3HOUG

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3houG01
5FJ8G 1SFOH 4X65Q 4DV7Q 3RLFA 2VUMG 4LF5L 4LNQA 1HNXL 1K3RA 4JI8L 3TQYA 3CD6A 2UXBQ 2RF4A 3CP0A 3F2BA 4DR4L 2NVTH 1YZ6A 3M4OH 2NZHA 2VQEQ 1KXLA 4LWCA 3K8AA 2LSSA 1U0LA 1E7ZA 2JA8G 1LM0A 1PH5A 2ZTEA 4BY7H 1MJEA 3CCLA 1MJCA 1N33Q 1XNQQ 4HJ9A 4JYAQ 2CKZB 5M3MG 1S3OA 2FXQA 1QVCA 4JC0A 4X64Q 1D8LA 1E24A 5M5YH 3HOXG 1WOCA 1TXYA 4NB3A 4DR3L 1L1OB 1J5EQ 2IX1A 3OTOL 1VQAA 2IT1A 3FKIH 3NEMA 4HIMA 1N32Q 3L7ZC 4P72A 2VQEL 3HKZG 2E2JH 1V9PA 1PVOA 3RZDH 1SLJA 4PMWA 4OX9L 2YTVA 4HIKA 2HIXA 1YITA 4UPAA 4O0AA 5JEAJ 2AKWB 3G48A 4DUYL 3SGIA 4AH6A 3L2PA 4DR5L 4R4IA 2CFMA 2R6GA 1VQLA 2PI2E 1OXUA 2OTLA 5BR8L 1KL9A 3ZJYC 4DPGA 4B3ML 4QQBX 5LMNQ 2ZTDA 1VS0A 2GN5A 3CPFA 1GO3E 2JQOA 5IYBG 3OTOQ 4GNXC 4A3MG 2LXKA 2PQAA 4BXXG 2K5VA 4NXMQ 4A3LG 2VY3A 2I5MX 4GN5A 3GTQH 3M85A 1N8RC 4GNXA 3PO2G 1C0AA 1EUJA 1IZ6A 2ZJPA 4OWWB 4DR2L 4JI1L 1PH7A 2JA8H 3UDXA 2HIVA 3PUYA 3KDFA 4X62L 3J81c 1HNWQ 1WJJA 3HKZE 5M3FG 1VQ4A 5M3MH 3S1RH 4FDBA 4KHZA 3H3VH 4YWMA 1TWFH 3CCVA 4GOPB 4YCUA 4JI4Q 1KAWA 2YTYA 1N36L 1GD7A 5C4XH 1HNXQ 4A3CG 3GD7A 2K52A 4DV4L 1I94L 3AEVA 2UUAQ 3STBC 2EQSA 2YTXA 1CSPA 3GO5A 1PH3A 2Q2TA 1IBKL 5JJIA 4A3GH 3A0JA 1G291 1PYSB 3AQQA 2KHIA 1I50H 4MNOA 4JBMA 4B3RQ 3F1ZA 1VQKA 1UE1A 4L5QA 4POGA 1CUKA 1IBMQ 1HZ9A 1VQDA 4BBSH 1MKHA 1XTDA 1S72A 4DR7L 3HOWG 3HKSA 3RN5A 4A93H 1PH4A 4JG2A 1HJPA 4IPGA 4X66Q 3CCSA 4A3CH 2ZJRA 1P8LA 1Y1WG 2UUBQ 4LF7L 4GKKL 2EXDA 1NE3A 3KDFB 1HZBA 2CCZA 1XNRL 2WAQG 1NMGA 4NPSA 4WJ4A 3GTMH 2VQFL 2R7ZG 4P73A 3J80i 5LMUQ 4HJ5A 2XTIA 1PH8A 5JEAG 4QL5A 1WCMG 1TWAH 2UU9Q 2UXDQ 1HH2P 1OXSC 2JEBI 3AFPA 3DM3A 5ELNA 3S1QH 1VQ6A 1Y14B 4OX9Q 1K9MC 2A8VA 4X65L 3FHWA 4DV7L 4R4QA 2B63H 3PSIA 4B3MQ 1XMOL 1HR0L 1XPUA 2K5HA 5GAGC 1X65A 2CWPA 2HQLA 2VW9A 3VDYA 2E5LL 2R93G 2D62A 3K80C 5C44H 4DV6Q 1KD1C 4TQUS 2JA9A 1JT8A 4IFDG 1E3PA 5C4JH 2BH2A 3GDEA 5C0XI 2UUCQ 4BY7G 4JI1Q 4AYBG 2VNUD 1NTGA 2AHOB 1I5FA 1HNWL 4R4CA 2NZOA 4X6AH 2ZM6Q 3CPWA 3GTPH 2AWNA 3FKIG 2E8GA 3KFUA 1RL2A 1SR3A 3S24A 4JBJA 1YJ9A 2MFIA 4LF6Q 3A5ZB 4DV3L 3HOZH 1FVIA 4YCVA 4JOIC 3JAMc 3KOJA 1JB7A 2JA6H 1VQIA 4JI2Q 4DV4Q 1E1OA 1Q46A 2WAQE 4JV5L 1WI5A 5IYDG 1YNXA 3CMEA 3M9BA 1A63A 3CC4A 4Y7NH 1N36Q 1EQRA 4BBRG 1EIYB 4DK3C 2NN6G 5IWAL 1CKNA 2JE6I 5GAHC 1WFQA 4DR5Q 1HZAA 2I5HA 4QJFA 1PV4A 1BVSA 2Q2HA 4LFBL 2DUDA 4DAMA 3J81i 3J81j 3GTGH 2MNAA 1JE5A 2N78A 3RR5A 2UUBL 4LF7Q 1AE3A 4DV3Q 4LF9L 4GKKQ 1JJ2A 5IT9c 2C35B 1YEZA 3KLWA 4LF6L 4APVA 2QGQA 2VZAA 1FL0A 5IP7G 1K73C 4DR7Q 3TS0A 2ALYB 3PUXA 1C7YA 2Y0SE 2ZM6L 4UP9A 1EIFA 2ID0A 1PH9A 4DUZQ 4ME3A 5C0XG 2ASBA 2N8NA 3U58A 3M7NA 4R4TA 3HOYG 3M3YH 4A3JG 1PFSA 5M5XH 4DV5L 3NENA 4LFAL 2K75A 3CW2C 2E2IH 1EFWA 3EBEA 4YCWA 4C3HH 1TWCH 3F2CA 4JI0L 1IBLL 1P16A 1V43A 4POFA 1XPOA 1Z9FA 1IXRA 2OQ0A 5FLXc 5HY6A 4GKJQ 1XMQL 2R92G 3WWVA 3J7A5 3PCOB 1IBKQ 1DGSA 3U4VA 3BZKA 4J15A 2F3IA 4DUZL 3BJUA 1X3EA 1Q82C 2NN6I 1J5EL 4YY3Q 2AWOA 1VQ5A 2IX0A 2WB1G 3H0GG 4DKAC 1IL2A 4GN3B 2HHHL 4DR6L 1SE8A 1VQJA 3I55A 1Y1VG 4NXNQ 4DV1Q 1VQOA 3HOXH 2MO1A 1SN8A 3K81C 4R4OA 2ZJQA 1CSQA 1VQCA 3HFZB 4A3IG 2UXCQ 3E9HA 4RMFA 1QZGA 3I4NG 5IP7H 2F4VL 1C9OA 1WCMH 3W5OA 1CKOA 2OCEA 1OXXK 4KHPQ 4JV5Q 1X54A 4MTNA 1PA6A 4LF5Q 1VCIA 2OQKA 1QVGA 1V1QA 2RHSB 4R1JA 1YJWA 3S1NH 3G71A 4PZ8A 3TREA 1L2FA 4LFCQ 4IO9A 4TVAB 3K0XA 3J7ZC 2ATWA 3D31A 1SROA 4IFDI 1E1TA 4JBWA 1OXTA 4OWXB 5H1SE 3PUWA 4BY1H 4A3LH 2VS1A 2JA6G 1YHQA 3STBD 1X3GA 3LGJA 2AMCB 1A62A 1YHBA 4DV1L 4IOAA 4PG3A 3K7UC 2XGTA 3NBHB 3OW2A 4JBKA 1W2BA 1VQHA 3H15A 1JJCB 1B8AA 1CKNB 1MIUA 4JI6Q 3TRZA 4P71A 1PH6A 5BR8Q 1VQ7A 4LF8L 2MO0A 4GLVB 4UP8A 4IPHA 4C3JH 1T9HA 1YI2A 5K36G 3I4MH 1Q7YC 2D0OA 1PYBA 1YHAA 1OXVA 4JI3Q 3I4OA 4DNIA 3Q8DA 4IFDJ 3KJOA 3ULPA 4A3KG 4A3EG 2UXBL 1D7QA 2VQFQ 2JK8A 2IHFA 3PO2H 5JJLA 3BZCA 1GKHA 1Q81C 1R9TH 1JMCA 4EQ5A 1FJGQ 4OWTB 3HOVH 1G51A 5IYCH 3M4PA 4OONA 1LYLA 4A3BG 1VQEA 4GN4B 4NXNL 3RZOH 4AYBE 1YJNA 4X62Q 2Y0SG 4B3TL 2LXJA 4IOCA 5LMNW 2HHHQ 1YIJA 3CCQA 4A3DH 4DV0L 3GTOH 2V1CC 4IPCA 1NY4A 4C3IH 3EIVA 4LF9Q 3A5UA 5GADC 1PH1A 4JI7L 4BA2I 2R7DA 2IY5B 1UE6A 1XNQL 4JI5L 4YHHQ 1BBUA 1I3QH 1IYJB 5C3EH 3HOVG 2UUAL 4A93G 1IBML 1I6HH 3HOWH 3RNUA 5FLMH 2JA7G 4P74A 5IYBH 1FJGL 3HOYH 3I56A 4QIWE 4BXXH 2Q2IA 5ELOA 4QGUA 4AQYL 4A3FH 1Q86C 3S15H 3RLNA 1IBLQ 4A3DG 1RIPA 4B3SQ 3CCEA 2R92H 1VQBA 3CC7A 2Z0SA 5HGQA 1Q1EA 2A19A 4DV2L 2Z6KA 1U5KA 3KYHC 3FP9A 2OTJA 2KCMA 4A76A 2QEXA 3T1YL 1HNZQ 2A1AA 4YWLA 1EQQA 4EX5A 1JJGA 2Z6KC 2E2HH 1X3FA 3W1BA 2NVXH 3CQZH 2NVYH 4JOIA 2KENA 4O2DA 4DR1Q 1PH2A 4LF4Q 4DR6Q 4DR2Q 4WJ3M 1TWHH 1QUQB 4LUVA 1Y1VH 2VUMH 4C2MH 2JEAI 3GTKH 4QY7A 4JYAL 1NMFA 2VL6A 4BY1G 1FGUA 4GOPA 1VQPA 4UP7A 3T1HL 3KF8B 2MQHA 2I5LX 3F8TA 4GLAC 2KBNA 1H95A 4OXPA 1XMOQ 1M1KC 1HR0Q 1B7YB 4K0KQ 4JI3L 1QUQA 1X6OA 3UE0A 2HT1A 1HZCA 5E7NA 1QVFA 2RHQB 1N32L 2D0PA 1I94Q 4UY8C 2PMZE 2F4VQ 3TS2A 5IE8A 1LUZA 4DK6C 2WP8J 2L15A 5M3FH 4KHPL 4LFCL 3U50C 4LW1A 2N49A 3H3VI 1UE5A 2WFWA 4DV5Q 1KRSA 4YWKA 3MEFA 3CAMA 1UE7A 3CCRA 1PHJA 1B70B 3KF6B 3PGZA 1BBWA 3I2ZA 5AJ3Q 2R93H 5C3EG 4H02A 1A0IA 5IP9G 4X66L 1VQFA 4A3KH 1O7IA 1N34Q 2BA0A 3AFQA 4GKJL 1AE2A 4JI8Q 1GM5A 2JA5G 4NXML 1Z47A 1OTCA 3CXCA 4HIDA 4HIOA 2K50A 4L5RC 3M4QA 5LMNL 3PIOA 1K83H 3GTLH 2UU9L 4YY3L 4AQYQ 4A3BH 4PZ6A 3I4NH 1N9WA 2IHEA 2B3GA 3ULJA 1L1OA 1NBWA 2KCTA 2JA7H 4L5TA 4LF8Q 2YU9H 5JJKA 2QA4A 4JI4L 3JAMi 1XPRA 1N34L 4BA1I 2I0QA 3CMAA 2UXDL 3TEHB 5IYDH 4LFAQ 4IPDA 2DGYA 3H0GH 4AIMA 3G6EA 3CF5A 1HR0W 4L5SA 3S14H 5AJ3L 1EOVA 3HOUG 4XTCS 2N3SA 3S1MH 3ER0A 2ES2A 1ASZA 2PI2A 3UE1A 1L0WA 1J6QA 4A3GG 2F52A 2UUCL 2R7FA 3I7FA 3CCUA 4HJ7A 4GOPC 1KIXA 4B3TQ 5C4XG 1W3SA 1AH9A 3NELA 2YYZA 3L0OA 4BBRH 5M5WH 1VQ9A 1X9NA 3PF5A 4DUYQ 3JC66 1Q12A 3S2HH 4GS3A 3ICEA 1XMQQ 3HOUH 4HJAA 4HJ8A 5FJ8H 2B29A 1ASYA 4DR4Q 3T1HQ 1LTLA 5DLQE 2JA5H 4JI2L 2H5XA 3UDFA 2BA1A 1K8GA 2NVQH 2JJQA 4A3FG 1EWIA 5EAYA 3K7AH 4K0KL 1YBYA 3PV0A 5J3BA 5FLMG 2K14A 2RCNA 3GTJH 4GNXB 5C0XJ 1K0RA 1WYDA 3PIPA 1VQNA 3D0FA 4PZ7A 4JI6L 5GROA 4A3MH 2UXCL 3HOZG 1G6PA 4RG1A 4KLKA 5IY0A 2Q2UA 3ERSX 1KHIA 4DR3Q 2PQAB 1HNZL 2ZTCA 4LUOA 4KI0A 3G4SA 4A75A 3T1YQ 3CC2A 2OWOA 5C44G 3CCJA 2K4KA 2WB1E 4DV2Q 4DR1L 1KQSA 3PO3H 4LF4L 1VQGA 3OYYA 3PO3G 3E0EA 3PF4A 3U4ZA 4DV6L 4A3IH 1XJVA 4OO1G 1VQMA 2CQOA 3BU2A 1Y1WH 1QZHA 3W1GA 4B3RL 1Q8KA 1L1OC 1X55A 3EN2A 3RN2A 3AYHB 3F2DA 5GAEC 4IJLA 1NJIC 3J80c 4P75A 3E9IA 4A4IA 4JI0Q 5GQOA 1KC8C 4JI7Q 2PNHA 1SMXA 3DLLA 3IRBA 1XNRQ 4Y52H 3KJPA 4DV0Q 1S40A 4GLXA 1X56A 4XIGS 1UEBA 3I4MG 5IYCG 2YV5A 4YHHL 4JI5Q 2KHJA 1M90C 2EIFA 3MXNB 1GVPA 3RLOA 1EYGA 1Q1BA 1A8VA 1UWVA 3B6YA 1BKBA 4LUZA 4JCVE 4MZ9A 3UDIA 2CWAA 3UDGA 1K8AC 1YVCA 2GVAA 1VQ8A 2R7ZH 2GVBA 5LMUL 1CKMA 4X64L 3PUZA 4A3EH 2BH8A 3S2DH 4LFBQ 4IJHA 4DAYB 1E22A 5IP9H 3S17H 1SRUA 3CCMA 4A3JH 3KF6A 4B3SL 3PUVA 1N33L 2B63G 3S16H 5IWAQ 2K5NA 3ULLA 1TWGH 2E5LQ 4ALPA 4BBSG 3A74A 1KRTA 4OO1I
chains in the Genus database with same CATH superfamily
4DV7Q 4UCRA 4WJWA 1M7JA 5D1OA 1LTGD 4LNQA 1HNXL 5LXTF 4JI8L 2UXBQ 4ECQA 2RF4A 5D1PA 1HR0H 4DR4L 4BY1B 1YZ6A 1EU3A 2NZHA 4LWCA 1OO9B 3A56A 4DV2H 1S4ZA 1BNZA 5EGTA 5JVG3 1MJCA 1B9NA 4HSVA 2W9BA 3KBGA 2EZVA 1T36A 2FXQA 1QVCA 3AMUA 4JC0A 2ZJTA 1FYCA 1EOTA 2TMPA 3MWMA 4ZK9B 1CQFA 5DNFA 4M8AA 4ZRZA 3T4AC 3FKIH 5C5LA 1AZPA 4WBNF 1WTWA 1S5CD 1WTRA 3MXUA 4I50F 2F0GA 1E2WA 2YTVA 2R92B 1WTQA 1YITA 4C3IG 4DUYL 3J80E 4F87A 2VUMB 3L2PA 5CBEE 2VUGA 1SAPA 3H09A 2F0MA 3IFTA 5BR8L 1KL9A 3I73A 3MWYW 4DPGA 2WE6A 5T1IA 2J4XA 2E2JB 2C2DA 1MSHA 2ZTDA 3CPFA 4MV9A 1GO3E 1H9JA 1O7LA 5IYBG 3OTOQ 4PNYA 2K5VA 4NXMQ 2VY3A 4GNXA 2E2DC 1IZ6A 3GIIA 2B63A 3M9OB 3KUPA 3G6VA 3HKZE 5M3FG 1VQ4A 3S1RH 4FDBA 4KHZA 4JI5H 4YWMA 3I4NB 1TWFH 5LL6b 4FNFA 4JI4Q 2AU0A 4EGQA 2X0SA 1N36L 3V6KA 3N6RA 1HNXQ 1BNCA 2JA7B 3DEPA 5IGCA 2UUAQ 2CHBD 4YAKB 4KJNA 1R4QB 1IBKL 4A3GH 1PRTD 1PYSB 2JA6A 1IKLA 1SNDA 1I50H 5KNCA 1H9SB 1UE1A 2ZXOA 5I2YA 4L5QA 5BN3A 2F03A 2FP4B 3C1FA 1IBMQ 5KG6A 3GTOA 3RB3A 4O3OA 1XTDA 3QO2A 4DR7L 2XSCA 2K01A 3RN5A 5HBRB 1P8LA 2UUBQ 4LF7L 4GKKL 4J9KA 3H20A 2EXDA 4B3TH 5C1OA 1XNRL 2WAQG 2VQFL 5IGDA 4P73A 2R8KA 5I4DA 3MXPA 1OXSC 2J7ZA 2JEBI 5KG7A 3LNNA 1LT6D 1OWTA 1VQ6A 4K8JA 3MZ5A 2IL8A 1QOHA 1IW7C 3PSIA 4B3MQ 2FLPA 1F9PA 2W6ZA 1PFMA 3GTQA 2E5LL 3H6MA 4LFCH 4KMUC 4QMGA 2Q8TA 1HA5A 4DV6Q 2UXDH 1GXDC 1Z6HA 3GTMA 3J7YW 4IQZA 2UUCQ 1HQMC 1I6VC 4JI1Q 4XYLB 1NTGA 5L1KA 2AHOB 1NAPA 2NZOA 1JDBB 3RV3A 5I47A 5IGFA 3CPWA 1I3QA 1NR4A 4CKBA 3KHRA 3S24A 2MFIA 3A5ZB 1EY4A 3GV6A 4JOIC 4E4TA 2FPIB 4JI2Q 2NVTB 1E1OA 1Q46A 2D9UA 2W9BB 3EROA 1VF5C 2FHTA 3NUCA 1N36Q 4BBRG 1EIYB 2V4DA 3CRLC 4R8UB 2R7LA 2JE6I 4YBZB 4B9XA 1SYFA 2JXMB 5GAHC 4DR5Q 4CC6A 1AN8A 4QJFA 3VYTA 4K0KH 1O7YA 1GLVA 2DUDA 4IR1A 2MNAA 1JE5A 3RR5A 2FB9A 2UUBL 4LF7Q 1AE3A 4GKKQ 2NUAB 4OGQC 5IT9c 2Z1CA 3KLWA 2K33A 1HCZA 1T94A 4J6HA 1K73C 4DR7Q 1C7YA 1I50B 2Y0SE 4UP9A 1EIFA 2ID0A 2ZM6L 1PH9A 2ASBA 2N8NA 2NYZD 3M7NA 5KFHA 4R4TA 2E2HB 3MXNA 3CW2C 4CKCA 4I7ZC 1C48A 3FKIA 4DAVA 4R9WA 1EFWA 4YCWA 1GUNA 3VMMA 4F88A 1IBLL 1CQVA 1XPOA 2IPKD 1ESRA 1Z9FA 1IKMA 5FLXc 2JP1A 3QZ8A 2R92G 4JW0A 3PCOB 3WOFA 4UCTA 4FBTA 3U4VA 3BZKA 3JAML 1UNNC 2TSSA 2FK2A 1X3EA 1J5EL 1NUCA 3NTHA 4MN3A 3K6OA 2AWOA 3AU7A 2IX0A 4DKAC 4GN3B 3T51B 4H44C 1F9QA 1SE8A 3K0YA 1XTCD 4H7BA 3I55A 1UNSA 1S10A 4NXNQ 2G9DA 1IHZA 1SN8A 4MHEA 4R4OA 1JC7A 4G7OC 5DG7A 2J9GA 4DV6H 4RMFA 4EQPA 3I4NG 1Z7TA 5FO9B 3NPPA 4I7AA 3P1HA 5IP7H 2F4VL 2NU6B 5FO8B 5M3FB 3GTMB 3NTKA 1JR0D 1QVGA 1PFNA 2KSWA 1D1KA 4XQNA 4O2BF 5E4WC 1B53A 1WTPA 3SK4A 3DWPA 2ATLA 2BE5D 3BS1A 1O80A 1EEID 5C0XH 1Y1VB 1O78A 1OXTA 5I6YA 3PUWA 4BY1H 5M9OA 3UQ8A 4A3LH 3GTPA 2VS1A 4FXKC 1CM9A 5KNDA 5FKAC 2CZGA 3SI8A 1RHPA 1X3GA 3STBD 1ZETA 2QW7A 4DV1L 5K2MA 1HNWH 2MUYA 5L9XA 4DF7A 1A3TA 4J0MA 4EBCA 1CKNB 1XX8A 4DK0A 2A68D 1VQ7A 2MO0A 1YI2A 3RB6A 3I4MH 2D0OA 3ND9A 3X3NA 2VA3A 5KYIA 1PYBA 3I4OA 3D8GA 2K7VA 1H9SA 5GONF 5KFWA 3Q8DA 4YR0A 3NP8A 4G7HC 1U4LA 3ULPA 4A3KG 4J9PA 3NWSA 2VQFQ 3A8JE 5JJLA 4NKLA 3BZCA 1N34H 4CDCC 2B2TC 1R9TH 2PVPA 5J2UF 4R7RA 2WACA 3E6ZX 4NXNL 3PW5A 5K36H 1TWGB 3D4DA 4PMCA 4X62Q 1W6KA 3LWBA 2SCUB 2RSNA 4HTHA 3I4MB 1BCPB 2LKVA 3GTOH 1I4HA 4ZQIA 4C3IH 3R3OA 3EIVA 4CDEC 3A5UA 2W6MA 3T5LA 2IY5B 1I50A 1UE6A 4FU0A 2PN1A 1I3QH 2EE1A 4S3SA 1E4EA 4TRDA 4OX9H 2E75C 4HMIA 3SEBA 4BXXH 2E2HA 4XQQA 4QIWE 3HXLA 5ELOA 3S15H 2Q8RE 3TP7A 5C6AA 4C3JG 1PX2A 3GIKA 2ASLA 5DLGA 1VQBA 1CZGA 4C1NI 3CC7A 2Z0SA 3RBDA 2OXPA 2IX3A 2CH4A 1Q1EA 2A19A 5EDWA 3KF8A 4DV2L 4ED0A 2W6NA 5KFNA 3TN2A 4C3HG 2KCMA 2ASJA 3ITPA 2QEXA 3T1YL 1FNUA 4U673 1SJHD 1EQQA 5KFBA 4EX5A 2Z6KC 1X3FA 5C44B 4YP3A 1D1IA 2NVYH 2KENA 4KV6A 4DR1Q 1H9KA 4LF4Q 4DR6Q 4DR2Q 3TIIA 2XCLA 3PW2A 4WJ3M 1I3QB 1S5FD 4C2MH 4JV1A 3OPOA 5L37A 3GTKH 4HNUA 5JPNC 2R82A 1KDAA 1VQPA 4EBDA 2VB2X 3KF8B 3KK7A 4ZKCB 2I5LX 3F8TA 1AUVA 2NVXA 2FINB 4N9TA 2NVYA 2EY6A 1ULZA 1X6OA 3DF7A 1ICFB 5E7NA 1QVFA 1N32L 1I94Q 3TS2A 3FRPB 1LUZA 1PYWD 2WP8J 2EYLA 2PCFB 5IE8A 5M3FH 5D1OB 2F0UA 2N49A 1PDQA 3H3VI 2WFWA 1ZQ7A 5KFUA 2XCPA 3HRZC 1JXLA 1EWCA 3BYYB 1LV9A 3FKIB 1BBWA 