3HOUG

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3houG01
2YTYA 3PUZA 1L0WA 4EX5A 3CMAA 1HZBA 3UDFA 1YHQA 1HNZL 2YTXA 4DV7L 3IRBA 5IWAL 3FP9A 5M3FG 4DK3C 5BR8Q 1PH8A 1X3EA 1OTCA 2OTLA 3CC4A 2AMCB 1SR3A 3ULJA 3PF5A 2VNUD 2D0PA 5FLMH 3M4OH 4R4QA 1KL9A 3W1GA 2UU9Q 4DR6L 3NENA 1EYGA 2CQOA 3T1YQ 1VQPA 4JI0L 3HKSA 5C4XG 2ZJQA 3J80i 3CW2C 1VQDA 1PYSB 4A3CH 1B8AA 3T1HQ 4AYBG 3Q8DA 1VQNA 2PNHA 2QGQA 2F4VQ 3I4OA 5IE8A 4UP8A 4A3BG 3M85A 1VCIA 5LMUL 1V9PA 2JA6H 2AWOA 1YHBA 3I2ZA 2I5MX 3BZKA 1AE3A 1JMCA 1CSPA 1EIYB 3RZOH 4O0AA 3FKIH 4A3KH 2B63G 1A0IA 3HFZB 1V1QA 4POFA 4LUZA 4JOIA 5M5XH 4DV1Q 4JV5Q 2VQEL 4JYAL 5JJIA 3K80C 2A19A 3E0EA 3LGJA 3M7NA 4BXXH 4NXMQ 1MIUA 4IPHA 1PVOA 1IBLQ 1C0AA 4YCWA 4GLXA 4B3MQ 1IXRA 1K0RA 3NELA 3TS2A 4C3JH 2NZHA 4DV3L 1OXXK 3JAMc 1EWIA 4PZ6A 2UUBL 2VZAA 3RLNA 5M3FH 4IFDJ 1HR0W 1UEBA 2GN5A 2KCMA 4GOPC 4IFDI 4GLAC 1K3RA 3CCMA 3J7ZC 2WFWA 2RF4A 1EQRA 1I5FA 2E8GA 1N36L 2XTIA 1XNRL 4XIGS 1XMQQ 1Y14B 5ELOA 4JBJA 5C4XH 3K8AA 4AQYQ 4LF7Q 2NVQH 4QQBX 1L1OC 4JC0A 3W5OA 4X66L 1VQOA 3GD7A 2IX1A 4KI0A 1HNWL 4YCVA 1HR0Q 4LWCA 4PZ8A 3CCJA 1IBMQ 4DUZQ 4J15A 1XNQQ 4LF9Q 3JC66 1Q86C 4LF6Q 3CPWA 2Q2TA 2RHSB 3KJOA 2JA5G 4LF5L 3TRZA 4XTCS 4JBKA 3A5ZB 4DR2L 1N32L 2UXCQ 1P16A 5FLXc 1KC8C 1VQ5A 3PUWA 4DV5L 2B63H 2ID0A 2Q2UA 1BBWA 1K83H 3CC7A 4RMFA 1GVPA 3AYHB 4DK6C 1SROA 4LFBQ 1E24A 5AJ3Q 2CKZB 2IHFA 2ZM6Q 4DV4L 4A3LG 1HZCA 4PZ7A 3J81c 3ICEA 4YWLA 4IJLA 1Z9FA 4GNXA 2F3IA 3KF8B 3RLOA 2Z0SA 2NZOA 2VS1A 1QVGA 2HHHL 1YNXA 4JBWA 3UDGA 4B3RQ 5JEAJ 4X65L 1SFOH 1Q46A 1UE7A 1GM5A 4YWMA 4JI5L 1VQKA 3DLLA 4JOIC 1KHIA 1M90C 1N34L 1IBKL 1JB7A 4YY3L 4A93G 5E7NA 1OXUA 5C44G 1K9MC 3S2HH 4Y7NH 3KDFB 4UY8C 1PH4A 4JI3Q 3OYYA 4NXNL 1IL2A 2UXDL 4AH6A 3FHWA 4QGUA 1XPRA 4DV2Q 4A3DG 1PA6A 1TWCH 3A5UA 1C7YA 2CCZA 2JA5H 2ATWA 2JJQA 1XTDA 2AWNA 1X56A 2B3GA 3OW2A 4DV1L 1G6PA 4A3FG 2VQFQ 3S15H 2ZTDA 1SRUA 1I50H 3OTOL 1X3FA 2XGTA 5IP7G 1Q7YC 4OWWB 4LFCL 4B3TQ 2ASBA 1E1OA 1YVCA 1KXLA 4GN4B 1J5EL 2UUAQ 5GQOA 2UUCQ 1SMXA 4A3LH 3RLFA 2F52A 2Z6KC 1S40A 4DUYQ 2K5NA 2K5VA 2L15A 4QY7A 4RG1A 2I5LX 3KJPA 2BH2A 4DV6Q 4IO9A 3BU2A 3F2DA 1V43A 3PO3G 1R9TH 3A74A 5C0XJ 3K0XA 3AQQA 1K8GA 4JI1Q 5C0XI 3STBD 2Q2IA 4X6AH 4DR3L 1XMOQ 4LF4L 4TQUS 2CWAA 1NMGA 4A93H 3GTGH 1X9NA 2IT1A 5C44H 3CQZH 1YJNA 4DUZL 1PV4A 3ULLA 3JAMi 4JI6L 1N8RC 1J6QA 2BA0A 1FVIA 3KDFA 4BA1I 4DR4L 5JJLA 4LF6L 2JA7H 2JK8A 3WWVA 4JBMA 1RL2A 2KHJA 3SGIA 4L5TA 1CUKA 1HNXQ 1Q81C 4A3DH 1UE1A 4LUVA 1M1KC 1EFWA 2UXCL 4MTNA 4PG3A 1CKNB 4QJFA 3S16H 3I55A 4HIKA 1FJGL 2VUMG 3GTQH 1PH9A 3PV0A 2MNAA 4P75A 4A75A 1SE8A 1PH3A 4A3FH 3NEMA 2IY5B 2NN6I 4X64L 4JI7Q 1WFQA 1UE6A 3K7UC 4YWKA 5IP7H 4P73A 1PH2A 3PSIA 2UXBL 4QL5A 5K36G 4KHPL 4PMWA 4MNOA 1K73C 3RR5A 1KIXA 3GTMH 1NY4A 1W3SA 4O2DA 1NJIC 4R4TA 1VQ6A 1D7QA 4Y52H 1QVCA 3PUXA 5GAHC 1Y1VG 1CSQA 1CKOA 2WB1G 4FDBA 2ZJPA 1PH7A 3AEVA 5LMNL 4B3RL 5M5YH 1U5KA 4YCUA 1MJEA 1N33L 3PO3H 2Y0SG 3I4MG 1VQGA 2K4KA 4UPAA 1NMFA 1KD1C 2R93G 4C3HH 4AIMA 4WJ3M 2ZJRA 4POGA 1AE2A 4ME3A 4R4IA 1Q82C 2FXQA 3G48A 4GNXB 4B3SQ 2MO0A 4KHZA 4DR5L 2YYZA 2ZTCA 3HKZG 3S1MH 3J81i 4IFDG 1YEZA 3HOXG 4P72A 5IYDG 4OONA 2V1CC 4DV0Q 3AFQA 2K50A 1Q1BA 2GVAA 2K52A 2PI2A 3TREA 2JA8G 2ALYB 2K5HA 4HJ9A 2R7DA 4EQ5A 4LFAL 4JI4Q 4DR1Q 2VUMH 1E7ZA 1VQFA 1CKNA 1SN8A 3M4PA 1Q12A 2IX0A 4IOCA 2YU9H 1LTLA 4KLKA 1HZ9A 4GKKQ 4GKJL 4OO1I 4APVA 1EOVA 5C3EG 4DR7L 4A3BH 4OWTB 3NBHB 3CCSA 4GLVB 1YBYA 2PQAB 4LF8Q 1Q1EA 4YHHQ 2JE6I 4JI2Q 4HIOA 3I56A 1K8AC 1VQJA 4IPGA 4JI8Q 1QUQB 2E2JH 5JJKA 1WCMG 2E2HH 3UE1A 1RIPA 1Y1VH 3S14H 1UE5A 4K0KL 1I94L 2E5LL 1XJVA 3B6YA 3PUYA 3ERSX 2EXDA 1XMOL 3I4MH 4HJ8A 2OQKA 2R93H 2D62A 2LSSA 4HIDA 4A3JG 2HIXA 3UE0A 5IP9G 2I0QA 2DGYA 3KOJA 4A3EG 4ALPA 3M3YH 5BR8L 3KF6A 4C3IH 5M5WH 3G71A 1LM0A 4DV7Q 1HNZQ 4BA2I 3HOXH 5IYDH 1A63A 5JEAG 2EIFA 1EIFA 3EN2A 1N9WA 4MZ9A 2RCNA 1NBWA 3BJUA 4AYBE 2UU9L 2JA8H 3T1YL 2JEBI 3CCEA 4OX9Q 4L5RC 3I4NG 4DR6Q 3PF4A 1YIJA 3HOUG 1OXTA 3ER0A 3ZJYC 3T1HL 1A8VA 1HJPA 1G291 1P8LA 1PH1A 2F4VL 4A3GG 2WB1E 1BVSA 1GO3E 5C3EH 2Y0SE 1JE5A 3MEFA 5LMUQ 1SLJA 2NVTH 2YTVA 2WP8J 2PQAA 1I3QH 1VQIA 4JG2A 3RZDH 1MKHA 2MFIA 1WCMH 2KCTA 3HOWG 3PCOB 1O7IA 1QUQA 2VL6A 4JV5L 3PUVA 4JYAQ 3CAMA 1PH5A 1D8LA 4NXML 3CC2A 2VQEQ 1IBLL 4B3ML 1ASYA 1AH9A 3GO5A 3EBEA 5IP9H 2JA9A 2E5LQ 1OXSC 5HY6A 2CWPA 1YJ9A 4A3EH 3CCLA 4DV3Q 1VQAA 1GKHA 3A0JA 4H02A 1JJ2A 3GTOH 2UUBQ 2NVYH 1TWGH 4BBRG 3S1NH 2OWOA 5C0XG 1LUZA 5GAGC 2N49A 3F2BA 1XMQL 1I6HH 4AQYL 1Y1WG 1W2BA 1QZGA 1N36Q 4LF7L 1XNRQ 3I4NH 1X65A 3UDIA 4OXPA 3STBC 5GADC 4HJ5A 3HOUH 3G6EA 1HR0L 4X66Q 1VQMA 3U58A 3GTPH 1IBML 3L7ZC 4P71A 1B7YB 1HNWQ 1XNQL 4A3GH 4LF9L 1TWHH 5J3BA 4GNXC 2I5HA 2GVBA 3CXCA 3G4SA 2AHOB 1TXYA 4LF5Q 4BBSG 4LW1A 4IPCA 1X6OA 1DGSA 2EQSA 2NN6G 4A3IG 3M4QA 3HOWH 2MQHA 2ZTEA 5M3MG 1L2FA 4DV5Q 1L1OA 4LFBL 3BZCA 5AJ3L 3RN5A 4X62Q 2ZM6L 2K75A 4GS3A 4GN3B 3UDXA 1NE3A 1KAWA 1VQCA 4DV4Q 2YV5A 3S2DH 2R7FA 1HZAA 3F8TA 1KRSA 1YHAA 4C2MH 1VQ4A 3M9BA 4UP9A 4NB3A 4BBRH 2HHHQ 2WAQG 4DNIA 2E2IH 3S17H 4OX9L 3CP0A 3H0GG 3CCVA 3H3VH 2AKWB 4QIWE 4X65Q 5EAYA 3U4VA 1Y1WH 4JI5Q 3CCQA 1OXVA 1QZHA 1VQ8A 1PH6A 1NTGA 3AFPA 3W1BA 3KF6B 1N34Q 1IBKQ 4YY3Q 1Z47A 1VS0A 2N78A 2R6GA 5DLQE 4JI3L 3F2CA 3E9HA 2K14A 3HOZG 4NXNQ 2A1AA 2R92G 4DV2L 1E3PA 2B29A 3GDEA 2UXDQ 3D0FA 1T9HA 4LUOA 4BBSH 5GROA 2VQFL 4A3MG 4A3IH 1B70B 1WOCA 5H1SE 4OO1G 5M3MH 1EQQA 2IHEA 4B3TL 3HOVG 3OTOQ 1VQLA 5FJ8G 2UUAL 5GAEC 2UUCL 1JT8A 1YZ6A 4LFCQ 4DAMA 3DM3A 1J5EQ 1S72A 3HOZH 2PI2E 3KYHC 1XPUA 4DUYL 5IYCG 1H95A 1YJWA 1VQBA 1IZ6A 3CF5A 2BA1A 2C35B 4DV6L 3PIOA 2JEAI 4OWXB 1QVFA 4JI1L 3TQYA 2QEXA 1BBUA 3GTLH 3H0GH 4DKAC 2D0OA 3J80c 3L2PA 4BY1G 4GN5A 1X3GA 3L0OA 2N8NA 3PIPA 3GTKH 3HOYG 3RNUA 4DR3Q 4LF4Q 2PMZE 2N3SA 2JQOA 4L5QA 1EUJA 1KRTA 2OTJA 4IJHA 2CFMA 3PGZA 1X55A 3CD6A 2HT1A 5IWAQ 3KFUA 3E9IA 2BH8A 3K81C 1YI2A 1E22A 1WI5A 2Z6KA 4JI6Q 1HNXL 2R92H 3J7A5 4DR4Q 3K7AH 2R7ZG 3PO2G 1JJGA 3H15A 3S24A 1X54A 4JI0Q 4BY7G 4A3MH 1FJGQ 4JI7L 2RHQB 3EIVA 1C9OA 4R4CA 1PYBA 4JCVE 5IT9c 4X62L 1YITA 1A62A 4IPDA 4X64Q 5IYBG 5LMNW 4HIMA 5FJ8H 3HOVH 2LXKA 4DPGA 3CPFA 2WAQE 1KQSA 4L5SA 2UXBQ 4HJ7A 4GOPB 4KHPQ 3F1ZA 3S1RH 2QA4A 4DAYB 1JJCB 3RN2A 4LNQA 1VQ9A 4NPSA 2HIVA 1UWVA 5IYCH 3GTJH 1VQEA 2DUDA 1L1OB 5LMNQ 4R1JA 3HKZE 3I7FA 1N33Q 1MJCA 2ES2A 1ASZA 2KBNA 3CCRA 1PFSA 4BY1H 2VW9A 1VQHA 4A3JH 3HOYH 3TS0A 4R4OA 2LXJA 4WJ4A 4B3SL 3J81j 2VY3A 1BKBA 3MXNB 4DR5Q 1S3OA 3KLWA 4DV0L 1GD7A 2JA7G 2MO1A 5FLMG 3TEHB 1TWAH 3D31A 3CCUA 4IOAA 2HQLA 1E1TA 1U0LA 2R7ZH 3VDYA 3PO2H 3U4ZA 2OCEA 4JI4L 2KENA 4DR1L 1PHJA 1CKMA 2Q2HA 5C4JH 2OQ0A 4LFAQ 1XPOA 4BY7H 4A3CG 1IYJB 4A4IA 4P74A 3ULPA 4GKKL 2KHIA 5IYBH 3U50C 4TVAB 4GKJQ 4HJAA 5IY0A 4LF8L 1LYLA 2JA6G 4YHHL 4DR7Q 2H5XA 1WJJA 4JI2L 4JI8L 4A76A 4GOPA 1FGUA 1HH2P 1WYDA 1Q8KA 1TWFH 3FKIG 2A8VA 4A3KG 3CMEA 1N32Q 4DR2Q 2NVXH 5ELNA 5HGQA 3S1QH 1G51A 4UP7A 1I94Q 1VQ7A 4K0KQ 4BXXG 1FL0A 3H3VI
chains in the Genus database with same CATH superfamily
2YTYA 4C3HG 4YR3A 4LSXA 1X3QA 4RAUC 1L0WA 4EX5A 3R2TA 4MV7A 1HZBA 1PFMA 1DONA 4GKJH 4HCSA 2F0VA 1HFNA 3GV8B 4DR7H 5IWAL 5M3FG 2A69D 2IWHA 5BR8Q 1PH8A 2NVXA 4JVZA 5A2QW 2FLLA 1BUVT 2D0PA 5FLMH 1I4QA 1U4MA 2NYZD 4ZKBB 4KN4C 3M9MB 4DR2H 2K5QA 1EYGA 2SOBA 5C4XG 3CW2C 3SR1A 1WVLA 4A3CH 4FF3A 4HSPA 2O5IC 3T1HQ 1I7NA 3TZUA 4AYBG 3JAMW 2PNHA 1ESRA 5KFNA 4QF4A 4A3BG 3P75A 5C1OA 2E2DC 2EYLA 1YHBA 4K14A 1AE3A 5DGBA 1JMCA 3T1YH 2B63G 3BS1A 4DV1Q 3MR6A 1GHKA 2A19A 3E0EA 3LGJA 1C0AA 1MIUA 4IPHA 4NDXA 4RUCA 4GLXA 3NTKA 4B3MQ 4UFZA 4Z9CB 2W70A 3MZ5A 2F0LA 1YNND 2UUBL 3FKIA 3GV7B 4ME6A 4CC5A 3KXYT 4IFDJ 1JWMD 1UEBA 1CHQD 3H20A 4GLAC 2I87A 3J7ZC 3FDSA 5CV5A 2RF4A 1EQRA 2F0IA 5LXTF 2F03A 2D5DA 1XMQQ 4P2CB 1Y14B 4JV5H 2H4OA 1CZGA 3K8AA 4QQBX 1JR0D 4NXMH 1VQOA 4X66L 2L11A 4G7OC 1IBLH 4BWGB 3J7AK 3CCJA 2R7LA 1IBMQ 1AW7A 4FXKC 2VQDA 1XNQQ 1A2UA 4LF6Q 4RB1A 4LF5L 3E0JA 2L0CA 4G57A 3HBLA 5FLXc 4LMQD 1VQ5A 3GLKA 3GTJA 4LJZC 2Q2UA 4CJ2C 1S5ED 3ONAB 4DGZA 5CBAE 4DK6C 2F0HA 4IUVA 4F88A 2IHFA 1GSOA 4ED6A 4V0BA 1HZCA 3J81c 4ABNA 3V6HA 4ZKCB 1E4EA 2VS1A 1K83A 1GM5A 4I7HA 3DLLA 1D1IA 1KHIA 4A93G 3HEJA 4YY3L 3BA9A 1HXYD 2R85A 4XQJA 5EPJA 1N48A 3KDFB 4RB0A 4JI3Q 4NXNL 4CGYB 4XT3B 1BCPD 4U7CA 1KDBA 1SFOA 4HR7A 4DV2Q 4B3RH 3GTGB 2CCZA 2C2EA 3LWBA 3PN1A 3VYRA 5EBCA 3PIO3 3BYTB 1STNA 1W6KA 2ZTDA 4KN7C 4OWWB 1KXLA 3I3CA 1J5EL 2UUAQ 1JQYD 1PZID 3J80L 3RAXA 2WIIB 5EGTA 3ITPA 1AN7A 4UCRA 3RGXA 1S40A 4DUYQ 2W6MA 1SBBB 3KJPA 5KEEA 2P0AA 2R82A 1DCZA 1K8MA 1PRTC 3AQQA 3FRPB 4JI1Q 2Q2IA 3RJ0A 5FO9B 1NMGA 2PW5A 3EPIA 3GTGH 2RBMA 2MP1A 1VBHA 2UUCH 1BCPB 2EY5A 3ULLA 4J1MA 1N8RC 4ED8A 4M9UA 2JK8A 3WWVA 1CTMA 4XYQA 3SGIA 1ULZA 3QB3A 1HNXQ 1UE1A 1B44D 1HFGA 2E76C 1M1KC 4JUZA 3RF2A 3S1MB 2ZXPA 4HIKA 1FJGL 3KHLA 1XMOH 2QDBA 2F0WA 1UE6A 2KUMA 3PSIA 2BE5D 4PMWA 1KIXA 4MTEA 2DN8A 3NE5B 2Z6BA 4O2DA 4K8JA 4DXFA 5KFUA 4Q45A 4QB4A 1QVCA 4KJOA 1K3BC 4LMYA 5GAHC 5J2TF 2F3VA 5D8DA 3K5MA 1G91A 2PO4A 4IUQA 1N33L 2W9CA 1VQGA 2XIWA 4UPAA 3D4RA 1G6ZA 1EHIA 2E2JB 4PQXA 4POGA 1AE2A 4R4IA 3GIKA 4IALA 3S14B 1VMPA 3G48A 5IIFA 2MO0A 1E4EB 4C3IG 3HKZG 3SXHA 3S1MH 3J81i 4XZ3B 1BO0A 2RDGA 1RKNA 2CHBD 4DV0Q 3VPDA 1IYUA 4IQZA 1SYEA 2J7ZA 2K50A 4YJ3F 2FLNA 1FNWA 3QOJA 1TU2B 2PNRC 2DWCA 2W6PA 1S10A 5M5WB 4JI4Q 1T94A 1LTLA 4GKJL 4OO1I 4B3SH 1Z2NX 4DR7L 3GV5B 3OOCA 3CCSA 4GLVB 1AZQA 5FPOA 4DL7A 2RDIA 4YHHQ 1WD0A 2E2JH 2R8JA 1QUQB 3K5NA 2VUMA 4H44C 1S68A 3S14H 2EY2A 2YZGA 2FINB 3B6YA 4DR1H 3PUYA 2EXDA 2DY7A 1TIID 2HJWA 4WBNF 2NVTB 2LSSA 2R7KA 4J9MA 1XTCD 4RNOA 4GKKH 2JEJA 4A3EG 4ECZA 4MTKA 2RQXA 5M5WH 3I73A 2WB1A 4IFDH 3NQIA 4MV3A 4JI2H 3M9OB 3QIAA 4JI8H 1JICA 1A63A 2Y0SA 4CDCC 1H9MA 5KFFA 4AYBE 1N9WA 1NBWA 2B2WA 2R93A 2KA7A 3T1YL 4RH6A 1TAEA 4L5RC 4XT1B 1C48A 5JVG3 3KHRA 2XVSA 2NU8B 3V96A 3LWUA 4O3RA 2TSSA 2YS6A 3GILA 3QWNA 1PH1A 2J4XA 2WB1E 4ZQIA 2R87A 1HQRD 2FHTA 2Y0SE 3SI8A 1KABA 2A6EC 2NVTH 1HRJA 2YTVA 2ZDHA 2KEDA 1MKHA 4A3GB 5FO7B 3GIPA 4JV5L 4DR6H 3V4SA 2NZ1D 4O42A 1PH5A 4NXML 1IBLL 2B2TC 3I91A 3PQIA 4X3KA 1ASYA 3PIP3 2HVRA 2FK3A 5IP9H 3NUCA 2CWPA 1I3QA 1NR4A 1B3AA 4I50F 2W6NA 4H02A 1GKHA 4RCNA 1WCMA 4JV1A 4HMIA 1JJ2A 5LMUH 4O2BF 2UUBQ 3DWAA 1S5FD 1S5CD 3VA5A 2WYOA 2YW2A 4MA0A 2W9BB 3JRXA 1ZYRD 3TQ1A 3S2DB 4JYAH 5JVLA 1X65A 1ZYRC 4OXPA 5GADC 3NXWA 5NUCA 4BBRB 4X66Q 1VQMA 4Q8FA 4UCSA 4IR9A 3D4DA 1B7YB 4A3GH 4DV3H 4ECSA 2F1MA 4J9NA 4CKEA 2NUAB 1VBGA 3G4SA 4C56C 2AHOB 4IZ8A 1F77A 2B2WC 4LF5Q 4IPCA 1DGSA 1G2SA 1XNRH 4OIJA 3M4QA 2MQHA 5IGDA 2KECA 2K1BA 2XGQA 3L4JA 3BZCA 1TWHA 3K6OA 4MA5A 4MV1A 3Q6SA 1B9NA 4BBSB 3OSNA 1B6RA 5KFRA 4A3IB 1HA5A 5KFCA 3SK4A 3S2DH 4ZOLF 4I65A 4QMGA 1Z2PX 1YHAA 4FM9A 3M9BA 4BBRH 2WAQG 4DNIA 2V9WA 4EYIB 1RK5A 5EAYA 4DV5H 3RAQA 1RODA 1IW7D 1M4VA 1PH6A 1NTGA 4Q5VA 3AFPA 1PTOD 4YY3Q 3MEHA 2KCNA 1B53A 1Z47A 3F2CA 1SEIA 2FE3A 4F7XA 3BZDB 3H0GB 4DV4H 2AUJD 3CRLC 3HOZG 4NXNQ 3GTKB 1MZBA 4LSAA 5JH7F 1E3PA 3T5LA 1CT1D 2A73B 2IMWP 1RHPA 3J80W 3R3OA 1I4XA 5J39A 4BBSH 2NN6H 1B70B 4A3IH 2HGSA 1EEID 5H1SE 4OO1G 2R92B 3HOVG 5C3WA 5KFLA 5KG4A 4NP5A 3RB6A 1IBKH 4N8FA 2UUCL 2W6QA 