3HOUG

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3houG01
1A62A 3CCQA 4DV4L 3W5OA 3T1HQ 2UU9L 4LFCQ 4L5QA 3HOXG 2HHHQ 3CC2A 1HNXQ 2WAQG 1FVIA 1L2FA 1EQRA 5JEAJ 3IRBA 1TWCH 1K3RA 2CWPA 4NXNQ 2EXDA 3CCUA 4UPAA 5IP7H 4BXXG 4LUZA 2EIFA 2JA9A 5HY6A 4GKJQ 2JK8A 3CCVA 3HKZG 1AH9A 1UE5A 3BU2A 3UE0A 3H3VI 1JJ2A 4JI2Q 2EQSA 4DUYQ 2NZHA 4DR5Q 4OWWB 5IP9G 3S1NH 3F8TA 3PV0A 2K52A 4IJLA 4A3CH 3AYHB 4B3SQ 2RF4A 2R93H 4A3MH 4JI3L 4P73A 1E7ZA 2K5NA 5C3EH 1HR0W 1VQHA 1HR0Q 4PZ7A 4HJAA 1XNQL 4JYAL 4XIGS 3AFPA 4LF8L 3K7AH 4UP7A 4LF6L 3S1MH 1V43A 1CKMA 3A0JA 1NBWA 4A3EG 4LFCL 5GROA 2K4KA 2WB1E 1XNRQ 3GD7A 3K0XA 3HOZH 4DR6Q 4YCWA 4DUZQ 2F3IA 1I94L 3J80i 1E24A 3KDFA 4Y7NH 2VQFL 1GM5A 1GO3E 4PZ6A 4GN3B 4NXNL 2E8GA 1A8VA 1E3PA 2PI2A 1VQNA 2CFMA 5C44H 4A3JG 2B63G 1QZHA 3KFUA 4BY7H 2ZM6Q 3KLWA 1RL2A 1QVFA 4A3BG 1YJ9A 1K8AC 1O7IA 2DUDA 3RN2A 2R7FA 2LXKA 1X6OA 4DV7Q 4DPGA 2JA7H 4DUYL 4HJ8A 3T1YQ 2B29A 5LMNW 5LMNQ 4DR5L 2R92G 5M3MG 4POFA 5IWAL 1CUKA 2QGQA 2KCTA 4TVAB 1M1KC 3L0OA 4B3TL 1ASZA 1BBWA 5IYCG 3UDXA 4C3JH 3NENA 4DV1Q 1EYGA 3M7NA 4A93H 2CQOA 2BA0A 3W1BA 2ZJPA 1UEBA 3RN5A 1HR0L 4LUVA 3RLNA 4JI4Q 3KF6A 2Q2UA 5FLXc 4BBRG 4HJ5A 1QVCA 3W1GA 4C2MH 1VQJA 1MJCA 4DUZL 1XPOA 2E2IH 3H15A 1VQAA 3F2BA 1Q46A 4X66Q 3CCEA 2JEAI 1VQ6A 4JI7L 1K8GA 1OXTA 1N33Q 2FXQA 4OO1G 3I55A 3PUXA 4AQYQ 4LW1A 5GAHC 1EWIA 3GTGH 2JA5G 1K83H 1X3GA 1DGSA 4LF5L 4MZ9A 4P75A 4ME3A 4JC0A 2KCMA 2ID0A 2LSSA 4YCVA 4X62Q 3KJPA 2N78A 4KHZA 1FGUA 4DV7L 4HIOA 3T1YL 1CSQA 1M90C 1PYBA 2A8VA 3I4MH 3LGJA 1PH4A 4P74A 4PZ8A 2IY5B 4JI6Q 2KHJA 1PH1A 1X56A 2Q2IA 1UWVA 3D0FA 4GN5A 3ZJYC 1Q7YC 3M4OH 1A0IA 4B3RQ 1TWFH 4JI4L 2NVTH 1SFOH 3S17H 4LF4L 1FJGQ 3GTKH 2UUAQ 2BH8A 2I5LX 3I2ZA 1W2BA 1G51A 1A63A 1TXYA 1PH9A 1X3FA 2R7DA 1KXLA 1RIPA 4DV4Q 1VQIA 2UUBQ 2UU9Q 3KF6B 3GTMH 1KL9A 4A3MG 2OTLA 2ATWA 3PSIA 2JA6H 2UUCQ 3MXNB 4GLVB 1EIFA 2PNHA 1GVPA 2VS1A 5C4XH 3PUVA 1I5FA 4FDBA 5M3FG 4GOPB 1I6HH 3EBEA 4POGA 2WP8J 1J5EL 3UDFA 1PHJA 4GLAC 1EIYB 2DGYA 2R7ZH 2IX1A 1VQKA 1N8RC 1V1QA 3G4SA 2Y0SG 1Q8KA 4DK3C 4GOPC 2BA1A 4L5TA 4DK6C 3F2CA 4JV5Q 3CC7A 2WFWA 4LF7Q 4JI6L 4IPHA 2VUMH 3HOUH 5C0XI 2E5LL 4BY7G 4A3LG 2AWOA 3RNUA 1KD1C 1S3OA 1N34Q 1LUZA 1E1TA 4JBJA 4X64L 4A3KH 1EQQA 4OX9Q 1YIJA 4B3RL 4QY7A 1FJGL 4JI3Q 1VQBA 4R4OA 3CCRA 3GTJH 4HIKA 4A3GG 4APVA 4J15A 1WOCA 4LF8Q 2MQHA 1K9MC 4LF6Q 1Y1WH 2BH2A 4YCUA 2UUBL 1D8LA 1PYSB 2MO0A 3M4PA 5EAYA 5FJ8H 4IOCA 1I94Q 2UUCL 1YHBA 1VQEA 1UE1A 2ALYB 3ULLA 4DV0L 2VQFQ 3PF4A 1N36L 3GO5A 4H02A 1U0LA 1YNXA 4YWMA 3B6YA 4OXPA 4AIMA 3J81c 3F2DA 4DV2L 2ASBA 2ZTDA 3HOWH 3I4NH 3PO3H 3HFZB 3CPWA 2VNUD 3HOVH 4JV5L 2YTVA 1Z47A 4R1JA 1YBYA 1YVCA 4LF7L 3I56A 2MO1A 1WYDA 4P71A 3ULPA 1X65A 4DV6L 4DR1Q 3GTOH 4R4CA 3FKIG 5E7NA 5JEAG 4Y52H 1N34L 1X3EA 3U4VA 5IWAQ 4BA1I 4OX9L 2IT1A 2F4VQ 3M85A 4B3TQ 3NBHB 1VQLA 2NVYH 4DV5L 1VQ4A 1PH8A 5IYBH 1N9WA 1PH6A 1K0RA 1HNZL 1KQSA 5JJIA 3OTOL 3F1ZA 3OW2A 3PIPA 1Q12A 4WJ3M 2IHFA 2RHSB 1Y1VG 2Q2HA 4LFAL 4R4QA 4GNXB 3RLOA 1IBKL 4LNQA 4QQBX 4NXML 2JA8H 3GDEA 3AEVA 1X55A 1Z9FA 2Z0SA 3ERSX 4EQ5A 1JE5A 2AMCB 2XTIA 5GQOA 4JI7Q 3TRZA 1PFSA 1TWAH 4JCVE 5GAEC 5GADC 4GNXC 4GLXA 1YITA 1PH7A 1OXUA 1C0AA 5JJLA 2IX0A 3KOJA 2GVBA 1Y14B 4LF5Q 2Q2TA 2UXBQ 4UP8A 3PF5A 4O0AA 3HKZE 4DR1L 3M4QA 3J81j 1QZGA 3CC4A 2JA6G 3PO2H 4JI1Q 1PV4A 1G6PA 1NMGA 1X54A 3TS2A 2F4VL 3HKSA 2R6GA 1W3SA 2YV5A 2L15A 2HQLA 3J7A5 5IYDH 1JJGA 1HH2P 1QVGA 1HZBA 2PQAB 2ES2A 1VQ7A 4LF4Q 1N32L 1XMOQ 3H3VH 1HJPA 3HOYG 1SROA 2B3GA 4GOPA 1HZCA 2OWOA 4LF9Q 4IOAA 1WCMG 1Q1EA 4EX5A 4DV3L 5FLMG 2IHEA 1X9NA 4A3DG 4MNOA 1E22A 3H0GG 4IPGA 4IO9A 3CCLA 1BBUA 2VQEQ 4BY1H 3PUWA 2UXCL 1AE2A 3CPFA 4A3IG 2JQOA 1SMXA 4JBWA 4QL5A 2AWNA 4MTNA 3G48A 5C0XJ 4X65L 2K5VA 2UXBL 3HOXH 1J5EQ 1BVSA 4KI0A 3BZCA 5ELNA 2YTYA 3PUYA 1CKNB 2JJQA 2HIVA 4JI1L 1J6QA 3JAMc 3D31A 3TREA 1G291 5AJ3Q 2N49A 4BXXH 4DR2L 3E9IA 4HIMA 2E5LQ 3PUZA 5IP7G 5C0XG 4X64Q 3I4NG 2MFIA 3DM3A 2ZTEA 4DR4L 3KJOA 3HOVG 3AFQA 5LMUQ 1R9TH 1WFQA 1KRTA 2A1AA 5IP9H 1XMOL 3GTPH 4AH6A 3S16H 4LF9L 1UE7A 4DR7L 2D62A 3Q8DA 4LWCA 3STBC 1XJVA 1EFWA 4A3CG 2R93G 2VQEL 2UXDQ 2CWAA 2NZOA 4DAYB 3J81i 1VQMA 1NY4A 5JJKA 1L1OA 5C3EG 4DV0Q 1CSPA 1U5KA 1N36Q 4A3EH 1KC8C 1YI2A 4IJHA 3A5UA 3CF5A 3TEHB 2RHQB 5C4JH 3HOZG 4DV2Q 2JEBI 2Z6KC 3L7ZC 2VW9A 3G71A 1EOVA 4AYBE 5HGQA 1B70B 2A19A 3U58A 1XMQQ 2OTJA 4A3JH 5AJ3L 1S40A 4IFDI 1SR3A 4QJFA 4DKAC 4DV6Q 4A3BH 5C44G 1JJCB 3CXCA 3AQQA 4L5RC 1WI5A 4GNXA 5LMUL 2N8NA 2K75A 4DV5Q 2R92H 5M3MH 2JA7G 3K80C 1HNZQ 3OTOQ 2NN6I 1PVOA 4UP9A 5IYCH 2YTXA 1XPRA 3KF8B 4TQUS 4YHHQ 1TWGH 4LFAQ 2HIXA 2UXDL 3RLFA 4A93G 5K36G 1IBKQ 2N3SA 1JMCA 4L5SA 4NXMQ 3I7FA 3BZKA 4C3HH 1PH2A 1QUQA 4DR3L 4R4IA 2I0QA 4JI0L 1IBLL 4GKKQ 1MJEA 4LFBQ 1LYLA 3TQYA 4K0KQ 4NB3A 2KENA 3S24A 3UDGA 4PMWA 4ALPA 4A3FH 2K5HA 4HJ7A 4BBSH 2E2HH 1L1OB 4HIDA 1XMQL 2PQAA 5BR8Q 2RCNA 1YJWA 4JI8Q 2WB1G 2D0PA 2JA5H 1IZ6A 1P16A 4P72A 1L1OC 4IPCA 4OONA 1PH5A 5DLQE 1JT8A 1Q1BA 4B3ML 3I4MG 3K8AA 1N32Q 2H5XA 1NJIC 3TS0A 2JE6I 3S1QH 4YHHL 2I5HA 1NMFA 3FP9A 2YU9H 2AHOB 1KIXA 1OXXK 2ZTCA 4O2DA 4DV3Q 2LXJA 1HNWQ 4A76A 1SRUA 2GVAA 5H1SE 1C7YA 1YEZA 2WAQE 3JC66 2VY3A 1CKNA 4GKKL 2UXCQ 4YY3L 4K0KL 1KRSA 4RMFA 1LM0A 1LTLA 2VL6A 4C3IH 3JAMi 3CMAA 3S2DH 3E0EA 3BJUA 4X65Q 4HJ9A 3M9BA 1YZ6A 1QUQB 3KYHC 5M3FH 5BR8L 3CCMA 4JI8L 4JOIA 3ICEA 5C4XG 3T1HL 1PA6A 1VS0A 1WJJA 1XPUA 2QEXA 1YHQA 4DR2Q 4WJ4A 3ER0A 1Q81C 3U50C 1HNXL 4PG3A 4JBMA 2R7ZG 1NE3A 3EIVA 4QGUA 1NTGA 3CW2C 4DR4Q 4RG1A 1P8LA 1OTCA 1HZ9A 3FHWA 5GAGC 2QA4A 4A3LH 2Z6KA 3CQZH 2VUMG 3U4ZA 3HOUG 2K14A 2V1CC 4A4IA 4DR7Q 3A5ZB 4GKJL 4A3KG 1HNWL 4BA2I 1IBMQ 2NVXH 4A3GH 3PIOA 2OQKA 4JI2L 4YWKA 2I5MX 3MEFA 1CKOA 3CMEA 3PCOB 1IXRA 4B3SL 1AE3A 1MIUA 4IFDJ 1Y1WG 3PGZA 2XGTA 1KHIA 3CD6A 3UE1A 4DNIA 1OXVA 3CCSA 4JI5Q 4DAMA 5FJ8G 1VQ8A 1UE6A 2D0OA 2C35B 2PMZE 3J7ZC 3G6EA 1VQFA 2KBNA 1XNRL 1PH3A 3S15H 4DR6L 2CCZA 4IFDG 1VQ5A 2HT1A 3EN2A 5IE8A 3ULJA 5IY0A 4A3FG 4GS3A 3HOWG 1IL2A 3PO3G 4BBSG 2NVQH 3NELA 3FKIH 1VQDA 3K7UC 2OCEA 3NEMA 2MNAA 2ZM6L 4QIWE 3J80c 1VCIA 4NPSA 1HZAA 3A74A 3KDFB 4OWXB 3VDYA 1IYJB 2NN6G 4JOIC 3WWVA 2OQ0A 1IBML 4AYBG 3GTLH 1H95A 5LMNL 5IYBG 3K81C 1B8AA 4XTCS 3UDIA 4DR3Q 3S14H 4JI0Q 1Y1VH 1IBLQ 1OXSC 4DV1L 1B7YB 1GD7A 4JI5L 3SGIA 3L2PA 1VQOA 2ZJQA 3CCJA 1EUJA 1VQGA 4R4TA 5M5WH 1S72A 3CAMA 3RZDH 3GTQH 1V9PA 2B63H 2JA8G 4KHPQ 1D7QA 3I4OA 1XTDA 3OYYA 3RZOH 1TWHH 4OO1I 4OWTB 2F52A 4X66L 1GKHA 3DLLA 2ZJRA 1N33L 1K73C 3STBD 1Q82C 4AQYL 1JB7A 1SN8A 4KLKA 4B3MQ 2YYZA 4UY8C 3PO2G 1MKHA 4JG2A 1FL0A 1T9HA 4YWLA 1KAWA 2GN5A 4GN4B 1BKBA 1L0WA 4X62L 1I50H 2HHHL 2PI2E 2E2JH 1Q86C 4A75A 5IYDG 5M5YH 2VZAA 1YJNA 4BBRH 1SE8A 3S1RH 1ASYA 4LUOA 3HOYH 5M5XH 4IPDA 3M3YH 2AKWB 4LFBL 2K50A 3S2HH 4X6AH 4YY3Q 1WCMH 5IT9c 4JBKA 1I3QH 4A3DH 5J3BA 1VQCA 5FLMH 2KHIA 1E1OA 1YHAA 3H0GH 2CKZB 1C9OA 3E9HA 3CP0A 4BY1G 4KHPL 2UUAL 3RR5A 1XNQQ 2Y0SE 4A3IH 4JYAQ 1VQPA 1SLJA 1VQ9A 5ELOA
chains in the Genus database with same CATH superfamily
5JH7F 1A62A 1ICFB 1G2SA 2UU9L 3KHHA 2NVQB 2HQEA 3S9WA 3CC2A 4XXEA 3IAYA 1HNXQ 3Q23A 2NU7B 5JEAJ 1U4MA 2W6ZA 3C46A 3CCUA 1BXRA 3GTLB 1STAA 3U9TA 1PFNA 4BXXG 5E4WC 1RF2D 2EIFA 1UAPA 2JA9A 5KRUA 3NSWA 1FNVA 2JK8A 3BVGA 2YZNA 4MA0A 5H80A 1YNND 3W3AA 2C9OA 4JI2Q 1TKWB 5IP9G 3S1NH 2W70A 3F8TA 3PV0A 5ELCA 3BZDB 4IJLA 2DLNA 4B3SQ 2R7MA 1CE8A 1PMRA 2RF4A 1PTOH 4P73A 4G57A 1XNQL 2B2YC 4TRDA 4HJAA 1JORA 3T13A 4C1NK 3K7AH 4UP7A 4KTAA 2W8KA 3M9NB 3PIO3 1CKMA 3ERQA 3A0JA 1NBWA 1VBGA 3HOZH 3GD7A 3K0XA 3KALA 2FPPB 1I94L 2R61A 3J80i 3R5FA 1E24A 1IBLH 4Y7NH 4DF7A 3IFDA 1GM5A 3DHQA 1GO3E 2SNSA 3BYTB 3K5NA 2E8GA 2PI2A 4BY7H 1I50B 2CFMA 5C44H 4DL2A 5DM73 4QUFA 2ZM6Q 3VR3A 4KHPH 3SI8A 4B9WA 4CC6A 2DUDA 4J9SA 5M5XB 1TIID 2K03A 4HJ8A 3T1YQ 3S2HB 2B29A 1MD2D 5LMNQ 2R92G 4RZQA 2EJFC 1I7NA 5FKAC 2QGQA 3L0OA 1ASZA 5IYCG 2R7NA 4A93H 5K36H 3M7NA 2Z1CA 1H9RA 5M9OA 2W8LA 4LUVA 4KKTA 4JI4Q 3KF6A 4KY7A 3MR5A 3I8ZA 2Q2UA 5FLXc 2X6LA 3CQZA 4QUCA 3MXNA 1I4PA 3R3OA 2R8GA 1XPOA 5FD6A 1TWCB 1DJRD 2JEAI 4FF3A 5KT4A 1OXTA 3PUXA 1B04A 3GTGH 4MA5A 2BCOA 1LT3D 3P20A 4MZ9A 4LF5L 4HIOA 1FGUA 3T1HH 3T1YL 1CSQA 5CORA 3EPIA 3LGJA 1EEID 4FU0A 4P74A 4FYDA 3K5IA 4LH7A 4A3MB 5KFHA 1FD7D 2E2IA 4IUTA 2F0TA 1SNQA 2Q2IA 3D0FA 1TWFH 4JI4L 1LTAD 3OUZA 1SFOH 3S1MB 1S68A 5JOBA 2LKVA 2Q8RE 5DQHA 1W2BA 1A63A 1TXYA 2FLLA 3PN1A 4DV4Q 4J8QA 3C0FB 1AZQA 3MFYA 4YB8B 2L0CA 5I47A 4J9MA 3RBDA 2JA6H 3MXGA 4GLVB 3OSOA 3K59A 4RU9A 1PFBA 1I6HH 4FDBA 1NR2A 3H4BA 2C2DA 4POGA 4GLAC 1EIYB 2DGYA 2R7ZH 5E3FA 1JOQA 4EG0A 2Y0SG 4DK3C 4E6IA 4GOPC 2J9GA 1GUSA 2VUGA 3G6XA 4DR6H 2HDMA 4C3JB 2BDOA 1LTGD 2E5LL 4BY7G 3K0YA 2AWOA 1C30A 1EYZA 2R3ZA 1E1TA 5I2YA 4A3KH 1YIJA 3KUPA 4QY7A 2E74C 1T5XD 3ND9A 5FO8B 4A3GG 5CV6A 4HIKA 5KFQA 2FK3A 1WOCA 1K9MC 4OIJA 1HUMA 1I50A 1BNZA 2WB1B 5JVDF 1WTHA 1ZETA 1UE1A 2ALYB 3ULLA 1BCPC 1CQVA 1N36L 1RDPD 4H02A 1PK8A 3TINA 1K1SA 1BDOA 3BDOA 1U0LA 3NTIA 5ISRA 2ZTDA 5DG8A 1S5FD 3CPWA 1PXUA 1Z47A 2BE5C 3I56A 2MO1A 1WYDA 1SEBD 4NP5A 3KTMA 4X66H 2EE1A 3M4OB 3M9MB 1X3EA 4EGQA 1ZEQX 3S17B 4EBCA 4AQYH 1B6SA 5T14A 5IIFA 1LACA 1JCKB 5IYBH 1K0RA 4ZUJA 1I7LA 5JJIA 4X3UA 2HD3A 5KT5A 1KNAA 2JP1A 5DLFA 2IHFA 2RHSB 3DXJC 4R9WA 5K5PA 4LNQA 4HSVA 1IBKL 3NHHA 5J39A 2E76C 2RCFA 3GTKB 5C4XB 2JA8H 1HQMC 3NBIA 1Z9FA 4EQ5A 5EKIA 4B3RH 2AMCB 4LFBL 1PFSA 1YITA 1C0AA 3L4KA 2FMCA 5C4HA 4PMBA 1JICA 1Y14B 4YJ3F 5KG0A 5IT9E 4Z9CB 2Q2TA 2I87A 4M9UA 3T5JA 1S0NA 3PW2A 2NWGA 4O0AA 5EBCA 4HYKA 2UUBH 2QKIC 4YIJA 2JA6G 2F0EA 2LFNA 3HKSA 3SXHA 1W3SA 1VMPA 2L15A 3GTJB 1JJGA 2PQAB 2ES2A 1SJED 3J81L 1Y1WB 3LWEA 1N32L 1E0BA 1CHPD 4JV5H 1SROA 4LF7H 4NW2A 4EX5A 4A3DG 1X9NA 2AQ4A 4MNOA 4EFBA 5FO9B 1KABA 4MV9A 1BBUA 2VQEQ 4J9KA 4ZLTF 5DG9A 5D14A 4IAJA 3BJYA 4G3IA 1SMXA 3PO3B 3HOVB 4RWSC 2FK2A 1MSHA 3HOXH 1Y8NB 4LF8H 5CA0F 3BZCA 3GTOB 1JWSD 1XX8A 4LFCH 4CDFC 5A2QL 1K1QA 2NVYB 