3I2ZA 5AJ3Q 4O4HF 4C2MB 1PXUA 3GV3A 4H02A 5C3EG 1KDBA 3JSNA 1BDOA 1O75A 2IWHA 1N34Q 2BA0A 3FEWX 1NSNS 4GKJL 4ZHQF 4GC7A 3KHHA 3GTGA 3W3AA 4IUUA 4JI8Q 4NXML 3I4LA 4I7HA 1LT5D 4MV7A 4MV8A 2K5QA 2K50A 1JORA 5KFQA 5EWGA 3GTLH 4ECUA 2WIIB 2FJZA 1LTSD 1N9WA 2X6GA 4CHTB 4YR2A 3M7GA 1NBWA 1ONLA 1LTTD 5CA1F 3QJYA 2B8GA 3OSOA 2PMZB 3NE5B 3WO0A 4RB3C 3MEHA 4JI4L 1N34L 2I0QA 1JWSD 3CMAA 4AYBA 1QNKA 5CGKA 4IPDA 4PWQA 5FLXL 3CF5A 3S14H 1A6XA 4A3IB 4E6IA 4KD4A 5FPOA 1WSCA 2R7NA 3JRXA 2N3SA 4ED6A 3S1MH 3RB0A 2BR0A 5LL6X 2WB1B 4FF3A 4G7ZC 4ED3A 5I9OA 3CCUA 4MIUA 4GOPC 1KIXA 1F9SA 5AFWA 1VBGA 3C1EA 4B3TQ 2FJ2A 2WKDA 3NELA 1G91A 3OUUA 3L0OA 3V96A 2RGVA 2B63B 3PF5A 5KT3A 3S2HH 3ICEA 4G4KA 2C28A 1EYDA 2R85A 1SJED 3OIPA 1LTLA 5DLQE 3BA9A 4NP5A 2SNMA 4A3FG 5IWAH 1TS4A 2C22A 4K0KL 1CT1D 4LH6A 1YBYA 2K14A 2I8CA 1TKWB 3R93A 2H1EA 1ENAA 5C0XJ 4A3KB 1G6PA 1Y1WA 5GROA 4A3MH 1JOQA 5E4XA 4KLKA 4ED7A 4FP5D 3ERSX 4F4XA 5KFLA 4DR3Q 1QNUA 3R5HA 4J9MA 2J6TA 2ZTCA 1TWCA 1EQTA 3M4OB 2UUCH 3CCJA 3PO3H 2NBFA 1AFPA 3I8ZA 3E0EA 4A3IH 1XJVA 4OO1G 3GIPA 4RAYA 5JQWA 3BU2A 1Y1WH 1QZHA 4B3RL 4MA0A 4IHJF 5KG2A 4APMA 4V0BA 1J8IA 4IRKA 5GAEC 2WKCA 2FMMA 4RHRA 2JEIA 1KC8C 4JI7Q 2VQDA 1SMXA 3C3LA 1S40A 4RUAA 4U6PA 3QR8A 2PZWA 2EYPA 4TQSA 1TA8A 4XIGS 5CB4F 2YV5A 2KHJA 1HXYD 1M90C 3RLOA 4LUZA 3PO2B 1BKBA 3UDIA 5CYUA 1YVCA 2GVAA 4X66H 2UVRA 4X64L 2BH8A 1EYCA 3R2IA 4LF4H 3QOLA 2FPGB 1G2TA 3BVGA 3ERQA 2B63G 1N33L 1EU4A 3VYRA 1GGOA 3J81W 4PDBA 2EYOA 3WOEA 2E5LQ 4ALPA 2O5IC 2KJXA 3A74A 1EUCB 4Q0FA 2HDMA 1KLUD 1SFOH 3RLFA 4M1UB 3ORQA 4K14A 4UCSA 3CD6A 3ZYYX 1UUPA 3F2BA 2O2LD 2HJWA 4RNOA 2XRQD 4R8IA 2VQEQ 2DJGC 2XNAC 3GQCA 4N9PA 1LM0A 4BY7H 1MJEA 1RF2D 3L9AX 4HJ9A 1LTAD 3T5KA 3CU7A 3GP7A 1ZYRC 3FPUB 1KBLA 1D8LA 1E24A 4AYBB 3KLSX 2RKSA 4X3TA 1L1OB 3ND8A 2WB1A 1I6HB 1VQAA 2IT1A 1TWAA 2E2JH 1V9PA 3NQIA 1PVOA 3T1HH 3MFIA 4OX9L 2A74C 2HIXA 2K1BA 2PZTA 3J81L 3RB4A 4KY6A 4R4IA 3VR6A 3HEJA 4RCNA 4N8FA 1TS2A 2PI2E 2OTLA 2E2IA 1CK1A 5KG5A 3ZJYC 1JDEA 1DZ1A 1YNND 2K5WA 4CJ1B 3V4ZA 3Q0AA 1VS0A 4J9NA 1CS0A 4C2MA 4A3MG 1TWHB 4GC6A 5KFXA 3GTQH 4GN5A 3UFXB 5KKNB 4L8JA 3PO2G 4ECYA 1EUJA 1XDNA 2QDBA 4OWWB 4LH7A 3IKJA 3UDXA 2KHSA 3PUYA 1ILPA 3KDFA 1HNWQ 3PW7A 4ZOLF 4PMBA 5CV9A 4DNTB 1EFID 1V1OA 4YJ3F 2A6ED 2R7ZB 5DQHA 1GD7A 4JI0H 1EEFD 4A3CG 3GD7A 1I94L 3AEVA 4HEDA 2DLNA 3GO5A 4WORA 1G291 2HVRA 4UHVA 4JBMA 2A6HD 1EY8A 2IA6A 1BF4A 2KUMA 4FF2A 3DEOA 1CUKA 2QDLA 1JKJB 4JV2A 1KJ8A 1KEEA 1MKHA 1U4MA 5KFYA 1HHVA 5CV4A 4A93H 2V58A 3CCSA 4IPGA 4DXGA 4A3CH 1MD2D 3A55A 3KDFB 1D5XC 4WJ4A 2R7ZG 1WR2A 2RGRA 3FVQA 3SE0A 2QYZA 4HN7A 1PH8A 4ECWA 4JI7H 1Y69U 4QL5A 2BDOA 1WCMG 3BG3A 5CORA 1TR5A 2UXDQ 2JSOA 1GUWA 1HH2P 4PV1C 1F2LA 3AFPA 2OLSA 3DM3A 5ELNA 3FMAA 5KG4A 1Y14B 3GTKB 3GV7B 2F4IA 4OX9Q 2B63H 4DV7L 4ME6A 2XGPA 1HR0L 4RGOS 2R7MA 2VW9A 2FLLA 3P75A 3CQZB 5C44H 2UXCH 5KT7A 4TQUS 2JA9A 5A35A 4RNNA 2SEBD 1JT8A 2VUMA 3MAQA 4A2BA 2Z6BA 5C4JH 2NU7B 3OIQA 1MBYA 2F0HA 1HNWL 5JPMC 1QILA 1F9RA 4X6AH 4TV9F 5KFSA 2CVRA 2NN6H 3GTPH 2AWNA 4ZYSA 2PYKA 2F0DA 4LF6Q 4O3NA 1D6EC 1L0XB 1EUDB 1BO0A 4B3RH 1JB7A 1EY0A 3RBEA 1PLFA 1VQIA 4DV4Q 4JV5L 3CRKC 2WAQE 4FXGC 4H0LC 1WI5A 1YNXA 3RFCA 2UVWA 3CC4A 4JI3H 2K6AA 1STBA 2F0LA 2E76C 4DK3C 2NN6G 3S1RB 2UXBH 1ZHSA 1QJOA 4XZ3B 5LA6F 1PV4A 1EZ6A 1HZAA 1GSHA 3P20A 3J81j 2W6PA 4HYKA 2MP1A 4RHSA 2WV6D 3ETJA 4LF9L 5EWEA 1JJ2A 1L2ZA 2R6FA 3PMFA 2QGQA 3RMHA 1LTBD 4APVA 5IP7G 5NUCA 5C3EB 4Q8FA 3ONAB 1WTXA 1X3PA 4ME3A 5C0XG 3T56B 1SDFA 3V6HA 3HOYG 1M4VA 2EDGA 3NENA 1HTPA 2K75A 2YU9A 3FMCA 4JV0A 2E2IH 4RH6A 4XYQA 2LFNA 3EBEA 5BPHA 5LMNH 2F0FA 4C3HH 1TWCH 2I07B 2F0OA 4JI0L 2RVLA 3AB9A 1IL8A 1JE4A 1P16A 1STHA 1V43A 2GPWA 4EBEA 2OQ0A 2P5ZX 2C00A 5L1JA 4F50A 1XMQL 4EGJA 3WWVA 3L3OC 3J7A5 2J6SA 1DGSA 3BJUA 1Q82C 2NVYB 2K28A 2A73B 1X3QA 2YW2A 3H0GG 1RJPA 5JVDF 1WTVA 4MTEA 2HHHL 3IAYA 4IWXA 1VQOA 3HOXH 1QCBD 1TWAB 4ME5A 1B1ZA 3K81C 2ZJQA 2YYAA 2UXCQ 4DV5H 4FM9A 1QWYA 3SK5A 1PTOC 2B39A 4J8QA 1CHQD 4C56C 3R23A 4KHPQ 1C9OA 3W5OA 5EOYA 1CKOA 1Q90A 1OXXK 2OCEA 4A3GB 1X54A 4QW9A 4IURA 2B2WA 4LF5Q 3VR2A 5EPLA 1V1QA 2C9OA 1JB3A 2RHSB 4R1JA 4R8NA 1GUGA 1YJWA 4X65H 5FPRA 1RK6A 4K8IA 4PZ8A 4Z9CB 2B8FA 4DAYA 2O5JC 4TVAB 4O3RA 2GA4B 3RZDB 1HFNA 2L4NA 3K0XA 3J7ZC 3WNZA 1STGA 1TY2A 1EY9A 4A3FB 1RJQA 2YS6A 3NGDA 2XIWA 5KFTA 4J9RA 5IT9W 5EKLA 3RAXA 3L4JA 5I2XA 3MHBA 3GILA 1CZWA 1VF7A 2XGTA 4JBKA 1VQHA 5C4HA 5C1PA 1MGSA 1B8AA 1MIUA 1VDZA 3EPIA 4LMYA 2KCCA 4MV4A 4GKJH 5BR8Q 2FPPB 4LF8L 2Y0SA 4MV3A 5D8DA 3KHGA 1T9HA 5KFMA 1SMYC 1CA5A 1N36H 2DJFC 4YIJA 3TINA 4YR3A 4DNIA 2Z4HA 5FLXW 1CE8A 4OELB 2IHFA 1MI2A 1TU2B 4OHJA 4QUFA 2DZDA 2W9CA 1K28A 1Q81C 4EG0A 4RGNA 5A2QW 4OWTB 4LF6H 4A3BG 1ET6A 1VQEA 3M9MB 3OHXC 1YJNA 2R86A 1KLGD 5M5WB 4IR9A 4B3TL 4JI1H 3HBLA 4OL7A 3CCQA 4BBSB 4DV0L 2V1CC 5KFCA 1GUOA 4KN7C 4BWSC 3PIP3 4QF4A 5EQ0A 5IT9L 5GADC 1PH1A 4EFBA 1C3OA 2AQ4A 1XNQL 4YHHQ 1BBUA 1IYJB 5C3EH 3HOVG 5HV6A 3NTIA 3SK6A 1IBML 1I6HH 2A68C 5FLMH 2JA7G 2EY2A 4P74A 5J39A 3HOYH 3CQZA 4DV4H 1Q86C 4AQYL 5LP6F 1T5XD 1GUTA 5C8YF 4DL7A 5EWFA 4A3DG 1IBLQ 4B3SQ 2R92H 5LYJF 5KEEA 4U7CA 4IUQA 4DUZH 3H4DA 4ECTA 4JI6H 3V4SA 4L6TB 3K5LA 3GQBA 2A1AA 3KALA 2E2HH 3U9SA 4UFZA 3HKZB 1EY5A 4WFN3 4ZI7F 1I4PA 1Y1VH 2VUMH 2EJMA 2JEAI 4UAIA 1SSOA 2SNSA 2VL6A 4BY1G 1VAJA 4UP7A 3FDTA 2UU9H 4GLAC 3H3VC 1M1KC 1B7YB 4DXFA 1QUQA 2XD4A 1SYDA 1WTHA 2RHQB 5J2TF 2PMZE 4ABNA 3GTQB 2L15A 3CKIB 1KTKA 4LW1A 1RTOA 3OOCA 3RGXA 5T1GA 1F2YA 1UE5A 4DV5Q 4O3QA 1DOLA 4LF9H 3CAMA 1GSOA 4XDXA 3M9NB 4EFEA 2E74C 3HG9A 5ISRA 1SFOA 1A0IA 2VQFH 1C4QA 2HQEA 1SNQA 5BN4A 5KFEA 1LLRD 3MVVA 2P0AA 1S5DD 1GM5A 2JA5G 4LF8H 1N33H 1I4RA 1Z47A 5M5YB 4ETSA 2W8KA 3GLKA 3IFDA 2CQAA 2OF1A 3J7AV 4A3BH 4AQYQ 3S16B 4ECZA 4PZ6A 5HURA 3I4NH 4LF5H 1A2TA 3GTOB 1ZYRD 2IHEA 4X3KA 4C3JB 3TZDA 2JYOA 1B6RA 5D14A 5JJKA 4LF8Q 1Y8OB 2BQUA 3S1QB 2UXDL 1EWHA 2DGYA 4KD3A 5AJ3L 5DG9A 4P2CB 5BPFA 1ICWA 1VMCA 3BVZA 2A5HA 2F52A 4YJ2F 1CQIB 4QWBA 1WCMB 5KFJA 3LX0A 2VPQA 2GLTA 1R4PB 3G8CA 4LFAH 3OMGA 1VQ9A 4F4WA 2PPBC 1Q12A 1SYCA 3BABA 2L1BA 4MTDA 3KLSA 4IFDH 2F0PA 1FJGH 1A15A 1K1SA 4TKOB 4DR4Q 2NVQH 2H5XA 2BA1A 2JJQA 1B04A 1S0NA 3S14B 1KAAA 4B3MH 5FLMG 2MGSA 2JA7H 2M05A 2RCNA 4DL4A 1WYDA 3PIPA 3GIDA 1EQVA 3D0FA 4PZ7A 3HOZG 4RA8A 3QFFA 2HVQA 1DYQA 1HQRD 1RTNA 2Q2UA 2I87A 2WINB 2M00A 2PQAB 5JEAH 4Q44A 5JOBA 3CC2A 4B9WA 4A75A 3T1YQ 1IW7D 1D2BA 1ET9A 1KQSA 5LMUH 2K4KA 4DR1L 4DV2Q 4J9LA 2KQ3A 3U4ZA 3Q8QB 1VQMA 3NWTA 1PTOB 3W1GA 1CFMA 4JV5H 4N8X1 3AYHB 3J80c 4A4IA 1HNXH 1SNOA 5GQOA 4MA5A 1IBKH 3DLLA 1EY6A 3IRBA 2RSOA 3R2TA 3HKZA 4DV0Q 2G5DA 4GLXA 5IYZF 3TQ1A 1X56A 2ZXPA 1EYAA 5DGAA 3QG1A 3BVMA 1WD0A 3N52A 4IUNA 1BBXC 2HHHH 2EIFA 3MXNB 1GVPA 4IN3A 1EYGA 5DM73 3B6YA 3BQ0A 4DV1H 4IFDJ 2F0QA 2Z9HA 2EOTA 4A3EH 4ED2A 2FMCA 4DAYB 3OTOH 1E22A 3U9OA 1K8OA 3KF6A 4NXMH 3PUVA 3NK9A 4CGYB 2K5NA 3O13A 3ULLA 4BBSG 1RJRA 2KEEA 2QF7A 3S1MB 3EYYA 1KRTA 1JOOA 4OO1I 4CBVA 5I9PA 4RAZA 2VUMG 2WYOA 4CJ2C 2I46A 4M7EA 2QILA 5CV8A 3LWUA 1K3RA 3TQYA 3CP0A 4K2LA 4LK1C 1Q3LA 2NVTH 1TWFB 2A6HC 3FDSA 4WD3A 2LSSA 2J6UA 2JA8G 1PH5A 1N33Q 4DNRB 2N55A 2BOSA 1KC7A 3DUZA 4X64Q 4ECVA 3BDOA 1SNPA 3M4YA 3BDLA 4ZUIA 4NB3A 3SK8A 1SCUB 2IX1A 5DGBA 3Q8SB 3GTLB 4DA2A 4LSXA 3BQ1A 3NEMA 1TVXA 1N32Q 4CJ0B 3L7ZC 4P72A 2ASDA 1WTOA 2ZT9C 5J1ZA 1SLJA 1SYEA 4XXEA 3HB9A 2AKWB 1AEXA 3GTGB 3SGIA 4AH6A 4BBRB 2V59A 4ZKBB 4JI2H 4AQYH 2CFMA 2HGSA 2R6GA 3BDCA 1OXUA 4IUTA 3DWQA 4KHVA 3PZPA 3I12A 4B3ML 3NBIA 4QQBX 5LMNQ 5JUMA 4BWGB 4GNXC 3VR4A 1RKNA 2PQAA 3C0FB 4FXDA 4A3LG 3VPCA 2WAQA 1N8RC 2F0KA 1HUNA 5IT9E 2ZJPA 4LF7H 4GKKH 1BOSA 1L0YB 4JI1L 5IODA 1PH7A 2JA8H 4DR1H 4A3MB 2F0JA 4X62L 3J81c 3R5XA 3PW4A 1N48A 5M3MH 3TBIB 3JAMW 2YZNA 1K0SA 3CCVA 4ZLTF 2QCPX 4BS9A 3OHBA 4YCUA 2YTYA 5DAUA 4QIWB 4RB0A 5F2DA 5JJIA 1PH3A 2NU9B 3QB3A 3A0JA 3CVZA 2PQEA 3IG0A 2KA7A 1A9XA 4QWDA 1XXGA 2NZ1D 4MNOA 4B3RQ 3F1ZA 3A54A 1VQKA 2R93B 4POGA 3RJ0A 3Q8RB 1J5EH 1HZ9A 1VQDA 1HRJA 1GYFA 3HOWG 3N8DA 2AGOA 1YNNC 4FBUA 4K6DA 5C4ZA 5I6WA 4X66Q 3TMEA 4DR6H 1PZKD 4HMJA 4KY7A 1HZBA 3HZXA 4NPSA 3GTMH 1H9RA 1TIID 4X62H 5LMUQ 1JCKB 4HJ5A 5JEAG 1VBHA 3MTSA 1NR2A 1E4EB 3WDNA 2DPIA 1FGBD 1SEIA 5KRUA 3S17B 3S1QH 5ELDA 1A3UA 1K9MC 2A8VA 4X65L 3FHWA 4IZOA 4R4QA 3QZ7A 1XMOL 5GAGC 2A69C 3VDYA 2JN4A 1IYUA 3K80C 1SFOB 3DXJC 2W71A 3MJFA 4IFDG 2R8HA 4XT3B 5C0XI 4BY7G 4AYBG 2VNUD 2W70A 2FE3A 2C2RA 4F4YA 1I5FA 3BA8A 4FF4A 5EBDA 3S2HB 3H91A 5C5MA 3FKIG 1KNAA 3KFUA 1YJ9A 2R7KA 4DV3L 4XQJA 5IOCA 3JAMc 3KOJA 2R7ZA 2F0WA 4IUVA 4LMQD 3RGZA 4NLGA 3CMEA 4DK1A 3V2TA 1CKNA 4KHPH 2YS7A 3QIAA 1BVSA 2Q2HA 3DHQA 4JK1C 3J81i 1CI3M 1EIGA 2BE5C 4DV3Q 4C5AA 4DLKA 4LF6L 3BZDB 2DY8A 5FD6A 1ZEQX 2VZAA 1ZKOA 1SYXB 1S03G 2ALYB 3BYTB 1RD9D 2EY1A 4DUZQ 4X64H 3U58A 5CR3A 4A3JG 1PFSA 5M5XH 4DV5L 1X32A 2YRWA 2KEDA 1V51A 3TSSA 1J9OA 3A8IE 2UUAH 4RGMA 2LY7A 2EY5A 2W9AA 3G6YA 1PK8A 3M3YB 5HY6A 3Q24A 3A8KE 2FK1A 4ZCKA 5EZYF 3V6JA 1M0WA 5JJZA 1A3VA 5KFFA 4QWCA 2F3IA 3RF2A 3PIO3 4DL2A 1V1PA 2EJFC 2WB1G 1IL2A 2VPSA 4NDXA 2EVBA 5KFRA 3OWFA 3OWEB 1SYGA 3ORRA 3NQTA 2KECA 3MA2B 1H9MA 1Y1VG 1JWUD 3TIGA 4Q45A 2MO1A 1CSQA 3HFZB 3K57A 4A3IG 3E9HA 3MFYA 1BXTA 3RD4A 1O7ZA 1DXMA 1QZGA 2FMAA 3X3MA 4OIJA 1EZ1A 2VXWA 1TQOA 4F4ZA 1DD2A 1PA6A 2JEJA 2XCAA 1B3QA 5C5JA 3S1NH 5FOBB 5KT4A 4DV7H 3TREA 4LFCQ 2IW3A 3Q23A 4MAMA 5F9LA 3EA6A 1SE3A 1F2MA 1ZHQA 5KFVA 4QCLA 2ATWA 5KG3A 3D31A 1SROA 1E1TA 2O4XA 4G3IA 2JA6G 3S15B 1YHQA 1Y1WB 4QW8A 1ESFA 4FS2A 4IOAA 4PG3A 3K7UC 3NBHB 4Q8EA 4DR3H 2JA5B 1JJCB 4JI6Q 5DQIA 4P71A 3Q1KA 2ZXRA 4ODGA 4UP8A 4IPHA 2RDJA 4DV3H 1K1QA 5L1IA 3OUZA 1DOKA 1SE2A 1EYZA 4RAUC 1YHAA 3R5FA 1OXVA 4JI3Q 5G3LD 4Q0YA 4O2AF 2W7OA 4L1KA 3HOWB 1S5ED 3KJOA 1DOMA 2ALZA 1JOKA 5CC4A 4A3EG 1IOVA 4K2KA 2HVSA 1GKHA 4IUPA 4CKEA 4FYDA 1FJGQ 4EQ5A 5IGBA 4Q43A 2UUBH 2OH2A 3RV4A 4YHHH 4QWAA 3M4PA 4OO1H 1LYLA 3K5NA 3K5MA 4V190 3RZOH 4RZRA 4AYBE 3OW7A 2LXJA 3OMCA 4IOCA 5LMNW 4BY7B 5DG8A 2YCHA 2G9HD 2XC9A 4IPCA 1NY4A 5JVH3 4LF9Q 4B3SH 4JI7L 4BA2I 3N40P 5C4JB 1HTLD 1WH2A 4JI5L 4G57A 1JLLB 2XWBB 5ELEA 1UAPA 2UUAL 3D3RA 1WVLA 3I56A 1SYBA 2VR1A 2YL2A 4F7XA 4ED8A 2Q2IA 4QGUA 2XWJB 4IZ8A 1XMQH 5KFGA 1Z2PX 4JI8H 2GPSA 4Q5VA 1K3BC 2B2UA 3CCEA 3K5HA 2PO4A 4UDUC 1IYVA 1SBBB 3SVMA 2Z6KA 3EFXD 3FP9A 4YWLA 4RNMA 2Q8IB 3K3VA 4CDDC 2NVXH 4TSSA 2K32A 3CQZH 4JOIA 4O2DA 1BJTA 3KTMA 4LSAA 3PW0A 3NHHA 5CBAE 2B2VC 1QUQB 5D3IB 4CDFC 4LUVA 4C3HB 5CV6A 1GHJA 2QEJC 3DM1A 2RDHA 1JIHA 3SDZA 3T1HL 2MQHA 2L11A 4RKBA 2OT2A 1SNCA 4I55F 4YY3H 4OXPA 1XMOQ 4K0KQ 4JI3L 4DR5H 3UE0A 3SHLA 1C0AA 2B2TA 2QKIC 1QB5D 4UY8C 4KHPL 3K5IA 5COYA 5BR8H 4HAEA 2XVSA 4ID6A 1HPCA 3Q6SA 5EBCA 3QOJA 4DR7H 4YWKA 1TWHA 3MEFA 3HOXB 5KG1A 4A2AA 2V4QA 1EY7A 2CH4W 1S5BD 1FKAH 1KJQA 1E4FT 4A3KH 2AUKA 4J9SA 3T16A 1AE2A 1EL0A 3PN1A 2NB0A 5KT2A 3PVXA 2W7PA 3CXCA 4HIDA 1NNXA 4L5RC 3M4QA 1BCPC 1K83H 3RUZA 2UU9L 4YY3L 2B2UC 1DONA 3MR2A 2EYFA 2MHVA 4HR7B 3R8BA 2B3GA 2DWCA 3IN5A 1L1OA 2KCTA 3N43B 4ECSA 4NW2A 2DPJA 1N32H 2BQ3A 1YNJD 4L5TA 2O03A 2YU9H 4J9OA 1GJXA 1XPRA 2MPMA 1V4YA 3UI2A 5DM63 4I65A 4LFAQ 3K7AB 3ETHA 