4I7AA 3DM3A 1STEA 1J5EQ 1GUTA 3P1HA 3E3XA 1XPUA 5IYCG 1T5XD 2UXDH 2N55A 3J7AV 4KY5A 4OWXB 3L9AX 4JV0A 4XYMB 1SYXB 5I6YA 3H0GH 1F9PA 4TRDA 4DKAC 1EEFD 3GTKH 3L0OA 3PIPA 4ECXA 2NBFA 3GTJB 3P20A 2PMZE 2N3SA 3KK7A 1DJRD 4L5QA 4LFCH 2OTJA 3K59A 4J0MA 3E5NA 2CFMA 2ENBA 4HTHA 5M9OA 3BVGA 4QW8A 1YI2A 2R92H 2Z6KA 5EWFA 4YB8B 1CZWA 3Q8SB 1Y8OB 4FO2A 2R7ZG 4RFBA 3NBIA 5FKAC 1GGOA 1EYAA 3ORQA 5KT7A 3H15A 1PTOF 1FJGQ 3MR3A 4IHJF 1QNKA 4R4CA 1PYBA 1A62A 1I4PA 4KMUC 4GOPB 5IWAH 3RN2A 5CV6A 1VQ9A 1SYDA 2HIVA 2XN9C 3VR5A 2I8CA 3GTJH 2IX3A 2EJMA 1X3PA 4Q43A 3MVVA 1HHVA 2WV6D 3BJYA 1QB5D 3HKZE 4JK1C 1N33Q 4IWXA 5EWEA 2ES2A 1ASZA 3RMHA 2VW9A 3D3RA 4U68A 2B2UC 2ZDQA 4R4OA 2LXJA 2EYJA 4B3SL 2UXBH 5DAUA 4KHPH 1S3OA 1ENAA 5KG3A 1GD7A 5EPLA 3V6JA 1CQJB 1SMYD 3TEHB 3JSNA 4TQSA 4IOAA 4CBVA 1QILA 5EPKA 5LMNH 3QJYA 3VDYA 2OXPA 1MSGA 2KENA 4DR1L 1PHJA 2OQ0A 3FPPA 3DXJC 1ILQA 3M4OB 3ULPA 3IKJA 4GKKL 3KHGA 2FLPA 3KLSX 5IYBH 3U50C 1B50A 4GKJQ 2WKDA 4DR5H 4RHSA 1PZKD 2V5AA 4DR7Q 4JI2L 4JI8L 5IODA 3LP8A 4A76A 1FGUA 2EXZA 3GQCA 3FKIG 4A3KG 1I50A 1QJOA 4DR2Q 1E4FT 4Q0YA 1G51A 2G5DA 4G7HC 5ELBA 2KHSA 2F0MA 3I8ZA 2EE1A 5J22A 1SJHD 3PUZA 4C3JG 1LT5D 1YHQA 4BWSC 1TWFA 3FP9A 3CC4A 5EDWA 1HUNA 3MXNA 4TQRA 1KTKA 5KG2A 3M4OH 4R4QA 1VDZA 4DR6L 3T1YQ 5DG8A 1I94H 2ZJQA 1GXDC 2IPKD 1VQDA 1PYSB 2R61A 1B2TA 2OLSA 1ZHSA 1SE4A 2PW7A 3VPBA 3O13A 1RJPA 4DN4M 2SDFA 5IE8A 5KFJA 4UP8A 4ZLTF 2E74C 5BN3A 2KCCA 5LMUL 1V9PA 5KG1A 1XDNA 4Q8EA 3I2ZA 2UVWA 3OHBA 1CSPA 1EIYB 2UU9H 3QFFA 5JAVA 3MR2A 1V1QA 4JYAL 4LUZA 5JJIA 2AU0A 4JV5Q 5C6AA 1SCUB 1SDFA 3M7NA 4BXXH 4YQWA 4NXMQ 1IBLQ 5I9OA 2F4VH 3GP7A 3NELA 4DV3L 2NZHA 1JXLA 4NKLA 4PZ6A 3HZXA 1SYCA 3RB3A 3LNNA 2KCMA 1EY7A 1K3RA 4FXDA 2WFWA 1BOSA 1S0NA 1I5FA 2E8GA 1XNRL 1CQVA 1CHPD 4IUNA 4XIGS 5G3LD 2FKLA 5KG6A 1L1OC 1B33N 1PXUA 5LA6F 3GD7A 1B4OA 4KI0A 4RAZA 2R84A 3SVMA 2R8HA 1D5ZC 5D65A 3D8GA 1CM9A 2YRWA 2V59A 2KQ3A 3VYSA 1S0MA 1N32L 4Y7NB 2UXCQ 2AGOA 2QYZA 3PUWA 4HN7A 4DV5L 5CA1F 2D2CC 1TS2A 1TWCB 2IBKA 2JA5B 4EYHB 2VR1A 1STHA 3EJIA 4DV4L 4A3LG 1G2TA 4YWLA 1DOMA 1IL8A 4DK0A 1ET6A 3S9WA 1Z9FA 1I50B 3RLOA 4GNXA 1Y1VA 1S5BD 2Z0SA 5BPFA 4XYOA 3MWDA 4B3RQ 1PZJD 1Z2OX 5JEAJ 5KYIA 2HCIA 1II3A 5KGUA 4C5AA 2A68C 1SNPA 5EKKA 4UCOA 4ECQA 3RBEA 2NTSA 1M90C 1DXMA 2L1BA 5TSSA 1JB7A 2ICEC 1IBKL 4FP5D 3UFXB 1IKMA 3RD4A 4Y7NH 1R9TB 4UY8C 3SK6A 5FPRA 4ED3A 2JSOA 4EFEA 5KFMA 1IL2A 1EY9A 1D5MC 5D3IB 2UXDL 3K5HA 4A3DG 1TWCH 5G3LF 5C44B 2JA5H 1TA8A 2ATWA 2JJQA 1XTDA 2AWNA 1X56A 2B3GA 3IN5A 2RSOA 4Y8VB 2YCHA 1I50H 4ECYA 4XQQA 3BYYB 1Q7YC 2XGTA 4LFCL 3PW4A 1E1OA 1YVCA 4RB2C 3P7JA 2V4RA 2UUCQ 1LO5D 3S16B 3GTQB 1B9MA 2F52A 4A3FB 3FVQA 4EGJA 4TKOB 3KLRA 5CGKA 3F2DA 3PO3G 1V43A 5K5PA 5JJZA 3A74A 1R9TH 4ZK9B 1UUPA 2J0TD 4IUUA 3STBD 5C0XI 2VQFH 4RGOS 2HUGA 4X6AH 1XMOQ 5AFWA 2R8GA 3QZ8A 4TQUS 4B3TH 1CFMA 2HCCA 3R5XA 1X9NA 5C44H 4CKBA 2EZVA 3A55A 4DUZL 1IHZA 3Q8QB 2VPQA 4MV9A 3KDFA 4BA1I 4FNFA 5JJLA 1EZ8A 2A69C 3H4DA 1U9RA 2W8KA 4DV6H 4LUVA 1GHJA 3N6XA 4ME5A 4MTNA 1CKNB 4QJFA 2BR0A 5COYA 1U4PA 3I55A 3S16H 2VUMG 5BPHA 3GTQH 3GTGA 2MNAA 4P75A 3VR3A 5DGAA 2IL8A 4A3FH 2F0FA 1I6UA 3CRKC 1JKJB 4YWKA 5IP7H 4P73A 2UXBL 4IZOA 2NU9B 4KHPL 1K73C 2OH2A 3T4AC 4CJ0B 1NJIC 4R4TA 3URYA 2YU9B 4OHJA 4PMBA 2WB1G 3ORRA 5LMNL 4C1NK 4RAYA 2Y0SG 2XD4A 3I4MG 1SNQA 2R93G 3VA7A 2L55A 1ICFB 4BS9A 4WJ3M 1WSCA 2E2HB 4R8UB 3VR2A 3MC0B 1XX8A 1Y1VB 4RZQA 4K6DA 4GNXB 4B3SQ 3GQBA 4DR5L 2YYZA 2YRXA 3WO1A 3NK9A 3HOXG 4YIJA 1V4YA 1YNNC 5KFYA 4DNTB 4PDBA 2K52A 2Q8TA 2W6OA 3LX0A 2ALYB 2K5HA 4CHTB 5E3FA 5C1PA 4DR1Q 1LABA 1VQFA 1SN8A 2CH4W 2IX0A 1OO9B 2YU9H 1PX2A 2JA8B 4GKKQ 5K36H 1E2VA 1MI2A 5C3EG 1KEEA 3NBHB 2MUYA 1YBYA 3CKIB 2PQAB 1Q1EA 4X3UA 1LTTD 4JI2Q 1H9JA 4OL7A 1VQJA 1DOLA 4JI8Q 5A2QE 5JJKA 1WCMG 3FMCA 2E2HH 1Y1VH 5CV8A 1IKLA 1GSAA 3U9TA 1I94L 1XJVA 3KALA 3X3NA 3ERSX 3FEWX 3F8NA 4HJ8A 4X3SA 3D6WA 3RZDB 3UE0A 4F87A 2DGYA 3KOJA 4C1NI 3JAME 1Y8NB 3G71A 1QWYA 5L1LA 1LM0A 3PZPA 4LF8H 3OSOA 4YAKB 1S9FA 5IYDH 3GTLA 2I46A 1BBXC 2EIFA 1JIHA 3HB9A 1EIFA 2UU9L 5KX5F 2RCNA 2JA8H 4JV2A 2LY7A 1I6VC 5KT3A 1CQFA 3I4NG 4DR6Q 1I7LA 5DQIA 1EIHA 4O4HF 1RK6A 3T16A 1A3UA 1JOOA 1V1PB 1TWGB 3S1NB 5EOYA 3J7YW 1G291 2F4VL 5C5JA 1Z6HA 5C5MA 1BVSA 2AQ2B 2Q8RE 5BN4A 2CH4A 1HNZH 4O2AF 4DV7H 4K6LA 1A6XA 3DWPA 5LMUQ 2VOBA 1SLJA 3HOUB 1BCPC 4J9RA 2M9VA 2WP8J 1JE4A 4JG2A 4XXEA 3RZDH 4IRKA 5DM63 3HOWG 1DM0B 2QW7A 1QUQA 2EDGA 2N88A 2JEGA 1RD9D 4JYAQ 3CAMA 5C4HA 3CC2A 3R5HA 2XRSD 4U6PA 3MWYW 4KV6A 1B6SA 1F9SA 1OXSC 5HY6A 1ONLA 1YJ9A 3CCLA 5DLFA 4DV3Q 3A0JA 3MXGA 1CK1A 3SHLA 1TWGH 4IN3A 3S1NH 5C3XA 5C0XG 5GAGC 2N49A 3VR4A 1PFBA 4RA8A 3F2BA 5KG0A 4ECVA 2EJGC 3UI2A 1BGWA 4J8QA 4WFN3 1QZGA 1XNRQ 2XCLA 4XX0B 4HJ5A 2VQEH 5ELCA 2HVQA 3HOUH 3G6EA 4ILWA 3S17B 2E2IB 2UVUA 2JEFA 5FLXL 1NUCA 1S5DD 1DZ1A 3BDCA 3VR6A 1Y1WB 3PW7A 3RFCA 2XIGA 2J9GA 4RU9A 2GVBA 4EFBA 4WRDA 1TXYA 5KFGA 3J81L 1DOKA 2XCAA 4LW1A 4K2LA 1X6OA 4DNRB 3GIMA 2ZTEA 5M3MG 1JDBB 4EQOA 1L2FA 4DV5Q 4F50A 4J9LA 1DYQA 4FXGC 4RGMA 4X62Q 1BCPF 4ODGA 3T5HA 4GS3A 4GN3B 2OF1A 2BE5C 2DIKA 1KAWA 4DV4Q 2YL2A 4KY6A 1HZAA 4DAPA 5T1IA 1VQ4A 3E5SA 3S17H 2E2IH 4OX9L 3CP0A 1WH2A 2AKWB 4V190 4ZQ3A 2W9BA 3U4VA 3AU7A 1Y1WH 5D1PA 3CCQA 1EWCA 2FK2A 3G6JB 1QZHA 1VQ8A 1IBKQ 4YR0A 5DLQE 1VS0A 3N6RA 2WINB 1B3QA 3GTLB 1EZ1A 1SNOA 4RHRA 2W8LA 5KRUA 2A1AA 4UAIA 2QCPX 2B29A 2UXDQ 2HHHH 4IURA 4PNYA 1PRTB 1PLFA 3D0FA 4LUOA 2IJ0A 4X65H 2A6HD 2VQFL 4A3MG 4R7RA 3HS0C 4HCEA 2DNCA 4B3TL 5D1OB 5GAEC 2B2VA 4L6TB 1YZ6A 3ND8A 2Z8LA 4LFCQ 1UC9A 4N8X1 1S72A 5KFEA 3KYHC 1NR2A 1VQBA 2C35B 3MXPA 4DV6L 3PIOA 1CE8A 3TQYA 3GTLH 1BBUA 3H6MA 1RTOA 4IWYA 2XCPA 2L12A 4O1NA 2N8NA 2WE6A 4DLKA 3HOYG 3OTOH 2RA4A 4M8AA 3R23A 1RYSA 3DM1A 2SNSA 4KD4A 2KJXA 3T56B 2HT1A 2F0DA 3D6CA 3X3MA 5IWAQ 4J9PA 4BY1B 1A3VA 1E22A 3H0GA 2XGPA 2XC9A 3GTKA 4ID6A 1ZKOA 1X54A 4BY7G 2SEBD 4DR3H 4FYDA 1EIGA 5IT9c 3QG1A 4HNVA 5LOVF 4HIMA 4LF4H 5LMNW 2ASDA 4DA2A 5FJ8H 5HV6A 2R92A 4G7ZC 3CPFA 3PO2B 2UXBQ 3OSPA 1RF2D 1BXTA 1I4HA 5KNBA 4HJ7A 4KHPQ 3F1ZA 5DQHA 5C4JB 4DAYB 1JJCB 4LNQA 4DR4H 1BNZA 2PZTA 2PZUA 1LACA 1UWVA 4RNMA 5LMNQ 3Q22A 3BQ1A 1L2ZA 1MHWC 3RGZA 4TV8F 1F9QA 3CCRA 1PFSA 4BY1H 3C1EA 1VQHA 3I90A 4JPBW 4X64H 4EBDA 4ZUJA 4F8MA 2B2VC 5H80A 4DL6A 2JXMB 1RJQA 2VY3A 1BKBA 1UNSA 3TSSA 4DR5Q 3KLWA 1WTWA 3TN2A 3N40P 1TS5A 5FLMG 3H91A 2HQEA 2V4DA 2O03A 2RVLA 3G6VA 1E1TA 1U0LA 1I4GA 2F0OA 4WJWA 2RCFA 3PO2H 2GPSA 3U9OA 2OCEA 1AFPA 5KG5A 1E4GT 4MN3A 2Q2HA 4DK1A 5C4JH 4XYLB 5CC4A 1XPOA 4A3CG 5D3DA 3MFIA 2G9HD 2FB9A 4ZAIA 1EU3A 5EKLA 5EJWA 4LF8L 4LH7A 4H7BA 2J6SA 4UDUC 4MV8A 1PK8A 4GOPA 1A2TA 2LS01 1HH2P 1Q8KA 1RDPD 1TT2A 3CMEA 1KJ8A 3KF8A 5ELNA 1CA5A 1I94Q 1K0SA 2JA6B 1YJWA 3WDNA 5E4XA 3CMAA 5KFVA 3DEOA 3UDFA 4YJ2F 1SAPA 1HNZL 4DV7L 2G9DA 3T13A 2K05A 4DK3C 1X3EA 4E6IA 1OTCA 2AMCB 3ULJA 4PWQA 1KL9A 3W1GA 1N32H 5KFHA 2UU9Q 1XYIA 3NENA 3TP8A 1VQPA 4JI0L 2AGPA 4K0KH 3HKSA 5M3FB 4Q44A 3K0YA 2O5JC 1IW7C 1B8AA 2NUCA 1PDQA 2WKCA 3FPUB 3OWEB 3Q8DA 2DJGC 1VQNA 1UC8A 1PTOC 2QGQA 2F4VQ 3MXUA 5C4XB 2JA6H 2AWOA 2CW8A 5I6WA 3BZKA 4AYBB 1TKWB 5KFOA 2IW3A 1A0IA 3HFZB 4POFA 2VQEL 3K80C 1WTRA 1LTSD 4YCWA 1IXRA 3TS2A 4DAVA 1EYCA 4EBCA 4FBUA 1OXXK 3JAMc 5KT2A 1EWIA 2B63B 2L9HA 3IFTA 3MFGA 3OW7A 3RLNA 5M3FH 5CBEE 1STBA 1F2YA 2GN5A 4GOPC 4IFDI 3CCMA 5FLXW 3TP6A 1A3TA 3CHBD 5ELOA 5C4XH 1SXTA 4HAEA 1RCVD 1JCKB 5EWGA 3GIQA 2IX1A 3J81W 2C9OA 4YCVA 1AUVA 3RB4A 2EYMA 2RDHA 2K5WA 3JC66 1BXRA 1Q86C 1GUNA 2V4QA 2RHSB 3OPOA 1M8AA 3TRZA 3S2HB 3A5ZB 4F4YA 1LTBD 1QNUA 3VYTA 1HTLD 2B63H 4AQYH 2R8KA 2ID0A 2HDLA 4LF7H 1BBWA 5DLGA 1KAAA 4QCLA 4RMFA 5KFZA 1SROA 1E24A 1HR0H 2CKZB 4DUZH 3RB0A 3BDLA 4PZ7A 3ICEA 4O3OA 4LF9H 4IJLA 2GLTA 4KJNA 2F3IA 3KF8B 2V58A 4RNNA 2NZOA 2HHHL 2ALZA 3UDGA 4JBWA 4X65L 3J80E 5CORA 1VQKA 1TS3A 4YWMA 4HMJA 4E4TA 1KC7A 5L37A 2NB0A 1ZEQX 4HNTA 4LFBH 2JN4A 5E7NA 1K9MC 3BABA 4RUAA 4DL5A 3S2HH 1MBYA 2ZM6H 4ULLA 2M05A 4EQPA 1PH4A 3OHXC 3Q8RB 2EYOA 2ZJTA 2BOSA 4AH6A 3FHWA 4QGUA 1BQQT 4A93B 1SMYC 4H0LC 3CQZB 4TUYF 5FLXE 1FR3A 3K5OA 2YZNA 3OW2A 4DV1L 3OWFA 4CDDC 4L1KA 2UVVA 2VQFQ 3PR4A 3OTOL 1ZXTA 4B3TQ 4GN4B 3TZDA 5GQOA 4FF4A 2JEIA 1TWCA 2F0SA 1SMXA 4RGNA 2JA5A 3JSLA 3ETHA 2Z6KC 2BQRA 2K5NA 4RG1A 2BH2A 5L1JA 2P5ZX 4DV6Q 2DJFC 1Q90A 3K0XA 3GTMB 2Z9HA 3CVZA 4KHVA 1BF4A 4DR3L 4LF4L 4O4IF 4A93H 1BDOA 2DY8A 3MFYA 3SE7A 4EVOA 3CQZH 1YJNA 1O7ZA 4KD3A 1AP0A 3JAMi 5EQ0A 4DR4L 1R9TA 5CV9A 1TVXA 4LF6L 3TBIB 1WTQA 2K04A 5CA0F 2R8IA 3NWTA 4L5TA 1CUKA 1NCVA 5HBRB 4NLGA 1C8CA 3RV4A 1TR5A 4M1UB 1M7JA 1LLRD 2CQYA 3KAKA 3GTPA 2IY5B 1SE8A 1PH3A 3NEMA 2NN6I 4X64L 2NU7B 1EY0A 1FYCA 1WFQA 3D4WA 3K7UC 1PH2A 2PMZB 1QE6A 1WTVA 4QIWA 3NPPA 1CQIB 4ED1A 3GTMH 1NY4A 1W3SA 3I72A 2K03A 5IGCA 4ETSA 3GTQA 4Q0FA 2XWJB 2RGVA 4FDBA 3AEVA 1PH7A 3BQ2A 1U5KA 1MJEA 1J8IA 1AUXA 1KD1C 2LMCB 4JI7H 4EQNA 2CW0D 2ZJRA 3N41B 1K28A 4CC6A 1YNJD 1E0BA 4IFDG 3C3LA 1YEZA 1RJRA 5KT5A 2K7VA 1GSHA 3AFQA 1Q1BA 2GVAA 2PI2A 2ZXRA 3TREA 3I4LA 2M00A 2JP1A 1ET9A 3K5IA 2R7DA 4EQ5A 4C3IB 3HKZB 3NHHA 1E7ZA 1CKNA 1H9KA 1Q12A 1HTPA 4IOCA 1LT3D 2W57A 3R2IA 2B8FA 4KLKA 3GTOB 4O3SA 3U9SA 1EYZA 4O3QA 3MAQA 3I12A 3WOEA 1UNNC 4LF8Q 3EROA 1XXGA 4EGQA 5KFWA 4HIOA 1K8AC 3NP8A 1RIPA 1STAA 1SYFA 2F0UA 1UEAB 1EYDA 3GV3A 3UE1A 1CI3M 2YU9A 4K0KL 1PFNA 1FNVA 4YBZB 4NMZA 2C22A 2OQKA 4UHVA 2D62A 5I2XA 2HIXA 2Z4HA 5IP9G 2I0QA 4QWEA 2FK1A 3NSWA 3SK8A 3M4IA 4R8UA 2E2HA 4F4XA 3HG9A 2B8GA 4C3IH 1HNZQ 4DV7Q 4BA2I 1KDCA 1N56A 1ZHQA 2WAQA 3EQLC 1ZETA 2L5TA 4MZ9A 3GTOH 3BJUA 3CCEA 2VPSA 5DM73 4A3EB 2K33A 3N44B 1YIJA 4LK1C 2SCUB 1RJTA 1OXTA 1PYWD 2NVYB 3ER0A 4QUCA 3ZJYC 3RTXA 1P8LA 3G7LA 5ELFA 4A3GG 1QCBD 4HEDA 3MEFA 5JUMA 2NTTA 3NBHA 3CU7A 2PQAA 3GTPB 2C28A 4OX9H 4RCOA 3PCOB 1O7IA 4QIWB 5I4DA 3WOFA 1RYRA 3WO0A 1D8LA 4XDXA 5LP6F 2AQ3B 2VQEQ 1IOVA 1LTRD 1AH9A 3EBEA 3OMCA 1JLLB 2MHVA 1HUMA 3MHBA 4A3EH 2FMAA 1VQAA 1Q8IA 5I2YA 1B1ZA 2NVYH 5LL6S 4BBRG 2VUGA 5CAEB 1LUZA 2EYFA 2I80A 4AQYL 1W2BA 1WTOA 4LF7L 2CVRA 3UDIA 3STBC 4QUFA 2EYHA 4C2MB 4APMA 1HR0L 5JPMC 3U58A 3GTPH 3L7ZC 1TWGA 1V1PA 4F4WA 3R8BA 4LF9L 4QWBA 3R5FA 2K6AA 5LL6b 4GNXC 3CXCA 3KUPA 1JOQA 4BBSG 1Q3LA 2NN6G 4A3IG 1N36H 4K2KA 4K5VA 4EGVA 1F2MA 4LFBL 5KFPA 5AJ3L 2FMMA 5JQWA 2B39A 2ZM6L 1HNWH 4FF1A 1STGA 4R8NA 1AZPA 5IGEA 1C3OA 1BR9A 1VAJA 2CW7A 2R7FA 1S0OA 3EPGA 3C2PA 3H94A 1MSHA 1KRSA 4C2MH 4UP9A 4NB3A 2HHHQ 3A8IE 2QKIC 1E2WA 4K5XA 3K57A 3H0GG 3H3VH 1GJXA 5KFSA 4HYKA 4X65Q 2FPGB 1DV2A 1OXVA 2R7MA 5JVDF 3W1BA 1M0TA 1X32A 3IAYA 2WAQB 1R4PB 5D14A 2ICIA 1ESFA 2J6UA 3NTIA 3E9HA 4MV6A 2E2IA 1LV9A 5JPNC 2R92G 5F9NA 3T53B 2X0SA 1EQVA 1A9XA 1Y1WA 3W2DA 1T9HA 3Q8PB 1JOKA 4ZCKA 2BDNA 3EVQA 5GROA 2C5CA 4JI5H 3RUPA 1WOCA 3HOZB 1EQQA 2IHEA 1N34H 3OTOQ 1JT8A 2YS7A 3L3OC 2ATLA 4DL2A 4EEQA 2F0NA 1QG7A 4B08A 4YP3A 1EL0A 1IZ6A 1VF7A 2EYPA 1W93A 3HOVB 3ZYYX 2PZWA 2BDOA 1QVFA 3QR8A 3SEBA 1S97A 1ENFA 2QEXA 1JDEA 3J80c 4ED7A 3L2PA 1KNAA 4GN5A 1X3GA 2W9AA 3K5LA 3RNUA 4O4LF 1GUSA 4DR3Q 3OHAA 4LF4Q 2JQOA 4RKLA 1EUJA 5KFQA 5J1ZA 1X55A 1GUWA 3CD6A 5LHY1 3KFUA 4IAJA 1OWTA 2BH8A 3HOZH 5IGGA 1WI5A 2QDLA 4DR4Q 