WUCA 1CJPA 1OLME 3DYMA 2CGNA 5C6CA 5EXOA 1YQ5A 2JE7A 3A4UA 1NCQC 3AYEA 5AVPA 1W8FA 4IV3B 3LIGA 1O3SA 1YXWA 3T0BA 1BBT2 5DDJ1 1DYKA 4HZFA 4LBLA 1L7LA 4UWDA 4BWOA 4EJRA 1ZNPA 1MVQA 2XBO1 5KHJA 3K3OA 3V0AB 1UOJA 1F4AA 4IV3C 2A70A 4NPRA 4KBZA 1UXZA 3WW2A 2DBIA 3GCXA 2YB7A 4W6YA 5EJ1B 2EXHA 2HEVF 4LHLA 4YVWC 2HH9A 1SBDA 5HPOA 1O3TA 5EIYB 1KEXA 3E5QA 3QH6A 2ZOEB 2VUAA 3E5UA 2GAUA 2OQ6A 4K7JA 4E8CA 4ET7A 4JHZA 4LBQA 4DEVA 5FRAA 2IXKA 2LRPA 2HWE2 4Y24A 1VBB3 5FPZA 4L11A 5F6KA 4MX3A 1S0IA 1NYWA 1NY71 3IPVB 3H8XA 5AC91 3MICA 1LCLA 5A3UA 3R4SA 4FQ4A 1A78A 3IIIA 4LBMA 4QQ2A 1F9KA 1OQ1A 3POIA 2B9VA 5FYBA 3I3BA 3I54A 4RHV1 5J48A 4E9KA 1RVF3 3A23A 1DQ6A 5T3NA 5ABJB 1N47A 1YNAA 1AR83 5C4WC 1RUG1 1AYN1 2E7QA 1W8NA 3BIEA 3EB7A 1K3IA 3K4AA 4XBNA 4GZ9A 1QNYA 2G19A 5FZGA 4GH4B 5GLUA 4BYYA 5C8CB 2WFF2 5APAA 2W39A 4IL7A 3BALA 1Q8SA 5ABJC 4KL1A 3KMHA 3UYJA 4S2GA 1O4TA 2DCZA 3KB5A 4LITA 3MFAA 4CRQA 3MHZA 4NIHA 2W1SA 4GH4C 4MSVA 1OD5A 5D1IA 1O5LA 5DAWA 1F35A 3WQ1A 1DZTA 1PMHX 2BGOA 1RUOA 3RMXA 1FOD1 4QMAA 3SCFA 2OQ7A 1YFYA 2XJQA 3ZSLA 3O1OA 1HLCA 1VBD2 2RS31 1H4GA 3DGTA 2NP0A 4LT5A 4FFFA 4IE6A 5CKQA 5FJKA 4ATFA 1OXCA 4FP2A 4AVCA 1U5YA 5I8SA 1UZYA 1E5IA 4RA0A 4QU2A 2AUYA 2HWC3 2YPDA 4XABA 3VBSC 4QHZA 1AR71 4D8MA 4HVOA 5I8YA 1ZBA2 5EJ3A 2CDPA 2P6HA 1W2AX 2GNDA 3CF6E 3CIHA 1W99A 2BGPA 4Q8LA 1RUE3 2Q8DA 4B3NA 4QD2A 1K5MC 2ZGKA 3C2UA 3PNAA 4UW4A 1V6MA 1XNDA 3N7JA 1M06G 3TN91 3HQUA 3GDBA 5L19A 2BQPA 2Q0AA 2J1VA 1UKRA 3IAQA 3KGZA 4MADA 4RYDA 3TEXA 1UY4A 4LR4A 5J1XA 5KHIA 5DG2A 5GJ6A 4Q1PA 1WCSA 2MNGA 5DUVA 1UOGA 2Y6HA 3WDYA 2ZX1A 4YPJA 2W87A 3MBWA 3H7JA 4FVVA 3VV1A 5L7OC 2VMEA 4LBQB 3MW3A 1A6CA 3CJXA 5LW9A 4IQPA 5LATA 5A1AA 3M3OA 2GNMA 4ZHNA 3KZ4C 3URFA 1ULCA 5FY5A 1US3A 4AQ6A 2OPKA 2VNVA 1NUKA 1OHFA 2V73A 4LPLA 2P3JA 3NJYA 5F2WA 5JCTA 1OD3A 4CPBD 1IPJA 1GANA 2ZMLA 3JCIA 4UOJA 4BQ5A 1OQDA 5FY0A 5D2AA 3VKOA 3VN4A 1J3PA 4E4ZA 1TMF3 1CX1A 2HEWF 4I09A 4BIFA 2CWSA 5CFDC 3I3DA 4PCRA 3R05A 1W0OA 1QEXA 4IE5A 1VMJA 1LOCA 3KCYA 4HSLA 4DPNA 1ZRFA 3UGGA 1JZ8A 5T54A 4WVWA 3WF4A 2WO3A 4GB33 1X50A 2OX0A 4LBNA 4FO9A 3OUHA 1LRHA 3ZPYA 2HWE1 5JOXA 4QX1A 2O1QA 4AAPA 1H9PA 3VL8A 2QZ3A 3VHRA 1V00A 4EQVA 1HRV1 4ATEA 3IIAA 5CZKA 3LOBA 1O8PA 3AMNA 4XJWA 4A6SA 1J1TA 2XHNA 3UESA 5FZ7A 3AJYA 3FFZA 5DQ0A 4M3CF 3AP6A 5AFBA 2CGPA 1HX6A 4MVTA 2YBKA 2W92A 5FO8B 1LOBA 1W04A 2XLGA 2TNFA 1HRI3 3LF7A 1JODA 3DYPA 3PL0A 1VB4A 4XQDA 4D7YA 1CZSA 1CZVA 2KXLA 4DY5A 2TBVA 3T2OA 3OTFA 2VMGA 4JQTA 4R52A 4TLFA 5M0TA 1IG3A 4PLOA 4CDWA 4AL9A 4P14A 1KS4A 3DKQA 4MHUA 1IGOA 4QB1A 3MZHA 3H3LA 4EN7B 2ET7A 4YWAA 5FLIA 3V0BA 5A7QA 1UZZA 1VAKA 3HJRA 1CIWA 4WM7A 1POV1 1RB8G 1V6KA 4GMP0 4JV4A 2D7FA 4WVMA 3QLQA 3HBZA 4QHOA 2VU9A 4P9IA 3RMYA 2FDJA 1MQTC 4OVEA 1BCXA 1R091 1YQ8A 4P5YA 5FYZA 3VBUA 3OYWA 3W20A 1KJRA 3FUQA 4BMBA 3KCXA 1X9PA 2UYAA 2VUDA 5FP4A 3BOPA 1XRUA 5ANQA 5JI9A 2BJSA 1UY3A 1XSQA 4IDZA 1BHGA 4IGQA 3JB8A 2FDIA 1EAH3 4EROA 3E97A 2Q1MA 1GQPA 4GMP3 1MS3A 2BUKA 2PAMA 4MYEA 3S30A 2NQYA 4YGEA 4COUA 2DUOA 4A4AA 4FPCA 3AFKA 3CHXA 1RYYA 2LALA 1OVSA 5FYIA 2NYYA 1WW4A 2DVGA 3PVNA 4IESA 3ZXFA 2ZCWA 1FPN2 1ZRCA 2RDRA 4E4DX 2OT7A 4BXFA 5JZGC 3CEWA 3TB0A 5C7GA 3ACFA 3D82A 1S0EA 3KQRA 2Y64A 2CU5A 2X53S 4P08A 3G6JB 5L9VA 3B01A 5KC5A 3NVCA 2ZGPA 4A6OA 4QX3A 1A3KA 2DF7A 1OFNA 2VXJA 1VRH3 5FMOS 4P9XA 5FZ6A 4CEYA 4Z1VA 1YEWA 1UNBA 5FUIA 2XJTA 1FV3A 1VBA1 4AVTA 4SLIA 4Z2AA 1JZ2A 4Q4Y1 3HN3A 4IE0A 4RSUA 1QJU1 4ONUA 4DNYA 5FKBA 1XYOA 2B45X 2QUOA 4AHXA 3I4IA 3FJSA 3PTRB 4GD4A 1KD7A 1UU4A 2W52A 4R9DA 1WW5A 4OHZA 2EXIA 3DPRC 5E88A 5ACA3 2BPA2 5F2SA 2NN8A 2D6KA 2IXLA 2UWAA 3AYCA 2A71A 3LFMA 2RM23 4CDWB 5HCAA 1KRIA 2WZ8A 1DGRN 1O8SA 2YHJA 3AP5A 2ZHMA 4UW3A 5JMCA 5IAXA 3LKJA 3UGHA 3TEZA 4RS5A 4WVVA 3NO8A 4Q8KA 1YJKA 2PLV1 3RZHA 4D0QA 1JYWA 3V0BB 1XSRA 1WW7A 1SLLA 4WM7B 4TSVA 4CDWC 1AYM1 3OB8A 1OOPC 4M4PA 5A7WA 4FPEA 5H9QA 3T08A 1VBC2 3ZN6A 1HN0A 1RL3A 1UOFA 4AI3A 5IVBA 5BNNC 4TZDA 3VBUB 5FOJB 5KHKA 3OYWB 2VMHA 5FMCA 3EXUA 2VMFA 2YGLA 4I02A 2QKDA 2SBAA 5DPNA 5DG1A 5GZEA 1MEC2 4C91A 4RR3A 3ON7A 3SQOA 4FPLA 3M1HA 4KG8A 5G05L 3VBUC 2O8QA 1LGNA 4M3CE 5FO7B 3ZIWA 1Z7S2 4NRPA 1O3RA 2G9FA 5GM0A 1QJZA 3VHOA 2EVXA 1L7RA 3GZTB 5FZ0A 3U4XA 3ZYFA 4YARA 5JXGA 2JDHA 3LA3A 2XUEA 5FYTA 1SLAA 4K1ZA 1RUJ2 4UBGA 5LEKA 1RIRA 3OF1A 3QCWA 3VB9A 4CDUA 4Q0SA 1HXS2 2EXJA 1Y3TA 1V9U1 4WZCA 3UETA 4CEYB 4TXWA 1GLHA 4CZSA 1XNTA 4E4HA 5JIUA 3E1F1 3W58A 3N7LA 2BNOA 4PJYA 1MS4A 4EV0A 5F3EA 4I3PA 5J3UA 1OC1A 3AXDA 3K77A 1ASJ3 1LEMA 2DU1A 4E2SA 5EFUA 2P4EA 1DLCA 4KGQA 1RUH3 1FXZA 4AZZA 2CAVA 1RC6A 1DQ5A 1UW8A 1S0FA 4OZXA 5I0RA 1J83A 2VY0A 4I0BA 3M2MA 1G9FA 3CJIC 3MUZ1 4SBVA 2ZX3A 5FYUA 3OGGA 1G9CA 3WW1A 1GWMA 4BISA 2C9KA 1FPN1 5GKAC 5LZ6A 3M3CA 4LK7A 3U4SA 3FBYA 4K3UA 1AR92 4QQLA 4RS5B 4O61A 2K9ZA 3H1YA 3RWKX 2B39A 2HKXA 4OULA 2ATFA 2UURA 2B46X 4QDRA 1YFXA 1UY1A 2IWGB 5J7MA 3AM2A 5JOZA 3WG4A 3LQCA 4OI4A 5A7WB 2ZGNA 4XF0A 3CZUA 3JD73 3RI8A 3ZN6B 1HJFA 4UW5A 3WDVA 1QJFA 3HWJA 2MEV3 1JYIA 3WDXA 1MS9A 1XNAA 5A6YA 2A6XA 1VRBA 4IEVA 5FXWA 4PIYA 4ASMB 5HCHA 2WC2A 3WR0A 1WCKA 4OMCA 1Q8VA 4UAPA 4GKXA 1LOEA 3OPWA 1XU2A 3WNXA 4RR3B 2ZKNA 2XL9A 1SCRA 5DAXA 1BVVA 2CSGA 5F6LB 3TBDA 4YYOA 1HB1A 1AL0G 1ULEA 1ZYBA 3B9CA 4AI1A 3PVOA 1RVF1 2HWF2 3U0ZA 2JDYA 4BK4A 4K1YA 1UQXA 4JGYA 1SCSA 1M4WA 1UYXA 4WV8A 1BZWA 2J1TA 1E5SA 4FFGA 1KITA 5FFOC 4DXZA 4FFIA 5GZFA 1S0JA 4NAOA 4CDUB 1NX9A 4CEWA 1O7FA 4NHLA 5FZEA 2JENA 3J9SA 1CWPA 5L73A 4K8RB 2DDUA 4OHXA 4V2WA 3ZYPA 1HN1A 5KXEA 3TRSB 2ERFA 5JPMB 3RZZA 3POYA 2VOVA 3OD0A 4R9AA 1QJX1 1PMJX 2W3JA 3ZPOA 1MEC1 1IQDC 4XFFA 3SH3A 1K42A 4JDNA 1F31A 4LO8A 3TNQA 3H3UA 4NIIA 2I45A 4LTAA 1AVBA 1AR62 4YGBA 4A41A 5FP3A 3AK0A 1J59A 4O9EA 1OLMA 4GULA 1LHWA 2EAAA 3B94A 1J3QA 1DBNA 3I2HA 3KT1A 3RVHA 5I93A 5A6XA 2IC1A 2VXRA 4UBHA 3MIGA 2KA3A 3OEAA 2CTVA 1RUJ1 1UY0A 1SG3A 3C8XA 4XUOA 5LA0A 3N7KA 4L99A 5KC6A 4Q1RA 3C7HA 3ROUA 4DB5A 2X10A 4AFMA 3THDA 4LBQD 4HSJA 5BNOA 5DMYA 4BOWA 4LXLA 3HR9A 1LESA 2AREA 2JB8A 2YYOA 3S5AA 3KWVA 2MHFA 4AGVA 1O6UA 1HQWA 1K5JA 1U0AA 2RJKA 4D3WA 1X8MA 1E57A 4DRRA 5D21A 2JIGA 4N7IA 4YW2A 4JC1A 5J09A 1LGBA 2R16A 4L97A 1OKQA 4XDPA 3S0MA 5DN2A 2QDNA 1S0BA 1H9WA 1H2MA 3KM5A 4NOTA 5C33A 1CPNA 3K3NA 3GNEA 5T50A 3OGVA 5I0DA 2YV8A 4ZXKA 1PX3A 2OS2A 1LHOA 3P1IA 1FMD2 3FMGA 1IS3A 3H0OA 4BDVB 2EIBA 3DYOA 3H8UA 5CFCC 1LOFA 1LU1A 1AR91 3NJXA 2H0VA 1PM7A 2QQVA 5FXZA 4CU9A 3BN6A 2XMLA 4JGYB 3WW3A 2HWD2 5T5OA 3H3ZA 2WNEA 4XJ8A 2OUHA 3ECQA 1UY2A 3WCSA 2RHPA 1EV12 2QFEA 2Y6FA 1IZ3A 1DQ2A 3POEA 2WIIB 3ITQA 4AEDA 2ZHLA 4CEWB 4XJ9A 4JGYC 1XNCA 1UX6A 1A8DA 1ND2A 2WA3A 4QPWA 2VBBA 2FHRA 3LGRA 5A7NA 3W5NA 1ODNA 1OI6A 3BTYA 4RL7A 3RZGA 3JQWA 1AZDA 2WABA 3B69A 1O59A 1GQHA 1W8ZA 3POGA 5E1RA 4QKNA 2YPJA 2BOJA 1DGLA 4ZU7A 3LEMA 3DKWA 2K2SA 2Q1FA 3UT0A 3NJVA 4WBBA 1HRI1 1Y4WA 3CLPA 1H30A 4HPKA 4Q0PA 4RGAA 1Q8PA 1ST8A 2JDKA 4LIVA 1FATA 4PIZA 4P00B 1XC6A 2WZEA 3WXPA 4MXVA 1R1A3 2HWB3 2K0GA 5A3OA 4CP1A 4GA9A 2GC3A 2VMDA 5IATA 2BYVE 4LO7A 1BK0A 5FZOA 1W05A 3F2ZA 5JI7A 1BVP1 5FZCA 3SH4A 1JZ3A 3LE0A 1NE4A 1ZZ8A 3NSTA 1WD3A 5DUXA 5BNOB 1URXA 4PBPA 2O8OA 5DZFA 1OPOA 4HETA 4BQYA 1JW6A 4GJZA 4EYUA 5FYVA 2WAOA 1NY72 2Z4FA 2ZMKA 1J3RA 4K21A 4G4FA 4XC9A 3GZEA 2JDMA 5F39A 1GZWA 3VD3A 2RR12 4BE3A 4CP9A 3T2PA 5C3RA 2ZEYA 4I30A 2XDVA 4YVWA 3O1MA 3SEEA 2XGXA 4CE8A 5A1FA 1GMMA 3LZZA 5FV3A 2YDEA 5BNOC 1ALYA 1YRZA 4DXRA 1RUG2 3QACA 4W6XA 3RZLA 1DDLA 3VDBA 3VZJA 1MZ6A 4BHPA 3M4FA 4PI2A 2Z2SB 3GHNA 5FLHA 1UYYA 4MH0E 3GJBA 3DECA 3UV9A 1K45A 2P1BA 2ZMNA 1RGSA 3NNFA 4Q4X2 5E89A 3T0DA 4RD7A 2ZAHA 1WA6X 2CL2A 3SH5A 3EJKA 3WQBA 4Y20A 5HCFA 4Q4W3 4A7YA 1ULDA 2Y8KA 4EN9B 4JGZA 1IQAA 3PTYA 4IEZA 4XEZA 5C4WA 4AEDB 1WLDA 3ENRA 4YM3A 4O9GA 3QBQA 2BRTA 1FOD2 1ND2B 3WF2A 4Z92B 1ENSA 3KF5A 1E5HA 2PXJA 3IN9A 3PURA 2RS32 4TTGA 2NMOA 1VRH1 2W47A 1S0GA 4OUEA 4JKLA 1W3XA 4AEDC 5H9PA 2P34A 3TNPB 4LBKA 4W50A 2WJSA 1ZZCA 1QJY2 5IUQA 1JYVA 5JR7B 3OOXA 2GMEA 4TN7A 3ACLA 1FMD1 3CQOA 3OGRA 5AVAA 3WX5A 3ZXAC 2YU1A 1J58A 2JWPA 2XJRA 4HPKB 5C70A 2XVKA 1XE0A 2BWAA 4QX8A 4OHWA 3TN92 5C5UA 1VBE3 2HWD1 2FBEA 2JE8A 1UKGA 2PHFA 4URAA 1RHI1 3K4DA 1OURA 4DFSA 2ZGUA 1NAEA 4NIGA 5FY9A 1EV11 1EYBA 5FZOB 1A34A 1PHMA 2RM21 4A7KA 3ZIXA 3AJZA 3J26N 3I8TA 3VBSA 4XZPA 1H0BA 3AVRA 3FC0A 2H0BA 4R9CA 4DINB 5C3OA 5J96B 1UYZA 1BMV1 2NM1A 5FY8A 3V56A 2CDOA 5KWRA 2XQXA 3BVCA 4HXCA 1K5MA 1GZWB 5GLTA 3VZKA 1GZ9A 1UXXX 3ZFFA 4CP9B 1W0NA 5EJZB 1JYCA 4YVWB 1CJDA 1H4HA 4ZKTB 2WAAA 1GKBA 5DXDA 1X33A 3ZR6A 1YI7A 4GALA 4BH9A 2XHKA 4YLZA 4BCUA 3A0KA 4Q0QA 3Q9OA 3T30A 1D4M2 5L7OA 3O1PA 4GAZA 4PHZA 4FQZA 5EP9A 2G4IA 4FXKB 2QQJA 3ACGA 5LA9A 1JYTA 1TNRA 4LK6A 3PIGA 2BP6A 2D6OX 2XLAA 2DWRA 4IEXA 4KNCA 4Y1UA 2XR4A 2WBKA 2VD7A 4GXLA 1C8NA 1GFF2 2E7AA 3BB6A 5IVYA 3R6SA 5FZ4A 3RDIA 3WZ1A 2V4AA 1ULFA 3WNKA 1CAUA 2DVFA 3GZUC 5LBEA 4CCKA 1RITA 4Y20B 5LB6A 4CU8A 1I3HA 3MFCA 2RS12 5FPVA 1H6YA 2BFUL 4NHMA 5EYYA 1BQPA 4JGZB 5FWJA 2FD8A 5C4WB 1HRV2 1EUTA 2WO2A 2ZPXA 1Q3EA 5CFDA 2B8MA 2D3RA 4Y4YA 2RR11 1G86A 4CUBA 2QQIA 1CVNA 2C1FA 1B35C 1YO8A 3LA7A 5SV5A 2EA7A 3GBWA 4JGZC 3WW4A 3OBZA 2VMIA 3T1LA 2RMU1 4GIQA 4FT8A 2WDBA 4QKBA 2QJVA 5FK8A 4UFHA 5T52A 1MS0A 4INDA 4BQ2A 1ULPA 3IT8A 3RFRA 1RUH1 4M01A 3DL3A 3J8F1 1MZ5A 1W28A 2D44A 4Q4X1 4AW7A 3KV4A 2DU0A 3OEBA 4HKOA 3PVEA 1RMU3 4LHKA 4DEQA 3MIDA 1AHSA 1GZTA 2C0ZA 4QX7A 3LEIA 1YYNA 1PO13 2Y60A 3VBHC 1COV3 1OF3A 1OA3A 2QDRA 1UZ0A 2W08A 3IDBB 2R043 2YFZA 1U12A 5FBZA 5K0UC 3RZJA 3VL9A 4AI8A 5CADA 3IDCB 2WKKA 3VBSB 2D93A 4YW3A 5CBLA 1RUD3 2A6WA 3A7QA 1F2NA 4AVVA 1RUF3 2VJXA 3ACIA 1R092 3GBGA 3NRUA 1K5MB 3NNMA 3R0RA 4W65A 5F5CA 3ZFFB 3SLIA 1UMIA 1KFXL 4ASKA 3VDCA 2Q8EA 1QJY1 3ILFA 4P02B 1TEIA 4YZ5A 3KHBA 2MEV1 4XFHA 4ZONA 1YQ6A 4IGOA 4L0PA 4LE4A 2WNUC 4E2QA 5L7OB 3ZFFC 1ZBE3 1DQ4A 2QQMA 2FZ2A 1NLQA 3NMBA 4XW3A 5HI0A 2F6BA 1MQTA 1W6MA 2F4LA 2XL7A 3WNPA 2JECA 5A7SA 1ACCA 3ZR5A 3AP4A 4EN0A 1LHVA 