2NYZD 2N49A 3PUZA 5IP7G 4F4WA 2KA7A 1BO0A 4NXNH 4I7HA 4X64Q 2MFIA 3PMFA 4DR4L 4KKUA 4K8JA 3KJOA 1AP0A 3RB3A 1WFQA 5L1LA 2XGQA 5KFZA 2F0NA 5EWGA 2FLNA 2F0WA 3S16H 1ML0D 5C6AA 4DR1H 1XJVA 4DR5H 4A3CG 2BQUA 3BG3A 2R93G 2VQEL 2UXDQ 5IWAH 5C1OA 2CWAA 2M00A 5JJKA 3RUPA 1L1OA 5C3EG 4O4HF 3GIPA 4MV1A 2MJ8A 5KFWA 5D1PA 4IJHA 2JSOA 2E75C 2RHQB 1NUCA 1ZHSA 3HKZA 3Q0AA 5KFDA 5HGQA 4A3JH 1EY0A 3TZDA 4DV6Q 4RGOS 2DZDA 1RD9D 2IA6A 2X6GA 1LTBD 4EEYA 4DV5Q 2JA7G 1T3NA 1HNZQ 1B44D 2UXBH 3OMGA 1EL0A 2LMCB 3PR5B 2TSSA 4F50A 2QYZA 4TQUS 4LFAQ 3I90A 3J80E 1CA6A 3RJ0A 2UXDL 2C2EA 5FPRA 4JI1H 4ECRA 4WFN3 3BZKA 3R93A 5KFNA 4DGZA 1UC9A 4GKKQ 1EY6A 2R8IA 1C8CA 4LF4H 4K0KQ 1TQOA 1RTOA 3EJIA 3S24A 1CQFA 2YW2A 4R8UA 4BBSH 2K5DA 3TBIB 1BR9A 3T4AC 2PQAA 3FVQA 2RCNA 2W7PA 4JI8Q 1TWGA 1PRTB 3BDLA 2RDHA 4TQSA 1SMYC 2RDJA 1L1OC 4IPCA 4OONA 1V8QA 3GTPB 1C4QA 1TVXA 1EYAA 1SYDA 4B3ML 4YAKB 1SXTA 1NJIC 3S1QH 4FXGC 2A6HC 4K2LA 3GQBA 2W6QA 2AHOB 1KIXA 1IL8A 2ZTCA 1AN7A 4IZOA 1E2VA 3RFCA 4DV3Q 3G8CA 1C7YA 2YYAA 1IOWA 1WR2A 4GKKL 2WAQE 3H94A 2QDLA 5KNCA 4K0KL 3S2DH 4C3IH 3DEOA 3MR2A 1SNDA 1EUDB 4FXDA 2NVYA 4F4XA 4X65Q 2JYOA 1MBYA 1AW7A 1K8MA 2F0HA 3QOJA 4JI8L 3O13A 1GGOA 2RSNA 2ICIA 4DV0H 4DAVA 4DR2Q 1Q81C 2R92B 4ULLA 4DL6A 4I4TF 2V59A 3GV5B 1B53A 3GV6A 4QGUA 1Y69U 2A68D 1NTGA 4C56C 2V58A 1XYIA 5LL6S 3QWNA 2Z6KA 2VUMG 3U4ZA 3HOUG 3I73A 3WDNA 2KUMA 2V1CC 4A4IA 4DR7Q 2O03A 4ABNA 2W9CB 3HXLA 2PO4A 3MTSA 1Q3LA 1KAAA 4YWKA 1W93A 2XD4A 1S5CD 3CMEA 4A3FB 1WTXA 1MIUA 3CCSA 4JI5Q 1VQ8A 2G9DA 2JEGA 4ZK9B 4O4IF 5NUCA 3GQCA 1BXTA 2NB0A 4RGTA 2VB3X 2VB2X 1EEFD 1F2YA 2CCZA 1Z2PX 1VQ5A 2XC9A 2HT1A 2NVXA 2B2VA 3EN2A 4MIUA 1W6JA 3ULJA 4BBSG 4DLKA 2YU9B 2OH2A 4EGJA 5D1OB 5CV8A 4JK1C 4QIWE 3J80c 1VCIA 4NPSA 4I7ZC 3NTHA 3RV3A 3KDFB 4ED8A 1UNNC 2NN6G 1PZID 4AYBG 4NLGA 5KEEA 4ZKBB 3UDIA 4XT3B 3S14H 4JI0Q 1Y1VH 2XN9C 4DV1L 5CC4A 1B7YB 4JI5L 3SGIA 3L2PA 1VQOA 2ZJQA 1SEIA 2LY7A 2B39A 4R4TA 2D5DA 3CAMA 3RZDH 2XCAA 1V9PA 2B63H 2XVSA 5I2XA 3JSNA 1D7QA 3G6JB 1ENFA 2Y0SB 2UXCH 3NUCA 5C3WA 3KXYT 3DLLA 3ITPA 2KHSA 3KK7A 1K73C 1N33L 3H40A 2J7ZA 2F3VA 4NDXA 4KLKA 3C3LA 3PO2G 4EBEA 2R86A 4FVMA 4IALA 1KJ8A 4GN4B 4A3GB 4X62L 1B2TA 2KOLA 3M4IA 1TR5A 3FRPB 1Q86C 3KHGA 4F87A 4O3SA 4I65A 3T16A 3NQIA 2EY6A 4BBRH 5KG6A 1C48A 3HOYH 2B2VC 4IPDA 2VA3A 3JAME 4X6AH 4EYIB 3HS0C 1TWHA 1G91A 4JBKA 2NU6B 5AFWA 4ECQA 4ECZA 4ED2A 3V6JA 3H0GH 4K8IA 4BY1G 4DXFA 2PCFB 3D3RA 3K57A 2V4QA 1IBMH 1TS2A 4FF4A 1AUVA 4WORA 3V96A 2VQDA 4KJOA 5DEHA 2W9CA 3SE0A 1QWYA 1WCMA 1TT2A 1I3QA 3P75A 5C0XH 4LUZA 5KG2A 1LLRD 3LX0A 4GKJQ 5J22A 4CJ1B 3HKZG 1UE5A 3IKJA 2FB9A 3H3VI 1JJ2A 2QILA 2NZHA 3TN2A 4OWWB 1RYRA 2K52A 3GTQB 3AYHB 3EYYA 1B6RA 3L9AX 4JI3L 4A2AA 2RKSA 1HR0W 2K04A 2QDBA 1QNUA 4XIGS 3RZOB 4LF6L 1HTPA 5KIXA 3K5LA 3U9OA 2PMZB 4A3EG 1XNRQ 2K4KA 2WB1E 1CZGA 1PRTD 3PR4A 4EEQA 4DR3H 2F3IA 1WD1A 2KCNA 3KDFA 3EVQA 4U673 2VQFL 1O78A 3GIJA 5CV5A 2VXWA 4GN3B 4PZ6A 2B63G 1A8VA 1E3PA 1HCZA 2GPWA 4J9QA 3OMCA 1YNJC 5M5YB 1RL2A 4A3BG 4MV8A 1WTRA 1FKAH 1B50A 2YZMA 3S1RB 2R7FA 4J1MA 3T53B 4O3RA 3M3YB 1J9OA 1FNUA 4DFAA 2W6PA 4A3DB 4EGVA 2L5TA 5M3MG 3TP6A 1OWTA 1CUKA 5CV9A 1M1KC 3CU7A 1QB5D 4B3TL 3N44B 1L2ZA 1BBWA 1EYGA 3EROA 3NENA 2Y0SA 4RAZA 1K28A 5DGBA 4CC5A 5EWEA 2KCCA 3RN5A 5DQIA 3ORQA 3RLNA 4YHHH 1IW7C 3QIAA 4BBRG 2WTFA 3MR6A 1QVCA 4C2MH 1VQJA 1S10A 4Q0YA 2BOSA 1SDFA 1SNOA 3MFGA 3Q1KA 4YY3H 3CCEA 4N9TA 5C1PA 4JI7L 1EY4A 2W6NA 4WBNF 5GAHC 2EYMA 2XIWA 2JA5G 1K83H 1A6XA 1XNQH 3QZ8A 4YCVA 4JV0A 2HHHQ 4FS1A 1L0XB 2A8VA 3I4MH 5I4DA 3GV8B 2R93B 2IY5B 1HNXH 4JI6Q 2FKLA 1S5BD 5C3EB 3KLSX 1A0IA 2NVTH 1UNSA 2K7VA 4HNUA 2FMAA 1FJGQ 2UUAQ 2BH8A 3GTGA 1EZ1A 5LP6F 2A5HA 3OHXC 1HHVA 1PH9A 4O2BF 1X3FA 3VYRA 4JI2H 4ZI7F 2UU9Q 3KF6B 3V05A 4B3SH 1D1KA 3MXNB 4C5AA 2VS1A 1GVPA 4G7HC 4GOPB 1FNWA 2F0LA 4K5XA 4X3KA 4ECVA 1J5EL 2JA7B 2B2YA 1PHJA 1TWFA 2SCUB 1SFOA 3GTQA 4GC6A 1VQKA 5HURA 1JLLB 3TQTA 1Q8KA 2EJMA 4YR0A 2WFWA 1STEA 4JI6L 1A3UA 4IPHA 5C0XI 4TV8F 1N56A 1F2MA 4JBJA 1EQQA 1N48A 4HN7A 1TA8A 2JA6A 2ZM6H 1FJGL 1VQBA 1X32A 2ZXRA 4R4OA 4J0MA 2AGPA 1SSOA 1M6VA 3PW4A 2E2IB 1NCVA 4G7ZC 4N8FA 1BCPB 2BQRA 1B3AA 3T1YH 5LMNH 5KFJA 2MO0A 3R23A 3K3PA 3M4PA 5EAYA 5FJ8H 4IOCA 5FD5A 1I94Q 4PMCA 1VQEA 2MCTA 2OEOA 2BDNA 1HFNA 1R4PB 4JI4H 5JUMA 2VR1A 4IFDH 1C3OA 3LWUA 4K14A 4DV2L 1CS0A 3HOWH 3HFZB 2VNUD 2XCPA 3MHBA 4P71A 1CM9A 1X65A 4MHEA 3FKIG 5JEAG 4IUNA 4ID6A 3H4DA 4BA1I 4MTEA 2IT1A 4N8X1 2MHVA 1I4HA 3NBHB 4U7CA 4NKLA 1VQ4A 1LABA 4HEDA 2HCIA 3V2TA 5CAEB 3OTOL 4WJ3M 4IN3A 2L55A 3GTMB 2NBFA 1U9RA 4QQBX 1HXYD 4NXML 3JRWA 1X3PA 5KFFA 2R84A 2D9UA 5KG5A 1X55A 3D8GA 3ERSX 3X3MA 5GQOA 3JRXA 4DK0A 1Q8IA 2EYLA 1TWAH 5GAEC 5GADC 4GLXA 1OXUA 2R93A 3E3XA 3C1FA 1EQVA 3BVZA 4LF5Q 4QWBA 1VF5C 2VUMB 3HOUB 2E2DC 3PF5A 4DV4H 1QZGA 3OSPA 1O80A 1EHIA 3GIMA 5DLGA 4ECUA 1TS4A 3K5OA 1U4RA 1HH2P 3RGZA 1QVGA 1HZBA 3A8JE 3OSNA 4XYQA 1DV1A 2VPQA 1FGBD 2IL8A 4RNMA 5L1KA 4K5WA 4GOPA 4LF9Q 4RNOA 4IOAA 5IYZF 1WCMG 1Q1EA 1AN8A 1KJJA 4CKEA 2JA7A 4IO9A 3CCLA 2J6UA 1KLGD 1TY0A 1AE2A 3CPFA 2L11A 3QZ7A 3I4NB 4A3IG 4TV9F 4HR7A 2AWNA 4MTNA 3G48A 1JWMD 5BPHA 3MAQA 5FLXW 2W6OA 4ECWA 4FP5D 1CKNB 2IPKD 4QCLA 1ZKOA 2CQYA 3VPCA 2E5LQ 3E9IA 4HIMA 1ILPA 3KF8A 2V4DA 3RBEA 1L0YB 3CRLC 2KJXA 1R9TH 1ONLA 2W71A 2EXZA 4HNTA 3RAQA 4LF9L 1UE7A 5C8YF 3T5HA 3CVZA 3STBC 4V0BA 5KFVA 1SNCA 3MZ5A 1WTPA 1N36Q 1DCZA 3A5UA 5C4JH 3HOZG 3PO2B 2VW9A 2HGSA 3NBHA 1D1IA 1EOVA 4XYLB 2F0SA 1XMQQ 4RB2C 4IFDI 1TU2B 4QJFA 3DF7A 5C44G 4RUCA 3R5XA 3GTMA 5BMVF 1CFMA 5KYIA 3BQ2A 5KFYA 1I6VC 1ESRA 3JZIA 5E4XA 1PFMA 1II3A 4UP9A 4BY1B 2YTXA 1AZPA 5IOCA 4OEMB 2PYKA 4A93G 5K36G 2AQ1B 3T56B 1IBKQ 1T94A 5EQ0A 1QJOA 4I7AA 4C3HH 3QG1A 2VUMA 3CHBD 2W9BA 2ICEC 2KECA 1IBLL 1MJEA 5KFGA 4LFBQ 5FK9C 4B9XA 4RGMA 4J9LA 3SK4A 4GZYC 2KENA 5I9OA 3V4SA 3PIP3 4ECTA 2F0PA 4HJ7A 5KG7A 1JB3A 2E2HH 2HDLA 1L1OB 1XMQL 4OO1H 5CV4A 4X3SA 2CW7A 1IYUA 2WDTA 4ZHQF 2HUGA 1EY7A 5BR8Q 1G2TA 3HKZB 2R85A 3BABA 1P16A 5JPMC 4F8MA 3Q6SA 5KFCA 4XT1B 1Q1BA 4LAAA 1N32Q 2H5XA 4ZAIA 2KSWA 2JE6I 2I5HA 3RD4A 1BCPD 4MV6A 4HAEA 1B1ZA 1SYBA 3AMUA 5KG4A 1HNWQ 1D5ZC 4A3EB 2G5DA 2GVAA 1GOZA 4X64H 1QCBD 2VY3A 1CKNA 1VBHA 3BQ0A 1STBA 2EY2A 2BE5D 3RTXA 1LM0A 2VL6A 3JAMi 4AYBA 2NU9B 3IG0A 1CQJB 3BJUA 4HJ9A 3M9BA 2O2LD 4A3BB 3JSLA 3MWEA 5M3FH 5BR8L 4ECYA 2UXDH 1EWHA 3SHLA 3T1HL 2NUAB 3TSSA 4R8UB 3OIPA 1WJJA 2QEXA 4V190 2YS7A 1E2ZA 5T1GA 2PZUA 3ER0A 4WJ4A 5M3MB 4ED3A 5DGAA 4JBMA 4PG3A 2R7ZG 2FPIB 4Q0FA 2PW5A 4DR4Q 5EDWA 3ZYYX 1P8LA 1TWGB 1EZ8A 1HZ9A 1I4QA 2QA4A 4A3LH 4C5BA 3CQZH 3MEHA 4APMA 2ASDA 2K14A 4DV6H 4A3KG 1HNWL 4A2BA 4BA2I 3J81E 4YAJB 3GIKA 2F0MA 3PIOA 4FS2A 3SR1A 4FXKC 1F9PA 4KKSA 3W2DA 2I5MX 4WRDA 4DV5H 3RB0A 3K6OA 1HNZH 1KHIA 2DNEA 3CD6A 1EUCB 4DNIA 2ASJA 4KD3A 2OLSA 2JA5B 4LFAH 1UE6A 1I4XA 2C35B 1HFGA 2PMZE 3J7ZC 4RB1A 5KFKA 1EU3A 1PH3A 4DR6L 4GKKH 4YBZB 5IY0A 2RVLA 4GS3A 1QE6A 2K1BA 2NVQH 2B2UA 3NE5B 2VPSA 1ILQA 4JI8H 3GIDA 2OQ0A 3GTLH 3P7JA 5KFOA 2UVWA 5DG7A 2ZDQA 2C2RA 2IBKA 5IYBG 4HQ6A 3SE7A 2K5WA 4MAMA 4C5CA 2H4OA 2A74C 1BJTA 5KFIA 4O42A 1VQGA 1S72A 1BNCA 2DPJA 2JA8G 4DV3H 4ED0A 4X3TA 1CI3M 1WSCA 5KT2A 3I70A 4QB4A 3ONAB 1XTDA 4L1KA 1DYQA 3OYYA 1GUWA 1S9FA 4OO1I 2F52A 1QNKA 4X66L 3FEWX 1GKHA 5D65A 5I6YA 1CA5A 2RSOA 4AQYL 1SBBB 4X65H 3RIZA 1EIGA 1SN8A 4B3MQ 4JVZA 1Y1VA 1MSGA 1MKHA 2F0QA 2F0JA 1FL0A 4JG2A 2FP4B 3D4WA 1KAWA 4YWLA 1L0WA 1BKBA 2NVXB 2RDIA 4WD3A 1I50H 3H3VC 2PI2E 1DM0B 4IUUA 2B63A 2VZAA 1YJNA 2PPBC 4DR2H 1SE8A 3D6CA 2M05A 1SYXB 5M5XH 3S2HH 1I6UA 1U4LA 5IT9c 2J6TA 3Q8QB 2B2UC 5C3XA 5FLMH 2KHIA 1I4RA 2K01A 2BR0A 2V4RA 1T36A 1XMOH 2CKZB 4F4YA 1C9OA 3HG9A 4DR7H 2R8KA 3S15B 5CBAE 5D3IB 4JYAQ 4L8JA 1Z7TA 1MGSA 5ELOA 1JDEA 1KDBA 4H13C 1B4OA 2Z4IA 3W5OA 4LFCQ 1B33N 3PQIA 3R2TA 4I55F 3FKIB 4L5QA 3HOXG 1EOTA 2RQXA 2MP1A 2WAQG 1FVIA 1KEEA 4RUAA 5IT9W 2R8JA 4NMZA 3IRBA 5C5LA 1TWCH 4JI5H 2CWPA 4NXNQ 1GUTA 2JEIA 1S03G 3AU7A 3R5HA 1SYCA 2TMPA 5EJWA 3H0GA 1IKLA 5HY6A 2HVRA 4IHJF 1W6KA 4HMJA 1AH9A 2MGSA 2NTTA 3VA7A 2EQSA 4DUYQ 2JA5A 4DR5Q 1SE4A 2I8CA 5LMUH 5M5WB 1OO9B 4GC7A 4O3NA 4A3MH 1KJQA 1E7ZA 1SMYD 2EYOA 2K5NA 1HR0Q 4JYAL 4FF1A 2XWJB 4LF8L 3QFFA 1TWHB 4ZCKA 3S1MH 1V43A 3C2PA 4LFCL 1V51A 3K58A 2FPGB 4DUZQ 4JI0H 2A6HD 2IJ0A 2FK1A 3FPUB 1GUNA 4NXNL 2P0AA 2E2JB 4A3JG 4DU9A 2ZXPA 3LMLA 4CGYB 1QVFA 1YJ9A 1MZBA 4QMGA 5D8DA 4LH6A 5LOVF 3RN2A 1V1PB 2LXKA 2HJWA 1X6OA 5JAVA 4DV7Q 3R8BA 4DPGA 2EPBA 4DUYL 1WCMB 2FFKB 4DR5L 1I3QB 1GLVA 4POFA 3PVXA 4IUQA 1S5DD 5IWAL 2KCTA 2C28A 2NTSA 1BGWA 3L4JA 1ZQ7A 2A69C 2ZDHA 4C3JH 4DV1Q 2P5ZX 2O5JC 2CQOA 2BA0A 3W1BA 2ZJPA 4A3IB 1HR0L 3J7AF 4QWDA 4HJ5A 3W1GA 1VAJA 1MJCA 4DUZL 1EYDA 5F9NA 1Q46A 2J6SA 3GV3A 1VQ6A 1N33Q 1K8GA 1XDNA 2FXQA 2KVMA 3I55A 1TS3A 4LW1A 3SDZA 1EWIA 4J9OA 4JV2A 3M7GA 1B3QA 1X3GA 1DGSA 4RAYA 4ME3A 2EYFA 4JC0A 2LSSA 2ID0A 4X62Q 2DJGC 3KJPA 4DV7L 2N78A 3Q8PB 1VDZA 3KLSA 1M90C 3S1NB 5C5JA 1WTWA 1PH4A 3T5LA 4RKLA 4E4TA 1DV2A 3U9SA 2DY7A 1PTOB 5IGEA 1PH1A 1BBXC 3T5KA 3ZJYC 1SYFA 1Q7YC 3M4OH 3UI2A 3RB4A 3K7AB 3J80W 2CH4W 2ALZA 3S17H 4LF4L 1O7YA 4CJ2C 3FKIA 1EQTA 3HOZB 4GKJH 1Z2OX 1K83A 1G51A 4Y7NB 1E4GT 4C3IG 4UCUA 4BS9A 5KGUA 4A3MG 3VR5A 4BY7B 3CRKC 5C44B 2UUCQ 2FE3A 5KFXA 1EIFA 2PNHA 5C4XH 3GTKH 1I5FA 3EBEA 2WP8J 5HGTA 5KFBA 1V4YA 1EY9A 2IP4A 4IRCA 2F0DA 1M7JA 2IX1A 1PYWD 1N8RC 1V1QA 5JQWA 4RNNA 3G4SA 1XNRH 1A9XA 2BA1A 4DK6C 3F2CA 4HMIA 4A93B 1H9JA 3MFHA 1BF4A 3RNUA 1EY8A 1KD1C 1N34Q 2WINB 3TZUA 4OX9Q 1ULZA 1NR4A 1JIHA 2OXPA 4JI3Q 3VA5A 5KFTA 5L1JA 3CCRA 3GTJH 3URYA 4APVA 2X0SA 1QILA 4MV7A 4LF6Q 3Q8RB 1Y1WH 4YCUA 5L1IA 2R7KA 4UCVA 2UUCL 1YHBA 2HVSA 2CW8A 4DV0L 3GTGB 1V1PA 2VQFQ 3PF4A 3GO5A 2VOBA 4QWCA 1YNXA 4YWMA 3B6YA 3LNNA 3F2DA 2EZVA 3PO3H 3HOVH 2FMMA 2JEJA 4XQJA 4R1JA 1YBYA 2JXMB 2GPSA 2Q8TA 3GTOH 4R4CA 5E7NA 4Y52H 1TWFB 2PNRC 4DAPA 3U4VA 1N34L 1SFOB 4OX9L 4DL4A 4Y8VB 