3HOUG

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3houG01
2JJQA 2YV5A 4YHHL 1HH2P 1YITA 2F4VL 5GROA 3H3VI 2K5HA 1BVSA 1QUQA 2H5XA 3SGIA 1MJEA 4GS3A 3RN2A 3M4QA 5C4XH 1PH6A 3NELA 2D0OA 2QGQA 3GTOH 2ZM6Q 1SN8A 2UXDL 2JA7H 3S17H 5JJKA 3RZOH 4X6AH 1O7IA 3HOXG 2GVAA 4DV4L 1RL2A 3GD7A 3HFZB 4HJ7A 1IBML 2IX0A 4DR3Q 5LMNQ 2Z0SA 4OO1I 4DUZQ 1VS0A 4L5SA 4X62L 1QUQB 1Y14B 1NTGA 2CFMA 2K5NA 1KAWA 3ULPA 5FJ8G 1VQHA 3L2PA 3HOZH 4DR6L 3UDGA 4AQYL 1FJGQ 3OYYA 3KDFB 2HQLA 4P75A 4POGA 3GTGH 1HZ9A 4HIDA 3J81c 3PUXA 2UUBQ 4LUVA 5C4JH 3CMEA 4OX9L 2LSSA 2MFIA 5M5YH 1XNRQ 1Y1WG 5IYCG 2D62A 2PNHA 2BH8A 1EUJA 3E9IA 3HKZE 4AH6A 2KCMA 1GD7A 3BJUA 3PUWA 4YWKA 4B3TQ 3PO3G 4LFCQ 1UE6A 1RIPA 4GNXA 2PMZE 4A3MH 3H3VH 3RLOA 4DR5L 5IP9H 2UUAQ 1XPUA 1PH4A 3FHWA 2MO0A 1E22A 4JV5Q 1Q46A 1X56A 4AQYQ 5ELOA 2UUAL 4DR1L 4YWLA 1GM5A 4TVAB 3TS2A 2ATWA 5E7NA 4LFCL 5IYBG 3OW2A 1CKMA 3PF5A 4LNQA 4HJ9A 3K80C 1X6OA 3UDFA 2ZJRA 4JI8Q 4IJHA 2Q2TA 3CP0A 1CSQA 1YI2A 3BZCA 4IFDJ 3CCSA 2UXDQ 3I4MG 1L1OC 4BXXG 1XMOL 3U4VA 4KI0A 3HOYG 1QZGA 2C35B 1KIXA 4A93G 1CKNA 2N3SA 3CPFA 2RHQB 1KD1C 4JI5Q 4YHHQ 4R4CA 1X3EA 5LMNL 4A3JH 1VQDA 1Q7YC 3L7ZC 1VQ5A 3GTPH 4BY1G 4DV4Q 2EQSA 4BBRG 4GNXC 2K75A 2E5LQ 4GLVB 4LF7Q 2MNAA 1AE3A 4HJAA 4OWXB 3G4SA 5IP9G 2HHHL 1ASYA 3PUYA 1SROA 4OWTB 1PYSB 3KYHC 2QEXA 4A3IH 4JI4L 4JOIA 4JI3Q 2R7ZG 3H0GG 2Z6KC 5BR8Q 3T1YQ 2F4VQ 2VUMH 2K14A 5BR8L 5AJ3Q 3T1YL 4PG3A 3PF4A 3PUVA 3ER0A 4P71A 4DV7L 1JT8A 4POFA 4JI6Q 2YU9H 4NXNL 3EN2A 4ME3A 3TS0A 4JBMA 1L0WA 4LF7L 2E5LL 3CMAA 2UUCQ 2WFWA 4JOIC 1EIYB 1MKHA 3TEHB 2VY3A 4JI2Q 4PZ6A 4UPAA 4JI7L 3CD6A 3EBEA 1NMFA 4JI5L 5IP7H 3HOWH 4LFAQ 1K9MC 2KCTA 3F1ZA 2NVYH 1J5EL 1PV4A 1JE5A 1TWCH 3K7UC 1UE1A 4A3GH 2F3IA 1WJJA 1A63A 3S2HH 4DPGA 5M3FG 3RLFA 3A0JA 2B63G 1N32Q 5J3BA 4O2DA 1OXTA 2YTXA 2JA6G 2B29A 1T9HA 3UE0A 4DKAC 4HJ8A 1VQNA 1Y1WH 4A3IG 4X64Q 1V43A 3W5OA 5GQOA 4R1JA 3PUZA 4GNXB 3S15H 5M3MH 4DAMA 1YJ9A 2FXQA 3GTJH 2ZTEA 4DUYL 3KF6B 4LFBQ 2A19A 4DV5L 3CCMA 4ALPA 3TREA 2IHEA 3D0FA 4MTNA 2RF4A 2N49A 4XTCS 3S24A 1D8LA 2UXBL 4B3TL 3RLNA 4LF4L 2DGYA 4UY8C 5JEAJ 5C4XG 5IYBH 3TQYA 3I4MH 3NBHB 3CPWA 4A3BH 1K83H 4OX9Q 3RN5A 2KBNA 1VQAA 4LUOA 3ULJA 3H15A 4LF6Q 1JB7A 4JYAQ 3UDXA 3F2CA 4R4TA 3KJPA 3EIVA 4DR6Q 2NZHA 4X65Q 1L2FA 4H02A 1CKNB 1E1TA 1Q8KA 3UDIA 1OXVA 4X66L 4X62Q 4DUZL 1KRSA 1VQLA 2OWOA 4DR3L 1A8VA 1VQFA 1WYDA 2QA4A 3J7ZC 1K73C 1B8AA 1HNWL 2NN6G 4B3RL 2Y0SE 5JEAG 3LGJA 3HOYH 4A93H 3J7A5 1N36L 4NB3A 1E7ZA 4BY1H 2LXJA 4QJFA 4LF5Q 4R4QA 4BBRH 2K50A 2R7ZH 1L1OA 2YTVA 2I5HA 4K0KQ 1V9PA 3FKIH 4GLXA 1G51A 4HJ5A 2B3GA 1IBKL 2ZJQA 2R7DA 1VQOA 2ASBA 2R93G 1X3GA 4A3EG 1VQ8A 1MIUA 4O0AA 2ZJPA 1K3RA 2OQKA 4DV3L 1PVOA 1U5KA 1XNQQ 3I55A 2NVXH 3T1HL 3CC2A 5HY6A 1KL9A 1NBWA 1HZAA 2PQAA 3CF5A 1ASZA 4JCVE 1W2BA 3MXNB 1TWGH 3J80c 1VQKA 3KFUA 2VNUD 1TWAH 1I94L 4P74A 1VCIA 3NENA 1N8RC 4GN4B 3PV0A 1J6QA 2ZTCA 4IO9A 4LF9L 3S1MH 5IP7G 2AKWB 1XPRA 4NXML 2JA8G 4TQUS 1B70B 2JA7G 2JEBI 2UXCL 3F2BA 4A3CH 5GAGC 1LUZA 1X54A 1U0LA 4JI7Q 4KLKA 4B3SL 2KHJA 4YCVA 4YCUA 4KHPQ 1E3PA 1UWVA 4IOAA 4QGUA 1X65A 3PO2G 4DV1Q 4DV6Q 2Q2UA 5IE8A 3CCJA 3W1GA 1Z47A 4PZ7A 3KLWA 3OTOL 2CWAA 1EQQA 4UP7A 1HR0L 5GADC 2OTLA 2BA0A 2K4KA 4FDBA 3CCVA 1IL2A 1PH3A 1M1KC 5C0XG 3AEVA 4NPSA 1P16A 1VQEA 4LWCA 3K7AH 2VW9A 2VQEL 1K8GA 1N33Q 2NVQH 1EWIA 1JJCB 4RG1A 4DV2Q 1C7YA 2IY5B 2WP8J 1Q81C 4OO1G 4DV6L 4DV1L 1PH8A 3CCEA 3CCQA 3I2ZA 1FL0A 4C3JH 3MEFA 2VUMG 4DK3C 4Y52H 1G6PA 4A3BG 1A62A 2LXKA 1XPOA 5C0XJ 2VL6A 1I6HH 3GTKH 4GKKL 4B3MQ 1YNXA 1VQIA 1WFQA 3D31A 1HNXL 1A0IA 4BY7G 4C2MH 1YHBA 3BZKA 3HOWG 5IYDG 3RNUA 4DV0L 1GO3E 3CCLA 4IPDA 3AYHB 4A3FG 3S1RH 3CCUA 1N34L 5GAHC 3IRBA 4LF8L 4A3GG 3KF8B 3S1NH 1L1OB 1MJCA 2N78A 3GDEA 1YJNA 2KHIA 4GKJL 4HIMA 1E24A 2AMCB 2XTIA 2VQFQ 1QVCA 1YEZA 1Z9FA 2MQHA 1S3OA 1WOCA 1YIJA 1C0AA 1UE7A 3M7NA 4DR7L 4IOCA 1H95A 4MNOA 5IWAL 4PMWA 3E0EA 4XIGS 1HNZQ 1XNQL 3I4NG 2B63H 1XMQL 1VQ9A 2AWNA 5M3MG 3HOVG 4DV3Q 4GOPA 5IWAQ 2I5LX 2E2IH 4DR7Q 4P72A 1VQCA 4JBJA 2PQAB 2YYZA 3NEMA 4RMFA 1NY4A 2R92G 4A3DH 2OQ0A 5JJIA 4A75A 1IBKQ 4JI1Q 1XJVA 2RCNA 3U58A 2BH2A 1CUKA 4QQBX 2E8GA 3B6YA 4OWWB 1WI5A 2NN6I 1N36Q 4DR2L 2JA8H 4JG2A 1XMQQ 1KQSA 1CSPA 1K8AC 2HIXA 4BY7H 3M4OH 2KENA 1EFWA 4JI0Q 3M3YH 1VQ6A 4APVA 1HZBA 2DUDA 4DR4L 4WJ3M 2EXDA 2ZTDA 1TWFH 3PSIA 2Y0SG 4GKJQ 3Q8DA 4HIOA 1JJGA 4A3CG 2CKZB 1N34Q 1EQRA 1FGUA 3U4ZA 5FLMH 4LF6L 4DV0Q 4YY3Q 1I5FA 4BA2I 2XGTA 1GVPA 3M4PA 1UEBA 2F52A 5IT9c 3M85A 3AFPA 4BBSH 1Q12A 2EIFA 4B3ML 1N33L 2UXBQ 1QZHA 1Q86C 3FKIG 2VS1A 1LTLA 1FVIA 1VQ7A 2UU9Q 1KRTA 2I0QA 4GN3B 3A5ZB 2R7FA 4A3LH 2R93H 1HR0Q 1IBLL 2JK8A 5C44G 5LMUQ 1PYBA 3DLLA 4LFBL 4A3KH 1G291 4PZ8A 4MZ9A 3F2DA 4KHZA 2MO1A 3J81i 2NZOA 5LMUL 4DV2L 1IBLQ 1KC8C 4A3EH 2UU9L 1PH9A 1AH9A 4LW1A 3HOXH 3RR5A 3RZDH 1NE3A 3G48A 4UP8A 1K0RA 3OTOQ 4AIMA 4DNIA 2OTJA 1HZCA 4IJLA 1Q82C 4YY3L 1OXUA 3S14H 1PFSA 1VQGA 2WAQE 1P8LA 3K81C 2GVBA 4A3JG 4KHPL 2YTYA 1C9OA 3K0XA 2I5MX 1E1OA 3HOUG 2K52A 4A3FH 1I94Q 4JBKA 2PI2A 3A74A 4R4OA 1Q1BA 5FJ8H 5GAEC 4HIKA 4OONA 3AFQA 5IYDH 1SE8A 5C3EH 4A4IA 4DR4Q 1SLJA 3BU2A 1NJIC 1HR0W 4C3IH 4WJ4A 4JI0L 4OXPA 1X3FA 4P73A 3T1HQ 5JJLA 4NXMQ 1UE5A 1WCMH 4JI6L 4EX5A 3PO2H 2D0PA 3W1BA 4DR2Q 4LF9Q 2HT1A 2R92H 2N8NA 3KF6A 4GOPB 2ALYB 1XTDA 4A76A 1N9WA 3UE1A 5EAYA 1Y1VG 3L0OA 1VQ4A 3HKSA 1BBWA 1PH7A 4JI3L 3I7FA 3JAMc 3GTQH 4JI1L 3FP9A 4C3HH 1CKOA 1SRUA 4A3DG 4K0KL 2IHFA 2HHHQ 3HKZG 3PO3H 2PI2E 1JMCA 3I56A 2K5VA 4LF5L 1R9TH 1BBUA 4A3MG 4UP9A 4JC0A 3DM3A 1SFOH 1M90C 2R6GA 3JAMi 3KJOA 1I50H 1PH5A 1HNZL 3CQZH 1BKBA 5LMNW 1KXLA 2E2HH 4IPGA 1EYGA 1X9NA 5DLQE 4X66Q 2VQFL 3TRZA 2Q2IA 1EOVA 4QL5A 1OTCA 3HOUH 5C0XI 1NMGA 3CCRA 2IX1A 5M5XH 4LF8Q 1XMOQ 4BA1I 3GTMH 1GKHA 2JE6I 5IY0A 3ICEA 3S1QH 3M9BA 2VZAA 4AYBG 2RHSB 3HOZG 1VQJA 2V1CC 1WCMG 4JI8L 1HNXQ 4B3RQ 3PIOA 1HNWQ 1QVGA 2CQOA 3STBC 3ZJYC 3G6EA 3CXCA 3A5UA 4GKKQ 4A3LG 2AHOB 3ERSX 4L5RC 1EIFA 4LUZA 4X65L 4DR1Q 1OXSC 3KDFA 4IPCA 2ES2A 1YZ6A 4BBSG 4JV5L 1W3SA 3F8TA 4AYBE 1OXXK 4JYAL 4GN5A 1LM0A 1PH2A 4DUYQ 4IFDI 1LYLA 4QY7A 4DR5Q 3I4NH 2HIVA 5C44H 1YHQA 1V1QA 3HOVH 1DGSA 2WB1G 1SMXA 3H0GH 1HJPA 2BA1A 4DAYB 4A3KG 4LF4Q 4GLAC 3CC4A 2IT1A 2VQEQ 1IXRA 1I3QH 1S72A 3PGZA 4EQ5A 1JJ2A 1VQBA 4IFDG 1XNRL 3J81j 3WWVA 1VQMA 1X55A 2JA9A 2JA5G 5HGQA 2UUBL 3PCOB 3S2DH 5K36G 1SR3A 1YBYA 2Z6KA 4QIWE 4DV5Q 1YHAA 3STBD 3CC7A 3PIPA 1KHIA 1J5EQ 1FJGL 1D7QA 4YWMA 3GTLH 1IZ6A 2Q2HA 3J80i 2ID0A 1AE2A 3ULLA 4J15A 4X64L 4Y7NH 1IBMQ 4B3SQ 4BXXH 4L5TA 4IPHA 3JC66 5ELNA 1N32L 2CWPA 2UUCL 2UXCQ 1YVCA 1Q1EA 1B7YB 5M5WH 3CW2C 2ZM6L 2AWOA 3K8AA 4L5QA 5FLMG 4DK6C 5C3EG 2JQOA 1TXYA 2GN5A 3KOJA 1TWHH 2A1AA 4LFAL 1QVFA 2JA6H 2JEAI 4R4IA 5M3FH 1S40A 2CCZA 3VDYA 3GO5A 1IYJB 3E9HA 4JI2L 3AQQA 5H1SE 4JI4Q 2A8VA 4GOPC 1Y1VH 3U50C 2NVTH 2WAQG 2L15A 3I4OA 5FLXc 3G71A 1PA6A 2OCEA 2WB1E 4JBWA 1YJWA 1PH1A 3CAMA 4NXNQ 5IYCH 1PHJA 4YCWA 2JA5H 3S16H 4DV7Q 2E2JH 1VQPA 5AJ3L
chains in the Genus database with same CATH superfamily
4OIJA 4ZKBB 1HH2P 2KEEA 2R3ZA 2F0IA 2F0LA 1RKNA 1PTOB 3SGIA 1CA6A 4YAKB 4GS3A 5C4XH 1PH6A 2D5DA 1IBMH 3GTOH 2D0OA 4PV1C 1ET6A 2ZM6Q 2UXDL 2JA7H 2WTFA 3GTGB 5JJKA 2BDNA 1B33N 1QWYA 5AFWA 3HOXG 2GVAA 3OSPA 2R8GA 2B63B 4UCSA 4O3OA 4DR3Q 5LMNQ 2XGPA 4ZQ3A 4DUZQ 1VS0A 4RGTA 2CFMA 4ECYA 4FVMA 4P75A 2K33A 4LJZC 5KFSA 2UUBQ 1RTOA 2HGSA 2Q8TA 4OX9L 4UCVA 1KDBA 1Y1WG 1A2UA 3HKZE 4C2MB 2CH4A 1XWEA 4QUCA 2CQYA 4UHVA 3PO3G 4B3TH 4GNXA 5BN4A 1T5EA 2ASDA 4DR5L 5IP9H 2R7NA 3K5MA 1QOHA 4JI2H 1PH4A 1HA6A 2A69D 1A6XA 1E22A 2A68D 2EVBA 2WIIB 4JV5Q 4LFAH 1GM5A 1CFMA 4TVAB 2XIWA 3BA8A 4LFCL 5KFDA 2F1MA 3A8JE 5C5LA 5IGFA 4V190 3UDFA 3VA7A 3NBHA 4MHEA 4JI8Q 4RNNA 3CP0A 1CSQA 2MHVA 1YI2A 4M7EA 2UXDQ 2B8FA 1L0YB 2OF1A 3KHLA 3TIGA 2C22A 3BABA 2E2IA 1CKNA 1KD1C 3MFHA 3A8IE 1D5ZC 4A3JH 1X3EA 1E4GT 1Q7YC 2BQ3A 3DM1A 1VQ5A 4UDUC 1DIKA 5KG1A 4BY1G 4DV4Q 4EBCA 4OIKA 4F4YA 1LV9A 4QCLA 1AE3A 4APMA 4OWXB 4YY3H 1W6KA 2NUAB 1ASYA 1AUVA 1PYSB 4NP5A 1F9PA 3R23A 2F4VQ 4C3JG 4ODGA 5BR8L 5AJ3Q 1V1OA 3T1YL 4JV5H 1BXRA 3SE0A 2EE1A 3VMMA 4P71A 1A3TA 4P2CB 4NXNL 2R8IA 4JVZA 3TS0A 1L0WA 3Q1KA 3GTGA 1EU4A 1C8CA 1Q8IA 2UXDH 2J6SA 4PZ6A 4KHPH 1JB3A 1F2YA 3EBEA 3GV8B 2WV6D 5IP7H 1EWHA 2NVYH 3EJIA 2KEDA 2R6FA 1WJJA 1WD1A 1MGSA 4DPGA 4C3JB 2B63G 5DGBA 1EY7A 1OXTA 1CT1D 2YTXA 4N9PA 1N32H 4LAAA 4DR5H 2F0FA 2EYOA 4A3IG 2RSOA 1V43A 3W5OA 4GNXB 3HP3A 3PUZA 3S15H 2WB1A 3OMCA 2WAQA 1JR0D 4QWEA 1SYGA 1WTPA 1D6EC 3LWUA 1FNUA 3CCMA 3LNNA 1I6VC 4ME6A 5KFEA 2IHEA 5EGTA 4IUQA 4WFN3 3NTKA 2K32A 4B3TL 4I4TF 1S9FA 1SYFA 2QEJC 1XMOH 3NBHB 4OL7A 3CPWA 4A3BH 2IPKD 3RN5A 5I9PA 1H9MA 1MSGA 2C9OA 1JB7A 1B44D 3N43B 1SDFA 4R4TA 4O4HF 2E2HB 1W6JA 2CQAA 1CKNB 1E1TA 3IFTA 4X66L 1OXVA 4X62Q 2OWOA 1TWCB 1WYDA 5FD5A 1K73C 1B8AA 1HNWL 1IYVA 1ML0D 2FPGB 5CBEE 3VYUA 5JEAG 3LGJA 3HOYH 4A93H 3S14B 2DJGC 1A3UA 4J9PA 2LXJA 4QJFA 3MAQA 4BBRH 4B9WA 2ICIA 1O7LA 5CB4F 1SSOA 4K0KQ 4MIUA 1V9PA 1TWGA 3PN1A 3TP6A 4HJ5A 1N56A 2ASBA 2R93G 5LP6F 4CKBA 4E6IA 2ASJA 4DV3L 1PVOA 3NP8A 1I4RA 5D65A 4ZRZA 2EYLA 3CC2A 1KL9A 4I65A 3S9WA 1EQVA 1TWGH 2VNUD 3N6RA 4J8QA 2YW2A 3N6XA 1VCIA 3NENA 3R93A 4TSSA 4ZAIA 4FXKC 4C5AA 5KFKA 2JA7A 1E4EA 4F8MA 4NXML 1XPRA 5KT4A 1B70B 1ZEQX 1CE8A 3T56B 2UXCL 4QWBA 4OHJA 1WCMB 1LUZA 1O75A 2WINB 4AYBB 3SE7A 4UCUA 4CDFC 4KHPQ 2IW3A 5FLXL 4QGUA 4RB0A 5D1OA 1C4QA 4DV6Q 1JXLA 3SI8A 1EOTA 5IE8A 3CCJA 3MFYA 1HR0L 3QOJA 4EQNA 5GADC 2BA0A 2K4KA 3MEHA 2QW7A 1X3PA 4FDBA 5FK9C 1M1KC 3GIJA 2QF7A 3S2HB 1P16A 1F9SA 3GTJB 2A6HC 3RGXA 3K7AH 1LACA 4LSXA 1JJCB 4RG1A 2FMMA 2JYOA 4DV2Q 2WP8J 4EYIB 3K7AB 4QIWA 5DLFA 2EYPA 1G2TA 2C2DA 1Y1VB 3MEFA 3G6VA 2M00A 4DV0H 4FNFA 1G6PA 2OXPA 4BY7B 4RWSC 1XPOA 1JWUD 5C0XJ 2R93B 1I6HH 1B2TA 1X3QA 2R7LA 4B3MQ 1TWCA 5KFCA 3TP5A 4NXMH 3CRKC 1CZWA 1MBYA 3QJYA 1NNXA 2KHSA 4I7AA 4U68A 1HNXL 3RNUA 2W7PA 2VUMB 3AYHB 3S1RH 1D5MC 3IRBA 4LF8L 3GTPB 2XRQD 5IODA 4DV6H 1MJCA 2N78A 4RGMA 1I7LA 3QOLA 2XTIA 4CDEC 2VQFQ 4HIMA 1E4EB 5C1OA 1KBLA 5E4XA 1S3OA 3S1RB 4XT3B 1YIJA 1C0AA 4DR7L 2C2EA 1UC8A 4PMWA 4RKBA 3I4NG 1LTGD 4C3HB 4DK0A 2AWNA 3HOVG 4ECXA 5EBCA 2E2IH 1KLUD 3E6ZX 2WDTA 4RMFA 4U673 4X3UA 4KY7A 1XJVA 4XYMB 4QQBX 4IWXA 4ZUJA 1LABA 3ONAB 1K1QA 5C44B 4HQ6A 3B6YA 3NWTA 2NN6I 2JA8H 4DR2L 2W71A 3C46A 4R8UA 1BCPF 2JA7B 1M7JA 1BDOA 2JA8B 4JI0Q 3M3YH 1S0MA 1VQ6A 4LSAA 4KK7A 1G91A 2LS01 2NVTB 3OMGA 4HIOA 3QR8A 5CC4A 2F0GA 4A3CG 2W9AA 4ED8A 3M3YB 5J1ZA 4LF6L 3P7JA 3S1NB 5KYIA 2KCCA 1N48A 3M4PA 3M85A 4BBSH 3C0FB 3AFPA 1JKJB 1N33L 4M1UB 4ZK9B 3QFFA 2Q8IB 2VS1A 5KFLA 5FOBB 2I0QA 4A3LH 4DV4H 2R93H 1CZGA 2L9HA 5DEHA 2PCFB 1PYBA 2XN9C 3J81L 4LFBL 4ZQIA 3OHAA 5C6AA 2PZTA 4MZ9A 4KHZA 2D2CC 1WVLA 4DV2L 2EY5A 3FPUB 4A3EH 4EQPA 3TP7A 2AQ4A 4LW1A 2WKCA 2TSSA 2HCCA 3VR5A 3HOXH 4KN4C 1IW7C 1Y8PB 1FR3A 2MP1A 1ZQ7A 4O2AF 2PZUA 3PIO3 3OTOQ 4G7OC 1ULZA 4DNIA 1IYUA 1HZCA 1Y8NB 2A73B 3FMAA 3M9OB 2WAQE 1P8LA 3K81C 4LK1C 2EYJA 3NQTA 2YTYA 4LMQD 4ZCKA 3OPOA 3BDOA 4R4OA 3AMUA 4HIKA 1A9XA 3AFQA 1SE8A 5C3EH 4WJ4A 2R7KA 3T1HQ 4NXMQ 5JJZA 4JI6L 1TWFA 1YNJD 4DR2Q 5LYJF 1KNAA 4A3BB 2FKLA 2HDMA 2NYZD 3R2IA 1XTDA 4DLKA 