3PHMA 4LHSA 4QXBA 3ZFGA 2EIEA 1VJ2A 3ZYIB 1CAUB 4WM8B 1JZ6A 1YJLA 3H42B 2GC1A 2WT2A 3NKGA 1IKPA 1LGCA 1CGPA 2V72A 2PA7A 4XXAA 2E31A 4A44A 5C5TA 3D0JA 1NXMA 5C71A 1QXJA 2ZHNA 5CG8A 4M3CA 5CFDB 2J1SA 1VBA2 4D69A 4WM8C 1WLTA 2RS53 1U5ZA 4ES8A 2J1RA 4Q4Y2 4ORFA 3L2YA 5A80A 2VOTA 2XQRA 1QJU2 4Q29A 4RGGA 2YG0A 4XHXA 1B09A 1XE7A 2H6BA 3EQEA 4XJAA 1HQLA 2Z42A 1W6OA 3BGAA 5JZGA 1D4M1 2IXCA 3POSA 5BUVA 2F4PA 2YGMA 4XPVA 3V64A 2GH8A 4U2AA 2LROA 2VZRA 5A3TA 3KD4A 2PMWB 1R083 4AQTA 2FDFA 4XUPA 1ZRIA 3FFQA 5BPXA 3B02A 4B1LA 4N53C 5EV7A 3TYJA 3WP4A 4QPGA 1GNHA 2VZ1A 3ZFEA 2ES3A 1WCQA 1CD3G 4MG2A 2RS11 5KR7A 5F37A 1HB2A 2PLV2 3FLRA 3HNYM 1QNWA 4K8FA 4FBFA 1LR5A 2E26A 4ZZ8A 1U5XA 1AYM2 5FJHA 1YWKA 1HQNA 2V09A 2WQZC 2WYFA 3AB0A 3QD6A 4Y5SA 5F5QA 2R32A 2JD9A 4AR2A 3ZXEA 2DVAA 1C5IA 3DPRA 4K9SA 2ORZA 3QOPA 2FDGA 4PQQA 4I3GA 4QX0A 3ES4A 2GDFA 1PGW1 2PHTA 4P9WA 3MLKA 2PELA 1QWRA 3LSDA 3I3EA 4PDWA 1RXFA 3HPNA 4XE9A 4AOCA 5E6HA 2JIJA 2VQTA 1OOPA 3FE5A 4Q26A 1MQTB 1W6MB 1RUI1 4PF5A 3FZ3A 3MGUA 4XCAA 1DZQA 1ONAA 4LORA 5E8AA 2FZ1A 1Q56A 3WD5A 3ZYGA 4PIXA 4AK3A 5F5IA 3ZFGB 4EWDA 5BNNA 4NWVA 2EICA 3PU8A 4NROA 4AVSA 2JXAA 3WP5A 2XUMA 3SNMA 4PT6A 1PVC3 1ZVFA 1TME3 5IK5A 1FNYA 1QIQA 2G9ZA 4Z07A 1V9U2 3W5MA 4M3CB 3ZFGC 4NUBA 2ZS6B 5A3PA 1JXNA 1QH7A 4LA2A 3WG2A 1OUSA 4AEKA 1N3OA 3J7NA 2AACA 1X8EA 1LOGA 4EN8B 2UU8A 1MPXA 4PLMA 2HYKA 3NNJA 5CIRA 5FZDA 1MACA 1W3VA 1W6OB 4XZUG 5JZGB 4OUMA 5A32A 5JUVA 1ZZBA 4KU8A 2ZGSA 3LA2A 1G8WA 2R30A 4XUQA 3AKSA 4BQXA 4X6QB 4YGDA 3RZKA 2WO1A 2VZVA 4QPGB 2D3SA 3BU7A 3C7FA 5FDBA 3ZFEB 4K20A 4GQ7A 1WMDA 2W94A 3I2FA 2WQ8A 2VOKA 2XH6A 4YVSC 4CCDA 4NN0A 2YBSA 3M7AA 5A3MA 1WD4A 1FAYA 4OCTA 5FO9B 1WA4A 5HBAA 3OBAA 4QPGC 5CNAA 4MO3M 1GZCA 2AZ5A 3CMGA 3ZFEC 2E7TA 3K48A 2IXHA 3CJIA 3RQ0A 4EN6B 3DPRB 1PX4A 2JDPA 4W6WA 3N3HA 1JZ5A 3AMQA 1VBB2 4MGQA 1PIV3 2C24A 4MXWA 4AG4A 2A3XA 3BYWA 3C7OA 4ZS2A 3O1UA 4XJZA 3PUAA 4GWNA 4CP0A 4NHKA 3UK9A 3ORJA 1QMJA 2R073 3VD7A 2E63A 1C8M3 4FAGA 1RUC1 5F5AA 2ID4A 4PDWB 2WYSA 1LULA 3FHIB 2AEYA 3BPZA 1DGWA 5CKMA 1RVF2 2VOXA 5EQUA 3WLUA 3TEYA 1CAXA 1AR82 1CN1A 1OOPB 4AHYA 1PMIA 4YRDA 1BEV3 4A2UA 1W8UA 4LE3A 4AEJA 3N4MA 2XJSA 1NQJA 2R063 1PZ9A 4Q4V3 3GGLA 4BM8A 5BNNB 2R1BA 4CTEA 4FPFA 3T4VA 4PDWC 3GBFA 4CDQC 3AL5A 1ZZ7A 1SLBA 4NIAA 4H2AA 4BIOA 4NRQA 3ALQA 5FZ3A 4N43C 4XDOA 1OF4A 4YW7A 3VKLA 2BBVA 3ZXDA 3D6EA 2BV4A 4ZPIA 2AR6A 2BNNA 4HG6B 3JB4C 4LO6B 4DXSA 4CU6A 2W91A 1QQP3 1QOOA 2WWJA 3AZVA 3ZSJA 1QJX2 4KBBA 1I9RA 4BXSV 1OFSA 2ZACA 4J6GA 4LO5B 4NJ4A 5LWBA 3RWNA 2QQOA 4EWEA 1AL23 2UWBA 1OQEA 3B00A 3OG2A 3P3NA 1D0GA 2DTYA 4V2VA 3Q8BA 2BW8A 5A32B 5DDJ3 1NCRC 4HKLA 2PAEA 3WSOA 1W06A 3AC0A 4LQRA 3IKWA 4A3ZA 4JRAA 1QOSA 4MGSA 2PHXA 3WDTA 3KT4A 2HWC2 3DXUA 3ZYRA 3MF6A 5IWFA 2XBO3 1UIJA 1W8HA 3LFIA 4NRMA 4H7LA 3KVAA 2ZTNA 3CZJA 4D6SA 2AH2A 4EZHA 1RUE2 2VBDA 4FI9A 5FUNA 4COYA 4B29A 4KWLA 3K46A 1IS6A 4Q5OA 2XLFA 1KS5A 4AEMA 2DVBA 1MR5A 1DYOA 2FMYA 1VBE1 4K6BA 4LO4B 3UL2A 4LNVA 1BK1A 4UFIA 2YC0A 2VZPA 5DAQA 1W2UA 1OUXA 2NMNA 2PHRA 2WA4A 4XFCA 4Y1XA 3WNLA 5GZCA 5I8TA 1NLSA 1PM4A 2D97A 3APBA 3CJIB 3GHMA 1DGRA 1Q8OA 1WBLA 2HBUA 3ETQA 3GALA 3JBG3 4MGIE 2UY9A 4PF1A 3SXWA 3IZOA 3N9OA 3RYPA 4EWAA 2R7EB 3WT3A 2XJUA 3ZSEA 4A42A 4MXWB 3VKNA 4YFZA 5AC93 1RXGA 4MV2A 1CZTA 2ZEZA 5H9SA 5FYHA 4KH9A 2GC0A 3ZYBA 1UL9A 3UJQA 2J7MA 5FXVA 2D6LX 4G9SB 4H55A 4QB2A 4RHV3 1GICA 3UJOA 3F95A 1HKDA 2X5IA 2PN5A 1QH6A 1SFYA 3IMNA 1WWYA 2VQUA 2WS93 1PO23 1CAXB 1RUG3 1AYN3 1JMUB 1VALA 2P37A 1TMF2 3POFA 4YM2A 4AI2A 4LKEA 3R4DB 3THCA 3R4UA 1H2LA 2XKOA 4CYDA 2WZR3 3O14A 3WOGA 2VNOA 3FHAA 4Y1ZA 5DZEA 3O1SA 2CV6A 3BTZA 2PQSA 4HANA 1NKGA 2C5DA 3QH7A 4GB32 3VD9A 4ZS3A 4XF3A 4JRLA 2BVBA 3IBMA 3SMHA 4LULA 2IFWA 1VBB1 1LNSA 1RTVA 4FOVA 4RQPA 1XNBA 4OQ9A 5CFCA 5JPNB 4LIUA 3ZXGA 3FHQA 2QQPA 1STMA 5GALA 2V5YA 1ZREA 4LMFA 5FY7A 4OHVA 2WLQA 1PZ8A 2I07B 3NJZA 2Q8CA 1W8OA 2RS33 5KXBA 4QXCA 3PJYA 2FDKA 3JZVA 2VAUA 1EP0A 1LODA 1AR81 1HRI2 3N9NA 3ZMOA 3CKHA 1OVPA 3D0SA 1R1ZA 1AR73 4AVBA 2WN3A 4XOGA 1V6NA 3GM8A 3S7IA 4UF0A 3WNOA 3AKTA 4META 1NOVA 3JU9A 5EPAA 3ACHA 4XAAA 3TN93 5FMOL 4XF1A 3H8OA 1RMU1 4K40A 4P9LA 4DO0A 5BXXA 3CO2A 3VZOA 5JMOA 2VPVA 1SHWB 2B7YA 2VZQA 2W68A 2YFUA 1COV1 1SQ4A 4GJYA 2HBTA 4KMQA 2VH9A 2GN3A 2R041 3ZN4A 3KT7A 1GBGA 1RUNA 4Y22A 2C9AA 1I1EA 2W1QA 1YQ2A 3I49A 4YW5A 4D6QA 2D43A 2X29A 2JG9A 3B9IA 1RUD1 3K51A 5FOBB 4FTEA 3I7DA 4DQAA 2RVAA 2E9QA 2W5FA 2W95A 5BY5A 5JXJA 5LY1A 1BBT3 2Y6LA 4ZU5A 3VGIA 1DHKB 4F83A 4U36A 3LB9A 4P5HA 2HWC1 4HVRA 4AVAA 4DOUA 1O5UA 4XTMA 2X5IB 2R0HA 2WSVA 5F8PA 5FTTC 3SCHA 1RUE1 2FQPA 1EAH2 3ELNA 1Y9MA 3I59A 3THTA 3G7DA 3NAPC 2X5IC 2ZZJA 2O0OA 4Q27A 3VDDC 1S0CA 5IFTA 2DYCA 4ZU4A 4BPZA 2HWE3 2GSYA 3NV2A 2QCSB 2YZ4A 4UFKA 3MPBA 4RQPB 3BKZA 4C0HA 4CXXA 5CFCB 3N35A 1VRH2 5C9AA 5IVJA 4YW4A 4LKFA 1UO9A 5HV0A 5CU1A 4QDQA 1C1FA 5FZMA 1SACA 3HT2A 4FOWA 1E5RA 1VR3A 4RQPC 2JEMA 2JKXA 2RE9A 3IWZA 4RFT0 1N1YA 2BOIA 1POV0 4QKDA 1TMF1 4MGTA 1D2SA 5BYNA 4KWKA 1C28A 4XBLA 3OBRA 2Q4SA 4XF9A 5CYYA 3Q8AA 4FFHA 3WY6A 2WFF3 1V6OA 1RHI2 3H7YA 3RS6A 4NE9A 2VZTA 4UF0B 4BA6A 1IKQA 1KXGA 5ACA2 5A70A 2VCMA 5FYCA 4CXYA 2XXZA 2ZX4A 2DVDA 5A33A 3OUIA 3IMMA 2PQQA 2RM22 1R64A 2VGDA 4AI0A 2RDSA 5FCCA 4DY3A 4GB31 4BLIA 2CHHA 3N36A 1JH5A 2NPIA 2JD4A 4M00A 2XWJB 3HOBA 2YMZA 1BMV2 3TEWA 1SBEA 5FREA 5DABA 2J1AA 3K4ZA 2L9LA 1TVGA 4QB6A 4Y22B 1GQGA 4YZ3A 5LRRA 1LKNA 2JG9B 1CQ9A 1VBD3 1R093 2AYHA 2WR9A 2WRAA 3POWA 4X6RB 4CVUA 1OLQA 2ETEA 1N3PA 3GZAA 2DBNA 3IM0A 4XHBA 1AXKA 5IVVA 2TUNA 4OQ8A 2D5FA 4FPHA 1GYKA 2Y26A 4IEPA 4M0NA 5I0SA 3UKNA 1QF3A 4H3WA 5FR3A 1ZBA3 2A7AA 2JG9C 1RJ7A 5FWEA 5T55A 1F5JA 1VAMA 2XB6C 4OMDA 1F8VA 2WT1A 1EPZA 2CNAA 3O0XA 3BTAA 4C8DA 2LTNA 2VVDA 2VW2A 2VE1A 3I59B 1GWLA 5TSWA 3WF1A 2AENA 1BXHA 1DIWA 2VZUA 3C3VA 1FYUA 4IETA 3ZDVA 3ZYJB 3O12A 1D4VB 1HJGA 3FN9A 3PMSA 5F3GA 1LENA 3HVDA 4Y26A 4RFRB 3INAA 3OPTA 1UX7A 4CCMA 5IT6A 1JU4A 3LPFA 4AE2A 2BDRA 2JE9A 3A21A 2ZGQA 4OI0A 1PVC1 2PHUA 1H1AA 3N9MA 2FDHA 4FAHA 2BEOA 5C9AB 2RMU2 2OYZA 4QHBA 2R1DA 1QHDA 3KV5A 4NR1A 4EE2A 2D6NA 1YCIA 5JDBA 1LEDA 2VTXA 2ZA9A 1QJU3 2DFBA 2D5HA 1ASJ2 1F15A 2YXSA 1QOTA 1APNA 2Y0IA 3MV11 3PIJA 1G9DA 1RUH2 2A75A 3I2GA 3J8F2 3WUDA 3USUA 5C9AC 1EAH1 4OHYA 3FL7A 4GMP1 4HT1T 2VC9A 5AFEA 4KWUA 1VMFA 3EBRA 1KDMA 1S2BA 3HAGA 5FIXA 3RZMA 5D8AC 3BOWA 1B35A 3N7MA 5A33B 4YG3A 2G9GA 4BU2A 5H9RA 2OUJA 5CB7A 4J1WA 3LDRA 4FPYA 3POBA 4YFWA 2GNTA 4IE7A 2XPJA 1C5HA 2OXBA 4CCCA 3OSDA 1UZVA 5GLWA 2P3IA 5CA6A 2SLIA 2EAKA 2UWCA 1UF2C 4LBJA 1I6XA 3MIFA 5HCBA 1UD1A 3ZYHA 3S7EA 4KGGA 4RN5A 5ISLA 3PMEA 3JD72 3KV6A 4G3YC 5FY1A 4MOAA 3MYXA 2FCVA 3AKQA 5IW0A 3VBHA 3RI9A 4CP2A 2VM9A 2BERA 2C6SA 2I2SA 2MEV2 2WFPA 2ET1A 3H1MA 3NNGA 4XVHA 1JYXA 1PIV1 2WSUA 4QPIA 4AHWA 1N3QA 2XVLA 5K0UA 3PU3A 3OGSA 1H8TA 3BTXA 4JX0A 3PVBB 3KQ4B 3KGLA 3W9AA 1T6BX 5F7UA 1DFQA 1UU6A 2R071 3A22A 3DF0A 1ZZ9A 4FPGA 4IEYA 3BPSA 4NMIA 2BU9A 4S2DA 3RRDA 3ZO0B 5ACA1 5FP9A 1OSGA 1SMVA 3AL6A 4JKKA 3CDZB 3S5QA 3HMYA 1DP0A 5IFPA 3AVSA 4PQ9A 2AGSA 2WINB 3H8RA 4P9JA 4HOOA 4LA3A 4I2OA 5HV4A 5CISA 1CX4A 4R8HA 1W9FA 4F8AA 4OI1A 4AQSA 3ASIA 5F9TA 4KG0A 4MGKE 4TWTA 3JUUA 2V5DA 1W6QA 4YM1A 3DN7A 4HFSA 5C3SA 2OPWA 4XXPA 5JAXA 2WNUA 2MPFA 2YC2A 1YLLA 3EMRA 4MHRA 1Q8QA 1BJQA 4E2GA 1Z78A 3J4UH 4DIQA 3MLLA 5BNPC 1S0DA 2JDUA 3FWEA 3M3QA 4N9IA 2OW4A 1MS1A 4MLOA 1JS9A 2B4KA 4FTSA 1W39A 2CGOA 5GZDA 5FZKA 2BZDA 2ZBJA 4KQ7A 3ST7A 3WF3A 4LLOA 4AFAA 3MDPA 1AL21 4MZUA 3USUB 4AGRA 4LUMA 2Y6KA 5I0TA 1EPWA 5EYXA 3V65A 4WM8A 2RV9A 3BCWA 5FMDA 1QDCA 5FZ1A 3ZXJA 3I3MA 2YU2A 1LHNA 2NZ9A 3OCPA 4UYBA 1B35B 1JZ4A 1FPN3 1HV1A 1MZFA 4NHXA 3AYAA 1ENQA 3WVJA 2N7GA 1IHMA 1X82A 4Z8BA 2ORXA 5FK7A 4HK8A 2QBXA 4JKMA 2E53A 2RG4A 1ND3A 3VBFA 2E51A 1GR3A 1F5FA 4N53A 5JSPA 1O91A 1KQRA 3T09A 3NKTA 4BLJA 5HXMA 1DLLA 1HB4A 3JBG1 2A73B 1PGW2 2CYFA 4B7EA 3VBHB 4HONA 1ASJ1 4QGNA 1W9TA 4XFAA 4BQ3A 3OGJA 2Q8OA 4QPIB 4JTNA 5K0UB 1N1SA 4YM0A 5IJRA 4UFLA 1H8TB 1SFPA 5A7OA 1RUI2 4DUXA 4XTPA 5C8WA 4BMEA 5IYYA 4N90A 3WG1A 4QPIC 2JDZA 5C3PA 1FNZA 1PO21 2WS91 5JOYA 1JHJA 2BVVA 1H8TC 5FPUA 2WL1A 4GWIA 3HBKA 5ANNA 2WZR1 4IEOA 1S55A 3PUQA 1W6QB 3SHRA 4FPOB 1WKYA 1OA2A 2WNUB 3KLSA 2WQ4A 2GMPA 1JI6A 3JXSA 3MIBA 1XXNA 4LUKA 4DUVA 2HEYF 1VBC3 2Q1ZB 3I2DA 1AXYA 5CEHA 3JD71 4W8JA 5LBCA 5C8CC 2W0XA 2GALA 1BYHA 2JDNA 1V6JA 2DTWA 4UFMA 3NV1A 4LKSA 1QJX3 1PK6A 3FUOA 5A3NA 2Y6GA 3MW4A 4IEWA 4XIKA 1W03A 2ZGMA 3AFGA 1MEC3 3RNSA 1S4CA 2HJIA 2VO5A 3S6PA 2VR4A 5JSOA 1G7YA 2DCKA 3ILRA 4XUNA 2BWCA 3U78A 3AYDA 1Z7S3 2CY6A 1W9SA 3B3QE 3L9JT 4P9YA 2VVFA 1CONA 1UN1A 2HLEA 5LBFA 1SLCA 3OUJA 2JB4A 4Y5Z0 4FOQA 1PGL2 5K9YA 2DCJA 4L92A 2ARXA 1W0PA 2WNOA 3O7OA 1LJ7A 1OT5A 1R1A2 2HWB2 1RUJ3 2R6QA 4IERA 1HV0A 4FOYA 4A3XA 4AWDA 2BTVC 1QXPA 4O7XA 1HXS3 2W46A 3JQXA 1N1VA 1ND3B 1VAVA 3VBFB 4DRVA 4L2NA 2XONA 4N53B 3T0AA 3VD5A 4COVA 3HN1A 2D40A 1G9AA 1JZ7A 4JVAA 1SPPA 3I3QA 4XACA 4XCBA 1NG0A 1XU1A 4QGMA 1QDOA 4Y1YA 2QQUA 1LHUA 2VECA 1ND3C 3MIHA 4YVSA 4ZY9A 1RUC2 5T5PA 3T2QA 3U37A 2WO7A 3VBFC 3RYKA 1POQA 4UW6A 2A6ZA 1UOBA 2GC2A 3LAGA 3O1RA 3ZSKA 3RGBA 1XE8A 2VNRA 1YHFA 1BBT1 1QGLA 2JX9A 2ZZQA 4XFBA 2DUPA 4LOSA 1NLRA 1H6XA 1L3JA 4LEJA 2XJPA 1G9BA 2ZXQA 4WVZA 3UKVA 3T1MA 5J36A 5JXIA 3D5OA 3NW4A 4Y4RA 2Q5TA 3U10A 1CAWA 4D6RA 3UKTA 1AR93 1BLZA 4MGZE 5LASA 2GNBA 4H7MA 5KXCA 2VTXJ 2VCCA 3M8LA 3T2TA 2PAKA 3UNPA 5FZLA 4XQ4A 2GH2A 4Q4W2 1WCUA 1FI2A 2YROA 5IVEA 1NE6A 4M4RA 3CBNA 5K7PA 4CUCA 3ZDSA 2H6CA 3VHNA 4R4ZA 1AX2A 1D0HA 2W2IA 1VIWB 3PUHA 1Y9GA 4A7ZA 1CAVA 2C4XA 1RINA 2XJVA 4BZ4A 1XYNA 1UMZA 2IXIA 5I0UA 4NAMA 1WMXA 3TOJA 4IXLA 4Z2WA 5LK7B 1PK6B 2ADEA 2DV9A 4YW1A 4CDQA 3AP7A 1DG6A 2WN2A 4OI2A 1WUVA 1GNZA 2WNVA 1BKZA 1P8JA 2BNMA 4N43A 2CWMA 5FXXA 4NO4A 1EUUA 2YUEA 1JUHA 5A1LA 4JTOA 1IOAA 1CESA 2UYBA 3POJA 4LHNA 1UPIA 2OZ6A 3KSCA 3M3IA 1F4HA 4E8DA 5JOWA 2HWF3 1ZRRA 2R0FA 3AMMA 2PFWA 3MV01 1PK6C 5FPAA 4OUSA 