2F4VQ 5KFMA 4B3TQ 1VQLA 2NVYH 1BOSA 5COYA 1PH8A 1K8OA 4KK7A 1PDQA 1RJRA 1UC8A 3F1ZA 2V5AA 3OW2A 2HHHH 4BWGB 1Q12A 3QO2A 2XSCA 2A6EC 1Y1VG 2Q2HA 2JA6B 3DWAA 4R4QA 1X3QA 3RLOA 4JI6H 5F2DA 1D2BA 1I6HB 1VKZA 3GDEA 2ZXOA 5CR3A 3AEVA 4L63B 3TP5A 4JI7Q 3D4RA 3TRZA 4J6HA 2R7ZB 4EYHB 4GNXC 1FJGH 5KYLA 5JJLA 1S4ZA 1ZYRC 2UUAH 3KOJA 2GVBA 3KBGA 1RTNA 4UP8A 3HKZE 3J81j 5CA1F 1PRTF 3CC4A 1G6PA 4A3KB 1LO5D 3D6WA 2UU9H 1X54A 2F0IA 2F4VL 2YS6A 2R6GA 5KNDA 3I91A 3L3OC 5IYDH 1EWCA 3E0JA 4XDXA 5EKLA 1DOMA 1VQ7A 2F3WA 5L9XA 2FLPA 2EDGA 1TWAA 5IGDA 3QJYA 3VYUA 3NWSA 4JUZA 1HJPA 3HOYG 2B3GA 1ENCA 1HZCA 3NK9A 1LV9A 5CYUA 2IHEA 1MHWC 1E22A 1YNJD 3H0GG 4IPGA 3H20A 3I3CA 2UXCL 4YR3A 3TDQA 3VR6A 1K0SA 4DL7A 4JBWA 4QL5A 1KLUD 3WOEA 2IMWP 3MXPA 5C0XJ 2K5VA 2PW7A 1J5EQ 5LXTF 2R8HA 5ELNA 3PUYA 4LMYA 1LT6D 1RKNA 2JJQA 2SOBA 1DD2A 3JAMc 1I94H 3TREA 1IW7D 4BXXH 5LYJF 3TIIA 2I07B 4ME6A 2EOTA 3EA6A 2F0FA 5C0XG 4N9PA 2QCPX 3DM3A 2EVBA 2ZTEA 3I4LA 3A56A 5KG3A 3HOVG 1KBLA 3Q8SB 3A7AB 2A1AA 2D2CC 1PTOC 5IP9H 3GTPH 3K5HA 3GV7B 4ZKCB 1QG7A 2D62A 4LWCA 2IWHA 2JA8B 3JAMW 2C00A 2F03A 4QWEA 5KNBA 3J81i 2W7OA 2CW0C 3MXUA 2XNAC 3KBXA 1KC8C 1YI2A 5HBRB 3DWPA 4Q44A 3TEHB 5FLXL 4CDDC 4DV2Q 2JEBI 3L7ZC 3G71A 1R9TA 2QK4A 5GONF 1B70B 2A19A 3H91A 1S40A 4HR7B 1SR3A 1HA5A 4DKAC 3SVMA 3P1HA 4RFBA 1JJCB 2GA4B 3BVMA 4IRDA 3DWQA 5IGBA 5I9PA 2K75A 5IGGA 2R92H 3N40P 1ESFA 4LF5H 1V1OA 3OPOA 3OTOQ 1JXLA 4RKBA 1S5ED 5IYCH 3KF8B 4YHHQ 4FBUA 5J1ZA 2R7ZA 5EPLA 1SAPA 2PBZA 1DOLA 2FHTA 3BG5A 4NXMQ 4UCRA 4HSPA 4CBVA 1PH2A 1QUQA 4DR3L 4PV1C 4O3OA 3NXWA 4CDEC 2WAQB 2HVQA 1YNNC 3UDGA 2L1BA 4PMWA 3RB6A 5BN3A 4A3FH 2K5HA 2CVRA 5KFRA 4EQNA 4HIDA 4LF9H 3K5MA 4J9NA 4LSXA 4PNYA 1YJWA 1HTLD 2J4XA 1LTRD 3OUUA 1A2TA 4P72A 2WKCA 3F2UA 3A54A 5DLQE 3S16B 4O4LF 1A2UA 3UFXB 1NAPA 4XQNA 3I4MG 2C22A 3TS0A 4YHHL 2YU9H 1PX2A 1GSOA 2E2HA 4O2DA 2SNMA 2XGPA 5FOBB 1GUGA 4UCTA 4LSAA 2E5LH 1JX4A 3N42B 1YEZA 3JC66 3VYSA 4C1NI 4YY3L 3MWMA 1EY5A 4RMFA 5CBEE 4RAUC 2JN4A 2IW3A 3C1EA 4A3JB 2XRQD 5KKNB 2W9BB 5A35A 4JOIA 3ICEA 4F4ZA 5EPJA 1UEAB 1VF7A 1YHQA 4U6PA 3HZXA 1N36H 1S0MA 3U50C 1HNXL 1RK5A 3EIVA 1SNPA 1KJIA 3CW2C 1LT4D 2CH4A 1H9KA 1OTCA 3FHWA 5GAGC 5BN5A 5CGKA 2DN8A 1DIKA 1XMQH 2XCLA 1A3TA 1JR0D 4QIWB 3A5ZB 4A3GH 3MC0B 3TQ1A 2OQKA 4IUPA 4JI2L 4IQZA 3I72A 1JDBB 3G6VA 3TIGA 3MEFA 5JVH3 1CKOA 1WTQA 4B3SL 4MN3A 4IFDJ 4BBSB 2RGVA 1OXVA 1R4QB 4DAMA 5FJ8G 1H9MA 2D0OA 4G7OC 3TP7A 1J8IA 1IBKH 4IRKA 4AYBB 2KBNA 2R7LA 3EFXD 2WE6A 2F0OA 2CQAA 2F0UA 5FPOA 1M0WA 4IFDG 4LFBH 5IE8A 3HOWG 3HRZC 4A3FG 4PWQA 3S1QB 5JVG3 3PZPA 3RF2A 1JWUD 1PZKD 4Q5VA 2ZM6L 2PQEA 3A74A 2ENBA 1WVLA 3NWTA 4DNTB 5BR8H 1SE3A 1IYJB 2W57A 2WAQA 2W9AA 5J2TF 4JOIC 1EZ6A 5T1IA 1H95A 5LMNL 5EPKA 3S2DB 4C3IB 4XTCS 4JW0A 3OW7A 1IBLQ 4RB0A 3VMMA 3RMHA 1O7ZA 3VR4A 1OXSC 3BA8A 1DXMA 1K3BC 2BQ3A 1N32H 4OELB 3VPBA 3CCJA 3GTQH 2K32A 2Q8IB 3WO1A 2QW7A 1AUXA 4KHPQ 1IOVA 2Z9HA 3V4ZA 2F0KA 1HNWH 2WYOA 1EIHA 4LK1C 3RZOH 4K5VA 3GTLA 1EU4A 4DL3A 2ZJRA 4ECXA 3CKIB 3STBD 1HRJA 1JB7A 4UY8C 4J9RA 2YYZA 1T9HA 5EWFA 2GN5A 3MFIA 3BYYB 1CZWA 3IFTA 4ME5A 5LHY1 4A75A 5M5YH 3S1RH 1ASYA 5CB4F 4LUOA 4JPBW 3HEJA 3T51B 3M3YH 2AKWB 2F1MA 2K50A 4DR4H 4QW8A 4A3DH 5J3BA 1VQCA 3KHLA 4CDCC 1E1OA 1SE2A 3E9HA 4QWAA 3CP0A 4KHPL 2EYHA 3E5NA 3RR5A 2Y0SE 1Z2NX 1VQPA 2EY5A 1SLJA 4O2AF 1VQ9A 2OF1A 2VQEH 1CK1A 1STHA 3CCQA 4DV4L 3DUZA 3T1HQ 2DWCA 3FMAA 1JQYD 4RZRA 4U68A 4QIWA 4HNVA 2AQ2B 1L2FA 1EQRA 5DNFA 4YJ2F 3EPGA 1K3RA 2EXDA 2DNCA 4UPAA 5IP7H 3Q2OA 1SYGA 3FDTA 3CCVA 3S14B 4RHRA 1S0OA 1Y1VB 3BU2A 3UE0A 3HBLA 3R2IA 3J7AV 1ET6A 3M4YA 4RGNA 3RZDB 4A3CH 2R93H 2B63B 2RDGA 3H6MA 2C5CA 4HCEA 1TWCA 5C3EH 1VQHA 4PZ7A 1BCPF 2O5IC 3AFPA 1PLFA 5ELDA 2UVVA 3UQ8A 2KEEA 5DM63 1T5EA 5GROA 3DM1A 1DZ1A 4DR6Q 4YCWA 4IR1A 2K5QA 3K3VA 5IT9L 2AQ3B 3HP3A 1KNEA 1VQNA 4DL5A 1QZHA 3KFUA 5I6WA 3KLWA 1EFID 1K8AC 3HB9A 4BBRB 1O7IA 5EKKA 2A73B 3HOYB 1F9SA 2R6FA 2Z4HA 2JA7H 4TUYF 4M7EA 5LMNW 4IR9A 2GLTA 5KT3A 3H0GB 1DONA 4TVAB 4B3MH 3UDXA 1D5XC 2L4NA 3BA9A 1UEBA 5TSSA 3BQ1A 4QW9A 2NUCA 1E4EB 4C3HG 4CHTB 1GXDC 4TQRA 1RHPA 1STGA 5KT6A 1U4PA 2DIKA 5KT7A 4EQOA 1XWEA 5EGTA 3FPPA 2E2IH 3H15A 1VQAA 3F2BA 3BDCA 4X66Q 1JKJB 4K0KH 3A8KE 4YP3A 4OO1G 5A2QE 1GSHA 3E5SA 4AQYQ 2M9VA 4XX0B 3LWBA 4JYAH 4P75A 2KCMA 1G6ZA 3Q22A 2KQ3A 4KHZA 3A8IE 1PYBA 5HV6A 3ORRA 4PZ8A 3ND8A 4LJZC 2KHJA 2WKDA 2WV6D 1PZJD 1STYA 1X56A 1UWVA 4GN5A 4B3RQ 1B9NA 2VA2A 3N41B 4KY5A 1SYEA 2L9HA 4FNFA 2WB1A 2Z8LA 3GP7A 2ZDGA 1JOOA 1NSNS 2I5LX 2I80A 3I2ZA 3PW5A 2MPMA 5C4ZA 1RODA 2K05A 2R7DA 1KXLA 1RIPA 4DUYH 1VQIA 2UUBQ 1GYFA 2DY8A 3A55A 4KN7C 4R7RA 3OHAA 1HPCA 3GTMH 1KL9A 2OTLA 2ATWA 3PSIA 5J2UF 3KAKA 5M3FG 1H9SB 3PUVA 5BPFA 3BAAA 1HR0H 4KJNA 2H1EA 3UDFA 5BN4A 1E4FT 5EBDA 1CQIB 1KC7A 5KFLA 2XRSD 4JV5Q 4DUZH 4L5TA 4CJ0B 1WH2A 4ED6A 5CMDA 3CC7A 4LF7Q 4RB3C 4PQXA 2Z6BA 3SK6A 2VUMH 4DNRB 3HOUH 1F9QA 2ATLA 4A3LG 4FO2A 1S3OA 1LUZA 4X64L 2XWBB 4B3RL 2R87A 4FM9A 3J80L 1IYVA 4TKOB 3VR2A 3GTKA 4C2MB 4Q43A 1O7LA 2N55A 2EYPA 4J15A 4DV7H 2J0TD 4LF8Q 2MQHA 1GHJA 3OHBA 2BH2A 1M8AA 4IUVA 2UUBL 1D8LA 1PYSB 1NNXA 2DPIA 4UAIA 3M9OB 3TP8A 4DV1H 1F2LA 1K83B 3G7LA 5E1FA 1KDAA 2O4XA 3N6RA 4FF2A 2SEBD 4OXPA 2FINB 4AIMA 3J81c 4H44C 2K33A 2ASBA 3I4NH 3I4MB 3PW0A 4RCNA 4JV5L 3GTJA 2YTVA 4R8NA 3FMCA 2K28A 4LF7L 1YVCA 1GJXA 4ZRZA 3ULPA 4QF4A 5K2MA 4DV6L 4DR1Q 1Y1WA 1E4EA 2NVTB 1N33H 2R82A 5IWAQ 2NN6H 3M85A 3KHRA 2YCHA 4XYMB 1FR3A 2UVRA 4DV5L 1PH6A 1N9WA 2CHBD 1HNZL 2PZWA 1KQSA 4X62H 3J81W 1S97A 2EY1A 2B8FA 3PIPA 3QR8A 2DJFC 1GSAA 4LFAL 2A68C 1D6EC 4GNXB 2HCCA 1F2ZA 5KFAA 4PDBA 2NU8B 3KAJA 2Z0SA 3GTOA 1JE5A 2XTIA 3WO0A 4JCVE 1PH7A 5L37A 4KHVA 3HGBA 2IX0A 1EYCA 3IN5A 1VMCA 2UXBQ 4ECSA 4MV4A 4RA8A 4DR1L 1CT1D 3M4QA 4OIKA 3PO2H 4JI1Q 1PV4A 5IODA 1NMGA 5A2QW 2UUCH 3TS2A 1JOKA 2YV5A 1M0TA 1RJPA 2HQLA 3J7A5 3N6XA 2MUYA 2UVUA 1BUVT 4KMUC 4LF4Q 1CHQD 3RUZA 4OHJA 3GIIA 4DXGA 1SNMA 1XMOQ 1W96A 2OT2A 3H3VH 2YRWA 3RV4A 3N52A 1H9SA 1E2WA 2OWOA 2ASLA 4DV3L 1O75A 1LTTD 5FLMG 2V9WA 4BY1H 2RA4A 4KD4A 1N34H 2NZ1D 3PUWA 4OX9H 1MI2A 3RAXA 4OL7A 3LP8A 3N43B 4ILWA 3HOWB 2JQOA 4JI3H 2PVPA 3D4DA 4O1NA 4X65L 2UXBL 2IX3A 1BVSA 4KI0A 4LF6H 2YTYA 2A69D 1A15A 2HIVA 4ZUIA 3A7LA 4JI1L 1J6QA 2YL2A 4DK1A 5FO7B 4UFZA 5KFUA 3D31A 3MA2B 4C2MA 1G291 5AJ3Q 4BWSC 4KY6A 4EQPA 5KX5F 5KFPA 4DR2L 2VQFH 1B9MA 2EYJA 5LL6X 1LTID 3I4NG 2ZJTA 1RJTA 1SJHD 2CZGA 2G9HD 4UCOA 3MJFA 4HCSA 3AFQA 5LMUQ 2YRXA 1ET9A 1KRTA 1XMOL 4AH6A 3RGXA 1M4VA 4XQQA 3G6YA 4DR7L 4UCSA 3Q8DA 1KDCA 1XXGA 4P2CB 1EFWA 1UUPA 4MV3A 1STNA 3GLKA 4EFEA 1TWAB 2NZOA 2F4VH 1Z6HA 4DAYB 1VQMA 4B3TH 1NY4A 1XTCD 4DV0Q 1CSPA 2I46A 1U5KA 5G3LD 2XIGA 4A3EH 3CF5A 3N8DA 5KG1A 1QOHA 4TSSA 5DQGA 2L12A 3J7YW 2Z6KC 2RBMA 4AYBE 2OTJA 3GTPA 3U58A 1ENAA 5AJ3L 4DA2A 4G4KA 4A3BH 4L6TB 2AUKA 4JI7H 3SK8A 3CXCA 1JC7A 3AQQA 4L5RC 4IURA 5G3LF 1WI5A 4GNXA 5LMUL 2N8NA 3AB9A 5M3MH 1G8ZD 3K80C 2W6MA 2AGQA 2JEFA 3V6HA 3MWYW 2NN6I 1PVOA 1F9RA 2PN1A 3VPDA 1XPRA 2FJZA 1TWGH 3WOFA 3JAML 1A3VA 1HA6A 1Q90A 2HIXA 3DMUA 3RLFA 4C3JG 1KJ9A 4IWYA 2F0GA 3ETHA 2N3SA 1JMCA 4L5SA 4Q8FA 3I7FA 4UHVA 2KEDA 4R4IA 2I0QA 4JI0L 3QOLA 1CTMA 1LYLA 3TQYA 1D5MC 4NB3A 5ELFA 2SDFA 5C5MA 5ELBA 4B08A 4ALPA 1HQRD 3OIQA 3X3NA 3MWDA 2R92A 1ZHQA 4MTDA 4MTKA 5KFSA 2WB1G 2D0PA 2JA5H 1IZ6A 3QB3A 1R9TB 1PH5A 1Y8PB 3F8NA 1BQQT 2K6AA 1JT8A 4M1UB 2F4IA 3NGDA 1PRTC 3K8AA 4K6LA 1J5EH 4O3QA 1NMFA 3EQLC 3FP9A 3H09A 5DAUA 1OXXK 1LT5D 3ETJA 2LXJA 4A76A 1SRUA 5H1SE 1WTVA 2UXCQ 3OWEB 1WD0A 4RCOA 5C4JB 2EJGC 4KN4C 4EBDA 4Q8EA 2WACA 4O3PA 1KRSA 1LTLA 3CMAA 1RJQA 1RYSA 3E0EA 1YZ6A 1QUQB 1AFPA 3NTKA 3KYHC 3MVVA 3NQTA 5EZYF 1IHZA 3CCMA 2AUJD 5C4XG 2YU9A 5JPNC 5D1OA 1PA6A 1VS0A 1XPUA 3MR3A 4J9PA 3NP8A 2X69A 4OGQC 3SK5A 4ZOLF 5JVLA 4R8IA 3V6KA 5KFEA 2A6ED 4LMQD 4KV6A 3PW7A 1NE3A 3I12A 1RK6A 3WNZA 4DV2H 4RG1A 4DAYA 3GILA 1HUNA 4C3HB 4H0LC 4GKJL 5LL6b 2YZGA 2LS01 2RDFA 1IBMQ 2NVXH 1ZYRD 5LA6F 4RH6A 5EOYA 2FJ2A 4UDUC 3PCOB 4H7BA 1IXRA 1AE3A 2E2HB 1ICWA 1Y1WG 4XZ3B 3PGZA 2XGTA 3OTOH 2B2WA 3UE1A 1ZXTA 4ZYSA 4K6DA 1KTKA 1I4GA 2WIIB 1JE4A 3G6EA 1VQFA 4EVOA 1XNRL 4YQWA 4NXMH 3S15H 3J7AK 3OOCA 4CKBA 5JJZA 4CKCA 4F88A 3PO3G 4Q45A 1IL2A 1RCVD 3NELA 5JEAH 3FKIH 1VQDA 3K7UC 2OCEA 3NEMA 3KLRA 2MNAA 4F7XA 1HZAA 4WJWA 3FDSA 4ED7A 4JV1A 3VYTA 4OWXB 3VDYA 2AGOA 2B2TA 3WWVA 1IBML 4ZQ3A 1GUOA 3NPPA 1LTSD 3K81C 1B8AA 4DR3Q 4ETSA 4ED1A 3OWFA 2ZT9C 4K2KA 4FBTA 1GD7A 4S3SA 5M3FB 2F0VA 1EUJA 5M5WH 5IGFA 4ODGA 3I4OA 2QF7A 3IL8A 2B8GA 5FLXE 5D3DA 1FYCA 5CV7A 3Q24A 1SCUB 5F9LA 1PTOD 1TWHH 1TAEA 4YR2A 4OWTB 3SEBA 1WTOA 4ZQIA 4I50F 3CQZB 1Q82C 1AEXA 2B2WC 4XYOA 2CW0D 3GIQA 1F77A 3TMEA 2N88A 1TS5A 2E2JH 1DOKA 2HHHL 1GHKA 5IYDG 2AU0A 2QEJC 1TY2A 3DEPA 4DN4M 1Y8OB 1PTOF 4HTHA 2PZTA 3HOXB 4IWXA 4YY3Q 1WCMH 4IZ8A 1I3QH 4RHSA 2M2LA 5IGCA 1YHAA 2PMZA 3BS1A 2RGRA 4M8AA 3E6ZX 1IKMA 2UUAL 1XNQQ 4A3IH 2B2TC 5ELEA
chains in the Genus database with same CATH topology
