3HO5A

Crystal structure of hedgehog-interacting protein (hhip) and sonic hedgehog (shh) complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
457
structure length
446
Chain Sequence
HNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNRWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTPEVFAHGLHDPGRCAVDRHNLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Hedgehog-interacting protein
total genus 95
structure length 446
sequence length 457
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07995 GSDH Glucose / Sorbosone dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3ho5A02
1XFEA 1KIGL 1APOA 1KLOA 1M1XB 1MQ5L 2I9BA 3N8YB 5K0HB 1RFNB 3LAQA 5JBAE 1IQML 1NPEB 4Z0LA 1MOXC 4G1MB 1JV2B 4NA9L 1B9WA 4COXA 2Y5GL 1APQA 3F1SB 2DDUA 2W3IB 3QCWA 2BQ6A 3OLTA 1ATEA 3TK5B 4RS0A 1C5MF 3QH0A 4ZH8B 2RA0L 1EZQB 2XBVL 3EGFA 2BQWA 1NFWB 1DVAL 2KB9A 2XC5L 1HAFA 2XC0L 3BT2A 1EPJA 3F6UL 3CS7L 1COUA 3N8YA 2K2TA 1K36A 4O1ZA 3ZYIB 2PHBB 4JZFL 1Z6EL 3H5CB 2UWLB 1Q4GA 4OTJA 3ENSA 1YGCL 4OTYA 3TH3L 4RRXA 1IQKL 2RNLA 2MHPA 4ISHL 2Y38A 4NGAL 1YUFA 5E8DA 2WG3C 2BOUA 4Y7BB 3LTFB 3ZYJB 5CKQA 3SOVA 3KQDL 2B7DL 2H9EL 2VWLL 3QMOA 1NFUB 1URKA 1CX2A 2WPKE 4CSYA 3U73A 5JB8E 4ZAEB 1JBUL 2VJ3A 1NQLB 5JB9E 2BOXA 5KN5C 1EBVA 1YUKB 1G2LB 4Y76B 1TOZA 1IQGL 1FE2A 2VWOL 1EMNA 1P9JA 2FD6A 3LTGD 3GISX 1WHFA 1CCFA 2EI8B 3KQCL 5FDQA 3P5BL 2BQ7A 3CENL 4YT6L 2VVUL 2Y80B 1DIYA 3PGHA 3KK6A 2W2OE 1IVOC 1Z6CA 1GK5A 2ADXA 1ADXA 4JZEL 1X7AL 3BPSE 2AYLA 4D0EA 5IKQA 1J9CL 5CISA 1EPIA 1O5DL 1L5GB 2Q1JB 4LMFA 2MGRA 1I0UA 2WPHE 5L2YL 4X8TL 5JBBE 2W2ME 2Y81B 1BF9A 4O02B 3LN0A 4E1GA 4ZXXL 1ATBA 4XBMA 2JKHL 1G1SA 3HS7A 4BXSA 2PUQL 1PRHA 4BTIA 1WHEA 2WPJE 1UZQA 2P93L 4AQTA 1PFXL 3OLUA 2P95L 2BZ6L 1LPKA 4Z6AL 1LMJA 5IKRA 2WFXB 3HO3A 2WYGB 3M36L 2WG4B 1NFYB 1EPHA 4NG9L 1HT8A 2J95B 3NTGA 1NFXB 1DDXA 3SW2A 1CCVA 3CFWA 1ATAA 2P3UA 1PTHA 1YO8A 4JYVL 1IQEL 2WPME 2Y7XB 1CVUA 5F1AA 1UZKA 4ZXYL 1G1RA 2XBWL 3GCWE 5EGMB 2P3FL 2P26A 3Q3KB 2D1JB 1ZAQA 2KV4A 1HT5A 2P94L 3KQBL 4X8UL 3Q7DA 1IQLL 5L30L 1IQJL 3HO4A 1G2MB 3FCSB 5JVZA 2FZZL 2NPRA 3TGFA 3TBDA 4RRZA 1XKBA 2PR3B 3HO5A 2VH0B 4D0FA 3FFGL 4CUFA 2GD4A 3U7UG 3CA7A 2FLGA 4D90A 2XBXL 3MDLA 2Y5HL 4RUTA 4BTUA 2W3KB 1XKAL 4CUEA 2VWNL 1G1TA 2VH6B 2W2PE 2Y82B 4BDWA 2XBYL 1HX2A 2EI7B 1IGXA 1ATDA 2W2NE 4XL1A 1FSBA 1LPGA 1IQHL 4C16A 3NJPC 2BOHA 1TLEA 2EI6B 1CQEA 1IQIL 2P3TA 1EAIC 4YZUB 2J4IB 1FFMA 1HZ8A 1LQDA 4JYUL 1V3XB 3LC3B 2WPIE 5JVYA 4X8VL 1UZPA 1P0SL 4LORA 1W7XL 1PGEA 1EQHA 2FLRL 3C9AC 3N8WA 1EMOA 1F7EA 1IP0A 1FF7A 2WPLE 3MQEA 1CVWL 3TK6B 3TZIA 5KIRA 4BXWA 1TPGA 4M10A 3V65B 3N8ZA 1HAEA 4JZDL 1NT0A 1IOXA 3SOQA 1AUTL 1IOEL 2P3FN 2P28B 2TGFA 4M11A 2J38B 1L3YA 1LPZA 3IITB 1W8BL 1A3PA 3HS5A 3NT1A 1F0SB 2I9AA 1YUGA 1G1QA 2VVCK 4MMZB 5IKTA 3DEMA 3KRKA 2J94B 2UWOB 1MQ6L 4Y79B 4Y71B 1U8CB 2G00L 3ELAL 4MMYB 2KL7A 5IKVA 3NTBA 3RR3A 6COXA 4BTTA 2BMGA 3V64C 1SZBA 3HPTA 1IQFL 4X8SL 5I46L 1F0RB 1HREA 