1O75A 4A3JB 2W71A 2MGSA 5CYUA 4IRDA 1JJGA 3BG3A 3S24A 2RDJA 3TINA 4K8IA 4JI7L 4ED2A 4S3SA 1TWAB 3MWEA 5FD5A 4OO1H 4JCVE 4X3TA 4ZUIA 3PW5A 4X64Q 3HOVH 5IYBG 2L4NA 4DPGA 2R7ZB 1DV1A 1CA6A 4L5SA 5D1OA 1H9SB 3PR5B 2F0PA 2QA4A 2XNAC 4JI6H 4NPSA 5CV7A 4ZRZA 5IYCH 3KBGA 5L9XA 3NGDA 1JX4A 3N42B 2UXCH 1SEBD 4JI0H 3I7FA 1DIKA 3T51B 1MJCA 3V05A 2DZDA 3FMAA 3UQ8A 2E75C 4LH6A 3KHHA 1D1KA 2C2RA 2R86A 4A3JH 4DL4A 1TQOA 2IP4A 2NVXB 5KT6A 3S1QB 4QWCA 5JOBA 4H13C 4G3IA 2MO1A 1TWAH 3D31A 2EY1A 1K8OA 5JEAH 3CCUA 3MFHA 3GIJA 2R7ZH 1MD2D 3U4ZA 5EBDA 1CKMA 4ZHQF 1IYJB 3TDQA 1J9OA 1JWUD 1GYFA 2H5XA 5K2MA 2I07B 1K1SA 1Y8PB 4DAYA 2R6FA 1WYDA 4N9TA 4OGQC 1PRTD 5ELDA 2NVXH 1N32Q 5EZYF 3S1QH 3LMLA 4K0KQ 1ILPA 3KAJA 4BXXG 4O0AA 4LFAH 3H3VI 2NU6B 3ERQA 5FD6A 1EQTA 3RZOB 3FKIB 4A3KB 3PVXA 5M5XB 2YTXA 4QWDA 3MR5A 1F2ZA 3IRBA 2OTLA 4RZRA 5KFXA 1JC7A 3GV6A 2FPPB 1SR3A 3PF5A 2VNUD 2KSWA 1KDAA 2AUKA 2YYAA 3SE0A 4C3JB 3MWMA 2CQOA 1TY0A 2X69A 2E5LH 1D5XC 3J80i 1ENCA 3BQ0A 1L0XB 3ND9A 2QF7A 5CV4A 2WDTA 3ETJA 3I4OA 2ASLA 4FBTA 2JA7A 2FJZA 2PYKA 3M85A 1VCIA 4HSVA 5HGTA 5BR8H 2NVQB 1HCZA 3V2TA 4ZI7F 3DUZA 2I5MX 4CKCA 3RZOH 3FKIH 4A3KH 5KFTA 4DU9A 5M5XH 1LTID 4JOIA 3N8DA 5C4ZA 2A6HC 2A74C 3L4KA 1PVOA 3T1HH 2HVSA 1Z7TA 2JA6A 3K3PA 1K0RA 4HQ6A 4C3JH 4R8IA 4J9QA 1LT6D 2YZMA 3K58A 2VZAA 1K83B 4CDEC 1PRTF 1HR0W 2VB2X 3A7AB 3Q24A 2AQ1B 3H4BA 1N36L 3BAAA 2XTIA 4DV1H 3C0FB 5KFKA 2O4XA 2GA4B 4JBJA 2KOLA 4RWSC 4AQYQ 4LF7Q 2NVQH 4JC0A 3W5OA 2MPMA 2B2TA 1KBLA 4MAMA 4B3MH 1HNWL 1R4QB 2Z4IA 1HR0Q 4LWCA 4PZ8A 1SFOB 2F0TA 4HR7B 4DUZQ 4J15A 4FF2A 1EUCB 4PV1C 4LF9Q 2WTFA 3CPWA 2Q2TA 1Y69U 3KJOA 2JA5G 4XTCS 4OEMB 4JBKA 4DR2L 1P16A 1W6JA 1XMQH 1KC8C 4AYBA 4YAJB 4EG0A 1K83H 1NNXA 3CC7A 1GVPA 3AYHB 4LFBQ 1CS0A 2F0GA 5AJ3Q 3TIGA 3RIZA 1IBMH 2ZM6Q 1XNQH 1O80A 3S15B 2F4IA 4MV4A 2PPBC 4LF6H 2B63A 1QVGA 1EY8A 4GC6A 3C46A 1YNXA 1M0WA 5DG7A 1IOWA 4ECWA 1SFOH 1Q46A 1UE7A 3F2UA 4JI5L 3OUZA 1L0YB 4JOIC 4B9XA 5F2DA 2ASJA 1N34L 5KFIA 1OXUA 5C44G 1UAPA 3RUZA 3OYYA 4UCVA 2A6ED 2RGRA 5IYZF 1D6EC 1O7YA 3G6XA 4KKTA 5DQGA 2NWGA 1XPRA 2SNMA 4EEYA 4IRCA 4TSSA 5C5LA 4NW2A 1PA6A 1V1OA 3A5UA 5FO8B 5GONF 5I9PA 1C7YA 3A7LA 3TP7A 5KFBA 5KT4A 2EVBA 1G6PA 2FP4B 4A3FG 4OIKA 3S15H 2JA7B 4M7EA 1SRUA 1X3FA 5IP7G 5LYJF 4UCTA 2ASBA 4A3DB 1KJQA 3G8CA 3TIIA 5HURA 3TQTA 1STYA 4JI3H 4A3LH 4L8JA 3M4YA 3RLFA 4GZYC 1LT4D 2DLNA 3QOLA 5KNCA 2W9CB 4DV2H 2K5VA 4QY7A 2L15A 2I5LX 4IO9A 1TY2A 3BU2A 2PQEA 1FKAH 5C0XJ 1K8GA 4O3PA 1KJ9A 3BA8A 3DHQA 1WD1A 4RKBA 4IR1A 1EY5A 1GUOA 2CWAA 2TMPA 1FNUA 2UUAH 2IT1A 4XQNA 5M5YB 1KNEA 3PO3B 1PV4A 1SE3A 5BMVF 3C1FA 2BQUA 2EOTA 2J6TA 3EFXD 4JI6L 1J6QA 2BA0A 1FVIA 3E6ZX 5IT9L 4C3HB 2JA7H 4DUYH 4JBMA 1RL2A 1NAPA 2KHJA 1VF5C 4ECUA 1LTGD 3BDOA 1Q81C 4A3DH 4HNUA 1EFWA 3MA2B 3NTHA 4PG3A 2UXCL 3N52A 2AQ4A 5DNFA 4JI1H 2ZT9C 1PH9A 3PV0A 4A75A 3CQZA 3JZIA 3GIIA 4JI7Q 3A8JE 5K36G 4KKSA 4QL5A 4IUTA 4MNOA 3KTMA 3RR5A 1DD2A 2VUMB 1JB3A 1D7QA 1I4RA 1VQ6A 1SYBA 4Y52H 3PUXA 1HNXH 1Y1VG 1CSQA 1CKOA 2ZJPA 4B3RL 2B2YA 3WNZA 2W7PA 4J6HA 5M5YH 1RTNA 4YCUA 3H09A 4A3BB 3PO3H 3N43B 2K4KA 2F0KA 1NMFA 1O78A 4B9WA 4C3HH 3GTMA 4AIMA 3G6YA 4X62H 4ME3A 1SYGA 2KEEA 2FXQA 2WB1B 1Q82C 3HXLA 4KHZA 1JWSD 1ICWA 1S4ZA 2ZTCA 2BQ3A 2ZXOA 2Y0SB 3A54A 4K5WA 3I4MB 4P72A 5IYDG 4OONA 2V1CC 3FDTA 4DXGA 2R93B 4R9WA 2DPIA 4U673 1LTAD 2JA8G 3IG0A 5FOBB 3M3YB 4FVMA 4HJ9A 2VXWA 4LFAL 2VUMH 3RBDA 3HOXB 3PMFA 3M4PA 3DWQA 3OMGA 1O7LA 2A5HA 2B2UA 3DEPA 4I4TF 1HZ9A 2RSNA 4RGTA 4APVA 1EOVA 4A3BH 4OWTB 2PMZA 5KFDA 3T5JA 5DG9A 4DV0H 2JE6I 3I56A 2AGQA 4IPGA 1K1QA 4UCUA 3PW2A 5ISRA 4G4KA 2LKVA 1IYVA 1AEXA 2D9UA 1UE5A 3VYUA 2E5LL 2F3WA 5C3EB 4JI4H 1XMOL 3I4MH 2R93H 1PTOB 3A56A 4A3JG 4DFAA 4HIDA 1EZ6A 1GLVA 1I3QB 4DL3A 3BVMA 3HRZC 1WCMB 4ALPA 3M3YH 1FD7D 2O2LD 5BR8L 3VMMA 3I70A 3KF6A 2PVPA 1V51A 4YHHH 2PCFB 4ECTA 3HOXH 4KK7A 3RV3A 4MIUA 5JEAG 1C4QA 3EN2A 2FJ2A 4O3NA 4MHEA 2B2YC 3M7GA 5IOCA 2JEBI 4OX9Q 2FPIB 5T1GA 3EA6A 3PF4A 3HOUG 4FS1A 3T1HL 2CZGA 4QW9A 1A8VA 1HJPA 5A2QL 3HKZA 4DF7A 3HP3A 4J9KA 1I6HB 5E4WC 1GO3E 3GTOA 5C3EH 3I4NB 2VA3A 1JE5A 1D2BA 1MGSA 1WTHA 1PTOH 1I3QH 1VQIA 5KNDA 1S03G 2MFIA 1WCMH 2KCTA 3JAML 2HD3A 2VL6A 1U4RA 3PUVA 1TWHB 4MTDA 4B3ML 3GO5A 2XRQD 1M6VA 3J81E 2JA9A 4A2BA 3HOWB 2OT2A 3T5KA 5IGBA 2C2DA 5E1FA 4ZYSA 3IL8A 4C5CA 2OWOA 4C5BA 5CMDA 5CB4F 1XMQL 3KBXA 1I6HH 1Y1WG 1N36Q 2BCOA 4L63B 3I4NH 1ZQ7A 2W7OA 5KYLA 3V4ZA 5L1KA 1VKZA 1B04A 3NWSA 3OIQA 3LWEA 4KTAA 5BN5A 2EJFC 1IBML 4P71A 2NVYA 5A35A 1HNWQ 1XNQL 2M2LA 2UVRA 2CQAA 4QWAA 1TWHH 5J3BA 2UUBH 2I5HA 1T36A 1TS4A 3R93A 1GOZA 5KFAA 2XSCA 1WTPA 3SDZA 2QEJC 4I7ZC 5IGFA 3HOWH 2EQSA 1T3NA 3KLSA 5C8YF 2W6ZA 2X6LA 1KJJA 1T5EA 1FGBD 2RKSA 5F9LA 1L1OA 1KLGD 1C30A 3RN5A 4X66H 2FFKB 2FMCA 2QK4A 5KKNB 3QZ7A 4CDFC 2OEOA 2C00A 2K75A 3UDXA 1NE3A 1VQCA 5KG7A 2YV5A 3W3AA 5M3MB 3F8TA 5I47A 1HA6A 4YR2A 4LF5H 5C0XH 3CCVA 2K01A 4QIWE 5FK9C 4EBEA 4WORA 4JI5Q 1EY6A 3BG5A 3TMEA 5EKIA 4GC7A 1H9RA 1BJTA 1N34Q 3KF6B 2CW0C 1EY4A 2N78A 2R6GA 4JI3L 3QO2A 4C2MA 4JW0A 2K14A 1YNJC 4F4ZA 4DV2L 3GDEA 4OELB 5CR3A 1SNCA 3OIPA 1SSOA 4N9PA 3JRWA 4ED0A 3Q2OA 3PW0A 5M3MH 3TP5A 1PMRA 2QILA 3K7AB 1VQLA 5FJ8G 1EWHA 2KVMA 3AMUA 2UUAL 4YY3H 2F0EA 1F2LA 2VA2A 4DAMA 2XWBB 2DNEA 4J9OA 4NXNH 2R3ZA 2PI2E 4A3MB 4DUYL 2Q8IB 1H95A 3CF5A 4FU0A 2BA1A 2H1EA 3DF7A 3Q1KA 2JEAI 2DPJA 1NSNS 1W96A 4JI1L 2EPBA 3MTSA 2D0OA 2F0QA 3S1RB 4BY1G 5IT9W 3GIDA 3A8KE 4A2AA 2HDMA 1JORA 2X6GA 1KRTA 4IJHA 2ZDGA 1J5EH 4TV9F 3DMUA 3PGZA 2RDFA 1SNDA 3E9IA 3BVZA 3K81C 4JI6Q 1HNXL 3J7A5 3HOYB 4I55F 3K7AH 5J2UF 3M9NB 1EUDB 4WD3A 3PO2G 1G8ZD 2F0JA 3VPCA 2VB3X 1SE2A 1GUGA 3K3VA 1SJED 4JI0Q 4A3MH 2RHQB 3EIVA 1C9OA 4RB3C 3HGBA 4X62L 3Q23A 1YITA 4IPDA 1QOHA 2LXKA 4IUPA 2WAQE 1KQSA 1U4LA 3S1RH 4BY7B 3H3VC 1KLUD 3EYYA 1V8QA 3AB9A 2IA6A 2PN1A 1VQEA 2DUDA 4CJ1B 4KY7A 2K5DA 3Q0AA 1L1OB 2A68D 1HPCA 4R1JA 5ELEA 2GPWA 4LAAA 1WR2A 1FJGH 2KBNA 5JVH3 3HOYH 3TS0A 1WTXA 4WJ4A 1TWFB 3J81j 5L1IA 3MXNB 5T14A 1EOTA 4DV0L 2JA7G 3IFDA 1VMCA 1A15A 4KKUA 3H40A 5DEHA 2HQLA 5KIXA 1XWEA 4PMCA 3MJFA 2MCTA 1N33H 4JI4L 3J7AF 2K28A 4BY7H 4LFAQ 2Z1CA 1F9RA 1EFID 2WACA 4A4IA 2JYOA 4P74A 5IT9E 1SNMA 2KHIA 1TWAA 4TVAB 4FS2A 4HJAA 5IY0A 2EY6A 1LYLA 2JA6G 1EU4A 3SK5A 4YHHL 1WJJA 2R7ZA 1H9SA 2LFNA 1ML0D 4ECRA 2PBZA 2A8VA 3V6KA 1TWFH 1E2ZA 1BNCA 5LL6X 1AN8A 2MJ8A 5HGQA 3NQTA 2K32A 2R7NA 1HQMC 4UP7A 1VQ7A 2E5LQ 3OUUA 1FL0A 1KJIA 4J9SA
chains in the Genus database with same CATH topology
2YTYA 3PUZA 1L0WA 4EX5A 3CMAA 1HZBA 3UDFA 1YHQA 1HNZL 2YTXA 4DV7L 3IRBA 5IWAL 3FP9A 5M3FG 4DK3C 5BR8Q 1PH8A 1X3EA 1OTCA 2OTLA 3CC4A 2AMCB 1SR3A 3ULJA 3PF5A 2VNUD 2D0PA 5FLMH 3M4OH 4R4QA 1KL9A 3W1GA 2UU9Q 4DR6L 3NENA 1EYGA 2CQOA 3T1YQ 1VQPA 4JI0L 3HKSA 5C4XG 2ZJQA 3J80i 3CW2C 1VQDA 1PYSB 4A3CH 1B8AA 3T1HQ 4AYBG 3Q8DA 1VQNA 2PNHA 2QGQA 2F4VQ 3I4OA 5IE8A 4UP8A 4A3BG 3M85A 1VCIA 5LMUL 1V9PA 2JA6H 2AWOA 1YHBA 3I2ZA 2I5MX 3BZKA 1AE3A 1JMCA 1CSPA 1EIYB 3RZOH 4O0AA 3FKIH 4A3KH 2B63G 1A0IA 3HFZB 1V1QA 4POFA 4LUZA 4JOIA 5M5XH 4DV1Q 4JV5Q 2VQEL 4JYAL 5JJIA 3K80C 2A19A 3E0EA 3LGJA 3M7NA 4BXXH 4NXMQ 1MIUA 4IPHA 1PVOA 1IBLQ 1C0AA 4YCWA 4GLXA 4B3MQ 1IXRA 1K0RA 3NELA 3TS2A 4C3JH 2NZHA 4DV3L 1OXXK 3JAMc 1EWIA 4PZ6A 2UUBL 2VZAA 3RLNA 5M3FH 4IFDJ 1HR0W 1UEBA 2GN5A 2KCMA 4GOPC 4IFDI 4GLAC 1K3RA 3CCMA 3J7ZC 2WFWA 2RF4A 1EQRA 1I5FA 2E8GA 1N36L 2XTIA 1XNRL 4XIGS 1XMQQ 1Y14B 5ELOA 4JBJA 5C4XH 3K8AA 4AQYQ 4LF7Q 2NVQH 4QQBX 1L1OC 4JC0A 3W5OA 4X66L 1VQOA 3GD7A 2IX1A 4KI0A 1HNWL 4YCVA 1HR0Q 4LWCA 4PZ8A 3CCJA 1IBMQ 4DUZQ 4J15A 1XNQQ 4LF9Q 3JC66 1Q86C 4LF6Q 3CPWA 2Q2TA 2RHSB 3KJOA 2JA5G 4LF5L 3TRZA 4XTCS 4JBKA 3A5ZB 4DR2L 1N32L 2UXCQ 1P16A 5FLXc 1KC8C 1VQ5A 3PUWA 4DV5L 2B63H 2ID0A 2Q2UA 1BBWA 1K83H 3CC7A 4RMFA 1GVPA 3AYHB 4DK6C 1SROA 4LFBQ 1E24A 5AJ3Q 2CKZB 2IHFA 2ZM6Q 4DV4L 4A3LG 1HZCA 4PZ7A 3J81c 3ICEA 4YWLA 4IJLA 1Z9FA 4GNXA 2F3IA 3KF8B 3RLOA 2Z0SA 2NZOA 2VS1A 1QVGA 2HHHL 1YNXA 4JBWA 3UDGA 4B3RQ 5JEAJ 4X65L 1SFOH 1Q46A 1UE7A 1GM5A 4YWMA 4JI5L 1VQKA 3DLLA 4JOIC 1KHIA 1M90C 1N34L 1IBKL 1JB7A 4YY3L 4A93G 5E7NA 1OXUA 5C44G 1K9MC 3S2HH 4Y7NH 3KDFB 4UY8C 1PH4A 4JI3Q 3OYYA 4NXNL 1IL2A 2UXDL 4AH6A 3FHWA 4QGUA 1XPRA 4DV2Q 4A3DG 1PA6A 1TWCH 3A5UA 1C7YA 2CCZA 2JA5H 2ATWA 2JJQA 1XTDA 2AWNA 1X56A 2B3GA 3OW2A 4DV1L 1G6PA 4A3FG 2VQFQ 3S15H 2ZTDA 1SRUA 1I50H 3OTOL 1X3FA 2XGTA 5IP7G 1Q7YC 4OWWB 4LFCL 4B3TQ 2ASBA 1E1OA 1YVCA 1KXLA 4GN4B 1J5EL 2UUAQ 5GQOA 2UUCQ 1SMXA 4A3LH 3RLFA 2F52A 2Z6KC 1S40A 4DUYQ 2K5NA 2K5VA 2L15A 4QY7A 4RG1A 2I5LX 3KJPA 2BH2A 4DV6Q 4IO9A 3BU2A 3F2DA 1V43A 3PO3G 1R9TH 3A74A 5C0XJ 3K0XA 3AQQA 1K8GA 4JI1Q 5C0XI 3STBD 2Q2IA 4X6AH 4DR3L 1XMOQ 4LF4L 4TQUS 2CWAA 1NMGA 4A93H 3GTGH 1X9NA 2IT1A 5C44H 3CQZH 1YJNA 4DUZL 1PV4A 3ULLA 3JAMi 4JI6L 1N8RC 1J6QA 2BA0A 1FVIA 3KDFA 4BA1I 4DR4L 5JJLA 4LF6L 2JA7H 2JK8A 3WWVA 4JBMA 1RL2A 2KHJA 3SGIA 4L5TA 1CUKA 1HNXQ 1Q81C 4A3DH 1UE1A 4LUVA 1M1KC 1EFWA 2UXCL 4MTNA 4PG3A 1CKNB 4QJFA 3S16H 3I55A 4HIKA 1FJGL 2VUMG 3GTQH 1PH9A 3PV0A 2MNAA 4P75A 4A75A 1SE8A 1PH3A 4A3FH 3NEMA 2IY5B 2NN6I 4X64L 4JI7Q 1WFQA 1UE6A 3K7UC 4YWKA 5IP7H 4P73A 1PH2A 3PSIA 2UXBL 4QL5A 5K36G 4KHPL 4PMWA 4MNOA 1K73C 3RR5A 1KIXA 3GTMH 1NY4A 1W3SA 4O2DA 1NJIC 4R4TA 1VQ6A 1D7QA 4Y52H 1QVCA 3PUXA 5GAHC 1Y1VG 1CSQA 1CKOA 2WB1G 4FDBA 2ZJPA 1PH7A 3AEVA 5LMNL 4B3RL 5M5YH 1U5KA 4YCUA 1MJEA 1N33L 3PO3H 2Y0SG 3I4MG 1VQGA 2K4KA 4UPAA 1NMFA 1KD1C 2R93G 4C3HH 4AIMA 4WJ3M 2ZJRA 4POGA 1AE2A 4ME3A 4R4IA 1Q82C 2FXQA 3G48A 4GNXB 4B3SQ 2MO0A 4KHZA 4DR5L 2YYZA 2ZTCA 3HKZG 3S1MH 3J81i 4IFDG 1YEZA 3HOXG 4P72A 5IYDG 4OONA 2V1CC 4DV0Q 3AFQA 2K50A 1Q1BA 2GVAA 2K52A 2PI2A 3TREA 2JA8G 2ALYB 2K5HA 4HJ9A 2R7DA 4EQ5A 4LFAL 4JI4Q 4DR1Q 2VUMH 1E7ZA 1VQFA 1CKNA 1SN8A 3M4PA 1Q12A 2IX0A 4IOCA 2YU9H 1LTLA 4KLKA 1HZ9A 4GKKQ 4GKJL 4OO1I 4APVA 1EOVA 5C3EG 4DR7L 4A3BH 4OWTB 3NBHB 3CCSA 4GLVB 1YBYA 2PQAB 4LF8Q 1Q1EA 4YHHQ 2JE6I 4JI2Q 4HIOA 3I56A 1K8AC 1VQJA 4IPGA 4JI8Q 1QUQB 2E2JH 5JJKA 1WCMG 2E2HH 3UE1A 1RIPA 1Y1VH 3S14H 1UE5A 4K0KL 1I94L 2E5LL 1XJVA 3B6YA 3PUYA 3ERSX 2EXDA 1XMOL 3I4MH 4HJ8A 2OQKA 2R93H 2D62A 2LSSA 4HIDA 4A3JG 2HIXA 3UE0A 5IP9G 2I0QA 2DGYA 3KOJA 4A3EG 4ALPA 3M3YH 5BR8L 3KF6A 4C3IH 5M5WH 3G71A 1LM0A 4DV7Q 1HNZQ 4BA2I 3HOXH 5IYDH 1A63A 5JEAG 2EIFA 1EIFA 3EN2A 1N9WA 4MZ9A 2RCNA 1NBWA 3BJUA 4AYBE 2UU9L 2JA8H 3T1YL 2JEBI 3CCEA 4OX9Q 4L5RC 3I4NG 4DR6Q 3PF4A 1YIJA 3HOUG 1OXTA 3ER0A 3ZJYC 3T1HL 1A8VA 1HJPA 1G291 1P8LA 1PH1A 2F4VL 4A3GG 2WB1E 1BVSA 1GO3E 5C3EH 2Y0SE 1JE5A 3MEFA 5LMUQ 1SLJA 2NVTH 2YTVA 2WP8J 2PQAA 1I3QH 1VQIA 4JG2A 3RZDH 1MKHA 2MFIA 1WCMH 2KCTA 3HOWG 3PCOB 1O7IA 1QUQA 2VL6A 4JV5L 3PUVA 4JYAQ 3CAMA 1PH5A 1D8LA 4NXML 3CC2A 2VQEQ 1IBLL 4B3ML 1ASYA 1AH9A 3GO5A 3EBEA 5IP9H 2JA9A 2E5LQ 1OXSC 5HY6A 2CWPA 1YJ9A 4A3EH 3CCLA 4DV3Q 1VQAA 1GKHA 3A0JA 4H02A 1JJ2A 3GTOH 2UUBQ 2NVYH 1TWGH 4BBRG 3S1NH 2OWOA 5C0XG 1LUZA 5GAGC 2N49A 3F2BA 1XMQL 1I6HH 4AQYL 1Y1WG 1W2BA 1QZGA 1N36Q 4LF7L 1XNRQ 3I4NH 1X65A 3UDIA 4OXPA 3STBC 5GADC 4HJ5A 3HOUH 3G6EA 1HR0L 4X66Q 1VQMA 3U58A 3GTPH 1IBML 3L7ZC 4P71A 1B7YB 1HNWQ 1XNQL 4A3GH 4LF9L 1TWHH 5J3BA 4GNXC 