1C4RA 4R9BA 4UFJA 4W4ZA 1REEA 1VBE2 2KR2A 4H14A 4QX2A 3SITA 2B42B 2WFF1 5KHHA 3SKVA 5JSRA 3B5LB 1S2KA 3FLPA 2XVGA 3ZXLA 2QQLA 1VP6A 4PBOA 3PUSA 4JHTA 1NCRA 4CCEA 5JVVA 1Y9QA 3WNMA 4OLLA 5FPXA 1LOAA 2DUQA 4XYXA 1VMHA 4XQWA 3TAYA 1DYPA 3P6BA 1X7NA 4C0BA 2A6YA 1JUIA 1UMHA 1SPPB 1H8VA 3OY8A 2D3PA 3IDEA 1I5ZA 5GLZA 5JXHA 1WCDJ 2B5HA 5B2GB 2RDNA 2Z79A 4YVSB 3WDUA 3SKJE 5FBJA 1XPWA 2FCTA 1VBD1 2Y0OA 2ZGRA 1AR63 1TQ5A 1PNGA 3WQ7A 1NA1A 1CIYA 4XDQA 4DMIA 3BU0A 2D6MA 2O14A 2UY8A 4HKWA 5FYSA 5DUWA 5C3QA 2WUHA 4CA9A 2VCBA 1PGL1 1AJKA 3RG0A 1XB9A 2XKPA 1O4YA 1ZBA1 2AEZA 2GP5A 2I74A 3D3AA 4XUTA 5T5LA 1CAWB 2TEPA 1C3HA 1R1A1 2HWB1 1A8MA 1OPMA 3J7MA 4IE4A 3VLBB 3VD4A 3ZVXA 2Q30A 2ARAA 4N8MA 3S57A 3AX4A 2VZ3A 5LBBA 2IZWA 3ZLIA 1D7PM 4DXTA 1JOJA 4EZ4A 3MLJA 1AX1A 2E33A 4NHYA 1K12A 5HXVA 4F7ZA 1DQ0A 3D8CA 2OVUA 3B7MA 5FAXA 1IS5A 4XILA 1DCSA 1VB2A 3RJ2X 3N9LA 4QM8A 5GLVA 5J98B 5A7PA 3VZMA 5LRSA 3O1TA 3VDAA 1I5PA 2IFRA 2P5BA 1WZXA 3K75B 4COWA 1CAVB 1PNFA 4YNIA 3I2IA 1IS4A 2W1UA 1W8WA 4CDQB 2LW8A 4TYSA 1MZEA 2WNVB 5KHGA 1REDA 1DQ1A 4N43B 3N9QA 4PLNA 4V1PA 3LWCA 4ES9A 3DXTA 3I2KA 1T6GC 1YIPA 3UGFA 4OFGA 1ZA7A 2ZGTA 4JAAA 4BQWA 1FMD3 4QM9A 3GJAA 4CU7A 1WMFA 4B1MA 3M70A 4UXAA 1YFWA 4D7SA 2RJ2A 5JWPA 2DFCA 2HWD3 2WNVC 1RHI3 3ES1A 1RMU2 1NT0A 1TG7A 1W90A 2F17A 4Q2FA 3E6CC 2ARBA 3P5BA 1ODMA 4HL0A 4Q4W1 5F3IA 1SLTA 1PO12 1EV13 1HW5A 2A3WA 1COV2 2J42A 3ATGA 3DV8A 4AAXA 3VUOA 1NCRB 2JJ6A 3AXEA 3AZYA 2IVJA 3KVBA 2R042 1CPMA 2QQWA 5FKCA 1GP6A 3MI8A 3AKRA 4B4QA 4XMIA 4DS0A 3OJBA 4JCKA 3RPQA 1RUD2 2P6CA 2PYTA 3EHKA 5L9BA 2OA2A 4ARXA 1RUF2 4RGKA 3RYRA 1G6NA 4S2FA 5A3WA 2GMMA 3OY8B 4BB3A 1O3QA 3DEMA 1Z0HA 4WVMB 1KGYA 2B9UA 2VQ0A 1TE1B 2X8KA 1AUYA 2Y38A 4R4XA 5EWSA 4JZRA 4ISQA 4NWWA 5JIAA 3W59A 4AQ2A 2DURA 1W6PA 4B4RA 1FT9A 1NA1B 5BNQA 5B4NA 1X9TA 4WM7C 3VBRA 4CCLA 4FP3A 4E27A 3B93A 4FPKA 3PJQA 1ZBE2 4CDXA 4BQ4A 3WQ0A 5IVFA 3LEGA 1U5IA 1LTEA 3IAPA 5FZHA 3ME2A 1V6IA 1OH4A 2VW0A 4HVQA 2JDAA 5CKNA 4C1WA 1NQDA 4AFDA 1RJ8A 1NA1C 1ZM1A 3U07A 5A6QA 3AMPA 3U75A 3H9AA 2ZX2A 4J25A 4LOTA 5FZ9A 1JBCA 4YW6A 1V0AA 5FZBA 3VBOA 2PTMA 3MUY1 3VZLA 1WLWA 4L8QA 3WHUA 3H1WA 2R49A 1UCXA 3E6DA 1YC61 3RJRA 3P3PA 3C7EA 1ENXA 4GKYA 5I91A 2KM2A 3VKMA 2RR13 2IVIB 4QDSA 4YZ1A 3Q8CA 3SC7X 2QNKA 2RS52 3MO4A 3HIFA 3NAPA 5FYMA 1YFUA 1ZA4A 2C26A 1Q43A 2E6VA 2VVEA 3WP3A 4JDOA 2RMU3 2VULA 3VDDA 2BBAA 3AKPA 4CPBA 3BIWE 2ZAAA 5LEJA 3O0VA 2W1WA 4A45A 2A6VA 2ILMA 4Q0VA 2CAUA 1R082 3LD8A 4I0AA 2P3KA 2QE3A 3J8F3 4OZOA 3SEPA 2YBPA 4CEYC 5KXDA 4Q4X3 3OD4A 4XMAA 2FMDA 3GYDA 5T5JA 1NZIA 4IV1A 5KBFA 1GU3A 5B4XA 3LOIA 1GP4A 1H2NA 5BV6A 4XFGA 1XNKA 3KV9A 3H50A 3FBMA 3I2OA 2KD7A 5LCWL 1FOD3 5DAVA 1MVEA 1IG0A 4KWJA 3HNMA 4XURA 4QQPA 3WP6A 5DUUA 1GSLA 1GV9A 1QXRA 3NWKA 1WBFA 4F3JA 1PGSA 1FX5A 4J1XA 4QWNA 1OBNA 2D98A 4Q0UA 4XJUA 1XYPA 1XQNA 2GZWA 2K46A 2ZGLA 3NV4A 4FCAA 2IUWA 3WHTA 3HT1A 3ZN5A 1OA4A 1QJY3 2LUWA 4RS5C 3WEZA 1WMEA 1VE0A 3C7GA 1JN2P 4YG0A 1J84A 1W6PB 2J1EA 1UPSA 4O65A 3PUIA 3BI3A 1V70A 3NV3A 3VBRB 1JU3A 5LA2A 3TWIA 4B4PA 1HB3A 4N9HA 1IPKA 4URTA 4CDXB 4XETA 4UT5A 2OIIA 4MGYE 2NLRA 2X05A 3WNNA 1ULOA 4I0WB 5K4LA 2YC4A 4LLFA 3W21A 1PO11 3ZKYA 1JHNA 1YUDA 2QZ2A 4NPMA 4QQHA 1SDWA 1SEFA 1QJEA 4GWMA 1H1IA 4IGPA 4Y33A 4YGCA 5E16A 1W6NA 3VBRC 5FMBA 3VBOB 5IHRA 1NXD1 3WDWA 4CDXC 1W9YA 3KCCA 4QKFA 4JQRA 3ZKUA 2Z69A 4PI0A 1PVC2 4LBOA 1TME2 4RR3C 1RUF1 3SISA 4FXGB 4FPJA 5DZGA 1Q5OA 1DZRA 2ZABA 3CNAA 1LECA 2YY1A 4QU1A 1JOPA 1EY2A 3X29B 4COZA 4AGGA 1SDDB 2J22A 4MUVA 3VBOC 1H2KA 4QGLA 3NAPB 5FP7A 1VBC1 1WGPA 4ZXEA 1DU3D 4Y5TA 5IK8A 3HQXA 4GWJA 5LK5A 3VDDB 1JYNA 2ZEWA 2ARCA 4QAWA 4LJHA 2VZOA 1D4M3 1UU5A 5EZWA 2Y34A 1ZBE1 1VLNA 2J1UA 2ZKLA 1UYPA 3O5SA 1UIKA 2Y33A 3OPZA 2WLPA 4YG6A 3VZNA 4CDUC 1PZ7A 1GNYA 1PVXA 1LAJA 1KJLA 4NVPA 4DZGA 5A6ZA 3HQRA 3AMHA 1Z7S1 4TLGA 2VTFA 3ZXKA 4JDMA 1ZZ6A 3LCPA 4IV1B 4ASLA 3HNBM 1MS5A 4S2HA 2RS13 3MEPA 1YI9A 2Z5WA 1GOGA 3I97A 1GUIA 3M3EA 2XOMA 4BQ1A 4FTBA 1HRV3 2P17A 1MS8A 2VCAA 2RDQA 4AFBA 1GOHA 4X8NA 4C1XA 4CCJA 2HYXA 5IVCA 2VUCA 3KF3A 3SCGA 2QTWB 4YZ2A 3AP9A 4IV1C 4N7UA 2A3YA 1IPSA 2RS51 5FPBA 1HXS1 1HIXA 5FQ0A 5D8AA 1TZOA 3CU7A 1LB2A 3D4KA 3T4HB 1AX0A 1GWKA 3LDBA 2E32A 1PIV2 1FV2A 3ZX7A 4AXOA 5FY4A 1C1LA 4HLTA 4HMZA 5L36A 3ETPA 1W2TA 5CG9A 1ZX5A 1VPHA 3WCRA 2R072 1R081 1C8M2 2WWSA 3J7HA 4X8PA 1REFA 2VUJA 4CXWA 1J1LA 3IB3A 4CCOA 3O1VA 5LA1A 1AXZA 2VG9A 1O4ZA 4XFIA 3AZXA 2DCYA 1RUI3 1BEV2 3WG3A 5A3LA 3CL1A 4NIDA 2ZX0A 2R062 4Q4V2 3BUCA 5F3CA 4BJ0A 1POV3 2VW1A 1W6NB 1L7QA 5SV8A 1QKQA 5IK7A 1WLCA 4E4SA 5G04L 2D6PA 3LEKA 4AF9A 4NPLA 3WV6A 3MW2A 1SBFA 1CR7A 1QQP2 4YZ4A 1QU0A 1GP5A 1SFNA 1W9WA 2BFUS 4CSWA 3KHCA 1SLIA 1S1AA 2JG8A 3NNLA 4HN0A 1JTZX 3Q8FA 2QVSB 4UI9L 5FZ8A 2GP3A 1AL22 5FYYA 1OLRA 3WINE 1WW6A 4FSJA 4YSFA 3FLTA 4QXKA 2XG3A 4Y3OA 2JKBA 3MPPG 2P3YA 2XWBB 2EIDA 5DDJ2 1XOYA 4CEWC 1XBFA 4Z82A 4CUAA 4D7TA 3USSA 1QY4A 1LU2A 4QT6A 2WWUA 5F1RA 3OBTA 1JOBA 2DCTA 2XBO2 5BNPA 2EF6A 5CVRA 2V4VA 3PDQA 3GXUA 2HWF1 4AYUA 4QPYA 2EXKA 1TNFA 4OYUA 5FZAA 4ZZ5A 3MF9A 1OH3A 5FP8A 4KI5M 2A5ZA 3AZZA 1DF0A 3DCQA 2ADDA 5FZIA 3E6BA 2RJLA 4AI9A 1TME1 2ZHKA 3K2OA 1UAIA 1W8TA 2P2KA 4HBNA 4WZFA 3ABZA 4QQOA 1NCQA 1YQCA 4XBQA 4ITCA 3GF6A 3NL1A 1VBA3 4B8EA 2OZJA 2FCUA 3ZOIA 3J7LA 1YIFA 4CUGA 4QXHA 5GZGA 2GN7A 4Q4Y3 2WZPP 3JBG2 5IAVA 3VHPA 5CAZA 5FQ0B 5D8AB 2PHWA 2JICA 4XIOA 2OKXA 4KU7A 4IV3A 5F32A 5AC92 1Y43B 4XAEA 1KDKA 3T3YA 1OMIA 1HDKA 2LM3A 3DUIA 4DUWA 1RUC3 3ILNA 1Y7BA 3N9PA 4RHV2 3U14A 2VQAA 3V0AA 1AF9A 1AR61 1KFUL 1T2XA 2PHDA 2WS92 1PO22 3E5XA 1AYN2 4L9BA 3MIEA 5FPLA 2IXJA 1SZBA 5FUPA 2PLV3 5LY2A 5EHDA 3EYPA 5J37A 2WZR2 5FZFA 3BODA 2VNGA 4IUGA 3VKFC 2VOWA 3THPA 1ZRDA 3L2HA 3LDKA 3U11A 1AYM3
chains in the Genus database with same CATH topology
3NQHA 3HEIA 2DCJA 4ARYA 2ID4A 2WYSA 2X09A 1OT5A 1PMJX 2W3JA 2W9XA 1IQDC 1K42A 3IDAA 3ZM8A 3GGLA 2W46A 3LPGA 4A41A 2XONA 3WF0A 2QQKA 3T0AA 3VD5A 1JZ7A 3I2HA 1OF4A 1US2A 5JR2A 2ZEXA 3OEAA 2VZSA 4HG6B 1UWWA 3U37A 4ZY9A 1UY0A 1SG3A 3C8XA 2W91A 4XUOA 3T2QA 4DXSA 4CU6A 5LA0A 3C7HA 2VL4A 2X10A 4BXSV 3THDA 2LS6A 5DMYA 1H6XA 2QQOA 2QQNA 3OG2A 2ZXQA 4BK5A 5JXIA 4A3ZA 3WSOA 3AC0A 4LQRA 2VMCA 2Y6JA 4MGSA 1GOFA 3UNPA 2VCCA 3I2JA 5DN2A 3CZJA 3DYMA 4M4RA 4FI9A 4CUCA 3OGVA 5I0DA 3K46A 1PX3A 1DYOA 3T0BA 3P1IA 3PUHA 4BDVB 2VZPA 2EIBA 3DYOA 2C4XA 3NJXA 3WNLA 4CU9A 3BN6A 1F4AA 3ECQA 4PF1A 1UY2A 2WN2A 1UXZA 1P8JA 2R7EB 4A42A 1EUUA 2YB7A 5EJ1B 5HPOA 4E8DA 5EIYB 1F4HA 1KEXA 1CZTA 2ZEZA 3MV01 4QPWA 2J7MA 4QB2A 3W5NA 4ET7A 4E8CA 4W4ZA 4QX2A 3SKVA 4JHZA 4DEVA 2VQUA 2QQLA 2WABA 1O59A 3THCA 3WNMA 3FHAA 3IIIA 3NJVA 2PQSA 3P6BA 2B9VA 1NKGA 3I3BA 1UMHA 4P00B 1XC6A 3VD9A 2WZEA 3A23A 5JXHA 2VMDA 1W8NA 3SKJE 3EB7A 1LNSA 1K3IA 1XPWA 3K4AA 3F2ZA 4GZ9A 3FHQA 1JZ3A 3LE0A 1CIYA 2WUHA 1W8OA 2VCBA 2WAOA 2Z4FA 3VD3A 3D3AA 4XUTA 3T2PA 2W1SA 2ZEYA 3VD4A 3CKHA 3SEEA 1GMMA 2WN3A 2VZ3A 3GM8A 1D7PM 4DXTA 1PMHX 3WNOA 2BGOA 4DXRA 2E33A 1K12A 3ACHA 3VDBA 3VDAA 1I5PA 5JMOA 1UYYA 3K75B 1SHWB 2VZQA 3DECA 3I2IA 1K45A 2YFUA 3T0DA 2W1UA 4KMQA 4D8MA 2CDPA 3WQBA 3CIHA 2LW8A 1W99A 2BGPA 2W1QA 1YQ2A 2Y8KA 3I2KA 2RVAA 3GDBA 2W5FA 2W95A 3IAQA 4MADA 2J1VA 2Y6LA 4CU7A 5J1XA 4RYDA 5JXJA 1UY4A 3WF2A 2RJ2A 2Y6HA 4YPJA 2W87A 3MBWA 4TTGA 1TG7A 2W47A 2VMEA 4OUEA 4JKLA 5A1AA 4W50A 4AAXA 1US3A 1NUKA 1JYVA 3CQOA 4LPLA 3OGRA 1OD3A 5C70A 4ARXA 4UOJA 2JE8A 5IFTA 3K4DA 1KGYA 1CX1A 1NAEA 3I3DA 5B4NA 1JZ8A 4QDQA 3WF4A 1UYZA 2WO3A 2CDOA 2XQXA 3LEGA 2JKXA 3IAPA 1UXXX 1OH4A 1W0NA 5EJZB 2JDAA 4QX1A 5CYYA 2WAAA 2VZTA 5CZKA 1O8PA 3MUY1 2XHNA 3UESA 5DQ0A 1R64A 3C7EA 2QQJA 3ACGA 4QDSA 2W92A 3DYPA 2WBKA 3HOBA 1CZSA 3MO4A 1CZVA 2C26A 2J1AA 3K4ZA 3T2OA 3WNKA 2L9LA 1TVGA 4QB6A 4CU8A 2BBAA 1H6YA 4CVUA 4QB1A 1EUTA 2WO2A 2W1WA 4A45A 4CUBA 3SEPA 4OZOA 2QQIA 3HJRA 1GU3A 4OMDA 5B4XA 2WDBA 2KD7A 4P5YA 3WF1A 1ULPA 5LCWL 2VZUA 4XURA 3HNMA 3FN9A 3OEBA 1UY3A 1UX7A 4DEQA 1BHGA 1JU4A 3LEIA 3LPFA 3A21A 1OF3A 1GQPA 1UZ0A 3WEZA 2YFZA 3C7GA 4A4AA 1J84A 2J1EA 1RYYA 3PUIA 1JU3A 5LA2A 3A7QA 2VJXA 3ACIA 3NRUA 5C7GA 3ACFA 3MV11 2X05A 3WNNA 1ULOA 1UMIA 2Y64A 3I2GA 2YC4A 4P08A 3VDCA 4A6OA 4QX3A 3FL7A 2VC9A 4KWUA 4P02B 5IHRA 5FUIA 4L0PA 4Z2AA 2QQMA 1JZ2A 3HN3A 3WNPA 1SDDB 2J22A 4LHSA 4ZXEA 2EIEA 1JZ6A 4GWJA 1JYNA 2ZEWA 4QAWA 2VZOA 2V72A 4RN5A 5C71A 4A44A 2E31A 2J1UA 4MOAA 2WZ8A 1O8SA 2VM9A 2BERA 1GNYA 2J1SA 4XVHA 3NNGA 1JYXA 4D0QA 1JYWA 3OGSA 2J1RA 4JX0A 2VTFA 2VOTA 5F7UA 2YG0A 3HNBM 3A22A 3OB8A 4M4PA 3I97A 1GOGA 1GUIA 3BGAA 2XOMA 3CDZB 4JKKA 3T08A 1DP0A 2VCAA 5IFPA 1GOHA 2VZRA 2HYXA 4XUPA 2VMFA 2V5DA 2VZ1A 5DPNA 1WCQA 2YC2A 2E32A 5G05L 3HNYM 2E26A 3ETPA 4ZZ8A 1L7RA 3J7HA 2B4KA 3IB3A 5JXGA 5LA1A 2JD9A 2BZDA 3WF3A 2ORZA 4PQQA 2Y6KA 4QX0A 4BJ0A 3UETA 1L7QA 2RV9A 4TXWA 1XNTA 3E1F1 5G04L 3LEKA 3I3EA 1JZ4A 3HPNA 2VQTA 3K77A 2ORXA 1DLCA 5JUVA 2QBXA 4JKMA 1W9WA 2EICA 1J83A 3MUZ1 4UI9L 3T09A 4PT6A 2C9KA 5HXMA 2EIDA 3W5MA 4CUAA 1W9TA 5IJRA 2V4VA 3GXUA 4ZZ5A 4OYUA 4QDRA 1MPXA 1UY1A 4KI5M 4DUXA 3LQCA 5IYYA 4XZUG 3CZUA 3ABZA 1JHJA 4XUQA 1XNAA 4GWIA 2WO1A 4OMCA 2VZVA 3C7FA 4UAPA 2W94A 1WKYA 2OKXA 3I2FA 2WQ8A 1JI6A 3JXSA 4DUVA 4W8JA 4BK4A 4DUWA 3OBAA 4MO3M 3CMGA 4LKSA 1UYXA 2Y6GA 1PX4A 1T2XA 2J1TA 1JZ5A 2VO5A 4MGQA 2VR4A 4AG4A 2DCKA 3C7OA 4XUNA 3EYPA 1NX9A 4IUGA 1W9SA 2DDUA 3VD7A 2HLEA 1HN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQH A;  3HEI A;  2DCJ A;  4ARY A;  2ID4 A;  2WYS A;  2X09 A;  1OT5 A;  1PMJ X;  2W3J A;  2W9X A;  1IQD C;  1K42 A;  3IDA A;  3ZM8 A;  3GGL A;  2W46 A;  3LPG A;  4A41 A;  2XON A;  3WF0 A;  2QQK A;  3T0A A;  3VD5 A;  1JZ7 A;  3I2H A;  1OF4 A;  1US2 A;  5JR2 A;  2ZEX A;  3OEA A;  2VZS A;  4HG6 B;  1UWW A;  3U37 A;  4ZY9 A;  1UY0 A;  1SG3 A;  3C8X A;  2W91 A;  4XUO A;  3T2Q A;  4DXS A;  4CU6 A;  5LA0 A;  3C7H A;  2VL4 A;  2X10 A;  4BXS V;  3THD A;  2LS6 A;  5DMY A;  1H6X A;  2QQO A;  2QQN A;  3OG2 A;  2ZXQ A;  4BK5 A;  5JXI