1Q90A 3IL8A 1Y1VG 2GA4B 1F2ZA 2R7MA 2UVVA 2M2LA 2Q8RE 1PTOF 1STNA 3CKIB 3HKZG 5FD6A 2F0TA 4OGQC 3I56A 4IZ8A 2CW0C 4LF5L 3RB4A 2BE5C 1M4VA 2W6OA 2R6GA 3JAMi 3KJOA 3GTLA 3FDTA 1BKBA 3L9AX 4I7HA 4ECZA 2E74C 2E2HH 3NTIA 2F0SA 5EJWA 3VR3A 4I50F 1X9NA 4RB3C 3R5FA 2UVWA 4EVOA 2Q2IA 3PO3B 1EOVA 1O7YA 4QL5A 4DXFA 3CCRA 5DQGA 1GUNA 1KABA 2IX1A 5M5XH 3GTMH 1QB5D 1CHQD 4BA1I 1RCVD 1XMOQ 2UU9H 1EYCA 4ECVA 5KFRA 5LMUH 3HOZG 1VQJA 2B2VC 1HNXQ 2VOBA 3GILA 2N55A 1QVGA 3ZJYC 3G6EA 1JC7A 3DWQA 4K5VA 3A5UA 4GKKH 1EIFA 1K3BC 5D14A 4DL6A 3TZDA 4IPCA 1I4QA 3RZDB 4JYAL 4GN5A 3Q8PB 1GXDC 1PH2A 3A54A 4DUYQ 1GHKA 4IFDI 4QY7A 3F8NA 4UAIA 3I4NH 3P20A 5C44H 3F2UA 1V1QA 1YHQA 3HOVH 3H0GH 4YIJA 2VPQA 3CC4A 3TIIA 2IT1A 1WH2A 4RAYA 2IBKA 1I3QH 3VYRA 4EQ5A 4M8AA 4Q45A 3WWVA 1VQMA 2JA9A 4DF7A 4EEQA 4QWDA 4DV5Q 4IN3A 1A3VA 2PO4A 3STBD 5HURA 5A2QL 1KHIA 3CC7A 1FJGL 1ZHQA 2VXWA 4KMUC 4M9UA 2Q2HA 4X64L 1AE2A 1VMPA 4B3SQ 4QW8A 3EQLC 4L5TA 3PR4A 2XVSA 2B2TC 3JC66 4OX9H 4HSPA 2RKSA 2IP4A 1VAJA 4G57A 2UUCL 3M9NB 4ECTA 2K01A 4IRDA 3JSNA 4DK6C 1SEIA 1TWHH 2A1AA 1Y1WA 4K2KA 4R4IA 3NQIA 2PN1A 4YAJB 1PMRA 3TZUA 1IYJB 3E9HA 3AQQA 3T51B 5JAVA 5CA0F 2W7OA 2BOSA 2NVTH 2WAQG 3G71A 1BUVT 3GIMA 3Q2OA 4NXNQ 2JA5H 2D9UA 4YCWA 5CV5A 2XD4A 2B2YA 4RA8A 1EEFD 2JA5B 1VQPA 3KK7A 2YV5A 4YHHL 2F4VL 2FK3A 2J9GA 4K8IA 2K5HA 1BVSA 2H5XA 4ZLTF 4ZYSA 5KFQA 4F50A 2R8JA 3RN2A 3M4QA 3Q23A 4MTDA 3BYTB 1BR9A 1SN8A 4IR9A 3S17H 1BCPC 5DLGA 2KVMA 5EKKA 3RZOH 1EYAA 1O7IA 3W2DA 1LT6D 1DD2A 1Z2PX 3QWNA 4LF7H 3K5LA 2FK2A 2PW5A 1KJ8A 1HQRD 2Z0SA 4OO1I 4DGZA 4CJ1B 4X62L 1QUQB 1Y14B 5M5YB 1B04A 4A2AA 3L2PA 2EPBA 3OYYA 3KDFB 2HQLA 4JI5H 1HZ9A 2ICEC 3J81c 5C4JH 1EY8A 3CMEA 1NUCA 2LSSA 2MFIA 5M5YH 1UC9A 1L2ZA 1S5BD 3GTJA 2D62A 2PNHA 3H6MA 2BH8A 2J0TD 1EUJA 1IBKH 3EFXD 3HGBA 4AH6A 3BJUA 4B3TQ 3GIPA 4LFCQ 4EFBA 2FPPB 2JEJA 3RLOA 1E0BA 1QILA 2AQ1B 2VA3A 2NVXB 1B1ZA 2NZ1D 3FHWA 5BR8H 3T1YH 1HNWH 4XDXA 1DOKA 2WACA 2K05A 4YWLA 3PQIA 4RUAA 1SNDA 3TS2A 1CQFA 1F77A 5IYBG 2YZGA 3PF5A 1XXGA 4PWQA 4LNQA 3V4ZA 3H91A 5F9LA 4Q5VA 1JQYD 5KEEA 3MZ5A 1AZPA 4IRCA 3U9OA 4IJHA 2Q2TA 4UCRA 1SYEA 2KJXA 4H0LC 3BZCA 4IFDJ 3CCSA 2XWJB 3I4MG 3JRWA 4BXXG 1TQOA 3WO0A 3MXNA 1KIXA 1MSHA 3T1HH 2N3SA 3K57A 4JI5Q 2E2JB 4Q44A 4R4CA 1S5DD 5LMNL 1OWTA 1VQDA 1QE6A 3GTPH 5D1PA 1S0OA 3RTXA 5KG6A 5T14A 3P1HA 2F0JA 3J7AF 2FLPA 2IMWP 3G4SA 1TWAB 4YJ2F 4A3IB 3KHRA 2HHHL 4HR7A 5TSSA 3KYHC 4A3IH 4RGOS 3EA6A 2JA6B 3N8DA 3H0GG 5KT6A 5BR8Q 3T1YQ 2ZXRA 4JYAH 2K14A 2ZJTA 5FPOA 4PG3A 3T4AC 2VQDA 2C28A 4DV7L 2R8HA 1Y8OB 4JI6Q 2YU9H 1JLLB 1WTVA 5C4HA 2E5LL 1EYDA 3CMAA 3S1MB 4IFDH 1ZETA 1HUNA 4CHTB 4JI2Q 4JI7L 3OHXC 4RFBA 2L11A 3CD6A 4F4XA 4LFAQ 3O13A 1J5EL 1JE5A 1UE1A 2K04A 4A3GH 1A63A 5M3FG 1ET9A 1HRJA 3A0JA 1N32Q 2V58A 5J3BA 3MFGA 3U9SA 1AEXA 2R82A 4Y8VB 3H4DA 4DUYH 2B29A 1EZ6A 4TKOB 4HJ8A 4X3TA 3V6JA 3J7AK 3KHGA 2YL2A 4DXGA 1F2MA 4MN3A 2AQ3B 3BVZA 4LFBQ 4ZHQF 1STBA 2ZXPA 4BY1B 1DZ1A 5T1IA 4ILWA 4KV6A 3D0FA 3GTMA 3ORQA 2RA4A 1D8LA 5J39A 1LTRD 5C4XG 5L1KA 1TY0A 4FBTA 1I4HA 4N9TA 1LTAD 1BO0A 4OX9Q 2KBNA 1VQAA 4LUOA 3H15A 4LF6Q 4LMYA 5M5WB 2P0AA 5JVLA 3UDXA 3F2CA 5IIFA 3KJPA 1S5FD 4H02A 2L0CA 4C56C 4RGNA 4DUZL 2QDLA 2M05A 4U6PA 1KRSA 4YP3A 2DY7A 3MTSA 1SNMA 1VQFA 2QA4A 3J7ZC 1EWCA 1Q3LA 2NN6G 4B3RL 5F2DA 3C1EA 4IR1A 2PW7A 3WDNA 3J7A5 3BA9A 4NB3A 5BMVF 4LF5Q 5HV6A 3GQBA 3NUCA 3BZDB 2R7ZH 1D2BA 3NSWA 2CZGA 4IWYA 1H9RA 4GLXA 3HKZA 2ZDQA 2ZJQA 2B3GA 2H4OA 2R7DA 2Z4IA 3RB6A 4A3EG 1VQ8A 4RZQA 5EPKA 5KFFA 2J6UA 4EEYA 1KAAA 1K3RA 2OQKA 3H0GA 3OUZA 3BQ0A 5E1FA 5J22A 4XYQA 3I55A 2O5IC 1WTOA 2E75C 1HTPA 3DF7A 1CQIB 4O3RA 2LKVA 2EY6A 3MXNB 5EWFA 1TS3A 1I94L 5DQIA 1AZQA 1B3AA 3N41B 4GN4B 1T94A 1JOQA 2VR1A 1FKAH 4EBEA 2YS6A 5FLXE 3DHQA 4TQUS 4N8FA 3PZPA 2YZNA 3GP7A 2IA6A 3UQ8A 5GAGC 3UI2A 2KA7A 4UCOA 4PNYA 4A2BA 1LT5D 2IJ0A 4YCVA 1CQVA 1E3PA 1UWVA 4EGQA 5LL6b 2AGPA 3PO2G 2EDGA 2SEBD 2Q2UA 5KGUA 4FU0A 3W1GA 2O5JC 1EIGA 2CWAA 1IL2A 2I07B 3MXPA 2X6GA 4UP7A 3EPGA 1HXYD 5A2QW 1Y1VA 3TSSA 3HOVB 4C3HG 3I4NB 4NPSA 3D3RA 3D6CA 3NXWA 4LWCA 1N33Q 2ZDGA 1TT2A 3S15B 2XWBB 1BF4A 3JSLA 3I4LA 4DV1L 1A2TA 1QNKA 3G6JB 4KD4A 5H80A 2A6EC 4Y52H 4RH6A 5C4JB 4FXDA 4A3BG 3LMLA 1ZXTA 4CBVA 1DM0B 1GJXA 1VQIA 1WFQA 1RJQA 1B4OA 2MJ8A 1A0IA 1YHBA 5LL6X 2K28A 3VPCA 4DV0L 3CCLA 2DY8A 4A3FG 3KBXA 3K58A 1N34L 5GAHC 4A3GG 2QK4A 3V6KA 1EL0A 2SNSA 1YJNA 3GDEA 2KHIA 1QVCA 4F88A 4WD3A 4XT1B 4QW9A 3M7NA 4QMGA 1H95A 2F03A 4HSVA 2RSNA 4XIGS 2X69A 1XNQL 1E2ZA 4AQYH 2J6TA 1SE3A 2RBMA 5L1JA 4DL5A 3MR3A 4DR7Q 1GLVA 4JBJA 4JI6H 2PQAB 3E5SA 3SK8A 2R92G 4RNOA 3RB0A 4A75A 1IBKQ 2FPIB 3ORRA 2F0NA 3H09A 1CUKA 4LFCH 3CU7A 2K1BA 1WI5A 4DR1H 1N36Q 3M4OB 3G7LA 1KQSA 5IOCA 4BY7H 5CBAE 3M4OH 2F0EA 2KENA 2K6AA 4Z9CB 3KHHA 1HZBA 2ZTDA 4PDBA 4KY6A 4GKJQ 3Q8DA 1JJGA 4TRDA 2B39A 1EFID 1WTWA 4R7RA 3TQTA 1VKZA 4DV0Q 4MV9A 2XGTA 4NDXA 1GVPA 1UEBA 1UEAB 3ND9A 2X0SA 1Q12A 2F4IA 3K5IA 4LFBH 2HUGA 3BYYB 1QZHA 2DLNA 4WRDA 1LTLA 1FVIA 2UU9Q 4LF9H 3A5ZB 2R7FA 3GTKB 3AU7A 4RHRA 3LWBA 1HR0Q 1B6RA 2JK8A 3MWMA 5LMUQ 3DLLA 5EPJA 4A3KH 1G291 4PZ8A 1DV2A 1GSOA 3T13A 5KT3A 1PTOH 4C5BA 1PRTC 1SFOA 5JPNC 4LF6H 5BN5A 1TVXA 4XQNA 4B9XA 5M3MB 1K0SA 5JVH3 1CI3M 1NE3A 4RCOA 4UP8A 1N33H 1I4PA 1EIHA 4RNMA 3PR5B 1Q82C 1H9SA 5LXTF 4YY3L 1PRTF 4A3JG 1PDQA 1AW7A 3H4BA 2F0KA 2K52A 2RDJA 5I6YA 2QILA 4DR4Q 5C8YF 1Z6HA 4ECUA 1NJIC 3VYSA 4OXPA 4P73A 2NU6B 2R8KA 4EX5A 3V4SA 3PO2H 3W1BA 4LF9Q 5GONF 5DQHA 2ALYB 3I4MB 3FKIB 3I72A 4FBUA 4A76A 5IYZF 4Q8FA 5EAYA 3I12A 3ZYYX 4Q43A 3PW5A 3JAME 4C3HH 1S0NA 1U9RA 4A3DG 2PI2E 1DCZA 3K5HA 2K5VA 2TMPA 2ATLA 4A3MG 4UP9A 1SFOH 3DM3A 5KG4A 3GTQA 2A6HD 2L1BA 1PH5A 3S1QB 4L1KA 2W9CA 5EWGA 3CQZH 1PTOC 5IT9E 4ED3A 2NU7B 4FF4A 1EYGA 5IT9W 1FNWA 5CV6A 1BNZA 4X66Q 2YYAA 3HOUH 1NMGA 2HJWA 1K83B 5G3LD 1GKHA 2JE6I 2SNMA 3X3NA 4DA2A 1KJQA 3QG1A 4LF8H 2KCNA 2QDBA 3ICEA 1WR2A 3QB3A 3GTOB 2R87A 4JI8L 1WCMG 4JV1A 4FM9A 2CQOA 3OIQA 5FO9B 2VB3X 1S4ZA 3CXCA 4G7HC 5I2YA 4GKKQ 2AHOB 3ERSX 1IBLH 1WCMA 1OXSC 4NMZA 4H13C 4JV5L 4BBSG 1W3SA 3F8TA 1OXXK 4JI8H 1LM0A 5G3LF 3JAMW 4U7CA 2PMZB 4HCSA 3DMUA 1S10A 1XTCD 4XX0B 1ICWA 2WB1G 4DAYB 3RBEA 4GLAC 4R8IA 4ZKCB 5KG2A 1PXUA 2W70A 3LWEA 1JJ2A 1VQBA 4IFDG 5LA6F 1XNRL 4CDCC 3J81j 2RGRA 1QCBD 2HCIA 1IKLA 5ELDA 2JA5G 3PCOB 1SR3A 2Z6KA 4A3EB 2BH2A 5KX5F 1YHAA 1D7QA 3HOYB 3RMHA 4YWMA 4A93B 1HFNA 4ZOLF 5C1PA 1Z7TA 3ULLA 3J80i 2ID0A 1LTSD 1RHPA 3JZIA 1R9TA 3GTQB 3TMEA 5KYLA 3SK5A 4DL3A 2CWPA 1JX4A 1Q1EA 1ICFB 1B7YB 3WOEA 5M5WH 3RV3A 2ZM6L 3R3OA 3BQ2A 1G6ZA 4H7BA 2JA6H 4HAEA 1QVFA 4JK1C 3KLSA 5ELFA 4XYLB 3QZ8A 1BCPD 3VDYA 3GO5A 5KG0A 4YB8B 4JPBW 4FS2A 2CHBD 4DR7H 4QWCA 3GIIA 4GOPC 3Q24A 2W6MA 4JBWA 4IALA 2FINB 3L4KA 4X3SA 4PQXA 3CAMA 3S16H 2W9CB 5JH7F 2B2VA 1B6SA 3NHHA 5L37A 1QUQA 3J80L 1MJEA 1CTMA 1IKMA 1SNCA 2N88A 2L4NA 1EY6A 2F0OA 2I80A 4G3IA 2JP1A 2NVYA 2KECA 3I90A 1JORA 2W8LA 4HJ7A 1IBML 2IX0A 3HS0C 4KKTA 2JXMB 1ONLA 1VF7A 4EQOA 5BPFA 5K36G 4XZ3B 2K5NA 4Q0FA 1PLFA 3HOZH 3UDGA 4AQYL 1TS2A 3GTGH 5KFUA 4EGJA 3PUXA 4WJWA 2K5WA 3HOZB 4R8NA 1XNRQ 1EEID 3FVQA 1HR0H 5KRUA 5IYCG 4DL7A 1DJRD 1NR2A 2KCMA 4BWGB 3PUWA 1SNQA 1UE6A 2PMZE 3I73A 2L55A 2NBFA 1OO9B 5CV9A 2DJFC 2LY7A 2ZXOA 1Q46A 1R4QB 1X56A 5ELOA 3H0GB 5C5MA 4DR1L 4AQYQ 2UUAL 4MA5A 5C3EB 4ZUIA 2HVRA 1KNEA 2DNEA 1SE4A 4XQQA 1PYWD 1VDZA 4HJ9A 4K0KH 3K80C 1X6OA 2SOBA 4YR0A 4QF4A 2ZJRA 1W96A 1SXTA 5JOBA 1M6VA 3E5NA 2NUCA 4KTAA 2NU8B 3J80E 4JW0A 1L1OC 2R7ZA 2MUYA 3U4VA 4KI0A 5FO7B 1ZKOA 2W8KA 4RCNA 2C35B 3OW7A 1XYIA 4RZRA 2DIKA 1MHWC 3L7ZC 3KTMA 2XGQA 1U4PA 3URYA 4GKJH 4S3SA 3AB9A 2I46A 2A68C 3HOUB 4BBRG 3N44B 5KFBA 2E5LQ 3BG5A 4GLVB 4LF7Q 2MNAA 5KG7A 4HJAA 4C3IG 3MVVA 4A3KB 4X64H 1SROA 4OWTB 1I3QA 4J9NA 2QEXA 4JI3Q 2Z6KC 1UNSA 1R9TB 4XYOA 3PF4A 1GHJA 1LT3D 4YQWA 3ER0A 1C30A 1JT8A 3FPPA 5FKAC 3S2DB 4OO1H 3EN2A 3BS1A 4JBMA 1B3QA 1PRTB 4MV1A 1KDCA 2WFWA 4JOIC 1EIYB 1SYDA 3QO2A 3TEHB 2VY3A 2OLSA 1SAPA 4UPAA 1K8OA 3DEOA 3C2PA 4JI5L 1C48A 1TWGB 4HMIA 4QIWB 2KCTA 1K9MC 1GUSA 1PV4A 3K0YA 3S17B 3IG0A 3HZXA 2UUAH 3JRXA 3Q22A 3Q8RB 5IT9L 1ILQA 3GIKA 3RLFA 2W6NA 2JA6G 5EZYF 2BR0A 1HA5A 1T9HA 2UVUA 3UE0A 4ABNA 1VQNA 1Y1WH 4X64Q 1D5XC 5C0XH 5GQOA 4R1JA 1HNZH 4DR4H 4RHSA 2C5CA 2ZTEA 3D6WA 2A19A 1EY4A 3IN5A 1SFOB 4DV5L 1V8QA 3TREA 5KFWA 4ECSA 5KNCA 2RF4A 3S24A 1G8ZD 5CA1F 2OEOA 2RDFA 2UXBL 3RLNA 2P5ZX 4LF4L 4UY8C 3CRLC 3TQYA 4RAZA 4DNRB 1I3QB 1K83H 1IOVA 1LTID 1SMYD 3ULJA 2V5AA 3HRZC 1SEBD 4JYAQ 4TQSA 5I2XA 4MAMA 4TUYF 4DR6Q 1H9KA 1ZYRC 1L2FA 5E3FA 1QNUA 1EHIA 5KFMA 3UDIA 5KFPA 3Q8QB 4O3SA 2KSWA 1RF2D 2RDGA 3VYTA 2Y0SE 2RVLA 2SCUB 2WKDA 5KNBA 1N36L 3RIZA 4BY1H 1STHA 2OT2A 4R4QA 4UFZA 5KFGA 2AUKA 2YTVA 4YR3A 3FKIH 2FMAA 1GYFA 3FDSA 3K59A 1G51A 1IBKL 1JE4A 2B8GA 3KXYT 1VQOA 3KAJA 2NU9B 1X3GA 1J9OA 4ED6A 1JOKA 4DL2A 2G5DA 4J6HA 1XNQQ 4CJ0B 2YRWA 3OUUA 1TWHA 2R93A 1WD0A 4JI7H 4JCVE 3KFUA 2E2IB 2NTTA 1JWMD 2L12A 2WB1B 2KQ3A 5EBDA 1TWAH 4O3PA 2A69C 3N40P 1K83A 1WTHA 4P74A 3NTHA 5BN3A 3RBDA 5DG9A 1N8RC 1SJHD 2CW8A 3MR2A 1DYQA 3S1MH 2MCTA 5IP7G 2AKWB 3QIAA 3BVMA 4DAPA 2JA8G 4DNTB 4IAJA 2JA7G 3E0JA 5ELEA 2JEBI 4MV6A 3Q8SB 4A3CH 1AFPA 1U0LA 1XNRH 2HQEA 2RCFA 1YNJC 4B3SL 1TS4A 3M4IA 5HBRB 3MFIA 1IOWA 4IUNA 4DV1Q 3EYYA 2WAQB 4FP5D 1DONA 3KLWA 3V2TA 3OTOL 1EQQA 2FE3A 4EBDA 2EY1A 1PX2A 2WE6A 1PH3A 1JDBB 3AEVA 2JN4A 2BQRA 2BE5D 2BDOA 5CMDA 2V4DA 1PZJD 3OIPA 2VW9A 4X65H 4A3MB 4LF5H 1C7YA 2IY5B 1Q81C 1JWSD 2B2YC 3RAQA 2V59A 2XSCA 1M0WA 1SYCA 3NPPA 3CCEA 3CCQA 3I2ZA 2VUMG 4DK3C 4CKEA 2GPWA 2K03A 2DN8A 5LL6S 4RB1A 1VBGA 1XMQH 1XX8A 5CORA 2L5TA 4DAYA 1YNXA 4FF2A 2W57A 3T5HA 3D31A 4BY7G 4C2MH 3BZKA 1MD2D 5IYDG 2AGQA 4IPDA 3MWYW 5JEAH 2AGOA 3HB9A 2H1EA 1SNOA 4O4IF 3N42B 4UCTA 2AMCB 1ENCA 1LTBD 2PYKA 1Z9FA 2MQHA 1WOCA 1GOZA 1UE7A 1TA8A 3I91A 1WTRA 4MNOA 3RV4A 3GQCA 2FJ2A 4N8X1 1HNZQ 1XMQL 2R86A 3WOFA 2F0VA 2I5LX 1S5ED 5IWAQ 1BJTA 1YNND 1VQCA 3BDCA 2XIGA 1ENFA 3KALA 3EVQA 5JJIA 2QCPX 5C4XB 4L8JA 5M9OA 3H3VC 1AUXA 1BQQT 1RJRA 1UUPA 4ME5A 4OWWB 5KFXA 2F0WA 1XMQQ 1EQTA 1EFWA 5J2TF 2EYMA 2Z9HA 3PW0A 4WJ3M 3SVMA 4ED7A 1TWFH 1STEA 2V9WA 1K28A 1BCPB 1GGOA 3VR6A 2NN6H 2EXZA 1PZID 1EQRA 3U4ZA 4MTEA 3CHBD 4GZYC 3R5XA 1EY5A 5D1OB 2EY2A 3WO1A 4CC6A 1HCZA 1TWHB 2F52A 4QUFA 2KOLA 5I9OA 4X66H 2EIFA 1TS5A 4B3ML 2F0MA 1Q86C 3FKIG 4HR7B 4K8JA 3U9TA 3ETHA 4ULLA 1VQ7A 2IWHA 1JCKB 4BS9A 4GN3B 5I4DA 1IBLL 5C44G 5JVDF 2E5LH 4Y7NB 2FFKB 2ALZA 3F2DA 2MO1A 4MV4A 4IZOA 3BQ1A 1IBLQ 5I6WA 1RTNA 1KC8C 1AH9A 3TDQA 4F7XA 4IHJF 4IUTA 1HQMC 4MTKA 2VPSA 3VPDA 3RZDH 3G48A 2R7ZB 1DOMA 2BCOA 3KLRA 4AIMA 5KFVA 4IJLA 5CR3A 2R92A 1PFSA 1VQGA 2PBZA 2CW0D 1WSCA 2JA5A 2GVBA 4KHPL 3K0XA 1C9OA 3HOUG 3MXGA 1PTOD 5DAUA 1I94Q 2PI2A 3OWEB 5FJ8H 4JBKA 4QWAA 2R61A 4OONA 5COYA 3M7GA 3HOWB 2O03A 5JJLA 4JI1H 4JI0L 3KBGA 3K3PA 5JUMA 1WCMH 4Q0YA 2D0PA 1LTTD 4ED0A 2A74C 2HT1A 3BG3A 3KF6A 5DM63 4MV7A 1XNQH 3HKSA 3JAMc 2CW7A 5KFHA 1BGWA 1CKOA 1SRUA 2CVRA 2HHHQ 3PO3H 3KAKA 1PK8A 5KFOA 1JMCA 3EROA 3J7YW 3RJ0A 4DK1A 1R9TH 1STYA 1M90C 4JC0A 4GC7A 2EJFC 4LF4H 4KKUA 1N34H 1HNZL 2VUMA 2EYFA 3NK9A 5C3WA 1KXLA 1E4FT 1X32A 2VQFH 4GC6A 