2WYJB 1EPGA 5CKMA 1KLJL 2Y7ZB 1UZJA 2BOKL 2YGOA 4BDXA 4YT7L 2J34B 3LC5B 2J2UB 1U67A 1XDTR 5JW1A 2CJIB 2XC4L 5CKNA 1NZIA 3N8WB 2FLBL 1IGZA 2K2SB 2P16L 4MMXB 1HJ7A 2W2QE 4A7IA 2VWMK 2OYEP 1KLIL 3ASIA 1PXXA 3N8VA 1WU1B 2OYUP 4RRYA 1IQNL 1EGFA 3M37L 4FM5A 1F7MA 1OB1C 2W26B 4ZHAB 2VVVL 2M74A 1FAXL 3K9XA 4PH9A 4TGFA 3HS6A 3IJEB 3R05A 1EQGA 2YGPA 5F19A 4Y7AB 2F9BL 3ZYGA 1JL9A 3KL6B 1HCGB 2Y5FL 2WFTA 1KSNB 3FBYA 2BO2A 3KCGL 3LN1A 3N8XA 4XLWA 3POYA 2MGPA 1FAKL 1DX5I 1DQBA 4CUDA 4Y6DB 2W86A 1N7DA 1IJQA 5COXA 1QFKL 1K37A 2UWPB 4RRWA 5JBCE 1CEJA 3GCXE 3SOBB 3LIWB 1FJSL 1HRFA 2RHPA 1N1IA 4Z0KB 5L2ZL 3BT1A 3KQEL 4ISIL
chains in the Genus database with same CATH superfamily
1XFEA 1KIGL 2BT8A 1APOA 1KLOA 1M1XB 1MQ5L 2I9BA 3N8YB 4GU3A 5K0HB 1RFNB 3LAQA 5JBAE 1IQML 1NPEB 4Z0LA 1MOXC 4G1MB 1JV2B 4NA9L 1B9WA 4COXA 2Y5GL 1APQA 3F1SB 2DDUA 2W3IB 4GU4A 3QCWA 2BQ6A 3OLTA 1ATEA 2KNIA 3TK5B 4RS0A 1KKEA 1C5MF 3QH0A 4ZH8B 2RA0L 1EZQB 2XBVL 3EGFA 2BQWA 1NFWB 2JJLA 1DVAL 2KB9A 2XC5L 1HAFA 2XC0L 3BT2A 1EPJA 3F6UL 3CS7L 1COUA 3N8YA 2K2TA 1K36A 4O1ZA 3ZYIB 2PHBB 4JZFL 1Z6EL 3H5CB 2UWLB 1Q4GA 4OTJA 3ENSA 1YGCL 4OTYA 3TH3L 4RRXA 1IQKL 2RNLA 2MHPA 4ISHL 2Y38A 4NGAL 1YUFA 2BT7A 5E8DA 2WG3C 2BOUA 4Y7BB 3LTFB 3ZYJB 5CKQA 3SOVA 3KQDL 2B7DL 2H9EL 2VWLL 3QMOA 1NFUB 1URKA 2VRSA 1CX2A 2WPKE 4CSYA 3U73A 5JB8E 4ZAEB 1JBUL 2VJ3A 1NQLB 5JB9E 2BOXA 5KN5C 1EBVA 1YUKB 1G2LB 2BSFA 1TOZA 4Y76B 1IQGL 1FE2A 2VWOL 1EMNA 1P9JA 2FD6A 3LTGD 1QIUA 3GISX 1WHFA 1CCFA 2EI8B 3KQCL 5FDQA 3P5BL 2BQ7A 3CENL 4YT6L 2VVUL 2Y80B 1DIYA 3PGHA 3KK6A 2W2OE 1IVOC 1Z6CA 1GK5A 2ADXA 1ADXA 4JZEL 1X7AL 3BPSE 2AYLA 4D0EA 5IKQA 1J9CL 5CISA 1EPIA 1O5DL 1L5GB 2Q1JB 4LMFA 2MGRA 1I0UA 2WPHE 5L2YL 4X8TL 5JBBE 2W2ME 2Y81B 1BF9A 4O02B 3LN0A 4E1GA 4ZXXL 1ATBA 4XBMA 2JKHL 1G1SA 3HS7A 4BXSA 2PUQL 1PRHA 4BTIA 1WHEA 2WPJE 1UZQA 2P93L 4AQTA 1PFXL 3OLUA 2P95L 2BZ6L 1LPKA 4Z6AL 1LMJA 5IKRA 2WFXB 3HO3A 2WYGB 3M36L 2H9EC 2WG4B 1NFYB 1EPHA 4NG9L 1HT8A 2J95B 3NTGA 1NFXB 1DDXA 3SW2A 1CCVA 3CFWA 1V1IA 1ATAA 2P3UA 1PTHA 1YO8A 4JYVL 1IQEL 2WPME 4A94C 2Y7XB 1CVUA 5F1AA 1UZKA 4ZXYL 1G1RA 2XBWL 3GCWE 5EGMB 2P3FL 2P26A 3Q3KB 2D1JB 1ZAQA 2KV4A 1HT5A 2P94L 3KQBL 4X8UL 3Q7DA 1IQLL 5L30L 1IQJL 3HO4A 1G2MB 3FCSB 5JVZA 2FZZL 2NPRA 3TGFA 3TBDA 4RRZA 1XKBA 2PR3B 3HO5A 2VH0B 4D0FA 3FFGL 1LK9A 4CUFA 2GD4A 3U7UG 1V1HA 3CA7A 2FLGA 4D90A 2XBXL 3MDLA 2Y5HL 4RUTA 4BTUA 2W3KB 1XKAL 4CUEA 2VWNL 1G1TA 2VH6B 2W2PE 2Y82B 4BDWA 2XBYL 1HX2A 2EI7B 1IGXA 1ATDA 2W2NE 4XL1A 1FSBA 1LPGA 1IQHL 4C16A 3NJPC 2BOHA 1TLEA 2EI6B 1CQEA 1IQIL 2P3TA 1EAIC 4YZUB 2J4IB 1FFMA 1HZ8A 1LQDA 4JYUL 1V3XB 3LC3B 2WPIE 5JVYA 4X8VL 1UZPA 1P0SL 4LORA 1W7XL 1PGEA 2YGQA 1EQHA 2FLRL 3C9AC 3N8WA 1EMOA 1F7EA 1IP0A 1FF7A 2WPLE 3MQEA 1CVWL 3TK6B 3TZIA 5KIRA 4BXWA 1TPGA 2WZPP 4M10A 3V65B 3N8ZA 1HAEA 4JZDL 1NT0A 1IOXA 3SOQA 1AUTL 1IOEL 2P3FN 2P28B 2TGFA 4M11A 2J38B 1L3YA 1LMMA 1LPZA 3IITB 1W8BL 1A3PA 3HS5A 3NT1A 1F0SB 2I9AA 1YUGA 2VVCK 