2I5HA 2GVBA 3CXCA 3G4SA 2AHOB 1TXYA 4LF5Q 4BBSG 4LW1A 4IPCA 1X6OA 1DGSA 2EQSA 2NN6G 4A3IG 3M4QA 3HOWH 2MQHA 2ZTEA 5M3MG 1L2FA 4DV5Q 1L1OA 4LFBL 3BZCA 5AJ3L 3RN5A 4X62Q 2ZM6L 2K75A 4GS3A 4GN3B 3UDXA 1NE3A 1KAWA 1VQCA 4DV4Q 2YV5A 3S2DH 2R7FA 1HZAA 3F8TA 1KRSA 1YHAA 4C2MH 1VQ4A 3M9BA 4UP9A 4NB3A 4BBRH 2HHHQ 2WAQG 4DNIA 2E2IH 3S17H 4OX9L 3CP0A 3H0GG 3CCVA 3H3VH 2AKWB 4QIWE 4X65Q 5EAYA 3U4VA 1Y1WH 4JI5Q 3CCQA 1OXVA 1QZHA 1VQ8A 1PH6A 1NTGA 3AFPA 3W1BA 3KF6B 1N34Q 1IBKQ 4YY3Q 1Z47A 1VS0A 2N78A 2R6GA 5DLQE 4JI3L 3F2CA 3E9HA 2K14A 3HOZG 4NXNQ 2A1AA 2R92G 4DV2L 1E3PA 2B29A 3GDEA 2UXDQ 3D0FA 1T9HA 4LUOA 4BBSH 5GROA 2VQFL 4A3MG 4A3IH 1B70B 1WOCA 5H1SE 4OO1G 5M3MH 1EQQA 2IHEA 4B3TL 3HOVG 3OTOQ 1VQLA 5FJ8G 2UUAL 5GAEC 2UUCL 1JT8A 1YZ6A 4LFCQ 4DAMA 3DM3A 1J5EQ 1S72A 3HOZH 2PI2E 3KYHC 1XPUA 4DUYL 5IYCG 1H95A 1YJWA 1VQBA 1IZ6A 3CF5A 2BA1A 2C35B 4DV6L 3PIOA 2JEAI 4OWXB 1QVFA 4JI1L 3TQYA 2QEXA 1BBUA 3GTLH 3H0GH 4DKAC 2D0OA 3J80c 3L2PA 4BY1G 4GN5A 1X3GA 3L0OA 2N8NA 3PIPA 3GTKH 3HOYG 3RNUA 4DR3Q 4LF4Q 2PMZE 2N3SA 2JQOA 4L5QA 1EUJA 1KRTA 2OTJA 4IJHA 2CFMA 3PGZA 1X55A 3CD6A 2HT1A 5IWAQ 3KFUA 3E9IA 2BH8A 3K81C 1YI2A 1E22A 1WI5A 2Z6KA 4JI6Q 1HNXL 2R92H 3J7A5 4DR4Q 3K7AH 2R7ZG 3PO2G 1JJGA 3H15A 3S24A 1X54A 4JI0Q 4BY7G 4A3MH 1FJGQ 4JI7L 2RHQB 3EIVA 1C9OA 4R4CA 1PYBA 4JCVE 5IT9c 4X62L 1YITA 1A62A 4IPDA 4X64Q 5IYBG 5LMNW 4HIMA 5FJ8H 3HOVH 2LXKA 4DPGA 3CPFA 2WAQE 1KQSA 4L5SA 2UXBQ 4HJ7A 4GOPB 4KHPQ 3F1ZA 3S1RH 2QA4A 4DAYB 1JJCB 3RN2A 4LNQA 1VQ9A 4NPSA 2HIVA 1UWVA 5IYCH 3GTJH 1VQEA 2DUDA 1L1OB 5LMNQ 4R1JA 3HKZE 3I7FA 1N33Q 1MJCA 2ES2A 1ASZA 2KBNA 3CCRA 1PFSA 4BY1H 2VW9A 1VQHA 4A3JH 3HOYH 3TS0A 4R4OA 2LXJA 4WJ4A 4B3SL 3J81j 2VY3A 1BKBA 3MXNB 4DR5Q 1S3OA 3KLWA 4DV0L 1GD7A 2JA7G 2MO1A 5FLMG 3TEHB 1TWAH 3D31A 3CCUA 4IOAA 2HQLA 1E1TA 1U0LA 2R7ZH 3VDYA 3PO2H 3U4ZA 2OCEA 4JI4L 2KENA 4DR1L 1PHJA 1CKMA 2Q2HA 5C4JH 2OQ0A 4LFAQ 1XPOA 4BY7H 4A3CG 1IYJB 4A4IA 4P74A 3ULPA 4GKKL 2KHIA 5IYBH 3U50C 4TVAB 4GKJQ 4HJAA 5IY0A 4LF8L 1LYLA 2JA6G 4YHHL 4DR7Q 2H5XA 1WJJA 4JI2L 4JI8L 4A76A 4GOPA 1FGUA 1HH2P 1WYDA 1Q8KA 1TWFH 3FKIG 2A8VA 4A3KG 3CMEA 1N32Q 4DR2Q 2NVXH 5ELNA 5HGQA 3S1QH 1G51A 4UP7A 1I94Q 1VQ7A 4K0KQ 4BXXG 1FL0A 3H3VI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTY A;  3PUZ A;  1L0W A;  4EX5 A;  3CMA A;  1HZB A;  3UDF A;  1YHQ A;  1HNZ L;  2YTX A;  4DV7 L;  3IRB A;  5IWA L;  3FP9 A;  5M3F G;  4DK3 C;  5BR8 Q;  1PH8 A;  1X3E A;  1OTC A;  2OTL A;  3CC4 A;  2AMC B;  1SR3 A;  3ULJ A;  3PF5 A;  2VNU D;  2D0P A;  5FLM H;  3M4O H;  4R4Q A;  1KL9 A;  3W1G A;  2UU9 Q;  4DR6 L;  3NEN A;  1EYG A;  2CQO A;  3T1Y Q;  1VQP A;  4JI0 L;  3HKS A;  5C4X G;  2ZJQ A;  3J80 i;  3CW2 C;  1VQD A;  1PYS B;  4A3C H;  1B8A A;  3T1H Q;  4AYB G;  3Q8D A;  1VQN A;  2PNH A;  2QGQ A;  2F4V Q;  3I4O A;  5IE8 A;  4UP8 A;  4A3B G;  3M85 A;  1VCI A;  5LMU L;  1V9P A;  2JA6 H;  2AWO A;  1YHB A;  3I2Z A;  2I5M X;  3BZK A;  1AE3 A;  1JMC A;  1CSP A;  1EIY B;  3RZO H;  4O0A A;  3FKI H;  4A3K H;  2B63 G;  1A0I A;  3HFZ B;  1V1Q A;  4POF A;  4LUZ A;  4JOI A;  5M5X H;  4DV1 Q;  4JV5 Q;  2VQE L;  4JYA L;  5JJI A;  3K80 C;  2A19 A;  3E0E A;  3LGJ A;  3M7N A;  4BXX H;  4NXM Q;  1MIU A;  4IPH A;  1PVO A;  1IBL Q;  1C0A A;  4YCW A;  4GLX A;  4B3M Q;  1IXR A;  1K0R A;  3NEL A;  3TS2 A;  4C3J H;  2NZH A;  4DV3 L;  1OXX K;  3JAM c;  1EWI A;  4PZ6 A;  2UUB L;  2VZA A;  3RLN A;  5M3F H;  4IFD J;  1HR0 W;  1UEB A;  2GN5 A;  2KCM A;  4GOP C;  4IFD I;  4GLA C;  1K3R A;  3CCM A;  3J7Z C;  2WFW A;  2RF4 A;  1EQR A;  1I5F A;  2E8G A;  1N36 L;  2XTI A;  1XNR L;  4XIG S;  1XMQ Q;  1Y14 B;  5ELO A;  4JBJ A;  5C4X H;  3K8A A;  4AQY Q;  4LF7 Q;  2NVQ H;  4QQB X;  1L1O C;  4JC0 A;  3W5O A;  4X66 L;  1VQO A;  3GD7 A;  2IX1 A;  4KI0 A;  1HNW L;  4YCV A;  1HR0 Q;  4LWC A;  4PZ8 A;  3CCJ A;  1IBM Q;  4DUZ Q;  4J15 A;  1XNQ Q;  4LF9 Q;  3JC6 6;  1Q86 C;  4LF6 Q;  3CPW A;  2Q2T A;  2RHS B;  3KJO A;  2JA5 G;  4LF5 L;  3TRZ A;  4XTC S;  4JBK A;  3A5Z B;  4DR2 L;  1N32 L;  2UXC Q;  1P16 A;  5FLX c;  1KC8 C;  1VQ5 A;  3PUW A;  4DV5 L;  2B63 H;  2ID0 A;  2Q2U A;  1BBW A;  1K83 H;  3CC7 A;  4RMF A;  1GVP A;  3AYH B;  4DK6 C;  1SRO A;  4LFB Q;  1E24 A;  5AJ3 Q;  2CKZ B;  2IHF A;  2ZM6 Q;  4DV4 L;  4A3L G;  1HZC A;  4PZ7 A;  3J81 c;  3ICE A;  4YWL A;  4IJL A;  1Z9F A;  4GNX A;  2F3I A;  3KF8 B;  3RLO A;  2Z0S A;  2NZO A;  2VS1 A;  1QVG A;  2HHH L;  1YNX A;  4JBW A;  3UDG A;  4B3R Q;  5JEA J;  4X65 L;  1SFO H;  1Q46 A;  1UE7 A;  1GM5 A;  4YWM A;  4JI5 L;  1VQK A;  3DLL A;  4JOI C;  1KHI A;  1M90 C;  1N34 L;  1IBK L;  1JB7 A;  4YY3 L;  4A93 G;  5E7N A;  1OXU A;  5C44 G;  1K9M C;  3S2H H;  4Y7N H;  3KDF B;  4UY8 C;  1PH4 A;  4JI3 Q;  3OYY A;  4NXN L;  1IL2 A;  2UXD L;  4AH6 A;  3FHW A;  4QGU A;  1XPR A;  4DV2 Q;  4A3D G;  1PA6 A;  1TWC H;  3A5U A;  1C7Y A;  2CCZ A;  2JA5 H;  2ATW A;  2JJQ A;  1XTD A;  2AWN A;  1X56 A;  2B3G A;  3OW2 A;  4DV1 L;  1G6P A;  4A3F G;  2VQF Q;  3S15 H;  2ZTD A;  1SRU A;  1I50 H;  3OTO L;  1X3F A;  2XGT A;  5IP7 G;  1Q7Y C;  4OWW B;  4LFC L;  4B3T Q;  2ASB A;  1E1O A;  1YVC A;  1KXL A;  4GN4 B;  1J5E L;  2UUA Q;  5GQO A;  2UUC Q;  1SMX A;  4A3L H;  3RLF A;  2F52 A;  2Z6K C;  1S40 A;  4DUY Q;  2K5N A;  2K5V A;  2L15 A;  4QY7 A;  4RG1 A;  2I5L X;  3KJP A;  2BH2 A;  4DV6 Q;  4IO9 A;  3BU2 A;  3F2D A;  1V43 A;  3PO3 G;  1R9T H;  3A74 A;  5C0X J;  3K0X A;  3AQQ A;  1K8G A;  4JI1 Q;  5C0X I;  3STB D;  2Q2I A;  4X6A H;  4DR3 L;  1XMO Q;  4LF4 L;  4TQU S;  2CWA A;  1NMG A;  4A93 H;  3GTG H;  1X9N A;  2IT1 A;  5C44 H;  3CQZ H;  1YJN A;  4DUZ L;  1PV4 A;  3ULL A;  3JAM i;  4JI6 L;  1N8R C;  1J6Q A;  2BA0 A;  1FVI A;  3KDF A;  4BA1 I;  4DR4 L;  5JJL A;  4LF6 L;  2JA7 H;  2JK8 A;  3WWV A;  4JBM A;  1RL2 A;  2KHJ A;  3SGI A;  4L5T A;  1CUK A;  1HNX Q;  1Q81 C;  4A3D H;  1UE1 A;  4LUV A;  1M1K C;  1EFW A;  2UXC L;  4MTN A;  4PG3 A;  1CKN B;  4QJF A;  3S16 H;  3I55 A;  4HIK A;  1FJG L;  2VUM G;  3GTQ H;  1PH9 A;  3PV0 A;  2MNA A;  4P75 A;  4A75 A;  1SE8 A;  1PH3 A;  4A3F H;  3NEM A;  2IY5 B;  2NN6 I;  4X64 L;  4JI7 Q;  1WFQ A;  1UE6 A;  3K7U C;  4YWK A;  5IP7 H;  4P73 A;  1PH2 A;  3PSI A;  2UXB L;  4QL5 A;  5K36 G;  4KHP L;  4PMW A;  4MNO A;  1K73 C;  3RR5 A;  1KIX A;  3GTM H;  1NY4 A;  1W3S A;  4O2D A;  1NJI C;  4R4T A;  1VQ6 A;  1D7Q A;  4Y52 H;  1QVC A;  3PUX A;  5GAH C;  1Y1V G;  1CSQ A;  1CKO A;  2WB1 G;  4FDB A;  2ZJP A;  1PH7 A;  3AEV A;  5LMN L;  4B3R L;  5M5Y H;  1U5K A;  4YCU A;  1MJE A;  1N33 L;  3PO3 H;  2Y0S G;  3I4M G;  1VQG A;  2K4K A;  4UPA A;  1NMF A;  1KD1 C;  2R93 G;  4C3H H;  4AIM A;  4WJ3 M;  2ZJR A;  4POG A;  1AE2 A;  4ME3 A;  4R4I A;  1Q82 C;  2FXQ A;  3G48 A;  4GNX B;  4B3S Q;  2MO0 A;  4KHZ A;  4DR5 L;  2YYZ A;  2ZTC A;  3HKZ G;  3S1M H;  3J81 i;  4IFD G;  1YEZ A;  3HOX G;  4P72 A;  5IYD G;  4OON A;  2V1C C;  4DV0 Q;  3AFQ A;  2K50 A;  1Q1B A;  2GVA A;  2K52 A;  2PI2 A;  3TRE A;  2JA8 G;  2ALY B;  2K5H A;  4HJ9 A;  2R7D A;  4EQ5 A;  4LFA L;  4JI4 Q;  4DR1 Q;  2VUM H;  1E7Z A;  1VQF A;  1CKN A;  1SN8 A;  3M4P A;  1Q12 A;  2IX0 A;  4IOC A;  2YU9 H;  1LTL A;  4KLK A;  1HZ9 A;  4GKK Q;  4GKJ L;  4OO1 I;  4APV A;  1EOV A;  5C3E G;  4DR7 L;  4A3B H;  4OWT B;  3NBH B;  3CCS A;  4GLV B;  1YBY A;  2PQA B;  4LF8 Q;  1Q1E A;  4YHH Q;  2JE6 I;  4JI2 Q;  4HIO A;  3I56 A;  1K8A C;  1VQJ A;  4IPG A;  4JI8 Q;  1QUQ B;  2E2J H;  5JJK A;  1WCM G;  2E2H H;  3UE1 A;  1RIP A;  1Y1V H;  3S14 H;  1UE5 A;  4K0K L;  1I94 L;  2E5L L;  1XJV A;  3B6Y A;  3PUY A;  3ERS X;  2EXD A;  1XMO L;  3I4M H;  4HJ8 A;  2OQK A;  2R93 H;  2D62 A;  2LSS A;  4HID A;  4A3J G;  2HIX A;  3UE0 A;  5IP9 G;  2I0Q A;  2DGY A;  3KOJ A;  4A3E G;  4ALP A;  3M3Y H;  5BR8 L;  3KF6 A;  4C3I H;  5M5W H;  3G71 A;  1LM0 A;  4DV7 Q;  1HNZ Q;  4BA2 I;  3HOX H;  5IYD H;  1A63 A;  5JEA G;  2EIF A;  1EIF A;  3EN2 A;  1N9W A;  4MZ9 A;  2RCN A;  1NBW A;  3BJU A;  4AYB E;  2UU9 L;  2JA8 H;  3T1Y L;  2JEB I;  3CCE A;  4OX9 Q;  4L5R C;  3I4N G;  4DR6 Q;  3PF4 A;  1YIJ A;  3HOU G;  1OXT A;  3ER0 A;  3ZJY C;  3T1H L;  1A8V A;  1HJP A;  1G29 1;  1P8L A;  1PH1 A;  2F4V L;  4A3G G;  2WB1 E;  1BVS A;  1GO3 E;  5C3E H;  2Y0S E;  1JE5 A;  3MEF A;  5LMU Q;  1SLJ A;  2NVT H;  2YTV A;  2WP8 J;  2PQA A;  1I3Q H;  1VQI A;  4JG2 A;  3RZD H;  1MKH A;  2MFI A;  1WCM H;  2KCT A;  3HOW G;  3PCO B;  1O7I A;  1QUQ A;  2VL6 A;  4JV5 L;  3PUV A;  4JYA Q;  3CAM A;  1PH5 A;  1D8L A;  4NXM L;  3CC2 A;  2VQE Q;  1IBL L;  4B3M L;  1ASY A;  1AH9 A;  3GO5 A;  3EBE A;  5IP9 H;  2JA9 A;  2E5L Q;  1OXS C;  5HY6 A;  2CWP A;  1YJ9 A;  4A3E H;  3CCL A;  4DV3 Q;  1VQA A;  1GKH A;  3A0J A;  4H02 A;  1JJ2 A;  3GTO H;  2UUB Q;  2NVY H;  1TWG H;  4BBR G;  3S1N H;  2OWO A;  5C0X G;  1LUZ A;  5GAG C;  2N49 A;  3F2B A;  1XMQ L;  1I6H H;  4AQY L;  1Y1W G;  1W2B A;  1QZG A;  1N36 Q;  4LF7 L;  1XNR Q;  3I4N H;  1X65 A;  3UDI A;  4OXP A;  3STB C;  5GAD C;  4HJ5 A;  3HOU H;  3G6E A;  1HR0 L;  4X66 Q;  1VQM A;  3U58 A;  3GTP H;  1IBM L;  3L7Z C;  4P71 A;  1B7Y B;  1HNW Q;  1XNQ L;  4A3G H;  4LF9 L;  1TWH H;  5J3B A;  4GNX C;  2I5H A;  2GVB A;  3CXC A;  3G4S A;  2AHO B;  1TXY A;  4LF5 Q;  4BBS G;  4LW1 A;  4IPC A;  1X6O A;  1DGS A;  2EQS A;  2NN6 G;  4A3I G;  3M4Q A;  3HOW H;  2MQH A;  2ZTE A;  5M3M G;  1L2F A;  4DV5 Q;  1L1O A;  4LFB L;  3BZC A;  5AJ3 L;  3RN5 A;  4X62 Q;  2ZM6 L;  2K75 A;  4GS3 A;  4GN3 B;  3UDX A;  1NE3 A;  1KAW A;  1VQC A;  4DV4 Q;  2YV5 A;  3S2D H;  2R7F A;  1HZA A;  3F8T A;  1KRS A;  1YHA A;  4C2M H;  1VQ4 A;  3M9B A;  4UP9 A;  4NB3 A;  4BBR H;  2HHH Q;  2WAQ G;  4DNI A;  2E2I H;  3S17 H;  4OX9 L;  3CP0 A;  3H0G G;  3CCV A;  3H3V H;  2AKW B;  4QIW E;  4X65 Q;  5EAY A;  3U4V A;  1Y1W H;  4JI5 Q;  3CCQ A;  1OXV A;  1QZH A;  1VQ8 A;  1PH6 A;  1NTG A;  3AFP A;  3W1B A;  3KF6 B;  1N34 Q;  1IBK Q;  4YY3 Q;  1Z47 A;  1VS0 A;  2N78 A;  2R6G A;  5DLQ E;  4JI3 L;  3F2C A;  3E9H A;  2K14 A;  3HOZ G;  4NXN Q;  2A1A A;  2R92 G;  4DV2 L;  1E3P A;  2B29 A;  3GDE A;  2UXD Q;  3D0F A;  1T9H A;  4LUO A;  4BBS H;  5GRO A;  2VQF L;  4A3M G;  4A3I H;  1B70 B;  1WOC A;  5H1S E;  4OO1 G;  5M3M H;  1EQQ A;  2IHE A;  4B3T L;  3HOV G;  3OTO Q;  1VQL A;  5FJ8 G;  2UUA L;  5GAE C;  2UUC L;  1JT8 A;  1YZ6 A;  4LFC Q;  4DAM A;  3DM3 A;  1J5E Q;  1S72 A;  3HOZ H;  2PI2 E;  3KYH C;  1XPU A;  4DUY L;  5IYC G;  1H95 A;  1YJW A;  1VQB A;  1IZ6 A;  3CF5 A;  2BA1 A;  2C35 B;  4DV6 L;  3PIO A;  2JEA I;  4OWX B;  1QVF A;  4JI1 L;  3TQY A;  2QEX A;  1BBU A;  3GTL H;  3H0G H;  4DKA C;  2D0O A;  3J80 c;  3L2P A;  4BY1 G;  4GN5 A;  1X3G A;  3L0O A;  2N8N A;  3PIP A;  3GTK H;  3HOY G;  3RNU A;  4DR3 Q;  4LF4 Q;  2PMZ E;  2N3S A;  2JQO A;  4L5Q A;  1EUJ A;  1KRT A;  2OTJ A;  4IJH A;  2CFM A;  3PGZ A;  1X55 A;  3CD6 A;  2HT1 A;  5IWA Q;  3KFU A;  3E9I A;  2BH8 A;  3K81 C;  1YI2 A;  1E22 A;  1WI5 A;  2Z6K A;  4JI6 Q;  1HNX L;  2R92 H;  3J7A 5;  4DR4 Q;  3K7A H;  2R7Z G;  3PO2 G;  1JJG A;  3H15 A;  3S24 A;  1X54 A;  4JI0 Q;  4BY7 G;  4A3M H;  1FJG Q;  4JI7 L;  2RHQ B;  3EIV A;  1C9O A;  4R4C A;  1PYB A;  4JCV E;  5IT9 c;  4X62 L;  1YIT A;  1A62 A;  4IPD A;  4X64 Q;  5IYB G;  5LMN W;  4HIM A;  5FJ8 H;  3HOV H;  2LXK A;  4DPG A;  3CPF A;  2WAQ E;  1KQS A;  4L5S A;  2UXB Q;  4HJ7 A;  4GOP B;  4KHP Q;  3F1Z A;  3S1R H;  2QA4 A;  4DAY B;  1JJC B;  3RN2 A;  4LNQ A;  1VQ9 A;  4NPS A;  2HIV A;  1UWV A;  5IYC H;  3GTJ H;  1VQE A;  2DUD A;  1L1O B;  5LMN Q;  4R1J A;  3HKZ E;  3I7F A;  1N33 Q;  1MJC A;  2ES2 A;  1ASZ A;  2KBN A;  3CCR A;  1PFS A;  4BY1 H;  2VW9 A;  1VQH A;  4A3J H;  3HOY H;  3TS0 A;  4R4O A;  2LXJ A;  4WJ4 A;  4B3S L;  3J81 j;  2VY3 A;  1BKB A;  3MXN B;  4DR5 Q;  1S3O A;  3KLW A;  4DV0 L;  1GD7 A;  2JA7 G;  2MO1 A;  5FLM G;  3TEH B;  1TWA H;  3D31 A;  3CCU A;  4IOA A;  2HQL A;  1E1T A;  1U0L A;  2R7Z H;  3VDY A;  3PO2 H;  3U4Z A;  2OCE A;  4JI4 L;  2KEN A;  4DR1 L;  1PHJ A;  1CKM A;  2Q2H A;  5C4J H;  2OQ0 A;  4LFA Q;  1XPO A;  4BY7 H;  4A3C G;  1IYJ B;  4A4I A;  4P74 A;  3ULP A;  4GKK L;  2KHI A;  5IYB H;  3U50 C;  4TVA B;  4GKJ Q;  4HJA A;  5IY0 A;  4LF8 L;  1LYL A;  2JA6 G;  4YHH L;  4DR7 Q;  2H5X A;  1WJJ A;  4JI2 L;  4JI8 L;  4A76 A;  4GOP A;  1FGU A;  1HH2 P;  1WYD A;  1Q8K A;  1TWF H;  3FKI G;  2A8V A;  4A3K G;  3CME A;  1N32 Q;  4DR2 Q;  2NVX H;  5ELN A;  5HGQ A;  3S1Q H;  1G51 A;  4UP7 A;  1I94 Q;  1VQ7 A;  4K0K Q;  4BXX G;  1FL0 A;  3H3V I; 