5LHY1 5E4WC 3D4RA 5DLQE 2EJGC 2VQFL 3A8KE 1CK1A 1F2LA 1OTCA 1AP0A 1RYRA 4LF8Q 2NVXA 3KUPA 5IY0A 1PFNA 3M9BA 3SXHA 2XCAA 2VZAA 4AYBG 3PW7A 4K14A 3E3XA 3PIOA 1HNWQ 4DFAA 2UXCH 3STBC 4DR6H 4KKSA 1H9JA 4DN4M 1B9MA 1Z2NX 4A3LG 4L5RC 2VB2X 3CVZA 3RGZA 4DL4A 3KDFA 1YZ6A 1EU3A 1FD7D 4AYBE 3VPBA 5IGGA 1LYLA 2Z6BA 2F0QA 4I7ZC 4R8UB 2FLLA 2W6ZA 2HIVA 3TP8A 1SMXA 2RDIA 2BA1A 4LF4Q 1II3A 1IXRA 1TR5A 3PGZA 3NWSA 1X55A 4FF1A 5HGQA 3KLSX 1HHVA 2PPBC 3RAXA 3NE5B 1BOSA 1BBXC 1J5EQ 1V4YA 2E2HA 4YJ3F 4KJNA 3BAAA 4O42A 1SYBA 3MC0B 1IZ6A 4JI7Q 1NAPA 5IGCA 1KJIA 5KG5A 3SR1A 1JIHA 4IPHA 5ELNA 1V51A 2FJZA 3M4YA 2GLTA 2RDHA 4R9WA 3GV3A 1QG7A 1U4LA 2UXCQ 3L3OC 3SHLA 2B2WC 3R2TA 3K8AA 4L5QA 3J80W 5C3EG 2JQOA 1TXYA 3KOJA 1GSHA 2JEAI 5FPRA 4ID6A 3DWPA 2AUJD 3GV6A 1I6HB 1UAPA 2W9BB 3ETJA 5J2UF 3J7AV 5H1SE 4JI4Q 2Z4HA 2K7VA 1SNPA 3HG9A 1Y1VH 3I4OA 2L15A 1KDAA 3SEBA 5KIXA 5FLXc 1PA6A 2OCEA 2F3VA 2WB1E 1EY9A 1PH1A 1HFGA 5IYCH 1PHJA 3RUPA 4NKLA 4RAUC 2E2JH 2JA6A 1SE2A 5AJ3L 4F4WA 2ZDHA 2JJQA 1YITA 5EKIA 5GROA 3H3VI 3H94A 3MA2B 5L1LA 2F3WA 1C3OA 5KNDA 3NELA 4DR2H 2QGQA 3MWDA 1LT4D 1EZ1A 1RJPA 3HOXB 4JI3H 4X6AH 1IW7D 3T5KA 4K5XA 4DV4L 1RL2A 3GD7A 3HFZB 2B2UA 5D3DA 2FK1A 4C2MA 2PQEA 4L5SA 4ZI7F 3TN2A 2W6PA 1NTGA 5KT2A 4YBZB 1KAWA 3ULPA 5FJ8G 1VQHA 4DR6L 1FJGQ 4POGA 4EGVA 4HIDA 4DV3H 3D4WA 1RK5A 4LUVA 4J9SA 3PMFA 4IRKA 1TIID 2F0PA 4HN7A 4NW2A 5CV7A 3E9IA 2JEFA 1GD7A 4YWKA 3W3AA 1RIPA 5T1GA 4A3MH 3H3VH 3S16B 2UUAQ 1MZBA 1XPUA 2F0DA 2R84A 3A7AB 2MO0A 5K5PA 2IX3A 1ESRA 4PMCA 2ATWA 5E7NA 3OW2A 1CKMA 2HDLA 2LFNA 4O1NA 2KUMA 4A3DB 1B50A 3RB3A 4IUUA 4NLGA 4Q8EA 4BBRB 3J81E 5BPHA 1Y69U 5KFNA 5ISRA 1XMOL 4KY5A 4C5CA 3TQ1A 3T53B 1QZGA 3HOYG 3BVGA 1H9SB 3Q0AA 4A93G 3CPFA 2RHQB 2K5QA 4YHHQ 5DNFA 2XC9A 2W9BA 2B2UC 1TAEA 1TKWB 5F9NA 3V6HA 4H44C 4C1NI 2NWGA 2EQSA 4HTHA 2PVPA 2K5DA 2K75A 4GNXC 5EQ0A 4B08A 4J9LA 1GUTA 5IP9G 1S68A 3PUYA 5ELCA 4JI4L 4JOIA 2R7ZG 5C4ZA 2EZVA 2VUMH 4WBNF 3VR4A 3GTPA 2V4QA 3PUVA 1GUOA 2A6ED 1BNCA 3UFXB 1TU2B 4POFA 5CGKA 1EYZA 1XDNA 4DUZH 3RZOB 5EPLA 2G9HD 4ME3A 3C1FA 3DUZA 1O80A 4FF3A 4LF7L 5EWEA 3R5HA 3G6XA 5K2MA 3GIQA 2V4RA 2NVQB 2UUCQ 1Y1WB 1W93A 5KFYA 5KT5A 1MKHA 4XXEA 2YZMA 5KFTA 3MR6A 1LO5D 1NMFA 2AU0A 3HOWH 3F1ZA 1TWCH 3K7UC 4J0MA 2YU9A 5IGBA 2F3IA 3S2HH 1CS0A 2G9DA 5CV8A 1SMYC 4O2DA 4L63B 4O2BF 4DKAC 3DWAA 4IURA 3N52A 1ZYRD 1E2VA 5FLXW 4RU9A 5NUCA 5M3MH 4DAMA 1YJ9A 2FXQA 3GTJH 4DUYL 3KF6B 4RKLA 5KG3A 1NCVA 2PMZA 2LMCB 4MTNA 5ELBA 2N49A 4XTCS 1RODA 2QYZA 1GSAA 2DGYA 2JEGA 5JEAJ 1UNNC 1PFMA 5IYBH 5KFAA 2EYHA 3I4MH 2FP4B 2R92B 3GTLB 2B2TA 1JICA 1WTQA 3EIVA 2NZHA 3GTOA 4X65Q 2EOTA 5KFIA 1VQLA 1Q8KA 3ERQA 4DR3L 2Z8LA 5JQWA 1A8VA 3G6YA 5IGEA 1E7ZA 4JI4H 3GLKA 4YR2A 1DV1A 3G8CA 1RYSA 3OWFA 2BQUA 1N36H 2K50A 3VA5A 3NBIA 1L1OA 3SDZA 2I5HA 1ENAA 1SYXB 2W6QA 2Z1CA 5DG7A 2YU9B 4YHHH 3MWEA 4V0BA 2XCPA 1MIUA 4O0AA 2ZJPA 1FNVA 1U4MA 1PRTD 2C00A 2VA2A 1U5KA 4CDDC 2NVXH 3I70A 3T1HL 2RQXA 1NBWA 5HY6A 1S97A 1V1PB 1HZAA 2PQAA 3CF5A 1ASZA 1W2BA 4RUCA 3J80c 1VQKA 3MR5A 4MV3A 4AYBA 1IL8A 1G2SA 1EY0A 3VR2A 1I50A 1LLRD 3PV0A 1J6QA 4BBSB 2Y0SB 2ZTCA 4IO9A 1I4GA 4LF9L 2C2RA 2PZWA 1FGBD 3Q6SA 1CA5A 4J9MA 1I6UA 1U4RA 2ASLA 1T36A 4XQJA 3GV5B 1RDPD 1RJTA 1FJGH 4DU9A 2FB9A 3F2BA 1MI2A 2UUCH 1X54A 5CAEB 4KLKA 2KHJA 3IAYA 4YCUA 4JV0A 3OHBA 4ECRA 4K6LA 4IOAA 1X65A 1M8AA 2J7ZA 4F4ZA 1M0TA 5EOYA 1L0XB 1A15A 1Z47A 2F0UA 4PZ7A 1SCUB 2OTLA 1SJED 3K5NA 3CCVA 1F9QA 1HPCA 1CHPD 5C0XG 3C3LA 3A55A 4ED2A 4FXGC 3QZ7A 1VQEA 2VQEL 2NVQH 4X62H 1EWIA 1BXTA 2NB0A 4OO1G 4DV2H 1T3NA 2E76C 2ZM6H 3HKZB 3FMCA 4DV6L 1PH8A 4PMBA 4J9KA 5KKNB 4C3JH 1FL0A 4X3KA 4TV9F 1A62A 2LXKA 1YNNC 4J9QA 1FYCA 2VL6A 2O2LD 3GTKH 4GKKL 2YRXA 5KT7A 4B3MH 4HCEA 4O3QA 2UUBH 3HOWG 5L1IA 5CYUA 3WNZA 1GO3E 1O7ZA 3T16A 5D3IB 3PW2A 3GTKA 3CCUA 3PW4A 3SK6A 2CH4W 3D8GA 3KF8B 4OELB 3S1NH 1L1OB 4K6DA 4A3JB 2Y0SA 3RF2A 4GKJL 2YS7A 5KFZA 4RB2C 1E24A 1EUCB 1YEZA 3DXJC 4IOCA 1NSNS 5IWAL 3E0EA 2B63H 1VQ9A 5M3MG 5IWAH 4DV3Q 4GOPA 4ED1A 3PVXA 4P72A 1I94H 1EZ8A 2MGSA 2YYZA 3NEMA 4A3DH 1NY4A 2OQ0A 3PO2B 1KEEA 4IUPA 4JI1Q 3LP8A 4DV1H 2RCNA 3U58A 1ESFA 4QB4A 4LH7A 2E8GA 5FO8B 4EG0A 4J1MA 1CM9A 4K2LA 4DV7H 2JEIA 2YCHA 2NTSA 5A35A 2R85A 3MHBA 4KHVA 3TINA 4EFEA 1RD9D 4J9RA 4JG2A 4KN7C 1CSPA 1K8AC 2HIXA 4JI0H 3I8ZA 4APVA 2DUDA 4DR4L 1TY2A 2EXDA 4ECWA 3PSIA 2Y0SG 4HNVA 5IGDA 2CKZB 4K5WA 1N34Q 4ECQA 1FGUA 4HMJA 5FLMH 5DGAA 3OSOA 4YY3Q 1I5FA 4BA2I 2DWCA 1STAA 5IT9c 2FLNA 4DAVA 1KJ9A 2VQEH 2UXBQ 3K3VA 3FRPB 3DEPA 1I4XA 4CC5A 1R4PB 1E2WA 1KRTA 3P75A 2A5HA 4MV8A 5JVG3 1VF5C 3MJFA 1I7NA 2WYOA 2FMCA 3J81i 2NZOA 2FHTA 2PNRC 5LMUL 5A2QE 2HVQA 3GIDA 2JSOA 4G4KA 2UU9L 1PH9A 3T5LA 1KLGD 2XRSD 1AN7A 1HNXH 2X6LA 3IFDA 1D1IA 3RD4A 3RR5A 4L6TB 3JAML 1K0RA 3TBIB 3OTOH 2OTJA 2DPJA 3HXLA 4JV2A 4F87A 1OXUA 1TWFB 3A56A 3S14H 5LOVF 4EYHB 3NGDA 3BJYA 2I5MX 1E1OA 2DZDA 4A3FH 3V05A 2HVSA 3A74A 5GAEC 1Q1BA 5IYDH 5C3XA 2OH2A 5EDWA 4A4IA 1PZKD 4B3RH 1SLJA 3BU2A 1HR0W 3H20A 4C3IH 4FO2A 5I47A 1X3FA 1UE5A 1PFBA 5JPMC 3CQZA 2R92H 2N8NA 4GOPB 2B63A 5HGTA 1N9WA 3UE1A 1K8GA 3GTQH 3L0OA 1VQ4A 1PH7A 1BBWA 1J8IA 4JI3L 3I7FA 1EUDB 4HNUA 4JI1L 3FP9A 4HEDA 1NR4A 1F9RA 1JOOA 4K0KL 2IHFA 2RGVA 1AN8A 2E2DC 3OSNA 1BBUA 4BWSC 3L4JA 3A7LA 2M9VA 4J9OA 1I50H 2F4VH 2XCLA 5M3FB 3RUZA 1CQJB 2UVRA 5LMNW 4DR3H 4IPGA 2MPMA 1GUGA 1TWAA 3KF8A 1VBHA 3TRZA 5C0XI 1KTKA 3IKJA 3D4DA 4O3NA 3EPIA 5EKLA 3LX0A 3S1QH 1K1SA 2ZT9C 3ITPA 4IUVA 2RHSB 2V1CC 1JDEA 4B3RQ 4HYKA 1S5CD 3R8BA 3H40A 5K36H 4FYDA 1D1KA 2XNAC 1ILPA 3RFCA 4IQZA 4MA0A 4HNTA 4LUZA 2O4XA 3FEWX 1DOLA 2B2WA 3BDLA 4X65L 4DR1Q 3PIP3 2ES2A 1VMCA 4E4TA 3MXUA 3K5OA 4O4LF 5DM73 4FS1A 1T5XD 1IHZA 4C1NK 4DR5Q 5M5XB 3GTMB 4OEMB 1DGSA 4C3IB 4A3KG 1HJPA 2AQ2B 2F0HA 5L9XA 4I55F 2VQEQ 4A3GB 4KD3A 1S72A 1WTXA 2I8CA 2UXBH 4JUZA 2DPIA 4A3FB 2ENBA 2SDFA 2NVYB 3V96A 4G7ZC 4KJOA 3K6OA 3FKIA 4TV8F 5C5JA 1B53A 2QKIC 2UUBL 3S2DH 1V1PA 1YBYA 1K8MA 2DNCA 4QIWE 1HTLD 4CKCA 1B9NA 4ALPA 3PIPA 4ETSA 5DG8A 4DV5H 1J5EH 4CGYB 4LH6A 3GTLH 4Y7NH 2HHHH 4BXXH 4J15A 1IBMQ 4B3SH 5CV4A 1KC7A 1I50B 2HD3A 3SK4A 1N32L 1KJJA 5KFJA 2EJMA 1YVCA 3HEJA 3M9MB 3I3CA 3CW2C 2J4XA 2AWOA 3GV7B 5FLMG 1SBBB 5LMNH 2IL8A 4CJ2C 2GN5A 5D8DA 3T5JA 3ND8A 4WORA 4LFAL 3CQZB 5M3FH 1S40A 2CCZA 1HUMA 4JI2L 3HBLA 3J81W 1QJOA 1Z2OX 2A8VA 3U50C 1GUWA 2VUGA 1DXMA 1YJWA 1RK6A 3OOCA 1O78A 1ZHSA 2I87A 4TQRA 4NXNH 3X3MA 4DV7Q 2GPSA 1STGA 1S03G
chains in the Genus database with same CATH topology
2JJQA 2YV5A 4YHHL 1HH2P 1YITA 2F4VL 5GROA 3H3VI 2K5HA 1BVSA 1QUQA 2H5XA 3SGIA 1MJEA 4GS3A 3RN2A 3M4QA 5C4XH 1PH6A 3NELA 2D0OA 2QGQA 3GTOH 2ZM6Q 1SN8A 2UXDL 2JA7H 3S17H 5JJKA 3RZOH 4X6AH 1O7IA 3HOXG 2GVAA 4DV4L 1RL2A 3GD7A 3HFZB 4HJ7A 1IBML 2IX0A 4DR3Q 5LMNQ 2Z0SA 4OO1I 4DUZQ 1VS0A 4L5SA 4X62L 1QUQB 1Y14B 1NTGA 2CFMA 2K5NA 1KAWA 3ULPA 5FJ8G 1VQHA 3L2PA 3HOZH 4DR6L 3UDGA 4AQYL 1FJGQ 3OYYA 3KDFB 2HQLA 4P75A 4POGA 3GTGH 1HZ9A 4HIDA 3J81c 3PUXA 2UUBQ 4LUVA 5C4JH 3CMEA 4OX9L 2LSSA 2MFIA 5M5YH 1XNRQ 1Y1WG 5IYCG 2D62A 2PNHA 2BH8A 1EUJA 3E9IA 3HKZE 4AH6A 2KCMA 1GD7A 3BJUA 3PUWA 4YWKA 4B3TQ 3PO3G 4LFCQ 1UE6A 1RIPA 4GNXA 2PMZE 4A3MH 3H3VH 3RLOA 4DR5L 5IP9H 2UUAQ 1XPUA 1PH4A 3FHWA 2MO0A 1E22A 4JV5Q 1Q46A 1X56A 4AQYQ 5ELOA 2UUAL 4DR1L 4YWLA 1GM5A 4TVAB 3TS2A 2ATWA 5E7NA 4LFCL 5IYBG 3OW2A 1CKMA 3PF5A 4LNQA 4HJ9A 3K80C 1X6OA 3UDFA 2ZJRA 4JI8Q 4IJHA 2Q2TA 3CP0A 1CSQA 1YI2A 3BZCA 4IFDJ 3CCSA 2UXDQ 3I4MG 1L1OC 4BXXG 1XMOL 3U4VA 4KI0A 3HOYG 1QZGA 2C35B 1KIXA 4A93G 1CKNA 2N3SA 3CPFA 2RHQB 1KD1C 4JI5Q 4YHHQ 4R4CA 1X3EA 5LMNL 4A3JH 1VQDA 1Q7YC 3L7ZC 1VQ5A 3GTPH 4BY1G 4DV4Q 2EQSA 4BBRG 4GNXC 2K75A 2E5LQ 4GLVB 4LF7Q 2MNAA 1AE3A 4HJAA 4OWXB 3G4SA 5IP9G 2HHHL 1ASYA 3PUYA 1SROA 4OWTB 1PYSB 3KYHC 2QEXA 4A3IH 4JI4L 4JOIA 4JI3Q 2R7ZG 3H0GG 2Z6KC 5BR8Q 3T1YQ 2F4VQ 2VUMH 2K14A 5BR8L 5AJ3Q 3T1YL 4PG3A 3PF4A 3PUVA 3ER0A 4P71A 4DV7L 1JT8A 4POFA 4JI6Q 2YU9H 4NXNL 3EN2A 4ME3A 3TS0A 4JBMA 1L0WA 4LF7L 2E5LL 3CMAA 2UUCQ 2WFWA 4JOIC 1EIYB 1MKHA 3TEHB 2VY3A 4JI2Q 4PZ6A 4UPAA 4JI7L 3CD6A 3EBEA 1NMFA 4JI5L 5IP7H 3HOWH 4LFAQ 1K9MC 2KCTA 3F1ZA 2NVYH 1J5EL 1PV4A 1JE5A 1TWCH 3K7UC 1UE1A 4A3GH 2F3IA 1WJJA 1A63A 3S2HH 4DPGA 5M3FG 3RLFA 3A0JA 2B63G 1N32Q 5J3BA 4O2DA 1OXTA 2YTXA 2JA6G 2B29A 1T9HA 3UE0A 4DKAC 4HJ8A 1VQNA 1Y1WH 4A3IG 4X64Q 1V43A 3W5OA 5GQOA 4R1JA 3PUZA 4GNXB 3S15H 5M3MH 4DAMA 1YJ9A 2FXQA 3GTJH 2ZTEA 4DUYL 3KF6B 4LFBQ 2A19A 4DV5L 3CCMA 4ALPA 3TREA 2IHEA 3D0FA 4MTNA 2RF4A 2N49A 4XTCS 3S24A 1D8LA 2UXBL 4B3TL 3RLNA 4LF4L 2DGYA 4UY8C 5JEAJ 5C4XG 5IYBH 3TQYA 3I4MH 3NBHB 3CPWA 4A3BH 1K83H 4OX9Q 3RN5A 2KBNA 1VQAA 4LUOA 3ULJA 3H15A 4LF6Q 1JB7A 4JYAQ 3UDXA 3F2CA 4R4TA 3KJPA 3EIVA 4DR6Q 2NZHA 4X65Q 1L2FA 4H02A 1CKNB 1E1TA 1Q8KA 3UDIA 1OXVA 4X66L 4X62Q 4DUZL 1KRSA 1VQLA 2OWOA 4DR3L 1A8VA 1VQFA 1WYDA 2QA4A 3J7ZC 1K73C 1B8AA 1HNWL 2NN6G 4B3RL 2Y0SE 5JEAG 3LGJA 3HOYH 4A93H 3J7A5 1N36L 4NB3A 1E7ZA 4BY1H 2LXJA 4QJFA 4LF5Q 4R4QA 4BBRH 2K50A 2R7ZH 1L1OA 2YTVA 2I5HA 4K0KQ 1V9PA 3FKIH 4GLXA 1G51A 4HJ5A 2B3GA 1IBKL 2ZJQA 2R7DA 1VQOA 2ASBA 2R93G 1X3GA 4A3EG 1VQ8A 1MIUA 4O0AA 2ZJPA 1K3RA 2OQKA 4DV3L 1PVOA 1U5KA 1XNQQ 3I55A 2NVXH 3T1HL 3CC2A 5HY6A 1KL9A 1NBWA 1HZAA 2PQAA 3CF5A 1ASZA 4JCVE 1W2BA 3MXNB 1TWGH 3J80c 1VQKA 3KFUA 2VNUD 1TWAH 1I94L 4P74A 1VCIA 3NENA 1N8RC 4GN4B 3PV0A 1J6QA 2ZTCA 4IO9A 4LF9L 3S1MH 5IP7G 2AKWB 1XPRA 4NXML 2JA8G 4TQUS 1B70B 2JA7G 2JEBI 2UXCL 3F2BA 4A3CH 5GAGC 1LUZA 1X54A 1U0LA 4JI7Q 4KLKA 4B3SL 2KHJA 4YCVA 4YCUA 4KHPQ 1E3PA 1UWVA 4IOAA 4QGUA 1X65A 3PO2G 4DV1Q 4DV6Q 2Q2UA 5IE8A 3CCJA 3W1GA 1Z47A 4PZ7A 3KLWA 3OTOL 2CWAA 1EQQA 4UP7A 1HR0L 5GADC 2OTLA 2BA0A 2K4KA 4FDBA 3CCVA 1IL2A 1PH3A 1M1KC 5C0XG 3AEVA 4NPSA 1P16A 1VQEA 4LWCA 3K7AH 2VW9A 2VQEL 1K8GA 1N33Q 2NVQH 1EWIA 1JJCB 4RG1A 4DV2Q 1C7YA 2IY5B 2WP8J 1Q81C 4OO1G 4DV6L 4DV1L 1PH8A 3CCEA 3CCQA 3I2ZA 1FL0A 4C3JH 3MEFA 2VUMG 4DK3C 4Y52H 1G6PA 4A3BG 1A62A 2LXKA 1XPOA 5C0XJ 2VL6A 1I6HH 3GTKH 4GKKL 4B3MQ 1YNXA 1VQIA 1WFQA 3D31A 1HNXL 1A0IA 4BY7G 4C2MH 1YHBA 3BZKA 3HOWG 5IYDG 3RNUA 4DV0L 1GO3E 3CCLA 4IPDA 3AYHB 4A3FG 3S1RH 3CCUA 1N34L 5GAHC 3IRBA 4LF8L 4A3GG 3KF8B 3S1NH 1L1OB 1MJCA 2N78A 3GDEA 1YJNA 2KHIA 4GKJL 4HIMA 1E24A 2AMCB 2XTIA 2VQFQ 1QVCA 1YEZA 1Z9FA 2MQHA 1S3OA 1WOCA 1YIJA 1C0AA 1UE7A 3M7NA 4DR7L 4IOCA 1H95A 4MNOA 5IWAL 4PMWA 3E0EA 4XIGS 1HNZQ 1XNQL 3I4NG 2B63H 1XMQL 1VQ9A 2AWNA 5M3MG 3HOVG 4DV3Q 4GOPA 5IWAQ 2I5LX 2E2IH 4DR7Q 4P72A 1VQCA 4JBJA 2PQAB 2YYZA 3NEMA 4RMFA 1NY4A 2R92G 4A3DH 2OQ0A 5JJIA 4A75A 1IBKQ 4JI1Q 1XJVA 2RCNA 3U58A 2BH2A 1CUKA 4QQBX 2E8GA 3B6YA 4OWWB 1WI5A 2NN6I 1N36Q 4DR2L 2JA8H 4JG2A 1XMQQ 1KQSA 1CSPA 1K8AC 2HIXA 4BY7H 3M4OH 2KENA 1EFWA 4JI0Q 3M3YH 1VQ6A 4APVA 1HZBA 2DUDA 4DR4L 4WJ3M 2EXDA 2ZTDA 1TWFH 3PSIA 2Y0SG 4GKJQ 3Q8DA 4HIOA 1JJGA 4A3CG 2CKZB 1N34Q 1EQRA 1FGUA 3U4ZA 5FLMH 4LF6L 4DV0Q 4YY3Q 1I5FA 4BA2I 2XGTA 1GVPA 3M4PA 1UEBA 2F52A 5IT9c 3M85A 3AFPA 4BBSH 1Q12A 2EIFA 4B3ML 1N33L 2UXBQ 1QZHA 1Q86C 3FKIG 2VS1A 1LTLA 1FVIA 1VQ7A 2UU9Q 1KRTA 2I0QA 4GN3B 3A5ZB 2R7FA 4A3LH 2R93H 1HR0Q 1IBLL 2JK8A 5C44G 5LMUQ 1PYBA 3DLLA 4LFBL 4A3KH 1G291 