1V8QA 4AIMA 2EYJA 1HR0W 2W8LA 2UVVA 3HOUG 4NXNH 3ER0A 2ES2A 2EYMA 1ASZA 5KFZA 3UE1A 3KAJA 4A3GG 2YZMA 2Y0SB 2R7FA 2R8GA 5LHY1 3G7LA 1SNMA 1BCPD 3J81E 1AH9A 2YYZA 2W6QA 1NCVA 1X9NA 4DUYQ 2YZGA 1RJTA 3JC66 3GTJB 2WAQB 2L5TA 2CW7A 3HOUH 1B9MA 4HJ8A 3JZIA 2MCTA 5FJ8H 3S2DB 1ASYA 4EEQA 3T1HQ 2FK3A 2W57A 1T5EA 1EWIA 1QG7A 2F3VA 2VB3X 1GOZA 1M6VA 2EXZA 2PNRC 3GV5B 2E5LH 1S9FA 4KY5A 1SE4A 3PV0A 4U68A 3GTJH 1Z2OX 1KDCA 1S68A 2UXCL 3GTPB 4MV6A 4RG1A 3Q8PB 1II3A 4QWEA 4YQWA 1YNJC 1Y1VA 4KTAA 5IY0A 5FD5A 4JUZA 1KHIA 4ECXA 3GIMA 4TV8F 3T5HA 2L12A 1HNZL 3I70A 1U4PA 1B6SA 4KI0A 2XGQA 4A3BB 1WD1A 5C44G 2DNEA 2ICIA 2K05A 1B2TA 4IWYA 3GTLA 2IMWP 4C5CA 3E0JA 3HOYB 5KT6A 2CQOA 1G2SA 4C1NK 1STYA 3RTXA 4KKTA 3K3PA 2NVXB 2PW7A 4ECRA 1L1OC 3EN2A 2R92A 1BCPF 1UEAB 3RN2A 1LACA 1BR9A 4IJLA 1NJIC 4JI0Q 2HCIA 5KFAA 4X3SA 3HOVB 1TWCB 4Y52H 3KJPA 1EIHA 3KAKA 3TZUA 4KJOA 2QK4A 5D65A 4JI5Q 3MXGA 2AQ3B 3P7JA 4A3DB 4HCSA 1B50A 3BQ2A 3T13A 3OSNA 2HCCA 1Q1BA 1A8VA 1UWVA 1ENFA 4MZ9A 3C2PA 1K8AC 2YU9B 2ZM6H 2Z4IA 2EJGC 1XNRH 5LMUL 1GHKA 3PUZA 4B08A 5IP9H 1R9TA 4UCOA 5E1FA 2DIKA 4NMZA 5IWAQ 2F4VH 1TWGH 3SE7A 3I7FA 1PTOD 4XYOA 2R87A 1IBMH 5FJ8G 2F0SA 4RWSC 5E3FA 4X65Q 3HGBA 4LF5L 3GIJA 1FD7D 2V5AA 1XMOH 4EVOA 2PW5A 3M4OH 1Y8PB 1AP0A 1KXLA 3K8AA 3BG5A 3KHLA 1U0LA 1E7ZA 2N88A 1C30A 2B2VA 2ZTEA 3CCLA 1JICA 4YAJB 1XNQQ 4JYAQ 2CKZB 5M3MG 3PR4A 1S3OA 3VPBA 2AGPA 5KFPA 4JPBW 4RZQA 3HOXG 5M5YH 2W9CB 1WOCA 4R8UA 1TXYA 5KGUA 4DR3L 3A7LA 2VOBA 1J5EQ 1KJIA 3OTOL 1SXTA 1C8CA 4HIMA 4PQXA 3CHBD 1CHPD 2VQEL 3HKZG 4FVMA 3RZDH 4PMWA 4HIKA 1DCZA 4I4TF 4UPAA 4O0AA 5JEAJ 3G48A 2KOLA 3FPPA 4RUCA 1I94H 4RGTA 4DR5L 4QB4A 3QWNA 3OSPA 1DV2A 1VQLA 3DWAA 1PTOH 1W6JA 3MC0B 1E0BA 3MWEA 4FS1A 2GN5A 2JQOA 4BXXG 2BDNA 1S0MA 2LXKA 4DU9A 3T1YH 2I5MX 1LT4D 3M85A 1TS3A 4DR2L 5KFOA 4F8MA 3MFHA 3URYA 1VKZA 5T14A 2HIVA 4HSPA 1UC8A 4DV0H 2K04A 1JQYD 1WCMA 1WJJA 4LJZC 3H3VH 2SDFA 5EPKA 4EQNA 4GOPB 1KAWA 2XIGA 1JX4A 4IAJA 5C4XH 1HFGA 5C3XA 2K52A 4DV4L 1RYRA 4C3IB 3STBC 2EQSA 2YTXA 5KFDA 1CSPA 2Q2TA 2C2EA 4IRCA 2F0IA 3AQQA 2KHIA 2L55A 4ZQ3A 2F0VA 4K5XA 1BUVT 1DM0B 4HR7A 1RDPD 4BBSH 1S72A 4FF1A 1XWEA 3HKSA 5EJWA 4A3EB 2X69A 4JG2A 1HJPA 1PH4A 2ZJRA 1I4GA 1Y1WG 1PTOF 1LTID 4KKUA 1NE3A 2CCZA 2JA6B 1NMGA 3H40A 3RAQA 3I91A 1QE6A 3F8NA 2NTSA 3J80i 3VR5A 2XTIA 3KLRA 5IIFA 2NTTA 4UCVA 2FLNA 5C4XB 2RA4A 2NWGA 5LOVF 4J9QA 1XNQH 2ENBA 1MSGA 1TWAH 2UU9Q 3D4RA 2DN8A 2IJ0A 1RYSA 1B44D 3F2UA 1EZ8A 5DEHA 4K5WA 3D6CA 3PR5B 1XPUA 2F0TA 2K5HA 1X65A 2CWPA 2HQLA 2R93G 3G6XA 3I72A 2D62A 5EKKA 1KD1C 4LFBH 4RB1A 1E2VA 2DNCA 1PFBA 1XYIA 1E3PA 2YRXA 1FR3A 3V05A 1RCVD 2BH2A 3GDEA 1B3AA 2R84A 1HA6A 1ML0D 4R4CA 3TP5A 3LWEA 2RQXA 5KFKA 1SMYD 5A2QL 2ZM6Q 5KFIA 2JEGA 1MHWC 2AUJD 2A6EC 2E8GA 1TAEA 1RL2A 1SR3A 1Z2NX 5CAEB 4JBJA 2NU8B 3EQLC 3VPDA 3HOZH 1FVIA 3JAME 4YCVA 2JA7A 2JA6H 4O1NA 1STNA 1B4OA 1BGWA 1S97A 5IYDG 1A63A 4ILWA 3M9BA 5L1LA 4Y7NH 1EQRA 4DL3A 4A93B 3VYSA 2R93A 4EYIB 5FLXE 5IWAL 2B2YC 1WFQA 4IRDA 2I5HA 1F77A 4L63B 4LFBL 4DAMA 3K58A 3GTGH 4RCOA 2N78A 2Z8LA 2C35B 1YEZA 1CA6A 3MWDA 1FL0A 4DL6A 2IBKA 3TS0A 4HNVA 4DR2H 3PUXA 5K5PA 3LMLA 1K8MA 3KBXA 2ZDQA 4CC5A 1S0OA 3M3YH 3H0GB 5KX5F 2EPBA 5KNBA 4LFAL 4GZYC 2UVUA 3E5SA 3GTJA 3F2CA 5EPJA 3NSWA 1IOWA 3K59A 4POFA 5EKIA 5J22A 1IXRA 2WDTA 5KT5A 2M9VA 3S9WA 4GKJQ 5IGEA 1K83B 5CA0F 1IBKQ 1ILQA 1TWGA 1N56A 4J15A 4O3PA 4DUZL 3MFGA 2NN6I 3JSLA 4YY3Q 1VQ5A 4XYMB 5CV7A 1LT3D 4M9UA 4TUYF 4DR6L 5F9NA 1ENCA 1VQJA 1MZBA 2RDFA 4EGVA 1STEA 4DV1Q 2W6OA 2F0NA 5ELFA 2RDGA 4Y8VB 1I6UA 2M2LA 4HNTA 1VQCA 5G3LF 2NVQB 2L9HA 5JAVA 4DAPA 1AN7A 4J1MA 1E4GT 1WCMH 2WTFA 1W96A 4JV5Q 5DLFA 1D5ZC 4K6LA 4MTNA 3H4BA 2RBMA 1VCIA 2LMCB 2OQKA 4JVZA 4DUYH 1D5MC 3J80W 4O4IF 3G71A 5IGGA 1L2FA 3SR1A 1BXRA 3SXHA 4RFBA 3RZOB 3HOUB 2HUGA 4IO9A 1VMPA 3GTKA 4JBWA 4OWXB 5H1SE 1DIKA 3EVQA 1W93A 4ZAIA 3LGJA 2AMCB 2K5DA 1A62A 1YHBA 1R9TB 3U9TA 5CV5A 3OW2A 3KXYT 1W2BA 2C5CA 3PQIA 3H15A 3TRZA 1PMRA 1PH6A 1HUMA 4GLVB 5HGTA 1FNWA 1DJRD 1PRTF 4C3JH 5K36G 3GV8B 2DY7A 1Q7YC 2X6LA 3EJIA 1E2ZA 1RK5A 3VR3A 4K5VA 2RDIA 5M5XB 2UXBL 2V4RA 1D7QA 2JK8A 3PO2H 4LAAA 1UC9A 2H4OA 3DMUA 1JMCA 3HOVH 1PRTC 1G51A 5IYCH 4DGZA 4OONA 3J7AF 4GN4B 1KJJA 4EYHB 4OEMB 2AGQA 2Y0SG 4DN4M 2V9WA 5LL6S 2HHHQ 2D5DA 3EPGA 1YIJA 4A3DH 4YB8B 1PZID 2R7DA 2EYHA 4IALA 1A2UA 5D3DA 2L0CA 4DFAA 3HS0C 3PO3B 4A93G 1TY0A 1I7NA 3HOWH 3RNUA 3Q22A 5IYBH 1FJGL 1RODA 4A3FH 2F1MA 3MR6A 2E2IB 2FKLA 4FO2A 3RLNA 3TP8A 2JEFA 1RIPA 1CTMA 4DR4H 5HGQA 3M4IA 3J80L 5FO7B 1U5KA 3K5OA 3KYHC 2OTJA 4MTKA 4WRDA 1BQQT 2J0TD 4A76A 1M8AA 2ICEC 2SOBA 3TQTA 1HNZQ 4DL5A 1JJGA 2BCOA 3W1BA 2K03A 4XX0B 1I4QA 2VA2A 1Q8IA 1PH2A 2R8IA 1TWHH 2NUCA 3A7AB 3H94A 3LP8A 4QY7A 4JYAL 3VA5A 4ULLA 1NMFA 1FGUA 4H13C 4GOPA 1CQJB 5DQGA 1G6ZA 2HD3A 3N44B 4TQRA 2KBNA 3N42B 5BMVF 1H95A 1HR0Q 5KIXA 2HT1A 1HZCA 2D0PA 2F4VQ 1EHIA 2R3ZA 4DK6C 4LFCL 3U50C 4KK7A 2HDLA 1JWMD 3RIZA 1KRSA 2D2CC 5A2QE 1UE7A 4A3JB 3BAAA 3N41B 3CCRA 1PHJA 1B70B 3KF6B 3PGZA 2R93H 3I90A 4O42A 4X3UA 1ZXTA 5IP9G 4X66L 5BN5A 3H0GA 1VQFA 1F2ZA 1O7IA 3AFQA 4ED1A 2PZUA 1PZJD 5CMDA 4JYAH 1OTCA 4KKSA 4HIOA 3N6XA 5LMNL 3PIOA 4RB2C 2KVMA 2AQ2B 3ULJA 3WO1A 2PBZA 2IP4A 2R8JA 1PRTB 2QA4A 2JA8B 1LTRD 3JAMi 3T5JA 4BA1I 2A69D 3MR3A 3TEHB 5IYDH 1KJ9A 3H0GH 4L5SA 3TP6A 3D6WA 3G6EA 2FFKB 1EOVA 2XRSD 4ZUJA 4XTCS 2CW0C 3OHAA 2B2YA 3C46A 1I7LA 4HCEA 1AW7A 2BQRA 3E3XA 2PI2A 2JA5A 1Y8NB 1J6QA 1L0WA 2UUCL 1G8ZD 4UCUA 3HOZB 2PMZA 4HJ7A 3D4WA 1T3NA 1TWFA 3T53B 2XN9C 1M0TA 5C4XG 1W3SA 3L4KA 4BBRH 5M5WH 3TDQA 2VQEH 3GIQA 4GS3A 1XMQQ 5TSSA 3JRWA 4HJAA 1U9RA 2B29A 1IBLH 3E5NA 2JA5H 2CW0D 2CQYA 2MJ8A 2R61A 3UDFA 4JI2L 1K8GA 4EEYA 1KNEA 5EAYA 3K7AH 1AUXA 3MR5A 4RU9A 4GNXB 5J3BA 4JI4H 1VQNA 1K0RA 1AZQA 4C5BA 3G6JB 4JI6L 4QUCA 3RUPA 1LO5D 4MV1A 4OIKA 2ZDGA 5M3MB 2KCNA 5ELBA 2I80A 3G4SA 4LUOA 5JVLA 2OWOA 3NXWA 2WB1E 3IL8A 2LS01 4LF4L 1VQGA 3OYYA 3PO3G 1KABA 5ELCA 3PF4A 4KN4C 3HP3A 1TT2A 4DV6L 3S1NB 3Q2OA 2RCFA 4O4LF 1GSAA 1B33N 5JH7F 4O3SA 3VA7A 4XT1B 1V1PB 1SEBD 1LABA 1Q8KA 2ZDHA 1X55A 3F2DA 5FK9C 4EQOA 4P75A 3E9IA 2PNHA 2AQ1B 1XNRQ 4Y7NB 5H80A 2B2WC 3BJYA 1UEBA 3I3CA 1GUSA 3I4MG 5IYCG 4YHHL 5C3WA 1FNVA 4QIWA 2F0EA 1I4XA 1U4RA 3J7AK 1DV1A 4HQ6A 1HNZH 2F3WA 4JCVE 2R7ZH 1STAA 2CWAA 3UDGA 4IFDI 1VQ8A 2GVBA 3NBHA 1CKMA 5KYLA 3S2DH 1K83A 4LFBQ 2OEOA 4IJHA 3S17H 1SRUA 3CCMA 4A3JH 4B3SL 3S16H 4RKLA 2CW8A 5KG0A 3W2DA 1TS5A 3VYUA
chains in the Genus database with same CATH topology
5FJ8G 1SFOH 4X65Q 4DV7Q 3RLFA 2VUMG 4LF5L 4LNQA 1HNXL 1K3RA 4JI8L 3TQYA 3CD6A 2UXBQ 2RF4A 3CP0A 3F2BA 4DR4L 2NVTH 1YZ6A 3M4OH 2NZHA 2VQEQ 1KXLA 4LWCA 3K8AA 2LSSA 1U0LA 1E7ZA 2JA8G 1LM0A 1PH5A 2ZTEA 4BY7H 1MJEA 3CCLA 1MJCA 1N33Q 1XNQQ 4HJ9A 4JYAQ 2CKZB 5M3MG 1S3OA 2FXQA 1QVCA 4JC0A 4X64Q 1D8LA 1E24A 5M5YH 3HOXG 1WOCA 1TXYA 4NB3A 4DR3L 1L1OB 1J5EQ 2IX1A 3OTOL 1VQAA 2IT1A 3FKIH 3NEMA 4HIMA 1N32Q 3L7ZC 4P72A 2VQEL 3HKZG 2E2JH 1V9PA 1PVOA 3RZDH 1SLJA 4PMWA 4OX9L 2YTVA 4HIKA 2HIXA 1YITA 4UPAA 4O0AA 5JEAJ 2AKWB 3G48A 4DUYL 3SGIA 4AH6A 3L2PA 4DR5L 4R4IA 2CFMA 2R6GA 1VQLA 2PI2E 1OXUA 2OTLA 5BR8L 1KL9A 3ZJYC 4DPGA 4B3ML 4QQBX 5LMNQ 2ZTDA 1VS0A 2GN5A 3CPFA 1GO3E 2JQOA 5IYBG 3OTOQ 4GNXC 4A3MG 2LXKA 2PQAA 4BXXG 2K5VA 4NXMQ 4A3LG 2VY3A 2I5MX 4GN5A 3GTQH 3M85A 1N8RC 4GNXA 3PO2G 1C0AA 1EUJA 1IZ6A 2ZJPA 4OWWB 4DR2L 4JI1L 1PH7A 2JA8H 3UDXA 2HIVA 3PUYA 3KDFA 4X62L 3J81c 1HNWQ 1WJJA 3HKZE 5M3FG 1VQ4A 5M3MH 3S1RH 4FDBA 4KHZA 3H3VH 4YWMA 1TWFH 3CCVA 4GOPB 4YCUA 4JI4Q 1KAWA 2YTYA 1N36L 1GD7A 5C4XH 1HNXQ 4A3CG 3GD7A 2K52A 4DV4L 1I94L 3AEVA 2UUAQ 3STBC 2EQSA 2YTXA 1CSPA 3GO5A 1PH3A 2Q2TA 1IBKL 5JJIA 4A3GH 3A0JA 1G291 1PYSB 3AQQA 2KHIA 1I50H 4MNOA 4JBMA 4B3RQ 3F1ZA 1VQKA 1UE1A 4L5QA 4POGA 1CUKA 1IBMQ 1HZ9A 1VQDA 4BBSH 1MKHA 1XTDA 1S72A 4DR7L 3HOWG 3HKSA 3RN5A 4A93H 1PH4A 4JG2A 1HJPA 4IPGA 4X66Q 3CCSA 4A3CH 2ZJRA 1P8LA 1Y1WG 2UUBQ 4LF7L 4GKKL 2EXDA 1NE3A 3KDFB 1HZBA 2CCZA 1XNRL 2WAQG 1NMGA 4NPSA 4WJ4A 3GTMH 2VQFL 2R7ZG 4P73A 3J80i 5LMUQ 4HJ5A 2XTIA 1PH8A 5JEAG 4QL5A 1WCMG 1TWAH 2UU9Q 2UXDQ 1HH2P 1OXSC 2JEBI 3AFPA 3DM3A 5ELNA 3S1QH 1VQ6A 1Y14B 4OX9Q 1K9MC 2A8VA 4X65L 3FHWA 4DV7L 4R4QA 2B63H 3PSIA 4B3MQ 1XMOL 1HR0L 1XPUA 2K5HA 5GAGC 1X65A 2CWPA 2HQLA 2VW9A 3VDYA 2E5LL 2R93G 2D62A 3K80C 5C44H 4DV6Q 1KD1C 4TQUS 2JA9A 1JT8A 4IFDG 1E3PA 5C4JH 2BH2A 3GDEA 5C0XI 2UUCQ 4BY7G 4JI1Q 4AYBG 2VNUD 1NTGA 2AHOB 1I5FA 1HNWL 4R4CA 2NZOA 4X6AH 2ZM6Q 3CPWA 3GTPH 2AWNA 3FKIG 2E8GA 3KFUA 1RL2A 1SR3A 3S24A 4JBJA 1YJ9A 2MFIA 4LF6Q 3A5ZB 4DV3L 3HOZH 1FVIA 4YCVA 4JOIC 3JAMc 3KOJA 1JB7A 2JA6H 1VQIA 4JI2Q 4DV4Q 1E1OA 1Q46A 2WAQE 4JV5L 1WI5A 5IYDG 1YNXA 3CMEA 3M9BA 1A63A 3CC4A 4Y7NH 1N36Q 1EQRA 4BBRG 1EIYB 4DK3C 2NN6G 5IWAL 1CKNA 2JE6I 5GAHC 1WFQA 4DR5Q 1HZAA 2I5HA 4QJFA 1PV4A 1BVSA 2Q2HA 4LFBL 2DUDA 4DAMA 3J81i 3J81j 3GTGH 2MNAA 1JE5A 2N78A 3RR5A 2UUBL 4LF7Q 1AE3A 4DV3Q 4LF9L 4GKKQ 1JJ2A 5IT9c 2C35B 1YEZA 3KLWA 4LF6L 4APVA 2QGQA 2VZAA 1FL0A 5IP7G 1K73C 4DR7Q 3TS0A 2ALYB 3PUXA 1C7YA 2Y0SE 2ZM6L 4UP9A 1EIFA 2ID0A 1PH9A 4DUZQ 4ME3A 5C0XG 2ASBA 2N8NA 3U58A 3M7NA 4R4TA 3HOYG 3M3YH 4A3JG 1PFSA 5M5XH 4DV5L 3NENA 4LFAL 2K75A 3CW2C 2E2IH 1EFWA 3EBEA 4YCWA 4C3HH 1TWCH 3F2CA 4JI0L 1IBLL 1P16A 1V43A 4POFA 1XPOA 1Z9FA 1IXRA 2OQ0A 5FLXc 5HY6A 4GKJQ 1XMQL 2R92G 3WWVA 3J7A5 3PCOB 1IBKQ 1DGSA 3U4VA 3BZKA 4J15A 2F3IA 4DUZL 3BJUA 1X3EA 1Q82C 2NN6I 1J5EL 4YY3Q 2AWOA 1VQ5A 2IX0A 2WB1G 3H0GG 4DKAC 1IL2A 4GN3B 2HHHL 4DR6L 1SE8A 1VQJA 3I55A 1Y1VG 4NXNQ 4DV1Q 1VQOA 3HOXH 2MO1A 1SN8A 3K81C 4R4OA 2ZJQA 1CSQA 1VQCA 3HFZB 4A3IG 2UXCQ 3E9HA 4RMFA 1QZGA 3I4NG 5IP7H 2F4VL 1C9OA 1WCMH 3W5OA 1CKOA 2OCEA 1OXXK 4KHPQ 4JV5Q 1X54A 4MTNA 1PA6A 4LF5Q 1VCIA 2OQKA 1QVGA 1V1QA 2RHSB 4R1JA 1YJWA 3S1NH 3G71A 4PZ8A 3TREA 1L2FA 4LFCQ 4IO9A 4TVAB 3K0XA 3J7ZC 2ATWA 3D31A 1SROA 4IFDI 1E1TA 4JBWA 1OXTA 4OWXB 5H1SE 3PUWA 4BY1H 4A3LH 2VS1A 2JA6G 1YHQA 3STBD 1X3GA 3LGJA 2AMCB 1A62A 1YHBA 4DV1L 4IOAA 4PG3A 3K7UC 2XGTA 3NBHB 3OW2A 4JBKA 1W2BA 1VQHA 3H15A 1JJCB 1B8AA 1CKNB 1MIUA 4JI6Q 3TRZA 4P71A 1PH6A 5BR8Q 1VQ7A 4LF8L 2MO0A 4GLVB 4UP8A 4IPHA 4C3JH 1T9HA 1YI2A 5K36G 3I4MH 1Q7YC 2D0OA 1PYBA 1YHAA 1OXVA 4JI3Q 3I4OA 4DNIA 3Q8DA 4IFDJ 3KJOA 3ULPA 4A3KG 4A3EG 2UXBL 1D7QA 2VQFQ 2JK8A 2IHFA 3PO2H 5JJLA 3BZCA 1GKHA 1Q81C 1R9TH 1JMCA 4EQ5A 1FJGQ 4OWTB 3HOVH 1G51A 5IYCH 3M4PA 4OONA 1LYLA 4A3BG 1VQEA 4GN4B 4NXNL 3RZOH 4AYBE 1YJNA 4X62Q 2Y0SG 4B3TL 2LXJA 4IOCA 5LMNW 2HHHQ 1YIJA 3CCQA 4A3DH 4DV0L 3GTOH 2V1CC 4IPCA 1NY4A 4C3IH 3EIVA 4LF9Q 3A5UA 5GADC 1PH1A 4JI7L 4BA2I 2R7DA 2IY5B 1UE6A 1XNQL 4JI5L 4YHHQ 1BBUA 1I3QH 1IYJB 5C3EH 3HOVG 2UUAL 4A93G 1IBML 1I6HH 3HOWH 3RNUA 5FLMH 2JA7G 4P74A 5IYBH 1FJGL 3HOYH 3I56A 4QIWE 4BXXH 2Q2IA 5ELOA 4QGUA 4AQYL 4A3FH 1Q86C 3S15H 3RLNA 1IBLQ 4A3DG 1RIPA 4B3SQ 3CCEA 2R92H 1VQBA 3CC7A 2Z0SA 5HGQA 1Q1EA 2A19A 4DV2L 2Z6KA 1U5KA 3KYHC 3FP9A 2OTJA 2KCMA 4A76A 2QEXA 3T1YL 1HNZQ 2A1AA 4YWLA 1EQQA 4EX5A 1JJGA 2Z6KC 2E2HH 1X3FA 3W1BA 2NVXH 3CQZH 2NVYH 4JOIA 2KENA 4O2DA 4DR1Q 1PH2A 4LF4Q 4DR6Q 4DR2Q 4WJ3M 1TWHH 1QUQB 4LUVA 1Y1VH 2VUMH 4C2MH 2JEAI 3GTKH 4QY7A 4JYAL 1NMFA 