1G1QA 2HORA 4MMZB 5IKTA 3DEMA 3KRKA 2J94B 2UWOB 1MQ6L 4Y79B 4Y71B 1U8CB 2G00L 3ELAL 4MMYB 2KL7A 5IKVA 3NTBA 3RR3A 6COXA 4BTTA 2BMGA 3V64C 1SZBA 3HPTA 1IQFL 4X8SL 5I46L 1F0RB 1HREA 2WYJB 1EPGA 5CKMA 1KLJL 2Y7ZB 1UZJA 2BOKL 2YGOA 4BDXA 4YT7L 2J34B 3LC5B 2J2UB 3S6XA 1U67A 1XDTR 5JW1A 2CJIB 2XC4L 5CKNA 2HOXA 1NZIA 3N8WB 2FLBL 1IGZA 2K2SB 2P16L 4MMXB 1HJ7A 2W2QE 4A7IA 2VWMK 2OYEP 1KLIL 3ASIA 1PXXA 3N8VA 1WU1B 2OYUP 4RRYA 1IQNL 1EGFA 3M37L 4FM5A 1F7MA 1OB1C 2W26B 4ZHAB 2VVVL 2M74A 1FAXL 3K9XA 4PH9A 4TGFA 3HS6A 3IJEB 3R05A 1EQGA 2YGPA 5F19A 4Y7AB 2F9BL 3ZYGA 1JL9A 3KL6B 1HCGB 2Y5FL 2WFTA 1KSNB 3FBYA 2BO2A 3KCGL 3LN1A 3N8XA 4XLWA 3POYA 2MGPA 1FAKL 1DX5I 1DQBA 4CUDA 4Y6DB 2W86A 1N7DA 1IJQA 5COXA 1QFKL 1K37A 2UWPB 4RRWA 5JBCE 1CEJA 3GCXE 3SOBB 3LIWB 1FJSL 1HRFA 2RHPA 1N1IA 4Z0KB 5L2ZL 3BT1A 3KQEL 4ISIL
chains in the Genus database with same CATH topology
1XFEA 1KIGL 1APOA 1KLOA 1M1XB 1MQ5L 2I9BA 3N8YB 5K0HB 1RFNB 3LAQA 5JBAE 1IQML 1NPEB 4Z0LA 1MOXC 4G1MB 1JV2B 4NA9L 1B9WA 4COXA 2Y5GL 1APQA 3F1SB 2DDUA 2W3IB 3QCWA 2BQ6A 3OLTA 1ATEA 2KNIA 3TK5B 4RS0A 1C5MF 3QH0A 4ZH8B 2RA0L 1EZQB 2XBVL 3EGFA 2BQWA 1NFWB 1DVAL 2KB9A 2XC5L 1HAFA 2XC0L 3BT2A 1EPJA 3F6UL 3CS7L 1COUA 3N8YA 2K2TA 1K36A 4O1ZA 3ZYIB 2PHBB 4JZFL 1Z6EL 3H5CB 2UWLB 1Q4GA 4OTJA 3ENSA 1YGCL 4OTYA 3TH3L 4RRXA 1IQKL 2RNLA 2MHPA 4ISHL 2Y38A 4NGAL 1YUFA 5E8DA 2WG3C 2BOUA 4Y7BB 3LTFB 3ZYJB 5CKQA 3SOVA 3KQDL 2B7DL 2H9EL 2VWLL 3QMOA 1NFUB 1URKA 1CX2A 2WPKE 4CSYA 3U73A 5JB8E 4ZAEB 1JBUL 2VJ3A 1NQLB 5JB9E 2BOXA 5KN5C 1EBVA 1YUKB 1G2LB 4Y76B 1TOZA 1IQGL 1FE2A 2VWOL 1EMNA 1P9JA 2FD6A 3LTGD 3GISX 1WHFA 1CCFA 2EI8B 3KQCL 5FDQA 3P5BL 2BQ7A 3CENL 4YT6L 2VVUL 2Y80B 1DIYA 3PGHA 3KK6A 2W2OE 1IVOC 1Z6CA 1GK5A 2ADXA 1ADXA 4JZEL 1X7AL 3BPSE 2AYLA 4D0EA 5IKQA 1J9CL 5CISA 1EPIA 1O5DL 1L5GB 2Q1JB 4LMFA 2MGRA 1I0UA 2WPHE 5L2YL 4X8TL 5JBBE 2W2ME 2Y81B 1BF9A 4O02B 3LN0A 4E1GA 4ZXXL 1ATBA 4XBMA 2JKHL 1G1SA 3HS7A 4BXSA 2PUQL 1PRHA 4BTIA 1WHEA 2WPJE 1UZQA 2P93L 4AQTA 1PFXL 3OLUA 2P95L 2BZ6L 1LPKA 4Z6AL 1LMJA 5IKRA 2WFXB 3HO3A 2WYGB 3M36L 2H9EC 2WG4B 1NFYB 1EPHA 4NG9L 1HT8A 2J95B 3NTGA 1NFXB 1DDXA 3SW2A 1CCVA 3CFWA 1ATAA 2P3UA 1PTHA 1YO8A 4JYVL 1IQEL 2WPME 4A94C 2Y7XB 1CVUA 5F1AA 1UZKA 4ZXYL 1G1RA 2XBWL 3GCWE 5EGMB 2P3FL 2P26A 3Q3KB 2D1JB 1ZAQA 2KV4A 1HT5A 2P94L 3KQBL 4X8UL 3Q7DA 1IQLL 5L30L 1IQJL 3HO4A 1G2MB 3FCSB 5JVZA 2FZZL 2NPRA 3TGFA 3TBDA 4RRZA 1XKBA 2PR3B 3HO5A 2VH0B 4D0FA 3FFGL 4CUFA 2GD4A 3U7UG 3CA7A 2FLGA 4D90A 2XBXL 3MDLA 2Y5HL 4RUTA 4BTUA 2W3KB 1XKAL 4CUEA 2VWNL 1G1TA 2VH6B 2W2PE 2Y82B 4BDWA 2XBYL 1HX2A 2EI7B 1IGXA 1ATDA 2W2NE 4XL1A 1FSBA 1LPGA 1IQHL 4C16A 3NJPC 2BOHA 1TLEA 2EI6B 1CQEA 1IQIL 2P3TA 1EAIC 4YZUB 2J4IB 1FFMA 1HZ8A 1LQDA 4JYUL 1V3XB 3LC3B 2WPIE 5JVYA 4X8VL 1UZPA 1P0SL 4LORA 1W7XL 1PGEA 2YGQA 1EQHA 2FLRL 3C9AC 3N8WA 1EMOA 1F7EA 1IP0A 1FF7A 2WPLE 3MQEA 1CVWL 3TK6B 3TZIA 5KIRA 4BXWA 1TPGA 2WZPP 4M10A 3V65B 3N8ZA 1HAEA 4JZDL 1NT0A 1IOXA 3SOQA 