4PZ8A 4MZ9A 3F2DA 4KHZA 2MO1A 3J81i 2NZOA 5LMUL 4DV2L 1IBLQ 1KC8C 4A3EH 2UU9L 1PH9A 1AH9A 4LW1A 3HOXH 3RR5A 3RZDH 1NE3A 3G48A 4UP8A 1K0RA 3OTOQ 4AIMA 4DNIA 2OTJA 1HZCA 4IJLA 1Q82C 4YY3L 1OXUA 3S14H 1PFSA 1VQGA 2WAQE 1P8LA 3K81C 2GVBA 4A3JG 4KHPL 2YTYA 1C9OA 3K0XA 2I5MX 1E1OA 3HOUG 2K52A 4A3FH 1I94Q 4JBKA 2PI2A 3A74A 4R4OA 1Q1BA 5FJ8H 5GAEC 4HIKA 4OONA 3AFQA 5IYDH 1SE8A 5C3EH 4A4IA 4DR4Q 1SLJA 3BU2A 1NJIC 1HR0W 4C3IH 4WJ4A 4JI0L 4OXPA 1X3FA 4P73A 3T1HQ 5JJLA 4NXMQ 1UE5A 1WCMH 4JI6L 4EX5A 3PO2H 2D0PA 3W1BA 4DR2Q 4LF9Q 2HT1A 2R92H 2N8NA 3KF6A 4GOPB 2ALYB 1XTDA 4A76A 1N9WA 3UE1A 5EAYA 1Y1VG 3L0OA 1VQ4A 3HKSA 1BBWA 1PH7A 4JI3L 3I7FA 3JAMc 3GTQH 4JI1L 3FP9A 4C3HH 1CKOA 1SRUA 4A3DG 4K0KL 2IHFA 2HHHQ 3HKZG 3PO3H 2PI2E 1JMCA 3I56A 2K5VA 4LF5L 1R9TH 1BBUA 4A3MG 4UP9A 4JC0A 3DM3A 1SFOH 1M90C 2R6GA 3JAMi 3KJOA 1I50H 1PH5A 1HNZL 3CQZH 1BKBA 5LMNW 1KXLA 2E2HH 4IPGA 1EYGA 1X9NA 5DLQE 4X66Q 2VQFL 3TRZA 2Q2IA 1EOVA 4QL5A 1OTCA 3HOUH 5C0XI 1NMGA 3CCRA 2IX1A 5M5XH 4LF8Q 1XMOQ 4BA1I 3GTMH 1GKHA 2JE6I 5IY0A 3ICEA 3S1QH 3M9BA 2VZAA 4AYBG 2RHSB 3HOZG 1VQJA 2V1CC 1WCMG 4JI8L 1HNXQ 4B3RQ 3PIOA 1HNWQ 1QVGA 2CQOA 3STBC 3ZJYC 3G6EA 3CXCA 3A5UA 4GKKQ 4A3LG 2AHOB 3ERSX 4L5RC 1EIFA 4LUZA 4X65L 4DR1Q 1OXSC 3KDFA 4IPCA 2ES2A 1YZ6A 4BBSG 4JV5L 1W3SA 3F8TA 4AYBE 1OXXK 4JYAL 4GN5A 1LM0A 1PH2A 4DUYQ 4IFDI 1LYLA 4QY7A 4DR5Q 3I4NH 2HIVA 5C44H 1YHQA 1V1QA 3HOVH 1DGSA 2WB1G 1SMXA 3H0GH 1HJPA 2BA1A 4DAYB 4A3KG 4LF4Q 4GLAC 3CC4A 2IT1A 2VQEQ 1IXRA 1I3QH 1S72A 3PGZA 4EQ5A 1JJ2A 1VQBA 4IFDG 1XNRL 3J81j 3WWVA 1VQMA 1X55A 2JA9A 2JA5G 5HGQA 2UUBL 3PCOB 3S2DH 5K36G 1SR3A 1YBYA 2Z6KA 4QIWE 4DV5Q 1YHAA 3STBD 3CC7A 3PIPA 1KHIA 1J5EQ 1FJGL 1D7QA 4YWMA 3GTLH 1IZ6A 2Q2HA 3J80i 2ID0A 1AE2A 3ULLA 4J15A 4X64L 4Y7NH 1IBMQ 4B3SQ 4BXXH 4L5TA 4IPHA 3JC66 5ELNA 1N32L 2CWPA 2UUCL 2UXCQ 1YVCA 1Q1EA 1B7YB 5M5WH 3CW2C 2ZM6L 2AWOA 3K8AA 4L5QA 5FLMG 4DK6C 5C3EG 2JQOA 1TXYA 2GN5A 3KOJA 1TWHH 2A1AA 4LFAL 1QVFA 2JA6H 2JEAI 4R4IA 5M3FH 1S40A 2CCZA 3VDYA 3GO5A 1IYJB 3E9HA 4JI2L 3AQQA 5H1SE 4JI4Q 2A8VA 4GOPC 1Y1VH 3U50C 2NVTH 2WAQG 2L15A 3I4OA 5FLXc 3G71A 1PA6A 2OCEA 2WB1E 4JBWA 1YJWA 1PH1A 3CAMA 4NXNQ 5IYCH 1PHJA 4YCWA 2JA5H 3S16H 4DV7Q 2E2JH 1VQPA 5AJ3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJQ A;  2YV5 A;  4YHH L;  1HH2 P;  1YIT A;  2F4V L;  5GRO A;  3H3V I;  2K5H A;  1BVS A;  1QUQ A;  2H5X A;  3SGI A;  1MJE A;  4GS3 A;  3RN2 A;  3M4Q A;  5C4X H;  1PH6 A;  3NEL A;  2D0O A;  2QGQ A;  3GTO H;  2ZM6 Q;  1SN8 A;  2UXD L;  2JA7 H;  3S17 H;  5JJK A;  3RZO H;  4X6A H;  1O7I A;  3HOX G;  2GVA A;  4DV4 L;  1RL2 A;  3GD7 A;  3HFZ B;  4HJ7 A;  1IBM L;  2IX0 A;  4DR3 Q;  5LMN Q;  2Z0S A;  4OO1 I;  4DUZ Q;  1VS0 A;  4L5S A;  4X62 L;  1QUQ B;  1Y14 B;  1NTG A;  2CFM A;  2K5N A;  1KAW A;  3ULP A;  5FJ8 G;  1VQH A;  3L2P A;  3HOZ H;  4DR6 L;  3UDG A;  4AQY L;  1FJG Q;  3OYY A;  3KDF B;  2HQL A;  4P75 A;  4POG A;  3GTG H;  1HZ9 A;  4HID A;  3J81 c;  3PUX A;  2UUB Q;  4LUV A;  5C4J H;  3CME A;  4OX9 L;  2LSS A;  2MFI A;  5M5Y H;  1XNR Q;  1Y1W G;  5IYC G;  2D62 A;  2PNH A;  2BH8 A;  1EUJ A;  3E9I A;  3HKZ E;  4AH6 A;  2KCM A;  1GD7 A;  3BJU A;  3PUW A;  4YWK A;  4B3T Q;  3PO3 G;  4LFC Q;  1UE6 A;  1RIP A;  4GNX A;  2PMZ E;  4A3M H;  3H3V H;  3RLO A;  4DR5 L;  5IP9 H;  2UUA Q;  1XPU A;  1PH4 A;  3FHW A;  2MO0 A;  1E22 A;  4JV5 Q;  1Q46 A;  1X56 A;  4AQY Q;  5ELO A;  2UUA L;  4DR1 L;  4YWL A;  1GM5 A;  4TVA B;  3TS2 A;  2ATW A;  5E7N A;  4LFC L;  5IYB G;  3OW2 A;  1CKM A;  3PF5 A;  4LNQ A;  4HJ9 A;  3K80 C;  1X6O A;  3UDF A;  2ZJR A;  4JI8 Q;  4IJH A;  2Q2T A;  3CP0 A;  1CSQ A;  1YI2 A;  3BZC A;  4IFD J;  3CCS A;  2UXD Q;  3I4M G;  1L1O C;  4BXX G;  1XMO L;  3U4V A;  4KI0 A;  3HOY G;  1QZG A;  2C35 B;  1KIX A;  4A93 G;  1CKN A;  2N3S A;  3CPF A;  2RHQ B;  1KD1 C;  4JI5 Q;  4YHH Q;  4R4C A;  1X3E A;  5LMN L;  4A3J H;  1VQD A;  1Q7Y C;  3L7Z C;  1VQ5 A;  3GTP H;  4BY1 G;  4DV4 Q;  2EQS A;  4BBR G;  4GNX C;  2K75 A;  2E5L Q;  4GLV B;  4LF7 Q;  2MNA A;  1AE3 A;  4HJA A;  4OWX B;  3G4S A;  5IP9 G;  2HHH L;  1ASY A;  3PUY A;  1SRO A;  4OWT B;  1PYS B;  3KYH C;  2QEX A;  4A3I H;  4JI4 L;  4JOI A;  4JI3 Q;  2R7Z G;  3H0G G;  2Z6K C;  5BR8 Q;  3T1Y Q;  2F4V Q;  2VUM H;  2K14 A;  5BR8 L;  5AJ3 Q;  3T1Y L;  4PG3 A;  3PF4 A;  3PUV A;  3ER0 A;  4P71 A;  4DV7 L;  1JT8 A;  4POF A;  4JI6 Q;  2YU9 H;  4NXN L;  3EN2 A;  4ME3 A;  3TS0 A;  4JBM A;  1L0W A;  4LF7 L;  2E5L L;  3CMA A;  2UUC Q;  2WFW A;  4JOI C;  1EIY B;  1MKH A;  3TEH B;  2VY3 A;  4JI2 Q;  4PZ6 A;  4UPA A;  4JI7 L;  3CD6 A;  3EBE A;  1NMF A;  4JI5 L;  5IP7 H;  3HOW H;  4LFA Q;  1K9M C;  2KCT A;  3F1Z A;  2NVY H;  1J5E L;  1PV4 A;  1JE5 A;  1TWC H;  3K7U C;  1UE1 A;  4A3G H;  2F3I A;  1WJJ A;  1A63 A;  3S2H H;  4DPG A;  5M3F G;  3RLF A;  3A0J A;  2B63 G;  1N32 Q;  5J3B A;  4O2D A;  1OXT A;  2YTX A;  2JA6 G;  2B29 A;  1T9H A;  3UE0 A;  4DKA C;  4HJ8 A;  1VQN A;  1Y1W H;  4A3I G;  4X64 Q;  1V43 A;  3W5O A;  5GQO A;  4R1J A;  3PUZ A;  4GNX B;  3S15 H;  5M3M H;  4DAM A;  1YJ9 A;  2FXQ A;  3GTJ H;  2ZTE A;  4DUY L;  3KF6 B;  4LFB Q;  2A19 A;  4DV5 L;  3CCM A;  4ALP A;  3TRE A;  2IHE A;  3D0F A;  4MTN A;  2RF4 A;  2N49 A;  4XTC S;  3S24 A;  1D8L A;  2UXB L;  4B3T L;  3RLN A;  4LF4 L;  2DGY A;  4UY8 C;  5JEA J;  5C4X G;  5IYB H;  3TQY A;  3I4M H;  3NBH B;  3CPW A;  4A3B H;  1K83 H;  4OX9 Q;  3RN5 A;  2KBN A;  1VQA A;  4LUO A;  3ULJ A;  3H15 A;  4LF6 Q;  1JB7 A;  4JYA Q;  3UDX A;  3F2C A;  4R4T A;  3KJP A;  3EIV A;  4DR6 Q;  2NZH A;  4X65 Q;  1L2F A;  4H02 A;  1CKN B;  1E1T A;  1Q8K A;  3UDI A;  1OXV A;  4X66 L;  4X62 Q;  4DUZ L;  1KRS A;  1VQL A;  2OWO A;  4DR3 L;  1A8V A;  1VQF A;  1WYD A;  2QA4 A;  3J7Z C;  1K73 C;  1B8A A;  1HNW L;  2NN6 G;  4B3R L;  2Y0S E;  5JEA G;  3LGJ A;  3HOY H;  4A93 H;  3J7A 5;  1N36 L;  4NB3 A;  1E7Z A;  4BY1 H;  2LXJ A;  4QJF A;  4LF5 Q;  4R4Q A;  4BBR H;  2K50 A;  2R7Z H;  1L1O A;  2YTV A;  2I5H A;  4K0K Q;  1V9P A;  3FKI H;  4GLX A;  1G51 A;  4HJ5 A;  2B3G A;  1IBK L;  2ZJQ A;  2R7D A;  1VQO A;  2ASB A;  2R93 G;  1X3G A;  4A3E G;  1VQ8 A;  1MIU A;  4O0A A;  2ZJP A;  1K3R A;  2OQK A;  4DV3 L;  1PVO A;  1U5K A;  1XNQ Q;  3I55 A;  2NVX H;  3T1H L;  3CC2 A;  5HY6 A;  1KL9 A;  1NBW A;  1HZA A;  2PQA A;  3CF5 A;  1ASZ A;  4JCV E;  1W2B A;  3MXN B;  1TWG H;  3J80 c;  1VQK A;  3KFU A;  2VNU D;  1TWA H;  1I94 L;  4P74 A;  1VCI A;  3NEN A;  1N8R C;  4GN4 B;  3PV0 A;  1J6Q A;  2ZTC A;  4IO9 A;  4LF9 L;  3S1M H;  5IP7 G;  2AKW B;  1XPR A;  4NXM L;  2JA8 G;  4TQU S;  1B70 B;  2JA7 G;  2JEB I;  2UXC L;  3F2B A;  4A3C H;  5GAG C;  1LUZ A;  1X54 A;  1U0L A;  4JI7 Q;  4KLK A;  4B3S L;  2KHJ A;  4YCV A;  4YCU A;  4KHP Q;  1E3P A;  1UWV A;  4IOA A;  4QGU A;  1X65 A;  3PO2 G;  4DV1 Q;  4DV6 Q;  2Q2U A;  5IE8 A;  3CCJ A;  3W1G A;  1Z47 A;  4PZ7 A;  3KLW A;  3OTO L;  2CWA A;  1EQQ A;  4UP7 A;  1HR0 L;  5GAD C;  2OTL A;  2BA0 A;  2K4K A;  4FDB A;  3CCV A;  1IL2 A;  1PH3 A;  1M1K C;  5C0X G;  3AEV A;  4NPS A;  1P16 A;  1VQE A;  4LWC A;  3K7A H;  2VW9 A;  2VQE L;  1K8G A;  1N33 Q;  2NVQ H;  1EWI A;  1JJC B;  4RG1 A;  4DV2 Q;  1C7Y A;  2IY5 B;  2WP8 J;  1Q81 C;  4OO1 G;  4DV6 L;  4DV1 L;  1PH8 A;  3CCE A;  3CCQ A;  3I2Z A;  1FL0 A;  4C3J H;  3MEF A;  2VUM G;  4DK3 C;  4Y52 H;  1G6P A;  4A3B G;  1A62 A;  2LXK A;  1XPO A;  5C0X J;  2VL6 A;  1I6H H;  3GTK H;  4GKK L;  4B3M Q;  1YNX A;  1VQI A;  1WFQ A;  3D31 A;  1HNX L;  1A0I A;  4BY7 G;  4C2M H;  1YHB A;  3BZK A;  3HOW G;  5IYD G;  3RNU A;  4DV0 L;  1GO3 E;  3CCL A;  4IPD A;  3AYH B;  4A3F G;  3S1R H;  3CCU A;  1N34 L;  5GAH C;  3IRB A;  4LF8 L;  4A3G G;  3KF8 B;  3S1N H;  1L1O B;  1MJC A;  2N78 A;  3GDE A;  1YJN A;  2KHI A;  4GKJ L;  4HIM A;  1E24 A;  2AMC B;  2XTI A;  2VQF Q;  1QVC A;  1YEZ A;  1Z9F A;  2MQH A;  1S3O A;  1WOC A;  1YIJ A;  1C0A A;  1UE7 A;  3M7N A;  4DR7 L;  4IOC A;  1H95 A;  4MNO A;  5IWA L;  4PMW A;  3E0E A;  4XIG S;  1HNZ Q;  1XNQ L;  3I4N G;  2B63 H;  1XMQ L;  1VQ9 A;  2AWN A;  5M3M G;  3HOV G;  4DV3 Q;  4GOP A;  5IWA Q;  2I5L X;  2E2I H;  4DR7 Q;  4P72 A;  1VQC A;  4JBJ A;  2PQA B;  2YYZ A;  3NEM A;  4RMF A;  1NY4 A;  2R92 G;  4A3D H;  2OQ0 A;  5JJI A;  4A75 A;  1IBK Q;  4JI1 Q;  1XJV A;  2RCN A;  3U58 A;  2BH2 A;  1CUK A;  4QQB X;  2E8G A;  3B6Y A;  4OWW B;  1WI5 A;  2NN6 I;  1N36 Q;  4DR2 L;  2JA8 H;  4JG2 A;  1XMQ Q;  1KQS A;  1CSP A;  1K8A C;  2HIX A;  4BY7 H;  3M4O H;  2KEN A;  1EFW A;  4JI0 Q;  3M3Y H;  1VQ6 A;  4APV A;  1HZB A;  2DUD A;  4DR4 L;  4WJ3 M;  2EXD A;  2ZTD A;  1TWF H;  3PSI A;  2Y0S G;  4GKJ Q;  3Q8D A;  4HIO A;  1JJG A;  4A3C G;  2CKZ B;  1N34 Q;  1EQR A;  1FGU A;  3U4Z A;  5FLM H;  4LF6 L;  4DV0 Q;  4YY3 Q;  1I5F A;  4BA2 I;  2XGT A;  1GVP A;  3M4P A;  1UEB A;  2F52 A;  5IT9 c;  3M85 A;  3AFP A;  4BBS H;  1Q12 A;  2EIF A;  4B3M L;  1N33 L;  2UXB Q;  1QZH A;  1Q86 C;  3FKI G;  2VS1 A;  1LTL A;  1FVI A;  1VQ7 A;  2UU9 Q;  1KRT A;  2I0Q A;  4GN3 B;  3A5Z B;  2R7F A;  4A3L H;  2R93 H;  1HR0 Q;  1IBL L;  2JK8 A;  5C44 G;  5LMU Q;  1PYB A;  3DLL A;  4LFB L;  4A3K H;  1G29 1;  4PZ8 A;  4MZ9 A;  3F2D A;  4KHZ A;  2MO1 A;  3J81 i;  2NZO A;  5LMU L;  4DV2 L;  1IBL Q;  1KC8 C;  4A3E H;  2UU9 L;  1PH9 A;  1AH9 A;  4LW1 A;  3HOX H;  3RR5 A;  3RZD H;  1NE3 A;  3G48 A;  4UP8 A;  1K0R A;  3OTO Q;  4AIM A;  4DNI A;  2OTJ A;  1HZC A;  4IJL A;  1Q82 C;  4YY3 L;  1OXU A;  3S14 H;  1PFS A;  1VQG A;  2WAQ E;  1P8L A;  3K81 C;  2GVB A;  4A3J G;  4KHP L;  2YTY A;  1C9O A;  3K0X A;  2I5M X;  1E1O A;  3HOU G;  2K52 A;  4A3F H;  1I94 Q;  4JBK A;  2PI2 A;  3A74 A;  4R4O A;  1Q1B A;  5FJ8 H;  5GAE C;  4HIK A;  4OON A;  3AFQ A;  5IYD H;  1SE8 A;  5C3E H;  4A4I A;  4DR4 Q;  1SLJ A;  3BU2 A;  1NJI C;  1HR0 W;  4C3I H;  4WJ4 A;  4JI0 L;  4OXP A;  1X3F A;  4P73 A;  3T1H Q;  5JJL A;  4NXM Q;  1UE5 A;  1WCM H;  4JI6 L;  4EX5 A;  3PO2 H;  2D0P A;  3W1B A;  4DR2 Q;  4LF9 Q;  2HT1 A;  2R92 H;  2N8N A;  3KF6 A;  4GOP B;  2ALY B;  1XTD A;  4A76 A;  1N9W A;  3UE1 A;  5EAY A;  1Y1V G;  3L0O A;  1VQ4 A;  3HKS A;  1BBW A;  1PH7 A;  4JI3 L;  3I7F A;  3JAM c;  3GTQ H;  4JI1 L;  3FP9 A;  4C3H H;  1CKO A;  1SRU A;  4A3D G;  4K0K L;  2IHF A;  2HHH Q;  3HKZ G;  3PO3 H;  2PI2 E;  1JMC A;  3I56 A;  2K5V A;  4LF5 L;  1R9T H;  1BBU A;  4A3M G;  4UP9 A;  4JC0 A;  3DM3 A;  1SFO H;  1M90 C;  2R6G A;  3JAM i;  3KJO A;  1I50 H;  1PH5 A;  1HNZ L;  3CQZ H;  1BKB A;  5LMN W;  1KXL A;  2E2H H;  4IPG A;  1EYG A;  1X9N A;  5DLQ E;  4X66 Q;  2VQF L;  3TRZ A;  2Q2I A;  1EOV A;  4QL5 A;  1OTC A;  3HOU H;  5C0X I;  1NMG A;  3CCR A;  2IX1 A;  5M5X H;  4LF8 Q;  1XMO Q;  4BA1 I;  3GTM H;  1GKH A;  2JE6 I;  5IY0 A;  3ICE A;  3S1Q H;  3M9B A;  2VZA A;  4AYB G;  2RHS B;  3HOZ G;  1VQJ A;  2V1C C;  1WCM G;  4JI8 L;  1HNX Q;  4B3R Q;  3PIO A;  1HNW Q;  1QVG A;  2CQO A;  3STB C;  3ZJY C;  3G6E A;  3CXC A;  3A5U A;  4GKK Q;  4A3L G;  2AHO B;  3ERS X;  4L5R C;  1EIF A;  4LUZ A;  4X65 L;  4DR1 Q;  1OXS C;  3KDF A;  4IPC A;  2ES2 A;  1YZ6 A;  4BBS G;  4JV5 L;  1W3S A;  3F8T A;  4AYB E;  1OXX K;  4JYA L;  4GN5 A;  1LM0 A;  1PH2 A;  4DUY Q;  4IFD I;  1LYL A;  4QY7 A;  4DR5 Q;  3I4N H;  2HIV A;  5C44 H;  1YHQ A;  1V1Q A;  3HOV H;  1DGS A;  2WB1 G;  1SMX A;  3H0G H;  1HJP A;  2BA1 A;  4DAY B;  4A3K G;  4LF4 Q;  4GLA C;  3CC4 A;  2IT1 A;  2VQE Q;  1IXR A;  1I3Q H;  1S72 A;  3PGZ A;  4EQ5 A;  1JJ2 A;  1VQB A;  4IFD G;  1XNR L;  3J81 j;  3WWV A;  1VQM A;  1X55 A;  2JA9 A;  2JA5 G;  5HGQ A;  2UUB L;  3PCO B;  3S2D H;  5K36 G;  1SR3 A;  1YBY A;  2Z6K A;  4QIW E;  4DV5 Q;  1YHA A;  3STB D;  3CC7 A;  3PIP A;  1KHI A;  1J5E Q;  1FJG L;  1D7Q A;  4YWM A;  3GTL H;  1IZ6 A;  2Q2H A;  3J80 i;  2ID0 A;  1AE2 A;  3ULL A;  4J15 A;  4X64 L;  4Y7N H;  1IBM Q;  4B3S Q;  4BXX H;  4L5T A;  4IPH A;  3JC6 6;  5ELN A;  1N32 L;  2CWP A;  2UUC L;  2UXC Q;  1YVC A;  1Q1E A;  1B7Y B;  5M5W H;  3CW2 C;  2ZM6 L;  2AWO A;  3K8A A;  4L5Q A;  5FLM G;  4DK6 C;  5C3E G;  2JQO A;  1TXY A;  2GN5 A;  3KOJ A;  1TWH H;  2A1A A;  4LFA L;  1QVF A;  2JA6 H;  2JEA I;  4R4I A;  5M3F H;  1S40 A;  2CCZ A;  3VDY A;  3GO5 A;  1IYJ B;  3E9H A;  4JI2 L;  3AQQ A;  5H1S E;  4JI4 Q;  2A8V A;  4GOP C;  1Y1V H;  3U50 C;  2NVT H;  2WAQ G;  2L15 A;  3I4O A;  5FLX c;  3G71 A;  1PA6 A;  2OCE A;  2WB1 E;  4JBW A;  1YJW A;  1PH1 A;  3CAM A;  4NXN Q;  5IYC H;  1PHJ A;  4YCW A;  2JA5 H;  3S16 H;  4DV7 Q;  2E2J H;  1VQP A;  5AJ3 L; 
