3HONA

Crystal structure of human collagen xviii trimerization domain (cubic form)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
55
structure length
55
Chain Sequence
GSSGVRLWATRQAMLGQVHEVPEGWLIFVAEQEELYVRVQNGFRKVQLEARTPLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen alpha-1(XVIII) chain
publication title Crystal structure of human collagen XVIII trimerization domain: A novel collagen trimerization Fold.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2009-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.50 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3honA00
3N3FA 3HONA 3HSHA
chains in the Genus database with same CATH superfamily
1YU4A 4NZ5A 4MB3A 1E88A 1UR9A 4MB4A 1ED7A 3L2AA 4OJ6A 2Y2MA 3KS4A 3HSHA 1UR8A 2Y2OA 4IJEA 4IBKA 4MB5A 1W1YA 2Y2PA 1QO6A 1W1TA 3HONA 1H8PA 3M7PA 4NYUA 4Z2LA 2Y2QA 4HMDA 4Z2HA 4Z2IA 2Y2GA 4IBBA 4NYYA 2Y2JA 4LG2A 1GPFA 2XD5A 3WD1A 1E6NA 4IBIA 4OUIA 1OGBA 4OJ5A 3L29A 2FN2A 4IBJA 2UWXA 4IBEA 4IBDA 1GOIA 4Z2KA 5BPVA 1E8BA 1E6PA 1CK7A 1EAKA 3WD2A 2V5OA 3MQLA 1KS0A 1AIWA 1YU0A 3FKEA 4Z2GA 1H0IA 1E6ZA 4TX8A 1J7MA 2JE5A 1W1VA 4IJFA 4QNLA 4Z2JA 3WD0A 4HMCA 1E6RA 2Y2NA 3L26A 4IBCA 2IOUA 2XD1A 3WD3A 3KS8A 4NZ1A 2Y2IA 1OGGA 3WD4A 4IBGA 3WX7A 4OJPA 4IBFA 1E15A 1L6JA 1W1PA 2Y2LA 1YU1A 1GXDA 2BG1A 4NZ4A 2JCHA 3L25A 1PDCA 1YU2A 2Y2HA 4GH9A 4OJOA 4NZ3A 4GHAA 1O6IA 2RTSA 4NY2A 1YU3A 2FFFB 1YUEA 4OJLA 4GHLA 1CXWA 2D49A 3L27A 3N3FA 1H0GA 4HMEA 3L28A 2Y2KA
chains in the Genus database with same CATH topology
1YU4A 4NZ5A 3FKEA 3L28A 2Y2GA 4IBBA 2Y2LA 1YU1A 2JE5A 4IJFA 2BG1A 2Y2JA 3L2AA 4NZ4A 4NYYA 4OJ6A 4QNLA 4LG2A 2JCHA 3L25A 2Y2MA 2Y2NA 3KS4A 2XD5A 1YU2A 3HSHA 3L26A 2Y2HA 4GH9A 4IBCA 4IBIA 4NZ3A 4OJOA 2IOUA 4OUIA 2XD1A 2Y2OA 4IJEA 4GHAA 4OJ5A 4IBKA 3L29A 3KS8A 4IBJA 4NZ1A 2UWXA 2Y2IA 1YU3A 4NY2A 2Y2PA 4IBEA 2FFFB 4IBDA 1YUEA 4OJLA 4GHLA 3HONA 5BPVA 4IBGA 3WX7A 4OJPA 4NYUA 3L27A 3N3FA 4IBFA 2Y2QA 2Y2KA 1YU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3F A;  3HON A;  3HSH A; 
#chains in the Genus database with same CATH topology
 1YU4 A;  4NZ5 A;  4MB3 A;  1E88 A;  1UR9 A;  4MB4 A;  1ED7 A;  3L2A A;  4OJ6 A;  2Y2M A;  3KS4 A;  3HSH A;  1UR8 A;  2Y2O A;  4IJE A;  4IBK A;  4MB5 A;  1W1Y A;  2Y2P A;  1QO6 A;  1W1T A;  3HON A;  1H8P A;  3M7P A;  4NYU A;  4Z2L A;  2Y2Q A;  4HMD A;  4Z2H A;  4Z2I A;  2Y2G A;  4IBB A;  4NYY A;  2Y2J A;  4LG2 A;  1GPF A;  2XD5 A;  3WD1 A;  1E6N A;  4IBI A;  4OUI A;  1OGB A;  4OJ5 A;  3L29 A;  2FN2 A;  4IBJ A;  2UWX A;  4IBE A;  4IBD A;  1GOI A;  4Z2K A;  5BPV A;  1E8B A;  1E6P A;  1CK7 A;  1EAK A;  3WD2 A;  2V5O A;  3MQL A;  1KS0 A;  1AIW A;  1YU0 A;  3FKE A;  4Z2G A;  1H0I A;  1E6Z A;  4TX8 A;  1J7M A;  2JE5 A;  1W1V A;  4IJF A;  4QNL A;  4Z2J A;  3WD0 A;  4HMC A;  1E6R A;  2Y2N A;  3L26 A;  4IBC A;  2IOU A;  2XD1 A;  3WD3 A;  3KS8 A;  4NZ1 A;  2Y2I A;  1OGG A;  3WD4 A;  4IBG A;  3WX7 A;  4OJP A;  4IBF A;  1E15 A;  1L6J A;  1W1P A;  2Y2L A;  1YU1 A;  1GXD A;  2BG1 A;  4NZ4 A;  2JCH A;  3L25 A;  1PDC A;  1YU2 A;  2Y2H A;  4GH9 A;  4OJO A;  4NZ3 A;  4GHA A;  1O6I A;  2RTS A;  4NY2 A;  1YU3 A;  2FFF B;  1YUE A;  4OJL A;  4GHL A;  1CXW A;  2D49 A;  3L27 A;  3N3F A;  1H0G A;  4HME A;  3L28 A;  2Y2K A; 
#chains in the Genus database with same CATH homology
 1YU4 A;  4NZ5 A;  3FKE A;  3L28 A;  2Y2G A;  4IBB A;  2Y2L A;  1YU1 A;  2JE5 A;  4IJF A;  2BG1 A;  2Y2J A;  3L2A A;  4NZ4 A;  4NYY A;  4OJ6 A;  4QNL A;  4LG2 A;  2JCH A;  3L25 A;  2Y2M A;  2Y2N A;  3KS4 A;  2XD5 A;  1YU2 A;  3HSH A;  3L26 A;  2Y2H A;  4GH9 A;  4IBC A;  4IBI A;  4NZ3 A;  4OJO A;  2IOU A;  4OUI A;  2XD1 A;  2Y2O A;  4IJE A;  4GHA A;  4OJ5 A;  4IBK A;  3L29 A;  3KS8 A;  4IBJ A;  4NZ1 A;  2UWX A;  2Y2I A;  1YU3 A;  4NY2 A;  2Y2P A;  4IBE A;  2FFF B;  4IBD A;  1YUE A;  4OJL A;  4GHL A;  3HON A;  5BPV A;  4IBG A;  3WX7 A;  4OJP A;  4NYU A;  3L27 A;  3N3F A;  4IBF A;  2Y2Q A;  2Y2K A;  1YU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...