1A62A 3CCQA 4DV4L 3W5OA 3T1HQ 2UU9L 4LFCQ 4L5QA 3HOXG 2HHHQ 3CC2A 1HNXQ 2WAQG 1FVIA 1L2FA 1EQRA 5JEAJ 3IRBA 1TWCH 1K3RA 2CWPA 4NXNQ 2EXDA 3CCUA 4UPAA 5IP7H 4BXXG 4LUZA 2EIFA 2JA9A 5HY6A 4GKJQ 2JK8A 3CCVA 3HKZG 1AH9A 1UE5A 3BU2A 3UE0A 3H3VI 1JJ2A 4JI2Q 2EQSA 4DUYQ 2NZHA 4DR5Q 4OWWB 5IP9G 3S1NH 3F8TA 3PV0A 2K52A 4IJLA 4A3CH 3AYHB 4B3SQ 2RF4A 2R93H 4A3MH 4JI3L 4P73A 1E7ZA 2K5NA 5C3EH 1HR0W 1VQHA 1HR0Q 4PZ7A 4HJAA 1XNQL 4JYAL 4XIGS 3AFPA 4LF8L 3K7AH 4UP7A 4LF6L 3S1MH 1V43A 1CKMA 3A0JA 1NBWA 4A3EG 4LFCL 5GROA 2K4KA 2WB1E 1XNRQ 3GD7A 3K0XA 3HOZH 4DR6Q 4YCWA 4DUZQ 2F3IA 1I94L 3J80i 1E24A 3KDFA 4Y7NH 2VQFL 1GM5A 1GO3E 4PZ6A 4GN3B 4NXNL 2E8GA 1A8VA 1E3PA 2PI2A 1VQNA 2CFMA 5C44H 4A3JG 2B63G 1QZHA 3KFUA 4BY7H 2ZM6Q 3KLWA 1RL2A 1QVFA 4A3BG 1YJ9A 1K8AC 1O7IA 2DUDA 3RN2A 2R7FA 2LXKA 1X6OA 4DV7Q 4DPGA 2JA7H 4DUYL 4HJ8A 3T1YQ 2B29A 5LMNW 5LMNQ 4DR5L 2R92G 5M3MG 4POFA 5IWAL 1CUKA 2QGQA 2KCTA 4TVAB 1M1KC 3L0OA 4B3TL 1ASZA 1BBWA 5IYCG 3UDXA 4C3JH 3NENA 4DV1Q 1EYGA 3M7NA 4A93H 2CQOA 2BA0A 3W1BA 2ZJPA 1UEBA 3RN5A 1HR0L 4LUVA 3RLNA 4JI4Q 3KF6A 2Q2UA 5FLXc 4BBRG 4HJ5A 1QVCA 3W1GA 4C2MH 1VQJA 1MJCA 4DUZL 1XPOA 2E2IH 3H15A 1VQAA 3F2BA 1Q46A 4X66Q 3CCEA 2JEAI 1VQ6A 4JI7L 1K8GA 1OXTA 1N33Q 2FXQA 4OO1G 3I55A 3PUXA 4AQYQ 4LW1A 5GAHC 1EWIA 3GTGH 2JA5G 1K83H 1X3GA 1DGSA 4LF5L 4MZ9A 4P75A 4ME3A 4JC0A 2KCMA 2ID0A 2LSSA 4YCVA 4X62Q 3KJPA 2N78A 4KHZA 1FGUA 4DV7L 4HIOA 3T1YL 1CSQA 1M90C 1PYBA 2A8VA 3I4MH 3LGJA 1PH4A 4P74A 4PZ8A 2IY5B 4JI6Q 2KHJA 1PH1A 1X56A 2Q2IA 1UWVA 3D0FA 4GN5A 3ZJYC 1Q7YC 3M4OH 1A0IA 4B3RQ 1TWFH 4JI4L 2NVTH 1SFOH 3S17H 4LF4L 1FJGQ 3GTKH 2UUAQ 2BH8A 2I5LX 3I2ZA 1W2BA 1G51A 1A63A 1TXYA 1PH9A 1X3FA 2R7DA 1KXLA 1RIPA 4DV4Q 1VQIA 2UUBQ 2UU9Q 3KF6B 3GTMH 1KL9A 4A3MG 2OTLA 2ATWA 3PSIA 2JA6H 2UUCQ 3MXNB 4GLVB 1EIFA 2PNHA 1GVPA 2VS1A 5C4XH 3PUVA 1I5FA 4FDBA 5M3FG 4GOPB 1I6HH 3EBEA 4POGA 2WP8J 1J5EL 3UDFA 1PHJA 4GLAC 1EIYB 2DGYA 2R7ZH 2IX1A 1VQKA 1N8RC 1V1QA 3G4SA 2Y0SG 1Q8KA 4DK3C 4GOPC 2BA1A 4L5TA 4DK6C 3F2CA 4JV5Q 3CC7A 2WFWA 4LF7Q 4JI6L 4IPHA 2VUMH 3HOUH 5C0XI 2E5LL 4BY7G 4A3LG 2AWOA 3RNUA 1KD1C 1S3OA 1N34Q 1LUZA 1E1TA 4JBJA 4X64L 4A3KH 1EQQA 4OX9Q 1YIJA 4B3RL 4QY7A 1FJGL 4JI3Q 1VQBA 4R4OA 3CCRA 3GTJH 4HIKA 4A3GG 4APVA 4J15A 1WOCA 4LF8Q 2MQHA 1K9MC 4LF6Q 1Y1WH 2BH2A 4YCUA 2UUBL 1D8LA 1PYSB 2MO0A 3M4PA 5EAYA 5FJ8H 4IOCA 1I94Q 2UUCL 1YHBA 1VQEA 1UE1A 2ALYB 3ULLA 4DV0L 2VQFQ 3PF4A 1N36L 3GO5A 4H02A 1U0LA 1YNXA 4YWMA 3B6YA 4OXPA 4AIMA 3J81c 3F2DA 4DV2L 2ASBA 2ZTDA 3HOWH 3I4NH 3PO3H 3HFZB 3CPWA 2VNUD 3HOVH 4JV5L 2YTVA 1Z47A 4R1JA 1YBYA 1YVCA 4LF7L 3I56A 2MO1A 1WYDA 4P71A 3ULPA 1X65A 4DV6L 4DR1Q 3GTOH 4R4CA 3FKIG 5E7NA 5JEAG 4Y52H 1N34L 1X3EA 3U4VA 5IWAQ 4BA1I 4OX9L 2IT1A 2F4VQ 3M85A 4B3TQ 3NBHB 1VQLA 2NVYH 4DV5L 1VQ4A 1PH8A 5IYBH 1N9WA 1PH6A 1K0RA 1HNZL 1KQSA 5JJIA 3OTOL 3F1ZA 3OW2A 3PIPA 1Q12A 4WJ3M 2IHFA 2RHSB 1Y1VG 2Q2HA 4LFAL 4R4QA 4GNXB 3RLOA 1IBKL 4LNQA 4QQBX 4NXML 2JA8H 3GDEA 3AEVA 1X55A 1Z9FA 2Z0SA 3ERSX 4EQ5A 1JE5A 2AMCB 2XTIA 5GQOA 4JI7Q 3TRZA 1PFSA 1TWAH 4JCVE 5GAEC 5GADC 4GNXC 4GLXA 1YITA 1PH7A 1OXUA 1C0AA 5JJLA 2IX0A 3KOJA 2GVBA 1Y14B 4LF5Q 2Q2TA 2UXBQ 4UP8A 3PF5A 4O0AA 3HKZE 4DR1L 3M4QA 3J81j 1QZGA 3CC4A 2JA6G 3PO2H 4JI1Q 1PV4A 1G6PA 1NMGA 1X54A 3TS2A 2F4VL 3HKSA 2R6GA 1W3SA 2YV5A 2L15A 2HQLA 3J7A5 5IYDH 1JJGA 1HH2P 1QVGA 1HZBA 2PQAB 2ES2A 1VQ7A 4LF4Q 1N32L 1XMOQ 3H3VH 1HJPA 3HOYG 1SROA 2B3GA 4GOPA 1HZCA 2OWOA 4LF9Q 4IOAA 1WCMG 1Q1EA 4EX5A 4DV3L 5FLMG 2IHEA 1X9NA 4A3DG 4MNOA 1E22A 3H0GG 4IPGA 4IO9A 3CCLA 1BBUA 2VQEQ 4BY1H 3PUWA 2UXCL 1AE2A 3CPFA 4A3IG 2JQOA 1SMXA 4JBWA 4QL5A 2AWNA 4MTNA 3G48A 5C0XJ 4X65L 2K5VA 2UXBL 3HOXH 1J5EQ 1BVSA 4KI0A 3BZCA 5ELNA 2YTYA 3PUYA 1CKNB 2JJQA 2HIVA 4JI1L 1J6QA 3JAMc 3D31A 3TREA 1G291 5AJ3Q 2N49A 4BXXH 4DR2L 3E9IA 4HIMA 2E5LQ 3PUZA 5IP7G 5C0XG 4X64Q 3I4NG 2MFIA 3DM3A 2ZTEA 4DR4L 3KJOA 3HOVG 3AFQA 5LMUQ 1R9TH 1WFQA 1KRTA 2A1AA 5IP9H 1XMOL 3GTPH 4AH6A 3S16H 4LF9L 1UE7A 4DR7L 2D62A 3Q8DA 4LWCA 3STBC 1XJVA 1EFWA 4A3CG 2R93G 2VQEL 2UXDQ 2CWAA 2NZOA 4DAYB 3J81i 1VQMA 1NY4A 5JJKA 1L1OA 5C3EG 4DV0Q 1CSPA 1U5KA 1N36Q 4A3EH 1KC8C 1YI2A 4IJHA 3A5UA 3CF5A 3TEHB 2RHQB 5C4JH 3HOZG 4DV2Q 2JEBI 2Z6KC 3L7ZC 2VW9A 3G71A 1EOVA 4AYBE 5HGQA 1B70B 2A19A 3U58A 1XMQQ 2OTJA 4A3JH 5AJ3L 1S40A 4IFDI 1SR3A 4QJFA 4DKAC 4DV6Q 4A3BH 5C44G 1JJCB 3CXCA 3AQQA 4L5RC 1WI5A 4GNXA 5LMUL 2N8NA 2K75A 4DV5Q 2R92H 5M3MH 2JA7G 3K80C 1HNZQ 3OTOQ 2NN6I 1PVOA 4UP9A 5IYCH 2YTXA 1XPRA 3KF8B 4TQUS 4YHHQ 1TWGH 4LFAQ 2HIXA 2UXDL 3RLFA 4A93G 5K36G 1IBKQ 2N3SA 1JMCA 4L5SA 4NXMQ 3I7FA 3BZKA 4C3HH 1PH2A 1QUQA 4DR3L 4R4IA 2I0QA 4JI0L 1IBLL 4GKKQ 1MJEA 4LFBQ 1LYLA 3TQYA 4K0KQ 4NB3A 2KENA 3S24A 3UDGA 4PMWA 4ALPA 4A3FH 2K5HA 4HJ7A 4BBSH 2E2HH 1L1OB 4HIDA 1XMQL 2PQAA 5BR8Q 2RCNA 1YJWA 4JI8Q 2WB1G 2D0PA 2JA5H 1IZ6A 1P16A 4P72A 1L1OC 4IPCA 4OONA 1PH5A 5DLQE 1JT8A 1Q1BA 4B3ML 3I4MG 3K8AA 1N32Q 2H5XA 1NJIC 3TS0A 2JE6I 3S1QH 4YHHL 2I5HA 1NMFA 3FP9A 2YU9H 2AHOB 1KIXA 1OXXK 2ZTCA 4O2DA 4DV3Q 2LXJA 1HNWQ 4A76A 1SRUA 2GVAA 5H1SE 1C7YA 1YEZA 2WAQE 3JC66 2VY3A 1CKNA 4GKKL 2UXCQ 4YY3L 4K0KL 1KRSA 4RMFA 1LM0A 1LTLA 2VL6A 4C3IH 3JAMi 3CMAA 3S2DH 3E0EA 3BJUA 4X65Q 4HJ9A 3M9BA 1YZ6A 1QUQB 3KYHC 5M3FH 5BR8L 3CCMA 4JI8L 4JOIA 3ICEA 5C4XG 3T1HL 1PA6A 1VS0A 1WJJA 1XPUA 2QEXA 1YHQA 4DR2Q 4WJ4A 3ER0A 1Q81C 3U50C 1HNXL 4PG3A 4JBMA 2R7ZG 1NE3A 3EIVA 4QGUA 1NTGA 3CW2C 4DR4Q 4RG1A 1P8LA 1OTCA 1HZ9A 3FHWA 5GAGC 2QA4A 4A3LH 2Z6KA 3CQZH 2VUMG 3U4ZA 3HOUG 2K14A 2V1CC 4A4IA 4DR7Q 3A5ZB 4GKJL 4A3KG 1HNWL 4BA2I 1IBMQ 2NVXH 4A3GH 3PIOA 2OQKA 4JI2L 4YWKA 2I5MX 3MEFA 1CKOA 3CMEA 3PCOB 1IXRA 4B3SL 1AE3A 1MIUA 4IFDJ 1Y1WG 3PGZA 2XGTA 1KHIA 3CD6A 3UE1A 4DNIA 1OXVA 3CCSA 4JI5Q 4DAMA 5FJ8G 1VQ8A 1UE6A 2D0OA 2C35B 2PMZE 3J7ZC 3G6EA 1VQFA 2KBNA 1XNRL 1PH3A 3S15H 4DR6L 2CCZA 4IFDG 1VQ5A 2HT1A 3EN2A 5IE8A 3ULJA 5IY0A 4A3FG 4GS3A 3HOWG 1IL2A 3PO3G 4BBSG 2NVQH 3NELA 3FKIH 1VQDA 3K7UC 2OCEA 3NEMA 2MNAA 2ZM6L 4QIWE 3J80c 1VCIA 4NPSA 1HZAA 3A74A 3KDFB 4OWXB 3VDYA 1IYJB 2NN6G 4JOIC 3WWVA 2OQ0A 1IBML 4AYBG 3GTLH 1H95A 5LMNL 5IYBG 3K81C 1B8AA 4XTCS 3UDIA 4DR3Q 3S14H 4JI0Q 1Y1VH 1IBLQ 1OXSC 4DV1L 1B7YB 1GD7A 4JI5L 3SGIA 3L2PA 1VQOA 2ZJQA 3CCJA 1EUJA 1VQGA 4R4TA 5M5WH 1S72A 3CAMA 3RZDH 3GTQH 1V9PA 2B63H 2JA8G 4KHPQ 1D7QA 3I4OA 1XTDA 3OYYA 3RZOH 1TWHH 4OO1I 4OWTB 2F52A 4X66L 1GKHA 3DLLA 2ZJRA 1N33L 1K73C 3STBD 1Q82C 4AQYL 1JB7A 1SN8A 4KLKA 4B3MQ 2YYZA 4UY8C 3PO2G 1MKHA 4JG2A 1FL0A 1T9HA 4YWLA 1KAWA 2GN5A 4GN4B 1BKBA 1L0WA 4X62L 1I50H 2HHHL 2PI2E 2E2JH 1Q86C 4A75A 5IYDG 5M5YH 2VZAA 1YJNA 4BBRH 1SE8A 3S1RH 1ASYA 4LUOA 3HOYH 5M5XH 4IPDA 3M3YH 2AKWB 4LFBL 2K50A 3S2HH 4X6AH 4YY3Q 1WCMH 5IT9c 4JBKA 1I3QH 4A3DH 5J3BA 1VQCA 5FLMH 2KHIA 1E1OA 1YHAA 3H0GH 2CKZB 1C9OA 3E9HA 3CP0A 4BY1G 4KHPL 2UUAL 3RR5A 1XNQQ 2Y0SE 4A3IH 4JYAQ 1VQPA 1SLJA 1VQ9A 5ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A62 A;  3CCQ A;  4DV4 L;  3W5O A;  3T1H Q;  2UU9 L;  4LFC Q;  4L5Q A;  3HOX G;  2HHH Q;  3CC2 A;  1HNX Q;  2WAQ G;  1FVI A;  1L2F A;  1EQR A;  5JEA J;  3IRB A;  1TWC H;  1K3R A;  2CWP A;  4NXN Q;  2EXD A;  3CCU A;  4UPA A;  5IP7 H;  4BXX G;  4LUZ A;  2EIF A;  2JA9 A;  5HY6 A;  4GKJ Q;  2JK8 A;  3CCV A;  3HKZ G;  1AH9 A;  1UE5 A;  3BU2 A;  3UE0 A;  3H3V I;  1JJ2 A;  4JI2 Q;  2EQS A;  4DUY Q;  2NZH A;  4DR5 Q;  4OWW B;  5IP9 G;  3S1N H;  3F8T A;  3PV0 A;  2K52 A;  4IJL A;  4A3C H;  3AYH B;  4B3S Q;  2RF4 A;  2R93 H;  4A3M H;  4JI3 L;  4P73 A;  1E7Z A;  2K5N A;  5C3E H;  1HR0 W;  1VQH A;  1HR0 Q;  4PZ7 A;  4HJA A;  1XNQ L;  4JYA L;  4XIG S;  3AFP A;  4LF8 L;  3K7A H;  4UP7 A;  4LF6 L;  3S1M H;  1V43 A;  1CKM A;  3A0J A;  1NBW A;  4A3E G;  4LFC L;  5GRO A;  2K4K A;  2WB1 E;  1XNR Q;  3GD7 A;  3K0X A;  3HOZ H;  4DR6 Q;  4YCW A;  4DUZ Q;  2F3I A;  1I94 L;  3J80 i;  1E24 A;  3KDF A;  4Y7N H;  2VQF L;  1GM5 A;  1GO3 E;  4PZ6 A;  4GN3 B;  4NXN L;  2E8G A;  1A8V A;  1E3P A;  2PI2 A;  1VQN A;  2CFM A;  5C44 H;  4A3J G;  2B63 G;  1QZH A;  3KFU A;  4BY7 H;  2ZM6 Q;  3KLW A;  1RL2 A;  1QVF A;  4A3B G;  1YJ9 A;  1K8A C;  1O7I A;  2DUD A;  3RN2 A;  2R7F A;  2LXK A;  1X6O A;  4DV7 Q;  4DPG A;  2JA7 H;  4DUY L;  4HJ8 A;  3T1Y Q;  2B29 A;  5LMN W;  5LMN Q;  4DR5 L;  2R92 G;  5M3M G;  4POF A;  5IWA L;  1CUK A;  2QGQ A;  2KCT A;  4TVA B;  1M1K C;  3L0O A;  4B3T L;  1ASZ A;  1BBW A;  5IYC G;  3UDX A;  4C3J H;  3NEN A;  4DV1 Q;  1EYG A;  3M7N A;  4A93 H;  2CQO A;  2BA0 A;  3W1B A;  2ZJP A;  1UEB A;  3RN5 A;  1HR0 L;  4LUV A;  3RLN A;  4JI4 Q;  3KF6 A;  2Q2U A;  5FLX c;  4BBR G;  4HJ5 A;  1QVC A;  3W1G A;  4C2M H;  1VQJ A;  1MJC A;  4DUZ L;  1XPO A;  2E2I H;  3H15 A;  1VQA A;  3F2B A;  1Q46 A;  4X66 Q;  3CCE A;  2JEA I;  1VQ6 A;  4JI7 L;  1K8G A;  1OXT A;  1N33 Q;  2FXQ A;  4OO1 G;  3I55 A;  3PUX A;  4AQY Q;  4LW1 A;  5GAH C;  1EWI A;  3GTG H;  2JA5 G;  1K83 H;  1X3G A;  1DGS A;  4LF5 L;  4MZ9 A;  4P75 A;  4ME3 A;  4JC0 A;  2KCM A;  2ID0 A;  2LSS A;  4YCV A;  4X62 Q;  3KJP A;  2N78 A;  4KHZ A;  1FGU A;  4DV7 L;  4HIO A;  3T1Y L;  1CSQ A;  1M90 C;  1PYB A;  2A8V A;  3I4M H;  3LGJ A;  1PH4 A;  4P74 A;  4PZ8 A;  2IY5 B;  4JI6 Q;  2KHJ A;  1PH1 A;  1X56 A;  2Q2I A;  1UWV A;  3D0F A;  4GN5 A;  3ZJY C;  1Q7Y C;  3M4O H;  1A0I A;  4B3R Q;  1TWF H;  4JI4 L;  2NVT H;  1SFO H;  3S17 H;  4LF4 L;  1FJG Q;  3GTK H;  2UUA Q;  2BH8 A;  2I5L X;  3I2Z A;  1W2B A;  1G51 A;  1A63 A;  1TXY A;  1PH9 A;  1X3F A;  2R7D A;  1KXL A;  1RIP A;  4DV4 Q;  1VQI A;  2UUB Q;  2UU9 Q;  3KF6 B;  3GTM H;  1KL9 A;  4A3M G;  2OTL A;  2ATW A;  3PSI A;  2JA6 H;  2UUC Q;  3MXN B;  4GLV B;  1EIF A;  2PNH A;  1GVP A;  2VS1 A;  5C4X H;  3PUV A;  1I5F A;  4FDB A;  5M3F G;  4GOP B;  1I6H H;  3EBE A;  4POG A;  2WP8 J;  1J5E L;  3UDF A;  1PHJ A;  4GLA C;  1EIY B;  2DGY A;  2R7Z H;  2IX1 A;  1VQK A;  1N8R C;  1V1Q A;  3G4S A;  2Y0S G;  1Q8K A;  4DK3 C;  4GOP C;  2BA1 A;  4L5T A;  4DK6 C;  3F2C A;  4JV5 Q;  3CC7 A;  2WFW A;  4LF7 Q;  4JI6 L;  4IPH A;  2VUM H;  3HOU H;  5C0X I;  2E5L L;  4BY7 G;  4A3L G;  2AWO A;  3RNU A;  1KD1 C;  1S3O A;  1N34 Q;  1LUZ A;  1E1T A;  4JBJ A;  4X64 L;  4A3K H;  1EQQ A;  4OX9 Q;  1YIJ A;  4B3R L;  4QY7 A;  1FJG L;  4JI3 Q;  1VQB A;  4R4O A;  3CCR A;  3GTJ H;  4HIK A;  4A3G G;  4APV A;  4J15 A;  1WOC A;  4LF8 Q;  2MQH A;  1K9M C;  4LF6 Q;  1Y1W H;  2BH2 A;  4YCU A;  2UUB L;  1D8L A;  1PYS B;  2MO0 A;  3M4P A;  5EAY A;  5FJ8 H;  4IOC A;  1I94 Q;  2UUC L;  1YHB A;  1VQE A;  1UE1 A;  2ALY B;  3ULL A;  4DV0 L;  2VQF Q;  3PF4 A;  1N36 L;  3GO5 A;  4H02 A;  1U0L A;  1YNX A;  4YWM A;  3B6Y A;  4OXP A;  4AIM A;  3J81 c;  3F2D A;  4DV2 L;  2ASB A;  2ZTD A;  3HOW H;  3I4N H;  3PO3 H;  3HFZ B;  3CPW A;  2VNU D;  3HOV H;  4JV5 L;  2YTV A;  1Z47 A;  4R1J A;  1YBY