#chains in the Genus database with same CATH topology
 4OIJ A;  4ZKB B;  1HH2 P;  2KEE A;  2R3Z A;  2F0I A;  2F0L A;  1RKN A;  1PTO B;  3SGI A;  1CA6 A;  4YAK B;  4GS3 A;  5C4X H;  1PH6 A;  2D5D A;  1IBM H;  3GTO H;  2D0O A;  4PV1 C;  1ET6 A;  2ZM6 Q;  2UXD L;  2JA7 H;  2WTF A;  3GTG B;  5JJK A;  2BDN A;  1B33 N;  1QWY A;  5AFW A;  3HOX G;  2GVA A;  3OSP A;  2R8G A;  2B63 B;  4UCS A;  4O3O A;  4DR3 Q;  5LMN Q;  2XGP A;  4ZQ3 A;  4DUZ Q;  1VS0 A;  4RGT A;  2CFM A;  4ECY A;  4FVM A;  4P75 A;  2K33 A;  4LJZ C;  5KFS A;  2UUB Q;  1RTO A;  2HGS A;  2Q8T A;  4OX9 L;  4UCV A;  1KDB A;  1Y1W G;  1A2U A;  3HKZ E;  4C2M B;  2CH4 A;  1XWE A;  4QUC A;  2CQY A;  4UHV A;  3PO3 G;  4B3T H;  4GNX A;  5BN4 A;  1T5E A;  2ASD A;  4DR5 L;  5IP9 H;  2R7N A;  3K5M A;  1QOH A;  4JI2 H;  1PH4 A;  1HA6 A;  2A69 D;  1A6X A;  1E22 A;  2A68 D;  2EVB A;  2WII B;  4JV5 Q;  4LFA H;  1GM5 A;  1CFM A;  4TVA B;  2XIW A;  3BA8 A;  4LFC L;  5KFD A;  2F1M A;  3A8J E;  5C5L A;  5IGF A;  4V19 0;  3UDF A;  3VA7 A;  3NBH A;  4MHE A;  4JI8 Q;  4RNN A;  3CP0 A;  1CSQ A;  2MHV A;  1YI2 A;  4M7E A;  2UXD Q;  2B8F A;  1L0Y B;  2OF1 A;  3KHL A;  3TIG A;  2C22 A;  3BAB A;  2E2I A;  1CKN A;  1KD1 C;  3MFH A;  3A8I E;  1D5Z C;  4A3J H;  1X3E A;  1E4G T;  1Q7Y C;  2BQ3 A;  3DM1 A;  1VQ5 A;  4UDU C;  1DIK A;  5KG1 A;  4BY1 G;  4DV4 Q;  4EBC A;  4OIK A;  4F4Y A;  1LV9 A;  4QCL A;  1AE3 A;  4APM A;  4OWX B;  4YY3 H;  1W6K A;  2NUA B;  1ASY A;  1AUV A;  1PYS B;  4NP5 A;  1F9P A;  3R23 A;  2F4V Q;  4C3J G;  4ODG A;  5BR8 L;  5AJ3 Q;  1V1O A;  3T1Y L;  4JV5 H;  1BXR A;  3SE0 A;  2EE1 A;  3VMM A;  4P71 A;  1A3T A;  4P2C B;  4NXN L;  2R8I A;  4JVZ A;  3TS0 A;  1L0W A;  3Q1K A;  3GTG A;  1EU4 A;  1C8C A;  1Q8I A;  2UXD H;  2J6S A;  4PZ6 A;  4KHP H;  1JB3 A;  1F2Y A;  3EBE A;  3GV8 B;  2WV6 D;  5IP7 H;  1EWH A;  2NVY H;  3EJI A;  2KED A;  2R6F A;  1WJJ A;  1WD1 A;  1MGS A;  4DPG A;  4C3J B;  2B63 G;  5DGB A;  1EY7 A;  1OXT A;  1CT1 D;  2YTX A;  4N9P A;  1N32 H;  4LAA A;  4DR5 H;  2F0F A;  2EYO A;  4A3I G;  2RSO A;  1V43 A;  3W5O A;  4GNX B;  3HP3 A;  3PUZ A;  3S15 H;  2WB1 A;  3OMC A;  2WAQ A;  1JR0 D;  4QWE A;  1SYG A;  1WTP A;  1D6E C;  3LWU A;  1FNU A;  3CCM A;  3LNN A;  1I6V C;  4ME6 A;  5KFE A;  2IHE A;  5EGT A;  4IUQ A;  4WFN 3;  3NTK A;  2K32 A;  4B3T L;  4I4T F;  1S9F A;  1SYF A;  2QEJ C;  1XMO H;  3NBH B;  4OL7 A;  3CPW A;  4A3B H;  2IPK D;  3RN5 A;  5I9P A;  1H9M A;  1MSG A;  2C9O A;  1JB7 A;  1B44 D;  3N43 B;  1SDF A;  4R4T A;  4O4H F;  2E2H B;  1W6J A;  2CQA A;  1CKN B;  1E1T A;  3IFT A;  4X66 L;  1OXV A;  4X62 Q;  2OWO A;  1TWC B;  1WYD A;  5FD5 A;  1K73 C;  1B8A A;  1HNW L;  1IYV A;  1ML0 D;  2FPG B;  5CBE E;  3VYU A;  5JEA G;  3LGJ A;  3HOY H;  4A93 H;  3S14 B;  2DJG C;  1A3U A;  4J9P A;  2LXJ A;  4QJF A;  3MAQ A;  4BBR H;  4B9W A;  2ICI A;  1O7L A;  5CB4 F;  1SSO A;  4K0K Q;  4MIU A;  1V9P A;  1TWG A;  3PN1 A;  3TP6 A;  4HJ5 A;  1N56 A;  2ASB A;  2R93 G;  5LP6 F;  4CKB A;  4E6I A;  2ASJ A;  4DV3 L;  1PVO A;  3NP8 A;  1I4R A;  5D65 A;  4ZRZ A;  2EYL A;  3CC2 A;  1KL9 A;  4I65 A;  3S9W A;  1EQV A;  1TWG H;  2VNU D;  3N6R A;  4J8Q A;  2YW2 A;  3N6X A;  1VCI A;  3NEN A;  3R93 A;  4TSS A;  4ZAI A;  4FXK C;  4C5A A;  5KFK A;  2JA7 A;  1E4E A;  4F8M A;  4NXM L;  1XPR A;  5KT4 A;  1B70 B;  1ZEQ X;  1CE8 A;  3T56 B;  2UXC L;  4QWB A;  4OHJ A;  1WCM B;  1LUZ A;  1O75 A;  2WIN B;  4AYB B;  3SE7 A;  4UCU A;  4CDF C;  4KHP Q;  2IW3 A;  5FLX L;  4QGU A;  4RB0 A;  5D1O A;  1C4Q A;  4DV6 Q;  1JXL A;  3SI8 A;  1EOT A;  5IE8 A;  3CCJ A;  3MFY A;  1HR0 L;  3QOJ A;  4EQN A;  5GAD C;  2BA0 A;  2K4K A;  3MEH A;  2QW7 A;  1X3P A;  4FDB A;  5FK9 C;  1M1K C;  3GIJ A;  2QF7 A;  3S2H B;  1P16 A;  1F9S A;  3GTJ B;  2A6H C;  3RGX A;  3K7A H;  1LAC A;  4LSX A;  1JJC B;  4RG1 A;  2FMM A;  2JYO A;  4DV2 Q;  2WP8 J;  4EYI B;  3K7A B;  4QIW A;  5DLF A;  2EYP A;  1G2T A;  2C2D A;  1Y1V B;  3MEF A;  3G6V A;  2M00 A;  4DV0 H;  4FNF A;  1G6P A;  2OXP A;  4BY7 B;  4RWS C;  1XPO A;  1JWU D;  5C0X J;  2R93 B;  1I6H H;  1B2T A;  1X3Q A;  2R7L A;  4B3M Q;  1TWC A;  5KFC A;  3TP5 A;  4NXM H;  3CRK C;  1CZW A;  1MBY A;  3QJY A;  1NNX A;  2KHS A;  4I7A A;  4U68 A;  1HNX L;  3RNU A;  2W7P A;  2VUM B;  3AYH B;  3S1R H;  1D5M C;  3IRB A;  4LF8 L;  3GTP B;  2XRQ D;  5IOD A;  4DV6 H;  1MJC A;  2N78 A;  4RGM A;  1I7L A;  3QOL A;  2XTI A;  4CDE C;  2VQF Q;  4HIM A;  1E4E B;  5C1O A;  1KBL A;  5E4X A;  1S3O A;  3S1R B;  4XT3 B;  1YIJ A;  1C0A A;  4DR7 L;  2C2E A;  1UC8 A;  4PMW A;  4RKB A;  3I4N G;  1LTG D;  4C3H B;  4DK0 A;  2AWN A;  3HOV G;  4ECX A;  5EBC A;  2E2I H;  1KLU D;  3E6Z X;  2WDT A;  4RMF A;  4U67 3;  4X3U A;  4KY7 A;  1XJV A;  4XYM B;  4QQB X;  4IWX A;  4ZUJ A;  1LAB A;  3ONA B;  1K1Q A;  5C44 B;  4HQ6 A;  3B6Y A;  3NWT A;  2NN6 I;  2JA8 H;  4DR2 L;  2W71 A;  3C46 A;  4R8U A;  1BCP F;  2JA7 B;  1M7J A;  1BDO A;  2JA8 B;  4JI0 Q;  3M3Y H;  1S0M A;  1VQ6 A;  4LSA A;  4KK7 A;  1G91 A;  2LS0 1;  2NVT B;  3OMG A;  4HIO A;  3QR8 A;  5CC4 A;  2F0G A;  4A3C G;  2W9A A;  4ED8 A;  3M3Y B;  5J1Z A;  4LF6 L;  3P7J A;  3S1N B;  5KYI A;  2KCC A;  1N48 A;  3M4P A;  3M85 A;  4BBS H;  3C0F B;  3AFP A;  1JKJ B;  1N33 L;  4M1U B;  4ZK9 B;  3QFF A;  2Q8I B;  2VS1 A;  5KFL A;  5FOB B;  2I0Q A;  4A3L H;  4DV4 H;  2R93 H;  1CZG A;  2L9H A;  5DEH A;  2PCF B;  1PYB A;  2XN9 C;  3J81 L;  4LFB L;  4ZQI A;  3OHA A;  5C6A A;  2PZT A;  4MZ9 A;  4KHZ A;  2D2C C;  1WVL A;  4DV2 L;  2EY5 A;  3FPU B;  4A3E H;  4EQP A;  3TP7 A;  2AQ4 A;  4LW1 A;  2WKC A;  2TSS A;  2HCC A;  3VR5 A;  3HOX H;  4KN4 C;  1IW7 C;  1Y8P B;  1FR3 A;  2MP1 A;  1ZQ7 A;  4O2A F;  2PZU A;  3PIO 3;  3OTO Q;  4G7O C;  1ULZ A;  4DNI A;  1IYU A;  1HZC A;  1Y8N B;  2A73 B;  3FMA A;  3M9O B;  2WAQ E;  1P8L A;  3K81 C;  4LK1 C;  2EYJ A;  3NQT A;  2YTY A;  4LMQ D;  4ZCK A;  3OPO A;  3BDO A;  4R4O A;  3AMU A;  4HIK A;  1A9X A;  3AFQ A;  1SE8 A;  5C3E H;  4WJ4 A;  2R7K A;  3T1H Q;  4NXM Q;  5JJZ A;  4JI6 L;  1TWF A;  1YNJ D;  4DR2 Q;  5LYJ F;  1KNA A;  4A3B B;  2FKL A;  2HDM A;  2NYZ D;  3R2I A;  1XTD A;  4DLK A;  1Q90 A;  3IL8 A;  1Y1V G;  2GA4 B;  1F2Z A;  2R7M A;  2UVV A;  2M2L A;  2Q8R E;  1PTO F;  1STN A;  3CKI B;  3HKZ G;  5FD6 A;  2F0T A;  4OGQ C;  3I56 A;  4IZ8 A;  2CW0 C;  4LF5 L;  3RB4 A;  2BE5 C;  1M4V A;  2W6O A;  2R6G A;  3JAM i;  3KJO A;  3GTL A;  3FDT A;  1BKB A;  3L9A X;  4I7H A;  4ECZ A;  2E74 C;  2E2H H;  3NTI A;  2F0S A;  5EJW A;  3VR3 A;  4I50 F;  1X9N A;  4RB3 C;  3R5F A;  2UVW A;  4EVO A;  2Q2I A;  3PO3 B;  1EOV A;  1O7Y A;  4QL5 A;  4DXF A;  3CCR A;  5DQG A;  1GUN A;  1KAB A;  2IX1 A;  5M5X H;  3GTM H;  1QB5 D;  1CHQ D;  4BA1 I;  1RCV D;  1XMO Q;  2UU9 H;  1EYC A;  4ECV A;  5KFR A;  5LMU H;  3HOZ G;  1VQJ A;  2B2V C;  1HNX Q;  2VOB A;  3GIL A;  2N55 A;  1QVG A;  3ZJY C;  3G6E A;  1JC7 A;  3DWQ A;  4K5V A;  3A5U A;  4GKK H;  1EIF A;  1K3B C;  5D14 A;  4DL6 A;  3TZD A;  4IPC A;  1I4Q A;  3RZD B;  4JYA L;  4GN5 A;  3Q8P B;  1GXD C;  1PH2 A;  3A54 A;  4DUY Q;  1GHK A;  4IFD I;  4QY7 A;  3F8N A;  4UAI A;  3I4N H;  3P20 A;  5C44 H;  3F2U A;  1V1Q A;  1YHQ A;  3HOV H;  3H0G H;  4YIJ A;  2VPQ A;  3CC4 A;  3TII A;  2IT1 A;  1WH2 A;  4RAY A;  2IBK A;  1I3Q H;  3VYR A;  4EQ5 A;  4M8A A;  4Q45 A;  3WWV A;  1VQM A;  2JA9 A;  4DF7 A;  4EEQ A;  4QWD A;  4DV5 Q;  4IN3 A;  1A3V A;  2PO4 A;  3STB D;  5HUR A;  5A2Q L;  1KHI A;  3CC7 A;  1FJG L;  1ZHQ A;  2VXW A;  4KMU C;  4M9U A;  2Q2H A;  4X64 L;  1AE2 A;  1VMP A;  4B3S Q;  4QW8 A;  3EQL C;  4L5T A;  3PR4 A;  2XVS A;  2B2T C;  3JC6 6;  4OX9 H;  4HSP A;  2RKS A;  2IP4 A;  1VAJ A;  4G57 A;  2UUC L;  3M9N B;  4ECT A;  2K01 A;  4IRD A;  3JSN A;  4DK6 C;  1SEI A;  1TWH H;  2A1A A;  1Y1W A;  4K2K A;  4R4I A;  3NQI A;  2PN1 A;  4YAJ B;  1PMR A;  3TZU A;  1IYJ B;  3E9H A;  3AQQ A;  3T51 B;  5JAV A;  5CA0 F;  2W7O A;  2BOS A;  2NVT H;  2WAQ G;  3G71 A;  1BUV T;  3GIM A;  3Q2O A;  4NXN Q;  2JA5 H;  2D9U A;  4YCW A;  5CV5 A;  2XD4 A;  2B2Y A;  4RA8 A;  1EEF D;  2JA5 B;  1VQP A;  3KK7 A;  2YV5 A;  4YHH L;  2F4V L;  2FK3 A;  2J9G A;  4K8I A;  2K5H A;  1BVS A;  2H5X A;  4ZLT F;  4ZYS A;  5KFQ A;  4F50 A;  2R8J A;  3RN2 A;  3M4Q A;  3Q23 A;  4MTD A;  3BYT B;  1BR9 A;  1SN8 A;  4IR9 A;  3S17 H;  1BCP C;  5DLG A;  2KVM A;  5EKK A;  3RZO H;  1EYA A;  1O7I A;  3W2D A;  1LT6 D;  1DD2 A;  1Z2P X;  3QWN A;  4LF7 H;  3K5L A;  2FK2 A;  2PW5 A;  1KJ8 A;  1HQR D;  2Z0S A;  4OO1 I;  4DGZ A;  4CJ1 B;  4X62 L;  1QUQ B;  1Y14 B;  5M5Y B;  1B04 A;  4A2A A;  3L2P A;  2EPB A;  3OYY A;  3KDF B;  2HQL A;  4JI5 H;  1HZ9 A;  2ICE C;  3J81 c;  5C4J H;  1EY8 A;  3CME A;  1NUC A;  2LSS A;  2MFI A;  5M5Y H;  1UC9 A;  1L2Z A;  1S5B D;  3GTJ A;  2D62 A;  2PNH A;  3H6M A;  2BH8 A;  2J0T D;  1EUJ A;  1IBK H;  3EFX D;  3HGB A;  4AH6 A;  3BJU A;  4B3T Q;  3GIP A;  4LFC Q;  4EFB A;  2FPP B;  2JEJ A;  3RLO A;  1E0B A;  1QIL A;  2AQ1 B;  2VA3 A;  2NVX B;  1B1Z A;  2NZ1 D;  3FHW A;  5BR8 H;  3T1Y H;  1HNW H;  4XDX A;  1DOK A;  2WAC A;  2K05 A;  4YWL A;  3PQI A;  4RUA A;  1SND A;  3TS2 A;  1CQF A;  1F77 A;  5IYB G;  2YZG A;  3PF5 A;  1XXG A;  4PWQ A;  4LNQ A;  3V4Z A;  3H91 A;  5F9L A;  4Q5V A;  1JQY D;  5KEE A;  3MZ5 A;  1AZP A;  4IRC A;  3U9O A;  4IJH A;  2Q2T A;  4UCR A;  1SYE A;  2KJX A;  4H0L C;  3BZC A;  4IFD J;  3CCS A;  2XWJ B;  3I4M G;  3JRW A;  4BXX G;  1TQO A;  3WO0 A;  3MXN A;  1KIX A;  1MSH A;  3T1H H;  2N3S A;  3K57 A;  4JI5 Q;  2E2J