#chains in the Genus database with same CATH topology
 2YTY A;  4C3H G;  4YR3 A;  4LSX A;  1X3Q A;  4RAU C;  1L0W A;  4EX5 A;  3R2T A;  4MV7 A;  1HZB A;  1PFM A;  1DON A;  4GKJ H;  4HCS A;  2F0V A;  1HFN A;  3GV8 B;  4DR7 H;  5IWA L;  5M3F G;  2A69 D;  2IWH A;  5BR8 Q;  1PH8 A;  2NVX A;  4JVZ A;  5A2Q W;  2FLL A;  1BUV T;  2D0P A;  5FLM H;  1I4Q A;  1U4M A;  2NYZ D;  4ZKB B;  4KN4 C;  3M9M B;  4DR2 H;  2K5Q A;  1EYG A;  2SOB A;  5C4X G;  3CW2 C;  3SR1 A;  1WVL A;  4A3C H;  4FF3 A;  4HSP A;  2O5I C;  3T1H Q;  1I7N A;  3TZU A;  4AYB G;  3JAM W;  2PNH A;  1ESR A;  5KFN A;  4QF4 A;  4A3B G;  3P75 A;  5C1O A;  2E2D C;  2EYL A;  1YHB A;  4K14 A;  1AE3 A;  5DGB A;  1JMC A;  3T1Y H;  2B63 G;  3BS1 A;  4DV1 Q;  3MR6 A;  1GHK A;  2A19 A;  3E0E A;  3LGJ A;  1C0A A;  1MIU A;  4IPH A;  4NDX A;  4RUC A;  4GLX A;  3NTK A;  4B3M Q;  4UFZ A;  4Z9C B;  2W70 A;  3MZ5 A;  2F0L A;  1YNN D;  2UUB L;  3FKI A;  3GV7 B;  4ME6 A;  4CC5 A;  3KXY T;  4IFD J;  1JWM D;  1UEB A;  1CHQ D;  3H20 A;  4GLA C;  2I87 A;  3J7Z C;  3FDS A;  5CV5 A;  2RF4 A;  1EQR A;  2F0I A;  5LXT F;  2F03 A;  2D5D A;  1XMQ Q;  4P2C B;  1Y14 B;  4JV5 H;  2H4O A;  1CZG A;  3K8A A;  4QQB X;  1JR0 D;  4NXM H;  1VQO A;  4X66 L;  2L11 A;  4G7O C;  1IBL H;  4BWG B;  3J7A K;  3CCJ A;  2R7L A;  1IBM Q;  1AW7 A;  4FXK C;  2VQD A;  1XNQ Q;  1A2U A;  4LF6 Q;  4RB1 A;  4LF5 L;  3E0J A;  2L0C A;  4G57 A;  3HBL A;  5FLX c;  4LMQ D;  1VQ5 A;  3GLK A;  3GTJ A;  4LJZ C;  2Q2U A;  4CJ2 C;  1S5E D;  3ONA B;  4DGZ A;  5CBA E;  4DK6 C;  2F0H A;  4IUV A;  4F88 A;  2IHF A;  1GSO A;  4ED6 A;  4V0B A;  1HZC A;  3J81 c;  4ABN A;  3V6H A;  4ZKC B;  1E4E A;  2VS1 A;  1K83 A;  1GM5 A;  4I7H A;  3DLL A;  1D1I A;  1KHI A;  4A93 G;  3HEJ A;  4YY3 L;  3BA9 A;  1HXY D;  2R85 A;  4XQJ A;  5EPJ A;  1N48 A;  3KDF B;  4RB0 A;  4JI3 Q;  4NXN L;  4CGY B;  4XT3 B;  1BCP D;  4U7C A;  1KDB A;  1SFO A;  4HR7 A;  4DV2 Q;  4B3R H;  3GTG B;  2CCZ A;  2C2E A;  3LWB A;  3PN1 A;  3VYR A;  5EBC A;  3PIO 3;  3BYT B;  1STN A;  1W6K A;  2ZTD A;  4KN7 C;  4OWW B;  1KXL A;  3I3C A;  1J5E L;  2UUA Q;  1JQY D;  1PZI D;  3J80 L;  3RAX A;  2WII B;  5EGT A;  3ITP A;  1AN7 A;  4UCR A;  3RGX A;  1S40 A;  4DUY Q;  2W6M A;  1SBB B;  3KJP A;  5KEE A;  2P0A A;  2R82 A;  1DCZ A;  1K8M A;  1PRT C;  3AQQ A;  3FRP B;  4JI1 Q;  2Q2I A;  3RJ0 A;  5FO9 B;  1NMG A;  2PW5 A;  3EPI A;  3GTG H;  2RBM A;  2MP1 A;  1VBH A;  2UUC H;  1BCP B;  2EY5 A;  3ULL A;  4J1M A;  1N8R C;  4ED8 A;  4M9U A;  2JK8 A;  3WWV A;  1CTM A;  4XYQ A;  3SGI A;  1ULZ A;  3QB3 A;  1HNX Q;  1UE1 A;  1B44 D;  1HFG A;  2E76 C;  1M1K C;  4JUZ A;  3RF2 A;  3S1M B;  2ZXP A;  4HIK A;  1FJG L;  3KHL A;  1XMO H;  2QDB A;  2F0W A;  1UE6 A;  2KUM A;  3PSI A;  2BE5 D;  4PMW A;  1KIX A;  4MTE A;  2DN8 A;  3NE5 B;  2Z6B A;  4O2D A;  4K8J A;  4DXF A;  5KFU A;  4Q45 A;  4QB4 A;  1QVC A;  4KJO A;  1K3B C;  4LMY A;  5GAH C;  5J2T F;  2F3V A;  5D8D A;  3K5M A;  1G91 A;  2PO4 A;  4IUQ A;  1N33 L;  2W9C A;  1VQG A;  2XIW A;  4UPA A;  3D4R A;  1G6Z A;  1EHI A;  2E2J B;  4PQX A;  4POG A;  1AE2 A;  4R4I A;  3GIK A;  4IAL A;  3S14 B;  1VMP A;  3G48 A;  5IIF A;  2MO0 A;  1E4E B;  4C3I G;  3HKZ G;  3SXH A;  3S1M H;  3J81 i;  4XZ3 B;  1BO0 A;  2RDG A;  1RKN A;  2CHB D;  4DV0 Q;  3VPD A;  1IYU A;  4IQZ A;  1SYE A;  2J7Z A;  2K50 A;  4YJ3 F;  2FLN A;  1FNW A;  3QOJ A;  1TU2 B;  2PNR C;  2DWC A;  2W6P A;  1S10 A;  5M5W B;  4JI4 Q;  1T94 A;  1LTL A;  4GKJ L;  4OO1 I;  4B3S H;  1Z2N X;  4DR7 L;  3GV5 B;  3OOC A;  3CCS A;  4GLV B;  1AZQ A;  5FPO A;  4DL7 A;  2RDI A;  4YHH Q;  1WD0 A;  2E2J H;  2R8J A;  1QUQ B;  3K5N A;  2VUM A;  4H44 C;  1S68 A;  3S14 H;  2EY2 A;  2YZG A;  2FIN B;  3B6Y A;  4DR1 H;  3PUY A;  2EXD A;  2DY7 A;  1TII D;  2HJW A;  4WBN F;  2NVT B;  2LSS A;  2R7K A;  4J9M A;  1XTC D;  4RNO A;  4GKK H;  2JEJ A;  4A3E G;  4ECZ A;  4MTK A;  2RQX A;  5M5W H;  3I73 A;  2WB1 A;  4IFD H;  3NQI A;  4MV3 A;  4JI2 H;  3M9O B;  3QIA A;  4JI8 H;  1JIC A;  1A63 A;  2Y0S A;  4CDC C;  1H9M A;  5KFF A;  4AYB E;  1N9W A;  1NBW A;  2B2W A;  2R93 A;  2KA7 A;  3T1Y L;  4RH6 A;  1TAE A;  4L5R C;  4XT1 B;  1C48 A;  5JVG 3;  3KHR A;  2XVS A;  2NU8 B;  3V96 A;  3LWU A;  4O3R A;  2TSS A;  2YS6 A;  3GIL A;  3QWN A;  1PH1 A;  2J4X A;  2WB1 E;  4ZQI A;  2R87 A;  1HQR D;  2FHT A;  2Y0S E;  3SI8 A;  1KAB A;  2A6E C;  2NVT H;  1HRJ A;  2YTV A;  2ZDH A;  2KED A;  1MKH A;  4A3G B;  5FO7 B;  3GIP A;  4JV5 L;  4DR6 H;  3V4S A;  2NZ1 D;  4O42 A;  1PH5 A;  4NXM L;  1IBL L;  2B2T C;  3I91 A;  3PQI A;  4X3K A;  1ASY A;  3PIP 3;  2HVR A;  2FK3 A;  5IP9 H;  3NUC A;  2CWP A;  1I3Q A;  1NR4 A;  1B3A A;  4I50 F;  2W6N A;  4H02 A;  1GKH A;  4RCN A;  1WCM A;  4JV1 A;  4HMI A;  1JJ2 A;  5LMU H;  4O2B F;  2UUB Q;  3DWA A;  1S5F D;  1S5C D;  3VA5 A;  2WYO A;  2YW2 A;  4MA0 A;  2W9B B;  3JRX A;  1ZYR D;  3TQ1 A;  3S2D B;  4JYA H;  5JVL A;  1X65 A;  1ZYR C;  4OXP A;  5GAD C;  3NXW A;  5NUC A;  4BBR B;  4X66 Q;  1VQM A;  4Q8F A;  4UCS A;  4IR9 A;  3D4D A;  1B7Y B;  4A3G H;  4DV3 H;  4ECS A;  2F1M A;  4J9N A;  4CKE A;  2NUA B;  1VBG A;  3G4S A;  4C56 C;  2AHO B;  4IZ8 A;  1F77 A;  2B2W C;  4LF5 Q;  4IPC A;  1DGS A;  1G2S A;  1XNR H;  4OIJ A;  3M4Q A;  2MQH A;  5IGD A;  2KEC A;  2K1B A;  2XGQ A;  3L4J A;  3BZC A;  1TWH A;  3K6O A;  4MA5 A;  4MV1 A;  3Q6S A;  1B9N A;  4BBS B;  3OSN A;  1B6R A;  5KFR A;  4A3I B;  1HA5 A;  5KFC A;  3SK4 A;  3S2D H;  4ZOL F;  4I65 A;  4QMG A;  1Z2P X;  1YHA A;  4FM9 A;  3M9B A;  4BBR H;  2WAQ G;  4DNI A;  2V9W A;  4EYI B;  1RK5 A;  5EAY A;  4DV5 H;  3RAQ A;  1ROD A;  1IW7 D;  1M4V A;  1PH6 A;  1NTG A;  4Q5V A;  3AFP A;  1PTO D;  4YY3 Q;  3MEH A;  2KCN A;  1B53 A;  1Z47 A;  3F2C A;  1SEI A;  2FE3 A;  4F7X A;  3BZD B;  3H0G B;  4DV4 H;  2AUJ D;  3CRL C;  3HOZ G;  4NXN Q;  3GTK B;  1MZB A;  4LSA A;  5JH7 F;  1E3P A;  3T5L A;  1CT1 D;  2A73 B;  2IMW P;  1RHP A;  3J80 W;  3R3O A;  1I4X A;  5J39 A;  4BBS H;  2NN6 H;  1B70 B;  4A3I H;  2HGS A;  1EEI D;  5H1S E;  4OO1 G;  2R92 B;  3HOV G;  5C3W A;  5KFL A;  5KG4 A;  4NP5 A;  3RB6 A;  1IBK H;  4N8F A;  2UUC L;  2W6Q A;  4I7A A;  3DM3 A;  1STE A;  1J5E Q;  1GUT A;  3P1H A;  3E3X A;  1XPU A;  5IYC G;  1T5X D;  2UXD H;  2N55 A;  3J7A V;  4KY5 A;  4OWX B;  3L9A X;  4JV0 A;  4XYM B;  1SYX B;  5I6Y A;  3H0G H;  1F9P A;  4TRD A;  4DKA C;  1EEF D;  3GTK H;  3L0O A;  3PIP A;  4ECX A;  2NBF A;  3GTJ B;  3P20 A;  2PMZ E;  2N3S A;  3KK7 A;  1DJR D;  4L5Q A;  4LFC H;  2OTJ A;  3K59 A;  4J0M A;  3E5N A;  2CFM A;  2ENB A;  4HTH A;  5M9O A;  3BVG A;  4QW8 A;  1YI2 A;  2R92 H;  2Z6K A;  5EWF A;  4YB8 B;  1CZW A;  3Q8S B;  1Y8O B;  4FO2 A;  2R7Z G;  4RFB A;  3NBI A;  5FKA C;  1GGO A;  1EYA A;  3ORQ A;  5KT7 A;  3H15 A;  1PTO F;  1FJG Q;  3MR3 A;  4IHJ F;  1QNK A;  4R4C A;  1PYB A;  1A62 A;  1I4P A;  4KMU C;  4GOP B;  5IWA H;  3RN2 A;  5CV6 A;  1VQ9 A;  1SYD A;  2HIV A;  2XN9 C;  3VR5 A;  2I8C A;  3GTJ H;  2IX3 A;  2EJM A;  1X3P A;  4Q43 A;  3MVV A;  1HHV A;  2WV6 D;  3BJY A;  1QB5 D;  3HKZ E;  4JK1 C;  1N33 Q;  4IWX A;  5EWE A;  2ES2 A;  1ASZ A;  3RMH A;  2VW9 A;  3D3R A;  4U68 A;  2B2U C;  2ZDQ A;  4R4O A;  2LXJ A;  2EYJ A;  4B3S L;  2UXB H;  5DAU A;  4KHP H;  1S3O A;  1ENA A;  5KG3 A;  1GD7 A;  5EPL A;  3V6J A;  1CQJ B;  1SMY D;  3TEH B;  3JSN A;  4TQS A;  4IOA A;  4CBV A;  1QIL A;  5EPK A;  5LMN H;  3QJY A;  3VDY A;  2OXP A;  1MSG A;  2KEN A;  4DR1 L;  1PHJ A;  2OQ0 A;  3FPP A;  3DXJ C;  1ILQ A;  3M4O B;  3ULP A;  3IKJ A;  4GKK L;  3KHG A;  2FLP A;  3KLS X;  5IYB H;  3U50 C;  1B50 A;  4GKJ Q;  2WKD A;  4DR5 H;  4RHS A;  1PZK D;  2V5A A;  4DR7 Q;  4JI2 L;  4JI8 L;  5IOD A;  3LP8 A;  4A76 A;  1FGU A;  2EXZ A;  3GQC A;  3FKI G;  4A3K G;  1I50 A;  1QJO A;  4DR2 Q;  1E4F T;  4Q0Y A;  1G51 A;  2G5D A;  4G7H C;  5ELB A;  2KHS A;  2F0M A;  3I8Z A;  2EE1 A;  5J22 A;  1SJH D;  3PUZ A;  4C3J G;  1LT5 D;  1YHQ A;  4BWS C;  1TWF A;  3FP9 A;  3CC4 A;  5EDW A;  1HUN A;  3MXN A;  4TQR A;  1KTK A;  5KG2 A;  3M4O H;  4R4Q A;  1VDZ A;  4DR6 L;  3T1Y Q;  5DG8 A;  1I94 H;  2ZJQ A;  1GXD C;  2IPK D;  1VQD A;  1PYS B;  2R61 A;  1B2T A;  2OLS A;  1ZHS A;  1SE4 A;  2PW7 A;  3VPB A;  3O13 A;  1RJP A;  4DN4 M;  2SDF A;  5IE8 A;  5KFJ A;  4UP8 A;  4ZLT F;  2E74 C;  5BN3 A;  2KCC A;  5LMU L;  1V9P A;  5KG1 A;  1XDN A;  4Q8E A;  3I2Z A;  2UVW A;  3OHB A;  1CSP A;  1EIY B;  2UU9 H;  3QFF A;  5JAV A;  3MR2 A;  1V1Q A;  4JYA L;  4LUZ A;  5JJI A;  2AU0 A;  4JV5 Q;  5C6A A;  1SCU B;  1SDF A;  3M7N A;  4BXX H;  4YQW A;  4NXM Q;  1IBL Q;  5I9O A;  2F4V H;  3GP7 A;  3NEL A;  4DV3 L;  2NZH A;  1JXL A;  4NKL A;  4PZ6 A;  3HZX A;  1SYC A;  3RB3 A;  3LNN A;  2KCM A;  1EY7 A;  1K3R A;  4FXD A;  2WFW A;  1BOS A;  1S0N A;  1I5F A;  2E8G A;  1XNR L;  1CQV A;  1CHP D;  4IUN A;  4XIG S;  5G3L D;  2FKL A;  5KG6 A;  1L1O C;  1B33 N;  1PXU A;  5LA6 F;  3GD7 A;  1B4O A;  4KI0 A;  4RAZ A;  2R84 A;  3SVM A;  2R8H A;  1D5Z C;  5D65 A;  3D8G A;  1CM9 A;  2YRW A;  2V59 A;  2KQ3 A;  3VYS A;  1S0M A;  1N32 L;  4Y7N B;  2UXC Q;  2AGO A;  2QYZ A;  3PUW A;  4HN7 A;  4DV5 L;  5CA1 F;  2D2C C;  1TS2 A;  1TWC B;  2IBK A;  2JA5 B;  4EYH B;  2VR1 A;  1STH A;  3EJI A;  4DV4 L;  4A3L G;  1G2T A;  4YWL A;  1DOM A;  1IL8 A;  4DK0 A;  1ET6 A;  3S9W A;  1Z9F A;  1I50 B;  3RLO A;  4GNX A;  1Y1V A;  1S5B D;  2Z0S A;  5BPF A;  4XYO A;  3MWD A;  4B3R Q;  1PZJ D;  1Z2O X;  5JEA J;  5KYI A;  2HCI A;  1II3 A;  5KGU A;  4C5A A;  2A68 C;  1SNP A;  5EKK