2VL6A 4BY1G 1FGUA 4GOPA 1VQPA 4UP7A 3T1HL 3KF8B 2MQHA 2I5LX 3F8TA 4GLAC 2KBNA 1H95A 4OXPA 1XMOQ 1M1KC 1HR0Q 1B7YB 4K0KQ 4JI3L 1QUQA 1X6OA 3UE0A 2HT1A 1HZCA 5E7NA 1QVFA 2RHQB 1N32L 2D0PA 1I94Q 4UY8C 2PMZE 2F4VQ 3TS2A 5IE8A 1LUZA 4DK6C 2WP8J 2L15A 5M3FH 4KHPL 4LFCL 3U50C 4LW1A 2N49A 3H3VI 1UE5A 2WFWA 4DV5Q 1KRSA 4YWKA 3MEFA 3CAMA 1UE7A 3CCRA 1PHJA 1B70B 3KF6B 3PGZA 1BBWA 3I2ZA 5AJ3Q 2R93H 5C3EG 4H02A 1A0IA 5IP9G 4X66L 1VQFA 4A3KH 1O7IA 1N34Q 2BA0A 3AFQA 4GKJL 1AE2A 4JI8Q 1GM5A 2JA5G 4NXML 1Z47A 1OTCA 3CXCA 4HIDA 4HIOA 2K50A 4L5RC 3M4QA 5LMNL 3PIOA 1K83H 3GTLH 2UU9L 4YY3L 4AQYQ 4A3BH 4PZ6A 3I4NH 1N9WA 2IHEA 2B3GA 3ULJA 1L1OA 1NBWA 2KCTA 2JA7H 4L5TA 4LF8Q 2YU9H 5JJKA 2QA4A 4JI4L 3JAMi 1XPRA 1N34L 4BA1I 2I0QA 3CMAA 2UXDL 3TEHB 5IYDH 4LFAQ 4IPDA 2DGYA 3H0GH 4AIMA 3G6EA 3CF5A 1HR0W 4L5SA 3S14H 5AJ3L 1EOVA 3HOUG 4XTCS 2N3SA 3S1MH 3ER0A 2ES2A 1ASZA 2PI2A 3UE1A 1L0WA 1J6QA 4A3GG 2F52A 2UUCL 2R7FA 3I7FA 3CCUA 4HJ7A 4GOPC 1KIXA 4B3TQ 5C4XG 1W3SA 1AH9A 3NELA 2YYZA 3L0OA 4BBRH 5M5WH 1VQ9A 1X9NA 3PF5A 4DUYQ 3JC66 1Q12A 3S2HH 4GS3A 3ICEA 1XMQQ 3HOUH 4HJAA 4HJ8A 5FJ8H 2B29A 1ASYA 4DR4Q 3T1HQ 1LTLA 5DLQE 2JA5H 4JI2L 2H5XA 3UDFA 2BA1A 1K8GA 2NVQH 2JJQA 4A3FG 1EWIA 5EAYA 3K7AH 4K0KL 1YBYA 3PV0A 5J3BA 5FLMG 2K14A 2RCNA 3GTJH 4GNXB 5C0XJ 1K0RA 1WYDA 3PIPA 1VQNA 3D0FA 4PZ7A 4JI6L 5GROA 4A3MH 2UXCL 3HOZG 1G6PA 4RG1A 4KLKA 5IY0A 2Q2UA 3ERSX 1KHIA 4DR3Q 2PQAB 1HNZL 2ZTCA 4LUOA 4KI0A 3G4SA 4A75A 3T1YQ 3CC2A 2OWOA 5C44G 3CCJA 2K4KA 2WB1E 4DV2Q 4DR1L 1KQSA 3PO3H 4LF4L 1VQGA 3OYYA 3PO3G 3E0EA 3PF4A 3U4ZA 4DV6L 4A3IH 1XJVA 4OO1G 1VQMA 2CQOA 3BU2A 1Y1WH 1QZHA 3W1GA 4B3RL 1Q8KA 1L1OC 1X55A 3EN2A 3RN2A 3AYHB 3F2DA 5GAEC 4IJLA 1NJIC 3J80c 4P75A 3E9IA 4A4IA 4JI0Q 5GQOA 1KC8C 4JI7Q 2PNHA 1SMXA 3DLLA 3IRBA 1XNRQ 4Y52H 3KJPA 4DV0Q 1S40A 4GLXA 1X56A 4XIGS 1UEBA 3I4MG 5IYCG 2YV5A 4YHHL 4JI5Q 2KHJA 1M90C 2EIFA 3MXNB 1GVPA 3RLOA 1EYGA 1Q1BA 1A8VA 1UWVA 3B6YA 1BKBA 4LUZA 4JCVE 4MZ9A 3UDIA 2CWAA 3UDGA 1K8AC 1YVCA 2GVAA 1VQ8A 2R7ZH 2GVBA 5LMUL 1CKMA 4X64L 3PUZA 4A3EH 2BH8A 3S2DH 4LFBQ 4IJHA 4DAYB 1E22A 5IP9H 3S17H 1SRUA 3CCMA 4A3JH 3KF6A 4B3SL 3PUVA 1N33L 2B63G 3S16H 5IWAQ 2K5NA 3ULLA 1TWGH 2E5LQ 4ALPA 4BBSG 3A74A 1KRTA 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 G;  1SFO H;  4X65 Q;  4DV7 Q;  3RLF A;  2VUM G;  4LF5 L;  4LNQ A;  1HNX L;  1K3R A;  4JI8 L;  3TQY A;  3CD6 A;  2UXB Q;  2RF4 A;  3CP0 A;  3F2B A;  4DR4 L;  2NVT H;  1YZ6 A;  3M4O H;  2NZH A;  2VQE Q;  1KXL A;  4LWC A;  3K8A A;  2LSS A;  1U0L A;  1E7Z A;  2JA8 G;  1LM0 A;  1PH5 A;  2ZTE A;  4BY7 H;  1MJE A;  3CCL A;  1MJC A;  1N33 Q;  1XNQ Q;  4HJ9 A;  4JYA Q;  2CKZ B;  5M3M G;  1S3O A;  2FXQ A;  1QVC A;  4JC0 A;  4X64 Q;  1D8L A;  1E24 A;  5M5Y H;  3HOX G;  1WOC A;  1TXY A;  4NB3 A;  4DR3 L;  1L1O B;  1J5E Q;  2IX1 A;  3OTO L;  1VQA A;  2IT1 A;  3FKI H;  3NEM A;  4HIM A;  1N32 Q;  3L7Z C;  4P72 A;  2VQE L;  3HKZ G;  2E2J H;  1V9P A;  1PVO A;  3RZD H;  1SLJ A;  4PMW A;  4OX9 L;  2YTV A;  4HIK A;  2HIX A;  1YIT A;  4UPA A;  4O0A A;  5JEA J;  2AKW B;  3G48 A;  4DUY L;  3SGI A;  4AH6 A;  3L2P A;  4DR5 L;  4R4I A;  2CFM A;  2R6G A;  1VQL A;  2PI2 E;  1OXU A;  2OTL A;  5BR8 L;  1KL9 A;  3ZJY C;  4DPG A;  4B3M L;  4QQB X;  5LMN Q;  2ZTD A;  1VS0 A;  2GN5 A;  3CPF A;  1GO3 E;  2JQO A;  5IYB G;  3OTO Q;  4GNX C;  4A3M G;  2LXK A;  2PQA A;  4BXX G;  2K5V A;  4NXM Q;  4A3L G;  2VY3 A;  2I5M X;  4GN5 A;  3GTQ H;  3M85 A;  1N8R C;  4GNX A;  3PO2 G;  1C0A A;  1EUJ A;  1IZ6 A;  2ZJP A;  4OWW B;  4DR2 L;  4JI1 L;  1PH7 A;  2JA8 H;  3UDX A;  2HIV A;  3PUY A;  3KDF A;  4X62 L;  3J81 c;  1HNW Q;  1WJJ A;  3HKZ E;  5M3F G;  1VQ4 A;  5M3M H;  3S1R H;  4FDB A;  4KHZ A;  3H3V H;  4YWM A;  1TWF H;  3CCV A;  4GOP B;  4YCU A;  4JI4 Q;  1KAW A;  2YTY A;  1N36 L;  1GD7 A;  5C4X H;  1HNX Q;  4A3C G;  3GD7 A;  2K52 A;  4DV4 L;  1I94 L;  3AEV A;  2UUA Q;  3STB C;  2EQS A;  2YTX A;  1CSP A;  3GO5 A;  1PH3 A;  2Q2T A;  1IBK L;  5JJI A;  4A3G H;  3A0J A;  1G29 1;  1PYS B;  3AQQ A;  2KHI A;  1I50 H;  4MNO A;  4JBM A;  4B3R Q;  3F1Z A;  1VQK A;  1UE1 A;  4L5Q A;  4POG A;  1CUK A;  1IBM Q;  1HZ9 A;  1VQD A;  4BBS H;  1MKH A;  1XTD A;  1S72 A;  4DR7 L;  3HOW G;  3HKS A;  3RN5 A;  4A93 H;  1PH4 A;  4JG2 A;  1HJP A;  4IPG A;  4X66 Q;  3CCS A;  4A3C H;  2ZJR A;  1P8L A;  1Y1W G;  2UUB Q;  4LF7 L;  4GKK L;  2EXD A;  1NE3 A;  3KDF B;  1HZB A;  2CCZ A;  1XNR L;  2WAQ G;  1NMG A;  4NPS A;  4WJ4 A;  3GTM H;  2VQF L;  2R7Z G;  4P73 A;  3J80 i;  5LMU Q;  4HJ5 A;  2XTI A;  1PH8 A;  5JEA G;  4QL5 A;  1WCM G;  1TWA H;  2UU9 Q;  2UXD Q;  1HH2 P;  1OXS C;  2JEB I;  3AFP A;  3DM3 A;  5ELN A;  3S1Q H;  1VQ6 A;  1Y14 B;  4OX9 Q;  1K9M C;  2A8V A;  4X65 L;  3FHW A;  4DV7 L;  4R4Q A;  2B63 H;  3PSI A;  4B3M Q;  1XMO L;  1HR0 L;  1XPU A;  2K5H A;  5GAG C;  1X65 A;  2CWP A;  2HQL A;  2VW9 A;  3VDY A;  2E5L L;  2R93 G;  2D62 A;  3K80 C;  5C44 H;  4DV6 Q;  1KD1 C;  4TQU S;  2JA9 A;  1JT8 A;  4IFD G;  1E3P A;  5C4J H;  2BH2 A;  3GDE A;  5C0X I;  2UUC Q;  4BY7 G;  4JI1 Q;  4AYB G;  2VNU D;  1NTG A;  2AHO B;  1I5F A;  1HNW L;  4R4C A;  2NZO A;  4X6A H;  2ZM6 Q;  3CPW A;  3GTP H;  2AWN A;  3FKI G;  2E8G A;  3KFU A;  1RL2 A;  1SR3 A;  3S24 A;  4JBJ A;  1YJ9 A;  2MFI A;  4LF6 Q;  3A5Z B;  4DV3 L;  3HOZ H;  1FVI A;  4YCV A;  4JOI C;  3JAM c;  3KOJ A;  1JB7 A;  2JA6 H;  1VQI A;  4JI2 Q;  4DV4 Q;  1E1O A;  1Q46 A;  2WAQ E;  4JV5 L;  1WI5 A;  5IYD G;  1YNX A;  3CME A;  3M9B A;  1A63 A;  3CC4 A;  4Y7N H;  1N36 Q;  1EQR A;  4BBR G;  1EIY B;  4DK3 C;  2NN6 G;  5IWA L;  1CKN A;  2JE6 I;  5GAH C;  1WFQ A;  4DR5 Q;  1HZA A;  2I5H A;  4QJF A;  1PV4 A;  1BVS A;  2Q2H A;  4LFB L;  2DUD A;  4DAM A;  3J81 i;  3J81 j;  3GTG H;  2MNA A;  1JE5 A;  2N78 A;  3RR5 A;  2UUB L;  4LF7 Q;  1AE3 A;  4DV3 Q;  4LF9 L;  4GKK Q;  1JJ2 A;  5IT9 c;  2C35 B;  1YEZ A;  3KLW A;  4LF6 L;  4APV A;  2QGQ A;  2VZA A;  1FL0 A;  5IP7 G;  1K73 C;  4DR7 Q;  3TS0 A;  2ALY B;  3PUX A;  1C7Y A;  2Y0S E;  2ZM6 L;  4UP9 A;  1EIF A;  2ID0 A;  1PH9 A;  4DUZ Q;  4ME3 A;  5C0X G;  2ASB A;  2N8N A;  3U58 A;  3M7N A;  4R4T A;  3HOY G;  3M3Y H;  4A3J G;  1PFS A;  5M5X H;  4DV5 L;  3NEN A;  4LFA L;  2K75 A;  3CW2 C;  2E2I H;  1EFW A;  3EBE A;  4YCW A;  4C3H H;  1TWC H;  3F2C A;  4JI0 L;  1IBL L;  1P16 A;  1V43 A;  4POF A;  1XPO A;  1Z9F A;  1IXR A;  2OQ0 A;  5FLX c;  5HY6 A;  4GKJ Q;  1XMQ L;  2R92 G;  3WWV A;  3J7A 5;  3PCO B;  1IBK Q;  1DGS A;  3U4V A;  3BZK A;  4J15 A;  2F3I A;  4DUZ L;  3BJU A;  1X3E A;  1Q82 C;  2NN6 I;  1J5E L;  4YY3 Q;  2AWO A;  1VQ5 A;  2IX0 A;  2WB1 G;  3H0G G;  4DKA C;  1IL2 A;  4GN3 B;  2HHH L;  4DR6 L;  1SE8 A;  1VQJ A;  3I55 A;  1Y1V G;  4NXN Q;  4DV1 Q;  1VQO A;  3HOX H;  2MO1 A;  1SN8 A;  3K81 C;  4R4O A;  2ZJQ A;  1CSQ A;  1VQC A;  3HFZ B;  4A3I G;  2UXC Q;  3E9H A;  4RMF A;  1QZG A;  3I4N G;  5IP7 H;  2F4V L;  1C9O A;  1WCM H;  3W5O A;  1CKO A;  2OCE A;  1OXX K;  4KHP Q;  4JV5 Q;  1X54 A;  4MTN A;  1PA6 A;  4LF5 Q;  1VCI A;  2OQK A;  1QVG A;  1V1Q A;  2RHS B;  4R1J A;  1YJW A;  3S1N H;  3G71 A;  4PZ8 A;  3TRE A;  1L2F A;  4LFC Q;  4IO9 A;  4TVA B;  3K0X A;  3J7Z C;  2ATW A;  3D31 A;  1SRO A;  4IFD I;  1E1T A;  4JBW A;  1OXT A;  4OWX B;  5H1S E;  3PUW A;  4BY1 H;  4A3L H;  2VS1 A;  2JA6 G;  1YHQ A;  3STB D;  1X3G A;  3LGJ A;  2AMC B;  1A62 A;  1YHB A;  4DV1 L;  4IOA A;  4PG3 A;  3K7U C;  2XGT A;  3NBH B;  3OW2 A;  4JBK A;  1W2B A;  1VQH A;  3H15 A;  1JJC B;  1B8A A;  1CKN B;  1MIU A;  4JI6 Q;  3TRZ A;  4P71 A;  1PH6 A;  5BR8 Q;  1VQ7 A;  4LF8 L;  2MO0 A;  4GLV B;  4UP8 A;  4IPH A;  4C3J H;  1T9H A;  1YI2 A;  5K36 G;  3I4M H;  1Q7Y C;  2D0O A;  1PYB A;  1YHA A;  1OXV A;  4JI3 Q;  3I4O A;  4DNI A;  3Q8D A;  4IFD J;  3KJO A;  3ULP A;  4A3K G;  4A3E G;  2UXB L;  1D7Q A;  2VQF Q;  2JK8 A;  2IHF A;  3PO2 H;  5JJL A;  3BZC A;  1GKH A;  1Q81 C;  1R9T H;  1JMC A;  4EQ5 A;  1FJG Q;  4OWT B;  3HOV H;  1G51 A;  5IYC H;  3M4P A;  4OON A;  1LYL A;  4A3B G;  1VQE A;  4GN4 B;  4NXN L;  3RZO H;  4AYB E;  1YJN A;  4X62 Q;  2Y0S G;  4B3T L;  2LXJ A;  4IOC A;  5LMN W;  2HHH Q;  1YIJ A;  3CCQ A;  4A3D H;  4DV0 L;  3GTO H;  2V1C C;  4IPC A;  1NY4 A;  4C3I H;  3EIV A;  4LF9 Q;  3A5U A;  5GAD C;  1PH1 A;  4JI7 L;  4BA2 I;  2R7D A;  2IY5 B;  1UE6 A;  1XNQ L;  4JI5 L;  4YHH Q;  1BBU A;  1I3Q H;  1IYJ B;  5C3E H;  3HOV G;  2UUA L;  4A93 G;  1IBM L;  1I6H H;  3HOW H;  3RNU A;  5FLM H;  2JA7 G;  4P74 A;  5IYB H;  1FJG L;  3HOY H;  3I56 A;  4QIW E;  4BXX H;  2Q2I A;  5ELO A;  4QGU A;  4AQY L;  4A3F H;  1Q86 C;  3S15 H;  3RLN A;  1IBL Q;  4A3D G;  1RIP A;  4B3S Q;  3CCE A;  2R92 H;  1VQB A;  3CC7 A;  2Z0S A;  5HGQ A;  1Q1E A;  2A19 A;  4DV2 L;  2Z6K A;  1U5K A;  3KYH C;  3FP9 A;  2OTJ A;  2KCM A;  4A76 A;  2QEX A;  3T1Y L;  1HNZ Q;  2A1A A;  4YWL A;  1EQQ A;  4EX5 A;  1JJG A;  2Z6K C;  2E2H H;  1X3F A;  3W1B A;  2NVX H;  3CQZ H;  2NVY H;  4JOI A;  2KEN A;  4O2D A;  4DR1 Q;  1PH2 A;  4LF4 Q;  4DR6 Q;  4DR2 Q;  4WJ3 M;  1TWH H;  1QUQ B;  4LUV A;  1Y1V H;  2VUM H;  4C2M H;  2JEA I;  3GTK H;  4QY7 A;  4JYA L;  1NMF A;  2VL6 A;  4BY1 G;  1FGU A;  4GOP A;  1VQP A;  4UP7 A;  3T1H L;  3KF8 B;  2MQH A;  2I5L X;  3F8T A;  4GLA C;  2KBN A;  1H95 A;  4OXP A;  1XMO Q;  1M1K C;  1HR0 Q;  1B7Y B;  4K0K Q;  4JI3 L;  1QUQ A;  1X6O A;  3UE0 A;  2HT1 A;  1HZC A;  5E7N A;  1QVF A;  2RHQ B;  1N32 L;  2D0P A;  1I94 Q;  4UY8 C;  2PMZ E;  2F4V Q;  3TS2 A;  5IE8 A;  1LUZ A;  4DK6 C;  2WP8 J;  2L15 A;  5M3F H;  4KHP L;  4LFC L;  3U50 C;  4LW1 A;  2N49 A;  3H3V I;  1UE5 A;  2WFW A;  4DV5 Q;  1KRS A;  4YWK A;  3MEF A;  3CAM A;  1UE7 A;  3CCR A;  1PHJ A;  1B70 B;  3KF6 B;  3PGZ A;  1BBW A;  3I2Z A;  5AJ3 Q;  2R93 H;  5C3E G;  4H02 A;  1A0I A;  5IP9 G;  4X66 L;  1VQF A;  4A3K H;  1O7I A;  1N34 Q;  2BA0 A;  3AFQ A;  4GKJ L;  1AE2 A;  4JI8 Q;  1GM5 A;  2JA5 G;  4NXM L;  1Z47 A;  1OTC A;  3CXC A;  4HID A;  4HIO A;  2K50 A;  4L5R C;  3M4Q A;  5LMN L;  3PIO A;  1K83 H;  3GTL H;  2UU9 L;  4YY3 L;  4AQY Q;  4A3B H;  4PZ6 A;  3I4N H;  1N9W A;  2IHE A;  2B3G A;  3ULJ A;  1L1O A;  1NBW A;  2KCT A;  2JA7 H;  4L5T A;  4LF8 Q;  2YU9 H;  5JJK A;  2QA4 A;  4JI4 L;  3JAM i;  1XPR A;  1N34 L;  4BA1 I;  2I0Q A;  3CMA A;  2UXD L;  3TEH B;  5IYD H;  4LFA Q;  4IPD A;  2DGY A;  3H0G H;  4AIM A;  3G6E A;  3CF5 A;  1HR0 W;  4L5S A;  3S14 H;  5AJ3 L;  1EOV A;  3HOU G;  4XTC S;  2N3S A;  3S1M H;  3ER0 A;  2ES2 A;  1ASZ A;  2PI2 A;  3UE1 A;  1L0W A;  1J6Q A;  4A3G G;  2F52 A;  2UUC L;  2R7F A;  3I7F A;  3CCU A;  4HJ7 A;  4GOP C;  1KIX A;  4B3T Q;  5C4X G;  1W3S A;  1AH9 A;  3NEL A;  2YYZ A;  3L0O A;  4BBR H;  5M5W H;  1VQ9 A;  1X9N A;  3PF5 A;  4DUY Q;  3JC6 6;  1Q12 A;  3S2H H;  4GS3 A;  3ICE A;  1XMQ Q;  3HOU H;  4HJA A;  4HJ8 A;  5FJ8 H;  2B29 A;  1ASY A;  4DR4 Q;  3T1H Q;  1LTL A;  5DLQ E;  2JA5 H;  4JI2 L;  2H5X A;  3UDF A;  2BA1 A;  1K8G A;  2NVQ H;  2JJQ A;  4A3F G;  1EWI A;  5EAY A;  3K7A H;  4K0K L;  1YBY A;  3PV0 A;  5J3B A;  5FLM G;  2K14 A;  2RCN A;  3GTJ H;  4GNX B;  5C0X J;  1K0R A;  1WYD A;  3PIP A;  1VQN A;  3D0F A;  4PZ7 A;  4JI6 L;  5GRO A;  4A3M H;  2UXC L;  3HOZ G;  1G6P A;  4RG1 A;  4KLK A;  5IY0 A;  2Q2U A;  3ERS X;  1KHI A;  4DR3 Q;  2PQA B;  1HNZ L;  2ZTC A;  4LUO A;  4KI0 A;  3G4S A;  4A75 A;  3T1Y Q;  3CC2 A;  2OWO A;  5C44 G;  3CCJ A;  2K4K A;  2WB1 E;  4DV2 Q;  4DR1 L;  1KQS A;  3PO3 H;  4LF4 L;  1VQG A;  3OYY A;  3PO3 G;  3E0E A;  3PF4 A;  3U4Z A;  4DV6 L;  4A3I H;  1XJV A;  4OO1 G;  1VQM A;  2CQO A;  3BU2 A;  1Y1W H;  1QZH A;  3W1G A;  4B3R L;  1Q8K A;  1L1O C;  1X55 A;  3EN2 A;  3RN2 A;  3AYH B;  3F2D A;  5GAE C;  4IJL A;  1NJI C;  3J80 c;  4P75 A;  3E9I A;  4A4I A;  4JI0 Q;  5GQO A;  1KC8 C;  4JI7 Q;  2PNH A;  1SMX A;  3DLL A;  3IRB A;  1XNR Q;  4Y52 H;  3KJP A;  4DV0 Q;  1S40 A;  4GLX A;  1X56 A;  4XIG S;  1UEB A;  3I4M G;  5IYC G;  2YV5 A;  4YHH L;  4JI5 Q;  2KHJ A;  1M90 C;  2EIF A;  3MXN B;  1GVP A;  3RLO A;  1EYG A;  1Q1B A;  1A8V A;  1UWV A;  3B6Y A;  1BKB A;  4LUZ A;  4JCV E;  4MZ9 A;  3UDI A;  2CWA A;  3UDG A;  1K8A C;  1YVC A;  2GVA A;  1VQ8 A;  2R7Z H;  2GVB A;  5LMU L;  1CKM A;  4X64 L;  3PUZ A;  4A3E H;  2BH8 A;  3S2D H;  4LFB Q;  4IJH A;  4DAY B;  1E22 A;  5IP9 H;  3S17 H;  1SRU A;  3CCM A;  4A3J H;  3KF6 A;  4B3S L;  3PUV A;  1N33 L;  2B63 G;  3S16 H;  5IWA Q;  2K5N A;  3ULL A;  1TWG H;  2E5L Q;  4ALP A;  4BBS G;  3A74 A;  1KRT A;  4OO1 I; 