A;  1YVC A;  4LF7 L;  3I56 A;  2MO1 A;  1WYD A;  4P71 A;  3ULP A;  1X65 A;  4DV6 L;  4DR1 Q;  3GTO H;  4R4C A;  3FKI G;  5E7N A;  5JEA G;  4Y52 H;  1N34 L;  1X3E A;  3U4V A;  5IWA Q;  4BA1 I;  4OX9 L;  2IT1 A;  2F4V Q;  3M85 A;  4B3T Q;  3NBH B;  1VQL A;  2NVY H;  4DV5 L;  1VQ4 A;  1PH8 A;  5IYB H;  1N9W A;  1PH6 A;  1K0R A;  1HNZ L;  1KQS A;  5JJI A;  3OTO L;  3F1Z A;  3OW2 A;  3PIP A;  1Q12 A;  4WJ3 M;  2IHF A;  2RHS B;  1Y1V G;  2Q2H A;  4LFA L;  4R4Q A;  4GNX B;  3RLO A;  1IBK L;  4LNQ A;  4QQB X;  4NXM L;  2JA8 H;  3GDE A;  3AEV A;  1X55 A;  1Z9F A;  2Z0S A;  3ERS X;  4EQ5 A;  1JE5 A;  2AMC B;  2XTI A;  5GQO A;  4JI7 Q;  3TRZ A;  1PFS A;  1TWA H;  4JCV E;  5GAE C;  5GAD C;  4GNX C;  4GLX A;  1YIT A;  1PH7 A;  1OXU A;  1C0A A;  5JJL A;  2IX0 A;  3KOJ A;  2GVB A;  1Y14 B;  4LF5 Q;  2Q2T A;  2UXB Q;  4UP8 A;  3PF5 A;  4O0A A;  3HKZ E;  4DR1 L;  3M4Q A;  3J81 j;  1QZG A;  3CC4 A;  2JA6 G;  3PO2 H;  4JI1 Q;  1PV4 A;  1G6P A;  1NMG A;  1X54 A;  3TS2 A;  2F4V L;  3HKS A;  2R6G A;  1W3S A;  2YV5 A;  2L15 A;  2HQL A;  3J7A 5;  5IYD H;  1JJG A;  1HH2 P;  1QVG A;  1HZB A;  2PQA B;  2ES2 A;  1VQ7 A;  4LF4 Q;  1N32 L;  1XMO Q;  3H3V H;  1HJP A;  3HOY G;  1SRO A;  2B3G A;  4GOP A;  1HZC A;  2OWO A;  4LF9 Q;  4IOA A;  1WCM G;  1Q1E A;  4EX5 A;  4DV3 L;  5FLM G;  2IHE A;  1X9N A;  4A3D G;  4MNO A;  1E22 A;  3H0G G;  4IPG A;  4IO9 A;  3CCL A;  1BBU A;  2VQE Q;  4BY1 H;  3PUW A;  2UXC L;  1AE2 A;  3CPF A;  4A3I G;  2JQO A;  1SMX A;  4JBW A;  4QL5 A;  2AWN A;  4MTN A;  3G48 A;  5C0X J;  4X65 L;  2K5V A;  2UXB L;  3HOX H;  1J5E Q;  1BVS A;  4KI0 A;  3BZC A;  5ELN A;  2YTY A;  3PUY A;  1CKN B;  2JJQ A;  2HIV A;  4JI1 L;  1J6Q A;  3JAM c;  3D31 A;  3TRE A;  1G29 1;  5AJ3 Q;  2N49 A;  4BXX H;  4DR2 L;  3E9I A;  4HIM A;  2E5L Q;  3PUZ A;  5IP7 G;  5C0X G;  4X64 Q;  3I4N G;  2MFI A;  3DM3 A;  2ZTE A;  4DR4 L;  3KJO A;  3HOV G;  3AFQ A;  5LMU Q;  1R9T H;  1WFQ A;  1KRT A;  2A1A A;  5IP9 H;  1XMO L;  3GTP H;  4AH6 A;  3S16 H;  4LF9 L;  1UE7 A;  4DR7 L;  2D62 A;  3Q8D A;  4LWC A;  3STB C;  1XJV A;  1EFW A;  4A3C G;  2R93 G;  2VQE L;  2UXD Q;  2CWA A;  2NZO A;  4DAY B;  3J81 i;  1VQM A;  1NY4 A;  5JJK A;  1L1O A;  5C3E G;  4DV0 Q;  1CSP A;  1U5K A;  1N36 Q;  4A3E H;  1KC8 C;  1YI2 A;  4IJH A;  3A5U A;  3CF5 A;  3TEH B;  2RHQ B;  5C4J H;  3HOZ G;  4DV2 Q;  2JEB I;  2Z6K C;  3L7Z C;  2VW9 A;  3G71 A;  1EOV A;  4AYB E;  5HGQ A;  1B70 B;  2A19 A;  3U58 A;  1XMQ Q;  2OTJ A;  4A3J H;  5AJ3 L;  1S40 A;  4IFD I;  1SR3 A;  4QJF A;  4DKA C;  4DV6 Q;  4A3B H;  5C44 G;  1JJC B;  3CXC A;  3AQQ A;  4L5R C;  1WI5 A;  4GNX A;  5LMU L;  2N8N A;  2K75 A;  4DV5 Q;  2R92 H;  5M3M H;  2JA7 G;  3K80 C;  1HNZ Q;  3OTO Q;  2NN6 I;  1PVO A;  4UP9 A;  5IYC H;  2YTX A;  1XPR A;  3KF8 B;  4TQU S;  4YHH Q;  1TWG H;  4LFA Q;  2HIX A;  2UXD L;  3RLF A;  4A93 G;  5K36 G;  1IBK Q;  2N3S A;  1JMC A;  4L5S A;  4NXM Q;  3I7F A;  3BZK A;  4C3H H;  1PH2 A;  1QUQ A;  4DR3 L;  4R4I A;  2I0Q A;  4JI0 L;  1IBL L;  4GKK Q;  1MJE A;  4LFB Q;  1LYL A;  3TQY A;  4K0K Q;  4NB3 A;  2KEN A;  3S24 A;  3UDG A;  4PMW A;  4ALP A;  4A3F H;  2K5H A;  4HJ7 A;  4BBS H;  2E2H H;  1L1O B;  4HID A;  1XMQ L;  2PQA A;  5BR8 Q;  2RCN A;  1YJW A;  4JI8 Q;  2WB1 G;  2D0P A;  2JA5 H;  1IZ6 A;  1P16 A;  4P72 A;  1L1O C;  4IPC A;  4OON A;  1PH5 A;  5DLQ E;  1JT8 A;  1Q1B A;  4B3M L;  3I4M G;  3K8A A;  1N32 Q;  2H5X A;  1NJI C;  3TS0 A;  2JE6 I;  3S1Q H;  4YHH L;  2I5H A;  1NMF A;  3FP9 A;  2YU9 H;  2AHO B;  1KIX A;  1OXX K;  2ZTC A;  4O2D A;  4DV3 Q;  2LXJ A;  1HNW Q;  4A76 A;  1SRU A;  2GVA A;  5H1S E;  1C7Y A;  1YEZ A;  2WAQ E;  3JC6 6;  2VY3 A;  1CKN A;  4GKK L;  2UXC Q;  4YY3 L;  4K0K L;  1KRS A;  4RMF A;  1LM0 A;  1LTL A;  2VL6 A;  4C3I H;  3JAM i;  3CMA A;  3S2D H;  3E0E A;  3BJU A;  4X65 Q;  4HJ9 A;  3M9B A;  1YZ6 A;  1QUQ B;  3KYH C;  5M3F H;  5BR8 L;  3CCM A;  4JI8 L;  4JOI A;  3ICE A;  5C4X G;  3T1H L;  1PA6 A;  1VS0 A;  1WJJ A;  1XPU A;  2QEX A;  1YHQ A;  4DR2 Q;  4WJ4 A;  3ER0 A;  1Q81 C;  3U50 C;  1HNX L;  4PG3 A;  4JBM A;  2R7Z G;  1NE3 A;  3EIV A;  4QGU A;  1NTG A;  3CW2 C;  4DR4 Q;  4RG1 A;  1P8L A;  1OTC A;  1HZ9 A;  3FHW A;  5GAG C;  2QA4 A;  4A3L H;  2Z6K A;  3CQZ H;  2VUM G;  3U4Z A;  3HOU G;  2K14 A;  2V1C C;  4A4I A;  4DR7 Q;  3A5Z B;  4GKJ L;  4A3K G;  1HNW L;  4BA2 I;  1IBM Q;  2NVX H;  4A3G H;  3PIO A;  2OQK A;  4JI2 L;  4YWK A;  2I5M X;  3MEF A;  1CKO A;  3CME A;  3PCO B;  1IXR A;  4B3S L;  1AE3 A;  1MIU A;  4IFD J;  1Y1W G;  3PGZ A;  2XGT A;  1KHI A;  3CD6 A;  3UE1 A;  4DNI A;  1OXV A;  3CCS A;  4JI5 Q;  4DAM A;  5FJ8 G;  1VQ8 A;  1UE6 A;  2D0O A;  2C35 B;  2PMZ E;  3J7Z C;  3G6E A;  1VQF A;  2KBN A;  1XNR L;  1PH3 A;  3S15 H;  4DR6 L;  2CCZ A;  4IFD G;  1VQ5 A;  2HT1 A;  3EN2 A;  5IE8 A;  3ULJ A;  5IY0 A;  4A3F G;  4GS3 A;  3HOW G;  1IL2 A;  3PO3 G;  4BBS G;  2NVQ H;  3NEL A;  3FKI H;  1VQD A;  3K7U C;  2OCE A;  3NEM A;  2MNA A;  2ZM6 L;  4QIW E;  3J80 c;  1VCI A;  4NPS A;  1HZA A;  3A74 A;  3KDF B;  4OWX B;  3VDY A;  1IYJ B;  2NN6 G;  4JOI C;  3WWV A;  2OQ0 A;  1IBM L;  4AYB G;  3GTL H;  1H95 A;  5LMN L;  5IYB G;  3K81 C;  1B8A A;  4XTC S;  3UDI A;  4DR3 Q;  3S14 H;  4JI0 Q;  1Y1V H;  1IBL Q;  1OXS C;  4DV1 L;  1B7Y B;  1GD7 A;  4JI5 L;  3SGI A;  3L2P A;  1VQO A;  2ZJQ A;  3CCJ A;  1EUJ A;  1VQG A;  4R4T A;  5M5W H;  1S72 A;  3CAM A;  3RZD H;  3GTQ H;  1V9P A;  2B63 H;  2JA8 G;  4KHP Q;  1D7Q A;  3I4O A;  1XTD A;  3OYY A;  3RZO H;  1TWH H;  4OO1 I;  4OWT B;  2F52 A;  4X66 L;  1GKH A;  3DLL A;  2ZJR A;  1N33 L;  1K73 C;  3STB D;  1Q82 C;  4AQY L;  1JB7 A;  1SN8 A;  4KLK A;  4B3M Q;  2YYZ A;  4UY8 C;  3PO2 G;  1MKH A;  4JG2 A;  1FL0 A;  1T9H A;  4YWL A;  1KAW A;  2GN5 A;  4GN4 B;  1BKB A;  1L0W A;  4X62 L;  1I50 H;  2HHH L;  2PI2 E;  2E2J H;  1Q86 C;  4A75 A;  5IYD G;  5M5Y H;  2VZA A;  1YJN A;  4BBR H;  1SE8 A;  3S1R H;  1ASY A;  4LUO A;  3HOY H;  5M5X H;  4IPD A;  3M3Y H;  2AKW B;  4LFB L;  2K50 A;  3S2H H;  4X6A H;  4YY3 Q;  1WCM H;  5IT9 c;  4JBK A;  1I3Q H;  4A3D H;  5J3B A;  1VQC A;  5FLM H;  2KHI A;  1E1O A;  1YHA A;  3H0G H;  2CKZ B;  1C9O A;  3E9H A;  3CP0 A;  4BY1 G;  4KHP L;  2UUA L;  3RR5 A;  1XNQ Q;  2Y0S E;  4A3I H;  4JYA Q;  1VQP A;  1SLJ A;  1VQ9 A;  5ELO A; 
#chains in the Genus database with same CATH topology
 5JH7 F;  1A62 A;  1ICF B;  1G2S A;  2UU9 L;  3KHH A;  2NVQ B;  2HQE A;  3S9W A;  3CC2 A;  4XXE A;  3IAY A;  1HNX Q;  3Q23 A;  2NU7 B;  5JEA J;  1U4M A;  2W6Z A;  3C46 A;  3CCU A;  1BXR A;  3GTL B;  1STA A;  3U9T A;  1PFN A;  4BXX G;  5E4W C;  1RF2 D;  2EIF A;  1UAP A;  2JA9 A;  5KRU A;  3NSW A;  1FNV A;  2JK8 A;  3BVG A;  2YZN A;  4MA0 A;  5H80 A;  1YNN D;  3W3A A;  2C9O A;  4JI2 Q;  1TKW B;  5IP9 G;  3S1N H;  2W70 A;  3F8T A;  3PV0 A;  5ELC A;  3BZD B;  4IJL A;  2DLN A;  4B3S Q;  2R7M A;  1CE8 A;  1PMR A;  2RF4 A;  1PTO H;  4P73 A;  4G57 A;  1XNQ L;  2B2Y C;  4TRD A;  4HJA A;  1JOR A;  3T13 A;  4C1N K;  3K7A H;  4UP7 A;  4KTA A;  2W8K A;  3M9N B;  3PIO 3;  1CKM A;  3ERQ A;  3A0J A;  1NBW A;  1VBG A;  3HOZ H;  3GD7 A;  3K0X A;  3KAL A;  2FPP B;  1I94 L;  2R61 A;  3J80 i;  3R5F A;  1E24 A;  1IBL H;  4Y7N H;  4DF7 A;  3IFD A;  1GM5 A;  3DHQ A;  1GO3 E;  2SNS A;  3BYT B;  3K5N A;  2E8G A;  2PI2 A;  4BY7 H;  1I50 B;  2CFM A;  5C44 H;  4DL2 A;  5DM7 3;  4QUF A;  2ZM6 Q;  3VR3 A;  4KHP H;  3SI8 A;  4B9W A;  4CC6 A;  2DUD A;  4J9S A;  5M5X B;  1TII D;  2K03 A;  4HJ8 A;  3T1Y Q;  3S2H B;  2B29 A;  1MD2 D;  5LMN Q;  2R92 G;  4RZQ A;  2EJF C;  1I7N A;  5FKA C;  2QGQ A;  3L0O A;  1ASZ A;  5IYC G;  2R7N A;  4A93 H;  5K36 H;  3M7N A;  2Z1C A;  1H9R A;  5M9O A;  2W8L A;  4LUV A;  4KKT A;  4JI4 Q;  3KF6 A;  4KY7 A;  3MR5 A;  3I8Z A;  2Q2U A;  5FLX c;  2X6L A;  3CQZ A;  4QUC A;  3MXN A;  1I4P A;  3R3O A;  2R8G A;  1XPO A;  5FD6 A;  1TWC B;  1DJR D;  2JEA I;  4FF3 A;  5KT4 A;  1OXT A;  3PUX A;  1B04 A;  3GTG H;  4MA5 A;  2BCO A;  1LT3 D;  3P20 A;  4MZ9 A;  4LF5 L;  4HIO A;  1FGU A;  3T1H H;  3T1Y L;  1CSQ A;  5COR A;  3EPI A;  3LGJ A;  1EEI D;  4FU0 A;  4P74 A;  4FYD A;  3K5I A;  4LH7 A;  4A3M B;  5KFH A;  1FD7 D;  2E2I A;  4IUT A;  2F0T A;  1SNQ A;  2Q2I A;  3D0F A;  1TWF H;  4JI4 L;  1LTA D;  3OUZ A;  1SFO H;  3S1M B;  1S68 A;  5JOB A;  2LKV A;  2Q8R E;  5DQH A;  1W2B A;  1A63 A;  1TXY A;  2FLL A;  3PN1 A;  4DV4 Q;  4J8Q A;  3C0F B;  1AZQ A;  3MFY A;  4YB8 B;  2L0C A;  5I47 A;  4J9M A;  3RBD A;  2JA6 H;  3MXG A;  4GLV B;  3OSO A;  3K59 A;  4RU9 A;  1PFB A;  1I6H H;  4FDB A;  1NR2 A;  3H4B A;  2C2D A;  4POG A;  4GLA C;  1EIY B;  2DGY A;  2R7Z H;  5E3F A;  1JOQ A;  4EG0 A;  2Y0S G;  4DK3 C;  4E6I A;  4GOP C;  2J9G A;  1GUS A;  2VUG A;  3G6X A;  4DR6 H;  2HDM A;  4C3J B;  2BDO A;  1LTG D;  2E5L L;  4BY7 G;  3K0Y A;  2AWO A;  1C30 A;  1EYZ A;  2R3Z A;  1E1T A;  5I2Y A;  4A3K H;  1YIJ A;  3KUP A;  4QY7 A;  2E74 C;  1T5X D;  3ND9 A;  5FO8 B;  4A3G G;  5CV6 A;  4HIK A;  5KFQ A;  2FK3 A;  1WOC A;  1K9M C;  4OIJ A;  1HUM A;  1I50 A;  1BNZ A;  2WB1 B;  5JVD F;  1WTH A;  1ZET A;  1UE1 A;  2ALY B;  3ULL A;  1BCP C;  1CQV A;  1N36 L;  1RDP D;  4H02 A;  1PK8 A;  3TIN A;  1K1S A;  1BDO A;  3BDO A;  1U0L A;  3NTI A;  5ISR A;  2ZTD A;  5DG8 A;  1S5F D;  3CPW A;  1PXU A;  1Z47 A;  2BE5 C;  3I56 A;  2MO1 A;  1WYD A;  1SEB D;  4NP5 A;  3KTM A;  4X66 H;  2EE1 A;  3M4O B;  3M9M B;  1X3E A;  4EGQ A;  1ZEQ X;  3S17 B;  4EBC A;  4AQY H;  1B6S A;  5T14 A;  5IIF A;  1LAC A;  1JCK B;  5IYB H;  1K0R A;  4ZUJ A;  1I7L A;  5JJI A;  4X3U A;  2HD3 A;  5KT5 A;  1KNA A;  2JP1 A;  5DLF A;  2IHF A;  2RHS B;  3DXJ C;  4R9W A;  5K5P A;  4LNQ A;  4HSV A;  1IBK L;  3NHH A;  5J39 A;  2E76 C;  2RCF A;  3GTK B;  5C4X B;  2JA8 H;  