A;  4UCO A;  4ECQ A;  3RBE A;  2NTS A;  1M90 C;  1DXM A;  2L1B A;  5TSS A;  1JB7 A;  2ICE C;  1IBK L;  4FP5 D;  3UFX B;  1IKM A;  3RD4 A;  4Y7N H;  1R9T B;  4UY8 C;  3SK6 A;  5FPR A;  4ED3 A;  2JSO A;  4EFE A;  5KFM A;  1IL2 A;  1EY9 A;  1D5M C;  5D3I B;  2UXD L;  3K5H A;  4A3D G;  1TWC H;  5G3L F;  5C44 B;  2JA5 H;  1TA8 A;  2ATW A;  2JJQ A;  1XTD A;  2AWN A;  1X56 A;  2B3G A;  3IN5 A;  2RSO A;  4Y8V B;  2YCH A;  1I50 H;  4ECY A;  4XQQ A;  3BYY B;  1Q7Y C;  2XGT A;  4LFC L;  3PW4 A;  1E1O A;  1YVC A;  4RB2 C;  3P7J A;  2V4R A;  2UUC Q;  1LO5 D;  3S16 B;  3GTQ B;  1B9M A;  2F52 A;  4A3F B;  3FVQ A;  4EGJ A;  4TKO B;  3KLR A;  5CGK A;  3F2D A;  3PO3 G;  1V43 A;  5K5P A;  5JJZ A;  3A74 A;  1R9T H;  4ZK9 B;  1UUP A;  2J0T D;  4IUU A;  3STB D;  5C0X I;  2VQF H;  4RGO S;  2HUG A;  4X6A H;  1XMO Q;  5AFW A;  2R8G A;  3QZ8 A;  4TQU S;  4B3T H;  1CFM A;  2HCC A;  3R5X A;  1X9N A;  5C44 H;  4CKB A;  2EZV A;  3A55 A;  4DUZ L;  1IHZ A;  3Q8Q B;  2VPQ A;  4MV9 A;  3KDF A;  4BA1 I;  4FNF A;  5JJL A;  1EZ8 A;  2A69 C;  3H4D A;  1U9R A;  2W8K A;  4DV6 H;  4LUV A;  1GHJ A;  3N6X A;  4ME5 A;  4MTN A;  1CKN B;  4QJF A;  2BR0 A;  5COY A;  1U4P A;  3I55 A;  3S16 H;  2VUM G;  5BPH A;  3GTQ H;  3GTG A;  2MNA A;  4P75 A;  3VR3 A;  5DGA A;  2IL8 A;  4A3F H;  2F0F A;  1I6U A;  3CRK C;  1JKJ B;  4YWK A;  5IP7 H;  4P73 A;  2UXB L;  4IZO A;  2NU9 B;  4KHP L;  1K73 C;  2OH2 A;  3T4A C;  4CJ0 B;  1NJI C;  4R4T A;  3URY A;  2YU9 B;  4OHJ A;  4PMB A;  2WB1 G;  3ORR A;  5LMN L;  4C1N K;  4RAY A;  2Y0S G;  2XD4 A;  3I4M G;  1SNQ A;  2R93 G;  3VA7 A;  2L55 A;  1ICF B;  4BS9 A;  4WJ3 M;  1WSC A;  2E2H B;  4R8U B;  3VR2 A;  3MC0 B;  1XX8 A;  1Y1V B;  4RZQ A;  4K6D A;  4GNX B;  4B3S Q;  3GQB A;  4DR5 L;  2YYZ A;  2YRX A;  3WO1 A;  3NK9 A;  3HOX G;  4YIJ A;  1V4Y A;  1YNN C;  5KFY A;  4DNT B;  4PDB A;  2K52 A;  2Q8T A;  2W6O A;  3LX0 A;  2ALY B;  2K5H A;  4CHT B;  5E3F A;  5C1P A;  4DR1 Q;  1LAB A;  1VQF A;  1SN8 A;  2CH4 W;  2IX0 A;  1OO9 B;  2YU9 H;  1PX2 A;  2JA8 B;  4GKK Q;  5K36 H;  1E2V A;  1MI2 A;  5C3E G;  1KEE A;  3NBH B;  2MUY A;  1YBY A;  3CKI B;  2PQA B;  1Q1E A;  4X3U A;  1LTT D;  4JI2 Q;  1H9J A;  4OL7 A;  1VQJ A;  1DOL A;  4JI8 Q;  5A2Q E;  5JJK A;  1WCM G;  3FMC A;  2E2H H;  1Y1V H;  5CV8 A;  1IKL A;  1GSA A;  3U9T A;  1I94 L;  1XJV A;  3KAL A;  3X3N A;  3ERS X;  3FEW X;  3F8N A;  4HJ8 A;  4X3S A;  3D6W A;  3RZD B;  3UE0 A;  4F87 A;  2DGY A;  3KOJ A;  4C1N I;  3JAM E;  1Y8N B;  3G71 A;  1QWY A;  5L1L A;  1LM0 A;  3PZP A;  4LF8 H;  3OSO A;  4YAK B;  1S9F A;  5IYD H;  3GTL A;  2I46 A;  1BBX C;  2EIF A;  1JIH A;  3HB9 A;  1EIF A;  2UU9 L;  5KX5 F;  2RCN A;  2JA8 H;  4JV2 A;  2LY7 A;  1I6V C;  5KT3 A;  1CQF A;  3I4N G;  4DR6 Q;  1I7L A;  5DQI A;  1EIH A;  4O4H F;  1RK6 A;  3T16 A;  1A3U A;  1JOO A;  1V1P B;  1TWG B;  3S1N B;  5EOY A;  3J7Y W;  1G29 1;  2F4V L;  5C5J A;  1Z6H A;  5C5M A;  1BVS A;  2AQ2 B;  2Q8R E;  5BN4 A;  2CH4 A;  1HNZ H;  4O2A F;  4DV7 H;  4K6L A;  1A6X A;  3DWP A;  5LMU Q;  2VOB A;  1SLJ A;  3HOU B;  1BCP C;  4J9R A;  2M9V A;  2WP8 J;  1JE4 A;  4JG2 A;  4XXE A;  3RZD H;  4IRK A;  5DM6 3;  3HOW G;  1DM0 B;  2QW7 A;  1QUQ A;  2EDG A;  2N88 A;  2JEG A;  1RD9 D;  4JYA Q;  3CAM A;  5C4H A;  3CC2 A;  3R5H A;  2XRS D;  4U6P A;  3MWY W;  4KV6 A;  1B6S A;  1F9S A;  1OXS C;  5HY6 A;  1ONL A;  1YJ9 A;  3CCL A;  5DLF A;  4DV3 Q;  3A0J A;  3MXG A;  1CK1 A;  3SHL A;  1TWG H;  4IN3 A;  3S1N H;  5C3X A;  5C0X G;  5GAG C;  2N49 A;  3VR4 A;  1PFB A;  4RA8 A;  3F2B A;  5KG0 A;  4ECV A;  2EJG C;  3UI2 A;  1BGW A;  4J8Q A;  4WFN 3;  1QZG A;  1XNR Q;  2XCL A;  4XX0 B;  4HJ5 A;  2VQE H;  5ELC A;  2HVQ A;  3HOU H;  3G6E A;  4ILW A;  3S17 B;  2E2I B;  2UVU A;  2JEF A;  5FLX L;  1NUC A;  1S5D D;  1DZ1 A;  3BDC A;  3VR6 A;  1Y1W B;  3PW7 A;  3RFC A;  2XIG A;  2J9G A;  4RU9 A;  2GVB A;  4EFB A;  4WRD A;  1TXY A;  5KFG A;  3J81 L;  1DOK A;  2XCA A;  4LW1 A;  4K2L A;  1X6O A;  4DNR B;  3GIM A;  2ZTE A;  5M3M G;  1JDB B;  4EQO A;  1L2F A;  4DV5 Q;  4F50 A;  4J9L A;  1DYQ A;  4FXG C;  4RGM A;  4X62 Q;  1BCP F;  4ODG A;  3T5H A;  4GS3 A;  4GN3 B;  2OF1 A;  2BE5 C;  2DIK A;  1KAW A;  4DV4 Q;  2YL2 A;  4KY6 A;  1HZA A;  4DAP A;  5T1I A;  1VQ4 A;  3E5S A;  3S17 H;  2E2I H;  4OX9 L;  3CP0 A;  1WH2 A;  2AKW B;  4V19 0;  4ZQ3 A;  2W9B A;  3U4V A;  3AU7 A;  1Y1W H;  5D1P A;  3CCQ A;  1EWC A;  2FK2 A;  3G6J B;  1QZH A;  1VQ8 A;  1IBK Q;  4YR0 A;  5DLQ E;  1VS0 A;  3N6R A;  2WIN B;  1B3Q A;  3GTL B;  1EZ1 A;  1SNO A;  4RHR A;  2W8L A;  5KRU A;  2A1A A;  4UAI A;  2QCP X;  2B29 A;  2UXD Q;  2HHH H;  4IUR A;  4PNY A;  1PRT B;  1PLF A;  3D0F A;  4LUO A;  2IJ0 A;  4X65 H;  2A6H D;  2VQF L;  4A3M G;  4R7R A;  3HS0 C;  4HCE A;  2DNC A;  4B3T L;  5D1O B;  5GAE C;  2B2V A;  4L6T B;  1YZ6 A;  3ND8 A;  2Z8L A;  4LFC Q;  1UC9 A;  4N8X 1;  1S72 A;  5KFE A;  3KYH C;  1NR2 A;  1VQB A;  2C35 B;  3MXP A;  4DV6 L;  3PIO A;  1CE8 A;  3TQY A;  3GTL H;  1BBU A;  3H6M A;  1RTO A;  4IWY A;  2XCP A;  2L12 A;  4O1N A;  2N8N A;  2WE6 A;  4DLK A;  3HOY G;  3OTO H;  2RA4 A;  4M8A A;  3R23 A;  1RYS A;  3DM1 A;  2SNS A;  4KD4 A;  2KJX A;  3T56 B;  2HT1 A;  2F0D A;  3D6C A;  3X3M A;  5IWA Q;  4J9P A;  4BY1 B;  1A3V A;  1E22 A;  3H0G A;  2XGP A;  2XC9 A;  3GTK A;  4ID6 A;  1ZKO A;  1X54 A;  4BY7 G;  2SEB D;  4DR3 H;  4FYD A;  1EIG A;  5IT9 c;  3QG1 A;  4HNV A;  5LOV F;  4HIM A;  4LF4 H;  5LMN W;  2ASD A;  4DA2 A;  5FJ8 H;  5HV6 A;  2R92 A;  4G7Z C;  3CPF A;  3PO2 B;  2UXB Q;  3OSP A;  1RF2 D;  1BXT A;  1I4H A;  5KNB A;  4HJ7 A;  4KHP Q;  3F1Z A;  5DQH A;  5C4J B;  4DAY B;  1JJC B;  4LNQ A;  4DR4 H;  1BNZ A;  2PZT A;  2PZU A;  1LAC A;  1UWV A;  4RNM A;  5LMN Q;  3Q22 A;  3BQ1 A;  1L2Z A;  1MHW C;  3RGZ A;  4TV8 F;  1F9Q A;  3CCR A;  1PFS A;  4BY1 H;  3C1E A;  1VQH A;  3I90 A;  4JPB W;  4X64 H;  4EBD A;  4ZUJ A;  4F8M A;  2B2V C;  5H80 A;  4DL6 A;  2JXM B;  1RJQ A;  2VY3 A;  1BKB A;  1UNS A;  3TSS A;  4DR5 Q;  3KLW A;  1WTW A;  3TN2 A;  3N40 P;  1TS5 A;  5FLM G;  3H91 A;  2HQE A;  2V4D A;  2O03 A;  2RVL A;  3G6V A;  1E1T A;  1U0L A;  1I4G A;  2F0O A;  4WJW A;  2RCF A;  3PO2 H;  2GPS A;  3U9O A;  2OCE A;  1AFP A;  5KG5 A;  1E4G T;  4MN3 A;  2Q2H A;  4DK1 A;  5C4J H;  4XYL B;  5CC4 A;  1XPO A;  4A3C G;  5D3D A;  3MFI A;  2G9H D;  2FB9 A;  4ZAI A;  1EU3 A;  5EKL A;  5EJW A;  4LF8 L;  4LH7 A;  4H7B A;  2J6S A;  4UDU C;  4MV8 A;  1PK8 A;  4GOP A;  1A2T A;  2LS0 1;  1HH2 P;  1Q8K A;  1RDP D;  1TT2 A;  3CME A;  1KJ8 A;  3KF8 A;  5ELN A;  1CA5 A;  1I94 Q;  1K0S A;  2JA6 B;  1YJW A;  3WDN A;  5E4X A;  3CMA A;  5KFV A;  3DEO A;  3UDF A;  4YJ2 F;  1SAP A;  1HNZ L;  4DV7 L;  2G9D A;  3T13 A;  2K05 A;  4DK3 C;  1X3E A;  4E6I A;  1OTC A;  2AMC B;  3ULJ A;  4PWQ A;  1KL9 A;  3W1G A;  1N32 H;  5KFH A;  2UU9 Q;  1XYI A;  3NEN A;  3TP8 A;  1VQP A;  4JI0 L;  2AGP A;  4K0K H;  3HKS A;  5M3F B;  4Q44 A;  3K0Y A;  2O5J C;  1IW7 C;  1B8A A;  2NUC A;  1PDQ A;  2WKC A;  3FPU B;  3OWE B;  3Q8D A;  2DJG C;  1VQN A;  1UC8 A;  1PTO C;  2QGQ A;  2F4V Q;  3MXU A;  5C4X B;  2JA6 H;  2AWO A;  2CW8 A;  5I6W A;  3BZK A;  4AYB B;  1TKW B;  5KFO A;  2IW3 A;  1A0I A;  3HFZ B;  4POF A;  2VQE L;  3K80 C;  1WTR A;  1LTS D;  4YCW A;  1IXR A;  3TS2 A;  4DAV A;  1EYC A;  4EBC A;  4FBU A;  1OXX K;  3JAM c;  5KT2 A;  1EWI A;  2B63 B;  2L9H A;  3IFT A;  3MFG A;  3OW7 A;  3RLN A;  5M3F H;  5CBE E;  1STB A;  1F2Y A;  2GN5 A;  4GOP C;  4IFD I;  3CCM A;  5FLX W;  3TP6 A;  1A3T A;  3CHB D;  5ELO A;  5C4X H;  1SXT A;  4HAE A;  1RCV D;  1JCK B;  5EWG A;  3GIQ A;  2IX1 A;  3J81 W;  2C9O A;  4YCV A;  1AUV A;  3RB4 A;  2EYM A;  2RDH A;  2K5W A;  3JC6 6;  1BXR A;  1Q86 C;  1GUN A;  2V4Q A;  2RHS B;  3OPO A;  1M8A A;  3TRZ A;  3S2H B;  3A5Z B;  4F4Y A;  1LTB D;  1QNU A;  3VYT A;  1HTL D;  2B63 H;  4AQY H;  2R8K A;  2ID0 A;  2HDL A;  4LF7 H;  1BBW A;  5DLG A;  1KAA A;  4QCL A;  4RMF A;  5KFZ A;  1SRO A;  1E24 A;  1HR0 H;  2CKZ B;  4DUZ H;  3RB0 A;  3BDL A;  4PZ7 A;  3ICE A;  4O3O A;  4LF9 H;  4IJL A;  2GLT A;  4KJN A;  2F3I A;  3KF8 B;  2V58 A;  4RNN A;  2NZO A;  2HHH L;  2ALZ A;  3UDG A;  4JBW A;  4X65 L;  3J80 E;  5COR A;  1VQK A;  1TS3 A;  4YWM A;  4HMJ A;  4E4T A;  1KC7 A;  5L37 A;  2NB0 A;  1ZEQ X;  4HNT A;  4LFB H;  2JN4 A;  5E7N A;  1K9M C;  3BAB A;  4RUA A;  4DL5 A;  3S2H H;  1MBY A;  2ZM6 H;  4ULL A;  2M05 A;  4EQP A;  1PH4 A;  3OHX C;  3Q8R B;  2EYO A;  2ZJT A;  2BOS A;  4AH6 A;  3FHW A;  4QGU A;  1BQQ T;  4A93 B;  1SMY C;  4H0L C;  3CQZ B;  4TUY F;  5FLX E;  1FR3 A;  3K5O A;  2YZN A;  3OW2 A;  4DV1 L;  3OWF A;  4CDD C;  4L1K A;  2UVV A;  2VQF Q;  3PR4 A;  3OTO L;  1ZXT A;  4B3T Q;  4GN4 B;  3TZD A;  5GQO A;  4FF4 A;  2JEI A;  1TWC A;  2F0S A;  1SMX A;  4RGN A;  2JA5 A;  3JSL A;  3ETH A;  2Z6K C;  2BQR A;  2K5N A;  4RG1 A;  2BH2 A;  5L1J A;  2P5Z X;  4DV6 Q;  2DJF C;  1Q90 A;  3K0X A;  3GTM B;  2Z9H A;  3CVZ A;  4KHV A;  1BF4 A;  4DR3 L;  4LF4 L;  4O4I F;  4A93 H;  1BDO A;  2DY8 A;  3MFY A;  3SE7 A;  4EVO A;  3CQZ H;  1YJN A;  1O7Z A;  4KD3 A;  1AP0 A;  3JAM i;  5EQ0 A;  4DR4 L;  1R9T A;  5CV9 A;  1TVX A;  4LF6 L;  3TBI B;  1WTQ A;  2K04 A;  5CA0 F;  2R8I A;  3NWT A;  4L5T A;  1CUK A;  1NCV A;  5HBR B;  4NLG A;  1C8C A;  3RV4 A;  1TR5 A;  4M1U B;  1M7J A;  1LLR D;  2CQY A;  3KAK A;  3GTP A;  2IY5 B;  1SE8 A;  1PH3 A;  3NEM A;  2NN6 I;  4X64 L;  2NU7 B;  1EY0 A;  1FYC A;  1WFQ A;  3D4W A;  3K7U C;  1PH2 A;  2PMZ B;  1QE6 A;  1WTV A;  4QIW A;  3NPP A;  1CQI B;  4ED1 A;  3GTM H;  1NY4 A;  1W3S A;  3I72 A;  2K03 A;  5IGC A;  4ETS A;  3GTQ A;  4Q0F A;  2XWJ B;  2RGV A;  4FDB A;  3AEV A;  1PH7 A;  3BQ2 A;  1U5K A;  1MJE A;  1J8I A;  1AUX A;  1KD1 C;  2LMC B;  4JI7 H;  4EQN A;  2CW0 D;  2ZJR A;  3N41 B;  1K28 A;  4CC6 A;  1YNJ D;  1E0B A;  4IFD G;  3C3L A;  1YEZ A;  1RJR A;  5KT5 A;  2K7V A;  1GSH A;  3AFQ A;  1Q1B A;  2GVA A;  2PI2 A;  2ZXR A;  3TRE A;  3I4L A;  2M00 A;  2JP1 A;  1ET9 A;  3K5I A;  2R7D A;  4EQ5 A;  4C3I B;  3HKZ B;  3NHH A;  1E7Z A;  1CKN A;  1H9K A;  1Q12 A;  1HTP A;  4IOC A;  1LT3 D;  2W57 A;  3R2I A;  2B8F A;  4KLK A;  3GTO B;  4O3S A;  3U9S A;  1EYZ A;  4O3Q A;  3MAQ A;  3I12 A;  3WOE A;  1UNN C;  4LF8 Q;  3ERO A;  1XXG A;  4EGQ A;  5KFW A;  4HIO A;  1K8A C;  3NP8 A;  1RIP A;  1STA A;  1SYF A;  2F0U A;  1UEA B;  1EYD A;  3GV3 A;  3UE1 A;  1CI3 M;  2YU9 A;  4K0K L;  1PFN A;  1FNV A;  4YBZ B;  4NMZ A;  2C22 A;  2OQK A;  4UHV A;  2D62 A;  5I2X A;  2HIX A;  2Z4H A;  5IP9 G;  2I0Q A;  4QWE A;  2FK1 A;  3NSW A;  3SK8 A;  3M4I A;  4R8U A;  2E2H A;  4F4X A;  3HG9 A;  2B8G A;  4C3I H;  1HNZ Q;  4DV7 Q;  4BA2 I;  1KDC A;  1N56 A;  1ZHQ A;  2WAQ A;  3EQL C;  1ZET A;  2L5T A;  4MZ9 A;  3GTO H;  3BJU A;  3CCE A;  2VPS A;  5DM7 3;  4A3E B;  2K33 A;  3N44 B;  1YIJ A;  4LK1 C;  2SCU B;  1RJT A;  1OXT A;  1PYW D;  2NVY B;  3ER0 A;  4QUC A;  3ZJY C;  3RTX A;  1P8L A;  3G7L A;  5ELF A;  4A3G G;  1QCB