#chains in the Genus database with same CATH topology
 4DV7 Q;  4UCR A;  4WJW A;  1M7J A;  5D1O A;  1LTG D;  4LNQ A;  1HNX L;  5LXT F;  4JI8 L;  2UXB Q;  4ECQ A;  2RF4 A;  5D1P A;  1HR0 H;  4DR4 L;  4BY1 B;  1YZ6 A;  1EU3 A;  2NZH A;  4LWC A;  1OO9 B;  3A56 A;  4DV2 H;  1S4Z A;  1BNZ A;  5EGT A;  5JVG 3;  1MJC A;  1B9N A;  4HSV A;  2W9B A;  3KBG A;  2EZV A;  1T36 A;  2FXQ A;  1QVC A;  3AMU A;  4JC0 A;  2ZJT A;  1FYC A;  1EOT A;  2TMP A;  3MWM A;  4ZK9 B;  1CQF A;  5DNF A;  4M8A A;  4ZRZ A;  3T4A C;  3FKI H;  5C5L A;  1AZP A;  4WBN F;  1WTW A;  1S5C D;  1WTR A;  3MXU A;  4I50 F;  2F0G A;  1E2W A;  2YTV A;  2R92 B;  1WTQ A;  1YIT A;  4C3I G;  4DUY L;  3J80 E;  4F87 A;  2VUM B;  3L2P A;  5CBE E;  2VUG A;  1SAP A;  3H09 A;  2F0M A;  3IFT A;  5BR8 L;  1KL9 A;  3I73 A;  3MWY W;  4DPG A;  2WE6 A;  5T1I A;  2J4X A;  2E2J B;  2C2D A;  1MSH A;  2ZTD A;  3CPF A;  4MV9 A;  1GO3 E;  1H9J A;  1O7L A;  5IYB G;  3OTO Q;  4PNY A;  2K5V A;  4NXM Q;  2VY3 A;  4GNX A;  2E2D C;  1IZ6 A;  3GII A;  2B63 A;  3M9O B;  3KUP A;  3G6V A;  3HKZ E;  5M3F G;  1VQ4 A;  3S1R H;  4FDB A;  4KHZ A;  4JI5 H;  4YWM A;  3I4N B;  1TWF H;  5LL6 b;  4FNF A;  4JI4 Q;  2AU0 A;  4EGQ A;  2X0S A;  1N36 L;  3V6K A;  3N6R A;  1HNX Q;  1BNC A;  2JA7 B;  3DEP A;  5IGC A;  2UUA Q;  2CHB D;  4YAK B;  4KJN A;  1R4Q B;  1IBK L;  4A3G H;  1PRT D;  1PYS B;  2JA6 A;  1IKL A;  1SND A;  1I50 H;  5KNC A;  1H9S B;  1UE1 A;  2ZXO A;  5I2Y A;  4L5Q A;  5BN3 A;  2F03 A;  2FP4 B;  3C1F A;  1IBM Q;  5KG6 A;  3GTO A;  3RB3 A;  4O3O A;  1XTD A;  3QO2 A;  4DR7 L;  2XSC A;  2K01 A;  3RN5 A;  5HBR B;  1P8L A;  2UUB Q;  4LF7 L;  4GKK L;  4J9K A;  3H20 A;  2EXD A;  4B3T H;  5C1O A;  1XNR L;  2WAQ G;  2VQF L;  5IGD A;  4P73 A;  2R8K A;  5I4D A;  3MXP A;  1OXS C;  2J7Z A;  2JEB I;  5KG7 A;  3LNN A;  1LT6 D;  1OWT A;  1VQ6 A;  4K8J A;  3MZ5 A;  2IL8 A;  1QOH A;  1IW7 C;  3PSI A;  4B3M Q;  2FLP A;  1F9P A;  2W6Z A;  1PFM A;  3GTQ A;  2E5L L;  3H6M A;  4LFC H;  4KMU C;  4QMG A;  2Q8T A;  1HA5 A;  4DV6 Q;  2UXD H;  1GXD C;  1Z6H A;  3GTM A;  3J7Y W;  4IQZ A;  2UUC Q;  1HQM C;  1I6V C;  4JI1 Q;  4XYL B;  1NTG A;  5L1K A;  2AHO B;  1NAP A;  2NZO A;  1JDB B;  3RV3 A;  5I47 A;  5IGF A;  3CPW A;  1I3Q A;  1NR4 A;  4CKB A;  3KHR A;  3S24 A;  2MFI A;  3A5Z B;  1EY4 A;  3GV6 A;  4JOI C;  4E4T A;  2FPI B;  4JI2 Q;  2NVT B;  1E1O A;  1Q46 A;  2D9U A;  2W9B B;  3ERO A;  1VF5 C;  2FHT A;  3NUC A;  1N36 Q;  4BBR G;  1EIY B;  2V4D A;  3CRL C;  4R8U B;  2R7L A;  2JE6 I;  4YBZ B;  4B9X A;  1SYF A;  2JXM B;  5GAH C;  4DR5 Q;  4CC6 A;  1AN8 A;  4QJF A;  3VYT A;  4K0K H;  1O7Y A;  1GLV A;  2DUD A;  4IR1 A;  2MNA A;  1JE5 A;  3RR5 A;  2FB9 A;  2UUB L;  4LF7 Q;  1AE3 A;  4GKK Q;  2NUA B;  4OGQ C;  5IT9 c;  2Z1C A;  3KLW A;  2K33 A;  1HCZ A;  1T94 A;  4J6H A;  1K73 C;  4DR7 Q;  1C7Y A;  1I50 B;  2Y0S E;  4UP9 A;  1EIF A;  2ID0 A;  2ZM6 L;  1PH9 A;  2ASB A;  2N8N A;  2NYZ D;  3M7N A;  5KFH A;  4R4T A;  2E2H B;  3MXN A;  3CW2 C;  4CKC A;  4I7Z C;  1C48 A;  3FKI A;  4DAV A;  4R9W A;  1EFW A;  4YCW A;  1GUN A;  3VMM A;  4F88 A;  1IBL L;  1CQV A;  1XPO A;  2IPK D;  1ESR A;  1Z9F A;  1IKM A;  5FLX c;  2JP1 A;  3QZ8 A;  2R92 G;  4JW0 A;  3PCO B;  3WOF A;  4UCT A;  4FBT A;  3U4V A;  3BZK A;  3JAM L;  1UNN C;  2TSS A;  2FK2 A;  1X3E A;  1J5E L;  1NUC A;  3NTH A;  4MN3 A;  3K6O A;  2AWO A;  3AU7 A;  2IX0 A;  4DKA C;  4GN3 B;  3T51 B;  4H44 C;  1F9Q A;  1SE8 A;  3K0Y A;  1XTC D;  4H7B A;  3I55 A;  1UNS A;  1S10 A;  4NXN Q;  2G9D A;  1IHZ A;  1SN8 A;  4MHE A;  4R4O A;  1JC7 A;  4G7O C;  5DG7 A;  2J9G A;  4DV6 H;  4RMF A;  4EQP A;  3I4N G;  1Z7T A;  5FO9 B;  3NPP A;  4I7A A;  3P1H A;  5IP7 H;  2F4V L;  2NU6 B;  5FO8 B;  5M3F B;  3GTM B;  3NTK A;  1JR0 D;  1QVG A;  1PFN A;  2KSW A;  1D1K A;  4XQN A;  4O2B F;  5E4W C;  1B53 A;  1WTP A;  3SK4 A;  3DWP A;  2ATL A;  2BE5 D;  3BS1 A;  1O80 A;  1EEI D;  5C0X H;  1Y1V B;  1O78 A;  1OXT A;  5I6Y A;  3PUW A;  4BY1 H;  5M9O A;  3UQ8 A;  4A3L H;  3GTP A;  2VS1 A;  4FXK C;  1CM9 A;  5KND A;  5FKA C;  2CZG A;  3SI8 A;  1RHP A;  1X3G A;  3STB D;  1ZET A;  2QW7 A;  4DV1 L;  5K2M A;  1HNW H;  2MUY A;  5L9X A;  4DF7 A;  1A3T A;  4J0M A;  4EBC A;  1CKN B;  1XX8 A;  4DK0 A;  2A68 D;  1VQ7 A;  2MO0 A;  1YI2 A;  3RB6 A;  3I4M H;  2D0O A;  3ND9 A;  3X3N A;  2VA3 A;  5KYI A;  1PYB A;  3I4O A;  3D8G A;  2K7V A;  1H9S A;  5GON F;  5KFW A;  3Q8D A;  4YR0 A;  3NP8 A;  4G7H C;  1U4L A;  3ULP A;  4A3K G;  4J9P A;  3NWS A;  2VQF Q;  3A8J E;  5JJL A;  4NKL A;  3BZC A;  1N34 H;  4CDC C;  2B2T C;  1R9T H;  2PVP A;  5J2U F;  4R7R A;  2WAC A;  3E6Z X;  4NXN L;  3PW5 A;  5K36 H;  1TWG B;  3D4D A;  4PMC A;  4X62 Q;  1W6K A;  3LWB A;  2SCU B;  2RSN A;  4HTH A;  3I4M B;  1BCP B;  2LKV A;  3GTO H;  1I4H A;  4ZQI A;  4C3I H;  3R3O A;  3EIV A;  4CDE C;  3A5U A;  2W6M A;  3T5L A;  2IY5 B;  1I50 A;  1UE6 A;  4FU0 A;  2PN1 A;  1I3Q H;  2EE1 A;  4S3S A;  1E4E A;  4TRD A;  4OX9 H;  2E75 C;  4HMI A;  3SEB A;  4BXX H;  2E2H A;  4XQQ A;  4QIW E;  3HXL A;  5ELO A;  3S15 H;  2Q8R E;  3TP7 A;  5C6A A;  4C3J G;  1PX2 A;  3GIK A;  2ASL A;  5DLG A;  1VQB A;  1CZG A;  4C1N I;  3CC7 A;  2Z0S A;  3RBD A;  2OXP A;  2IX3 A;  2CH4 A;  1Q1E A;  2A19 A;  5EDW A;  3KF8 A;  4DV2 L;  4ED0 A;  2W6N A;  5KFN A;  3TN2 A;  4C3H G;  2KCM A;  2ASJ A;  3ITP A;  2QEX A;  3T1Y L;  1FNU A;  4U67 3;  1SJH D;  1EQQ A;  5KFB A;  4EX5 A;  2Z6K C;  1X3F A;  5C44 B;  4YP3 A;  1D1I A;  2NVY H;  2KEN A;  4KV6 A;  4DR1 Q;  1H9K A;  4LF4 Q;  4DR6 Q;  4DR2 Q;  3TII A;  2XCL A;  3PW2 A;  4WJ3 M;  1I3Q B;  1S5F D;  4C2M H;  4JV1 A;  3OPO A;  5L37 A;  3GTK H;  4HNU A;  5JPN C;  2R82 A;  1KDA A;  1VQP A;  4EBD A;  2VB2 X;  3KF8 B;  3KK7 A;  4ZKC B;  2I5L X;  3F8T A;  1AUV A;  2NVX A;  2FIN B;  4N9T A;  2NVY A;  2EY6 A;  1ULZ A;  1X6O A;  3DF7 A;  1ICF B;  5E7N A;  1QVF A;  1N32 L;  1I94 Q;  3TS2 A;  3FRP B;  1LUZ A;  1PYW D;  2WP8 J;  2EYL A;  2PCF B;  5IE8 A;  5M3F H;  5D1O B;  2F0U A;  2N49 A;  1PDQ A;  3H3V I;  2WFW A;  1ZQ7 A;  5KFU A;  2XCP A;  3HRZ C;  1JXL A;  1EWC A;  3BYY B;  1LV9 A;  3FKI B;  1BBW A;  3I2Z A;  5AJ3 Q;  4O4H F;  4C2M B;  1PXU A;  3GV3 A;  4H02 A;  5C3E G;  1KDB A;  3JSN A;  1BDO A;  1O75 A;  2IWH A;  1N34 Q;  2BA0 A;  3FEW X;  1NSN S;  4GKJ L;  4ZHQ F;  4GC7 A;  3KHH A;  3GTG A;  3W3A A;  4IUU A;  4JI8 Q;  4NXM L;  3I4L A;  4I7H A;  1LT5 D;  4MV7 A;  4MV8 A;  2K5Q A;  2K50 A;  1JOR A;  5KFQ A;  5EWG A;  3GTL H;  4ECU A;  2WII B;  2FJZ A;  1LTS D;  1N9W A;  2X6G A;  4CHT B;  4YR2 A;  3M7G A;  1NBW A;  1ONL A;  1LTT D;  5CA1 F;  3QJY A;  2B8G A;  3OSO A;  2PMZ B;  3NE5 B;  3WO0 A;  4RB3 C;  3MEH A;  4JI4 L;  1N34 L;  2I0Q A;  1JWS D;  3CMA A;  4AYB A;  1QNK A;  5CGK A;  4IPD A;  4PWQ A;  5FLX L;  3CF5 A;  3S14 H;  1A6X A;  4A3I B;  4E6I A;  4KD4 A;  5FPO A;  1WSC A;  2R7N A;  3JRX A;  2N3S A;  4ED6 A;  3S1M H;  3RB0 A;  2BR0 A;  5LL6 X;  2WB1 B;  4FF3 A;  4G7Z C;  4ED3 A;  5I9O A;  3CCU A;  4MIU A;  4GOP C;  1KIX A;  1F9S A;  5AFW A;  1VBG A;  3C1E A;  4B3T Q;  2FJ2 A;  2WKD A;  3NEL A;  1G91 A;  3OUU A;  3L0O A;  3V96 A;  2RGV A;  2B63 B;  3PF5 A;  5KT3 A;  3S2H H;  3ICE A;  4G4K A;  2C28 A;  1EYD A;  2R85 A;  1SJE D;  3OIP A;  1LTL A;  5DLQ E;  3BA9 A;  4NP5 A;  2SNM A;  4A3F G;  5IWA H;  1TS4 A;  2C22 A;  4K0K L;  1CT1 D;  4LH6 A;  1YBY A;  2K14 A;  2I8C A;  1TKW B;  3R93 A;  2H1E A;  1ENA A;  5C0X J;  4A3K B;  1G6P A;  1Y1W A;  5GRO A;  4A3M H;  1JOQ A;  5E4X A;  4KLK A;  4ED7 A;  4FP5 D;  3ERS X;  4F4X A;  5KFL A;  4DR3 Q;  1QNU A;  3R5H A;  4J9M A;  2J6T A;  2ZTC A;  1TWC A;  1EQT A;  3M4O B;  2UUC H;  3CCJ A;  3PO3 H;  2NBF A;  1AFP A;  3I8Z A;  3E0E A;  4A3I H;  1XJV A;  4OO1 G;  3GIP A;  4RAY A;  5JQW A;  3BU2 A;  1Y1W H;  1QZH A;  4B3R L;  4MA0 A;  4IHJ F;  5KG2 A;  4APM A;  4V0B A;  1J8I A;  4IRK A;  5GAE C;  2WKC A;  2FMM A;  4RHR A;  2JEI A;  1KC8 C;  4JI7 Q;  2VQD A;  1SMX A;  3C3L A;  1S40 A;  4RUA A;  4U6P A;  3QR8 A;  2PZW A;  2EYP A;  4TQS A;  1TA8 A;  4XIG S;  5CB4 F;  2YV5 A;  2KHJ A;  1HXY D;  1M90 C;  3RLO A;  4LUZ A;  3PO2 B;  1BKB A;  3UDI A;  5CYU A;  1YVC A;  2GVA A;  4X66 H;  2UVR A;  4X64 L;  2BH8 A;  1EYC A;  3R2I A;  4LF4 H;  3QOL A;  2FPG B;  1G2T A;  3BVG A;  3ERQ A;  2B63 G;  1N33 L;  1EU4 A;  3VYR A;  1GGO A;  3J81 W;  4PDB A;  2EYO A;  3WOE A;  2E5L Q;  4ALP A;  2O5I C;  2KJX A;  3A74 A;  1EUC B;  4Q0F A;  2HDM A;  1KLU D;  1SFO H;  3RLF A;  4M1U B;  3ORQ A;  4K14 A;  4UCS A;  3CD6 A;  3ZYY X;  1UUP A;  3F2B A;  2O2L D;  2HJW A;  4RNO A;  2XRQ D;  4R8I A;  2VQE Q;  2DJG C;  2XNA C;  3GQC A;  4N9P A;  1LM0 A;  4BY7 H;  1MJE A;  1RF2 D;  3L9A X;  4HJ9 A;  1LTA D;  3T5K A;  3CU7 A;  3GP7 A;  1ZYR C;  3FPU B;  1KBL A;  1D8L A;  1E24 A;  4AYB B;  3KLS X;  2RKS A;  4X3T A;  1L1O B;  3ND8 A;  2WB1 A;  1I6H B;  1VQA A;  2IT1 A;  1TWA A;  2E2J H;  1V9P A;  3NQI A;  1PVO A;  3T1H H;  3MFI A;  4OX9 L;  2A74 C;  2HIX A;  2K1B A;  2PZT A;  3J81 L;  3RB4 A;  4KY6 A;  4R4I A;  3VR6 A;  3HEJ A;  4RCN A;  4N8F A;  1TS2 A;  2PI2 E;  2OTL A;  2E2I A;  1CK1 A;  5KG5 A;  3ZJY C;  1JDE A;  1DZ1 A;  1YNN D;  2K5W A;  4CJ1 B;  3V4Z A;  3Q0A A;  1VS0 A;  4J9N A;  1CS0 A;  4C2M A;  4A3M G;  1TWH B;  4GC6 A;  5KFX A;  3GTQ H;  4GN5 A;  3UFX B;  5KKN B;  4L8J A;  3PO2 G;  4ECY A;  1EUJ A;  1XDN A;  2QDB A;  4OWW B;  4LH7 A;  3IKJ A;  3UDX A;  2KHS A;  3PUY A;  1ILP A;  3KDF A;  1HNW Q;  3PW7 A;  4ZOL F;  4PMB A;  5CV9 