1HQM C;  3NBI A;  1Z9F A;  4EQ5 A;  5EKI A;  4B3R H;  2AMC B;  4LFB L;  1PFS A;  1YIT A;  1C0A A;  3L4K A;  2FMC A;  5C4H A;  4PMB A;  1JIC A;  1Y14 B;  4YJ3 F;  5KG0 A;  5IT9 E;  4Z9C B;  2Q2T A;  2I87 A;  4M9U A;  3T5J A;  1S0N A;  3PW2 A;  2NWG A;  4O0A A;  5EBC A;  4HYK A;  2UUB H;  2QKI C;  4YIJ A;  2JA6 G;  2F0E A;  2LFN A;  3HKS A;  3SXH A;  1W3S A;  1VMP A;  2L15 A;  3GTJ B;  1JJG A;  2PQA B;  2ES2 A;  1SJE D;  3J81 L;  1Y1W B;  3LWE A;  1N32 L;  1E0B A;  1CHP D;  4JV5 H;  1SRO A;  4LF7 H;  4NW2 A;  4EX5 A;  4A3D G;  1X9N A;  2AQ4 A;  4MNO A;  4EFB A;  5FO9 B;  1KAB A;  4MV9 A;  1BBU A;  2VQE Q;  4J9K A;  4ZLT F;  5DG9 A;  5D14 A;  4IAJ A;  3BJY A;  4G3I A;  1SMX A;  3PO3 B;  3HOV B;  4RWS C;  2FK2 A;  1MSH A;  3HOX H;  1Y8N B;  4LF8 H;  5CA0 F;  3BZC A;  3GTO B;  1JWS D;  1XX8 A;  4LFC H;  4CDF C;  5A2Q L;  1K1Q A;  2NVY B;  2NYZ D;  2N49 A;  3PUZ A;  5IP7 G;  4F4W A;  2KA7 A;  1BO0 A;  4NXN H;  4I7H A;  4X64 Q;  2MFI A;  3PMF A;  4DR4 L;  4KKU A;  4K8J A;  3KJO A;  1AP0 A;  3RB3 A;  1WFQ A;  5L1L A;  2XGQ A;  5KFZ A;  2F0N A;  5EWG A;  2FLN A;  2F0W A;  3S16 H;  1ML0 D;  5C6A A;  4DR1 H;  1XJV A;  4DR5 H;  4A3C G;  2BQU A;  3BG3 A;  2R93 G;  2VQE L;  2UXD Q;  5IWA H;  5C1O A;  2CWA A;  2M00 A;  5JJK A;  3RUP A;  1L1O A;  5C3E G;  4O4H F;  3GIP A;  4MV1 A;  2MJ8 A;  5KFW A;  5D1P A;  4IJH A;  2JSO A;  2E75 C;  2RHQ B;  1NUC A;  1ZHS A;  3HKZ A;  3Q0A A;  5KFD A;  5HGQ A;  4A3J H;  1EY0 A;  3TZD A;  4DV6 Q;  4RGO S;  2DZD A;  1RD9 D;  2IA6 A;  2X6G A;  1LTB D;  4EEY A;  4DV5 Q;  2JA7 G;  1T3N A;  1HNZ Q;  1B44 D;  2UXB H;  3OMG A;  1EL0 A;  2LMC B;  3PR5 B;  2TSS A;  4F50 A;  2QYZ A;  4TQU S;  4LFA Q;  3I90 A;  3J80 E;  1CA6 A;  3RJ0 A;  2UXD L;  2C2E A;  5FPR A;  4JI1 H;  4ECR A;  4WFN 3;  3BZK A;  3R93 A;  5KFN A;  4DGZ A;  1UC9 A;  4GKK Q;  1EY6 A;  2R8I A;  1C8C A;  4LF4 H;  4K0K Q;  1TQO A;  1RTO A;  3EJI A;  3S24 A;  1CQF A;  2YW2 A;  4R8U A;  4BBS H;  2K5D A;  3TBI B;  1BR9 A;  3T4A C;  2PQA A;  3FVQ A;  2RCN A;  2W7P A;  4JI8 Q;  1TWG A;  1PRT B;  3BDL A;  2RDH A;  4TQS A;  1SMY C;  2RDJ A;  1L1O C;  4IPC A;  4OON A;  1V8Q A;  3GTP B;  1C4Q A;  1TVX A;  1EYA A;  1SYD A;  4B3M L;  4YAK B;  1SXT A;  1NJI C;  3S1Q H;  4FXG C;  2A6H C;  4K2L A;  3GQB A;  2W6Q A;  2AHO B;  1KIX A;  1IL8 A;  2ZTC A;  1AN7 A;  4IZO A;  1E2V A;  3RFC A;  4DV3 Q;  3G8C A;  1C7Y A;  2YYA A;  1IOW A;  1WR2 A;  4GKK L;  2WAQ E;  3H94 A;  2QDL A;  5KNC A;  4K0K L;  3S2D H;  4C3I H;  3DEO A;  3MR2 A;  1SND A;  1EUD B;  4FXD A;  2NVY A;  4F4X A;  4X65 Q;  2JYO A;  1MBY A;  1AW7 A;  1K8M A;  2F0H A;  3QOJ A;  4JI8 L;  3O13 A;  1GGO A;  2RSN A;  2ICI A;  4DV0 H;  4DAV A;  4DR2 Q;  1Q81 C;  2R92 B;  4ULL A;  4DL6 A;  4I4T F;  2V59 A;  3GV5 B;  1B53 A;  3GV6 A;  4QGU A;  1Y69 U;  2A68 D;  1NTG A;  4C56 C;  2V58 A;  1XYI A;  5LL6 S;  3QWN A;  2Z6K A;  2VUM G;  3U4Z A;  3HOU G;  3I73 A;  3WDN A;  2KUM A;  2V1C C;  4A4I A;  4DR7 Q;  2O03 A;  4ABN A;  2W9C B;  3HXL A;  2PO4 A;  3MTS A;  1Q3L A;  1KAA A;  4YWK A;  1W93 A;  2XD4 A;  1S5C D;  3CME A;  4A3F B;  1WTX A;  1MIU A;  3CCS A;  4JI5 Q;  1VQ8 A;  2G9D A;  2JEG A;  4ZK9 B;  4O4I F;  5NUC A;  3GQC A;  1BXT A;  2NB0 A;  4RGT A;  2VB3 X;  2VB2 X;  1EEF D;  1F2Y A;  2CCZ A;  1Z2P X;  1VQ5 A;  2XC9 A;  2HT1 A;  2NVX A;  2B2V A;  3EN2 A;  4MIU A;  1W6J A;  3ULJ A;  4BBS G;  4DLK A;  2YU9 B;  2OH2 A;  4EGJ A;  5D1O B;  5CV8 A;  4JK1 C;  4QIW E;  3J80 c;  1VCI A;  4NPS A;  4I7Z C;  3NTH A;  3RV3 A;  3KDF B;  4ED8 A;  1UNN C;  2NN6 G;  1PZI D;  4AYB G;  4NLG A;  5KEE A;  4ZKB B;  3UDI A;  4XT3 B;  3S14 H;  4JI0 Q;  1Y1V H;  2XN9 C;  4DV1 L;  5CC4 A;  1B7Y B;  4JI5 L;  3SGI A;  3L2P A;  1VQO A;  2ZJQ A;  1SEI A;  2LY7 A;  2B39 A;  4R4T A;  2D5D A;  3CAM A;  3RZD H;  2XCA A;  1V9P A;  2B63 H;  2XVS A;  5I2X A;  3JSN A;  1D7Q A;  3G6J B;  1ENF A;  2Y0S B;  2UXC H;  3NUC A;  5C3W A;  3KXY T;  3DLL A;  3ITP A;  2KHS A;  3KK7 A;  1K73 C;  1N33 L;  3H40 A;  2J7Z A;  2F3V A;  4NDX A;  4KLK A;  3C3L A;  3PO2 G;  4EBE A;  2R86 A;  4FVM A;  4IAL A;  1KJ8 A;  4GN4 B;  4A3G B;  4X62 L;  1B2T A;  2KOL A;  3M4I A;  1TR5 A;  3FRP B;  1Q86 C;  3KHG A;  4F87 A;  4O3S A;  4I65 A;  3T16 A;  3NQI A;  2EY6 A;  4BBR H;  5KG6 A;  1C48 A;  3HOY H;  2B2V C;  4IPD A;  2VA3 A;  3JAM E;  4X6A H;  4EYI B;  3HS0 C;  1TWH A;  1G91 A;  4JBK A;  2NU6 B;  5AFW A;  4ECQ A;  4ECZ A;  4ED2 A;  3V6J A;  3H0G H;  4K8I A;  4BY1 G;  4DXF A;  2PCF B;  3D3R A;  3K57 A;  2V4Q A;  1IBM H;  1TS2 A;  4FF4 A;  1AUV A;  4WOR A;  3V96 A;  2VQD A;  4KJO A;  5DEH A;  2W9C A;  3SE0 A;  1QWY A;  1WCM A;  1TT2 A;  1I3Q A;  3P75 A;  5C0X H;  4LUZ A;  5KG2 A;  1LLR D;  3LX0 A;  4GKJ Q;  5J22 A;  4CJ1 B;  3HKZ G;  1UE5 A;  3IKJ A;  2FB9 A;  3H3V I;  1JJ2 A;  2QIL A;  2NZH A;  3TN2 A;  4OWW B;  1RYR A;  2K52 A;  3GTQ B;  3AYH B;  3EYY A;  1B6R A;  3L9A X;  4JI3 L;  4A2A A;  2RKS A;  1HR0 W;  2K04 A;  2QDB A;  1QNU A;  4XIG S;  3RZO B;  4LF6 L;  1HTP A;  5KIX A;  3K5L A;  3U9O A;  2PMZ B;  4A3E G;  1XNR Q;  2K4K A;  2WB1 E;  1CZG A;  1PRT D;  3PR4 A;  4EEQ A;  4DR3 H;  2F3I A;  1WD1 A;  2KCN A;  3KDF A;  3EVQ A;  4U67 3;  2VQF L;  1O78 A;  3GIJ A;  5CV5 A;  2VXW A;  4GN3 B;  4PZ6 A;  2B63 G;  1A8V A;  1E3P A;  1HCZ A;  2GPW A;  4J9Q A;  3OMC A;  1YNJ C;  5M5Y B;  1RL2 A;  4A3B G;  4MV8 A;  1WTR A;  1FKA H;  1B50 A;  2YZM A;  3S1R B;  2R7F A;  4J1M A;  3T53 B;  4O3R A;  3M3Y B;  1J9O A;  1FNU A;  4DFA A;  2W6P A;  4A3D B;  4EGV A;  2L5T A;  5M3M G;  3TP6 A;  1OWT A;  1CUK A;  5CV9 A;  1M1K C;  3CU7 A;  1QB5 D;  4B3T L;  3N44 B;  1L2Z A;  1BBW A;  1EYG A;  3ERO A;  3NEN A;  2Y0S A;  4RAZ A;  1K28 A;  5DGB A;  4CC5 A;  5EWE A;  2KCC A;  3RN5 A;  5DQI A;  3ORQ A;  3RLN A;  4YHH H;  1IW7 C;  3QIA A;  4BBR G;  2WTF A;  3MR6 A;  1QVC A;  4C2M H;  1VQJ A;  1S10 A;  4Q0Y A;  2BOS A;  1SDF A;  1SNO A;  3MFG A;  3Q1K A;  4YY3 H;  3CCE A;  4N9T A;  5C1P A;  4JI7 L;  1EY4 A;  2W6N A;  4WBN F;  5GAH C;  2EYM A;  2XIW A;  2JA5 G;  1K83 H;  1A6X A;  1XNQ H;  3QZ8 A;  4YCV A;  4JV0 A;  2HHH Q;  4FS1 A;  1L0X B;  2A8V A;  3I4M H;  5I4D A;  3GV8 B;  2R93 B;  2IY5 B;  1HNX H;  4JI6 Q;  2FKL A;  1S5B D;  5C3E B;  3KLS X;  1A0I A;  2NVT H;  1UNS A;  2K7V A;  4HNU A;  2FMA A;  1FJG Q;  2UUA Q;  2BH8 A;  3GTG A;  1EZ1 A;  5LP6 F;  2A5H A;  3OHX C;  1HHV A;  1PH9 A;  4O2B F;  1X3F A;  3VYR A;  4JI2 H;  4ZI7 F;  2UU9 Q;  3KF6 B;  3V05 A;  4B3S H;  1D1K A;  3MXN B;  4C5A A;  2VS1 A;  1GVP A;  4G7H C;  4GOP B;  1FNW A;  2F0L A;  4K5X A;  4X3K A;  4ECV A;  1J5E L;  2JA7 B;  2B2Y A;  1PHJ A;  1TWF A;  2SCU B;  1SFO A;  3GTQ A;  4GC6 A;  1VQK A;  5HUR A;  1JLL B;  3TQT A;  1Q8K A;  2EJM A;  4YR0 A;  2WFW A;  1STE A;  4JI6 L;  1A3U A;  4IPH A;  5C0X I;  4TV8 F;  1N56 A;  1F2M A;  4JBJ A;  1EQQ A;  1N48 A;  4HN7 A;  1TA8 A;  2JA6 A;  2ZM6 H;  1FJG L;  1VQB A;  1X32 A;  2ZXR A;  4R4O A;  4J0M A;  2AGP A;  1SSO A;  1M6V A;  3PW4 A;  2E2I B;  1NCV A;  4G7Z C;  4N8F A;  1BCP B;  2BQR A;  1B3A A;  3T1Y H;  5LMN H;  5KFJ A;  2MO0 A;  3R23 A;  3K3P A;  3M4P A;  5EAY A;  5FJ8 H;  4IOC A;  5FD5 A;  1I94 Q;  4PMC A;  1VQE A;  2MCT A;  2OEO A;  2BDN A;  1HFN A;  1R4P B;  4JI4 H;  5JUM A;  2VR1 A;  4IFD H;  1C3O A;  3LWU A;  4K14 A;  4DV2 L;  1CS0 A;  3HOW H;  3HFZ B;  2VNU D;  2XCP A;  3MHB A;  4P71 A;  1CM9 A;  1X65 A;  4MHE A;  3FKI G;  5JEA G;  4IUN A;  4ID6 A;  3H4D A;  4BA1 I;  4MTE A;  2IT1 A;  4N8X 1;  2MHV A;  1I4H A;  3NBH B;  4U7C A;  4NKL A;  1VQ4 A;  1LAB A;  4HED A;  2HCI A;  3V2T A;  5CAE B;  3OTO L;  4WJ3 M;  4IN3 A;  2L55 A;  3GTM B;  2NBF A;  1U9R A;  4QQB X;  1HXY D;  4NXM L;  3JRW A;  1X3P A;  5KFF A;  2R84 A;  2D9U A;  5KG5 A;  1X55 A;  3D8G A;  3ERS X;  3X3M A;  5GQO A;  3JRX A;  4DK0 A;  1Q8I A;  2EYL A;  1TWA H;  5GAE C;  5GAD C;  4GLX A;  1OXU A;  2R93 A;  3E3X A;  3C1F A;  1EQV A;  3BVZ A;  4LF5 Q;  4QWB A;  1VF5 C;  2VUM B;  3HOU B;  2E2D C;  3PF5 A;  4DV4 H;  1QZG A;  3OSP A;  1O80 A;  1EHI A;  3GIM A;  5DLG A;  4ECU A;  1TS4 A;  3K5O A;  1U4R A;  1HH2 P;  3RGZ A;  1QVG A;  1HZB A;  3A8J E;  3OSN A;  4XYQ A;  1DV1 A;  2VPQ A;  1FGB D;  2IL8 A;  4RNM A;  5L1K A;  4K5W A;  4GOP A;  4LF9 Q;  4RNO A;  4IOA A;  5IYZ F;  1WCM G;  1Q1E A;  1AN8 A;  1KJJ A;  4CKE A;  2JA7 A;  4IO9 A;  3CCL A;  2J6U A;  1KLG D;  1TY0 A;  1AE2 A;  3CPF A;  2L11 A;  3QZ7 A;  3I4N B;  4A3I G;  4TV9 F;  4HR7 A;  2AWN A;  4MTN A;  3G48 A;  1JWM D;  5BPH A;  3MAQ A;  5FLX W;  2W6O A;  4ECW A;  4FP5 D;  1CKN B;  2IPK D;  4QCL A;  1ZKO A;  2CQY A;  3VPC A;  2E5L Q;  3E9I A;  4HIM A;  1ILP A;  3KF8 A;  2V4D A;  3RBE A;  1L0Y B;  3CRL C;  2KJX A;  1R9T H;  1ONL A;  2W71 A;  2EXZ A;  4HNT A;  3RAQ A;  4LF9 L;  1UE7 A;  5C8Y F;  3T5H A;  3CVZ A;  3STB C;  4V0B A;  5KFV A;  1SNC A;  3MZ5 A;  1WTP A;  1N36 Q;  1DCZ A;  3A5U A;  5C4J H;  3HOZ G;  3PO2 B;  2VW9 A;  2HGS A;  3NBH A;  1D1I A;  1EOV A;  4XYL B;  2F0S A;  1XMQ Q;  4RB2 C;  4IFD I;  1TU2 B;  4QJF A;  3DF7 A;  5C44 G;  4RUC A;  3R5X A;  3GTM A;  5BMV F;  1CFM A;  5KYI A;  3BQ2 A;  5KFY A;  1I6V C;  1ESR A;  3JZI A;  5E4X A;  1PFM A;  1II3 A;  4UP9 A;  4BY1 B;  2YTX A;  1AZP A;  5IOC A;  4OEM B;  2PYK A;  4A93 G;  5K36 G;  2AQ1 B;  3T56 B;  1IBK Q;  1T94 A;  5EQ0 A;  1QJO A;  4I7A A;  4C3H H;  3QG1 A;  2VUM A;  3CHB D;  2W9B A;  2ICE C;  2KEC A;  1IBL L;  1MJE A;  5KFG A;  4LFB Q;  5FK9 C;  4B9X A;  4RGM A;  4J9L A;  3SK4 A;  4GZY C;  2KEN A;  5I9O A;  3V4S A;  3PIP 3;  4ECT A;  2F0P A;  4HJ7 A;  5KG7 A;  1JB3 A;  2E2H H;  2HDL A;  1L1O B;  1XMQ L;  4OO1 H;  5CV4 A;  4X3S A;  2CW7 A;  1IYU A;  2WDT A;  4ZHQ F;  2HUG A;  1EY7 A;  5BR8 Q;  1G2T A;  3HKZ B;  2R85 A;  3BAB