D;  4HED A;  3MEF A;  5JUM A;  2NTT A;  3NBH A;  3CU7 A;  2PQA A;  3GTP B;  2C28 A;  4OX9 H;  4RCO A;  3PCO B;  1O7I A;  4QIW B;  5I4D A;  3WOF A;  1RYR A;  3WO0 A;  1D8L A;  4XDX A;  5LP6 F;  2AQ3 B;  2VQE Q;  1IOV A;  1LTR D;  1AH9 A;  3EBE A;  3OMC A;  1JLL B;  2MHV A;  1HUM A;  3MHB A;  4A3E H;  2FMA A;  1VQA A;  1Q8I A;  5I2Y A;  1B1Z A;  2NVY H;  5LL6 S;  4BBR G;  2VUG A;  5CAE B;  1LUZ A;  2EYF A;  2I80 A;  4AQY L;  1W2B A;  1WTO A;  4LF7 L;  2CVR A;  3UDI A;  3STB C;  4QUF A;  2EYH A;  4C2M B;  4APM A;  1HR0 L;  5JPM C;  3U58 A;  3GTP H;  3L7Z C;  1TWG A;  1V1P A;  4F4W A;  3R8B A;  4LF9 L;  4QWB A;  3R5F A;  2K6A A;  5LL6 b;  4GNX C;  3CXC A;  3KUP A;  1JOQ A;  4BBS G;  1Q3L A;  2NN6 G;  4A3I G;  1N36 H;  4K2K A;  4K5V A;  4EGV A;  1F2M A;  4LFB L;  5KFP A;  5AJ3 L;  2FMM A;  5JQW A;  2B39 A;  2ZM6 L;  1HNW H;  4FF1 A;  1STG A;  4R8N A;  1AZP A;  5IGE A;  1C3O A;  1BR9 A;  1VAJ A;  2CW7 A;  2R7F A;  1S0O A;  3EPG A;  3C2P A;  3H94 A;  1MSH A;  1KRS A;  4C2M H;  4UP9 A;  4NB3 A;  2HHH Q;  3A8I E;  2QKI C;  1E2W A;  4K5X A;  3K57 A;  3H0G G;  3H3V H;  1GJX A;  5KFS A;  4HYK A;  4X65 Q;  2FPG B;  1DV2 A;  1OXV A;  2R7M A;  5JVD F;  3W1B A;  1M0T A;  1X32 A;  3IAY A;  2WAQ B;  1R4P B;  5D14 A;  2ICI A;  1ESF A;  2J6U A;  3NTI A;  3E9H A;  4MV6 A;  2E2I A;  1LV9 A;  5JPN C;  2R92 G;  5F9N A;  3T53 B;  2X0S A;  1EQV A;  1A9X A;  1Y1W A;  3W2D A;  1T9H A;  3Q8P B;  1JOK A;  4ZCK A;  2BDN A;  3EVQ A;  5GRO A;  2C5C A;  4JI5 H;  3RUP A;  1WOC A;  3HOZ B;  1EQQ A;  2IHE A;  1N34 H;  3OTO Q;  1JT8 A;  2YS7 A;  3L3O C;  2ATL A;  4DL2 A;  4EEQ A;  2F0N A;  1QG7 A;  4B08 A;  4YP3 A;  1EL0 A;  1IZ6 A;  1VF7 A;  2EYP A;  1W93 A;  3HOV B;  3ZYY X;  2PZW A;  2BDO A;  1QVF A;  3QR8 A;  3SEB A;  1S97 A;  1ENF A;  2QEX A;  1JDE A;  3J80 c;  4ED7 A;  3L2P A;  1KNA A;  4GN5 A;  1X3G A;  2W9A A;  3K5L A;  3RNU A;  4O4L F;  1GUS A;  4DR3 Q;  3OHA A;  4LF4 Q;  2JQO A;  4RKL A;  1EUJ A;  5KFQ A;  5J1Z A;  1X55 A;  1GUW A;  3CD6 A;  5LHY 1;  3KFU A;  4IAJ A;  1OWT A;  2BH8 A;  3HOZ H;  5IGG A;  1WI5 A;  2QDL A;  4DR4 Q;  1O75 A;  4A3J B;  2W71 A;  2MGS A;  5CYU A;  4IRD A;  1JJG A;  3BG3 A;  3S24 A;  2RDJ A;  3TIN A;  4K8I A;  4JI7 L;  4ED2 A;  4S3S A;  1TWA B;  3MWE A;  5FD5 A;  4OO1 H;  4JCV E;  4X3T A;  4ZUI A;  3PW5 A;  4X64 Q;  3HOV H;  5IYB G;  2L4N A;  4DPG A;  2R7Z B;  1DV1 A;  1CA6 A;  4L5S A;  5D1O A;  1H9S B;  3PR5 B;  2F0P A;  2QA4 A;  2XNA C;  4JI6 H;  4NPS A;  5CV7 A;  4ZRZ A;  5IYC H;  3KBG A;  5L9X A;  3NGD A;  1JX4 A;  3N42 B;  2UXC H;  1SEB D;  4JI0 H;  3I7F A;  1DIK A;  3T51 B;  1MJC A;  3V05 A;  2DZD A;  3FMA A;  3UQ8 A;  2E75 C;  4LH6 A;  3KHH A;  1D1K A;  2C2R A;  2R86 A;  4A3J H;  4DL4 A;  1TQO A;  2IP4 A;  2NVX B;  5KT6 A;  3S1Q B;  4QWC A;  5JOB A;  4H13 C;  4G3I A;  2MO1 A;  1TWA H;  3D31 A;  2EY1 A;  1K8O A;  5JEA H;  3CCU A;  3MFH A;  3GIJ A;  2R7Z H;  1MD2 D;  3U4Z A;  5EBD A;  1CKM A;  4ZHQ F;  1IYJ B;  3TDQ A;  1J9O A;  1JWU D;  1GYF A;  2H5X A;  5K2M A;  2I07 B;  1K1S A;  1Y8P B;  4DAY A;  2R6F A;  1WYD A;  4N9T A;  4OGQ C;  1PRT D;  5ELD A;  2NVX H;  1N32 Q;  5EZY F;  3S1Q H;  3LML A;  4K0K Q;  1ILP A;  3KAJ A;  4BXX G;  4O0A A;  4LFA H;  3H3V I;  2NU6 B;  3ERQ A;  5FD6 A;  1EQT A;  3RZO B;  3FKI B;  4A3K B;  3PVX A;  5M5X B;  2YTX A;  4QWD A;  3MR5 A;  1F2Z A;  3IRB A;  2OTL A;  4RZR A;  5KFX A;  1JC7 A;  3GV6 A;  2FPP B;  1SR3 A;  3PF5 A;  2VNU D;  2KSW A;  1KDA A;  2AUK A;  2YYA A;  3SE0 A;  4C3J B;  3MWM A;  2CQO A;  1TY0 A;  2X69 A;  2E5L H;  1D5X C;  3J80 i;  1ENC A;  3BQ0 A;  1L0X B;  3ND9 A;  2QF7 A;  5CV4 A;  2WDT A;  3ETJ A;  3I4O A;  2ASL A;  4FBT A;  2JA7 A;  2FJZ A;  2PYK A;  3M85 A;  1VCI A;  4HSV A;  5HGT A;  5BR8 H;  2NVQ B;  1HCZ A;  3V2T A;  4ZI7 F;  3DUZ A;  2I5M X;  4CKC A;  3RZO H;  3FKI H;  4A3K H;  5KFT A;  4DU9 A;  5M5X H;  1LTI D;  4JOI A;  3N8D A;  5C4Z A;  2A6H C;  2A74 C;  3L4K A;  1PVO A;  3T1H H;  2HVS A;  1Z7T A;  2JA6 A;  3K3P A;  1K0R A;  4HQ6 A;  4C3J H;  4R8I A;  4J9Q A;  1LT6 D;  2YZM A;  3K58 A;  2VZA A;  1K83 B;  4CDE C;  1PRT F;  1HR0 W;  2VB2 X;  3A7A B;  3Q24 A;  2AQ1 B;  3H4B A;  1N36 L;  3BAA A;  2XTI A;  4DV1 H;  3C0F B;  5KFK A;  2O4X A;  2GA4 B;  4JBJ A;  2KOL A;  4RWS C;  4AQY Q;  4LF7 Q;  2NVQ H;  4JC0 A;  3W5O A;  2MPM A;  2B2T A;  1KBL A;  4MAM A;  4B3M H;  1HNW L;  1R4Q B;  2Z4I A;  1HR0 Q;  4LWC A;  4PZ8 A;  1SFO B;  2F0T A;  4HR7 B;  4DUZ Q;  4J15 A;  4FF2 A;  1EUC B;  4PV1 C;  4LF9 Q;  2WTF A;  3CPW A;  2Q2T A;  1Y69 U;  3KJO A;  2JA5 G;  4XTC S;  4OEM B;  4JBK A;  4DR2 L;  1P16 A;  1W6J A;  1XMQ H;  1KC8 C;  4AYB A;  4YAJ B;  4EG0 A;  1K83 H;  1NNX A;  3CC7 A;  1GVP A;  3AYH B;  4LFB Q;  1CS0 A;  2F0G A;  5AJ3 Q;  3TIG A;  3RIZ A;  1IBM H;  2ZM6 Q;  1XNQ H;  1O80 A;  3S15 B;  2F4I A;  4MV4 A;  2PPB C;  4LF6 H;  2B63 A;  1QVG A;  1EY8 A;  4GC6 A;  3C46 A;  1YNX A;  1M0W A;  5DG7 A;  1IOW A;  4ECW A;  1SFO H;  1Q46 A;  1UE7 A;  3F2U A;  4JI5 L;  3OUZ A;  1L0Y B;  4JOI C;  4B9X A;  5F2D A;  2ASJ A;  1N34 L;  5KFI A;  1OXU A;  5C44 G;  1UAP A;  3RUZ A;  3OYY A;  4UCV A;  2A6E D;  2RGR A;  5IYZ F;  1D6E C;  1O7Y A;  3G6X A;  4KKT A;  5DQG A;  2NWG A;  1XPR A;  2SNM A;  4EEY A;  4IRC A;  4TSS A;  5C5L A;  4NW2 A;  1PA6 A;  1V1O A;  3A5U A;  5FO8 B;  5GON F;  5I9P A;  1C7Y A;  3A7L A;  3TP7 A;  5KFB A;  5KT4 A;  2EVB A;  1G6P A;  2FP4 B;  4A3F G;  4OIK A;  3S15 H;  2JA7 B;  4M7E A;  1SRU A;  1X3F A;  5IP7 G;  5LYJ F;  4UCT A;  2ASB A;  4A3D B;  1KJQ A;  3G8C A;  3TII A;  5HUR A;  3TQT A;  1STY A;  4JI3 H;  4A3L H;  4L8J A;  3M4Y A;  3RLF A;  4GZY C;  1LT4 D;  2DLN A;  3QOL A;  5KNC A;  2W9C B;  4DV2 H;  2K5V A;  4QY7 A;  2L15 A;  2I5L X;  4IO9 A;  1TY2 A;  3BU2 A;  2PQE A;  1FKA H;  5C0X J;  1K8G A;  4O3P A;  1KJ9 A;  3BA8 A;  3DHQ A;  1WD1 A;  4RKB A;  4IR1 A;  1EY5 A;  1GUO A;  2CWA A;  2TMP A;  1FNU A;  2UUA H;  2IT1 A;  4XQN A;  5M5Y B;  1KNE A;  3PO3 B;  1PV4 A;  1SE3 A;  5BMV F;  3C1F A;  2BQU A;  2EOT A;  2J6T A;  3EFX D;  4JI6 L;  1J6Q A;  2BA0 A;  1FVI A;  3E6Z X;  5IT9 L;  4C3H B;  2JA7 H;  4DUY H;  4JBM A;  1RL2 A;  1NAP A;  2KHJ A;  1VF5 C;  4ECU A;  1LTG D;  3BDO A;  1Q81 C;  4A3D H;  4HNU A;  1EFW A;  3MA2 B;  3NTH A;  4PG3 A;  2UXC L;  3N52 A;  2AQ4 A;  5DNF A;  4JI1 H;  2ZT9 C;  1PH9 A;  3PV0 A;  4A75 A;  3CQZ A;  3JZI A;  3GII A;  4JI7 Q;  3A8J E;  5K36 G;  4KKS A;  4QL5 A;  4IUT A;  4MNO A;  3KTM A;  3RR5 A;  1DD2 A;  2VUM B;  1JB3 A;  1D7Q A;  1I4R A;  1VQ6 A;  1SYB A;  4Y52 H;  3PUX A;  1HNX H;  1Y1V G;  1CSQ A;  1CKO A;  2ZJP A;  4B3R L;  2B2Y A;  3WNZ A;  2W7P A;  4J6H A;  5M5Y H;  1RTN A;  4YCU A;  3H09 A;  4A3B B;  3PO3 H;  3N43 B;  2K4K A;  2F0K A;  1NMF A;  1O78 A;  4B9W A;  4C3H H;  3GTM A;  4AIM A;  3G6Y A;  4X62 H;  4ME3 A;  1SYG A;  2KEE A;  2FXQ A;  2WB1 B;  1Q82 C;  3HXL A;  4KHZ A;  1JWS D;  1ICW A;  1S4Z A;  2ZTC A;  2BQ3 A;  2ZXO A;  2Y0S B;  3A54 A;  4K5W A;  3I4M B;  4P72 A;  5IYD G;  4OON A;  2V1C C;  3FDT A;  4DXG A;  2R93 B;  4R9W A;  2DPI A;  4U67 3;  1LTA D;  2JA8 G;  3IG0 A;  5FOB B;  3M3Y B;  4FVM A;  4HJ9 A;  2VXW A;  4LFA L;  2VUM H;  3RBD A;  3HOX B;  3PMF A;  3M4P A;  3DWQ A;  3OMG A;  1O7L A;  2A5H A;  2B2U A;  3DEP A;  4I4T F;  1HZ9 A;  2RSN A;  4RGT A;  4APV A;  1EOV A;  4A3B H;  4OWT B;  2PMZ A;  5KFD A;  3T5J A;  5DG9 A;  4DV0 H;  2JE6 I;  3I56 A;  2AGQ A;  4IPG A;  1K1Q A;  4UCU A;  3PW2 A;  5ISR A;  4G4K A;  2LKV A;  1IYV A;  1AEX A;  2D9U A;  1UE5 A;  3VYU A;  2E5L L;  2F3W A;  5C3E B;  4JI4 H;  1XMO L;  3I4M H;  2R93 H;  1PTO B;  3A56 A;  4A3J G;  4DFA A;  4HID A;  1EZ6 A;  1GLV A;  1I3Q B;  4DL3 A;  3BVM A;  3HRZ C;  1WCM B;  4ALP A;  3M3Y H;  1FD7 D;  2O2L D;  5BR8 L;  3VMM A;  3I70 A;  3KF6 A;  2PVP A;  1V51 A;  4YHH H;  2PCF B;  4ECT A;  3HOX H;  4KK7 A;  3RV3 A;  4MIU A;  5JEA G;  1C4Q A;  3EN2 A;  2FJ2 A;  4O3N A;  4MHE A;  2B2Y C;  3M7G A;  5IOC A;  2JEB I;  4OX9 Q;  2FPI B;  5T1G A;  3EA6 A;  3PF4 A;  3HOU G;  4FS1 A;  3T1H L;  2CZG A;  4QW9 A;  1A8V A;  1HJP A;  5A2Q L;  3HKZ A;  4DF7 A;  3HP3 A;  4J9K A;  1I6H B;  5E4W C;  1GO3 E;  3GTO A;  5C3E H;  3I4N B;  2VA3 A;  1JE5 A;  1D2B A;  1MGS A;  1WTH A;  1PTO H;  1I3Q H;  1VQI A;  5KND A;  1S03 G;  2MFI A;  1WCM H;  2KCT A;  3JAM L;  2HD3 A;  2VL6 A;  1U4R A;  3PUV A;  1TWH B;  4MTD A;  4B3M L;  3GO5 A;  2XRQ D;  1M6V A;  3J81 E;  2JA9 A;  4A2B A;  3HOW B;  2OT2 A;  3T5K A;  5IGB A;  2C2D A;  5E1F A;  4ZYS A;  3IL8 A;  4C5C A;  2OWO A;  4C5B A;  5CMD A;  5CB4 F;  1XMQ L;  3KBX A;  1I6H H;  1Y1W G;  1N36 Q;  2BCO A;  4L63 B;  3I4N H;  1ZQ7 A;  2W7O A;  5KYL A;  3V4Z A;  5L1K A;  1VKZ A;  1B04 A;  3NWS A;  3OIQ A;  3LWE A;  4KTA A;  5BN5 A;  2EJF C;  1IBM L;  4P71 A;  2NVY A;  5A35 A;  1HNW Q;  1XNQ L;  2M2L A;  2UVR A;  2CQA A;  4QWA A;  1TWH H;  5J3B A;  2UUB H;  2I5H A;  1T36 A;  1TS4 A;  3R93 A;  1GOZ A;  5KFA A;  2XSC A;  1WTP A;  3SDZ A;  2QEJ C;  4I7Z C;  5IGF A;  3HOW H;  2EQS A;  1T3N A;  3KLS A;  5C8Y F;  2W6Z A;  2X6L A;  1KJJ A;  1T5E A;  1FGB D;  2RKS A;  5F9L A;  1L1O A;  1KLG D;  1C30 A;  3RN5 A;  4X66 H;  2FFK B;  2FMC A;  2QK4 A;  5KKN B;  3QZ7 A;  4CDF C;  2OEO A;  2C00 A;  2K75 A;  3UDX A;  1NE3 A;  1VQC A;  5KG7 A;  2YV5 A;  3W3A A;  5M3M B;  3F8T A;  5I47 A;  1HA6 A;  4YR2 A;  4LF5 H;  5C0X H;  3CCV A;  2K01 A;  4QIW E;  5FK9 C;  4EBE A;  4WOR A;  4JI5 Q;  1EY6 A;  3BG5 A;  3TME A;  5EKI A;  4GC7 A;  1H9R A;  1BJT A;  1N34 Q;  3KF6 B;  2CW0 C;  1EY4 A;  2N78 A;  2R6G A;  4JI3 L;  3QO2 A;  4C2M A;  4JW0 A;  2K14 A;  1YNJ C;  4F4Z A;  4DV2 L;  3GDE A;  4OEL B;  5CR3 A;  1SNC A;  3OIP A;  1SSO A;  4N9P A;  3JRW A;  4ED0 A;  3Q2O A;  3PW0 A;  5M3M H;  3TP5 A;  1PMR A;  2QIL A;  3K7A B;  1VQL A;  5FJ8 G;  1EWH A;  2KVM A;  3AMU A;  2UUA L;  4YY3 H;  2F0E A;  1F2L A;  2VA2 A;  4DAM A;  2XWB B;  2DNE A;  4J9O A;  4NXN H;  2R3Z A;  2PI2 E;  4A3M B;  4DUY L;  2Q8I B;  1H95 A;  3CF5 A;  4FU0 A;  2BA1 A;  2H1E A;  3DF7 A;  3Q1K A;  2JEA I;  2DPJ A;  1NSN S;  1W96 A;  4JI1 L;  2EPB A;  3MTS A;  2D0O A;  2F0Q A;  3S1R B;  4BY1 G;  5IT9 W;  3GID A;  3A8K E;  4A2A A;  2HDM A;  1JOR A;  2X6G A;  1KRT A;  4IJH A;  2ZDG A;  1J5E H;  4TV9 F;  3DMU A;  3PGZ A;  2RDF A;  1SND A;  3E9I A;  3BVZ A;  3K81 C;  4JI6 Q;  1HNX L;  3J7A 5;  3HOY B;  4I55 F;  3K7A H;  5J2U F;  3M9N B;  1EUD B;  4WD3 A;  3PO2 G;  1G8Z D;  2F0J A;  3VPC A;  2VB3 X;  1SE2 A;  1GUG A;  3K3V A;  1SJE D;  4JI0 Q;  4A3M H;  2RHQ B;  3EIV A;  1C9O A;  4RB3 C;  3HGB A;  4X62 L;  3Q23 A;  1YIT A;  4IPD A;  1QOH A;  2LXK A;  4IUP A;  2WAQ E;  1KQS A;  1U4L A;  3S1R H;  4BY7 B;  3H3V C;  1KLU D;  3EYY A;  1V8Q A;  3AB9 A;  2IA6 A;  2PN1 A;  1VQE A;  2DUD A;  4CJ1 B;  4KY7 A;  2K5D A;  3Q0A A;  1L1O B;  2A68 D;  1HPC A;  4R1J A;  5ELE A;  2GPW A;  4LAA A;  1WR2 A;  1FJG H;  2KBN A;  5JVH 3;  3HOY H;  3TS0 A;  1WTX A;  4WJ4 A;  1TWF B;  3J81 j;  5L1I A;  3MXN B;  5T14 A;  1EOT A;  4DV0 L;  2JA7 G;  3IFD A;  1VMC A;  1A15 A;  4KKU A;  3H40 A;  5DEH A;  2HQL A;  5KIX A;  1XWE A;  4PMC A;  3MJF A;  2MCT A;  1N33 H;  4JI4 L;  3J7A F;  2K28 A;  4BY7 H;  4LFA Q;  2Z1C A;  1F9R A;  1EFI D;  2WAC A;  4A4I A;  2JYO A;  4P74 A;  5IT9 E;  1SNM A;  2KHI A;  1TWA A;  4TVA B;  4FS2 A;  4HJA A;  5IY0 A;  2EY6 A;  1LYL A;  2JA6 G;  1EU4 A;  3SK5 A;  4YHH L;  1WJJ A;  2R7Z A;  1H9S A;  2LFN A;  1ML0 D;  4ECR A;  2PBZ A;  2A8V A;  3V6K A;  1TWF H;  1E2Z A;  1BNC A;  5LL6 X;  1AN8 A;  2MJ8 A;  5HGQ A;  3NQT A;  2K32 A;  2R7N A;  1HQM C;  4UP7 A;  1VQ7 A;  2E5L Q;  3OUU A;  1FL0 A;  1KJI A;  4J9S A; 