B;  4Q44 A;  4R4C A;  1S5D D;  5LMN L;  1OWT A;  1VQD A;  1QE6 A;  3GTP H;  5D1P A;  1S0O A;  3RTX A;  5KG6 A;  5T14 A;  3P1H A;  2F0J A;  3J7A F;  2FLP A;  2IMW P;  3G4S A;  1TWA B;  4YJ2 F;  4A3I B;  3KHR A;  2HHH L;  4HR7 A;  5TSS A;  3KYH C;  4A3I H;  4RGO S;  3EA6 A;  2JA6 B;  3N8D A;  3H0G G;  5KT6 A;  5BR8 Q;  3T1Y Q;  2ZXR A;  4JYA H;  2K14 A;  2ZJT A;  5FPO A;  4PG3 A;  3T4A C;  2VQD A;  2C28 A;  4DV7 L;  2R8H A;  1Y8O B;  4JI6 Q;  2YU9 H;  1JLL B;  1WTV A;  5C4H A;  2E5L L;  1EYD A;  3CMA A;  3S1M B;  4IFD H;  1ZET A;  1HUN A;  4CHT B;  4JI2 Q;  4JI7 L;  3OHX C;  4RFB A;  2L11 A;  3CD6 A;  4F4X A;  4LFA Q;  3O13 A;  1J5E L;  1JE5 A;  1UE1 A;  2K04 A;  4A3G H;  1A63 A;  5M3F G;  1ET9 A;  1HRJ A;  3A0J A;  1N32 Q;  2V58 A;  5J3B A;  3MFG A;  3U9S A;  1AEX A;  2R82 A;  4Y8V B;  3H4D A;  4DUY H;  2B29 A;  1EZ6 A;  4TKO B;  4HJ8 A;  4X3T A;  3V6J A;  3J7A K;  3KHG A;  2YL2 A;  4DXG A;  1F2M A;  4MN3 A;  2AQ3 B;  3BVZ A;  4LFB Q;  4ZHQ F;  1STB A;  2ZXP A;  4BY1 B;  1DZ1 A;  5T1I A;  4ILW A;  4KV6 A;  3D0F A;  3GTM A;  3ORQ A;  2RA4 A;  1D8L A;  5J39 A;  1LTR D;  5C4X G;  5L1K A;  1TY0 A;  4FBT A;  1I4H A;  4N9T A;  1LTA D;  1BO0 A;  4OX9 Q;  2KBN A;  1VQA A;  4LUO A;  3H15 A;  4LF6 Q;  4LMY A;  5M5W B;  2P0A A;  5JVL A;  3UDX A;  3F2C A;  5IIF A;  3KJP A;  1S5F D;  4H02 A;  2L0C A;  4C56 C;  4RGN A;  4DUZ L;  2QDL A;  2M05 A;  4U6P A;  1KRS A;  4YP3 A;  2DY7 A;  3MTS A;  1SNM A;  1VQF A;  2QA4 A;  3J7Z C;  1EWC A;  1Q3L A;  2NN6 G;  4B3R L;  5F2D A;  3C1E A;  4IR1 A;  2PW7 A;  3WDN A;  3J7A 5;  3BA9 A;  4NB3 A;  5BMV F;  4LF5 Q;  5HV6 A;  3GQB A;  3NUC A;  3BZD B;  2R7Z H;  1D2B A;  3NSW A;  2CZG A;  4IWY A;  1H9R A;  4GLX A;  3HKZ A;  2ZDQ A;  2ZJQ A;  2B3G A;  2H4O A;  2R7D A;  2Z4I A;  3RB6 A;  4A3E G;  1VQ8 A;  4RZQ A;  5EPK A;  5KFF A;  2J6U A;  4EEY A;  1KAA A;  1K3R A;  2OQK A;  3H0G A;  3OUZ A;  3BQ0 A;  5E1F A;  5J22 A;  4XYQ A;  3I55 A;  2O5I C;  1WTO A;  2E75 C;  1HTP A;  3DF7 A;  1CQI B;  4O3R A;  2LKV A;  2EY6 A;  3MXN B;  5EWF A;  1TS3 A;  1I94 L;  5DQI A;  1AZQ A;  1B3A A;  3N41 B;  4GN4 B;  1T94 A;  1JOQ A;  2VR1 A;  1FKA H;  4EBE A;  2YS6 A;  5FLX E;  3DHQ A;  4TQU S;  4N8F A;  3PZP A;  2YZN A;  3GP7 A;  2IA6 A;  3UQ8 A;  5GAG C;  3UI2 A;  2KA7 A;  4UCO A;  4PNY A;  4A2B A;  1LT5 D;  2IJ0 A;  4YCV A;  1CQV A;  1E3P A;  1UWV A;  4EGQ A;  5LL6 b;  2AGP A;  3PO2 G;  2EDG A;  2SEB D;  2Q2U A;  5KGU A;  4FU0 A;  3W1G A;  2O5J C;  1EIG A;  2CWA A;  1IL2 A;  2I07 B;  3MXP A;  2X6G A;  4UP7 A;  3EPG A;  1HXY D;  5A2Q W;  1Y1V A;  3TSS A;  3HOV B;  4C3H G;  3I4N B;  4NPS A;  3D3R A;  3D6C A;  3NXW A;  4LWC A;  1N33 Q;  2ZDG A;  1TT2 A;  3S15 B;  2XWB B;  1BF4 A;  3JSL A;  3I4L A;  4DV1 L;  1A2T A;  1QNK A;  3G6J B;  4KD4 A;  5H80 A;  2A6E C;  4Y52 H;  4RH6 A;  5C4J B;  4FXD A;  4A3B G;  3LML A;  1ZXT A;  4CBV A;  1DM0 B;  1GJX A;  1VQI A;  1WFQ A;  1RJQ A;  1B4O A;  2MJ8 A;  1A0I A;  1YHB A;  5LL6 X;  2K28 A;  3VPC A;  4DV0 L;  3CCL A;  2DY8 A;  4A3F G;  3KBX A;  3K58 A;  1N34 L;  5GAH C;  4A3G G;  2QK4 A;  3V6K A;  1EL0 A;  2SNS A;  1YJN A;  3GDE A;  2KHI A;  1QVC A;  4F88 A;  4WD3 A;  4XT1 B;  4QW9 A;  3M7N A;  4QMG A;  1H95 A;  2F03 A;  4HSV A;  2RSN A;  4XIG S;  2X69 A;  1XNQ L;  1E2Z A;  4AQY H;  2J6T A;  1SE3 A;  2RBM A;  5L1J A;  4DL5 A;  3MR3 A;  4DR7 Q;  1GLV A;  4JBJ A;  4JI6 H;  2PQA B;  3E5S A;  3SK8 A;  2R92 G;  4RNO A;  3RB0 A;  4A75 A;  1IBK Q;  2FPI B;  3ORR A;  2F0N A;  3H09 A;  1CUK A;  4LFC H;  3CU7 A;  2K1B A;  1WI5 A;  4DR1 H;  1N36 Q;  3M4O B;  3G7L A;  1KQS A;  5IOC A;  4BY7 H;  5CBA E;  3M4O H;  2F0E A;  2KEN A;  2K6A A;  4Z9C B;  3KHH A;  1HZB A;  2ZTD A;  4PDB A;  4KY6 A;  4GKJ Q;  3Q8D A;  1JJG A;  4TRD A;  2B39 A;  1EFI D;  1WTW A;  4R7R A;  3TQT A;  1VKZ A;  4DV0 Q;  4MV9 A;  2XGT A;  4NDX A;  1GVP A;  1UEB A;  1UEA B;  3ND9 A;  2X0S A;  1Q12 A;  2F4I A;  3K5I A;  4LFB H;  2HUG A;  3BYY B;  1QZH A;  2DLN A;  4WRD A;  1LTL A;  1FVI A;  2UU9 Q;  4LF9 H;  3A5Z B;  2R7F A;  3GTK B;  3AU7 A;  4RHR A;  3LWB A;  1HR0 Q;  1B6R A;  2JK8 A;  3MWM A;  5LMU Q;  3DLL A;  5EPJ A;  4A3K H;  1G29 1;  4PZ8 A;  1DV2 A;  1GSO A;  3T13 A;  5KT3 A;  1PTO H;  4C5B A;  1PRT C;  1SFO A;  5JPN C;  4LF6 H;  5BN5 A;  1TVX A;  4XQN A;  4B9X A;  5M3M B;  1K0S A;  5JVH 3;  1CI3 M;  1NE3 A;  4RCO A;  4UP8 A;  1N33 H;  1I4P A;  1EIH A;  4RNM A;  3PR5 B;  1Q82 C;  1H9S A;  5LXT F;  4YY3 L;  1PRT F;  4A3J G;  1PDQ A;  1AW7 A;  3H4B A;  2F0K A;  2K52 A;  2RDJ A;  5I6Y A;  2QIL A;  4DR4 Q;  5C8Y F;  1Z6H A;  4ECU A;  1NJI C;  3VYS A;  4OXP A;  4P73 A;  2NU6 B;  2R8K A;  4EX5 A;  3V4S A;  3PO2 H;  3W1B A;  4LF9 Q;  5GON F;  5DQH A;  2ALY B;  3I4M B;  3FKI B;  3I72 A;  4FBU A;  4A76 A;  5IYZ F;  4Q8F A;  5EAY A;  3I12 A;  3ZYY X;  4Q43 A;  3PW5 A;  3JAM E;  4C3H H;  1S0N A;  1U9R A;  4A3D G;  2PI2 E;  1DCZ A;  3K5H A;  2K5V A;  2TMP A;  2ATL A;  4A3M G;  4UP9 A;  1SFO H;  3DM3 A;  5KG4 A;  3GTQ A;  2A6H D;  2L1B A;  1PH5 A;  3S1Q B;  4L1K A;  2W9C A;  5EWG A;  3CQZ H;  1PTO C;  5IT9 E;  4ED3 A;  2NU7 B;  4FF4 A;  1EYG A;  5IT9 W;  1FNW A;  5CV6 A;  1BNZ A;  4X66 Q;  2YYA A;  3HOU H;  1NMG A;  2HJW A;  1K83 B;  5G3L D;  1GKH A;  2JE6 I;  2SNM A;  3X3N A;  4DA2 A;  1KJQ A;  3QG1 A;  4LF8 H;  2KCN A;  2QDB A;  3ICE A;  1WR2 A;  3QB3 A;  3GTO B;  2R87 A;  4JI8 L;  1WCM G;  4JV1 A;  4FM9 A;  2CQO A;  3OIQ A;  5FO9 B;  2VB3 X;  1S4Z A;  3CXC A;  4G7H C;  5I2Y A;  4GKK Q;  2AHO B;  3ERS X;  1IBL H;  1WCM A;  1OXS C;  4NMZ A;  4H13 C;  4JV5 L;  4BBS G;  1W3S A;  3F8T A;  1OXX K;  4JI8 H;  1LM0 A;  5G3L F;  3JAM W;  4U7C A;  2PMZ B;  4HCS A;  3DMU A;  1S10 A;  1XTC D;  4XX0 B;  1ICW A;  2WB1 G;  4DAY B;  3RBE A;  4GLA C;  4R8I A;  4ZKC B;  5KG2 A;  1PXU A;  2W70 A;  3LWE A;  1JJ2 A;  1VQB A;  4IFD G;  5LA6 F;  1XNR L;  4CDC C;  3J81 j;  2RGR A;  1QCB D;  2HCI A;  1IKL A;  5ELD A;  2JA5 G;  3PCO B;  1SR3 A;  2Z6K A;  4A3E B;  2BH2 A;  5KX5 F;  1YHA A;  1D7Q A;  3HOY B;  3RMH A;  4YWM A;  4A93 B;  1HFN A;  4ZOL F;  5C1P A;  1Z7T A;  3ULL A;  3J80 i;  2ID0 A;  1LTS D;  1RHP A;  3JZI A;  1R9T A;  3GTQ B;  3TME A;  5KYL A;  3SK5 A;  4DL3 A;  2CWP A;  1JX4 A;  1Q1E A;  1ICF B;  1B7Y B;  3WOE A;  5M5W H;  3RV3 A;  2ZM6 L;  3R3O A;  3BQ2 A;  1G6Z A;  4H7B A;  2JA6 H;  4HAE A;  1QVF A;  4JK1 C;  3KLS A;  5ELF A;  4XYL B;  3QZ8 A;  1BCP D;  3VDY A;  3GO5 A;  5KG0 A;  4YB8 B;  4JPB W;  4FS2 A;  2CHB D;  4DR7 H;  4QWC A;  3GII A;  4GOP C;  3Q24 A;  2W6M A;  4JBW A;  4IAL A;  2FIN B;  3L4K A;  4X3S A;  4PQX A;  3CAM A;  3S16 H;  2W9C B;  5JH7 F;  2B2V A;  1B6S A;  3NHH A;  5L37 A;  1QUQ A;  3J80 L;  1MJE A;  1CTM A;  1IKM A;  1SNC A;  2N88 A;  2L4N A;  1EY6 A;  2F0O A;  2I80 A;  4G3I A;  2JP1 A;  2NVY A;  2KEC A;  3I90 A;  1JOR A;  2W8L A;  4HJ7 A;  1IBM L;  2IX0 A;  3HS0 C;  4KKT A;  2JXM B;  1ONL A;  1VF7 A;  4EQO A;  5BPF A;  5K36 G;  4XZ3 B;  2K5N A;  4Q0F A;  1PLF A;  3HOZ H;  3UDG A;  4AQY L;  1TS2 A;  3GTG H;  5KFU A;  4EGJ A;  3PUX A;  4WJW A;  2K5W A;  3HOZ B;  4R8N A;  1XNR Q;  1EEI D;  3FVQ A;  1HR0 H;  5KRU A;  5IYC G;  4DL7 A;  1DJR D;  1NR2 A;  2KCM A;  4BWG B;  3PUW A;  1SNQ A;  1UE6 A;  2PMZ E;  3I73 A;  2L55 A;  2NBF A;  1OO9 B;  5CV9 A;  2DJF C;  2LY7 A;  2ZXO A;  1Q46 A;  1R4Q B;  1X56 A;  5ELO A;  3H0G B;  5C5M A;  4DR1 L;  4AQY Q;  2UUA L;  4MA5 A;  5C3E B;  4ZUI A;  2HVR A;  1KNE A;  2DNE A;  1SE4 A;  4XQQ A;  1PYW D;  1VDZ A;  4HJ9 A;  4K0K H;  3K80 C;  1X6O A;  2SOB A;  4YR0 A;  4QF4 A;  2ZJR A;  1W96 A;  1SXT A;  5JOB A;  1M6V A;  3E5N A;  2NUC A;  4KTA A;  2NU8 B;  3J80 E;  4JW0 A;  1L1O C;  2R7Z A;  2MUY A;  3U4V A;  4KI0 A;  5FO7 B;  1ZKO A;  2W8K A;  4RCN A;  2C35 B;  3OW7 A;  1XYI A;  4RZR A;  2DIK A;  1MHW C;  3L7Z C;  3KTM A;  2XGQ A;  1U4P A;  3URY A;  4GKJ H;  4S3S A;  3AB9 A;  2I46 A;  2A68 C;  3HOU B;  4BBR G;  3N44 B;  5KFB A;  2E5L Q;  3BG5 A;  4GLV B;  4LF7 Q;  2MNA A;  5KG7 A;  4HJA A;  4C3I G;  3MVV A;  4A3K B;  4X64 H;  1SRO A;  4OWT B;  1I3Q A;  4J9N A;  2QEX A;  4JI3 Q;  2Z6K C;  1UNS A;  1R9T B;  4XYO A;  3PF4 A;  1GHJ A;  1LT3 D;  4YQW A;  3ER0 A;  1C30 A;  1JT8 A;  3FPP A;  5FKA C;  3S2D B;  4OO1 H;  3EN2 A;  3BS1 A;  4JBM A;  1B3Q A;  1PRT B;  4MV1 A;  1KDC A;  2WFW A;  4JOI C;  1EIY B;  1SYD A;  3QO2 A;  3TEH B;  2VY3 A;  2OLS A;  1SAP A;  4UPA A;  1K8O A;  3DEO A;  3C2P A;  4JI5 L;  1C48 A;  1TWG B;  4HMI A;  4QIW B;  2KCT A;  1K9M C;  1GUS A;  1PV4 A;  3K0Y A;  3S17 B;  3IG0 A;  3HZX A;  2UUA H;  3JRX A;  3Q22 A;  3Q8R B;  5IT9 L;  1ILQ A;  3GIK A;  3RLF A;  2W6N A;  2JA6 G;  5EZY F;  2BR0 A;  1HA5 A;  1T9H A;  2UVU A;  3UE0 A;  4ABN A;  1VQN A;  1Y1W H;  4X64 Q;  1D5X C;  5C0X H;  5GQO A;  4R1J A;  1HNZ H;  4DR4 H;  4RHS A;  2C5C A;  2ZTE A;  3D6W A;  2A19 A;  1EY4 A;  3IN5 A;  1SFO B;  4DV5 L;  1V8Q A;  3TRE A;  5KFW A;  4ECS A;  5KNC A;  2RF4 A;  3S24 A;  1G8Z D;  5CA1 F;  2OEO A;  2RDF A;  2UXB L;  3RLN A;  2P5Z X;  4LF4 L;  4UY8 C;  3CRL C;  3TQY A;  4RAZ A;  4DNR B;  1I3Q B;  1K83 H;  1IOV A;  1LTI D;  1SMY D;  3ULJ A;  2V5A A;  3HRZ C;  1SEB D;  4JYA Q;  4TQS A;  5I2X A;  4MAM A;  4TUY F;  4DR6 Q;  1H9K A;  1ZYR C;  1L2F A;  5E3F A;  1QNU A;  1EHI A;  5KFM A;  3UDI A;  5KFP A;  3Q8Q B;  4O3S A;  2KSW A;  1RF2 D;  2RDG A;  3VYT A;  2Y0S E;  2RVL A;  2SCU B;  2WKD A;  5KNB A;  1N36 L;  3RIZ A;  4BY1 H;  1STH A;  2OT2 A;  4R4Q A;  4UFZ A;  5KFG A;  2AUK A;  2YTV A;  4YR3 A;  3FKI H;  2FMA A;  1GYF A;  3FDS A;  3K59 A;  1G51 A;  1IBK L;  1JE4 A;  2B8G A;  3KXY T;  1VQO A;  3KAJ A;  2NU9 B;  1X3G A;  1J9O A;  4ED6 A;  1JOK A;  4DL2 A;  2G5D A;  4J6H A;  1XNQ Q;  4CJ0 B;  2YRW A;  3OUU A;  1TWH A;  2R93 A;  1WD0 A;  4JI7 H;  4JCV E;  3KFU A;  2E2I B;  2NTT A;  1JWM D;  2L12 A;  2WB1 B;  2KQ3 A;  5EBD A;  1TWA H;  4O3P A;  2A69 C;  3N40 P;  1K83 A;  1WTH A;  4P74 A;  3NTH A;  5BN3 A;  3RBD A;  5DG9 A;  1N8R C;  1SJH D;  2CW8 A;  3MR2 A;  1DYQ A;  3S1M H;  2MCT A;  5IP7 G;  2AKW B;  3QIA A;  3BVM A;  4DAP A;  2JA8 G;  4DNT B;  4IAJ A;  2JA7 G;  3E0J A;  5ELE A;  2JEB I;  4MV6 A;  3Q8S B;  4A3C H;  1AFP A;  1U0L A;  1XNR H;  2HQE A;  2RCF A;  1YNJ C;  4B3S L;  1TS4 A;  3M4I A;  5HBR B;  3MFI A;  1IOW A;  4IUN A;  4DV1 Q;  3EYY A;  2WAQ B;  4FP5 D;  1DON A;  3KLW A;  3V2T A;  3OTO L;  1EQQ A;  2FE3 A;  4EBD A;  2EY1 A;  1PX2 A;  2WE6 A;  1PH3 A;  1JDB B;  3AEV A;  2JN4 A;  2BQR A;  2BE5 D;  2BDO A;  5CMD A;  2V4D A;  1PZJ D;  3OIP A;  2VW9 A;  4X65 H;  4A3M B;  4LF5 H;  1C7Y A;  2IY5 B;  1Q81 C;  1JWS D;  2B2Y C;  3RAQ A;  2V59 A;  2XSC A;  1M0W A;  1SYC A;  3NPP A;  3CCE A;  3CCQ A;  3I2Z A;  2VUM G;  4DK3 C;  4CKE A;  2GPW A;  2K03 A;  2DN8 A;  5LL6 S;  4RB1 A;  1VBG A;  1XMQ H;  1XX8 A;  5COR A;  2L5T A;  4DAY A;  1YNX A;  4FF2 A;  2W57 A;  3T5H A;  3D31 A;  4BY7 G;  4C2M H;  3BZK A;  1MD2 D;  5IYD G;  2AGQ A;  4IPD A;  3MWY W;  5JEA