A;  1P16 A;  5JPM C;  4F8M A;  3Q6S A;  5KFC A;  4XT1 B;  1Q1B A;  4LAA A;  1N32 Q;  2H5X A;  4ZAI A;  2KSW A;  2JE6 I;  2I5H A;  3RD4 A;  1BCP D;  4MV6 A;  4HAE A;  1B1Z A;  1SYB A;  3AMU A;  5KG4 A;  1HNW Q;  1D5Z C;  4A3E B;  2G5D A;  2GVA A;  1GOZ A;  4X64 H;  1QCB D;  2VY3 A;  1CKN A;  1VBH A;  3BQ0 A;  1STB A;  2EY2 A;  2BE5 D;  3RTX A;  1LM0 A;  2VL6 A;  3JAM i;  4AYB A;  2NU9 B;  3IG0 A;  1CQJ B;  3BJU A;  4HJ9 A;  3M9B A;  2O2L D;  4A3B B;  3JSL A;  3MWE A;  5M3F H;  5BR8 L;  4ECY A;  2UXD H;  1EWH A;  3SHL A;  3T1H L;  2NUA B;  3TSS A;  4R8U B;  3OIP A;  1WJJ A;  2QEX A;  4V19 0;  2YS7 A;  1E2Z A;  5T1G A;  2PZU A;  3ER0 A;  4WJ4 A;  5M3M B;  4ED3 A;  5DGA A;  4JBM A;  4PG3 A;  2R7Z G;  2FPI B;  4Q0F A;  2PW5 A;  4DR4 Q;  5EDW A;  3ZYY X;  1P8L A;  1TWG B;  1EZ8 A;  1HZ9 A;  1I4Q A;  2QA4 A;  4A3L H;  4C5B A;  3CQZ H;  3MEH A;  4APM A;  2ASD A;  2K14 A;  4DV6 H;  4A3K G;  1HNW L;  4A2B A;  4BA2 I;  3J81 E;  4YAJ B;  3GIK A;  2F0M A;  3PIO A;  4FS2 A;  3SR1 A;  4FXK C;  1F9P A;  4KKS A;  3W2D A;  2I5M X;  4WRD A;  4DV5 H;  3RB0 A;  3K6O A;  1HNZ H;  1KHI A;  2DNE A;  3CD6 A;  1EUC B;  4DNI A;  2ASJ A;  4KD3 A;  2OLS A;  2JA5 B;  4LFA H;  1UE6 A;  1I4X A;  2C35 B;  1HFG A;  2PMZ E;  3J7Z C;  4RB1 A;  5KFK A;  1EU3 A;  1PH3 A;  4DR6 L;  4GKK H;  4YBZ B;  5IY0 A;  2RVL A;  4GS3 A;  1QE6 A;  2K1B A;  2NVQ H;  2B2U A;  3NE5 B;  2VPS A;  1ILQ A;  4JI8 H;  3GID A;  2OQ0 A;  3GTL H;  3P7J A;  5KFO A;  2UVW A;  5DG7 A;  2ZDQ A;  2C2R A;  2IBK A;  5IYB G;  4HQ6 A;  3SE7 A;  2K5W A;  4MAM A;  4C5C A;  2H4O A;  2A74 C;  1BJT A;  5KFI A;  4O42 A;  1VQG A;  1S72 A;  1BNC A;  2DPJ A;  2JA8 G;  4DV3 H;  4ED0 A;  4X3T A;  1CI3 M;  1WSC A;  5KT2 A;  3I70 A;  4QB4 A;  3ONA B;  1XTD A;  4L1K A;  1DYQ A;  3OYY A;  1GUW A;  1S9F A;  4OO1 I;  2F52 A;  1QNK A;  4X66 L;  3FEW X;  1GKH A;  5D65 A;  5I6Y A;  1CA5 A;  2RSO A;  4AQY L;  1SBB B;  4X65 H;  3RIZ A;  1EIG A;  1SN8 A;  4B3M Q;  4JVZ A;  1Y1V A;  1MSG A;  1MKH A;  2F0Q A;  2F0J A;  1FL0 A;  4JG2 A;  2FP4 B;  3D4W A;  1KAW A;  4YWL A;  1L0W A;  1BKB A;  2NVX B;  2RDI A;  4WD3 A;  1I50 H;  3H3V C;  2PI2 E;  1DM0 B;  4IUU A;  2B63 A;  2VZA A;  1YJN A;  2PPB C;  4DR2 H;  1SE8 A;  3D6C A;  2M05 A;  1SYX B;  5M5X H;  3S2H H;  1I6U A;  1U4L A;  5IT9 c;  2J6T A;  3Q8Q B;  2B2U C;  5C3X A;  5FLM H;  2KHI A;  1I4R A;  2K01 A;  2BR0 A;  2V4R A;  1T36 A;  1XMO H;  2CKZ B;  4F4Y A;  1C9O A;  3HG9 A;  4DR7 H;  2R8K A;  3S15 B;  5CBA E;  5D3I B;  4JYA Q;  4L8J A;  1Z7T A;  1MGS A;  5ELO A;  1JDE A;  1KDB A;  4H13 C;  1B4O A;  2Z4I A;  3W5O A;  4LFC Q;  1B33 N;  3PQI A;  3R2T A;  4I55 F;  3FKI B;  4L5Q A;  3HOX G;  1EOT A;  2RQX A;  2MP1 A;  2WAQ G;  1FVI A;  1KEE A;  4RUA A;  5IT9 W;  2R8J A;  4NMZ A;  3IRB A;  5C5L A;  1TWC H;  4JI5 H;  2CWP A;  4NXN Q;  1GUT A;  2JEI A;  1S03 G;  3AU7 A;  3R5H A;  1SYC A;  2TMP A;  5EJW A;  3H0G A;  1IKL A;  5HY6 A;  2HVR A;  4IHJ F;  1W6K A;  4HMJ A;  1AH9 A;  2MGS A;  2NTT A;  3VA7 A;  2EQS A;  4DUY Q;  2JA5 A;  4DR5 Q;  1SE4 A;  2I8C A;  5LMU H;  5M5W B;  1OO9 B;  4GC7 A;  4O3N A;  4A3M H;  1KJQ A;  1E7Z A;  1SMY D;  2EYO A;  2K5N A;  1HR0 Q;  4JYA L;  4FF1 A;  2XWJ B;  4LF8 L;  3QFF A;  1TWH B;  4ZCK A;  3S1M H;  1V43 A;  3C2P A;  4LFC L;  1V51 A;  3K58 A;  2FPG B;  4DUZ Q;  4JI0 H;  2A6H D;  2IJ0 A;  2FK1 A;  3FPU B;  1GUN A;  4NXN L;  2P0A A;  2E2J B;  4A3J G;  4DU9 A;  2ZXP A;  3LML A;  4CGY B;  1QVF A;  1YJ9 A;  1MZB A;  4QMG A;  5D8D A;  4LH6 A;  5LOV F;  3RN2 A;  1V1P B;  2LXK A;  2HJW A;  1X6O A;  5JAV A;  4DV7 Q;  3R8B A;  4DPG A;  2EPB A;  4DUY L;  1WCM B;  2FFK B;  4DR5 L;  1I3Q B;  1GLV A;  4POF A;  3PVX A;  4IUQ A;  1S5D D;  5IWA L;  2KCT A;  2C28 A;  2NTS A;  1BGW A;  3L4J A;  1ZQ7 A;  2A69 C;  2ZDH A;  4C3J H;  4DV1 Q;  2P5Z X;  2O5J C;  2CQO A;  2BA0 A;  3W1B A;  2ZJP A;  4A3I B;  1HR0 L;  3J7A F;  4QWD A;  4HJ5 A;  3W1G A;  1VAJ A;  1MJC A;  4DUZ L;  1EYD A;  5F9N A;  1Q46 A;  2J6S A;  3GV3 A;  1VQ6 A;  1N33 Q;  1K8G A;  1XDN A;  2FXQ A;  2KVM A;  3I55 A;  1TS3 A;  4LW1 A;  3SDZ A;  1EWI A;  4J9O A;  4JV2 A;  3M7G A;  1B3Q A;  1X3G A;  1DGS A;  4RAY A;  4ME3 A;  2EYF A;  4JC0 A;  2LSS A;  2ID0 A;  4X62 Q;  2DJG C;  3KJP A;  4DV7 L;  2N78 A;  3Q8P B;  1VDZ A;  3KLS A;  1M90 C;  3S1N B;  5C5J A;  1WTW A;  1PH4 A;  3T5L A;  4RKL A;  4E4T A;  1DV2 A;  3U9S A;  2DY7 A;  1PTO B;  5IGE A;  1PH1 A;  1BBX C;  3T5K A;  3ZJY C;  1SYF A;  1Q7Y C;  3M4O H;  3UI2 A;  3RB4 A;  3K7A B;  3J80 W;  2CH4 W;  2ALZ A;  3S17 H;  4LF4 L;  1O7Y A;  4CJ2 C;  3FKI A;  1EQT A;  3HOZ B;  4GKJ H;  1Z2O X;  1K83 A;  1G51 A;  4Y7N B;  1E4G T;  4C3I G;  4UCU A;  4BS9 A;  5KGU A;  4A3M G;  3VR5 A;  4BY7 B;  3CRK C;  5C44 B;  2UUC Q;  2FE3 A;  5KFX A;  1EIF A;  2PNH A;  5C4X H;  3GTK H;  1I5F A;  3EBE A;  2WP8 J;  5HGT A;  5KFB A;  1V4Y A;  1EY9 A;  2IP4 A;  4IRC A;  2F0D A;  1M7J A;  2IX1 A;  1PYW D;  1N8R C;  1V1Q A;  5JQW A;  4RNN A;  3G4S A;  1XNR H;  1A9X A;  2BA1 A;  4DK6 C;  3F2C A;  4HMI A;  4A93 B;  1H9J A;  3MFH A;  1BF4 A;  3RNU A;  1EY8 A;  1KD1 C;  1N34 Q;  2WIN B;  3TZU A;  4OX9 Q;  1ULZ A;  1NR4 A;  1JIH A;  2OXP A;  4JI3 Q;  3VA5 A;  5KFT A;  5L1J A;  3CCR A;  3GTJ H;  3URY A;  4APV A;  2X0S A;  1QIL A;  4MV7 A;  4LF6 Q;  3Q8R B;  1Y1W H;  4YCU A;  5L1I A;  2R7K A;  4UCV A;  2UUC L;  1YHB A;  2HVS A;  2CW8 A;  4DV0 L;  3GTG B;  1V1P A;  2VQF Q;  3PF4 A;  3GO5 A;  2VOB A;  4QWC A;  1YNX A;  4YWM A;  3B6Y A;  3LNN A;  3F2D A;  2EZV A;  3PO3 H;  3HOV H;  2FMM A;  2JEJ A;  4XQJ A;  4R1J A;  1YBY A;  2JXM B;  2GPS A;  2Q8T A;  3GTO H;  4R4C A;  5E7N A;  4Y52 H;  1TWF B;  2PNR C;  4DAP A;  3U4V A;  1N34 L;  1SFO B;  4OX9 L;  4DL4 A;  4Y8V B;  2F4V Q;  5KFM A;  4B3T Q;  1VQL A;  2NVY H;  1BOS A;  5COY A;  1PH8 A;  1K8O A;  4KK7 A;  1PDQ A;  1RJR A;  1UC8 A;  3F1Z A;  2V5A A;  3OW2 A;  2HHH H;  4BWG B;  1Q12 A;  3QO2 A;  2XSC A;  2A6E C;  1Y1V G;  2Q2H A;  2JA6 B;  3DWA A;  4R4Q A;  1X3Q A;  3RLO A;  4JI6 H;  5F2D A;  1D2B A;  1I6H B;  1VKZ A;  3GDE A;  2ZXO A;  5CR3 A;  3AEV A;  4L63 B;  3TP5 A;  4JI7 Q;  3D4R A;  3TRZ A;  4J6H A;  2R7Z B;  4EYH B;  4GNX C;  1FJG H;  5KYL A;  5JJL A;  1S4Z A;  1ZYR C;  2UUA H;  3KOJ A;  2GVB A;  3KBG A;  1RTN A;  4UP8 A;  3HKZ E;  3J81 j;  5CA1 F;  1PRT F;  3CC4 A;  1G6P A;  4A3K B;  1LO5 D;  3D6W A;  2UU9 H;  1X54 A;  2F0I A;  2F4V L;  2YS6 A;  2R6G A;  5KND A;  3I91 A;  3L3O C;  5IYD H;  1EWC A;  3E0J A;  4XDX A;  5EKL A;  1DOM A;  1VQ7 A;  2F3W A;  5L9X A;  2FLP A;  2EDG A;  1TWA A;  5IGD A;  3QJY A;  3VYU A;  3NWS A;  4JUZ A;  1HJP A;  3HOY G;  2B3G A;  1ENC A;  1HZC A;  3NK9 A;  1LV9 A;  5CYU A;  2IHE A;  1MHW C;  1E22 A;  1YNJ D;  3H0G G;  4IPG A;  3H20 A;  3I3C A;  2UXC L;  4YR3 A;  3TDQ A;  3VR6 A;  1K0S A;  4DL7 A;  4JBW A;  4QL5 A;  1KLU D;  3WOE A;  2IMW P;  3MXP A;  5C0X J;  2K5V A;  2PW7 A;  1J5E Q;  5LXT F;  2R8H A;  5ELN A;  3PUY A;  4LMY A;  1LT6 D;  1RKN A;  2JJQ A;  2SOB A;  1DD2 A;  3JAM c;  1I94 H;  3TRE A;  1IW7 D;  4BXX H;  5LYJ F;  3TII A;  2I07 B;  4ME6 A;  2EOT A;  3EA6 A;  2F0F A;  5C0X G;  4N9P A;  2QCP X;  3DM3 A;  2EVB A;  2ZTE A;  3I4L A;  3A56 A;  5KG3 A;  3HOV G;  1KBL A;  3Q8S B;  3A7A B;  2A1A A;  2D2C C;  1PTO C;  5IP9 H;  3GTP H;  3K5H A;  3GV7 B;  4ZKC B;  1QG7 A;  2D62 A;  4LWC A;  2IWH A;  2JA8 B;  3JAM W;  2C00 A;  2F03 A;  4QWE A;  5KNB A;  3J81 i;  2W7O A;  2CW0 C;  3MXU A;  2XNA C;  3KBX A;  1KC8 C;  1YI2 A;  5HBR B;  3DWP A;  4Q44 A;  3TEH B;  5FLX L;  4CDD C;  4DV2 Q;  2JEB I;  3L7Z C;  3G71 A;  1R9T A;  2QK4 A;  5GON F;  1B70 B;  2A19 A;  3H91 A;  1S40 A;  4HR7 B;  1SR3 A;  1HA5 A;  4DKA C;  3SVM A;  3P1H A;  4RFB A;  1JJC B;  2GA4 B;  3BVM A;  4IRD A;  3DWQ A;  5IGB A;  5I9P A;  2K75 A;  5IGG A;  2R92 H;  3N40 P;  1ESF A;  4LF5 H;  1V1O A;  3OPO A;  3OTO Q;  1JXL A;  4RKB A;  1S5E D;  5IYC H;  3KF8 B;  4YHH Q;  4FBU A;  5J1Z A;  2R7Z A;  5EPL A;  1SAP A;  2PBZ A;  1DOL A;  2FHT A;  3BG5 A;  4NXM Q;  4UCR A;  4HSP A;  4CBV A;  1PH2 A;  1QUQ A;  4DR3 L;  4PV1 C;  4O3O A;  3NXW A;  4CDE C;  2WAQ B;  2HVQ A;  1YNN C;  3UDG A;  2L1B A;  4PMW A;  3RB6 A;  5BN3 A;  4A3F H;  2K5H A;  2CVR A;  5KFR A;  4EQN A;  4HID A;  4LF9 H;  3K5M A;  4J9N A;  4LSX A;  4PNY A;  1YJW A;  1HTL D;  2J4X A;  1LTR D;  3OUU A;  1A2T A;  4P72 A;  2WKC A;  3F2U A;  3A54 A;  5DLQ E;  3S16 B;  4O4L F;  1A2U A;  3UFX B;  1NAP A;  4XQN A;  3I4M G;  2C22 A;  3TS0 A;  4YHH L;  2YU9 H;  1PX2 A;  1GSO A;  2E2H A;  4O2D A;  2SNM A;  2XGP A;  5FOB B;  1GUG A;  4UCT A;  4LSA A;  2E5L H;  1JX4 A;  3N42 B;  1YEZ A;  3JC6 6;  3VYS A;  4C1N I;  4YY3 L;  3MWM A;  1EY5 A;  4RMF A;  5CBE E;  4RAU C;  2JN4 A;  2IW3 A;  3C1E A;  4A3J B;  2XRQ D;  5KKN B;  2W9B B;  5A35 A;  4JOI A;  3ICE A;  4F4Z A;  5EPJ A;  1UEA B;  1VF7 A;  1YHQ A;  4U6P A;  3HZX A;  1N36 H;  1S0M A;  3U50 C;  1HNX L;  1RK5 A;  3EIV A;  1SNP A;  1KJI A;  3CW2 C;  1LT4 D;  2CH4 A;  1H9K A;  1OTC A;  3FHW A;  5GAG C;  5BN5 A;  5CGK A;  2DN8 A;  1DIK A;  1XMQ H;  2XCL A;  1A3T A;  1JR0 D;  4QIW B;  3A5Z B;  4A3G H;  3MC0 B;  3TQ1 A;  2OQK A;  4IUP A;  4JI2 L;  4IQZ A;  3I72 A;  1JDB B;  3G6V A;  3TIG A;  3MEF A;  5JVH 3;  1CKO A;  1WTQ A;  4B3S L;  4MN3 A;  4IFD J;  4BBS B;  2RGV A;  1OXV A;  1R4Q B;  4DAM A;  5FJ8 G;  1H9M A;  2D0O A;  4G7O C;  3TP7 A;  1J8I A;  1IBK H;  4IRK A;  4AYB B;  2KBN A;  2R7L A;  3EFX D;  2WE6 A;  2F0O A;  2CQA A;  2F0U A;  5FPO A;  1M0W A;  4IFD G;  4LFB H;  5IE8 A;  3HOW G;  3HRZ C;  4A3F G;  4PWQ A;  3S1Q B;  5JVG 3;  3PZP A;  3RF2 A;  1JWU D;  1PZK D;  4Q5V A;  2ZM6 L;  2PQE A;  3A74 A;  2ENB A;  1WVL A;  3NWT A;  4DNT B;  5BR8 H;  1SE3 A;  1IYJ B;  