A;  4DNT B;  1EFI D;  1V1O A;  4YJ3 F;  2A6E D;  2R7Z B;  5DQH A;  1GD7 A;  4JI0 H;  1EEF D;  4A3C G;  3GD7 A;  1I94 L;  3AEV A;  4HED A;  2DLN A;  3GO5 A;  4WOR A;  1G29 1;  2HVR A;  4UHV A;  4JBM A;  2A6H D;  1EY8 A;  2IA6 A;  1BF4 A;  2KUM A;  4FF2 A;  3DEO A;  1CUK A;  2QDL A;  1JKJ B;  4JV2 A;  1KJ8 A;  1KEE A;  1MKH A;  1U4M A;  5KFY A;  1HHV A;  5CV4 A;  4A93 H;  2V58 A;  3CCS A;  4IPG A;  4DXG A;  4A3C H;  1MD2 D;  3A55 A;  3KDF B;  1D5X C;  4WJ4 A;  2R7Z G;  1WR2 A;  2RGR A;  3FVQ A;  3SE0 A;  2QYZ A;  4HN7 A;  1PH8 A;  4ECW A;  4JI7 H;  1Y69 U;  4QL5 A;  2BDO A;  1WCM G;  3BG3 A;  5COR A;  1TR5 A;  2UXD Q;  2JSO A;  1GUW A;  1HH2 P;  4PV1 C;  1F2L A;  3AFP A;  2OLS A;  3DM3 A;  5ELN A;  3FMA A;  5KG4 A;  1Y14 B;  3GTK B;  3GV7 B;  2F4I A;  4OX9 Q;  2B63 H;  4DV7 L;  4ME6 A;  2XGP A;  1HR0 L;  4RGO S;  2R7M A;  2VW9 A;  2FLL A;  3P75 A;  3CQZ B;  5C44 H;  2UXC H;  5KT7 A;  4TQU S;  2JA9 A;  5A35 A;  4RNN A;  2SEB D;  1JT8 A;  2VUM A;  3MAQ A;  4A2B A;  2Z6B A;  5C4J H;  2NU7 B;  3OIQ A;  1MBY A;  2F0H A;  1HNW L;  5JPM C;  1QIL A;  1F9R A;  4X6A H;  4TV9 F;  5KFS A;  2CVR A;  2NN6 H;  3GTP H;  2AWN A;  4ZYS A;  2PYK A;  2F0D A;  4LF6 Q;  4O3N A;  1D6E C;  1L0X B;  1EUD B;  1BO0 A;  4B3R H;  1JB7 A;  1EY0 A;  3RBE A;  1PLF A;  1VQI A;  4DV4 Q;  4JV5 L;  3CRK C;  2WAQ E;  4FXG C;  4H0L C;  1WI5 A;  1YNX A;  3RFC A;  2UVW A;  3CC4 A;  4JI3 H;  2K6A A;  1STB A;  2F0L A;  2E76 C;  4DK3 C;  2NN6 G;  3S1R B;  2UXB H;  1ZHS A;  1QJO A;  4XZ3 B;  5LA6 F;  1PV4 A;  1EZ6 A;  1HZA A;  1GSH A;  3P20 A;  3J81 j;  2W6P A;  4HYK A;  2MP1 A;  4RHS A;  2WV6 D;  3ETJ A;  4LF9 L;  5EWE A;  1JJ2 A;  1L2Z A;  2R6F A;  3PMF A;  2QGQ A;  3RMH A;  1LTB D;  4APV A;  5IP7 G;  5NUC A;  5C3E B;  4Q8F A;  3ONA B;  1WTX A;  1X3P A;  4ME3 A;  5C0X G;  3T56 B;  1SDF A;  3V6H A;  3HOY G;  1M4V A;  2EDG A;  3NEN A;  1HTP A;  2K75 A;  2YU9 A;  3FMC A;  4JV0 A;  2E2I H;  4RH6 A;  4XYQ A;  2LFN A;  3EBE A;  5BPH A;  5LMN H;  2F0F A;  4C3H H;  1TWC H;  2I07 B;  2F0O A;  4JI0 L;  2RVL A;  3AB9 A;  1IL8 A;  1JE4 A;  1P16 A;  1STH A;  1V43 A;  2GPW A;  4EBE A;  2OQ0 A;  2P5Z X;  2C00 A;  5L1J A;  4F50 A;  1XMQ L;  4EGJ A;  3WWV A;  3L3O C;  3J7A 5;  2J6S A;  1DGS A;  3BJU A;  1Q82 C;  2NVY B;  2K28 A;  2A73 B;  1X3Q A;  2YW2 A;  3H0G G;  1RJP A;  5JVD F;  1WTV A;  4MTE A;  2HHH L;  3IAY A;  4IWX A;  1VQO A;  3HOX H;  1QCB D;  1TWA B;  4ME5 A;  1B1Z A;  3K81 C;  2ZJQ A;  2YYA A;  2UXC Q;  4DV5 H;  4FM9 A;  1QWY A;  3SK5 A;  1PTO C;  2B39 A;  4J8Q A;  1CHQ D;  4C56 C;  3R23 A;  4KHP Q;  1C9O A;  3W5O A;  5EOY A;  1CKO A;  1Q90 A;  1OXX K;  2OCE A;  4A3G B;  1X54 A;  4QW9 A;  4IUR A;  2B2W A;  4LF5 Q;  3VR2 A;  5EPL A;  1V1Q A;  2C9O A;  1JB3 A;  2RHS B;  4R1J A;  4R8N A;  1GUG A;  1YJW A;  4X65 H;  5FPR A;  1RK6 A;  4K8I A;  4PZ8 A;  4Z9C B;  2B8F A;  4DAY A;  2O5J C;  4TVA B;  4O3R A;  2GA4 B;  3RZD B;  1HFN A;  2L4N A;  3K0X A;  3J7Z C;  3WNZ A;  1STG A;  1TY2 A;  1EY9 A;  4A3F B;  1RJQ A;  2YS6 A;  3NGD A;  2XIW A;  5KFT A;  4J9R A;  5IT9 W;  5EKL A;  3RAX A;  3L4J A;  5I2X A;  3MHB A;  3GIL A;  1CZW A;  1VF7 A;  2XGT A;  4JBK A;  1VQH A;  5C4H A;  5C1P A;  1MGS A;  1B8A A;  1MIU A;  1VDZ A;  3EPI A;  4LMY A;  2KCC A;  4MV4 A;  4GKJ H;  5BR8 Q;  2FPP B;  4LF8 L;  2Y0S A;  4MV3 A;  5D8D A;  3KHG A;  1T9H A;  5KFM A;  1SMY C;  1CA5 A;  1N36 H;  2DJF C;  4YIJ A;  3TIN A;  4YR3 A;  4DNI A;  2Z4H A;  5FLX W;  1CE8 A;  4OEL B;  2IHF A;  1MI2 A;  1TU2 B;  4OHJ A;  4QUF A;  2DZD A;  2W9C A;  1K28 A;  1Q81 C;  4EG0 A;  4RGN A;  5A2Q W;  4OWT B;  4LF6 H;  4A3B G;  1ET6 A;  1VQE A;  3M9M B;  3OHX C;  1YJN A;  2R86 A;  1KLG D;  5M5W B;  4IR9 A;  4B3T L;  4JI1 H;  3HBL A;  4OL7 A;  3CCQ A;  4BBS B;  4DV0 L;  2V1C C;  5KFC A;  1GUO A;  4KN7 C;  4BWS C;  3PIP 3;  4QF4 A;  5EQ0 A;  5IT9 L;  5GAD C;  1PH1 A;  4EFB A;  1C3O A;  2AQ4 A;  1XNQ L;  4YHH Q;  1BBU A;  1IYJ B;  5C3E H;  3HOV G;  5HV6 A;  3NTI A;  3SK6 A;  1IBM L;  1I6H H;  2A68 C;  5FLM H;  2JA7 G;  2EY2 A;  4P74 A;  5J39 A;  3HOY H;  3CQZ A;  4DV4 H;  1Q86 C;  4AQY L;  5LP6 F;  1T5X D;  1GUT A;  5C8Y F;  4DL7 A;  5EWF A;  4A3D G;  1IBL Q;  4B3S Q;  2R92 H;  5LYJ F;  5KEE A;  4U7C A;  4IUQ A;  4DUZ H;  3H4D A;  4ECT A;  4JI6 H;  3V4S A;  4L6T B;  3K5L A;  3GQB A;  2A1A A;  3KAL A;  2E2H H;  3U9S A;  4UFZ A;  3HKZ B;  1EY5 A;  4WFN 3;  4ZI7 F;  1I4P A;  1Y1V H;  2VUM H;  2EJM A;  2JEA I;  4UAI A;  1SSO A;  2SNS A;  2VL6 A;  4BY1 G;  1VAJ A;  4UP7 A;  3FDT A;  2UU9 H;  4GLA C;  3H3V C;  1M1K C;  1B7Y B;  4DXF A;  1QUQ A;  2XD4 A;  1SYD A;  1WTH A;  2RHQ B;  5J2T F;  2PMZ E;  4ABN A;  3GTQ B;  2L15 A;  3CKI B;  1KTK A;  4LW1 A;  1RTO A;  3OOC A;  3RGX A;  5T1G A;  1F2Y A;  1UE5 A;  4DV5 Q;  4O3Q A;  1DOL A;  4LF9 H;  3CAM A;  1GSO A;  4XDX A;  3M9N B;  4EFE A;  2E74 C;  3HG9 A;  5ISR A;  1SFO A;  1A0I A;  2VQF H;  1C4Q A;  2HQE A;  1SNQ A;  5BN4 A;  5KFE A;  1LLR D;  3MVV A;  2P0A A;  1S5D D;  1GM5 A;  2JA5 G;  4LF8 H;  1N33 H;  1I4R A;  1Z47 A;  5M5Y B;  4ETS A;  2W8K A;  3GLK A;  3IFD A;  2CQA A;  2OF1 A;  3J7A V;  4A3B H;  4AQY Q;  3S16 B;  4ECZ A;  4PZ6 A;  5HUR A;  3I4N H;  4LF5 H;  1A2T A;  3GTO B;  1ZYR D;  2IHE A;  4X3K A;  4C3J B;  3TZD A;  2JYO A;  1B6R A;  5D14 A;  5JJK A;  4LF8 Q;  1Y8O B;  2BQU A;  3S1Q B;  2UXD L;  1EWH A;  2DGY A;  4KD3 A;  5AJ3 L;  5DG9 A;  4P2C B;  5BPF A;  1ICW A;  1VMC A;  3BVZ A;  2A5H A;  2F52 A;  4YJ2 F;  1CQI B;  4QWB A;  1WCM B;  5KFJ A;  3LX0 A;  2VPQ A;  2GLT A;  1R4P B;  3G8C A;  4LFA H;  3OMG A;  1VQ9 A;  4F4W A;  2PPB C;  1Q12 A;  1SYC A;  3BAB A;  2L1B A;  4MTD A;  3KLS A;  4IFD H;  2F0P A;  1FJG H;  1A15 A;  1K1S A;  4TKO B;  4DR4 Q;  2NVQ H;  2H5X A;  2BA1 A;  2JJQ A;  1B04 A;  1S0N A;  3S14 B;  1KAA A;  4B3M H;  5FLM G;  2MGS A;  2JA7 H;  2M05 A;  2RCN A;  4DL4 A;  1WYD A;  3PIP A;  3GID A;  1EQV A;  3D0F A;  4PZ7 A;  3HOZ G;  4RA8 A;  3QFF A;  2HVQ A;  1DYQ A;  1HQR D;  1RTN A;  2Q2U A;  2I87 A;  2WIN B;  2M00 A;  2PQA B;  5JEA H;  4Q44 A;  5JOB A;  3CC2 A;  4B9W A;  4A75 A;  3T1Y Q;  1IW7 D;  1D2B A;  1ET9 A;  1KQS A;  5LMU H;  2K4K A;  4DR1 L;  4DV2 Q;  4J9L A;  2KQ3 A;  3U4Z A;  3Q8Q B;  1VQM A;  3NWT A;  1PTO B;  3W1G A;  1CFM A;  4JV5 H;  4N8X 1;  3AYH B;  3J80 c;  4A4I A;  1HNX H;  1SNO A;  5GQO A;  4MA5 A;  1IBK H;  3DLL A;  1EY6 A;  3IRB A;  2RSO A;  3R2T A;  3HKZ A;  4DV0 Q;  2G5D A;  4GLX A;  5IYZ F;  3TQ1 A;  1X56 A;  2ZXP A;  1EYA A;  5DGA A;  3QG1 A;  3BVM A;  1WD0 A;  3N52 A;  4IUN A;  1BBX C;  2HHH H;  2EIF A;  3MXN B;  1GVP A;  4IN3 A;  1EYG A;  5DM7 3;  3B6Y A;  3BQ0 A;  4DV1 H;  4IFD J;  2F0Q A;  2Z9H A;  2EOT A;  4A3E H;  4ED2 A;  2FMC A;  4DAY B;  3OTO H;  1E22 A;  3U9O A;  1K8O A;  3KF6 A;  4NXM H;  3PUV A;  3NK9 A;  4CGY B;  2K5N A;  3O13 A;  3ULL A;  4BBS G;  1RJR A;  2KEE A;  2QF7 A;  3S1M B;  3EYY A;  1KRT A;  1JOO A;  4OO1 I;  4CBV A;  5I9P A;  4RAZ A;  2VUM G;  2WYO A;  4CJ2 C;  2I46 A;  4M7E A;  2QIL A;  5CV8 A;  3LWU A;  1K3R A;  3TQY A;  3CP0 A;  4K2L A;  4LK1 C;  1Q3L A;  2NVT H;  1TWF B;  2A6H C;  3FDS A;  4WD3 A;  2LSS A;  2J6U A;  2JA8 G;  1PH5 A;  1N33 Q;  4DNR B;  2N55 A;  2BOS A;  1KC7 A;  3DUZ A;  4X64 Q;  4ECV A;  3BDO A;  1SNP A;  3M4Y A;  3BDL A;  4ZUI A;  4NB3 A;  3SK8 A;  1SCU B;  2IX1 A;  5DGB A;  3Q8S B;  3GTL B;  4DA2 A;  4LSX A;  3BQ1 A;  3NEM A;  1TVX A;  1N32 Q;  4CJ0 B;  3L7Z C;  4P72 A;  2ASD A;  1WTO A;  2ZT9 C;  5J1Z A;  1SLJ A;  1SYE A;  4XXE A;  3HB9 A;  2AKW B;  1AEX A;  3GTG B;  3SGI A;  4AH6 A;  4BBR B;  2V59 A;  4ZKB B;  4JI2 H;  4AQY H;  2CFM A;  2HGS A;  2R6G A;  3BDC A;  1OXU A;  4IUT A;  3DWQ A;  4KHV A;  3PZP A;  3I12 A;  4B3M L;  3NBI A;  4QQB X;  5LMN Q;  5JUM A;  4BWG B;  4GNX C;  3VR4 A;  1RKN A;  2PQA A;  3C0F B;  4FXD A;  4A3L G;  3VPC A;  2WAQ A;  1N8R C;  2F0K A;  1HUN A;  5IT9 E;  2ZJP A;  4LF7 H;  4GKK H;  1BOS A;  1L0Y B;  4JI1 L;  5IOD A;  1PH7 A;  2JA8 H;  4DR1 H;  4A3M B;  2F0J A;  4X62 L;  3J81 c;  3R5X A;  3PW4 A;  1N48 A;  5M3M H;  3TBI B;  3JAM W;  2YZN A;  1K0S A;  3CCV A;  4ZLT F;  2QCP X;  4BS9 A;  3OHB A;  4YCU A;  2YTY A;  5DAU A;  4QIW B;  4RB0 A;  5F2D A;  5JJI A;  1PH3 A;  2NU9 B;  3QB3 A;  3A0J A;  3CVZ A;  2PQE A;  3IG0 A;  2KA7 A;  1A9X A;  4QWD A;  1XXG A;  2NZ1 D;  4MNO A;  4B3R Q;  3F1Z A;  3A54 A;  1VQK A;  2R93 B;  4POG A;  3RJ0 A;  3Q8R B;  1J5E H;  1HZ9 A;  1VQD A;  1HRJ A;  1GYF A;  3HOW G;  3N8D A;  2AGO A;  1YNN C;  4FBU A;  4K6D A;  5C4Z A;  5I6W A;  4X66 Q;  3TME A;  4DR6 H;  1PZK D;  4HMJ A;  4KY7 A;  1HZB A;  3HZX A;  4NPS A;  3GTM H;  1H9R A;  1TII D;  4X62 H;  5LMU Q;  1JCK B;  4HJ5 A;  5JEA G;  1VBH A;  3MTS A;  1NR2 A;  1E4E B;  3WDN A;  2DPI A;  1FGB D;  1SEI A;  5KRU A;  3S17 B;  3S1Q H;  5ELD A;  1A3U A;  1K9M C;  2A8V A;  4X65 L;  3FHW A;  4IZO A;  4R4Q A;  3QZ7 A;  1XMO L;  5GAG C;  2A69 C;  3VDY A;  2JN4 A;  1IYU A;  3K80 C;  1SFO B;  3DXJ C;  2W71 A;  3MJF A;  4IFD G;  2R8H A;  4XT3 B;  5C0X I;  4BY7 G;  4AYB G;  2VNU D;  2W70 A;  2FE3 A;  2C2R A;  4F4Y A;  1I5F A;  3BA8 A;  4FF4 A;  5EBD A;  3S2H B;  3H91 A;  5C5M A;  3FKI G;  1KNA A;  3KFU A;  1YJ9 A;  2R7K A;  4DV3 L;  4XQJ A;  5IOC A;  3JAM c;  3KOJ A;  2R7Z A;  2F0W A;  4IUV A;  4LMQ D;  3RGZ A;  4NLG A;  3CME A;  4DK1 A;  3V2T A;  1CKN A;  4KHP H;  2YS7 A;  3QIA A;  1BVS A;  2Q2H A;  3DHQ A;  4JK1 C;  3J81 i;  1CI3 M;  1EIG A;  2BE5 C;  4DV3 Q;  4C5A A;  4DLK A;  4LF6 L;  3BZD B;  2DY8 A;  5FD6 A;  1ZEQ X;  2VZA A;  1ZKO A;  1SYX B;  1S03 G;  2ALY B;  3BYT B;  1RD9 D;  2EY1 A;  4DUZ Q;  4X64 H;  3U58 A;  5CR3 A;  4A3J G;  1PFS A;  5M5X H;  4DV5 L;  1X32 A;  2YRW A;  2KED A;  1V51 A;  3TSS A;  1J9O A;  3A8I E;  2UUA H;  4RGM A;  2LY7 A;  2EY5 A;  2W9A A;  3G6Y A;  1PK8 A;  3M3Y B;  5HY6 A;  3Q24 A;  3A8K E;  2FK1 A;  4ZCK A;  5EZY F;  3V6J A;  1M0W A;  5JJZ A;  1A3V A;  5KFF A;  4QWC A;  2F3I A;  3RF2 A;  3PIO 3;  4DL2 A;  1V1P A;  2EJF C;  2WB1 G;  1IL2 A;  2VPS A;  4NDX A;  2EVB A;  5KFR A;  3OWF A;  3OWE B;  1SYG A;  3ORR A;  3NQT A;  2KEC A;  3MA2 B;  1H9M A;  1Y1V G;  1JWU D;  3TIG A;  4Q45 A;  2MO1 A;  1CSQ A;  3HFZ B;  3K57 A;  4A3I G;  3E9H A;  3MFY A;  1BXT A;  3RD4 A;  1O7Z A;  1DXM A;  1QZG A;  2FMA A;  3X3M A;  4OIJ A;  1EZ1 A;  2VXW A;  1TQO A;  4F4Z A;  1DD2 A;  1PA6 A;  2JEJ A;  2XCA A;  1B3Q A;  5C5J A;  3S1N H;  5FOB B;  5KT4 A;  4DV7 H;  3TRE A;  4LFC Q;  2IW3 A;  3Q23 A;  4MAM A;  5F9L A;  3EA6 A;  1SE3 A;  1F2M A;  1ZHQ A;  5KFV A;  4QCL A;  2ATW A;  5KG3 A;  3D31 A;  1SRO A;  1E1T A;  2O4X A;  4G3I A;  2JA6 G;  3S15 B;  1YHQ A;  1Y1W B;  4QW8 A;  1ESF A;  4FS2 A;  4IOA A;  4PG3 A;  3K7U C;  3NBH B;  4Q8E A;  4DR3 H;  2JA5 B;  1JJC B;  4JI6 Q;  5DQI A;  4P71 A;  3Q1K A;  2ZXR A;  4ODG A;  4UP8 A;  4IPH A;  2RDJ A;  4DV3 H;  1K1Q A;  5L1I A;  3OUZ A;  1DOK A;  1SE2 A;  1EYZ A;  4RAU C;  1YHA A;  3R5F A;  1OXV A;  