H;  2AGO A;  3HB9 A;  2H1E A;  1SNO A;  4O4I F;  3N42 B;  4UCT A;  2AMC B;  1ENC A;  1LTB D;  2PYK A;  1Z9F A;  2MQH A;  1WOC A;  1GOZ A;  1UE7 A;  1TA8 A;  3I91 A;  1WTR A;  4MNO A;  3RV4 A;  3GQC A;  2FJ2 A;  4N8X 1;  1HNZ Q;  1XMQ L;  2R86 A;  3WOF A;  2F0V A;  2I5L X;  1S5E D;  5IWA Q;  1BJT A;  1YNN D;  1VQC A;  3BDC A;  2XIG A;  1ENF A;  3KAL A;  3EVQ A;  5JJI A;  2QCP X;  5C4X B;  4L8J A;  5M9O A;  3H3V C;  1AUX A;  1BQQ T;  1RJR A;  1UUP A;  4ME5 A;  4OWW B;  5KFX A;  2F0W A;  1XMQ Q;  1EQT A;  1EFW A;  5J2T F;  2EYM A;  2Z9H A;  3PW0 A;  4WJ3 M;  3SVM A;  4ED7 A;  1TWF H;  1STE A;  2V9W A;  1K28 A;  1BCP B;  1GGO A;  3VR6 A;  2NN6 H;  2EXZ A;  1PZI D;  1EQR A;  3U4Z A;  4MTE A;  3CHB D;  4GZY C;  3R5X A;  1EY5 A;  5D1O B;  2EY2 A;  3WO1 A;  4CC6 A;  1HCZ A;  1TWH B;  2F52 A;  4QUF A;  2KOL A;  5I9O A;  4X66 H;  2EIF A;  1TS5 A;  4B3M L;  2F0M A;  1Q86 C;  3FKI G;  4HR7 B;  4K8J A;  3U9T A;  3ETH A;  4ULL A;  1VQ7 A;  2IWH A;  1JCK B;  4BS9 A;  4GN3 B;  5I4D A;  1IBL L;  5C44 G;  5JVD F;  2E5L H;  4Y7N B;  2FFK B;  2ALZ A;  3F2D A;  2MO1 A;  4MV4 A;  4IZO A;  3BQ1 A;  1IBL Q;  5I6W A;  1RTN A;  1KC8 C;  1AH9 A;  3TDQ A;  4F7X A;  4IHJ F;  4IUT A;  1HQM C;  4MTK A;  2VPS A;  3VPD A;  3RZD H;  3G48 A;  2R7Z B;  1DOM A;  2BCO A;  3KLR A;  4AIM A;  5KFV A;  4IJL A;  5CR3 A;  2R92 A;  1PFS A;  1VQG A;  2PBZ A;  2CW0 D;  1WSC A;  2JA5 A;  2GVB A;  4KHP L;  3K0X A;  1C9O A;  3HOU G;  3MXG A;  1PTO D;  5DAU A;  1I94 Q;  2PI2 A;  3OWE B;  5FJ8 H;  4JBK A;  4QWA A;  2R61 A;  4OON A;  5COY A;  3M7G A;  3HOW B;  2O03 A;  5JJL A;  4JI1 H;  4JI0 L;  3KBG A;  3K3P A;  5JUM A;  1WCM H;  4Q0Y A;  2D0P A;  1LTT D;  4ED0 A;  2A74 C;  2HT1 A;  3BG3 A;  3KF6 A;  5DM6 3;  4MV7 A;  1XNQ H;  3HKS A;  3JAM c;  2CW7 A;  5KFH A;  1BGW A;  1CKO A;  1SRU A;  2CVR A;  2HHH Q;  3PO3 H;  3KAK A;  1PK8 A;  5KFO A;  1JMC A;  3ERO A;  3J7Y W;  3RJ0 A;  4DK1 A;  1R9T H;  1STY A;  1M90 C;  4JC0 A;  4GC7 A;  2EJF C;  4LF4 H;  4KKU A;  1N34 H;  1HNZ L;  2VUM A;  2EYF A;  3NK9 A;  5C3W A;  1KXL A;  1E4F T;  1X32 A;  2VQF H;  4GC6 A;  5LHY 1;  5E4W C;  3D4R A;  5DLQ E;  2EJG C;  2VQF L;  3A8K E;  1CK1 A;  1F2L A;  1OTC A;  1AP0 A;  1RYR A;  4LF8 Q;  2NVX A;  3KUP A;  5IY0 A;  1PFN A;  3M9B A;  3SXH A;  2XCA A;  2VZA A;  4AYB G;  3PW7 A;  4K14 A;  3E3X A;  3PIO A;  1HNW Q;  4DFA A;  2UXC H;  3STB C;  4DR6 H;  4KKS A;  1H9J A;  4DN4 M;  1B9M A;  1Z2N X;  4A3L G;  4L5R C;  2VB2 X;  3CVZ A;  3RGZ A;  4DL4 A;  3KDF A;  1YZ6 A;  1EU3 A;  1FD7 D;  4AYB E;  3VPB A;  5IGG A;  1LYL A;  2Z6B A;  2F0Q A;  4I7Z C;  4R8U B;  2FLL A;  2W6Z A;  2HIV A;  3TP8 A;  1SMX A;  2RDI A;  2BA1 A;  4LF4 Q;  1II3 A;  1IXR A;  1TR5 A;  3PGZ A;  3NWS A;  1X55 A;  4FF1 A;  5HGQ A;  3KLS X;  1HHV A;  2PPB C;  3RAX A;  3NE5 B;  1BOS A;  1BBX C;  1J5E Q;  1V4Y A;  2E2H A;  4YJ3 F;  4KJN A;  3BAA A;  4O42 A;  1SYB A;  3MC0 B;  1IZ6 A;  4JI7 Q;  1NAP A;  5IGC A;  1KJI A;  5KG5 A;  3SR1 A;  1JIH A;  4IPH A;  5ELN A;  1V51 A;  2FJZ A;  3M4Y A;  2GLT A;  2RDH A;  4R9W A;  3GV3 A;  1QG7 A;  1U4L A;  2UXC Q;  3L3O C;  3SHL A;  2B2W C;  3R2T A;  3K8A A;  4L5Q A;  3J80 W;  5C3E G;  2JQO A;  1TXY A;  3KOJ A;  1GSH A;  2JEA I;  5FPR A;  4ID6 A;  3DWP A;  2AUJ D;  3GV6 A;  1I6H B;  1UAP A;  2W9B B;  3ETJ A;  5J2U F;  3J7A V;  5H1S E;  4JI4 Q;  2Z4H A;  2K7V A;  1SNP A;  3HG9 A;  1Y1V H;  3I4O A;  2L15 A;  1KDA A;  3SEB A;  5KIX A;  5FLX c;  1PA6 A;  2OCE A;  2F3V A;  2WB1 E;  1EY9 A;  1PH1 A;  1HFG A;  5IYC H;  1PHJ A;  3RUP A;  4NKL A;  4RAU C;  2E2J H;  2JA6 A;  1SE2 A;  5AJ3 L;  4F4W A;  2ZDH A;  2JJQ A;  1YIT A;  5EKI A;  5GRO A;  3H3V I;  3H94 A;  3MA2 B;  5L1L A;  2F3W A;  1C3O A;  5KND A;  3NEL A;  4DR2 H;  2QGQ A;  3MWD A;  1LT4 D;  1EZ1 A;  1RJP A;  3HOX B;  4JI3 H;  4X6A H;  1IW7 D;  3T5K A;  4K5X A;  4DV4 L;  1RL2 A;  3GD7 A;  3HFZ B;  2B2U A;  5D3D A;  2FK1 A;  4C2M A;  2PQE A;  4L5S A;  4ZI7 F;  3TN2 A;  2W6P A;  1NTG A;  5KT2 A;  4YBZ B;  1KAW A;  3ULP A;  5FJ8 G;  1VQH A;  4DR6 L;  1FJG Q;  4POG A;  4EGV A;  4HID A;  4DV3 H;  3D4W A;  1RK5 A;  4LUV A;  4J9S A;  3PMF A;  4IRK A;  1TII D;  2F0P A;  4HN7 A;  4NW2 A;  5CV7 A;  3E9I A;  2JEF A;  1GD7 A;  4YWK A;  3W3A A;  1RIP A;  5T1G A;  4A3M H;  3H3V H;  3S16 B;  2UUA Q;  1MZB A;  1XPU A;  2F0D A;  2R84 A;  3A7A B;  2MO0 A;  5K5P A;  2IX3 A;  1ESR A;  4PMC A;  2ATW A;  5E7N A;  3OW2 A;  1CKM A;  2HDL A;  2LFN A;  4O1N A;  2KUM A;  4A3D B;  1B50 A;  3RB3 A;  4IUU A;  4NLG A;  4Q8E A;  4BBR B;  3J81 E;  5BPH A;  1Y69 U;  5KFN A;  5ISR A;  1XMO L;  4KY5 A;  4C5C A;  3TQ1 A;  3T53 B;  1QZG A;  3HOY G;  3BVG A;  1H9S B;  3Q0A A;  4A93 G;  3CPF A;  2RHQ B;  2K5Q A;  4YHH Q;  5DNF A;  2XC9 A;  2W9B A;  2B2U C;  1TAE A;  1TKW B;  5F9N A;  3V6H A;  4H44 C;  4C1N I;  2NWG A;  2EQS A;  4HTH A;  2PVP A;  2K5D A;  2K75 A;  4GNX C;  5EQ0 A;  4B08 A;  4J9L A;  1GUT A;  5IP9 G;  1S68 A;  3PUY A;  5ELC A;  4JI4 L;  4JOI A;  2R7Z G;  5C4Z A;  2EZV A;  2VUM H;  4WBN F;  3VR4 A;  3GTP A;  2V4Q A;  3PUV A;  1GUO A;  2A6E D;  1BNC A;  3UFX B;  1TU2 B;  4POF A;  5CGK A;  1EYZ A;  1XDN A;  4DUZ H;  3RZO B;  5EPL A;  2G9H D;  4ME3 A;  3C1F A;  3DUZ A;  1O80 A;  4FF3 A;  4LF7 L;  5EWE A;  3R5H A;  3G6X A;  5K2M A;  3GIQ A;  2V4R A;  2NVQ B;  2UUC Q;  1Y1W B;  1W93 A;  5KFY A;  5KT5 A;  1MKH A;  4XXE A;  2YZM A;  5KFT A;  3MR6 A;  1LO5 D;  1NMF A;  2AU0 A;  3HOW H;  3F1Z A;  1TWC H;  3K7U C;  4J0M A;  2YU9 A;  5IGB A;  2F3I A;  3S2H H;  1CS0 A;  2G9D A;  5CV8 A;  1SMY C;  4O2D A;  4L63 B;  4O2B F;  4DKA C;  3DWA A;  4IUR A;  3N52 A;  1ZYR D;  1E2V A;  5FLX W;  4RU9 A;  5NUC A;  5M3M H;  4DAM A;  1YJ9 A;  2FXQ A;  3GTJ H;  4DUY L;  3KF6 B;  4RKL A;  5KG3 A;  1NCV A;  2PMZ A;  2LMC B;  4MTN A;  5ELB A;  2N49 A;  4XTC S;  1ROD A;  2QYZ A;  1GSA A;  2DGY A;  2JEG A;  5JEA J;  1UNN C;  1PFM A;  5IYB H;  5KFA A;  2EYH A;  3I4M H;  2FP4 B;  2R92 B;  3GTL B;  2B2T A;  1JIC A;  1WTQ A;  3EIV A;  2NZH A;  3GTO A;  4X65 Q;  2EOT A;  5KFI A;  1VQL A;  1Q8K A;  3ERQ A;  4DR3 L;  2Z8L A;  5JQW A;  1A8V A;  3G6Y A;  5IGE A;  1E7Z A;  4JI4 H;  3GLK A;  4YR2 A;  1DV1 A;  3G8C A;  1RYS A;  3OWF A;  2BQU A;  1N36 H;  2K50 A;  3VA5 A;  3NBI A;  1L1O A;  3SDZ A;  2I5H A;  1ENA A;  1SYX B;  2W6Q A;  2Z1C A;  5DG7 A;  2YU9 B;  4YHH H;  3MWE A;  4V0B A;  2XCP A;  1MIU A;  4O0A A;  2ZJP A;  1FNV A;  1U4M A;  1PRT D;  2C00 A;  2VA2 A;  1U5K A;  4CDD C;  2NVX H;  3I70 A;  3T1H L;  2RQX A;  1NBW A;  5HY6 A;  1S97 A;  1V1P B;  1HZA A;  2PQA A;  3CF5 A;  1ASZ A;  1W2B A;  4RUC A;  3J80 c;  1VQK A;  3MR5 A;  4MV3 A;  4AYB A;  1IL8 A;  1G2S A;  1EY0 A;  3VR2 A;  1I50 A;  1LLR D;  3PV0 A;  1J6Q A;  4BBS B;  2Y0S B;  2ZTC A;  4IO9 A;  1I4G A;  4LF9 L;  2C2R A;  2PZW A;  1FGB D;  3Q6S A;  1CA5 A;  4J9M A;  1I6U A;  1U4R A;  2ASL A;  1T36 A;  4XQJ A;  3GV5 B;  1RDP D;  1RJT A;  1FJG H;  4DU9 A;  2FB9 A;  3F2B A;  1MI2 A;  2UUC H;  1X54 A;  5CAE B;  4KLK A;  2KHJ A;  3IAY A;  4YCU A;  4JV0 A;  3OHB A;  4ECR A;  4K6L A;  4IOA A;  1X65 A;  1M8A A;  2J7Z A;  4F4Z A;  1M0T A;  5EOY A;  1L0X B;  1A15 A;  1Z47 A;  2F0U A;  4PZ7 A;  1SCU B;  2OTL A;  1SJE D;  3K5N A;  3CCV A;  1F9Q A;  1HPC A;  1CHP D;  5C0X G;  3C3L A;  3A55 A;  4ED2 A;  4FXG C;  3QZ7 A;  1VQE A;  2VQE L;  2NVQ H;  4X62 H;  1EWI A;  1BXT A;  2NB0 A;  4OO1 G;  4DV2 H;  1T3N A;  2E76 C;  2ZM6 H;  3HKZ B;  3FMC A;  4DV6 L;  1PH8 A;  4PMB A;  4J9K A;  5KKN B;  4C3J H;  1FL0 A;  4X3K A;  4TV9 F;  1A62 A;  2LXK A;  1YNN C;  4J9Q A;  1FYC A;  2VL6 A;  2O2L D;  3GTK H;  4GKK L;  2YRX A;  5KT7 A;  4B3M H;  4HCE A;  4O3Q A;  2UUB H;  3HOW G;  5L1I A;  5CYU A;  3WNZ A;  1GO3 E;  1O7Z A;  3T16 A;  5D3I B;  3PW2 A;  3GTK A;  3CCU A;  3PW4 A;  3SK6 A;  2CH4 W;  3D8G A;  3KF8 B;  4OEL B;  3S1N H;  1L1O B;  4K6D A;  4A3J B;  2Y0S A;  3RF2 A;  4GKJ L;  2YS7 A;  5KFZ A;  4RB2 C;  1E24 A;  1EUC B;  1YEZ A;  3DXJ C;  4IOC A;  1NSN S;  5IWA L;  3E0E A;  2B63 H;  1VQ9 A;  5M3M G;  5IWA H;  4DV3 Q;  4GOP A;  4ED1 A;  3PVX A;  4P72 A;  1I94 H;  1EZ8 A;  2MGS A;  2YYZ A;  3NEM A;  4A3D H;  1NY4 A;  2OQ0 A;  3PO2 B;  1KEE A;  4IUP A;  4JI1 Q;  3LP8 A;  4DV1 H;  2RCN A;  3U58 A;  1ESF A;  4QB4 A;  4LH7 A;  2E8G A;  5FO8 B;  4EG0 A;  4J1M A;  1CM9 A;  4K2L A;  4DV7 H;  2JEI A;  2YCH A;  2NTS A;  5A35 A;  2R85 A;  3MHB A;  4KHV A;  3TIN A;  4EFE A;  1RD9 D;  4J9R A;  4JG2 A;  4KN7 C;  1CSP A;  1K8A C;  2HIX A;  4JI0 H;  3I8Z A;  4APV A;  2DUD A;  4DR4 L;  1TY2 A;  2EXD A;  4ECW A;  3PSI A;  2Y0S G;  4HNV A;  5IGD A;  2CKZ B;  4K5W A;  1N34 Q;  4ECQ A;  1FGU A;  4HMJ A;  5FLM H;  5DGA A;  3OSO A;  4YY3 Q;  1I5F A;  4BA2 I;  2DWC A;  1STA A;  5IT9 c;  2FLN A;  4DAV A;  1KJ9 A;  2VQE H;  2UXB Q;  3K3V A;  3FRP B;  3DEP A;  1I4X A;  4CC5 A;  1R4P B;  1E2W A;  1KRT A;  3P75 A;  2A5H A;  4MV8 A;  5JVG 3;  1VF5 C;  3MJF A;  1I7N A;  2WYO A;  2FMC A;  3J81 i;  2NZO A;  2FHT A;  2PNR C;  5LMU L;  5A2Q E;  2HVQ A;  3GID A;  2JSO A;  4G4K A;  2UU9 L;  1PH9 A;  3T5L A;  1KLG D;  2XRS D;  1AN7 A;  1HNX H;  2X6L A;  3IFD A;  1D1I A;  3RD4 A;  3RR5 A;  4L6T B;  3JAM L;  1K0R A;  3TBI B;  3OTO H;  2OTJ A;  2DPJ A;  3HXL A;  4JV2 A;  4F87 A;  1OXU A;  1TWF B;  3A56 A;  3S14 H;  5LOV F;  4EYH B;  3NGD A;  3BJY A;  2I5M X;  1E1O A;  2DZD A;  4A3F H;  3V05 A;  2HVS A;  3A74 A;  5GAE C;  1Q1B A;  5IYD H;  5C3X A;  2OH2 A;  5EDW A;  4A4I A;  1PZK D;  4B3R H;  1SLJ A;  3BU2 A;  1HR0 W;  3H20 A;  4C3I H;  4FO2 A;  5I47 A;  1X3F A;  1UE5 A;  1PFB A;  5JPM C;  3CQZ A;  2R92 H;  2N8N A;  4GOP B;  2B63 A;  5HGT A;  1N9W A;  3UE1 A;  1K8G A;  3GTQ H;  3L0O A;  1VQ4 A;  1PH7 A;  1BBW A;  1J8I A;  4JI3 L;  3I7F A;  1EUD B;  4HNU A;  4JI1 L;  3FP9 A;  4HED A;  1NR4 A;  1F9R A;  1JOO A;  4K0K L;  2IHF A;  2RGV A;  1AN8 A;  2E2D C;  3OSN A;  1BBU A;  4BWS C;  3L4J A;  3A7L A;  2M9V A;  4J9O A;  1I50 H;  2F4V H;  2XCL A;  5M3F B;  3RUZ A;  1CQJ B;  2UVR A;  5LMN W;  4DR3 H;  4IPG A;  2MPM A;  1GUG A;  1TWA A;  3KF8 A;  1VBH A;  3TRZ A;  5C0X I;  1KTK A;  3IKJ A;  3D4D A;  4O3N A;  3EPI A;  5EKL A;  3LX0 A;  3S1Q H;  1K1S A;  2ZT9 C;  3ITP A;  4IUV A;  2RHS B;  2V1C C;  1JDE A;  4B3R Q;  4HYK A;  1S5C D;  3R8B A;  3H40 A;  5K36 H;  4FYD A;  1D1K A;  2XNA C;  1ILP A;  3RFC A;  4IQZ A;  4MA0 A;  4HNT A;  4LUZ A;  2O4X A;  3FEW X;  1DOL A;  2B2W A;  3BDL A;  4X65 L;  4DR1 Q;  3PIP 3;  2ES2 A;  1VMC A;  4E4T A;  3MXU A;  3K5O A;  4O4L F;  5DM7 3;  4FS1 A;  1T5X D;  1IHZ A;  4C1N K;  4DR5 Q;  5M5X B;  3GTM B;  4OEM B;  1DGS A;  4C3I B;  4A3K G;  1HJP A;  2AQ2 B;  2F0H A;  5L9X A;  4I55 F;  2VQE Q;  4A3G B;  4KD3 A;  1S72 A;  1WTX A;  2I8C A;  2UXB H;  4JUZ A;  2DPI A;  4A3F B;  2ENB A;  2SDF A;  2NVY B;  3V96 A;  4G7Z C;  4KJO A;  3K6O A;  3FKI A;  4TV8 F;  5C5J A;  1B53 A;  2QKI C;  2UUB L;  3S2D H;  1V1P A;  1YBY A;  1K8M A;  2DNC A;  4QIW E;  1HTL D;  4CKC A;  1B9N A;  4ALP A;  3PIP A;  4ETS A;  5DG8 A;  4DV5 H;  1J5E H;  4CGY B;  4LH6 A;  3GTL H;  4Y7N H;  2HHH H;  4BXX H;  4J15 A;  1IBM Q;  4B3S H;  5CV4 A;  1KC7 A;  1I50 B;  2HD3 A;  3SK4 A;  1N32 L;  1KJJ A;  5KFJ A;  2EJM A;  1YVC A;  3HEJ A;  3M9M B;  3I3C A;  3CW2 C;  2J4X A;  2AWO A;  3GV7 B;  5FLM G;  1SBB B;  5LMN H;  2IL8 A;  4CJ2 C;  2GN5 A;  5D8D A;  3T5J A;  3ND8 A;  4WOR A;  4LFA L;  3CQZ B;  5M3F H;  1S40 A;  2CCZ A;  1HUM A;  4JI2 L;  3HBL A;  3J81 W;  1QJO A;  1Z2O X;  2A8V A;  3U50 C;  1GUW A;  2VUG A;  1DXM A;  1YJW A;  1RK6 A;  3OOC A;  1O78 A;  1ZHS A;  2I87 A;  4TQR A;  4NXN H;  3X3M A;  4DV7 Q;  2GPS A;  1STG A;  1S03 G; 