#chains in the Genus database with same CATH homology
 2YTY A;  3PUZ A;  1L0W A;  4EX5 A;  3CMA A;  1HZB A;  3UDF A;  1YHQ A;  1HNZ L;  2YTX A;  4DV7 L;  3IRB A;  5IWA L;  3FP9 A;  5M3F G;  4DK3 C;  5BR8 Q;  1PH8 A;  1X3E A;  1OTC A;  2OTL A;  3CC4 A;  2AMC B;  1SR3 A;  3ULJ A;  3PF5 A;  2VNU D;  2D0P A;  5FLM H;  3M4O H;  4R4Q A;  1KL9 A;  3W1G A;  2UU9 Q;  4DR6 L;  3NEN A;  1EYG A;  2CQO A;  3T1Y Q;  1VQP A;  4JI0 L;  3HKS A;  5C4X G;  2ZJQ A;  3J80 i;  3CW2 C;  1VQD A;  1PYS B;  4A3C H;  1B8A A;  3T1H Q;  4AYB G;  3Q8D A;  1VQN A;  2PNH A;  2QGQ A;  2F4V Q;  3I4O A;  5IE8 A;  4UP8 A;  4A3B G;  3M85 A;  1VCI A;  5LMU L;  1V9P A;  2JA6 H;  2AWO A;  1YHB A;  3I2Z A;  2I5M X;  3BZK A;  1AE3 A;  1JMC A;  1CSP A;  1EIY B;  3RZO H;  4O0A A;  3FKI H;  4A3K H;  2B63 G;  1A0I A;  3HFZ B;  1V1Q A;  4POF A;  4LUZ A;  4JOI A;  5M5X H;  4DV1 Q;  4JV5 Q;  2VQE L;  4JYA L;  5JJI A;  3K80 C;  2A19 A;  3E0E A;  3LGJ A;  3M7N A;  4BXX H;  4NXM Q;  1MIU A;  4IPH A;  1PVO A;  1IBL Q;  1C0A A;  4YCW A;  4GLX A;  4B3M Q;  1IXR A;  1K0R A;  3NEL A;  3TS2 A;  4C3J H;  2NZH A;  4DV3 L;  1OXX K;  3JAM c;  1EWI A;  4PZ6 A;  2UUB L;  2VZA A;  3RLN A;  5M3F H;  4IFD J;  1HR0 W;  1UEB A;  2GN5 A;  2KCM A;  4GOP C;  4IFD I;  4GLA C;  1K3R A;  3CCM A;  3J7Z C;  2WFW A;  2RF4 A;  1EQR A;  1I5F A;  2E8G A;  1N36 L;  2XTI A;  1XNR L;  4XIG S;  1XMQ Q;  1Y14 B;  5ELO A;  4JBJ A;  5C4X H;  3K8A A;  4AQY Q;  4LF7 Q;  2NVQ H;  4QQB X;  1L1O C;  4JC0 A;  3W5O A;  4X66 L;  1VQO A;  3GD7 A;  2IX1 A;  4KI0 A;  1HNW L;  4YCV A;  1HR0 Q;  4LWC A;  4PZ8 A;  3CCJ A;  1IBM Q;  4DUZ Q;  4J15 A;  1XNQ Q;  4LF9 Q;  3JC6 6;  1Q86 C;  4LF6 Q;  3CPW A;  2Q2T A;  2RHS B;  3KJO A;  2JA5 G;  4LF5 L;  3TRZ A;  4XTC S;  4JBK A;  3A5Z B;  4DR2 L;  1N32 L;  2UXC Q;  1P16 A;  5FLX c;  1KC8 C;  1VQ5 A;  3PUW A;  4DV5 L;  2B63 H;  2ID0 A;  2Q2U A;  1BBW A;  1K83 H;  3CC7 A;  4RMF A;  1GVP A;  3AYH B;  4DK6 C;  1SRO A;  4LFB Q;  1E24 A;  5AJ3 Q;  2CKZ B;  2IHF A;  2ZM6 Q;  4DV4 L;  4A3L G;  1HZC A;  4PZ7 A;  3J81 c;  3ICE A;  4YWL A;  4IJL A;  1Z9F A;  4GNX A;  2F3I A;  3KF8 B;  3RLO A;  2Z0S A;  2NZO A;  2VS1 A;  1QVG A;  2HHH L;  1YNX A;  4JBW A;  3UDG A;  4B3R Q;  5JEA J;  4X65 L;  1SFO H;  1Q46 A;  1UE7 A;  1GM5 A;  4YWM A;  4JI5 L;  1VQK A;  3DLL A;  4JOI C;  1KHI A;  1M90 C;  1N34 L;  1IBK L;  1JB7 A;  4YY3 L;  4A93 G;  5E7N A;  1OXU A;  5C44 G;  1K9M C;  3S2H H;  4Y7N H;  3KDF B;  4UY8 C;  1PH4 A;  4JI3 Q;  3OYY A;  4NXN L;  1IL2 A;  2UXD L;  4AH6 A;  3FHW A;  4QGU A;  1XPR A;  4DV2 Q;  4A3D G;  1PA6 A;  1TWC H;  3A5U A;  1C7Y A;  2CCZ A;  2JA5 H;  2ATW A;  2JJQ A;  1XTD A;  2AWN A;  1X56 A;  2B3G A;  3OW2 A;  4DV1 L;  1G6P A;  4A3F G;  2VQF Q;  3S15 H;  2ZTD A;  1SRU A;  1I50 H;  3OTO L;  1X3F A;  2XGT A;  5IP7 G;  1Q7Y C;  4OWW B;  4LFC L;  4B3T Q;  2ASB A;  1E1O A;  1YVC A;  1KXL A;  4GN4 B;  1J5E L;  2UUA Q;  5GQO A;  2UUC Q;  1SMX A;  4A3L H;  3RLF A;  2F52 A;  2Z6K C;  1S40 A;  4DUY Q;  2K5N A;  2K5V A;  2L15 A;  4QY7 A;  4RG1 A;  2I5L X;  3KJP A;  2BH2 A;  4DV6 Q;  4IO9 A;  3BU2 A;  3F2D A;  1V43 A;  3PO3 G;  1R9T H;  3A74 A;  5C0X J;  3K0X A;  3AQQ A;  1K8G A;  4JI1 Q;  5C0X I;  3STB D;  2Q2I A;  4X6A H;  4DR3 L;  1XMO Q;  4LF4 L;  4TQU S;  2CWA A;  1NMG A;  4A93 H;  3GTG H;  1X9N A;  2IT1 A;  5C44 H;  3CQZ H;  1YJN A;  4DUZ L;  1PV4 A;  3ULL A;  3JAM i;  4JI6 L;  1N8R C;  1J6Q A;  2BA0 A;  1FVI A;  3KDF A;  4BA1 I;  4DR4 L;  5JJL A;  4LF6 L;  2JA7 H;  2JK8 A;  3WWV A;  4JBM A;  1RL2 A;  2KHJ A;  3SGI A;  4L5T A;  1CUK A;  1HNX Q;  1Q81 C;  4A3D H;  1UE1 A;  4LUV A;  1M1K C;  1EFW A;  2UXC L;  4MTN A;  4PG3 A;  1CKN B;  4QJF A;  3S16 H;  3I55 A;  4HIK A;  1FJG L;  2VUM G;  3GTQ H;  1PH9 A;  3PV0 A;  2MNA A;  4P75 A;  4A75 A;  1SE8 A;  1PH3 A;  4A3F H;  3NEM A;  2IY5 B;  2NN6 I;  4X64 L;  4JI7 Q;  1WFQ A;  1UE6 A;  3K7U C;  4YWK A;  5IP7 H;  4P73 A;  1PH2 A;  3PSI A;  2UXB L;  4QL5 A;  5K36 G;  4KHP L;  4PMW A;  4MNO A;  1K73 C;  3RR5 A;  1KIX A;  3GTM H;  1NY4 A;  1W3S A;  4O2D A;  1NJI C;  4R4T A;  1VQ6 A;  1D7Q A;  4Y52 H;  1QVC A;  3PUX A;  5GAH C;  1Y1V G;  1CSQ A;  1CKO A;  2WB1 G;  4FDB A;  2ZJP A;  1PH7 A;  3AEV A;  5LMN L;  4B3R L;  5M5Y H;  1U5K A;  4YCU A;  1MJE A;  1N33 L;  3PO3 H;  2Y0S G;  3I4M G;  1VQG A;  2K4K A;  4UPA A;  1NMF A;  1KD1 C;  2R93 G;  4C3H H;  4AIM A;  4WJ3 M;  2ZJR A;  4POG A;  1AE2 A;  4ME3 A;  4R4I A;  1Q82 C;  2FXQ A;  3G48 A;  4GNX B;  4B3S Q;  2MO0 A;  4KHZ A;  4DR5 L;  2YYZ A;  2ZTC A;  3HKZ G;  3S1M H;  3J81 i;  4IFD G;  1YEZ A;  3HOX G;  4P72 A;  5IYD G;  4OON A;  2V1C C;  4DV0 Q;  3AFQ A;  2K50 A;  1Q1B A;  2GVA A;  2K52 A;  2PI2 A;  3TRE A;  2JA8 G;  2ALY B;  2K5H A;  4HJ9 A;  2R7D A;  4EQ5 A;  4LFA L;  4JI4 Q;  4DR1 Q;  2VUM H;  1E7Z A;  1VQF A;  1CKN A;  1SN8 A;  3M4P A;  1Q12 A;  2IX0 A;  4IOC A;  2YU9 H;  1LTL A;  4KLK A;  1HZ9 A;  4GKK Q;  4GKJ L;  4OO1 I;  4APV A;  1EOV A;  5C3E G;  4DR7 L;  4A3B H;  4OWT B;  3NBH B;  3CCS A;  4GLV B;  1YBY A;  2PQA B;  4LF8 Q;  1Q1E A;  4YHH Q;  2JE6 I;  4JI2 Q;  4HIO A;  3I56 A;  1K8A C;  1VQJ A;  4IPG A;  4JI8 Q;  1QUQ B;  2E2J H;  5JJK A;  1WCM G;  2E2H H;  3UE1 A;  1RIP A;  1Y1V H;  3S14 H;  1UE5 A;  4K0K L;  1I94 L;  2E5L L;  1XJV A;  3B6Y A;  3PUY A;  3ERS X;  2EXD A;  1XMO L;  3I4M H;  4HJ8 A;  2OQK A;  2R93 H;  2D62 A;  2LSS A;  4HID A;  4A3J G;  2HIX A;  3UE0 A;  5IP9 G;  2I0Q A;  2DGY A;  3KOJ A;  4A3E G;  4ALP A;  3M3Y H;  5BR8 L;  3KF6 A;  4C3I H;  5M5W H;  3G71 A;  1LM0 A;  4DV7 Q;  1HNZ Q;  4BA2 I;  3HOX H;  5IYD H;  1A63 A;  5JEA G;  2EIF A;  1EIF A;  3EN2 A;  1N9W A;  4MZ9 A;  2RCN A;  1NBW A;  3BJU A;  4AYB E;  2UU9 L;  2JA8 H;  3T1Y L;  2JEB I;  3CCE A;  4OX9 Q;  4L5R C;  3I4N G;  4DR6 Q;  3PF4 A;  1YIJ A;  3HOU G;  1OXT A;  3ER0 A;  3ZJY C;  3T1H L;  1A8V A;  1HJP A;  1G29 1;  1P8L A;  1PH1 A;  2F4V L;  4A3G G;  2WB1 E;  1BVS A;  1GO3 E;  5C3E H;  2Y0S E;  1JE5 A;  3MEF A;  5LMU Q;  1SLJ A;  2NVT H;  2YTV A;  2WP8 J;  2PQA A;  1I3Q H;  1VQI A;  4JG2 A;  3RZD H;  1MKH A;  2MFI A;  1WCM H;  2KCT A;  3HOW G;  3PCO B;  1O7I A;  1QUQ A;  2VL6 A;  4JV5 L;  3PUV A;  4JYA Q;  3CAM A;  1PH5 A;  1D8L A;  4NXM L;  3CC2 A;  2VQE Q;  1IBL L;  4B3M L;  1ASY A;  1AH9 A;  3GO5 A;  3EBE A;  5IP9 H;  2JA9 A;  2E5L Q;  1OXS C;  5HY6 A;  2CWP A;  1YJ9 A;  4A3E H;  3CCL A;  4DV3 Q;  1VQA A;  1GKH A;  3A0J A;  4H02 A;  1JJ2 A;  3GTO H;  2UUB Q;  2NVY H;  1TWG H;  4BBR G;  3S1N H;  2OWO A;  5C0X G;  1LUZ A;  5GAG C;  2N49 A;  3F2B A;  1XMQ L;  1I6H H;  4AQY L;  1Y1W G;  1W2B A;  1QZG A;  1N36 Q;  4LF7 L;  1XNR Q;  3I4N H;  1X65 A;  3UDI A;  4OXP A;  3STB C;  5GAD C;  4HJ5 A;  3HOU H;  3G6E A;  1HR0 L;  4X66 Q;  1VQM A;  3U58 A;  3GTP H;  1IBM L;  3L7Z C;  4P71 A;  1B7Y B;  1HNW Q;  1XNQ L;  4A3G H;  4LF9 L;  1TWH H;  5J3B A;  4GNX C;  2I5H A;  2GVB A;  3CXC A;  3G4S A;  2AHO B;  1TXY A;  4LF5 Q;  4BBS G;  4LW1 A;  4IPC A;  1X6O A;  1DGS A;  2EQS A;  2NN6 G;  4A3I G;  3M4Q A;  3HOW H;  2MQH A;  2ZTE A;  5M3M G;  1L2F A;  4DV5 Q;  1L1O A;  4LFB L;  3BZC A;  5AJ3 L;  3RN5 A;  4X62 Q;  2ZM6 L;  2K75 A;  4GS3 A;  4GN3 B;  3UDX A;  1NE3 A;  1KAW A;  1VQC A;  4DV4 Q;  2YV5 A;  3S2D H;  2R7F A;  1HZA A;  3F8T A;  1KRS A;  1YHA A;  4C2M H;  1VQ4 A;  3M9B A;  4UP9 A;  4NB3 A;  4BBR H;  2HHH Q;  2WAQ G;  4DNI A;  2E2I H;  3S17 H;  4OX9 L;  3CP0 A;  3H0G G;  3CCV A;  3H3V H;  2AKW B;  4QIW E;  4X65 Q;  5EAY A;  3U4V A;  1Y1W H;  4JI5 Q;  3CCQ A;  1OXV A;  1QZH A;  1VQ8 A;  1PH6 A;  1NTG A;  3AFP A;  3W1B A;  3KF6 B;  1N34 Q;  1IBK Q;  4YY3 Q;  1Z47 A;  1VS0 A;  2N78 A;  2R6G A;  5DLQ E;  4JI3 L;  3F2C A;  3E9H A;  2K14 A;  3HOZ G;  4NXN Q;  2A1A A;  2R92 G;  4DV2 L;  1E3P A;  2B29 A;  3GDE A;  2UXD Q;  3D0F A;  1T9H A;  4LUO A;  4BBS H;  5GRO A;  2VQF L;  4A3M G;  4A3I H;  1B70 B;  1WOC A;  5H1S E;  4OO1 G;  5M3M H;  1EQQ A;  2IHE A;  4B3T L;  3HOV G;  3OTO Q;  1VQL A;  5FJ8 G;  2UUA L;  5GAE C;  2UUC L;  1JT8 A;  1YZ6 A;  4LFC Q;  4DAM A;  3DM3 A;  1J5E Q;  1S72 A;  3HOZ H;  2PI2 E;  3KYH C;  1XPU A;  4DUY L;  5IYC G;  1H95 A;  1YJW A;  1VQB A;  1IZ6 A;  3CF5 A;  2BA1 A;  2C35 B;  4DV6 L;  3PIO A;  2JEA I;  4OWX B;  1QVF A;  4JI1 L;  3TQY A;  2QEX A;  1BBU A;  3GTL H;  3H0G H;  4DKA C;  2D0O A;  3J80 c;  3L2P A;  4BY1 G;  4GN5 A;  1X3G A;  3L0O A;  2N8N A;  3PIP A;  3GTK H;  3HOY G;  3RNU A;  4DR3 Q;  4LF4 Q;  2PMZ E;  2N3S A;  2JQO A;  4L5Q A;  1EUJ A;  1KRT A;  2OTJ A;  4IJH A;  2CFM A;  3PGZ A;  1X55 A;  3CD6 A;  2HT1 A;  5IWA Q;  3KFU A;  3E9I A;  2BH8 A;  3K81 C;  1YI2 A;  1E22 A;  1WI5 A;  2Z6K A;  4JI6 Q;  1HNX L;  2R92 H;  3J7A 5;  4DR4 Q;  3K7A H;  2R7Z G;  3PO2 G;  1JJG A;  3H15 A;  3S24 A;  1X54 A;  4JI0 Q;  4BY7 G;  4A3M H;  1FJG Q;  4JI7 L;  2RHQ B;  3EIV A;  1C9O A;  4R4C A;  1PYB A;  4JCV E;  5IT9 c;  4X62 L;  1YIT A;  1A62 A;  4IPD A;  4X64 Q;  5IYB G;  5LMN W;  4HIM A;  5FJ8 H;  3HOV H;  2LXK A;  4DPG A;  3CPF A;  2WAQ E;  1KQS A;  4L5S A;  2UXB Q;  4HJ7 A;  4GOP B;  4KHP Q;  3F1Z A;  3S1R H;  2QA4 A;  4DAY B;  1JJC B;  3RN2 A;  4LNQ A;  1VQ9 A;  4NPS A;  2HIV A;  1UWV A;  5IYC H;  3GTJ H;  1VQE A;  2DUD A;  1L1O B;  5LMN Q;  4R1J A;  3HKZ E;  3I7F A;  1N33 Q;  1MJC A;  2ES2 A;  1ASZ A;  2KBN A;  3CCR A;  1PFS A;  4BY1 H;  2VW9 A;  1VQH A;  4A3J H;  3HOY H;  3TS0 A;  4R4O A;  2LXJ A;  4WJ4 A;  4B3S L;  3J81 j;  2VY3 A;  1BKB A;  3MXN B;  4DR5 Q;  1S3O A;  3KLW A;  4DV0 L;  1GD7 A;  2JA7 G;  2MO1 A;  5FLM G;  3TEH B;  1TWA H;  3D31 A;  3CCU A;  4IOA A;  2HQL A;  1E1T A;  1U0L A;  2R7Z H;  3VDY A;  3PO2 H;  3U4Z A;  2OCE A;  4JI4 L;  2KEN A;  4DR1 L;  1PHJ A;  1CKM A;  2Q2H A;  5C4J H;  2OQ0 A;  4LFA Q;  1XPO A;  4BY7 H;  4A3C G;  1IYJ B;  4A4I A;  4P74 A;  3ULP A;  4GKK L;  2KHI A;  5IYB H;  3U50 C;  4TVA B;  4GKJ Q;  4HJA A;  5IY0 A;  4LF8 L;  1LYL A;  2JA6 G;  4YHH L;  4DR7 Q;  2H5X A;  1WJJ A;  4JI2 L;  4JI8 L;  4A76 A;  4GOP A;  1FGU A;  1HH2 P;  1WYD A;  1Q8K A;  1TWF H;  3FKI G;  2A8V A;  4A3K G;  3CME A;  1N32 Q;  4DR2 Q;  2NVX H;  5ELN A;  5HGQ A;  3S1Q H;  1G51 A;  4UP7 A;  1I94 Q;  1VQ7 A;  4K0K Q;  4BXX G;  1FL0 A;  3H3V I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...