A;  4A3Z A;  3WSO A;  3AC0 A;  4LQR A;  2VMC A;  2Y6J A;  4MGS A;  1GOF A;  3UNP A;  2VCC A;  3I2J A;  5DN2 A;  3CZJ A;  3DYM A;  4M4R A;  4FI9 A;  4CUC A;  3OGV A;  5I0D A;  3K46 A;  1PX3 A;  1DYO A;  3T0B A;  3P1I A;  3PUH A;  4BDV B;  2VZP A;  2EIB A;  3DYO A;  2C4X A;  3NJX A;  3WNL A;  4CU9 A;  3BN6 A;  1F4A A;  3ECQ A;  4PF1 A;  1UY2 A;  2WN2 A;  1UXZ A;  1P8J A;  2R7E B;  4A42 A;  1EUU A;  2YB7 A;  5EJ1 B;  5HPO A;  4E8D A;  5EIY B;  1F4H A;  1KEX A;  1CZT A;  2ZEZ A;  3MV0 1;  4QPW A;  2J7M A;  4QB2 A;  3W5N A;  4ET7 A;  4E8C A;  4W4Z A;  4QX2 A;  3SKV A;  4JHZ A;  4DEV A;  2VQU A;  2QQL A;  2WAB A;  1O59 A;  3THC A;  3WNM A;  3FHA A;  3III A;  3NJV A;  2PQS A;  3P6B A;  2B9V A;  1NKG A;  3I3B A;  1UMH A;  4P00 B;  1XC6 A;  3VD9 A;  2WZE A;  3A23 A;  5JXH A;  2VMD A;  1W8N A;  3SKJ E;  3EB7 A;  1LNS A;  1K3I A;  1XPW A;  3K4A A;  3F2Z A;  4GZ9 A;  3FHQ A;  1JZ3 A;  3LE0 A;  1CIY A;  2WUH A;  1W8O A;  2VCB A;  2WAO A;  2Z4F A;  3VD3 A;  3D3A A;  4XUT A;  3T2P A;  2W1S A;  2ZEY A;  3VD4 A;  3CKH A;  3SEE A;  1GMM A;  2WN3 A;  2VZ3 A;  3GM8 A;  1D7P M;  4DXT A;  1PMH X;  3WNO A;  2BGO A;  4DXR A;  2E33 A;  1K12 A;  3ACH A;  3VDB A;  3VDA A;  1I5P A;  5JMO A;  1UYY A;  3K75 B;  1SHW B;  2VZQ A;  3DEC A;  3I2I A;  1K45 A;  2YFU A;  3T0D A;  2W1U A;  4KMQ A;  4D8M A;  2CDP A;  3WQB A;  3CIH A;  2LW8 A;  1W99 A;  2BGP A;  2W1Q A;  1YQ2 A;  2Y8K A;  3I2K A;  2RVA A;  3GDB A;  2W5F A;  2W95 A;  3IAQ A;  4MAD A;  2J1V A;  2Y6L A;  4CU7 A;  5J1X A;  4RYD A;  5JXJ A;  1UY4 A;  3WF2 A;  2RJ2 A;  2Y6H A;  4YPJ A;  2W87 A;  3MBW A;  4TTG A;  1TG7 A;  2W47 A;  2VME A;  4OUE A;  4JKL A;  5A1A A;  4W50 A;  4AAX A;  1US3 A;  1NUK A;  1JYV A;  3CQO A;  4LPL A;  3OGR A;  1OD3 A;  5C70 A;  4ARX A;  4UOJ A;  2JE8 A;  5IFT A;  3K4D A;  1KGY A;  1CX1 A;  1NAE A;  3I3D A;  5B4N A;  1JZ8 A;  4QDQ A;  3WF4 A;  1UYZ A;  2WO3 A;  2CDO A;  2XQX A;  3LEG A;  2JKX A;  3IAP A;  1UXX X;  1OH4 A;  1W0N A;  5EJZ B;  2JDA A;  4QX1 A;  5CYY A;  2WAA A;  2VZT A;  5CZK A;  1O8P A;  3MUY 1;  2XHN A;  3UES A;  5DQ0 A;  1R64 A;  3C7E A;  2QQJ A;  3ACG A;  4QDS A;  2W92 A;  3DYP A;  2WBK A;  3HOB A;  1CZS A;  3MO4 A;  1CZV A;  2C26 A;  2J1A A;  3K4Z A;  3T2O A;  3WNK A;  2L9L A;  1TVG A;  4QB6 A;  4CU8 A;  2BBA A;  1H6Y A;  4CVU A;  4QB1 A;  1EUT A;  2WO2 A;  2W1W A;  4A45 A;  4CUB A;  3SEP A;  4OZO A;  2QQI A;  3HJR A;  1GU3 A;  4OMD A;  5B4X A;  2WDB A;  2KD7 A;  4P5Y A;  3WF1 A;  1ULP A;  5LCW L;  2VZU A;  4XUR A;  3HNM A;  3FN9 A;  3OEB A;  1UY3 A;  1UX7 A;  4DEQ A;  1BHG A;  1JU4 A;  3LEI A;  3LPF A;  3A21 A;  1OF3 A;  1GQP A;  1UZ0 A;  3WEZ A;  2YFZ A;  3C7G A;  4A4A A;  1J84 A;  2J1E A;  1RYY A;  3PUI A;  1JU3 A;  5LA2 A;  3A7Q A;  2VJX A;  3ACI A;  3NRU A;  5C7G A;  3ACF A;  3MV1 1;  2X05 A;  3WNN A;  1ULO A;  1UMI A;  2Y64 A;  3I2G A;  2YC4 A;  4P08 A;  3VDC A;  4A6O A;  4QX3 A;  3FL7 A;  2VC9 A;  4KWU A;  4P02 B;  5IHR A;  5FUI A;  4L0P A;  4Z2A A;  2QQM A;  1JZ2 A;  3HN3 A;  3WNP A;  1SDD B;  2J22 A;  4LHS A;  4ZXE A;  2EIE A;  1JZ6 A;  4GWJ A;  1JYN A;  2ZEW A;  4QAW A;  2VZO A;  2V72 A;  4RN5 A;  5C71 A;  4A44 A;  2E31 A;  2J1U A;  4MOA A;  2WZ8 A;  1O8S A;  2VM9 A;  2BER A;  1GNY A;  2J1S A;  4XVH A;  3NNG A;  1JYX A;  4D0Q A;  1JYW A;  3OGS A;  2J1R A;  4JX0 A;  2VTF A;  2VOT A;  5F7U A;  2YG0 A;  3HNB M;  3A22 A;  3OB8 A;  4M4P A;  3I97 A;  1GOG A;  1GUI A;  3BGA A;  2XOM A;  3CDZ B;  4JKK A;  3T08 A;  1DP0 A;  2VCA A;  5IFP A;  1GOH A;  2VZR A;  2HYX A;  4XUP A;  2VMF A;  2V5D A;  2VZ1 A;  5DPN A;  1WCQ A;  2YC2 A;  2E32 A;  5G05 L;  3HNY M;  2E26 A;  3ETP A;  4ZZ8 A;  1L7R A;  3J7H A;  2B4K A;  3IB3 A;  5JXG A;  5LA1 A;  2JD9 A;  2BZD A;  3WF3 A;  2ORZ A;  4PQQ A;  2Y6K A;  4QX0 A;  4BJ0 A;  3UET A;  1L7Q A;  2RV9 A;  4TXW A;  1XNT A;  3E1F 1;  5G04 L;  3LEK A;  3I3E A;  1JZ4 A;  3HPN A;  2VQT A;  3K77 A;  2ORX A;  1DLC A;  5JUV A;  2QBX A;  4JKM A;  1W9W A;  2EIC A;  1J83 A;  3MUZ 1;  4UI9 L;  3T09 A;  4PT6 A;  2C9K A;  5HXM A;  2EID A;  3W5M A;  4CUA A;  1W9T A;  5IJR A;  2V4V A;  3GXU A;  4ZZ5 A;  4OYU A;  4QDR A;  1MPX A;  1UY1 A;  4KI5 M;  4DUX A;  3LQC A;  5IYY A;  4XZU G;  3CZU A;  3ABZ A;  1JHJ A;  4XUQ A;  1XNA A;  4GWI A;  2WO1 A;  4OMC A;  2VZV A;  3C7F A;  4UAP A;  2W94 A;  1WKY A;  2OKX A;  3I2F A;  2WQ8 A;  1JI6 A;  3JXS A;  4DUV A;  4W8J A;  4BK4 A;  4DUW A;  3OBA A;  4MO3 M;  3CMG A;  4LKS A;  1UYX A;  2Y6G A;  1PX4 A;  1T2X A;  2J1T A;  1JZ5 A;  2VO5 A;  4MGQ A;  2VR4 A;  4AG4 A;  2DCK A;  3C7O A;  4XUN A;  3EYP A;  1NX9 A;  4IUG A;  1W9S A;  2DDU A;  3VD7 A;  2HLE A;  1HN1 A; 
#chains in the Genus database with same CATH topology
 5IK4 A;  3KS7 A;  5K8S A;  3NQH A;  3PLQ A;  3HEI A;  4ARY A;  5FLJ A;  2BGC A;  1OKO A;  2EIG A;  4IEU A;  2X09 A;  4Y1V A;  2EAL A;  3LIH A;  2AC1 A;  3O0W A;  2W9X A;  4LKD A;  3RSJ A;  3IDA A;  1XJA A;  1X36 A;  3ZM8 A;  4I01 A;  1LOF C;  3IPV A;  4P9G A;  4B7K A;  1D2Q A;  2ENR A;  1DGW X;  4HN1 A;  4AFC A;  3LPG A;  1S2E A;  1W2O A;  2JG8 B;  2ZJC A;  3WF0 A;  3ZSM A;  1NZC A;  2QQK A;  4D94 A;  1C8M 1;  2PHL A;  1ULG A;  4AHZ A;  5ABJ A;  1US2 A;  5JR2 A;  1N1T A;  2ZEX A;  3A0N A;  2VZS A;  3U1X A;  1UWW A;  5DAP A;  2ZGO A;  5JLV A;  4M0H A;  1BEV 1;  3FX3 A;  4C90 A;  5ERL A;  1AR7 2;  2JG8 C;  1ND2 C;  2GU9 A;  3HD8 B;  4GH4 A;  5BNP B;  5C8C A;  1V6L A;  2R06 1;  2VL4 A;  4Q4V 1;  4ISR A;  4XF4 A;  4QX5 A;  1H1M A;  2LS6 A;  1AJO A;  2G1M A;  2QQN A;  1C57 A;  4CCN A;  3ZMN A;  4BK5 A;  4HK9 A;  2A1X A;  1V9U 3;  3GCW A;  1NCQ B;  1ENR A;  4IEQ A;  2VMC A;  2Y6J A;  1W2N A;  4IW3 A;  2WT0 A;  5L9R A;  1GOF A;  3AZW A;  3LSE A;  1QQP 1;  1UZW A;  3I2J A;  3EO6 A;  3Q8E A;  2VBP A;  3WUC A;  1CJP A;  1OLM E;  3DYM A;  2CGN A;  5C6C A;  5EXO A;  1YQ5 A;  2JE7 A;  3A4U A;  1NCQ C;  3AYE A;  5AVP A;  1W8F A;  4IV3 B;  3LIG A;  1O3S A;  1YXW A;  3T0B A;  1BBT 2;  5DDJ 1;  1DYK A;  4HZF A;  4LBL A;  1L7L A;  4UWD A;  4BWO A;  4EJR A;  1ZNP A;  1MVQ A;  2XBO 1;  5KHJ A;  3K3O A;  3V0A B;  1UOJ A;  1F4A A;  4IV3 C;  2A70 A;  4NPR A;  4KBZ A;  1UXZ A;  3WW2 A;  2DBI A;  3GCX A;  2YB7 A;  4W6Y A;  5EJ1 B;  2EXH A;  2HEV F;  4LHL A;  4YVW C;  2HH9 A;  1SBD A;  5HPO A;  1O3T A;  5EIY B;  1KEX A;  3E5Q A;  3QH6 A;  2ZOE B;  2VUA A;  3E5U A;  2GAU A;  2OQ6 A;  4K7J A;  4E8C A;  4ET7 A;  4JHZ A;  4LBQ A;  4DEV A;  5FRA A;  2IXK A;  2LRP A;  2HWE 2;  4Y24 A;  1VBB 3;  5FPZ A;  4L11 A;  5F6K A;  4MX3 A;  1S0I A;  1NYW A;  1NY7 1;  3IPV B;  3H8X A;  5AC9 1;  3MIC A;  1LCL A;  5A3U A;  3R4S A;  4FQ4 A;  1A78 A;  3III A;  4LBM A;  4QQ2 A;  1F9K A;  1OQ1 A;  3POI A;  2B9V A;  5FYB A;  3I3B A;  3I54 A;  4RHV 1;  5J48 A;  4E9K A;  1RVF 3;  3A23 A;  1DQ6 A;  5T3N A;  5ABJ B;  1N47 A;  1YNA A;  1AR8 3;  5C4W C;  1RUG 1;  1AYN 1;  2E7Q A;  1W8N A;  3BIE A;  3EB7 A;  1K3I A;  3K4A A;  4XBN A;  4GZ9 A;  1QNY A;  2G19 A;  5FZG A;  4GH4 B;  5GLU A;  4BYY A;  5C8C B;  2WFF 2;  5APA A;  2W39 A;  4IL7 A;  3BAL A;  1Q8S A;  5ABJ C;  4KL1 A;  3KMH A;  3UYJ A;  4S2G A;  1O4T A;  2DCZ A;  3KB5 A;  4LIT A;  3MFA A;  4CRQ A;  3MHZ A;  4NIH A;  2W1S A;  4GH4 C;  4MSV A;  1OD5 A;  5D1I A;  1O5L A;  5DAW A;  1F35 A;  3WQ1 A;  1DZT A;  1PMH X;  2BGO A;  1RUO A;  3RMX A;  1FOD 1;  4QMA A;  3SCF A;  2OQ7 A;  1YFY A;  2XJQ A;  3ZSL A;  3O1O A;  1HLC A;  1VBD 2;  2RS3 1;  1H4G A;  3DGT A;  2NP0 A;  4LT5 A;  4FFF A;  4IE6 A;  5CKQ A;  5FJK A;  4ATF A;  1OXC A;  4FP2 A;  4AVC A;  1U5Y A;  5I8S A;  1UZY A;  1E5I A;  4RA0 A;  4QU2 A;  2AUY A;  2HWC 3;  2YPD A;  4XAB A;  3VBS C;  4QHZ A;  1AR7 1;  4D8M A;  4HVO A;  5I8Y A;  1ZBA 2;  5EJ3 A;  2CDP A;  2P6H A;  1W2A X;  2GND A;  3CF6 E;  3CIH A;  1W99 A;  2BGP A;  4Q8L A;  1RUE 3;  2Q8D A;  4B3N A;  4QD2 A;  1K5M C;  2ZGK A;  3C2U A;  3PNA A;  4UW4 A;  1V6M A;  1XND A;  3N7J A;  1M06 G;  3TN9 1;  3HQU A;  3GDB A;  5L19 A;  2BQP A;  2Q0A A;  2J1V A;  1UKR A;  3IAQ A;  3KGZ A;  4MAD A;  4RYD A;  3TEX A;  1UY4 A;  4LR4 A;  5J1X A;  5KHI A;  5DG2 A;  5GJ6 A;  4Q1P A;  1WCS A;  2MNG A;  5DUV A;  1UOG A;  2Y6H A;  3WDY A;  2ZX1 A;  4YPJ A;  2W87 A;  3MBW A;  3H7J A;  4FVV A;  3VV1 A;  5L7O C;  2VME A;  4LBQ B;  3MW3 A;  1A6C A;  3CJX A;  5LW9 A;  4IQP A;  5LAT A;  5A1A A;  3M3O A;  2GNM A;  4ZHN A;  3KZ4 C;  3URF A;  1ULC A;  5FY5 A;  1US3 A;  4AQ6 A;  2OPK A;  2VNV A;  1NUK A;  1OHF A;  2V73 A;  4LPL A;  2P3J A;  3NJY A;  5F2W A;  5JCT A;  1OD3 A;  4CPB D;  1IPJ A;  1GAN A;  2ZML A;  3JCI A;  4UOJ A;  4BQ5 A;  1OQD A;  5FY0 A;  5D2A A;  3VKO A;  3VN4 A;  1J3P A;  4E4Z A;  1TMF 3;  1CX1 A;  2HEW F;  4I09 A;  4BIF A;  2CWS A;  5CFD C;  3I3D A;  4PCR A;  3R05 A;  1W0O A;  1QEX A;  4IE5 A;  1VMJ A;  1LOC A;  3KCY A;  4HSL A;  4DPN A;  1ZRF A;  3UGG A;  1JZ8 A;  5T54 A;  4WVW A;  3WF4 A;  2WO3 A;  4GB3 3;  1X50 A;  2OX0 A;  4LBN A;  4FO9 A;  3OUH A;  1LRH A;  3ZPY A;  2HWE 1;  5JOX A;  4QX1 A;  2O1Q A;  4AAP A;  1H9P A;  3VL8 A;  2QZ3 A;  3VHR A;  1V00 A;  4EQV A;  1HRV 1;  4ATE A;  3IIA A;  5CZK A;  3LOB A;  1O8P A;  3AMN A;  4XJW A;  4A6S A;  1J1T A;  2XHN A;  3UES A;  5FZ7 A;  3AJY A;  3FFZ A;  5DQ0 A;  4M3C F;  3AP6 A;  5AFB A;  2CGP A;  1HX6 A;  4MVT A;  2YBK A;  2W92 A;  5FO8 B;  1LOB A;  1W04 A;  2XLG A;  2TNF A;  1HRI 3;  3LF7 A;  1JOD A;  3DYP A;  3PL0 A;  1VB4 A;  4XQD A;  4D7Y A;  1CZS A;  1CZV A;  2KXL A;  4DY5 A;  2TBV A;  3T2O A;  3OTF A;  2VMG A;  4JQT A;  4R52 A;  4TLF A;  5M0T A;  1IG3 A;  4PLO A;  4CDW A;  4AL9 A;  4P14 A;  1KS4 A;  3DKQ A;  4MHU A;  1IGO A;  4QB1 A;  3MZH A;  3H3L A;  4EN7 B;  2ET7 A;  4YWA A;  5FLI A;  3V0B A;  5A7Q A;  1UZZ A;  1VAK A;  3HJR A;  1CIW A;  4WM7 A;  1POV 1;  1RB8 G;  1V6K A;  4GMP 0;  4JV4 A;  2D7F A;  4WVM A;  