#chains in the Genus database with same CATH homology
 2JJQ A;  2YV5 A;  4YHH L;  1HH2 P;  1YIT A;  2F4V L;  5GRO A;  3H3V I;  2K5H A;  1BVS A;  1QUQ A;  2H5X A;  3SGI A;  1MJE A;  4GS3 A;  3RN2 A;  3M4Q A;  5C4X H;  1PH6 A;  3NEL A;  2D0O A;  2QGQ A;  3GTO H;  2ZM6 Q;  1SN8 A;  2UXD L;  2JA7 H;  3S17 H;  5JJK A;  3RZO H;  4X6A H;  1O7I A;  3HOX G;  2GVA A;  4DV4 L;  1RL2 A;  3GD7 A;  3HFZ B;  4HJ7 A;  1IBM L;  2IX0 A;  4DR3 Q;  5LMN Q;  2Z0S A;  4OO1 I;  4DUZ Q;  1VS0 A;  4L5S A;  4X62 L;  1QUQ B;  1Y14 B;  1NTG A;  2CFM A;  2K5N A;  1KAW A;  3ULP A;  5FJ8 G;  1VQH A;  3L2P A;  3HOZ H;  4DR6 L;  3UDG A;  4AQY L;  1FJG Q;  3OYY A;  3KDF B;  2HQL A;  4P75 A;  4POG A;  3GTG H;  1HZ9 A;  4HID A;  3J81 c;  3PUX A;  2UUB Q;  4LUV A;  5C4J H;  3CME A;  4OX9 L;  2LSS A;  2MFI A;  5M5Y H;  1XNR Q;  1Y1W G;  5IYC G;  2D62 A;  2PNH A;  2BH8 A;  1EUJ A;  3E9I A;  3HKZ E;  4AH6 A;  2KCM A;  1GD7 A;  3BJU A;  3PUW A;  4YWK A;  4B3T Q;  3PO3 G;  4LFC Q;  1UE6 A;  1RIP A;  4GNX A;  2PMZ E;  4A3M H;  3H3V H;  3RLO A;  4DR5 L;  5IP9 H;  2UUA Q;  1XPU A;  1PH4 A;  3FHW A;  2MO0 A;  1E22 A;  4JV5 Q;  1Q46 A;  1X56 A;  4AQY Q;  5ELO A;  2UUA L;  4DR1 L;  4YWL A;  1GM5 A;  4TVA B;  3TS2 A;  2ATW A;  5E7N A;  4LFC L;  5IYB G;  3OW2 A;  1CKM A;  3PF5 A;  4LNQ A;  4HJ9 A;  3K80 C;  1X6O A;  3UDF A;  2ZJR A;  4JI8 Q;  4IJH A;  2Q2T A;  3CP0 A;  1CSQ A;  1YI2 A;  3BZC A;  4IFD J;  3CCS A;  2UXD Q;  3I4M G;  1L1O C;  4BXX G;  1XMO L;  3U4V A;  4KI0 A;  3HOY G;  1QZG A;  2C35 B;  1KIX A;  4A93 G;  1CKN A;  2N3S A;  3CPF A;  2RHQ B;  1KD1 C;  4JI5 Q;  4YHH Q;  4R4C A;  1X3E A;  5LMN L;  4A3J H;  1VQD A;  1Q7Y C;  3L7Z C;  1VQ5 A;  3GTP H;  4BY1 G;  4DV4 Q;  2EQS A;  4BBR G;  4GNX C;  2K75 A;  2E5L Q;  4GLV B;  4LF7 Q;  2MNA A;  1AE3 A;  4HJA A;  4OWX B;  3G4S A;  5IP9 G;  2HHH L;  1ASY A;  3PUY A;  1SRO A;  4OWT B;  1PYS B;  3KYH C;  2QEX A;  4A3I H;  4JI4 L;  4JOI A;  4JI3 Q;  2R7Z G;  3H0G G;  2Z6K C;  5BR8 Q;  3T1Y Q;  2F4V Q;  2VUM H;  2K14 A;  5BR8 L;  5AJ3 Q;  3T1Y L;  4PG3 A;  3PF4 A;  3PUV A;  3ER0 A;  4P71 A;  4DV7 L;  1JT8 A;  4POF A;  4JI6 Q;  2YU9 H;  4NXN L;  3EN2 A;  4ME3 A;  3TS0 A;  4JBM A;  1L0W A;  4LF7 L;  2E5L L;  3CMA A;  2UUC Q;  2WFW A;  4JOI C;  1EIY B;  1MKH A;  3TEH B;  2VY3 A;  4JI2 Q;  4PZ6 A;  4UPA A;  4JI7 L;  3CD6 A;  3EBE A;  1NMF A;  4JI5 L;  5IP7 H;  3HOW H;  4LFA Q;  1K9M C;  2KCT A;  3F1Z A;  2NVY H;  1J5E L;  1PV4 A;  1JE5 A;  1TWC H;  3K7U C;  1UE1 A;  4A3G H;  2F3I A;  1WJJ A;  1A63 A;  3S2H H;  4DPG A;  5M3F G;  3RLF A;  3A0J A;  2B63 G;  1N32 Q;  5J3B A;  4O2D A;  1OXT A;  2YTX A;  2JA6 G;  2B29 A;  1T9H A;  3UE0 A;  4DKA C;  4HJ8 A;  1VQN A;  1Y1W H;  4A3I G;  4X64 Q;  1V43 A;  3W5O A;  5GQO A;  4R1J A;  3PUZ A;  4GNX B;  3S15 H;  5M3M H;  4DAM A;  1YJ9 A;  2FXQ A;  3GTJ H;  2ZTE A;  4DUY L;  3KF6 B;  4LFB Q;  2A19 A;  4DV5 L;  3CCM A;  4ALP A;  3TRE A;  2IHE A;  3D0F A;  4MTN A;  2RF4 A;  2N49 A;  4XTC S;  3S24 A;  1D8L A;  2UXB L;  4B3T L;  3RLN A;  4LF4 L;  2DGY A;  4UY8 C;  5JEA J;  5C4X G;  5IYB H;  3TQY A;  3I4M H;  3NBH B;  3CPW A;  4A3B H;  1K83 H;  4OX9 Q;  3RN5 A;  2KBN A;  1VQA A;  4LUO A;  3ULJ A;  3H15 A;  4LF6 Q;  1JB7 A;  4JYA Q;  3UDX A;  3F2C A;  4R4T A;  3KJP A;  3EIV A;  4DR6 Q;  2NZH A;  4X65 Q;  1L2F A;  4H02 A;  1CKN B;  1E1T A;  1Q8K A;  3UDI A;  1OXV A;  4X66 L;  4X62 Q;  4DUZ L;  1KRS A;  1VQL A;  2OWO A;  4DR3 L;  1A8V A;  1VQF A;  1WYD A;  2QA4 A;  3J7Z C;  1K73 C;  1B8A A;  1HNW L;  2NN6 G;  4B3R L;  2Y0S E;  5JEA G;  3LGJ A;  3HOY H;  4A93 H;  3J7A 5;  1N36 L;  4NB3 A;  1E7Z A;  4BY1 H;  2LXJ A;  4QJF A;  4LF5 Q;  4R4Q A;  4BBR H;  2K50 A;  2R7Z H;  1L1O A;  2YTV A;  2I5H A;  4K0K Q;  1V9P A;  3FKI H;  4GLX A;  1G51 A;  4HJ5 A;  2B3G A;  1IBK L;  2ZJQ A;  2R7D A;  1VQO A;  2ASB A;  2R93 G;  1X3G A;  4A3E G;  1VQ8 A;  1MIU A;  4O0A A;  2ZJP A;  1K3R A;  2OQK A;  4DV3 L;  1PVO A;  1U5K A;  1XNQ Q;  3I55 A;  2NVX H;  3T1H L;  3CC2 A;  5HY6 A;  1KL9 A;  1NBW A;  1HZA A;  2PQA A;  3CF5 A;  1ASZ A;  4JCV E;  1W2B A;  3MXN B;  1TWG H;  3J80 c;  1VQK A;  3KFU A;  2VNU D;  1TWA H;  1I94 L;  4P74 A;  1VCI A;  3NEN A;  1N8R C;  4GN4 B;  3PV0 A;  1J6Q A;  2ZTC A;  4IO9 A;  4LF9 L;  3S1M H;  5IP7 G;  2AKW B;  1XPR A;  4NXM L;  2JA8 G;  4TQU S;  1B70 B;  2JA7 G;  2JEB I;  2UXC L;  3F2B A;  4A3C H;  5GAG C;  1LUZ A;  1X54 A;  1U0L A;  4JI7 Q;  4KLK A;  4B3S L;  2KHJ A;  4YCV A;  4YCU A;  4KHP Q;  1E3P A;  1UWV A;  4IOA A;  4QGU A;  1X65 A;  3PO2 G;  4DV1 Q;  4DV6 Q;  2Q2U A;  5IE8 A;  3CCJ A;  3W1G A;  1Z47 A;  4PZ7 A;  3KLW A;  3OTO L;  2CWA A;  1EQQ A;  4UP7 A;  1HR0 L;  5GAD C;  2OTL A;  2BA0 A;  2K4K A;  4FDB A;  3CCV A;  1IL2 A;  1PH3 A;  1M1K C;  5C0X G;  3AEV A;  4NPS A;  1P16 A;  1VQE A;  4LWC A;  3K7A H;  2VW9 A;  2VQE L;  1K8G A;  1N33 Q;  2NVQ H;  1EWI A;  1JJC B;  4RG1 A;  4DV2 Q;  1C7Y A;  2IY5 B;  2WP8 J;  1Q81 C;  4OO1 G;  4DV6 L;  4DV1 L;  1PH8 A;  3CCE A;  3CCQ A;  3I2Z A;  1FL0 A;  4C3J H;  3MEF A;  2VUM G;  4DK3 C;  4Y52 H;  1G6P A;  4A3B G;  1A62 A;  2LXK A;  1XPO A;  5C0X J;  2VL6 A;  1I6H H;  3GTK H;  4GKK L;  4B3M Q;  1YNX A;  1VQI A;  1WFQ A;  3D31 A;  1HNX L;  1A0I A;  4BY7 G;  4C2M H;  1YHB A;  3BZK A;  3HOW G;  5IYD G;  3RNU A;  4DV0 L;  1GO3 E;  3CCL A;  4IPD A;  3AYH B;  4A3F G;  3S1R H;  3CCU A;  1N34 L;  5GAH C;  3IRB A;  4LF8 L;  4A3G G;  3KF8 B;  3S1N H;  1L1O B;  1MJC A;  2N78 A;  3GDE A;  1YJN A;  2KHI A;  4GKJ L;  4HIM A;  1E24 A;  2AMC B;  2XTI A;  2VQF Q;  1QVC A;  1YEZ A;  1Z9F A;  2MQH A;  1S3O A;  1WOC A;  1YIJ A;  1C0A A;  1UE7 A;  3M7N A;  4DR7 L;  4IOC A;  1H95 A;  4MNO A;  5IWA L;  4PMW A;  3E0E A;  4XIG S;  1HNZ Q;  1XNQ L;  3I4N G;  2B63 H;  1XMQ L;  1VQ9 A;  2AWN A;  5M3M G;  3HOV G;  4DV3 Q;  4GOP A;  5IWA Q;  2I5L X;  2E2I H;  4DR7 Q;  4P72 A;  1VQC A;  4JBJ A;  2PQA B;  2YYZ A;  3NEM A;  4RMF A;  1NY4 A;  2R92 G;  4A3D H;  2OQ0 A;  5JJI A;  4A75 A;  1IBK Q;  4JI1 Q;  1XJV A;  2RCN A;  3U58 A;  2BH2 A;  1CUK A;  4QQB X;  2E8G A;  3B6Y A;  4OWW B;  1WI5 A;  2NN6 I;  1N36 Q;  4DR2 L;  2JA8 H;  4JG2 A;  1XMQ Q;  1KQS A;  1CSP A;  1K8A C;  2HIX A;  4BY7 H;  3M4O H;  2KEN A;  1EFW A;  4JI0 Q;  3M3Y H;  1VQ6 A;  4APV A;  1HZB A;  2DUD A;  4DR4 L;  4WJ3 M;  2EXD A;  2ZTD A;  1TWF H;  3PSI A;  2Y0S G;  4GKJ Q;  3Q8D A;  4HIO A;  1JJG A;  4A3C G;  2CKZ B;  1N34 Q;  1EQR A;  1FGU A;  3U4Z A;  5FLM H;  4LF6 L;  4DV0 Q;  4YY3 Q;  1I5F A;  4BA2 I;  2XGT A;  1GVP A;  3M4P A;  1UEB A;  2F52 A;  5IT9 c;  3M85 A;  3AFP A;  4BBS H;  1Q12 A;  2EIF A;  4B3M L;  1N33 L;  2UXB Q;  1QZH A;  1Q86 C;  3FKI G;  2VS1 A;  1LTL A;  1FVI A;  1VQ7 A;  2UU9 Q;  1KRT A;  2I0Q A;  4GN3 B;  3A5Z B;  2R7F A;  4A3L H;  2R93 H;  1HR0 Q;  1IBL L;  2JK8 A;  5C44 G;  5LMU Q;  1PYB A;  3DLL A;  4LFB L;  4A3K H;  1G29 1;  4PZ8 A;  4MZ9 A;  3F2D A;  4KHZ A;  2MO1 A;  3J81 i;  2NZO A;  5LMU L;  4DV2 L;  1IBL Q;  1KC8 C;  4A3E H;  2UU9 L;  1PH9 A;  1AH9 A;  4LW1 A;  3HOX H;  3RR5 A;  3RZD H;  1NE3 A;  3G48 A;  4UP8 A;  1K0R A;  3OTO Q;  4AIM A;  4DNI A;  2OTJ A;  1HZC A;  4IJL A;  1Q82 C;  4YY3 L;  1OXU A;  3S14 H;  1PFS A;  1VQG A;  2WAQ E;  1P8L A;  3K81 C;  2GVB A;  4A3J G;  4KHP L;  2YTY A;  1C9O A;  3K0X A;  2I5M X;  1E1O A;  3HOU G;  2K52 A;  4A3F H;  1I94 Q;  4JBK A;  2PI2 A;  3A74 A;  4R4O A;  1Q1B A;  5FJ8 H;  5GAE C;  4HIK A;  4OON A;  3AFQ A;  5IYD H;  1SE8 A;  5C3E H;  4A4I A;  4DR4 Q;  1SLJ A;  3BU2 A;  1NJI C;  1HR0 W;  4C3I H;  4WJ4 A;  4JI0 L;  4OXP A;  1X3F A;  4P73 A;  3T1H Q;  5JJL A;  4NXM Q;  1UE5 A;  1WCM H;  4JI6 L;  4EX5 A;  3PO2 H;  2D0P A;  3W1B A;  4DR2 Q;  4LF9 Q;  2HT1 A;  2R92 H;  2N8N A;  3KF6 A;  4GOP B;  2ALY B;  1XTD A;  4A76 A;  1N9W A;  3UE1 A;  5EAY A;  1Y1V G;  3L0O A;  1VQ4 A;  3HKS A;  1BBW A;  1PH7 A;  4JI3 L;  3I7F A;  3JAM c;  3GTQ H;  4JI1 L;  3FP9 A;  4C3H H;  1CKO A;  1SRU A;  4A3D G;  4K0K L;  2IHF A;  2HHH Q;  3HKZ G;  3PO3 H;  2PI2 E;  1JMC A;  3I56 A;  2K5V A;  4LF5 L;  1R9T H;  1BBU A;  4A3M G;  4UP9 A;  4JC0 A;  3DM3 A;  1SFO H;  1M90 C;  2R6G A;  3JAM i;  3KJO A;  1I50 H;  1PH5 A;  1HNZ L;  3CQZ H;  1BKB A;  5LMN W;  1KXL A;  2E2H H;  4IPG A;  1EYG A;  1X9N A;  5DLQ E;  4X66 Q;  2VQF L;  3TRZ A;  2Q2I A;  1EOV A;  4QL5 A;  1OTC A;  3HOU H;  5C0X I;  1NMG A;  3CCR A;  2IX1 A;  5M5X H;  4LF8 Q;  1XMO Q;  4BA1 I;  3GTM H;  1GKH A;  2JE6 I;  5IY0 A;  3ICE A;  3S1Q H;  3M9B A;  2VZA A;  4AYB G;  2RHS B;  3HOZ G;  1VQJ A;  2V1C C;  1WCM G;  4JI8 L;  1HNX Q;  4B3R Q;  3PIO A;  1HNW Q;  1QVG A;  2CQO A;  3STB C;  3ZJY C;  3G6E A;  3CXC A;  3A5U A;  4GKK Q;  4A3L G;  2AHO B;  3ERS X;  4L5R C;  1EIF A;  4LUZ A;  4X65 L;  4DR1 Q;  1OXS C;  3KDF A;  4IPC A;  2ES2 A;  1YZ6 A;  4BBS G;  4JV5 L;  1W3S A;  3F8T A;  4AYB E;  1OXX K;  4JYA L;  4GN5 A;  1LM0 A;  1PH2 A;  4DUY Q;  4IFD I;  1LYL A;  4QY7 A;  4DR5 Q;  3I4N H;  2HIV A;  5C44 H;  1YHQ A;  1V1Q A;  3HOV H;  1DGS A;  2WB1 G;  1SMX A;  3H0G H;  1HJP A;  2BA1 A;  4DAY B;  4A3K G;  4LF4 Q;  4GLA C;  3CC4 A;  2IT1 A;  2VQE Q;  1IXR A;  1I3Q H;  1S72 A;  3PGZ A;  4EQ5 A;  1JJ2 A;  1VQB A;  4IFD G;  1XNR L;  3J81 j;  3WWV A;  1VQM A;  1X55 A;  2JA9 A;  2JA5 G;  5HGQ A;  2UUB L;  3PCO B;  3S2D H;  5K36 G;  1SR3 A;  1YBY A;  2Z6K A;  4QIW E;  4DV5 Q;  1YHA A;  3STB D;  3CC7 A;  3PIP A;  1KHI A;  1J5E Q;  1FJG L;  1D7Q A;  4YWM A;  3GTL H;  1IZ6 A;  2Q2H A;  3J80 i;  2ID0 A;  1AE2 A;  3ULL A;  4J15 A;  4X64 L;  4Y7N H;  1IBM Q;  4B3S Q;  4BXX H;  4L5T A;  4IPH A;  3JC6 6;  5ELN A;  1N32 L;  2CWP A;  2UUC L;  2UXC Q;  1YVC A;  1Q1E A;  1B7Y B;  5M5W H;  3CW2 C;  2ZM6 L;  2AWO A;  3K8A A;  4L5Q A;  5FLM G;  4DK6 C;  5C3E G;  2JQO A;  1TXY A;  2GN5 A;  3KOJ A;  1TWH H;  2A1A A;  4LFA L;  1QVF A;  2JA6 H;  2JEA I;  4R4I A;  5M3F H;  1S40 A;  2CCZ A;  3VDY A;  3GO5 A;  1IYJ B;  3E9H A;  4JI2 L;  3AQQ A;  5H1S E;  4JI4 Q;  2A8V A;  4GOP C;  1Y1V H;  3U50 C;  2NVT H;  2WAQ G;  2L15 A;  3I4O A;  5FLX c;  3G71 A;  1PA6 A;  2OCE A;  2WB1 E;  4JBW A;  1YJW A;  1PH1 A;  3CAM A;  4NXN Q;  5IYC H;  1PHJ A;  4YCW A;  2JA5 H;  3S16 H;  4DV7 Q;  2E2J H;  1VQP A;  5AJ3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...