1AUTL 1IOEL 2P3FN 2P28B 2TGFA 4M11A 2J38B 1L3YA 1LMMA 1LPZA 3IITB 1W8BL 1A3PA 3HS5A 3NT1A 1F0SB 2I9AA 1YUGA 1G1QA 2VVCK 4MMZB 5IKTA 3DEMA 3KRKA 2J94B 2UWOB 1MQ6L 4Y79B 4Y71B 1U8CB 2G00L 3ELAL 4MMYB 2KL7A 5IKVA 3NTBA 3RR3A 6COXA 4BTTA 2BMGA 3V64C 1SZBA 3HPTA 1IQFL 4X8SL 5I46L 1F0RB 1HREA 2WYJB 1EPGA 5CKMA 1KLJL 2Y7ZB 1UZJA 2BOKL 2YGOA 4BDXA 4YT7L 2J34B 3LC5B 2J2UB 3S6XA 1U67A 1XDTR 5JW1A 2CJIB 2XC4L 5CKNA 1NZIA 3N8WB 2FLBL 1IGZA 2K2SB 2P16L 4MMXB 1HJ7A 2W2QE 4A7IA 2VWMK 2OYEP 1KLIL 3ASIA 1PXXA 3N8VA 1WU1B 2OYUP 4RRYA 1IQNL 1EGFA 3M37L 4FM5A 1F7MA 1OB1C 2W26B 4ZHAB 2VVVL 2M74A 1FAXL 3K9XA 4PH9A 4TGFA 3HS6A 3IJEB 3R05A 1EQGA 2YGPA 5F19A 4Y7AB 2F9BL 3ZYGA 1JL9A 3KL6B 1HCGB 2Y5FL 2WFTA 1KSNB 3FBYA 2BO2A 3KCGL 3LN1A 3N8XA 4XLWA 3POYA 2MGPA 1FAKL 1DX5I 1DQBA 4CUDA 4Y6DB 2W86A 1N7DA 1IJQA 5COXA 1QFKL 1K37A 2UWPB 4RRWA 5JBCE 1CEJA 3GCXE 3SOBB 3LIWB 1FJSL 1HRFA 2RHPA 1N1IA 4Z0KB 5L2ZL 3BT1A 3KQEL 4ISIL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFE A;  1KIG L;  1APO A;  1KLO A;  1M1X B;  1MQ5 L;  2I9B A;  3N8Y B;  5K0H B;  1RFN B;  3LAQ A;  5JBA E;  1IQM L;  1NPE B;  4Z0L A;  1MOX C;  4G1M B;  1JV2 B;  4NA9 L;  1B9W A;  4COX A;  2Y5G L;  1APQ A;  3F1S B;  2DDU A;  2W3I B;  3QCW A;  2BQ6 A;  3OLT A;  1ATE A;  3TK5 B;  4RS0 A;  1C5M F;  3QH0 A;  4ZH8 B;  2RA0 L;  1EZQ B;  2XBV L;  3EGF A;  2BQW A;  1NFW B;  1DVA L;  2KB9 A;  2XC5 L;  1HAF A;  2XC0 L;  3BT2 A;  1EPJ A;  3F6U L;  3CS7 L;  1COU A;  3N8Y A;  2K2T A;  1K36 A;  4O1Z A;  3ZYI B;  2PHB B;  4JZF L;  1Z6E L;  3H5C B;  2UWL B;  1Q4G A;  4OTJ A;  3ENS A;  1YGC L;  4OTY A;  3TH3 L;  4RRX A;  1IQK L;  2RNL A;  2MHP A;  4ISH L;  2Y38 A;  4NGA L;  1YUF A;  5E8D A;  2WG3 C;  2BOU A;  4Y7B B;  3LTF B;  3ZYJ B;  5CKQ A;  3SOV A;  3KQD L;  2B7D L;  2H9E L;  2VWL L;  3QMO A;  1NFU B;  1URK A;  1CX2 A;  2WPK E;  4CSY A;  3U73 A;  5JB8 E;  4ZAE B;  1JBU L;  2VJ3 A;  1NQL B;  5JB9 E;  2BOX A;  5KN5 C;  1EBV A;  1YUK B;  1G2L B;  4Y76 B;  1TOZ A;  1IQG L;  1FE2 A;  2VWO L;  1EMN A;  1P9J A;  2FD6 A;  3LTG D;  3GIS X;  1WHF A;  1CCF A;  2EI8 B;  3KQC L;  5FDQ A;  3P5B L;  2BQ7 A;  3CEN L;  4YT6 L;  2VVU L;  2Y80 B;  1DIY A;  3PGH A;  3KK6 A;  2W2O E;  1IVO C;  1Z6C A;  1GK5 A;  2ADX A;  1ADX A;  4JZE L;  1X7A L;  3BPS E;  2AYL A;  4D0E A;  5IKQ A;  1J9C L;  5CIS A;  1EPI A;  1O5D L;  1L5G B;  2Q1J B;  4LMF A;  2MGR A;  1I0U A;  2WPH E;  5L2Y L;  4X8T L;  5JBB E;  2W2M E;  2Y81 B;  1BF9 A;  4O02 B;  3LN0 A;  4E1G A;  4ZXX L;  1ATB A;  4XBM A;  2JKH L;  1G1S A;  3HS7 A;  4BXS A;  2PUQ L;  1PRH A;  4BTI A;  1WHE A;  2WPJ E;  1UZQ A;  2P93 L;  4AQT A;  1PFX L;  3OLU A;  2P95 L;  2BZ6 L;  1LPK A;  4Z6A L;  1LMJ A;  5IKR A;  2WFX B;  3HO3 A;  2WYG B;  3M36 L;  2WG4 B;  1NFY B;  1EPH A;  4NG9 L;  1HT8 A;  2J95 B;  3NTG A;  1NFX B;  1DDX A;  3SW2 A;  1CCV A;  3CFW A;  1ATA A;  2P3U A;  1PTH A;  1YO8 A;  4JYV L;  1IQE L;  2WPM E;  2Y7X B;  1CVU A;  5F1A A;  1UZK A;  4ZXY L;  1G1R A;  2XBW L;  3GCW E;  5EGM B;  2P3F L;  2P26 A;  3Q3K B;  2D1J B;  1ZAQ A;  2KV4 A;  1HT5 A;  2P94 L;  3KQB L;  4X8U L;  3Q7D A;  1IQL L;  5L30 L;  1IQJ L;  3HO4 A;  1G2M B;  3FCS B;  5JVZ A;  2FZZ L;  2NPR A;  3TGF A;  3TBD A;  4RRZ A;  1XKB A;  2PR3 B;  3HO5 A;  2VH0 B;  4D0F A;  3FFG L;  4CUF A;  2GD4 A;  3U7U G;  3CA7 A;  2FLG A;  4D90 A;  2XBX L;  3MDL A;  2Y5H L;  4RUT A;  4BTU A;  2W3K B;  1XKA L;  4CUE A;  2VWN L;  1G1T A;  2VH6 B;  2W2P E;  2Y82 B;  4BDW A;  2XBY L;  1HX2 A;  2EI7 B;  1IGX A;  1ATD A;  2W2N E;  4XL1 A;  1FSB A;  1LPG A;  1IQH L;  4C16 A;  3NJP C;  2BOH A;  1TLE A;  2EI6 B;  1CQE A;  1IQI L;  2P3T A;  1EAI C;  4YZU B;  2J4I B;  1FFM A;  1HZ8 A;  1LQD A;  4JYU L;  1V3X B;  3LC3 B;  2WPI E;  5JVY A;  4X8V L;  1UZP A;  1P0S L;  4LOR A;  1W7X L;  1PGE A;  1EQH A;  2FLR L;  3C9A C;  3N8W A;  1EMO A;  1F7E A;  1IP0 A;  1FF7 A;  2WPL E;  3MQE A;  1CVW L;  3TK6 B;  3TZI A;  5KIR A;  4BXW A;  1TPG A;  4M10 A;  3V65 B;  3N8Z A;  1HAE A;  4JZD L;  1NT0 A;  1IOX A;  3SOQ A;  1AUT L;  1IOE L;  2P3F N;  2P28 B;  2TGF A;  4M11 A;  2J38 B;  1L3Y A;  1LPZ A;  3IIT B;  1W8B L;  1A3P A;  3HS5 A;  3NT1 A;  1F0S B;  2I9A A;  1YUG A;  1G1Q A;  2VVC K;  4MMZ B;  5IKT A;  3DEM A;  3KRK A;  2J94 B;  2UWO B;  1MQ6 L;  4Y79 B;  4Y71 B;  1U8C B;  2G00 L;  3ELA L;  4MMY B;  2KL7 A;  5IKV A;  3NTB A;  3RR3 A;  6COX A;  4BTT A;  2BMG A;  3V64 C;  1SZB A;  3HPT A;  1IQF L;  4X8S L;  5I46 L;  1F0R B;  1HRE A;  2WYJ B;  1EPG A;  5CKM A;  1KLJ L;  2Y7Z B;  1UZJ A;  2BOK L;  2YGO A;  4BDX A;  4YT7 L;  2J34 B;  3LC5 B;  2J2U B;  1U67 A;  1XDT R;  5JW1 A;  2CJI B;  2XC4 L;  5CKN A;  1NZI A;  3N8W B;  2FLB L;  1IGZ A;  2K2S B;  2P16 L;  4MMX B;  1HJ7 A;  2W2Q E;  4A7I A;  2VWM K;  2OYE P;  1KLI L;  3ASI A;  1PXX A;  3N8V A;  1WU1 B;  2OYU P;  4RRY A;  1IQN L;  1EGF A;  3M37 L;  4FM5 A;  1F7M A;  1OB1 C;  2W26 B;  4ZHA B;  2VVV L;  2M74 A;  1FAX L;  3K9X A;  4PH9 A;  4TGF A;  3HS6 A;  3IJE B;  3R05 A;  1EQG A;  2YGP A;  5F19 A;  4Y7A B;  2F9B L;  3ZYG A;  1JL9 A;  3KL6 B;  1HCG B;  2Y5F L;  2WFT A;  1KSN B;  3FBY A;  2BO2 A;  3KCG L;  3LN1 A;  3N8X A;  4XLW A;  3POY A;  2MGP A;  1FAK L;  1DX5 I;  1DQB A;  4CUD A;  4Y6D B;  2W86 A;  1N7D A;  1IJQ A;  5COX A;  1QFK L;  1K37 A;  2UWP B;  4RRW A;  5JBC E;  1CEJ A;  3GCX E;  3SOB B;  3LIW B;  1FJS L;  1HRF A;  2RHP A;  1N1I A;  4Z0K B;  5L2Z L;  3BT1 A;  3KQE L;  4ISI L; 
#chains in the Genus database with same CATH topology