3QLQ A;  3HBZ A;  4QHO A;  2VU9 A;  4P9I A;  3RMY A;  2FDJ A;  1MQT C;  4OVE A;  1BCX A;  1R09 1;  1YQ8 A;  4P5Y A;  5FYZ A;  3VBU A;  3OYW A;  3W20 A;  1KJR A;  3FUQ A;  4BMB A;  3KCX A;  1X9P A;  2UYA A;  2VUD A;  5FP4 A;  3BOP A;  1XRU A;  5ANQ A;  5JI9 A;  2BJS A;  1UY3 A;  1XSQ A;  4IDZ A;  1BHG A;  4IGQ A;  3JB8 A;  2FDI A;  1EAH 3;  4ERO A;  3E97 A;  2Q1M A;  1GQP A;  4GMP 3;  1MS3 A;  2BUK A;  2PAM A;  4MYE A;  3S30 A;  2NQY A;  4YGE A;  4COU A;  2DUO A;  4A4A A;  4FPC A;  3AFK A;  3CHX A;  1RYY A;  2LAL A;  1OVS A;  5FYI A;  2NYY A;  1WW4 A;  2DVG A;  3PVN A;  4IES A;  3ZXF A;  2ZCW A;  1FPN 2;  1ZRC A;  2RDR A;  4E4D X;  2OT7 A;  4BXF A;  5JZG C;  3CEW A;  3TB0 A;  5C7G A;  3ACF A;  3D82 A;  1S0E A;  3KQR A;  2Y64 A;  2CU5 A;  2X53 S;  4P08 A;  3G6J B;  5L9V A;  3B01 A;  5KC5 A;  3NVC A;  2ZGP A;  4A6O A;  4QX3 A;  1A3K A;  2DF7 A;  1OFN A;  2VXJ A;  1VRH 3;  5FMO S;  4P9X A;  5FZ6 A;  4CEY A;  4Z1V A;  1YEW A;  1UNB A;  5FUI A;  2XJT A;  1FV3 A;  1VBA 1;  4AVT A;  4SLI A;  4Z2A A;  1JZ2 A;  4Q4Y 1;  3HN3 A;  4IE0 A;  4RSU A;  1QJU 1;  4ONU A;  4DNY A;  5FKB A;  1XYO A;  2B45 X;  2QUO A;  4AHX A;  3I4I A;  3FJS A;  3PTR B;  4GD4 A;  1KD7 A;  1UU4 A;  2W52 A;  4R9D A;  1WW5 A;  4OHZ A;  2EXI A;  3DPR C;  5E88 A;  5ACA 3;  2BPA 2;  5F2S A;  2NN8 A;  2D6K A;  2IXL A;  2UWA A;  3AYC A;  2A71 A;  3LFM A;  2RM2 3;  4CDW B;  5HCA A;  1KRI A;  2WZ8 A;  1DGR N;  1O8S A;  2YHJ A;  3AP5 A;  2ZHM A;  4UW3 A;  5JMC A;  5IAX A;  3LKJ A;  3UGH A;  3TEZ A;  4RS5 A;  4WVV A;  3NO8 A;  4Q8K A;  1YJK A;  2PLV 1;  3RZH A;  4D0Q A;  1JYW A;  3V0B B;  1XSR A;  1WW7 A;  1SLL A;  4WM7 B;  4TSV A;  4CDW C;  1AYM 1;  3OB8 A;  1OOP C;  4M4P A;  5A7W A;  4FPE A;  5H9Q A;  3T08 A;  1VBC 2;  3ZN6 A;  1HN0 A;  1RL3 A;  1UOF A;  4AI3 A;  5IVB A;  5BNN C;  4TZD A;  3VBU B;  5FOJ B;  5KHK A;  3OYW B;  2VMH A;  5FMC A;  3EXU A;  2VMF A;  2YGL A;  4I02 A;  2QKD A;  2SBA A;  5DPN A;  5DG1 A;  5GZE A;  1MEC 2;  4C91 A;  4RR3 A;  3ON7 A;  3SQO A;  4FPL A;  3M1H A;  4KG8 A;  5G05 L;  3VBU C;  2O8Q A;  1LGN A;  4M3C E;  5FO7 B;  3ZIW A;  1Z7S 2;  4NRP A;  1O3R A;  2G9F A;  5GM0 A;  1QJZ A;  3VHO A;  2EVX A;  1L7R A;  3GZT B;  5FZ0 A;  3U4X A;  3ZYF A;  4YAR A;  5JXG A;  2JDH A;  3LA3 A;  2XUE A;  5FYT A;  1SLA A;  4K1Z A;  1RUJ 2;  4UBG A;  5LEK A;  1RIR A;  3OF1 A;  3QCW A;  3VB9 A;  4CDU A;  4Q0S A;  1HXS 2;  2EXJ A;  1Y3T A;  1V9U 1;  4WZC A;  3UET A;  4CEY B;  4TXW A;  1GLH A;  4CZS A;  1XNT A;  4E4H A;  5JIU A;  3E1F 1;  3W58 A;  3N7L A;  2BNO A;  4PJY A;  1MS4 A;  4EV0 A;  5F3E A;  4I3P A;  5J3U A;  1OC1 A;  3AXD A;  3K77 A;  1ASJ 3;  1LEM A;  2DU1 A;  4E2S A;  5EFU A;  2P4E A;  1DLC A;  4KGQ A;  1RUH 3;  1FXZ A;  4AZZ A;  2CAV A;  1RC6 A;  1DQ5 A;  1UW8 A;  1S0F A;  4OZX A;  5I0R A;  1J83 A;  2VY0 A;  4I0B A;  3M2M A;  1G9F A;  3CJI C;  3MUZ 1;  4SBV A;  2ZX3 A;  5FYU A;  3OGG A;  1G9C A;  3WW1 A;  1GWM A;  4BIS A;  2C9K A;  1FPN 1;  5GKA C;  5LZ6 A;  3M3C A;  4LK7 A;  3U4S A;  3FBY A;  4K3U A;  1AR9 2;  4QQL A;  4RS5 B;  4O61 A;  2K9Z A;  3H1Y A;  3RWK X;  2B39 A;  2HKX A;  4OUL A;  2ATF A;  2UUR A;  2B46 X;  4QDR A;  1YFX A;  1UY1 A;  2IWG B;  5J7M A;  3AM2 A;  5JOZ A;  3WG4 A;  3LQC A;  4OI4 A;  5A7W B;  2ZGN A;  4XF0 A;  3CZU A;  3JD7 3;  3RI8 A;  3ZN6 B;  1HJF A;  4UW5 A;  3WDV A;  1QJF A;  3HWJ A;  2MEV 3;  1JYI A;  3WDX A;  1MS9 A;  1XNA A;  5A6Y A;  2A6X A;  1VRB A;  4IEV A;  5FXW A;  4PIY A;  4ASM B;  5HCH A;  2WC2 A;  3WR0 A;  1WCK A;  4OMC A;  1Q8V A;  4UAP A;  4GKX A;  1LOE A;  3OPW A;  1XU2 A;  3WNX A;  4RR3 B;  2ZKN A;  2XL9 A;  1SCR A;  5DAX A;  1BVV A;  2CSG A;  5F6L B;  3TBD A;  4YYO A;  1HB1 A;  1AL0 G;  1ULE A;  1ZYB A;  3B9C A;  4AI1 A;  3PVO A;  1RVF 1;  2HWF 2;  3U0Z A;  2JDY A;  4BK4 A;  4K1Y A;  1UQX A;  4JGY A;  1SCS A;  1M4W A;  1UYX A;  4WV8 A;  1BZW A;  2J1T A;  1E5S A;  4FFG A;  1KIT A;  5FFO C;  4DXZ A;  4FFI A;  5GZF A;  1S0J A;  4NAO A;  4CDU B;  1NX9 A;  4CEW A;  1O7F A;  4NHL A;  5FZE A;  2JEN A;  3J9S A;  1CWP A;  5L73 A;  4K8R B;  2DDU A;  4OHX A;  4V2W A;  3ZYP A;  1HN1 A;  5KXE A;  3TRS B;  2ERF A;  5JPM B;  3RZZ A;  3POY A;  2VOV A;  3OD0 A;  4R9A A;  1QJX 1;  1PMJ X;  2W3J A;  3ZPO A;  1MEC 1;  1IQD C;  4XFF A;  3SH3 A;  1K42 A;  4JDN A;  1F31 A;  4LO8 A;  3TNQ A;  3H3U A;  4NII A;  2I45 A;  4LTA A;  1AVB A;  1AR6 2;  4YGB A;  4A41 A;  5FP3 A;  3AK0 A;  1J59 A;  4O9E A;  1OLM A;  4GUL A;  1LHW A;  2EAA A;  3B94 A;  1J3Q A;  1DBN A;  3I2H A;  3KT1 A;  3RVH A;  5I93 A;  5A6X A;  2IC1 A;  2VXR A;  4UBH A;  3MIG A;  2KA3 A;  3OEA A;  2CTV A;  1RUJ 1;  1UY0 A;  1SG3 A;  3C8X A;  4XUO A;  5LA0 A;  3N7K A;  4L99 A;  5KC6 A;  4Q1R A;  3C7H A;  3ROU A;  4DB5 A;  2X10 A;  4AFM A;  3THD A;  4LBQ D;  4HSJ A;  5BNO A;  5DMY A;  4BOW A;  4LXL A;  3HR9 A;  1LES A;  2ARE A;  2JB8 A;  2YYO A;  3S5A A;  3KWV A;  2MHF A;  4AGV A;  1O6U A;  1HQW A;  1K5J A;  1U0A A;  2RJK A;  4D3W A;  1X8M A;  1E57 A;  4DRR A;  5D21 A;  2JIG A;  4N7I A;  4YW2 A;  4JC1 A;  5J09 A;  1LGB A;  2R16 A;  4L97 A;  1OKQ A;  4XDP A;  3S0M A;  5DN2 A;  2QDN A;  1S0B A;  1H9W A;  1H2M A;  3KM5 A;  4NOT A;  5C33 A;  1CPN A;  3K3N A;  3GNE A;  5T50 A;  3OGV A;  5I0D A;  2YV8 A;  4ZXK A;  1PX3 A;  2OS2 A;  1LHO A;  3P1I A;  1FMD 2;  3FMG A;  1IS3 A;  3H0O A;  4BDV B;  2EIB A;  3DYO A;  3H8U A;  5CFC C;  1LOF A;  1LU1 A;  1AR9 1;  3NJX A;  2H0V A;  1PM7 A;  2QQV A;  5FXZ A;  4CU9 A;  3BN6 A;  2XML A;  4JGY B;  3WW3 A;  2HWD 2;  5T5O A;  3H3Z A;  2WNE A;  4XJ8 A;  2OUH A;  3ECQ A;  1UY2 A;  3WCS A;  2RHP A;  1EV1 2;  2QFE A;  2Y6F A;  1IZ3 A;  1DQ2 A;  3POE A;  2WII B;  3ITQ A;  4AED A;  2ZHL A;  4CEW B;  4XJ9 A;  4JGY C;  1XNC A;  1UX6 A;  1A8D A;  1ND2 A;  2WA3 A;  4QPW A;  2VBB A;  2FHR A;  3LGR A;  5A7N A;  3W5N A;  1ODN A;  1OI6 A;  3BTY A;  4RL7 A;  3RZG A;  3JQW A;  1AZD A;  2WAB A;  3B69 A;  1O59 A;  1GQH A;  1W8Z A;  3POG A;  5E1R A;  4QKN A;  2YPJ A;  2BOJ A;  1DGL A;  4ZU7 A;  3LEM A;  3DKW A;  2K2S A;  2Q1F A;  3UT0 A;  3NJV A;  4WBB A;  1HRI 1;  1Y4W A;  3CLP A;  1H30 A;  4HPK A;  4Q0P A;  4RGA A;  1Q8P A;  1ST8 A;  2JDK A;  4LIV A;  1FAT A;  4PIZ A;  4P00 B;  1XC6 A;  2WZE A;  3WXP A;  4MXV A;  1R1A 3;  2HWB 3;  2K0G A;  5A3O A;  4CP1 A;  4GA9 A;  2GC3 A;  2VMD A;  5IAT A;  2BYV E;  4LO7 A;  1BK0 A;  5FZO A;  1W05 A;  3F2Z A;  5JI7 A;  1BVP 1;  5FZC A;  3SH4 A;  1JZ3 A;  3LE0 A;  1NE4 A;  1ZZ8 A;  3NST A;  1WD3 A;  5DUX A;  5BNO B;  1URX A;  4PBP A;  2O8O A;  5DZF A;  1OPO A;  4HET A;  4BQY A;  1JW6 A;  4GJZ A;  4EYU A;  5FYV A;  2WAO A;  1NY7 2;  2Z4F A;  2ZMK A;  1J3R A;  4K21 A;  4G4F A;  4XC9 A;  3GZE A;  2JDM A;  5F39 A;  1GZW A;  3VD3 A;  2RR1 2;  4BE3 A;  4CP9 A;  3T2P A;  5C3R A;  2ZEY A;  4I30 A;  2XDV A;  4YVW A;  3O1M A;  3SEE A;  2XGX A;  4CE8 A;  5A1F A;  1GMM A;  3LZZ A;  5FV3 A;  2YDE A;  5BNO C;  1ALY A;  1YRZ A;  4DXR A;  1RUG 2;  3QAC A;  4W6X A;  3RZL A;  1DDL A;  3VDB A;  3VZJ A;  1MZ6 A;  4BHP A;  3M4F A;  4PI2 A;  2Z2S B;  3GHN A;  5FLH A;  1UYY A;  4MH0 E;  3GJB A;  3DEC A;  3UV9 A;  1K45 A;  2P1B A;  2ZMN A;  1RGS A;  3NNF A;  4Q4X 2;  5E89 A;  3T0D A;  4RD7 A;  2ZAH A;  1WA6 X;  2CL2 A;  3SH5 A;  3EJK A;  3WQB A;  4Y20 A;  5HCF A;  4Q4W 3;  4A7Y A;  1ULD A;  2Y8K A;  4EN9 B;  4JGZ A;  1IQA A;  3PTY A;  4IEZ A;  4XEZ A;  5C4W A;  4AED B;  1WLD A;  3ENR A;  4YM3 A;  4O9G A;  3QBQ A;  2BRT A;  1FOD 2;  1ND2 B;  3WF2 A;  4Z92 B;  1ENS A;  3KF5 A;  1E5H A;  2PXJ A;  3IN9 A;  3PUR A;  2RS3 2;  4TTG A;  2NMO A;  1VRH 1;  2W47 A;  1S0G A;  4OUE A;  4JKL A;  1W3X A;  4AED C;  5H9P A;  2P34 A;  3TNP B;  4LBK A;  4W50 A;  2WJS A;  1ZZC A;  1QJY 2;  5IUQ A;  1JYV A;  5JR7 B;  3OOX A;  2GME A;  4TN7 A;  3ACL A;  1FMD 1;  3CQO A;  3OGR A;  5AVA A;  3WX5 A;  3ZXA C;  2YU1 A;  1J58 A;  2JWP A;  2XJR A;  4HPK B;  5C70 A;  2XVK A;  1XE0 A;  2BWA A;  4QX8 A;  4OHW A;  3TN9 2;  5C5U A;  1VBE 3;  2HWD 1;  2FBE A;  2JE8 A;  1UKG A;  2PHF A;  4URA A;  1RHI 1;  3K4D A;  1OUR A;  4DFS A;  2ZGU A;  1NAE A;  4NIG A;  5FY9 A;  1EV1 1;  1EYB A;  5FZO B;  1A34 A;  1PHM A;  2RM2 1;  4A7K A;  3ZIX A;  3AJZ A;  3J26 N;  3I8T A;  3VBS A;  4XZP A;  1H0B A;  3AVR A;  3FC0 A;  2H0B A;  4R9C A;  4DIN B;  5C3O A;  5J96 B;  1UYZ A;  1BMV 1;  2NM1 A;  5FY8 A;  3V56 A;  2CDO A;  5KWR A;  2XQX A;  3BVC A;  4HXC A;  1K5M A;  1GZW B;  5GLT A;  3VZK A;  1GZ9 A;  1UXX X;  3ZFF A;  4CP9 B;  1W0N A;  5EJZ B;  1JYC A;  4YVW B;  1CJD A;  1H4H A;  4ZKT B;  2WAA A;  1GKB A;  5DXD A;  1X33 A;  3ZR6 A;  1YI7 A;  4GAL A;  4BH9 A;  2XHK A;  4YLZ A;  4BCU A;  3A0K A;  4Q0Q A;  3Q9O A;  3T30 A;  1D4M 2;  5L7O A;  3O1P A;  4GAZ A;  4PHZ A;  4FQZ A;  5EP9 A;  2G4I A;  4FXK B;  2QQJ A;  3ACG A;  5LA9 A;  1JYT A;  1TNR A;  4LK6 A;  3PIG A;  2BP6 A;  2D6O X;  2XLA A;  2DWR A;  4IEX A;  4KNC A;  4Y1U A;  2XR4 A;  2WBK A;  2VD7 A;  4GXL A;  1C8N A;  1GFF 2;  2E7A A;  3BB6 A;  5IVY A;  3R6S A;  5FZ4 A;  3RDI A;  3WZ1 A;  2V4A A;  1ULF A;  3WNK A;  1CAU A;  2DVF A;  3GZU C;  5LBE A;  4CCK A;  1RIT A;  4Y20 B;  5LB6 A;  4CU8 A;  1I3H A;  3MFC A;  2RS1 2;  5FPV A;  1H6Y A;  2BFU L;  4NHM A;  5EYY A;  1BQP A;  4JGZ B;  5FWJ A;  2FD8 A;  5C4W B;  1HRV 2;  1EUT A;  2WO2 A;  2ZPX A;  1Q3E A;  5CFD A;  2B8M A;  2D3R A;  4Y4Y A;  2RR1 1;  1G86 A;  4CUB A;  2QQI A;  1CVN A;  2C1F A;  1B35 C;  1YO8 A;  3LA7 A;  5SV5 A;  2EA7 A;  3GBW A;  4JGZ C;  3WW4 A;  3OBZ A;  2VMI A;  3T1L A;  2RMU 1;  4GIQ A;  4FT8 A;  2WDB A;  4QKB A;  2QJV A;  5FK8 A;  4UFH A;  5T52 A;  1MS0 A;  4IND A;  4BQ2 A;  1ULP A;  3IT8 A;  3RFR A;  1RUH 1;  4M01 A;  3DL3 A;  3J8F 1;  1MZ5 A;  1W28 A;  2D44 A;  4Q4X 1;  4AW7 A;  3KV4 A;  2DU0 A;  3OEB A;  4HKO A;  3PVE A;  1RMU 3;  4LHK A;  4DEQ A;  3MID A;  1AHS A;  1GZT A;  2C0Z A;  4QX7 A;  3LEI A;  1YYN A;  1PO1 3;  2Y60 A;  3VBH C;  1COV 3;  1OF3 A;  1OA3 A;  2QDR A;  1UZ0 A;  2W08 A;  3IDB B;  2R04 3;  2YFZ A;  1U12 A;  5FBZ A;  5K0U C;  3RZJ A;  3VL9 A;  4AI8 A;  5CAD A;  3IDC B;  2WKK A;  3VBS B;  2D93 A;  4YW3 A;  5CBL A;  1RUD 3;  2A6W A;  3A7Q A;  1F2N A;  4AVV A;  1RUF 3;  2VJX A;  3ACI A;  1R09 2;  3GBG A;  3NRU A;  1K5M B;  3NNM A;  3R0R A;  4W65 A;  5F5C A;  3ZFF B;  3SLI A;  1UMI A;  1KFX L;  4ASK A;  3VDC A;  2Q8E A;  1QJY 1;  3ILF A;  4P02 B;  1TEI A;  4YZ5 A;  3KHB A;  2MEV 1;  4XFH A;  4ZON A;  1YQ6 A;  4IGO A;  4L0P A;  4LE4 A;  2WNU C;  4E2Q A;  5L7O B;  3ZFF C;  1ZBE 3;  1DQ4 A;  2QQM A;  2FZ2 A;  1NLQ A;  3NMB A;  4XW3 A;  5HI0 A;  2F6B A;  1MQT A;  1W6M A;  2F4L A;  2XL7 A;  3WNP A;  2JEC A;  5A7S A;  1ACC A;  3ZR5 A;  3AP4 A;  4EN0 A;  1LHV A;  3PHM A;  4LHS A;  4QXB A;  3ZFG A;  2EIE A;  1VJ2 A;  3ZYI B;  1CAU B;  4WM8 B;  1JZ6 A;  1YJL A;  3H42 B;  2GC1 A;  2WT2 A;  3NKG A;  1IKP A;  1LGC A;  1CGP A;  2V72 A;  2PA7 A;  4XXA A;  2E31 A;  4A44 A;  5C5T A;  3D0J A;  1NXM A;  5C71 A;  1QXJ A;  2ZHN A;  5CG8 A;  4M3C A;  5CFD B;  2J1S A;  1VBA 2;  4D69 A;  4WM8 C;  1WLT A;  2RS5 3;  1U5Z A;  4ES8 A;  2J1R A;  4Q4Y 2;  4ORF A;  3L2Y A;  5A80 A;  2VOT A;  2XQR A;  1QJU 2;  4Q29 A;  4RGG A;  2YG0 A;  4XHX A;  1B09 A;  1XE7 A;  2H6B A;  3EQE A;  4XJA A;  1HQL A;  2Z42 A;  1W6O A;  3BGA A;  5JZG A;  1D4M 1;  2IXC A;  3POS A;  5BUV A;  2F4P A;  2YGM A;  4XPV A;  3V64 A;  2GH8 A;  4U2A A;  2LRO A;  2VZR A;  5A3T A;  3KD4 A;  2PMW B;  1R08 3;  4AQT A;  2FDF A;  4XUP A;  1ZRI A;  3FFQ A;  5BPX A;  3B02 A;  4B1L A;  4N53 C;  5EV7 A;  3TYJ A;  3WP4 A;  4QPG A;  1GNH A;  2VZ1 A;  3ZFE A;  2ES3 A;  1WCQ A;  1CD3 G;  4MG2 A;  2RS1 1;  5KR7 A;  5F37 A;  1HB2 A;  2PLV 2;  3FLR A;  3HNY M;  1QNW A;  4K8F A;  4FBF A;  1LR5 A;  2E26 A;  4ZZ8 A;  1U5X A;  1AYM 2;  5FJH A;  1YWK A;  1HQN A;  2V09 A;  2WQZ C;  2WYF A;  3AB0 A;  3QD6 A;  4Y5S A;  5F5Q A;  2R32 A;  2JD9 A;  4AR2 A;  3ZXE A;  2DVA A;  1C5I A;  3DPR A;  4K9S A;  2ORZ A;  3QOP A;  2FDG A;  4PQQ A;  4I3G A;  4QX0 A;  3ES4 A;  2GDF A;  1PGW 1;  2PHT A;  4P9W A;  3MLK A;  2PEL A;  1QWR A;  3LSD A;  3I3E A;  4PDW A;  1RXF A;  3HPN A;  4XE9 A;  4AOC A;  5E6H A;  2JIJ A;  2VQT A;  1OOP A;  3FE5 A;  4Q26 A;  1MQT B;  1W6M B;  1RUI 1;  4PF5 A;  3FZ3 A;  3MGU A;  4XCA A;  1DZQ A;  1ONA A;  4LOR A;  5E8A A;  2FZ1 A;  1Q56 A;  3WD5 A;  3ZYG A;  4PIX A;  4AK3 A;  5F5I A;  3ZFG B;  4EWD A;  5BNN A;  4NWV A;  2EIC A;  3PU8 A;  4NRO A;  4AVS A;  2JXA A;  3WP5 A;  2XUM A;  3SNM A;  4PT6 A;  1PVC 3;  1ZVF A;  1TME 3;  5IK5 A;  1FNY A;  1QIQ A;  2G9Z A;  4Z07 A;  1V9U 2;  3W5M A;  4M3C B;  3ZFG C;  4NUB A;  2ZS6 B;  5A3P A;  1JXN A;  1QH7 A;  4LA2 A;  3WG2 A;  1OUS A;  4AEK A;  1N3O A;  3J7N A;  2AAC A;  1X8E A;  1LOG A;  4EN8 B;  2UU8 A;  1MPX A;  4PLM A;  2HYK A;  3NNJ A;  5CIR A;  5FZD A;  1MAC A;  1W3V A;  1W6O B;  4XZU G;  5JZG B;  4OUM A;  5A32 A;  5JUV A;  1ZZB A;  4KU8 A;  2ZGS A;  3LA2 A;  1G8W A;  2R30 A;  4XUQ A;  3AKS A;  4BQX A;  4X6Q B;  4YGD A;  3RZK A;  2WO1 A;  2VZV A;  4QPG B;  2D3S A;  3BU7 A;  3C7F A;  5FDB A;  3ZFE B;  4K20 A;  4GQ7 A;  1WMD A;  2W94 A;  3I2F A;  2WQ8 A;  2VOK A;  2XH6 A;  4YVS C;  4CCD A;  4NN0 A;  2YBS A;  3M7A A;  5A3M A;  1WD4 A;  1FAY A;  4OCT A;  5FO9 B;  1WA4 A;  5HBA A;  3OBA A;  4QPG C;  5CNA A;  4MO3 M;  1GZC A;  2AZ5 A;  3CMG A;  3ZFE C;  2E7T A;  3K48 A;  2IXH A;  3CJI A;  3RQ0 A;  4EN6 B;  3DPR B;  1PX4 A;  2JDP A;  4W6W A;  3N3H A;  1JZ5 A;  3AMQ A;  1VBB 2;  4MGQ A;  1PIV 3;  2C24 A;  4MXW A;  4AG4 A;  2A3X A;  3BYW A;  3C7O A;  4ZS2 A;  3O1U A;  4XJZ A;  3PUA A;  4GWN A;  4CP0 A;  4NHK A;  3UK9 A;  3ORJ A;  1QMJ A;  2R07 3;  3VD7 A;  2E63 A;  1C8M 3;  4FAG A;  1RUC 1;  5F5A A;  2ID4 A;  4PDW B;  2WYS A;  1LUL A;  3FHI B;  2AEY A;  3BPZ A;  1DGW A;  5CKM A;  1RVF 2;  2VOX A;  5EQU A;  3WLU A;  3TEY A;  1CAX A;  1AR8 2;  1CN1 A;  1OOP B;  4AHY A;  1PMI A;  4YRD A;  1BEV 3;  4A2U A;  1W8U A;  4LE3 A;  4AEJ A;  3N4M A;  2XJS A;  1NQJ A;  2R06 3;  1PZ9 A;  4Q4V 3;  3GGL A;  4BM8 A;  5BNN B;  2R1B A;  4CTE A;  4FPF A;  3T4V A;  4PDW C;  3GBF A;  4CDQ C;  3AL5 A;  1ZZ7 A;  1SLB A;  4NIA A;  4H2A A;  4BIO A;  4NRQ A;  3ALQ A;  5FZ3 A;  4N43 C;  4XDO A;  1OF4 A;  4YW7 A;  3VKL A;  2BBV A;  3ZXD A;  3D6E A;  2BV4 A;  4ZPI A;  2AR6 A;  2BNN A;  4HG6 B;  3JB4 C;  4LO6 B;  4DXS A;  4CU6 A;  2W91 A;  1QQP 3;  1QOO A;  2WWJ A;  3AZV A;  3ZSJ A;  1QJX 2;  4KBB A;  1I9R A;  4BXS V;  1OFS A;  2ZAC A;  4J6G A;  4LO5 B;  4NJ4 A;  5LWB A;  3RWN A;  2QQO A;  4EWE A;  1AL2 3;  2UWB A;  1OQE A;  3B00 A;  3OG2 A;  3P3N A;  1D0G A;  2DTY A;  4V2V A;  3Q8B A;  2BW8 A;  5A32 B;  5DDJ 3;  1NCR C;  4HKL A;  2PAE A;  3WSO A;  1W06 A;  3AC0 A;  4LQR A;  3IKW A;  4A3Z A;  4JRA A;  1QOS A;  4MGS A;  2PHX A;  3WDT A;  3KT4 A;  2HWC 2;  3DXU A;  3ZYR A;  3MF6 A;  5IWF A;  2XBO 3;  1UIJ A;  1W8H A;  3LFI A;  4NRM A;  4H7L A;  3KVA A;  2ZTN A;  3CZJ A;  4D6S A;  2AH2 A;  4EZH A;  1RUE 2;  2VBD A;  4FI9 A;  5FUN A;  4COY A;  4B29 A;  4KWL A;  3K46 A;  1IS6 A;  4Q5O A;  2XLF A;  1KS5 A;  4AEM A;  2DVB A;  1MR5 A;  1DYO A;  2FMY A;  1VBE 1;  4K6B A;  4LO4 B;  3UL2 A;  4LNV A;  1BK1 A;  4UFI A;  2YC0 A;  2VZP A;  5DAQ A;  1W2U A;  1OUX A;  2NMN A;  2PHR A;  2WA4 A;  4XFC A;  4Y1X A;  3WNL A;  5GZC A;  5I8T A;  1NLS A;  1PM4 A;  2D97 A;  3APB A;  3CJI B;  3GHM A;  1DGR A;  1Q8O A;  1WBL A;  2HBU A;  3ETQ A;  3GAL A;  3JBG 3;  4MGI E;  2UY9 A;  4PF1 A;  3SXW A;  3IZO A;  3N9O A;  3RYP A;  4EWA A;  2R7E B;  3WT3 A;  2XJU A;  3ZSE A;  4A42 A;  4MXW B;  3VKN A;  4YFZ A;  5AC9 3;  1RXG A;  4MV2 A;  1CZT A;  2ZEZ A;  5H9S A;  5FYH A;  4KH9 A;  2GC0 A;  3ZYB A;  1UL9 A;  3UJQ A;  2J7M A;  5FXV A;  2D6L X;  4G9S B;  4H55 A;  4QB2 A;  4RHV 3;  1GIC A;  3UJO A;  3F95 A;  1HKD A;  2X5I A;  2PN5 A;  1QH6 A;  1SFY A;  3IMN A;  1WWY A;  2VQU A;  2WS9 3;  1PO2 3;  1CAX B;  1RUG 3;  1AYN 3;  1JMU B;  1VAL A;  2P37 A;  1TMF 2;  3POF A;  4YM2 A;  4AI2 A;  4LKE A;  3R4D B;  3THC A;  3R4U A;  1H2L A;  2XKO A;  4CYD A;  2WZR 3;  3O14 A;  3WOG A;  2VNO A;  3FHA A;  4Y1Z A;  5DZE A;  3O1S A;  2CV6 A;  3BTZ A;  2PQS A;  4HAN A;  1NKG A;  2C5D A;  3QH7 A;  4GB3 2;  3VD9 A;  4ZS3 A;  4XF3 A;  4JRL A;  2BVB A;  3IBM A;  3SMH A;  4LUL A;  2IFW A;  1VBB 1;  1LNS A;  1RTV A;  4FOV A;  4RQP A;  1XNB A;  4OQ9 A;  5CFC A;  5JPN B;  4LIU A;  3ZXG A;  3FHQ A;  2QQP A;  1STM A;  5GAL A;  2V5Y A;  1ZRE A;  4LMF A;  5FY7 A;  4OHV A;  2WLQ A;  1PZ8 A;  2I07 B;  3NJZ A;  2Q8C A;  1W8O A;  2RS3 3;  5KXB A;  4QXC A;  3PJY A;  2FDK A;  3JZV A;  2VAU A;  1EP0 A;  1LOD A;  1AR8 1;  1HRI 2;  3N9N A;  3ZMO A;  3CKH A;  1OVP A;  3D0S A;  1R1Z A;  1AR7 3;  4AVB A;  2WN3 A;  4XOG A;  1V6N A;  3GM8 A;  3S7I A;  4UF0 A;  3WNO A;  3AKT A;  4MET A;  1NOV A;  3JU9 A;  5EPA A;  3ACH A;  4XAA A;  3TN9 3;  5FMO L;  4XF1 A;  3H8O A;  1RMU 1;  4K40 A;  4P9L A;  4DO0 A;  5BXX A;  3CO2 A;  3VZO A;  5JMO A;  2VPV A;  1SHW B;  2B7Y A;  2VZQ A;  2W68 A;  2YFU A;  1COV 1;  1SQ4 A;  4GJY A;  2HBT A;  4KMQ A;  2VH9 A;  2GN3 A;  2R04 1;  3ZN4 A;  3KT7 A;  1GBG A;  1RUN A;  4Y22 A;  2C9A A;  1I1E A;  2W1Q A;  1YQ2 A;  3I49 A;  4YW5 A;  4D6Q A;  2D43 A;  2X29 A;  2JG9 A;  3B9I A;  1RUD 1;  3K51 A;  5FOB B;  4FTE A;  3I7D A;  4DQA A;  2RVA A;  2E9Q A;  2W5F A;  2W95 A;  5BY5 A;  5JXJ A;  5LY1 A;  1BBT 3;  2Y6L A;  4ZU5 A;  3VGI A;  1DHK B;  4F83 A;  4U36 A;  3LB9 A;  4P5H A;  2HWC 1;  4HVR A;  4AVA A;  4DOU A;  1O5U A;  4XTM A;  2X5I B;  2R0H A;  2WSV A;  5F8P A;  5FTT C;  3SCH A;  1RUE 1;  2FQP A;  1EAH 2;  3ELN A;  1Y9M A;  3I59 A;  3THT A;  3G7D A;  3NAP C;  2X5I C;  2ZZJ A;  2O0O A;  4Q27 A;  3VDD C;  1S0C A;  5IFT A;  2DYC A;  4ZU4 A;  4BPZ A;  2HWE 3;  2GSY A;  3NV2 A;  2QCS B;  2YZ4 A;  4UFK A;  3MPB A;  4RQP B;  3BKZ A;  4C0H A;  4CXX A;  5CFC B;  3N35 A;  1VRH 2;  5C9A A;  5IVJ A;  4YW4 A;  4LKF A;  1UO9 A;  5HV0 A;  5CU1 A;  4QDQ A;  1C1F A;  5FZM A;  1SAC A;  3HT2 A;  4FOW A;  1E5R A;  1VR3 A;  4RQP C;  2JEM A;  2JKX A;  2RE9 A;  3IWZ A;  4RFT 0;  1N1Y A;  2BOI A;  1POV 0;  4QKD A;  1TMF 1;  4MGT A;  1D2S A;  5BYN A;  4KWK A;  1C28 A;  4XBL A;  3OBR A;  2Q4S A;  4XF9 A;  5CYY A;  3Q8A A;  4FFH A;  3WY6 A;  2WFF 3;  1V6O A;  1RHI 2;  3H7Y A;  3RS6 A;  4NE9 A;  2VZT A;  4UF0 B;  4BA6 A;  1IKQ A;  1KXG A;  5ACA 2;  5A70 A;  2VCM A;  5FYC A;  4CXY A;  2XXZ A;  2ZX4 A;  2DVD A;  5A33 A;  3OUI A;  3IMM A;  2PQQ A;  2RM2 2;  1R64 A;  2VGD A;  4AI0 A;  2RDS A;  5FCC A;  4DY3 A;  4GB3 1;  4BLI A;  2CHH A;  3N36 A;  1JH5 A;  2NPI A;  2JD4 A;  4M00 A;  2XWJ B;  3HOB A;  2YMZ A;  1BMV 2;  3TEW A;  1SBE A;  5FRE A;  5DAB A;  2J1A A;  3K4Z A;  2L9L A;  1TVG A;  4QB6 A;  4Y22 B;  1GQG A;  4YZ3 A;  5LRR A;  1LKN A;  2JG9 B;  1CQ9 A;  1VBD 3;  1R09 3;  2AYH A;  2WR9 A;  2WRA A;  3POW A;  4X6R B;  4CVU A;  1OLQ A;  2ETE A;  1N3P A;  3GZA A;  2DBN A;  3IM0 A;  4XHB A;  1AXK A;  5IVV A;  2TUN A;  4OQ8 A;  2D5F A;  4FPH A;  1GYK A;  2Y26 A;  4IEP A;  4M0N A;  5I0S A;  3UKN A;  1QF3 A;  4H3W A;  5FR3 A;  1ZBA 3;  2A7A A;  2JG9 C;  1RJ7 A;  5FWE A;  5T55 A;  1F5J A;  1VAM A;  2XB6 C;  4OMD A;  1F8V A;  2WT1 A;  1EPZ A;  2CNA A;  3O0X A;  3BTA A;  4C8D A;  2LTN A;  2VVD A;  2VW2 A;  2VE1 A;  3I59 B;  1GWL A;  5TSW A;  3WF1 A;  2AEN A;  1BXH A;  1DIW A;  2VZU A;  3C3V A;  1FYU A;  4IET A;  3ZDV A;  3ZYJ B;  3O12 A;  1D4V B;  1HJG A;  3FN9 A;  3PMS A;  5F3G A;  1LEN A;  3HVD A;  4Y26 A;  4RFR B;  3INA A;  3OPT A;  1UX7 A;  4CCM A;  5IT6 A;  1JU4 A;  3LPF A;  4AE2 A;  2BDR A;  2JE9 A;  3A21 A;  2ZGQ A;  4OI0 A;  1PVC 1;  2PHU A;  1H1A A;  3N9M A;  2FDH A;  