4JI3 Q;  5G3L D;  4Q0Y A;  4O2A F;  2W7O A;  4L1K A;  3HOW B;  1S5E D;  3KJO A;  1DOM A;  2ALZ A;  1JOK A;  5CC4 A;  4A3E G;  1IOV A;  4K2K A;  2HVS A;  1GKH A;  4IUP A;  4CKE A;  4FYD A;  1FJG Q;  4EQ5 A;  5IGB A;  4Q43 A;  2UUB H;  2OH2 A;  3RV4 A;  4YHH H;  4QWA A;  3M4P A;  4OO1 H;  1LYL A;  3K5N A;  3K5M A;  4V19 0;  3RZO H;  4RZR A;  4AYB E;  3OW7 A;  2LXJ A;  3OMC A;  4IOC A;  5LMN W;  4BY7 B;  5DG8 A;  2YCH A;  2G9H D;  2XC9 A;  4IPC A;  1NY4 A;  5JVH 3;  4LF9 Q;  4B3S H;  4JI7 L;  4BA2 I;  3N40 P;  5C4J B;  1HTL D;  1WH2 A;  4JI5 L;  4G57 A;  1JLL B;  2XWB B;  5ELE A;  1UAP A;  2UUA L;  3D3R A;  1WVL A;  3I56 A;  1SYB A;  2VR1 A;  2YL2 A;  4F7X A;  4ED8 A;  2Q2I A;  4QGU A;  2XWJ B;  4IZ8 A;  1XMQ H;  5KFG A;  1Z2P X;  4JI8 H;  2GPS A;  4Q5V A;  1K3B C;  2B2U A;  3CCE A;  3K5H A;  2PO4 A;  4UDU C;  1IYV A;  1SBB B;  3SVM A;  2Z6K A;  3EFX D;  3FP9 A;  4YWL A;  4RNM A;  2Q8I B;  3K3V A;  4CDD C;  2NVX H;  4TSS A;  2K32 A;  3CQZ H;  4JOI A;  4O2D A;  1BJT A;  3KTM A;  4LSA A;  3PW0 A;  3NHH A;  5CBA E;  2B2V C;  1QUQ B;  5D3I B;  4CDF C;  4LUV A;  4C3H B;  5CV6 A;  1GHJ A;  2QEJ C;  3DM1 A;  2RDH A;  1JIH A;  3SDZ A;  3T1H L;  2MQH A;  2L11 A;  4RKB A;  2OT2 A;  1SNC A;  4I55 F;  4YY3 H;  4OXP A;  1XMO Q;  4K0K Q;  4JI3 L;  4DR5 H;  3UE0 A;  3SHL A;  1C0A A;  2B2T A;  2QKI C;  1QB5 D;  4UY8 C;  4KHP L;  3K5I A;  5COY A;  5BR8 H;  4HAE A;  2XVS A;  4ID6 A;  1HPC A;  3Q6S A;  5EBC A;  3QOJ A;  4DR7 H;  4YWK A;  1TWH A;  3MEF A;  3HOX B;  5KG1 A;  4A2A A;  2V4Q A;  1EY7 A;  2CH4 W;  1S5B D;  1FKA H;  1KJQ A;  1E4F T;  4A3K H;  2AUK A;  4J9S A;  3T16 A;  1AE2 A;  1EL0 A;  3PN1 A;  2NB0 A;  5KT2 A;  3PVX A;  2W7P A;  3CXC A;  4HID A;  1NNX A;  4L5R C;  3M4Q A;  1BCP C;  1K83 H;  3RUZ A;  2UU9 L;  4YY3 L;  2B2U C;  1DON A;  3MR2 A;  2EYF A;  2MHV A;  4HR7 B;  3R8B A;  2B3G A;  2DWC A;  3IN5 A;  1L1O A;  2KCT A;  3N43 B;  4ECS A;  4NW2 A;  2DPJ A;  1N32 H;  2BQ3 A;  1YNJ D;  4L5T A;  2O03 A;  2YU9 H;  4J9O A;  1GJX A;  1XPR A;  2MPM A;  1V4Y A;  3UI2 A;  5DM6 3;  4I65 A;  4LFA Q;  3K7A B;  3ETH A;  1V8Q A;  4AIM A;  2EYJ A;  1HR0 W;  2W8L A;  2UVV A;  3HOU G;  4NXN H;  3ER0 A;  2ES2 A;  2EYM A;  1ASZ A;  5KFZ A;  3UE1 A;  3KAJ A;  4A3G G;  2YZM A;  2Y0S B;  2R7F A;  2R8G A;  5LHY 1;  3G7L A;  1SNM A;  1BCP D;  3J81 E;  1AH9 A;  2YYZ A;  2W6Q A;  1NCV A;  1X9N A;  4DUY Q;  2YZG A;  1RJT A;  3JC6 6;  3GTJ B;  2WAQ B;  2L5T A;  2CW7 A;  3HOU H;  1B9M A;  4HJ8 A;  3JZI A;  2MCT A;  5FJ8 H;  3S2D B;  1ASY A;  4EEQ A;  3T1H Q;  2FK3 A;  2W57 A;  1T5E A;  1EWI A;  1QG7 A;  2F3V A;  2VB3 X;  1GOZ A;  1M6V A;  2EXZ A;  2PNR C;  3GV5 B;  2E5L H;  1S9F A;  4KY5 A;  1SE4 A;  3PV0 A;  4U68 A;  3GTJ H;  1Z2O X;  1KDC A;  1S68 A;  2UXC L;  3GTP B;  4MV6 A;  4RG1 A;  3Q8P B;  1II3 A;  4QWE A;  4YQW A;  1YNJ C;  1Y1V A;  4KTA A;  5IY0 A;  5FD5 A;  4JUZ A;  1KHI A;  4ECX A;  3GIM A;  4TV8 F;  3T5H A;  2L12 A;  1HNZ L;  3I70 A;  1U4P A;  1B6S A;  4KI0 A;  2XGQ A;  4A3B B;  1WD1 A;  5C44 G;  2DNE A;  2ICI A;  2K05 A;  1B2T A;  4IWY A;  3GTL A;  2IMW P;  4C5C A;  3E0J A;  3HOY B;  5KT6 A;  2CQO A;  1G2S A;  4C1N K;  1STY A;  3RTX A;  4KKT A;  3K3P A;  2NVX B;  2PW7 A;  4ECR A;  1L1O C;  3EN2 A;  2R92 A;  1BCP F;  1UEA B;  3RN2 A;  1LAC A;  1BR9 A;  4IJL A;  1NJI C;  4JI0 Q;  2HCI A;  5KFA A;  4X3S A;  3HOV B;  1TWC B;  4Y52 H;  3KJP A;  1EIH A;  3KAK A;  3TZU A;  4KJO A;  2QK4 A;  5D65 A;  4JI5 Q;  3MXG A;  2AQ3 B;  3P7J A;  4A3D B;  4HCS A;  1B50 A;  3BQ2 A;  3T13 A;  3OSN A;  2HCC A;  1Q1B A;  1A8V A;  1UWV A;  1ENF A;  4MZ9 A;  3C2P A;  1K8A C;  2YU9 B;  2ZM6 H;  2Z4I A;  2EJG C;  1XNR H;  5LMU L;  1GHK A;  3PUZ A;  4B08 A;  5IP9 H;  1R9T A;  4UCO A;  5E1F A;  2DIK A;  4NMZ A;  5IWA Q;  2F4V H;  1TWG H;  3SE7 A;  3I7F A;  1PTO D;  4XYO A;  2R87 A;  1IBM H;  5FJ8 G;  2F0S A;  4RWS C;  5E3F A;  4X65 Q;  3HGB A;  4LF5 L;  3GIJ A;  1FD7 D;  2V5A A;  1XMO H;  4EVO A;  2PW5 A;  3M4O H;  1Y8P B;  1AP0 A;  1KXL A;  3K8A A;  3BG5 A;  3KHL A;  1U0L A;  1E7Z A;  2N88 A;  1C30 A;  2B2V A;  2ZTE A;  3CCL A;  1JIC A;  4YAJ B;  1XNQ Q;  4JYA Q;  2CKZ B;  5M3M G;  3PR4 A;  1S3O A;  3VPB A;  2AGP A;  5KFP A;  4JPB W;  4RZQ A;  3HOX G;  5M5Y H;  2W9C B;  1WOC A;  4R8U A;  1TXY A;  5KGU A;  4DR3 L;  3A7L A;  2VOB A;  1J5E Q;  1KJI A;  3OTO L;  1SXT A;  1C8C A;  4HIM A;  4PQX A;  3CHB D;  1CHP D;  2VQE L;  3HKZ G;  4FVM A;  3RZD H;  4PMW A;  4HIK A;  1DCZ A;  4I4T F;  4UPA A;  4O0A A;  5JEA J;  3G48 A;  2KOL A;  3FPP A;  4RUC A;  1I94 H;  4RGT A;  4DR5 L;  4QB4 A;  3QWN A;  3OSP A;  1DV2 A;  1VQL A;  3DWA A;  1PTO H;  1W6J A;  3MC0 B;  1E0B A;  3MWE A;  4FS1 A;  2GN5 A;  2JQO A;  4BXX G;  2BDN A;  1S0M A;  2LXK A;  4DU9 A;  3T1Y H;  2I5M X;  1LT4 D;  3M85 A;  1TS3 A;  4DR2 L;  5KFO A;  4F8M A;  3MFH A;  3URY A;  1VKZ A;  5T14 A;  2HIV A;  4HSP A;  1UC8 A;  4DV0 H;  2K04 A;  1JQY D;  1WCM A;  1WJJ A;  4LJZ C;  3H3V H;  2SDF A;  5EPK A;  4EQN A;  4GOP B;  1KAW A;  2XIG A;  1JX4 A;  4IAJ A;  5C4X H;  1HFG A;  5C3X A;  2K52 A;  4DV4 L;  1RYR A;  4C3I B;  3STB C;  2EQS A;  2YTX A;  5KFD A;  1CSP A;  2Q2T A;  2C2E A;  4IRC A;  2F0I A;  3AQQ A;  2KHI A;  2L55 A;  4ZQ3 A;  2F0V A;  4K5X A;  1BUV T;  1DM0 B;  4HR7 A;  1RDP D;  4BBS H;  1S72 A;  4FF1 A;  1XWE A;  3HKS A;  5EJW A;  4A3E B;  2X69 A;  4JG2 A;  1HJP A;  1PH4 A;  2ZJR A;  1I4G A;  1Y1W G;  1PTO F;  1LTI D;  4KKU A;  1NE3 A;  2CCZ A;  2JA6 B;  1NMG A;  3H40 A;  3RAQ A;  3I91 A;  1QE6 A;  3F8N A;  2NTS A;  3J80 i;  3VR5 A;  2XTI A;  3KLR A;  5IIF A;  2NTT A;  4UCV A;  2FLN A;  5C4X B;  2RA4 A;  2NWG A;  5LOV F;  4J9Q A;  1XNQ H;  2ENB A;  1MSG A;  1TWA H;  2UU9 Q;  3D4R A;  2DN8 A;  2IJ0 A;  1RYS A;  1B44 D;  3F2U A;  1EZ8 A;  5DEH A;  4K5W A;  3D6C A;  3PR5 B;  1XPU A;  2F0T A;  2K5H A;  1X65 A;  2CWP A;  2HQL A;  2R93 G;  3G6X A;  3I72 A;  2D62 A;  5EKK A;  1KD1 C;  4LFB H;  4RB1 A;  1E2V A;  2DNC A;  1PFB A;  1XYI A;  1E3P A;  2YRX A;  1FR3 A;  3V05 A;  1RCV D;  2BH2 A;  3GDE A;  1B3A A;  2R84 A;  1HA6 A;  1ML0 D;  4R4C A;  3TP5 A;  3LWE A;  2RQX A;  5KFK A;  1SMY D;  5A2Q L;  2ZM6 Q;  5KFI A;  2JEG A;  1MHW C;  2AUJ D;  2A6E C;  2E8G A;  1TAE A;  1RL2 A;  1SR3 A;  1Z2N X;  5CAE B;  4JBJ A;  2NU8 B;  3EQL C;  3VPD A;  3HOZ H;  1FVI A;  3JAM E;  4YCV A;  2JA7 A;  2JA6 H;  4O1N A;  1STN A;  1B4O A;  1BGW A;  1S97 A;  5IYD G;  1A63 A;  4ILW A;  3M9B A;  5L1L A;  4Y7N H;  1EQR A;  4DL3 A;  4A93 B;  3VYS A;  2R93 A;  4EYI B;  5FLX E;  5IWA L;  2B2Y C;  1WFQ A;  4IRD A;  2I5H A;  1F77 A;  4L63 B;  4LFB L;  4DAM A;  3K58 A;  3GTG H;  4RCO A;  2N78 A;  2Z8L A;  2C35 B;  1YEZ A;  1CA6 A;  3MWD A;  1FL0 A;  4DL6 A;  2IBK A;  3TS0 A;  4HNV A;  4DR2 H;  3PUX A;  5K5P A;  3LML A;  1K8M A;  3KBX A;  2ZDQ A;  4CC5 A;  1S0O A;  3M3Y H;  3H0G B;  5KX5 F;  2EPB A;  5KNB A;  4LFA L;  4GZY C;  2UVU A;  3E5S A;  3GTJ A;  3F2C A;  5EPJ A;  3NSW A;  1IOW A;  3K59 A;  4POF A;  5EKI A;  5J22 A;  1IXR A;  2WDT A;  5KT5 A;  2M9V A;  3S9W A;  4GKJ Q;  5IGE A;  1K83 B;  5CA0 F;  1IBK Q;  1ILQ A;  1TWG A;  1N56 A;  4J15 A;  4O3P A;  4DUZ L;  3MFG A;  2NN6 I;  3JSL A;  4YY3 Q;  1VQ5 A;  4XYM B;  5CV7 A;  1LT3 D;  4M9U A;  4TUY F;  4DR6 L;  5F9N A;  1ENC A;  1VQJ A;  1MZB A;  2RDF A;  4EGV A;  1STE A;  4DV1 Q;  2W6O A;  2F0N A;  5ELF A;  2RDG A;  4Y8V B;  1I6U A;  2M2L A;  4HNT A;  1VQC A;  5G3L F;  2NVQ B;  2L9H A;  5JAV A;  4DAP A;  1AN7 A;  4J1M A;  1E4G T;  1WCM H;  2WTF A;  1W96 A;  4JV5 Q;  5DLF A;  1D5Z C;  4K6L A;  4MTN A;  3H4B A;  2RBM A;  1VCI A;  2LMC B;  2OQK A;  4JVZ A;  4DUY H;  1D5M C;  3J80 W;  4O4I F;  3G71 A;  5IGG A;  1L2F A;  3SR1 A;  1BXR A;  3SXH A;  4RFB A;  3RZO B;  3HOU B;  2HUG A;  4IO9 A;  1VMP A;  3GTK A;  4JBW A;  4OWX B;  5H1S E;  1DIK A;  3EVQ A;  1W93 A;  4ZAI A;  3LGJ A;  2AMC B;  2K5D A;  1A62 A;  1YHB A;  1R9T B;  3U9T A;  5CV5 A;  3OW2 A;  3KXY T;  1W2B A;  2C5C A;  3PQI A;  3H15 A;  3TRZ A;  1PMR A;  1PH6 A;  1HUM A;  4GLV B;  5HGT A;  1FNW A;  1DJR D;  1PRT F;  4C3J H;  5K36 G;  3GV8 B;  2DY7 A;  1Q7Y C;  2X6L A;  3EJI A;  1E2Z A;  1RK5 A;  3VR3 A;  4K5V A;  2RDI A;  5M5X B;  2UXB L;  2V4R A;  1D7Q A;  2JK8 A;  3PO2 H;  4LAA A;  1UC9 A;  2H4O A;  3DMU A;  1JMC A;  3HOV H;  1PRT C;  1G51 A;  5IYC H;  4DGZ A;  4OON A;  3J7A F;  4GN4 B;  1KJJ A;  4EYH B;  4OEM B;  2AGQ A;  2Y0S G;  4DN4 M;  2V9W A;  5LL6 S;  2HHH Q;  2D5D A;  3EPG A;  1YIJ A;  4A3D H;  4YB8 B;  1PZI D;  2R7D A;  2EYH A;  4IAL A;  1A2U A;  5D3D A;  2L0C A;  4DFA A;  3HS0 C;  3PO3 B;  4A93 G;  1TY0 A;  1I7N A;  3HOW H;  3RNU A;  3Q22 A;  5IYB H;  1FJG L;  1ROD A;  4A3F H;  2F1M A;  3MR6 A;  2E2I B;  2FKL A;  4FO2 A;  3RLN A;  3TP8 A;  2JEF A;  1RIP A;  1CTM A;  4DR4 H;  5HGQ A;  3M4I A;  3J80 L;  5FO7 B;  1U5K A;  3K5O A;  3KYH C;  2OTJ A;  4MTK A;  4WRD A;  1BQQ T;  2J0T D;  4A76 A;  1M8A A;  2ICE C;  2SOB A;  3TQT A;  1HNZ Q;  4DL5 A;  1JJG A;  2BCO A;  3W1B A;  2K03 A;  4XX0 B;  1I4Q A;  2VA2 A;  1Q8I A;  1PH2 A;  2R8I A;  1TWH H;  2NUC A;  3A7A B;  3H94 A;  3LP8 A;  4QY7 A;  4JYA L;  3VA5 A;  4ULL A;  1NMF A;  1FGU A;  4H13 C;  4GOP A;  1CQJ B;  5DQG A;  1G6Z A;  2HD3 A;  3N44 B;  4TQR A;  2KBN A;  3N42 B;  5BMV F;  1H95 A;  1HR0 Q;  5KIX A;  2HT1 A;  1HZC A;  2D0P A;  2F4V Q;  1EHI A;  2R3Z A;  4DK6 C;  4LFC L;  3U50 C;  4KK7 A;  2HDL A;  1JWM D;  3RIZ A;  1KRS A;  2D2C C;  5A2Q E;  1UE7 A;  4A3J B;  3BAA A;  3N41 B;  3CCR A;  1PHJ A;  1B70 B;  3KF6 B;  3PGZ A;  2R93 H;  3I90 A;  4O42 A;  4X3U A;  1ZXT A;  5IP9 G;  4X66 L;  5BN5 A;  3H0G A;  1VQF A;  1F2Z A;  1O7I A;  3AFQ A;  4ED1 A;  2PZU A;  1PZJ D;  5CMD A;  4JYA H;  1OTC A;  4KKS A;  4HIO A;  3N6X A;  5LMN L;  3PIO A;  4RB2 C;  2KVM A;  2AQ2 B;  3ULJ A;  3WO1 A;  2PBZ A;  2IP4 A;  2R8J A;  1PRT B;  2QA4 A;  2JA8 B;  1LTR D;  3JAM i;  3T5J A;  4BA1 I;  2A69 D;  3MR3 A;  3TEH B;  5IYD H;  1KJ9 A;  3H0G H;  4L5S A;  3TP6 A;  3D6W A;  3G6E A;  2FFK B;  1EOV A;  2XRS D;  4ZUJ A;  4XTC S;  2CW0 C;  3OHA A;  2B2Y A;  3C46 A;  1I7L A;  4HCE A;  1AW7 A;  2BQR A;  3E3X A;  2PI2 A;  2JA5 A;  1Y8N B;  1J6Q A;  1L0W A;  2UUC L;  1G8Z D;  4UCU A;  3HOZ B;  2PMZ A;  4HJ7 A;  3D4W A;  1T3N A;  1TWF A;  3T53 B;  2XN9 C;  1M0T A;  5C4X G;  1W3S A;  3L4K A;  4BBR H;  5M5W H;  3TDQ A;  2VQE H;  3GIQ A;  4GS3 A;  1XMQ Q;  5TSS A;  3JRW A;  4HJA A;  1U9R A;  2B29 A;  1IBL H;  3E5N A;  2JA5 H;  2CW0 D;  2CQY A;  2MJ8 A;  2R61 A;  3UDF A;  4JI2 L;  1K8G A;  4EEY A;  1KNE A;  5EAY A;  3K7A H;  1AUX A;  3MR5 A;  4RU9 A;  4GNX B;  5J3B A;  4JI4 H;  1VQN A;  1K0R A;  1AZQ A;  4C5B A;  3G6J B;  4JI6 L;  4QUC A;  3RUP A;  1LO5 D;  4MV1 A;  4OIK A;  2ZDG A;  5M3M B;  2KCN A;  5ELB A;  2I80 A;  3G4S A;  4LUO A;  5JVL A;  2OWO A;  3NXW A;  2WB1 E;  3IL8 A;  2LS0 1;  4LF4 L;  1VQG A;  3OYY A;  3PO3 G;  1KAB A;  5ELC A;  3PF4 A;  4KN4 C;  3HP3 A;  1TT2 A;  4DV6 L;  3S1N B;  3Q2O A;  2RCF A;  4O4L F;  1GSA A;  1B33 N;  5JH7 F;  4O3S A;  3VA7 A;  4XT1 B;  1V1P B;  1SEB D;  1LAB A;  1Q8K A;  2ZDH A;  1X55 A;  3F2D A;  5FK9 C;  4EQO A;  4P75 A;  3E9I A;  2PNH A;  2AQ1 B;  1XNR Q;  4Y7N B;  5H80 A;  2B2W C;  3BJY A;  1UEB A;  3I3C A;  1GUS A;  3I4M G;  5IYC G;  4YHH L;  5C3W A;  1FNV A;  4QIW A;  2F0E A;  1I4X A;  1U4R A;  3J7A K;  1DV1 A;  4HQ6 A;  1HNZ H;  2F3W A;  4JCV E;  2R7Z H;  1STA A;  2CWA A;  3UDG A;  4IFD I;  1VQ8 A;  2GVB A;  3NBH A;  1CKM A;  5KYL A;  3S2D H;  1K83 A;  4LFB Q;  2OEO A;  4IJH A;  3S17 H;  1SRU A;  3CCM A;  4A3J H;  4B3S L;  3S16 H;  4RKL A;  2CW8 A;  5KG0 A;  3W2D A;  1TS5 A;  3VYU A; 