 1XFE A;  1KIG L;  2BT8 A;  1APO A;  1KLO A;  1M1X B;  1MQ5 L;  2I9B A;  3N8Y B;  4GU3 A;  5K0H B;  1RFN B;  3LAQ A;  5JBA E;  1IQM L;  1NPE B;  4Z0L A;  1MOX C;  4G1M B;  1JV2 B;  4NA9 L;  1B9W A;  4COX A;  2Y5G L;  1APQ A;  3F1S B;  2DDU A;  2W3I B;  4GU4 A;  3QCW A;  2BQ6 A;  3OLT A;  1ATE A;  2KNI A;  3TK5 B;  4RS0 A;  1KKE A;  1C5M F;  3QH0 A;  4ZH8 B;  2RA0 L;  1EZQ B;  2XBV L;  3EGF A;  2BQW A;  1NFW B;  2JJL A;  1DVA L;  2KB9 A;  2XC5 L;  1HAF A;  2XC0 L;  3BT2 A;  1EPJ A;  3F6U L;  3CS7 L;  1COU A;  3N8Y A;  2K2T A;  1K36 A;  4O1Z A;  3ZYI B;  2PHB B;  4JZF L;  1Z6E L;  3H5C B;  2UWL B;  1Q4G A;  4OTJ A;  3ENS A;  1YGC L;  4OTY A;  3TH3 L;  4RRX A;  1IQK L;  2RNL A;  2MHP A;  4ISH L;  2Y38 A;  4NGA L;  1YUF A;  2BT7 A;  5E8D A;  2WG3 C;  2BOU A;  4Y7B B;  3LTF B;  3ZYJ B;  5CKQ A;  3SOV A;  3KQD L;  2B7D L;  2H9E L;  2VWL L;  3QMO A;  1NFU B;  1URK A;  2VRS A;  1CX2 A;  2WPK E;  4CSY A;  3U73 A;  5JB8 E;  4ZAE B;  1JBU L;  2VJ3 A;  1NQL B;  5JB9 E;  2BOX A;  5KN5 C;  1EBV A;  1YUK B;  1G2L B;  2BSF A;  1TOZ A;  4Y76 B;  1IQG L;  1FE2 A;  2VWO L;  1EMN A;  1P9J A;  2FD6 A;  3LTG D;  1QIU A;  3GIS X;  1WHF A;  1CCF A;  2EI8 B;  3KQC L;  5FDQ A;  3P5B L;  2BQ7 A;  3CEN L;  4YT6 L;  2VVU L;  2Y80 B;  1DIY A;  3PGH A;  3KK6 A;  2W2O E;  1IVO C;  1Z6C A;  1GK5 A;  2ADX A;  1ADX A;  4JZE L;  1X7A L;  3BPS E;  2AYL A;  4D0E A;  5IKQ A;  1J9C L;  5CIS A;  1EPI A;  1O5D L;  1L5G B;  2Q1J B;  4LMF A;  2MGR A;  1I0U A;  2WPH E;  5L2Y L;  4X8T L;  5JBB E;  2W2M E;  2Y81 B;  1BF9 A;  4O02 B;  3LN0 A;  4E1G A;  4ZXX L;  1ATB A;  4XBM A;  2JKH L;  1G1S A;  3HS7 A;  4BXS A;  2PUQ L;  1PRH A;  4BTI A;  1WHE A;  2WPJ E;  1UZQ A;  2P93 L;  4AQT A;  1PFX L;  3OLU A;  2P95 L;  2BZ6 L;  1LPK A;  4Z6A L;  1LMJ A;  5IKR A;  2WFX B;  3HO3 A;  2WYG B;  3M36 L;  2H9E C;  2WG4 B;  1NFY B;  1EPH A;  4NG9 L;  1HT8 A;  2J95 B;  3NTG A;  1NFX B;  1DDX A;  3SW2 A;  1CCV A;  3CFW A;  1V1I A;  1ATA A;  2P3U A;  1PTH A;  1YO8 A;  4JYV L;  1IQE L;  2WPM E;  4A94 C;  2Y7X B;  1CVU A;  5F1A A;  1UZK A;  4ZXY L;  1G1R A;  2XBW L;  3GCW E;  5EGM B;  2P3F L;  2P26 A;  3Q3K B;  2D1J B;  1ZAQ A;  2KV4 A;  1HT5 A;  2P94 L;  3KQB L;  4X8U L;  3Q7D A;  1IQL L;  5L30 L;  1IQJ L;  3HO4 A;  1G2M B;  3FCS B;  5JVZ A;  2FZZ L;  2NPR A;  3TGF A;  3TBD A;  4RRZ A;  1XKB A;  2PR3 B;  3HO5 A;  2VH0 B;  4D0F A;  3FFG L;  1LK9 A;  4CUF A;  2GD4 A;  3U7U G;  1V1H A;  3CA7 A;  2FLG A;  4D90 A;  2XBX L;  3MDL A;  2Y5H L;  4RUT A;  4BTU A;  2W3K B;  1XKA L;  4CUE A;  2VWN L;  1G1T A;  2VH6 B;  2W2P E;  2Y82 B;  4BDW A;  2XBY L;  1HX2 A;  2EI7 B;  1IGX A;  1ATD A;  2W2N E;  4XL1 A;  1FSB A;  1LPG A;  1IQH L;  4C16 A;  3NJP C;  2BOH A;  1TLE A;  2EI6 B;  1CQE A;  1IQI L;  2P3T A;  1EAI C;  4YZU B;  2J4I B;  1FFM A;  1HZ8 A;  1LQD A;  4JYU L;  1V3X B;  3LC3 B;  2WPI E;  5JVY A;  4X8V L;  1UZP A;  1P0S L;  4LOR A;  1W7X L;  1PGE A;  2YGQ A;  1EQH A;  2FLR L;  3C9A C;  3N8W A;  1EMO A;  1F7E A;  1IP0 A;  1FF7 A;  2WPL E;  3MQE A;  1CVW L;  3TK6 B;  3TZI A;  5KIR A;  4BXW A;  1TPG A;  2WZP P;  4M10 A;  3V65 B;  3N8Z A;  1HAE A;  4JZD L;  1NT0 A;  1IOX A;  3SOQ A;  1AUT L;  1IOE L;  2P3F N;  2P28 B;  2TGF A;  4M11 A;  2J38 B;  1L3Y A;  1LMM A;  1LPZ A;  3IIT B;  1W8B L;  1A3P A;  3HS5 A;  3NT1 A;  1F0S B;  2I9A