4FAH A;  2BEO A;  5C9A B;  2RMU 2;  2OYZ A;  4QHB A;  2R1D A;  1QHD A;  3KV5 A;  4NR1 A;  4EE2 A;  2D6N A;  1YCI A;  5JDB A;  1LED A;  2VTX A;  2ZA9 A;  1QJU 3;  2DFB A;  2D5H A;  1ASJ 2;  1F15 A;  2YXS A;  1QOT A;  1APN A;  2Y0I A;  3MV1 1;  3PIJ A;  1G9D A;  1RUH 2;  2A75 A;  3I2G A;  3J8F 2;  3WUD A;  3USU A;  5C9A C;  1EAH 1;  4OHY A;  3FL7 A;  4GMP 1;  4HT1 T;  2VC9 A;  5AFE A;  4KWU A;  1VMF A;  3EBR A;  1KDM A;  1S2B A;  3HAG A;  5FIX A;  3RZM A;  5D8A C;  3BOW A;  1B35 A;  3N7M A;  5A33 B;  4YG3 A;  2G9G A;  4BU2 A;  5H9R A;  2OUJ A;  5CB7 A;  4J1W A;  3LDR A;  4FPY A;  3POB A;  4YFW A;  2GNT A;  4IE7 A;  2XPJ A;  1C5H A;  2OXB A;  4CCC A;  3OSD A;  1UZV A;  5GLW A;  2P3I A;  5CA6 A;  2SLI A;  2EAK A;  2UWC A;  1UF2 C;  4LBJ A;  1I6X A;  3MIF A;  5HCB A;  1UD1 A;  3ZYH A;  3S7E A;  4KGG A;  4RN5 A;  5ISL A;  3PME A;  3JD7 2;  3KV6 A;  4G3Y C;  5FY1 A;  4MOA A;  3MYX A;  2FCV A;  3AKQ A;  5IW0 A;  3VBH A;  3RI9 A;  4CP2 A;  2VM9 A;  2BER A;  2C6S A;  2I2S A;  2MEV 2;  2WFP A;  2ET1 A;  3H1M A;  3NNG A;  4XVH A;  1JYX A;  1PIV 1;  2WSU A;  4QPI A;  4AHW A;  1N3Q A;  2XVL A;  5K0U A;  3PU3 A;  3OGS A;  1H8T A;  3BTX A;  4JX0 A;  3PVB B;  3KQ4 B;  3KGL A;  3W9A A;  1T6B X;  5F7U A;  1DFQ A;  1UU6 A;  2R07 1;  3A22 A;  3DF0 A;  1ZZ9 A;  4FPG A;  4IEY A;  3BPS A;  4NMI A;  2BU9 A;  4S2D A;  3RRD A;  3ZO0 B;  5ACA 1;  5FP9 A;  1OSG A;  1SMV A;  3AL6 A;  4JKK A;  3CDZ B;  3S5Q A;  3HMY A;  1DP0 A;  5IFP A;  3AVS A;  4PQ9 A;  2AGS A;  2WIN B;  3H8R A;  4P9J A;  4HOO A;  4LA3 A;  4I2O A;  5HV4 A;  5CIS A;  1CX4 A;  4R8H A;  1W9F A;  4F8A A;  4OI1 A;  4AQS A;  3ASI A;  5F9T A;  4KG0 A;  4MGK E;  4TWT A;  3JUU A;  2V5D A;  1W6Q A;  4YM1 A;  3DN7 A;  4HFS A;  5C3S A;  2OPW A;  4XXP A;  5JAX A;  2WNU A;  2MPF A;  2YC2 A;  1YLL A;  3EMR A;  4MHR A;  1Q8Q A;  1BJQ A;  4E2G A;  1Z78 A;  3J4U H;  4DIQ A;  3MLL A;  5BNP C;  1S0D A;  2JDU A;  3FWE A;  3M3Q A;  4N9I A;  2OW4 A;  1MS1 A;  4MLO A;  1JS9 A;  2B4K A;  4FTS A;  1W39 A;  2CGO A;  5GZD A;  5FZK A;  2BZD A;  2ZBJ A;  4KQ7 A;  3ST7 A;  3WF3 A;  4LLO A;  4AFA A;  3MDP A;  1AL2 1;  4MZU A;  3USU B;  4AGR A;  4LUM A;  2Y6K A;  5I0T A;  1EPW A;  5EYX A;  3V65 A;  4WM8 A;  2RV9 A;  3BCW A;  5FMD A;  1QDC A;  5FZ1 A;  3ZXJ A;  3I3M A;  2YU2 A;  1LHN A;  2NZ9 A;  3OCP A;  4UYB A;  1B35 B;  1JZ4 A;  1FPN 3;  1HV1 A;  1MZF A;  4NHX A;  3AYA A;  1ENQ A;  3WVJ A;  2N7G A;  1IHM A;  1X82 A;  4Z8B A;  2ORX A;  5FK7 A;  4HK8 A;  2QBX A;  4JKM A;  2E53 A;  2RG4 A;  1ND3 A;  3VBF A;  2E51 A;  1GR3 A;  1F5F A;  4N53 A;  5JSP A;  1O91 A;  1KQR A;  3T09 A;  3NKT A;  4BLJ A;  5HXM A;  1DLL A;  1HB4 A;  3JBG 1;  2A73 B;  1PGW 2;  2CYF A;  4B7E A;  3VBH B;  4HON A;  1ASJ 1;  4QGN A;  1W9T A;  4XFA A;  4BQ3 A;  3OGJ A;  2Q8O A;  4QPI B;  4JTN A;  5K0U B;  1N1S A;  4YM0 A;  5IJR A;  4UFL A;  1H8T B;  1SFP A;  5A7O A;  1RUI 2;  4DUX A;  4XTP A;  5C8W A;  4BME A;  5IYY A;  4N90 A;  3WG1 A;  4QPI C;  2JDZ A;  5C3P A;  1FNZ A;  1PO2 1;  2WS9 1;  5JOY A;  1JHJ A;  2BVV A;  1H8T C;  5FPU A;  2WL1 A;  4GWI A;  3HBK A;  5ANN A;  2WZR 1;  4IEO A;  1S55 A;  3PUQ A;  1W6Q B;  3SHR A;  4FPO B;  1WKY A;  1OA2 A;  2WNU B;  3KLS A;  2WQ4 A;  2GMP A;  1JI6 A;  3JXS A;  3MIB A;  1XXN A;  4LUK A;  4DUV A;  2HEY F;  1VBC 3;  2Q1Z B;  3I2D A;  1AXY A;  5CEH A;  3JD7 1;  4W8J A;  5LBC A;  5C8C C;  2W0X A;  2GAL A;  1BYH A;  2JDN A;  1V6J A;  2DTW A;  4UFM A;  3NV1 A;  4LKS A;  1QJX 3;  1PK6 A;  3FUO A;  5A3N A;  2Y6G A;  3MW4 A;  4IEW A;  4XIK A;  1W03 A;  2ZGM A;  3AFG A;  1MEC 3;  3RNS A;  1S4C A;  2HJI A;  2VO5 A;  3S6P A;  2VR4 A;  5JSO A;  1G7Y A;  2DCK A;  3ILR A;  4XUN A;  2BWC A;  3U78 A;  3AYD A;  1Z7S 3;  2CY6 A;  1W9S A;  3B3Q E;  3L9J T;  4P9Y A;  2VVF A;  1CON A;  1UN1 A;  2HLE A;  5LBF A;  1SLC A;  3OUJ A;  2JB4 A;  4Y5Z 0;  4FOQ A;  1PGL 2;  5K9Y A;  2DCJ A;  4L92 A;  2ARX A;  1W0P A;  2WNO A;  3O7O A;  1LJ7 A;  1OT5 A;  1R1A 2;  2HWB 2;  1RUJ 3;  2R6Q A;  4IER A;  1HV0 A;  4FOY A;  4A3X A;  4AWD A;  2BTV C;  1QXP A;  4O7X A;  1HXS 3;  2W46 A;  3JQX A;  1N1V A;  1ND3 B;  1VAV A;  3VBF B;  4DRV A;  4L2N A;  2XON A;  4N53 B;  3T0A A;  3VD5 A;  4COV A;  3HN1 A;  2D40 A;  1G9A A;  1JZ7 A;  4JVA A;  1SPP A;  3I3Q A;  4XAC A;  4XCB A;  1NG0 A;  1XU1 A;  4QGM A;  1QDO A;  4Y1Y A;  2QQU A;  1LHU A;  2VEC A;  1ND3 C;  3MIH A;  4YVS A;  4ZY9 A;  1RUC 2;  5T5P A;  3T2Q A;  3U37 A;  2WO7 A;  3VBF C;  3RYK A;  1POQ A;  4UW6 A;  2A6Z A;  1UOB A;  2GC2 A;  3LAG A;  3O1R A;  3ZSK A;  3RGB A;  1XE8 A;  2VNR A;  1YHF A;  1BBT 1;  1QGL A;  2JX9 A;  2ZZQ A;  4XFB A;  2DUP A;  4LOS A;  1NLR A;  1H6X A;  1L3J A;  4LEJ A;  2XJP A;  1G9B A;  2ZXQ A;  4WVZ A;  3UKV A;  3T1M A;  5J36 A;  5JXI A;  3D5O A;  3NW4 A;  4Y4R A;  2Q5T A;  3U10 A;  1CAW A;  4D6R A;  3UKT A;  1AR9 3;  1BLZ A;  4MGZ E;  5LAS A;  2GNB A;  4H7M A;  5KXC A;  2VTX J;  2VCC A;  3M8L A;  3T2T A;  2PAK A;  3UNP A;  5FZL A;  4XQ4 A;  2GH2 A;  4Q4W 2;  1WCU A;  1FI2 A;  2YRO A;  5IVE A;  1NE6 A;  4M4R A;  3CBN A;  5K7P A;  4CUC A;  3ZDS A;  2H6C A;  3VHN A;  4R4Z A;  1AX2 A;  1D0H A;  2W2I A;  1VIW B;  3PUH A;  1Y9G A;  4A7Z A;  1CAV A;  2C4X A;  1RIN A;  2XJV A;  4BZ4 A;  1XYN A;  1UMZ A;  2IXI A;  5I0U A;  4NAM A;  1WMX A;  3TOJ A;  4IXL A;  4Z2W A;  5LK7 B;  1PK6 B;  2ADE A;  2DV9 A;  4YW1 A;  4CDQ A;  3AP7 A;  1DG6 A;  2WN2 A;  4OI2 A;  1WUV A;  1GNZ A;  2WNV A;  1BKZ A;  1P8J A;  2BNM A;  4N43 A;  2CWM A;  5FXX A;  4NO4 A;  1EUU A;  2YUE A;  1JUH A;  5A1L A;  4JTO A;  1IOA A;  1CES A;  2UYB A;  3POJ A;  4LHN A;  1UPI A;  2OZ6 A;  3KSC A;  3M3I A;  1F4H A;  4E8D A;  5JOW A;  2HWF 3;  1ZRR A;  2R0F A;  3AMM A;  2PFW A;  3MV0 1;  1PK6 C;  5FPA A;  4OUS A;  1C4R A;  4R9B A;  4UFJ A;  4W4Z A;  1REE A;  1VBE 2;  2KR2 A;  4H14 A;  4QX2 A;  3SIT A;  2B42 B;  2WFF 1;  5KHH A;  3SKV A;  5JSR A;  3B5L B;  1S2K A;  3FLP A;  2XVG A;  3ZXL A;  2QQL A;  1VP6 A;  4PBO A;  3PUS A;  4JHT A;  1NCR A;  4CCE A;  5JVV A;  1Y9Q A;  3WNM A;  4OLL A;  5FPX A;  1LOA A;  2DUQ A;  4XYX A;  1VMH A;  4XQW A;  3TAY A;  1DYP A;  3P6B A;  1X7N A;  4C0B A;  2A6Y A;  1JUI A;  1UMH A;  1SPP B;  1H8V A;  3OY8 A;  2D3P A;  3IDE A;  1I5Z A;  5GLZ A;  5JXH A;  1WCD J;  2B5H A;  5B2G B;  2RDN A;  2Z79 A;  4YVS B;  3WDU A;  3SKJ E;  5FBJ A;  1XPW A;  2FCT A;  1VBD 1;  2Y0O A;  2ZGR A;  1AR6 3;  1TQ5 A;  1PNG A;  3WQ7 A;  1NA1 A;  1CIY A;  4XDQ A;  4DMI A;  3BU0 A;  2D6M A;  2O14 A;  2UY8 A;  4HKW A;  5FYS A;  5DUW A;  5C3Q A;  2WUH A;  4CA9 A;  2VCB A;  1PGL 1;  1AJK A;  3RG0 A;  1XB9 A;  2XKP A;  1O4Y A;  1ZBA 1;  2AEZ A;  2GP5 A;  2I74 A;  3D3A A;  4XUT A;  5T5L A;  1CAW B;  2TEP A;  1C3H A;  1R1A 1;  2HWB 1;  1A8M A;  1OPM A;  3J7M A;  4IE4 A;  3VLB B;  3VD4 A;  3ZVX A;  2Q30 A;  2ARA A;  4N8M A;  3S57 A;  3AX4 A;  2VZ3 A;  5LBB A;  2IZW A;  3ZLI A;  1D7P M;  4DXT A;  1JOJ A;  4EZ4 A;  3MLJ A;  1AX1 A;  2E33 A;  4NHY A;  1K12 A;  5HXV A;  4F7Z A;  1DQ0 A;  3D8C A;  2OVU A;  3B7M A;  5FAX A;  1IS5 A;  4XIL A;  1DCS A;  1VB2 A;  3RJ2 X;  3N9L A;  4QM8 A;  5GLV A;  5J98 B;  5A7P A;  3VZM A;  5LRS A;  3O1T A;  3VDA A;  1I5P A;  2IFR A;  2P5B A;  1WZX A;  3K75 B;  4COW A;  1CAV B;  1PNF A;  4YNI A;  3I2I A;  1IS4 A;  2W1U A;  1W8W A;  4CDQ B;  2LW8 A;  4TYS A;  1MZE A;  2WNV B;  5KHG A;  1RED A;  1DQ1 A;  4N43 B;  3N9Q A;  4PLN A;  4V1P A;  3LWC A;  4ES9 A;  3DXT A;  3I2K A;  1T6G C;  1YIP A;  3UGF A;  4OFG A;  1ZA7 A;  2ZGT A;  4JAA A;  4BQW A;  1FMD 3;  4QM9 A;  3GJA A;  4CU7 A;  1WMF A;  4B1M A;  3M70 A;  4UXA A;  1YFW A;  4D7S A;  2RJ2 A;  5JWP A;  2DFC A;  2HWD 3;  2WNV C;  1RHI 3;  3ES1 A;  1RMU 2;  1NT0 A;  1TG7 A;  1W90 A;  2F17 A;  4Q2F A;  3E6C C;  2ARB A;  3P5B A;  1ODM A;  4HL0 A;  4Q4W 1;  5F3I A;  1SLT A;  1PO1 2;  1EV1 3;  1HW5 A;  2A3W A;  1COV 2;  2J42 A;  3ATG A;  3DV8 A;  4AAX A;  3VUO A;  1NCR B;  2JJ6 A;  3AXE A;  3AZY A;  2IVJ A;  3KVB A;  2R04 2;  1CPM A;  2QQW A;  5FKC A;  1GP6 A;  3MI8 A;  3AKR A;  4B4Q A;  4XMI A;  4DS0 A;  3OJB A;  4JCK A;  3RPQ A;  1RUD 2;  2P6C A;  2PYT A;  3EHK A;  5L9B A;  2OA2 A;  4ARX A;  1RUF 2;  4RGK A;  3RYR A;  1G6N A;  4S2F A;  5A3W A;  2GMM A;  3OY8 B;  4BB3 A;  1O3Q A;  3DEM A;  1Z0H A;  4WVM B;  1KGY A;  2B9U A;  2VQ0 A;  1TE1 B;  2X8K A;  1AUY A;  2Y38 A;  4R4X A;  5EWS A;  4JZR A;  4ISQ A;  4NWW A;  5JIA A;  3W59 A;  4AQ2 A;  2DUR A;  1W6P A;  4B4R A;  1FT9 A;  1NA1 B;  5BNQ A;  5B4N A;  1X9T A;  4WM7 C;  3VBR A;  4CCL A;  4FP3 A;  4E27 A;  3B93 A;  4FPK A;  3PJQ A;  1ZBE 2;  4CDX A;  4BQ4 A;  3WQ0 A;  5IVF A;  3LEG A;  1U5I A;  1LTE A;  3IAP A;  5FZH A;  3ME2 A;  1V6I A;  1OH4 A;  2VW0 A;  4HVQ A;  2JDA A;  5CKN A;  4C1W A;  1NQD A;  4AFD A;  1RJ8 A;  1NA1 C;  1ZM1 A;  3U07 A;  5A6Q A;  3AMP A;  3U75 A;  3H9A A;  2ZX2 A;  4J25 A;  4LOT A;  5FZ9 A;  1JBC A;  4YW6 A;  1V0A A;  5FZB A;  3VBO A;  2PTM A;  3MUY 1;  3VZL A;  1WLW A;  4L8Q A;  3WHU A;  3H1W A;  2R49 A;  1UCX A;  3E6D A;  1YC6 1;  3RJR A;  3P3P A;  3C7E A;  1ENX A;  4GKY A;  5I91 A;  2KM2 A;  3VKM A;  2RR1 3;  2IVI B;  4QDS A;  4YZ1 A;  3Q8C A;  3SC7 X;  2QNK A;  2RS5 2;  3MO4 A;  3HIF A;  3NAP A;  5FYM A;  1YFU A;  1ZA4 A;  2C26 A;  1Q43 A;  2E6V A;  2VVE A;  3WP3 A;  4JDO A;  2RMU 3;  2VUL A;  3VDD A;  2BBA A;  3AKP A;  4CPB A;  3BIW E;  2ZAA A;  5LEJ A;  3O0V A;  2W1W A;  4A45 A;  2A6V A;  2ILM A;  4Q0V A;  2CAU A;  1R08 2;  3LD8 A;  4I0A A;  2P3K A;  2QE3 A;  3J8F 3;  4OZO A;  3SEP A;  2YBP A;  4CEY C;  5KXD A;  4Q4X 3;  3OD4 A;  4XMA A;  2FMD A;  3GYD A;  5T5J A;  1NZI A;  4IV1 A;  5KBF A;  1GU3 A;  5B4X A;  3LOI A;  1GP4 A;  1H2N A;  5BV6 A;  4XFG A;  1XNK A;  3KV9 A;  3H50 A;  3FBM A;  3I2O A;  2KD7 A;  5LCW L;  1FOD 3;  5DAV A;  1MVE A;  