#chains in the Genus database with same CATH homology
 5FJ8 G;  1SFO H;  4X65 Q;  4DV7 Q;  3RLF A;  2VUM G;  4LF5 L;  4LNQ A;  1HNX L;  1K3R A;  4JI8 L;  3TQY A;  3CD6 A;  2UXB Q;  2RF4 A;  3CP0 A;  3F2B A;  4DR4 L;  2NVT H;  1YZ6 A;  3M4O H;  2NZH A;  2VQE Q;  1KXL A;  4LWC A;  3K8A A;  2LSS A;  1U0L A;  1E7Z A;  2JA8 G;  1LM0 A;  1PH5 A;  2ZTE A;  4BY7 H;  1MJE A;  3CCL A;  1MJC A;  1N33 Q;  1XNQ Q;  4HJ9 A;  4JYA Q;  2CKZ B;  5M3M G;  1S3O A;  2FXQ A;  1QVC A;  4JC0 A;  4X64 Q;  1D8L A;  1E24 A;  5M5Y H;  3HOX G;  1WOC A;  1TXY A;  4NB3 A;  4DR3 L;  1L1O B;  1J5E Q;  2IX1 A;  3OTO L;  1VQA A;  2IT1 A;  3FKI H;  3NEM A;  4HIM A;  1N32 Q;  3L7Z C;  4P72 A;  2VQE L;  3HKZ G;  2E2J H;  1V9P A;  1PVO A;  3RZD H;  1SLJ A;  4PMW A;  4OX9 L;  2YTV A;  4HIK A;  2HIX A;  1YIT A;  4UPA A;  4O0A A;  5JEA J;  2AKW B;  3G48 A;  4DUY L;  3SGI A;  4AH6 A;  3L2P A;  4DR5 L;  4R4I A;  2CFM A;  2R6G A;  1VQL A;  2PI2 E;  1OXU A;  2OTL A;  5BR8 L;  1KL9 A;  3ZJY C;  4DPG A;  4B3M L;  4QQB X;  5LMN Q;  2ZTD A;  1VS0 A;  2GN5 A;  3CPF A;  1GO3 E;  2JQO A;  5IYB G;  3OTO Q;  4GNX C;  4A3M G;  2LXK A;  2PQA A;  4BXX G;  2K5V A;  4NXM Q;  4A3L G;  2VY3 A;  2I5M X;  4GN5 A;  3GTQ H;  3M85 A;  1N8R C;  4GNX A;  3PO2 G;  1C0A A;  1EUJ A;  1IZ6 A;  2ZJP A;  4OWW B;  4DR2 L;  4JI1 L;  1PH7 A;  2JA8 H;  3UDX A;  2HIV A;  3PUY A;  3KDF A;  4X62 L;  3J81 c;  1HNW Q;  1WJJ A;  3HKZ E;  5M3F G;  1VQ4 A;  5M3M H;  3S1R H;  4FDB A;  4KHZ A;  3H3V H;  4YWM A;  1TWF H;  3CCV A;  4GOP B;  4YCU A;  4JI4 Q;  1KAW A;  2YTY A;  1N36 L;  1GD7 A;  5C4X H;  1HNX Q;  4A3C G;  3GD7 A;  2K52 A;  4DV4 L;  1I94 L;  3AEV A;  2UUA Q;  3STB C;  2EQS A;  2YTX A;  1CSP A;  3GO5 A;  1PH3 A;  2Q2T A;  1IBK L;  5JJI A;  4A3G H;  3A0J A;  1G29 1;  1PYS B;  3AQQ A;  2KHI A;  1I50 H;  4MNO A;  4JBM A;  4B3R Q;  3F1Z A;  1VQK A;  1UE1 A;  4L5Q A;  4POG A;  1CUK A;  1IBM Q;  1HZ9 A;  1VQD A;  4BBS H;  1MKH A;  1XTD A;  1S72 A;  4DR7 L;  3HOW G;  3HKS A;  3RN5 A;  4A93 H;  1PH4 A;  4JG2 A;  1HJP A;  4IPG A;  4X66 Q;  3CCS A;  4A3C H;  2ZJR A;  1P8L A;  1Y1W G;  2UUB Q;  4LF7 L;  4GKK L;  2EXD A;  1NE3 A;  3KDF B;  1HZB A;  2CCZ A;  1XNR L;  2WAQ G;  1NMG A;  4NPS A;  4WJ4 A;  3GTM H;  2VQF L;  2R7Z G;  4P73 A;  3J80 i;  5LMU Q;  4HJ5 A;  2XTI A;  1PH8 A;  5JEA G;  4QL5 A;  1WCM G;  1TWA H;  2UU9 Q;  2UXD Q;  1HH2 P;  1OXS C;  2JEB I;  3AFP A;  3DM3 A;  5ELN A;  3S1Q H;  1VQ6 A;  1Y14 B;  4OX9 Q;  1K9M C;  2A8V A;  4X65 L;  3FHW A;  4DV7 L;  4R4Q A;  2B63 H;  3PSI A;  4B3M Q;  1XMO L;  1HR0 L;  1XPU A;  2K5H A;  5GAG C;  1X65 A;  2CWP A;  2HQL A;  2VW9 A;  3VDY A;  2E5L L;  2R93 G;  2D62 A;  3K80 C;  5C44 H;  4DV6 Q;  1KD1 C;  4TQU S;  2JA9 A;  1JT8 A;  4IFD G;  1E3P A;  5C4J H;  2BH2 A;  3GDE A;  5C0X I;  2UUC Q;  4BY7 G;  4JI1 Q;  4AYB G;  2VNU D;  1NTG A;  2AHO B;  1I5F A;  1HNW L;  4R4C A;  2NZO A;  4X6A H;  2ZM6 Q;  3CPW A;  3GTP H;  2AWN A;  3FKI G;  2E8G A;  3KFU A;  1RL2 A;  1SR3 A;  3S24 A;  4JBJ A;  1YJ9 A;  2MFI A;  4LF6 Q;  3A5Z B;  4DV3 L;  3HOZ H;  1FVI A;  4YCV A;  4JOI C;  3JAM c;  3KOJ A;  1JB7 A;  2JA6 H;  1VQI A;  4JI2 Q;  4DV4 Q;  1E1O A;  1Q46 A;  2WAQ E;  4JV5 L;  1WI5 A;  5IYD G;  1YNX A;  3CME A;  3M9B A;  1A63 A;  3CC4 A;  4Y7N H;  1N36 Q;  1EQR A;  4BBR G;  1EIY B;  4DK3 C;  2NN6 G;  5IWA L;  1CKN A;  2JE6 I;  5GAH C;  1WFQ A;  4DR5 Q;  1HZA A;  2I5H A;  4QJF A;  1PV4 A;  1BVS A;  2Q2H A;  4LFB L;  2DUD A;  4DAM A;  3J81 i;  3J81 j;  3GTG H;  2MNA A;  1JE5 A;  2N78 A;  3RR5 A;  2UUB L;  4LF7 Q;  1AE3 A;  4DV3 Q;  4LF9 L;  4GKK Q;  1JJ2 A;  5IT9 c;  2C35 B;  1YEZ A;  3KLW A;  4LF6 L;  4APV A;  2QGQ A;  2VZA A;  1FL0 A;  5IP7 G;  1K73 C;  4DR7 Q;  3TS0 A;  2ALY B;  3PUX A;  1C7Y A;  2Y0S E;  2ZM6 L;  4UP9 A;  1EIF A;  2ID0 A;  1PH9 A;  4DUZ Q;  4ME3 A;  5C0X G;  2ASB A;  2N8N A;  3U58 A;  3M7N A;  4R4T A;  3HOY G;  3M3Y H;  4A3J G;  1PFS A;  5M5X H;  4DV5 L;  3NEN A;  4LFA L;  2K75 A;  3CW2 C;  2E2I H;  1EFW A;  3EBE A;  4YCW A;  4C3H H;  1TWC H;  3F2C A;  4JI0 L;  1IBL L;  1P16 A;  1V43 A;  4POF A;  1XPO A;  1Z9F A;  1IXR A;  2OQ0 A;  5FLX c;  5HY6 A;  4GKJ Q;  1XMQ L;  2R92 G;  3WWV A;  3J7A 5;  3PCO B;  1IBK Q;  1DGS A;  3U4V A;  3BZK A;  4J15 A;  2F3I A;  4DUZ L;  3BJU A;  1X3E A;  1Q82 C;  2NN6 I;  1J5E L;  4YY3 Q;  2AWO A;  1VQ5 A;  2IX0 A;  2WB1 G;  3H0G G;  4DKA C;  1IL2 A;  4GN3 B;  2HHH L;  4DR6 L;  1SE8 A;  1VQJ A;  3I55 A;  1Y1V G;  4NXN Q;  4DV1 Q;  1VQO A;  3HOX H;  2MO1 A;  1SN8 A;  3K81 C;  4R4O A;  2ZJQ A;  1CSQ A;  1VQC A;  3HFZ B;  4A3I G;  2UXC Q;  3E9H A;  4RMF A;  1QZG A;  3I4N G;  5IP7 H;  2F4V L;  1C9O A;  1WCM H;  3W5O A;  1CKO A;  2OCE A;  1OXX K;  4KHP Q;  4JV5 Q;  1X54 A;  4MTN A;  1PA6 A;  4LF5 Q;  1VCI A;  2OQK A;  1QVG A;  1V1Q A;  2RHS B;  4R1J A;  1YJW A;  3S1N H;  3G71 A;  4PZ8 A;  3TRE A;  1L2F A;  4LFC Q;  4IO9 A;  4TVA B;  3K0X A;  3J7Z C;  2ATW A;  3D31 A;  1SRO A;  4IFD I;  1E1T A;  4JBW A;  1OXT A;  4OWX B;  5H1S E;  3PUW A;  4BY1 H;  4A3L H;  2VS1 A;  2JA6 G;  1YHQ A;  3STB D;  1X3G A;  3LGJ A;  2AMC B;  1A62 A;  1YHB A;  4DV1 L;  4IOA A;  4PG3 A;  3K7U C;  2XGT A;  3NBH B;  3OW2 A;  4JBK A;  1W2B A;  1VQH A;  3H15 A;  1JJC B;  1B8A A;  1CKN B;  1MIU A;  4JI6 Q;  3TRZ A;  4P71 A;  1PH6 A;  5BR8 Q;  1VQ7 A;  4LF8 L;  2MO0 A;  4GLV B;  4UP8 A;  4IPH A;  4C3J H;  1T9H A;  1YI2 A;  5K36 G;  3I4M H;  1Q7Y C;  2D0O A;  1PYB A;  1YHA A;  1OXV A;  4JI3 Q;  3I4O A;  4DNI A;  3Q8D A;  4IFD J;  3KJO A;  3ULP A;  4A3K G;  4A3E G;  2UXB L;  1D7Q A;  2VQF Q;  2JK8 A;  2IHF A;  3PO2 H;  5JJL A;  3BZC A;  1GKH A;  1Q81 C;  1R9T H;  1JMC A;  4EQ5 A;  1FJG Q;  4OWT B;  3HOV H;  1G51 A;  5IYC H;  3M4P A;  4OON A;  1LYL A;  4A3B G;  1VQE A;  4GN4 B;  4NXN L;  3RZO H;  4AYB E;  1YJN A;  4X62 Q;  2Y0S G;  4B3T L;  2LXJ A;  4IOC A;  5LMN W;  2HHH Q;  1YIJ A;  3CCQ A;  4A3D H;  4DV0 L;  3GTO H;  2V1C C;  4IPC A;  1NY4 A;  4C3I H;  3EIV A;  4LF9 Q;  3A5U A;  5GAD C;  1PH1 A;  4JI7 L;  4BA2 I;  2R7D A;  2IY5 B;  1UE6 A;  1XNQ L;  4JI5 L;  4YHH Q;  1BBU A;  1I3Q H;  1IYJ B;  5C3E H;  3HOV G;  2UUA L;  4A93 G;  1IBM L;  1I6H H;  3HOW H;  3RNU A;  5FLM H;  2JA7 G;  4P74 A;  5IYB H;  1FJG L;  3HOY H;  3I56 A;  4QIW E;  4BXX H;  2Q2I A;  5ELO A;  4QGU A;  4AQY L;  4A3F H;  1Q86 C;  3S15 H;  3RLN A;  1IBL Q;  4A3D G;  1RIP A;  4B3S Q;  3CCE A;  2R92 H;  1VQB A;  3CC7 A;  2Z0S A;  5HGQ A;  1Q1E A;  2A19 A;  4DV2 L;  2Z6K A;  1U5K A;  3KYH C;  3FP9 A;  2OTJ A;  2KCM A;  4A76 A;  2QEX A;  3T1Y L;  1HNZ Q;  2A1A A;  4YWL A;  1EQQ A;  4EX5 A;  1JJG A;  2Z6K C;  2E2H H;  1X3F A;  3W1B A;  2NVX H;  3CQZ H;  2NVY H;  4JOI A;  2KEN A;  4O2D A;  4DR1 Q;  1PH2 A;  4LF4 Q;  4DR6 Q;  4DR2 Q;  4WJ3 M;  1TWH H;  1QUQ B;  4LUV A;  1Y1V H;  2VUM H;  4C2M H;  2JEA I;  3GTK H;  4QY7 A;  4JYA L;  1NMF A;  2VL6 A;  4BY1 G;  1FGU A;  4GOP A;  1VQP A;  4UP7 A;  3T1H L;  3KF8 B;  2MQH A;  2I5L X;  3F8T A;  4GLA C;  2KBN A;  1H95 A;  4OXP A;  1XMO Q;  1M1K C;  1HR0 Q;  1B7Y B;  4K0K Q;  4JI3 L;  1QUQ A;  1X6O A;  3UE0 A;  2HT1 A;  1HZC A;  5E7N A;  1QVF A;  2RHQ B;  1N32 L;  2D0P A;  1I94 Q;  4UY8 C;  2PMZ E;  2F4V Q;  3TS2 A;  5IE8 A;  1LUZ A;  4DK6 C;  2WP8 J;  2L15 A;  5M3F H;  4KHP L;  4LFC L;  3U50 C;  4LW1 A;  2N49 A;  3H3V I;  1UE5 A;  2WFW A;  4DV5 Q;  1KRS A;  4YWK A;  3MEF A;  3CAM A;  1UE7 A;  3CCR A;  1PHJ A;  1B70 B;  3KF6 B;  3PGZ A;  1BBW A;  3I2Z A;  5AJ3 Q;  2R93 H;  5C3E G;  4H02 A;  1A0I A;  5IP9 G;  4X66 L;  1VQF A;  4A3K H;  1O7I A;  1N34 Q;  2BA0 A;  3AFQ A;  4GKJ L;  1AE2 A;  4JI8 Q;  1GM5 A;  2JA5 G;  4NXM L;  1Z47 A;  1OTC A;  3CXC A;  4HID A;  4HIO A;  2K50 A;  4L5R C;  3M4Q A;  5LMN L;  3PIO A;  1K83 H;  3GTL H;  2UU9 L;  4YY3 L;  4AQY Q;  4A3B H;  4PZ6 A;  3I4N H;  1N9W A;  2IHE A;  2B3G A;  3ULJ A;  1L1O A;  1NBW A;  2KCT A;  2JA7 H;  4L5T A;  4LF8 Q;  2YU9 H;  5JJK A;  2QA4 A;  4JI4 L;  3JAM i;  1XPR A;  1N34 L;  4BA1 I;  2I0Q A;  3CMA A;  2UXD L;  3TEH B;  5IYD H;  4LFA Q;  4IPD A;  2DGY A;  3H0G H;  4AIM A;  3G6E A;  3CF5 A;  1HR0 W;  4L5S A;  3S14 H;  5AJ3 L;  1EOV A;  3HOU G;  4XTC S;  2N3S A;  3S1M H;  3ER0 A;  2ES2 A;  1ASZ A;  2PI2 A;  3UE1 A;  1L0W A;  1J6Q A;  4A3G G;  2F52 A;  2UUC L;  2R7F A;  3I7F A;  3CCU A;  4HJ7 A;  4GOP C;  1KIX A;  4B3T Q;  5C4X G;  1W3S A;  1AH9 A;  3NEL A;  2YYZ A;  3L0O A;  4BBR H;  5M5W H;  1VQ9 A;  1X9N A;  3PF5 A;  4DUY Q;  3JC6 6;  1Q12 A;  3S2H H;  4GS3 A;  3ICE A;  1XMQ Q;  3HOU H;  4HJA A;  4HJ8 A;  5FJ8 H;  2B29 A;  1ASY A;  4DR4 Q;  3T1H Q;  1LTL A;  5DLQ E;  2JA5 H;  4JI2 L;  2H5X A;  3UDF A;  2BA1 A;  1K8G A;  2NVQ H;  2JJQ A;  4A3F G;  1EWI A;  5EAY A;  3K7A H;  4K0K L;  1YBY A;  3PV0 A;  5J3B A;  5FLM G;  2K14 A;  2RCN A;  3GTJ H;  4GNX B;  5C0X J;  1K0R A;  1WYD A;  3PIP A;  1VQN A;  3D0F A;  4PZ7 A;  4JI6 L;  5GRO A;  4A3M H;  2UXC L;  3HOZ G;  1G6P A;  4RG1 A;  4KLK A;  5IY0 A;  2Q2U A;  3ERS X;  1KHI A;  4DR3 Q;  2PQA B;  1HNZ L;  2ZTC A;  4LUO A;  4KI0 A;  3G4S A;  4A75 A;  3T1Y Q;  3CC2 A;  2OWO A;  5C44 G;  3CCJ A;  2K4K A;  2WB1 E;  4DV2 Q;  4DR1 L;  1KQS A;  3PO3 H;  4LF4 L;  1VQG A;  3OYY A;  3PO3 G;  3E0E A;  3PF4 A;  3U4Z A;  4DV6 L;  4A3I H;  1XJV A;  4OO1 G;  1VQM A;  2CQO A;  3BU2 A;  1Y1W H;  1QZH A;  3W1G A;  4B3R L;  1Q8K A;  1L1O C;  1X55 A;  3EN2 A;  3RN2 A;  3AYH B;  3F2D A;  5GAE C;  4IJL A;  1NJI C;  3J80 c;  4P75 A;  3E9I A;  4A4I A;  4JI0 Q;  5GQO A;  1KC8 C;  4JI7 Q;  2PNH A;  1SMX A;  3DLL A;  3IRB A;  1XNR Q;  4Y52 H;  3KJP A;  4DV0 Q;  1S40 A;  4GLX A;  1X56 A;  4XIG S;  1UEB A;  3I4M G;  5IYC G;  2YV5 A;  4YHH L;  4JI5 Q;  2KHJ A;  1M90 C;  2EIF A;  3MXN B;  1GVP A;  3RLO A;  1EYG A;  1Q1B A;  1A8V A;  1UWV A;  3B6Y A;  1BKB A;  4LUZ A;  4JCV E;  4MZ9 A;  3UDI A;  2CWA A;  3UDG A;  1K8A C;  1YVC A;  2GVA A;  1VQ8 A;  2R7Z H;  2GVB A;  5LMU L;  1CKM A;  4X64 L;  3PUZ A;  4A3E H;  2BH8 A;  3S2D H;  4LFB Q;  4IJH A;  4DAY B;  1E22 A;  5IP9 H;  3S17 H;  1SRU A;  3CCM A;  4A3J H;  3KF6 A;  4B3S L;  3PUV A;  1N33 L;  2B63 G;  3S16 H;  5IWA Q;  2K5N A;  3ULL A;  1TWG H;  2E5L Q;  4ALP A;  4BBS G;  3A74 A;  1KRT A;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...