A;  1YUG A;  2VVC K;  1G1Q A;  2HOR A;  4MMZ B;  5IKT A;  3DEM A;  3KRK A;  2J94 B;  2UWO B;  1MQ6 L;  4Y79 B;  4Y71 B;  1U8C B;  2G00 L;  3ELA L;  4MMY B;  2KL7 A;  5IKV A;  3NTB A;  3RR3 A;  6COX A;  4BTT A;  2BMG A;  3V64 C;  1SZB A;  3HPT A;  1IQF L;  4X8S L;  5I46 L;  1F0R B;  1HRE A;  2WYJ B;  1EPG A;  5CKM A;  1KLJ L;  2Y7Z B;  1UZJ A;  2BOK L;  2YGO A;  4BDX A;  4YT7 L;  2J34 B;  3LC5 B;  2J2U B;  3S6X A;  1U67 A;  1XDT R;  5JW1 A;  2CJI B;  2XC4 L;  5CKN A;  2HOX A;  1NZI A;  3N8W B;  2FLB L;  1IGZ A;  2K2S B;  2P16 L;  4MMX B;  1HJ7 A;  2W2Q E;  4A7I A;  2VWM K;  2OYE P;  1KLI L;  3ASI A;  1PXX A;  3N8V A;  1WU1 B;  2OYU P;  4RRY A;  1IQN L;  1EGF A;  3M37 L;  4FM5 A;  1F7M A;  1OB1 C;  2W26 B;  4ZHA B;  2VVV L;  2M74 A;  1FAX L;  3K9X A;  4PH9 A;  4TGF A;  3HS6 A;  3IJE B;  3R05 A;  1EQG A;  2YGP A;  5F19 A;  4Y7A B;  2F9B L;  3ZYG A;  1JL9 A;  3KL6 B;  1HCG B;  2Y5F L;  2WFT A;  1KSN B;  3FBY A;  2BO2 A;  3KCG L;  3LN1 A;  3N8X A;  4XLW A;  3POY A;  2MGP A;  1FAK L;  1DX5 I;  1DQB A;  4CUD A;  4Y6D B;  2W86 A;  1N7D A;  1IJQ A;  5COX A;  1QFK L;  1K37 A;  2UWP B;  4RRW A;  5JBC E;  1CEJ A;  3GCX E;  3SOB B;  3LIW B;  1FJS L;  1HRF A;  2RHP A;  1N1I A;  4Z0K B;  5L2Z L;  3BT1 A;  3KQE L;  4ISI L; 
#chains in the Genus database with same CATH homology
 1XFE A;  1KIG L;  1APO A;  1KLO A;  1M1X B;  1MQ5 L;  2I9B A;  3N8Y B;  5K0H B;  1RFN B;  3LAQ A;  5JBA E;  1IQM L;  1NPE B;  4Z0L A;  1MOX C;  4G1M B;  1JV2 B;  4NA9 L;  1B9W A;  4COX A;  2Y5G L;  1APQ A;  3F1S B;  2DDU A;  2W3I B;  3QCW A;  2BQ6 A;  3OLT A;  1ATE A;  2KNI A;  3TK5 B;  4RS0 A;  1C5M F;  3QH0 A;  4ZH8 B;  2RA0 L;  1EZQ B;  2XBV L;  3EGF A;  2BQW A;  1NFW B;  1DVA L;  2KB9 A;  2XC5 L;  1HAF A;  2XC0 L;  3BT2 A;  1EPJ A;  3F6U L;  3CS7 L;  1COU A;  3N8Y A;  2K2T A;  1K36 A;  4O1Z A;  3ZYI B;  2PHB B;  4JZF L;  1Z6E L;  3H5C B;  2UWL B;  1Q4G A;  4OTJ A;  3ENS A;  1YGC L;  4OTY A;  3TH3 L;  4RRX A;  1IQK L;  2RNL A;  2MHP A;  4ISH L;  2Y38 A;  4NGA L;  1YUF A;  5E8D A;  2WG3 C;  2BOU A;  4Y7B B;  3LTF B;  3ZYJ B;  5CKQ A;  3SOV A;  3KQD L;  2B7D L;  2H9E L;  2VWL L;  3QMO A;  1NFU B;  1URK A;  1CX2 A;  2WPK E;  4CSY A;  3U73 A;  5JB8 E;  4ZAE B;  1JBU L;  2VJ3 A;  1NQL B;  5JB9 E;  2BOX A;  5KN5 C;  1EBV A;  1YUK B;  1G2L B;  4Y76 B;  1TOZ A;  1IQG L;  1FE2 A;  2VWO L;  1EMN A;  1P9J A;  2FD6 A;  3LTG D;  3GIS X;  1WHF A;  1CCF A;  2EI8 B;  3KQC L;  5FDQ A;  3P5B L;  2BQ7 A;  3CEN L;  4YT6 L;  2VVU L;  2Y80 B;  1DIY A;  3PGH A;  3KK6 A;  2W2O E;  1IVO C;  1Z6C A;  1GK5 A;  2ADX A;  1ADX A;  4JZE L;  1X7A L;  3BPS E;  2AYL A;  4D0E A;  5IKQ A;  1J9C L;  5CIS A;  1EPI A;  1O5D L;  1L5G B;  2Q1J B;  4LMF A;  2MGR A;  1I0U A;  2WPH E;  5L2Y L;  4X8T L;  5JBB E;  2W2M E;  2Y81 B;  1BF9 A;  4O02 B;  3LN0 A;  4E1G A;  4ZXX L;  1ATB A;  4XBM A;  2JKH L;  1G1S A;  3HS7 A;  4BXS A;  2PUQ L;  1PRH A;  4BTI A;  