1IG0 A;  4KWJ A;  3HNM A;  4XUR A;  4QQP A;  3WP6 A;  5DUU A;  1GSL A;  1GV9 A;  1QXR A;  3NWK A;  1WBF A;  4F3J A;  1PGS A;  1FX5 A;  4J1X A;  4QWN A;  1OBN A;  2D98 A;  4Q0U A;  4XJU A;  1XYP A;  1XQN A;  2GZW A;  2K46 A;  2ZGL A;  3NV4 A;  4FCA A;  2IUW A;  3WHT A;  3HT1 A;  3ZN5 A;  1OA4 A;  1QJY 3;  2LUW A;  4RS5 C;  3WEZ A;  1WME A;  1VE0 A;  3C7G A;  1JN2 P;  4YG0 A;  1J84 A;  1W6P B;  2J1E A;  1UPS A;  4O65 A;  3PUI A;  3BI3 A;  1V70 A;  3NV3 A;  3VBR B;  1JU3 A;  5LA2 A;  3TWI A;  4B4P A;  1HB3 A;  4N9H A;  1IPK A;  4URT A;  4CDX B;  4XET A;  4UT5 A;  2OII A;  4MGY E;  2NLR A;  2X05 A;  3WNN A;  1ULO A;  4I0W B;  5K4L A;  2YC4 A;  4LLF A;  3W21 A;  1PO1 1;  3ZKY A;  1JHN A;  1YUD A;  2QZ2 A;  4NPM A;  4QQH A;  1SDW A;  1SEF A;  1QJE A;  4GWM A;  1H1I A;  4IGP A;  4Y33 A;  4YGC A;  5E16 A;  1W6N A;  3VBR C;  5FMB A;  3VBO B;  5IHR A;  1NXD 1;  3WDW A;  4CDX C;  1W9Y A;  3KCC A;  4QKF A;  4JQR A;  3ZKU A;  2Z69 A;  4PI0 A;  1PVC 2;  4LBO A;  1TME 2;  4RR3 C;  1RUF 1;  3SIS A;  4FXG B;  4FPJ A;  5DZG A;  1Q5O A;  1DZR A;  2ZAB A;  3CNA A;  1LEC A;  2YY1 A;  4QU1 A;  1JOP A;  1EY2 A;  3X29 B;  4COZ A;  4AGG A;  1SDD B;  2J22 A;  4MUV A;  3VBO C;  1H2K A;  4QGL A;  3NAP B;  5FP7 A;  1VBC 1;  1WGP A;  4ZXE A;  1DU3 D;  4Y5T A;  5IK8 A;  3HQX A;  4GWJ A;  5LK5 A;  3VDD B;  1JYN A;  2ZEW A;  2ARC A;  4QAW A;  4LJH A;  2VZO A;  1D4M 3;  1UU5 A;  5EZW A;  2Y34 A;  1ZBE 1;  1VLN A;  2J1U A;  2ZKL A;  1UYP A;  3O5S A;  1UIK A;  2Y33 A;  3OPZ A;  2WLP A;  4YG6 A;  3VZN A;  4CDU C;  1PZ7 A;  1GNY A;  1PVX A;  1LAJ A;  1KJL A;  4NVP A;  4DZG A;  5A6Z A;  3HQR A;  3AMH A;  1Z7S 1;  4TLG A;  2VTF A;  3ZXK A;  4JDM A;  1ZZ6 A;  3LCP A;  4IV1 B;  4ASL A;  3HNB M;  1MS5 A;  4S2H A;  2RS1 3;  3MEP A;  1YI9 A;  2Z5W A;  1GOG A;  3I97 A;  1GUI A;  3M3E A;  2XOM A;  4BQ1 A;  4FTB A;  1HRV 3;  2P17 A;  1MS8 A;  2VCA A;  2RDQ A;  4AFB A;  1GOH A;  4X8N A;  4C1X A;  4CCJ A;  2HYX A;  5IVC A;  2VUC A;  3KF3 A;  3SCG A;  2QTW B;  4YZ2 A;  3AP9 A;  4IV1 C;  4N7U A;  2A3Y A;  1IPS A;  2RS5 1;  5FPB A;  1HXS 1;  1HIX A;  5FQ0 A;  5D8A A;  1TZO A;  3CU7 A;  1LB2 A;  3D4K A;  3T4H B;  1AX0 A;  1GWK A;  3LDB A;  2E32 A;  1PIV 2;  1FV2 A;  3ZX7 A;  4AXO A;  5FY4 A;  1C1L A;  4HLT A;  4HMZ A;  5L36 A;  3ETP A;  1W2T A;  5CG9 A;  1ZX5 A;  1VPH A;  3WCR A;  2R07 2;  1R08 1;  1C8M 2;  2WWS A;  3J7H A;  4X8P A;  1REF A;  2VUJ A;  4CXW A;  1J1L A;  3IB3 A;  4CCO A;  3O1V A;  5LA1 A;  1AXZ A;  2VG9 A;  1O4Z A;  4XFI A;  3AZX A;  2DCY A;  1RUI 3;  1BEV 2;  3WG3 A;  5A3L A;  3CL1 A;  4NID A;  2ZX0 A;  2R06 2;  4Q4V 2;  3BUC A;  5F3C A;  4BJ0 A;  1POV 3;  2VW1 A;  1W6N B;  1L7Q A;  5SV8 A;  1QKQ A;  5IK7 A;  1WLC A;  4E4S A;  5G04 L;  2D6P A;  3LEK A;  4AF9 A;  4NPL A;  3WV6 A;  3MW2 A;  1SBF A;  1CR7 A;  1QQP 2;  4YZ4 A;  1QU0 A;  1GP5 A;  1SFN A;  1W9W A;  2BFU S;  4CSW A;  3KHC A;  1SLI A;  1S1A A;  2JG8 A;  3NNL A;  4HN0 A;  1JTZ X;  3Q8F A;  2QVS B;  4UI9 L;  5FZ8 A;  2GP3 A;  1AL2 2;  5FYY A;  1OLR A;  3WIN E;  1WW6 A;  4FSJ A;  4YSF A;  3FLT A;  4QXK A;  2XG3 A;  4Y3O A;  2JKB A;  3MPP G;  2P3Y A;  2XWB B;  2EID A;  5DDJ 2;  1XOY A;  4CEW C;  1XBF A;  4Z82 A;  4CUA A;  4D7T A;  3USS A;  1QY4 A;  1LU2 A;  4QT6 A;  2WWU A;  5F1R A;  3OBT A;  1JOB A;  2DCT A;  2XBO 2;  5BNP A;  2EF6 A;  5CVR A;  2V4V A;  3PDQ A;  3GXU A;  2HWF 1;  4AYU A;  4QPY A;  2EXK A;  1TNF A;  4OYU A;  5FZA A;  4ZZ5 A;  3MF9 A;  1OH3 A;  5FP8 A;  4KI5 M;  2A5Z A;  3AZZ A;  1DF0 A;  3DCQ A;  2ADD A;  5FZI A;  3E6B A;  2RJL A;  4AI9 A;  1TME 1;  2ZHK A;  3K2O A;  1UAI A;  1W8T A;  2P2K A;  4HBN A;  4WZF A;  3ABZ A;  4QQO A;  1NCQ A;  1YQC A;  4XBQ A;  4ITC A;  3GF6 A;  3NL1 A;  1VBA 3;  4B8E A;  2OZJ A;  2FCU A;  3ZOI A;  3J7L A;  1YIF A;  4CUG A;  4QXH A;  5GZG A;  2GN7 A;  4Q4Y 3;  2WZP P;  3JBG 2;  5IAV A;  3VHP A;  5CAZ A;  5FQ0 B;  5D8A B;  2PHW A;  2JIC A;  4XIO A;  2OKX A;  4KU7 A;  4IV3 A;  5F32 A;  5AC9 2;  1Y43 B;  4XAE A;  1KDK A;  3T3Y A;  1OMI A;  1HDK A;  2LM3 A;  3DUI A;  4DUW A;  1RUC 3;  3ILN A;  1Y7B A;  3N9P A;  4RHV 2;  3U14 A;  2VQA A;  3V0A A;  1AF9 A;  1AR6 1;  1KFU L;  1T2X A;  2PHD A;  2WS9 2;  1PO2 2;  3E5X A;  1AYN 2;  4L9B A;  3MIE A;  5FPL A;  2IXJ A;  1SZB A;  5FUP A;  2PLV 3;  5LY2 A;  5EHD A;  3EYP A;  5J37 A;  2WZR 2;  5FZF A;  3BOD A;  2VNG A;  4IUG A;  3VKF C;  2VOW A;  3THP A;  1ZRD A;  3L2H A;  3LDK A;  3U11 A;  1AYM 3; 
#chains in the Genus database with same CATH homology
 3NQH A;  3HEI A;  2DCJ A;  4ARY A;  2ID4 A;  2WYS A;  2X09 A;  1OT5 A;  1PMJ X;  2W3J A;  2W9X A;  1IQD C;  1K42 A;  3IDA A;  3ZM8 A;  3GGL A;  2W46 A;  3LPG A;  4A41 A;  2XON A;  3WF0 A;  2QQK A;  3T0A A;  3VD5 A;  1JZ7 A;  3I2H A;  1OF4 A;  1US2 A;  5JR2 A;  2ZEX A;  3OEA A;  2VZS A;  4HG6 B;  1UWW A;  3U37 A;  4ZY9 A;  1UY0 A;  1SG3 A;  3C8X A;  2W91 A;  4XUO A;  3T2Q A;  4DXS A;  4CU6 A;  5LA0 A;  3C7H A;  2VL4 A;  2X10 A;  4BXS V;  3THD A;  2LS6 A;  5DMY A;  1H6X A;  2QQO A;  2QQN A;  3OG2 A;  2ZXQ A;  4BK5 A;  5JXI A;  4A3Z A;  3WSO A;  3AC0 A;  4LQR A;  2VMC A;  2Y6J A;  4MGS A;  1GOF A;  3UNP A;  2VCC A;  3I2J A;  5DN2 A;  3CZJ A;  3DYM A;  4M4R A;  4FI9 A;  4CUC A;  3OGV A;  5I0D A;  3K46 A;  1PX3 A;  1DYO A;  3T0B A;  3P1I A;  3PUH A;  4BDV B;  2VZP A;  2EIB A;  3DYO A;  2C4X A;  3NJX A;  3WNL A;  4CU9 A;  3BN6 A;  1F4A A;  3ECQ A;  4PF1 A;  1UY2 A;  2WN2 A;  1UXZ A;  1P8J A;  2R7E B;  4A42 A;  1EUU A;  2YB7 A;  5EJ1 B;  5HPO A;  4E8D A;  5EIY B;  1F4H A;  1KEX A;  1CZT A;  2ZEZ A;  3MV0 1;  4QPW A;  2J7M A;  4QB2 A;  3W5N A;  4ET7 A;  4E8C A;  4W4Z A;  4QX2 A;  3SKV A;  4JHZ A;  4DEV A;  2VQU A;  2QQL A;  2WAB A;  1O59 A;  3THC A;  3WNM A;  3FHA A;  3III A;  3NJV A;  2PQS A;  3P6B A;  2B9V A;  1NKG A;  3I3B A;  1UMH A;  4P00 B;  1XC6 A;  3VD9 A;  2WZE A;  3A23 A;  5JXH A;  2VMD A;  1W8N A;  3SKJ E;  3EB7 A;  1LNS A;  1K3I A;  1XPW A;  3K4A A;  3F2Z A;  4GZ9 A;  3FHQ A;  1JZ3 A;  3LE0 A;  1CIY A;  2WUH A;  1W8O A;  2VCB A;  2WAO A;  2Z4F A;  3VD3 A;  3D3A A;  4XUT A;  3T2P A;  2W1S A;  2ZEY A;  3VD4 A;  3CKH A;  3SEE A;  1GMM A;  2WN3 A;  2VZ3 A;  3GM8 A;  1D7P M;  4DXT A;  1PMH X;  3WNO A;  2BGO A;  4DXR A;  2E33 A;  1K12 A;  3ACH A;  3VDB A;  3VDA A;  1I5P A;  5JMO A;  1UYY A;  3K75 B;  1SHW B;  2VZQ A;  3DEC A;  3I2I A;  1K45 A;  2YFU A;  3T0D A;  2W1U A;  4KMQ A;  4D8M A;  2CDP A;  3WQB A;  3CIH A;  2LW8 A;  1W99 A;  2BGP A;  2W1Q A;  1YQ2 A;  2Y8K A;  3I2K A;  2RVA A;  3GDB A;  2W5F A;  2W95 A;  3IAQ A;  4MAD A;  2J1V A;  2Y6L A;  4CU7 A;  5J1X A;  4RYD A;  5JXJ A;  1UY4 A;  3WF2 A;  2RJ2 A;  2Y6H A;  4YPJ A;  2W87 A;  3MBW A;  4TTG A;  1TG7 A;  2W47 A;  2VME A;  4OUE A;  4JKL A;  5A1A A;  4W50 A;  4AAX A;  1US3 A;  1NUK A;  1JYV A;  3CQO A;  4LPL A;  3OGR A;  1OD3 A;  5C70 A;  4ARX A;  4UOJ A;  2JE8 A;  5IFT A;  3K4D A;  1KGY A;  1CX1 A;  1NAE A;  3I3D A;  5B4N A;  1JZ8 A;  4QDQ A;  3WF4 A;  1UYZ A;  2WO3 A;  2CDO A;  2XQX A;  3LEG A;  2JKX A;  3IAP A;  1UXX X;  1OH4 A;  1W0N A;  5EJZ B;  2JDA A;  4QX1 A;  5CYY A;  2WAA A;  2VZT A;  5CZK A;  1O8P A;  3MUY 1;  2XHN A;  3UES A;  5DQ0 A;  1R64 A;  3C7E A;  2QQJ A;  3ACG A;  4QDS A;  2W92 A;  3DYP A;  2WBK A;  3HOB A;  1CZS A;  3MO4 A;  1CZV A;  2C26 A;  2J1A A;  3K4Z A;  3T2O A;  3WNK A;  2L9L A;  1TVG A;  4QB6 A;  4CU8 A;  2BBA A;  1H6Y A;  4CVU A;  4QB1 A;  1EUT A;  2WO2 A;  2W1W A;  4A45 A;  4CUB A;  3SEP A;  4OZO A;  2QQI A;  3HJR A;  1GU3 A;  4OMD A;  5B4X A;  2WDB A;  2KD7 A;  4P5Y A;  3WF1 A;  1ULP A;  5LCW L;  2VZU A;  4XUR A;  3HNM A;  3FN9 A;  3OEB A;  1UY3 A;  1UX7 A;  4DEQ A;  1BHG A;  1JU4 A;  3LEI A;  3LPF A;  3A21 A;  1OF3 A;  1GQP A;  1UZ0 A;  3WEZ A;  2YFZ A;  3C7G A;  4A4A A;  1J84 A;  2J1E A;  1RYY A;  3PUI A;  1JU3 A;  5LA2 A;  3A7Q A;  2VJX A;  3ACI A;  3NRU A;  5C7G A;  3ACF A;  3MV1 1;  2X05 A;  3WNN A;  1ULO A;  1UMI A;  2Y64 A;  3I2G A;  2YC4 A;  4P08 A;  3VDC A;  4A6O A;  4QX3 A;  3FL7 A;  2VC9 A;  4KWU A;  4P02 B;  5IHR A;  5FUI A;  4L0P A;  4Z2A A;  2QQM A;  1JZ2 A;  3HN3 A;  3WNP A;  1SDD B;  2J22 A;  4LHS A;  4ZXE A;  2EIE A;  1JZ6 A;  4GWJ A;  1JYN A;  2ZEW A;  4QAW A;  2VZO A;  2V72 A;  4RN5 A;  5C71 A;  4A44 A;  2E31 A;  2J1U A;  4MOA A;  2WZ8 A;  1O8S A;  2VM9 A;  2BER A;  1GNY A;  2J1S A;  4XVH A;  3NNG A;  1JYX A;  4D0Q A;  1JYW A;  3OGS A;  2J1R A;  4JX0 A;  2VTF A;  2VOT A;  5F7U A;  2YG0 A;  3HNB M;  3A22 A;  3OB8 A;  4M4P A;  3I97 A;  1GOG A;  1GUI A;  3BGA A;  2XOM A;  3CDZ B;  4JKK A;  3T08 A;  1DP0 A;  2VCA A;  5IFP A;  1GOH A;  2VZR A;  2HYX A;  4XUP A;  2VMF A;  2V5D A;  2VZ1 A;  5DPN A;  1WCQ A;  2YC2 A;  2E32 A;  5G05 L;  3HNY M;  2E26 A;  3ETP A;  4ZZ8 A;  1L7R A;  3J7H A;  2B4K A;  3IB3 A;  5JXG A;  5LA1 A;  2JD9 A;  2BZD A;  3WF3 A;  2ORZ A;  4PQQ A;  2Y6K A;  4QX0 A;  4BJ0 A;  3UET A;  1L7Q A;  2RV9 A;  4TXW A;  1XNT A;  3E1F 1;  5G04 L;  3LEK A;  3I3E A;  1JZ4 A;  3HPN A;  2VQT A;  3K77 A;  2ORX A;  1DLC A;  5JUV A;  2QBX A;  4JKM A;  1W9W A;  2EIC A;  1J83 A;  3MUZ 1;  4UI9 L;  3T09 A;  4PT6 A;  2C9K A;  5HXM A;  2EID A;  3W5M A;  4CUA A;  1W9T A;  5IJR A;  2V4V A;  3GXU A;  4ZZ5 A;  4OYU A;  4QDR A;  1MPX A;  1UY1 A;  4KI5 M;  4DUX A;  3LQC A;  5IYY A;  4XZU G;  3CZU A;  3ABZ A;  1JHJ A;  4XUQ A;  1XNA A;  4GWI A;  2WO1 A;  4OMC A;  2VZV A;  3C7F A;  4UAP A;  2W94 A;  1WKY A;  2OKX A;  3I2F A;  2WQ8 A;  1JI6 A;  3JXS A;  4DUV A;  4W8J A;  4BK4 A;  4DUW A;  3OBA A;  4MO3 M;  3CMG A;  4LKS A;  1UYX A;  2Y6G A;  1PX4 A;  1T2X A;  2J1T A;  1JZ5 A;  2VO5 A;  4MGQ A;  2VR4 A;  4AG4 A;  2DCK A;  3C7O A;  4XUN A;  3EYP A;  1NX9 A;  4IUG A;  1W9S A;  2DDU A;  3VD7 A;  2HLE A;  1HN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...