1WHE A;  2WPJ E;  1UZQ A;  2P93 L;  4AQT A;  1PFX L;  3OLU A;  2P95 L;  2BZ6 L;  1LPK A;  4Z6A L;  1LMJ A;  5IKR A;  2WFX B;  3HO3 A;  2WYG B;  3M36 L;  2H9E C;  2WG4 B;  1NFY B;  1EPH A;  4NG9 L;  1HT8 A;  2J95 B;  3NTG A;  1NFX B;  1DDX A;  3SW2 A;  1CCV A;  3CFW A;  1ATA A;  2P3U A;  1PTH A;  1YO8 A;  4JYV L;  1IQE L;  2WPM E;  4A94 C;  2Y7X B;  1CVU A;  5F1A A;  1UZK A;  4ZXY L;  1G1R A;  2XBW L;  3GCW E;  5EGM B;  2P3F L;  2P26 A;  3Q3K B;  2D1J B;  1ZAQ A;  2KV4 A;  1HT5 A;  2P94 L;  3KQB L;  4X8U L;  3Q7D A;  1IQL L;  5L30 L;  1IQJ L;  3HO4 A;  1G2M B;  3FCS B;  5JVZ A;  2FZZ L;  2NPR A;  3TGF A;  3TBD A;  4RRZ A;  1XKB A;  2PR3 B;  3HO5 A;  2VH0 B;  4D0F A;  3FFG L;  4CUF A;  2GD4 A;  3U7U G;  3CA7 A;  2FLG A;  4D90 A;  2XBX L;  3MDL A;  2Y5H L;  4RUT A;  4BTU A;  2W3K B;  1XKA L;  4CUE A;  2VWN L;  1G1T A;  2VH6 B;  2W2P E;  2Y82 B;  4BDW A;  2XBY L;  1HX2 A;  2EI7 B;  1IGX A;  1ATD A;  2W2N E;  4XL1 A;  1FSB A;  1LPG A;  1IQH L;  4C16 A;  3NJP C;  2BOH A;  1TLE A;  2EI6 B;  1CQE A;  1IQI L;  2P3T A;  1EAI C;  4YZU B;  2J4I B;  1FFM A;  1HZ8 A;  1LQD A;  4JYU L;  1V3X B;  3LC3 B;  2WPI E;  5JVY A;  4X8V L;  1UZP A;  1P0S L;  4LOR A;  1W7X L;  1PGE A;  2YGQ A;  1EQH A;  2FLR L;  3C9A C;  3N8W A;  1EMO A;  1F7E A;  1IP0 A;  1FF7 A;  2WPL E;  3MQE A;  1CVW L;  3TK6 B;  3TZI A;  5KIR A;  4BXW A;  1TPG A;  2WZP P;  4M10 A;  3V65 B;  3N8Z A;  1HAE A;  4JZD L;  1NT0 A;  1IOX A;  3SOQ A;  1AUT L;  1IOE L;  2P3F N;  2P28 B;  2TGF A;  4M11 A;  2J38 B;  1L3Y A;  1LMM A;  1LPZ A;  3IIT B;  1W8B L;  1A3P A;  3HS5 A;  3NT1 A;  1F0S B;  2I9A A;  1YUG A;  1G1Q A;  2VVC K;  4MMZ B;  5IKT A;  3DEM A;  3KRK A;  2J94 B;  2UWO B;  1MQ6 L;  4Y79 B;  4Y71 B;  1U8C B;  2G00 L;  3ELA L;  4MMY B;  2KL7 A;  5IKV A;  3NTB A;  3RR3 A;  6COX A;  4BTT A;  2BMG A;  3V64 C;  1SZB A;  3HPT A;  1IQF L;  4X8S L;  5I46 L;  1F0R B;  1HRE A;  2WYJ B;  1EPG A;  5CKM A;  1KLJ L;  2Y7Z B;  1UZJ A;  2BOK L;  2YGO A;  4BDX A;  4YT7 L;  2J34 B;  3LC5 B;  2J2U B;  3S6X A;  1U67 A;  1XDT R;  5JW1 A;  2CJI B;  2XC4 L;  5CKN A;  1NZI A;  3N8W B;  2FLB L;  1IGZ A;  2K2S B;  2P16 L;  4MMX B;  1HJ7 A;  2W2Q E;  4A7I A;  2VWM K;  2OYE P;  1KLI L;  3ASI A;  1PXX A;  3N8V A;  1WU1 B;  2OYU P;  4RRY A;  1IQN L;  1EGF A;  3M37 L;  4FM5 A;  1F7M A;  1OB1 C;  2W26 B;  4ZHA B;  2VVV L;  2M74 A;  1FAX L;  3K9X A;  4PH9 A;  4TGF A;  3HS6 A;  3IJE B;  3R05 A;  1EQG A;  2YGP A;  5F19 A;  4Y7A B;  2F9B L;  3ZYG A;  1JL9 A;  3KL6 B;  1HCG B;  2Y5F L;  2WFT A;  1KSN B;  3FBY A;  2BO2 A;  3KCG L;  3LN1 A;  3N8X A;  4XLW A;  3POY A;  2MGP A;  1FAK L;  1DX5 I;  1DQB A;  4CUD A;  4Y6D B;  2W86 A;  1N7D A;  1IJQ A;  5COX A;  1QFK L;  1K37 A;  2UWP B;  4RRW A;  5JBC E;  1CEJ A;  3GCX E;  3SOB B;  3LIW B;  1FJS L;  1HRF A;  2RHP A;  1N1I A;  4Z0K B;  5L2Z L;  3BT1 A;  3KQE L;  4ISI L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...