2W57 A;  2WAQ A;  2W9A A;  5J2T F;  4JOI C;  1EZ6 A;  5T1I A;  1H95 A;  5LMN L;  5EPK A;  3S2D B;  4C3I B;  4XTC S;  4JW0 A;  3OW7 A;  1IBL Q;  4RB0 A;  3VMM A;  3RMH A;  1O7Z A;  3VR4 A;  1OXS C;  3BA8 A;  1DXM A;  1K3B C;  2BQ3 A;  1N32 H;  4OEL B;  3VPB A;  3CCJ A;  3GTQ H;  2K32 A;  2Q8I B;  3WO1 A;  2QW7 A;  1AUX A;  4KHP Q;  1IOV A;  2Z9H A;  3V4Z A;  2F0K A;  1HNW H;  2WYO A;  1EIH A;  4LK1 C;  3RZO H;  4K5V A;  3GTL A;  1EU4 A;  4DL3 A;  2ZJR A;  4ECX A;  3CKI B;  3STB D;  1HRJ A;  1JB7 A;  4UY8 C;  4J9R A;  2YYZ A;  1T9H A;  5EWF A;  2GN5 A;  3MFI A;  3BYY B;  1CZW A;  3IFT A;  4ME5 A;  5LHY 1;  4A75 A;  5M5Y H;  3S1R H;  1ASY A;  5CB4 F;  4LUO A;  4JPB W;  3HEJ A;  3T51 B;  3M3Y H;  2AKW B;  2F1M A;  2K50 A;  4DR4 H;  4QW8 A;  4A3D H;  5J3B A;  1VQC A;  3KHL A;  4CDC C;  1E1O A;  1SE2 A;  3E9H A;  4QWA A;  3CP0 A;  4KHP L;  2EYH A;  3E5N A;  3RR5 A;  2Y0S E;  1Z2N X;  1VQP A;  2EY5 A;  1SLJ A;  4O2A F;  1VQ9 A;  2OF1 A;  2VQE H;  1CK1 A;  1STH A;  3CCQ A;  4DV4 L;  3DUZ A;  3T1H Q;  2DWC A;  3FMA A;  1JQY D;  4RZR A;  4U68 A;  4QIW A;  4HNV A;  2AQ2 B;  1L2F A;  1EQR A;  5DNF A;  4YJ2 F;  3EPG A;  1K3R A;  2EXD A;  2DNC A;  4UPA A;  5IP7 H;  3Q2O A;  1SYG A;  3FDT A;  3CCV A;  3S14 B;  4RHR A;  1S0O A;  1Y1V B;  3BU2 A;  3UE0 A;  3HBL A;  3R2I A;  3J7A V;  1ET6 A;  3M4Y A;  4RGN A;  3RZD B;  4A3C H;  2R93 H;  2B63 B;  2RDG A;  3H6M A;  2C5C A;  4HCE A;  1TWC A;  5C3E H;  1VQH A;  4PZ7 A;  1BCP F;  2O5I C;  3AFP A;  1PLF A;  5ELD A;  2UVV A;  3UQ8 A;  2KEE A;  5DM6 3;  1T5E A;  5GRO A;  3DM1 A;  1DZ1 A;  4DR6 Q;  4YCW A;  4IR1 A;  2K5Q A;  3K3V A;  5IT9 L;  2AQ3 B;  3HP3 A;  1KNE A;  1VQN A;  4DL5 A;  1QZH A;  3KFU A;  5I6W A;  3KLW A;  1EFI D;  1K8A C;  3HB9 A;  4BBR B;  1O7I A;  5EKK A;  2A73 B;  3HOY B;  1F9S A;  2R6F A;  2Z4H A;  2JA7 H;  4TUY F;  4M7E A;  5LMN W;  4IR9 A;  2GLT A;  5KT3 A;  3H0G B;  1DON A;  4TVA B;  4B3M H;  3UDX A;  1D5X C;  2L4N A;  3BA9 A;  1UEB A;  5TSS A;  3BQ1 A;  4QW9 A;  2NUC A;  1E4E B;  4C3H G;  4CHT B;  1GXD C;  4TQR A;  1RHP A;  1STG A;  5KT6 A;  1U4P A;  2DIK A;  5KT7 A;  4EQO A;  1XWE A;  5EGT A;  3FPP A;  2E2I H;  3H15 A;  1VQA A;  3F2B A;  3BDC A;  4X66 Q;  1JKJ B;  4K0K H;  3A8K E;  4YP3 A;  4OO1 G;  5A2Q E;  1GSH A;  3E5S A;  4AQY Q;  2M9V A;  4XX0 B;  3LWB A;  4JYA H;  4P75 A;  2KCM A;  1G6Z A;  3Q22 A;  2KQ3 A;  4KHZ A;  3A8I E;  1PYB A;  5HV6 A;  3ORR A;  4PZ8 A;  3ND8 A;  4LJZ C;  2KHJ A;  2WKD A;  2WV6 D;  1PZJ D;  1STY A;  1X56 A;  1UWV A;  4GN5 A;  4B3R Q;  1B9N A;  2VA2 A;  3N41 B;  4KY5 A;  1SYE A;  2L9H A;  4FNF A;  2WB1 A;  2Z8L A;  3GP7 A;  2ZDG A;  1JOO A;  1NSN S;  2I5L X;  2I80 A;  3I2Z A;  3PW5 A;  2MPM A;  5C4Z A;  1ROD A;  2K05 A;  2R7D A;  1KXL A;  1RIP A;  4DUY H;  1VQI A;  2UUB Q;  1GYF A;  2DY8 A;  3A55 A;  4KN7 C;  4R7R A;  3OHA A;  1HPC A;  3GTM H;  1KL9 A;  2OTL A;  2ATW A;  3PSI A;  5J2U F;  3KAK A;  5M3F G;  1H9S B;  3PUV A;  5BPF A;  3BAA A;  1HR0 H;  4KJN A;  2H1E A;  3UDF A;  5BN4 A;  1E4F T;  5EBD A;  1CQI B;  1KC7 A;  5KFL A;  2XRS D;  4JV5 Q;  4DUZ H;  4L5T A;  4CJ0 B;  1WH2 A;  4ED6 A;  5CMD A;  3CC7 A;  4LF7 Q;  4RB3 C;  4PQX A;  2Z6B A;  3SK6 A;  2VUM H;  4DNR B;  3HOU H;  1F9Q A;  2ATL A;  4A3L G;  4FO2 A;  1S3O A;  1LUZ A;  4X64 L;  2XWB B;  4B3R L;  2R87 A;  4FM9 A;  3J80 L;  1IYV A;  4TKO B;  3VR2 A;  3GTK A;  4C2M B;  4Q43 A;  1O7L A;  2N55 A;  2EYP A;  4J15 A;  4DV7 H;  2J0T D;  4LF8 Q;  2MQH A;  1GHJ A;  3OHB A;  2BH2 A;  1M8A A;  4IUV A;  2UUB L;  1D8L A;  1PYS B;  1NNX A;  2DPI A;  4UAI A;  3M9O B;  3TP8 A;  4DV1 H;  1F2L A;  1K83 B;  3G7L A;  5E1F A;  1KDA A;  2O4X A;  3N6R A;  4FF2 A;  2SEB D;  4OXP A;  2FIN B;  4AIM A;  3J81 c;  4H44 C;  2K33 A;  2ASB A;  3I4N H;  3I4M B;  3PW0 A;  4RCN A;  4JV5 L;  3GTJ A;  2YTV A;  4R8N A;  3FMC A;  2K28 A;  4LF7 L;  1YVC A;  1GJX A;  4ZRZ A;  3ULP A;  4QF4 A;  5K2M A;  4DV6 L;  4DR1 Q;  1Y1W A;  1E4E A;  2NVT B;  1N33 H;  2R82 A;  5IWA Q;  2NN6 H;  3M85 A;  3KHR A;  2YCH A;  4XYM B;  1FR3 A;  2UVR A;  4DV5 L;  1PH6 A;  1N9W A;  2CHB D;  1HNZ L;  2PZW A;  1KQS A;  4X62 H;  3J81 W;  1S97 A;  2EY1 A;  2B8F A;  3PIP A;  3QR8 A;  2DJF C;  1GSA A;  4LFA L;  2A68 C;  1D6E C;  4GNX B;  2HCC A;  1F2Z A;  5KFA A;  4PDB A;  2NU8 B;  3KAJ A;  2Z0S A;  3GTO A;  1JE5 A;  2XTI A;  3WO0 A;  4JCV E;  1PH7 A;  5L37 A;  4KHV A;  3HGB A;  2IX0 A;  1EYC A;  3IN5 A;  1VMC A;  2UXB Q;  4ECS A;  4MV4 A;  4RA8 A;  4DR1 L;  1CT1 D;  3M4Q A;  4OIK A;  3PO2 H;  4JI1 Q;  1PV4 A;  5IOD A;  1NMG A;  5A2Q W;  2UUC H;  3TS2 A;  1JOK A;  2YV5 A;  1M0T A;  1RJP A;  2HQL A;  3J7A 5;  3N6X A;  2MUY A;  2UVU A;  1BUV T;  4KMU C;  4LF4 Q;  1CHQ D;  3RUZ A;  4OHJ A;  3GII A;  4DXG A;  1SNM A;  1XMO Q;  1W96 A;  2OT2 A;  3H3V H;  2YRW A;  3RV4 A;  3N52 A;  1H9S A;  1E2W A;  2OWO A;  2ASL A;  4DV3 L;  1O75 A;  1LTT D;  5FLM G;  2V9W A;  4BY1 H;  2RA4 A;  4KD4 A;  1N34 H;  2NZ1 D;  3PUW A;  4OX9 H;  1MI2 A;  3RAX A;  4OL7 A;  3LP8 A;  3N43 B;  4ILW A;  3HOW B;  2JQO A;  4JI3 H;  2PVP A;  3D4D A;  4O1N A;  4X65 L;  2UXB L;  2IX3 A;  1BVS A;  4KI0 A;  4LF6 H;  2YTY A;  2A69 D;  1A15 A;  2HIV A;  4ZUI A;  3A7L A;  4JI1 L;  1J6Q A;  2YL2 A;  4DK1 A;  5FO7 B;  4UFZ A;  5KFU A;  3D31 A;  3MA2 B;  4C2M A;  1G29 1;  5AJ3 Q;  4BWS C;  4KY6 A;  4EQP A;  5KX5 F;  5KFP A;  4DR2 L;  2VQF H;  1B9M A;  2EYJ A;  5LL6 X;  1LTI D;  3I4N G;  2ZJT A;  1RJT A;  1SJH D;  2CZG A;  2G9H D;  4UCO A;  3MJF A;  4HCS A;  3AFQ A;  5LMU Q;  2YRX A;  1ET9 A;  1KRT A;  1XMO L;  4AH6 A;  3RGX A;  1M4V A;  4XQQ A;  3G6Y A;  4DR7 L;  4UCS A;  3Q8D A;  1KDC A;  1XXG A;  4P2C B;  1EFW A;  1UUP A;  4MV3 A;  1STN A;  3GLK A;  4EFE A;  1TWA B;  2NZO A;  2F4V H;  1Z6H A;  4DAY B;  1VQM A;  4B3T H;  1NY4 A;  1XTC D;  4DV0 Q;  1CSP A;  2I46 A;  1U5K A;  5G3L D;  2XIG A;  4A3E H;  3CF5 A;  3N8D A;  5KG1 A;  1QOH A;  4TSS A;  5DQG A;  2L12 A;  3J7Y W;  2Z6K C;  2RBM A;  4AYB E;  2OTJ A;  3GTP A;  3U58 A;  1ENA A;  5AJ3 L;  4DA2 A;  4G4K A;  4A3B H;  4L6T B;  2AUK A;  4JI7 H;  3SK8 A;  3CXC A;  1JC7 A;  3AQQ A;  4L5R C;  4IUR A;  5G3L F;  1WI5 A;  4GNX A;  5LMU L;  2N8N A;  3AB9 A;  5M3M H;  1G8Z D;  3K80 C;  2W6M A;  2AGQ A;  2JEF A;  3V6H A;  3MWY W;  2NN6 I;  1PVO A;  1F9R A;  2PN1 A;  3VPD A;  1XPR A;  2FJZ A;  1TWG H;  3WOF A;  3JAM L;  1A3V A;  1HA6 A;  1Q90 A;  2HIX A;  3DMU A;  3RLF A;  4C3J G;  1KJ9 A;  4IWY A;  2F0G A;  3ETH A;  2N3S A;  1JMC A;  4L5S A;  4Q8F A;  3I7F A;  4UHV A;  2KED A;  4R4I A;  2I0Q A;  4JI0 L;  3QOL A;  1CTM A;  1LYL A;  3TQY A;  1D5M C;  4NB3 A;  5ELF A;  2SDF A;  5C5M A;  5ELB A;  4B08 A;  4ALP A;  1HQR D;  3OIQ A;  3X3N A;  3MWD A;  2R92 A;  1ZHQ A;  4MTD A;  4MTK A;  5KFS A;  2WB1 G;  2D0P A;  2JA5 H;  1IZ6 A;  3QB3 A;  1R9T B;  1PH5 A;  1Y8P B;  3F8N A;  1BQQ T;  2K6A A;  1JT8 A;  4M1U B;  2F4I A;  3NGD A;  1PRT C;  3K8A A;  4K6L A;  1J5E H;  4O3Q A;  1NMF A;  3EQL C;  3FP9 A;  3H09 A;  5DAU A;  1OXX K;  1LT5 D;  3ETJ A;  2LXJ A;  4A76 A;  1SRU A;  5H1S E;  1WTV A;  2UXC Q;  3OWE B;  1WD0 A;  4RCO A;  5C4J B;  2EJG C;  4KN4 C;  4EBD A;  4Q8E A;  2WAC A;  4O3P A;  1KRS A;  1LTL A;  3CMA A;  1RJQ A;  1RYS A;  3E0E A;  1YZ6 A;  1QUQ B;  1AFP A;  3NTK A;  3KYH C;  3MVV A;  3NQT A;  5EZY F;  1IHZ A;  3CCM A;  2AUJ D;  5C4X G;  2YU9 A;  5JPN C;  5D1O A;  1PA6 A;  1VS0 A;  1XPU A;  3MR3 A;  4J9P A;  3NP8 A;  2X69 A;  4OGQ C;  3SK5 A;  4ZOL F;  5JVL A;  4R8I A;  3V6K A;  5KFE A;  2A6E D;  4LMQ D;  4KV6 A;  3PW7 A;  1NE3 A;  3I12 A;  1RK6 A;  3WNZ A;  4DV2 H;  4RG1 A;  4DAY A;  3GIL A;  1HUN A;  4C3H B;  4H0L C;  4GKJ L;  5LL6 b;  2YZG A;  2LS0 1;  2RDF A;  1IBM Q;  2NVX H;  1ZYR D;  5LA6 F;  4RH6 A;  5EOY A;  2FJ2 A;  4UDU C;  3PCO B;  4H7B A;  1IXR A;  1AE3 A;  2E2H B;  1ICW A;  1Y1W G;  4XZ3 B;  3PGZ A;  2XGT A;  3OTO H;  2B2W A;  3UE1 A;  1ZXT A;  4ZYS A;  4K6D A;  1KTK A;  1I4G A;  2WII B;  1JE4 A;  3G6E A;  1VQF A;  4EVO A;  1XNR L;  4YQW A;  4NXM H;  3S15 H;  3J7A K;  3OOC A;  4CKB A;  5JJZ A;  4CKC A;  4F88 A;  3PO3 G;  4Q45 A;  1IL2 A;  1RCV D;  3NEL A;  5JEA H;  3FKI H;  1VQD A;  3K7U C;  2OCE A;  3NEM A;  3KLR A;  2MNA A;  4F7X A;  1HZA A;  4WJW A;  3FDS A;  4ED7 A;  4JV1 A;  3VYT A;  4OWX B;  3VDY A;  2AGO A;  2B2T A;  3WWV A;  1IBM L;  4ZQ3 A;  1GUO A;  3NPP A;  1LTS D;  3K81 C;  1B8A A;  4DR3 Q;  4ETS A;  4ED1 A;  3OWF A;  2ZT9 C;  4K2K A;  4FBT A;  1GD7 A;  4S3S A;  5M3F B;  2F0V A;  1EUJ A;  5M5W H;  5IGF A;  4ODG A;  3I4O A;  2QF7 A;  3IL8 A;  2B8G A;  5FLX E;  5D3D A;  1FYC A;  5CV7 A;  3Q24 A;  1SCU B;  5F9L A;  1PTO D;  1TWH H;  1TAE A;  4YR2 A;  4OWT B;  3SEB A;  1WTO A;  4ZQI A;  4I50 F;  3CQZ B;  1Q82 C;  1AEX A;  2B2W C;  4XYO A;  2CW0 D;  3GIQ A;  1F77 A;  3TME A;  2N88 A;  1TS5 A;  2E2J H;  1DOK A;  2HHH L;  1GHK A;  5IYD G;  2AU0 A;  2QEJ C;  1TY2 A;  3DEP A;  4DN4 M;  1Y8O B;  1PTO F;  4HTH A;  2PZT A;  3HOX B;  4IWX A;  4YY3 Q;  1WCM H;  4IZ8 A;  1I3Q H;  4RHS A;  2M2L A;  5IGC A;  1YHA A;  2PMZ A;  3BS1 A;  2RGR A;  4M8A A;  3E6Z X;  1IKM A;  2UUA L;  1XNQ Q;  4A3I H;  2B2T C;  5ELE A; 
#chains in the Genus database with same CATH homology
 1A62 A;  3CCQ A;  4DV4 L;  3W5O A;  3T1H Q;  2UU9 L;  4LFC Q;  4L5Q A;  3HOX G;  2HHH Q;  3CC2 A;  1HNX Q;  2WAQ G;  1FVI A;  1L2F A;  1EQR A;  5JEA J;  3IRB A;  1TWC H;  1K3R A;  2CWP A;  4NXN Q;  2EXD A;  3CCU A;  4UPA A;  5IP7 H;  4BXX G;  4LUZ A;  2EIF A;  2JA9 A;  5HY6 A;  4GKJ Q;  2JK8 A;  3CCV A;  3HKZ G;  1AH9 A;  1UE5 A;  3BU2 A;  3UE0 A;  3H3V I;  1JJ2 A;  4JI2 Q;  2EQS A;  4DUY Q;  2NZH A;  4DR5 Q;  4OWW B;  5IP9 G;  3S1N H;  3F8T A;  3PV0 A;  2K52 A;  4IJL A;  4A3C H;  3AYH B;  4B3S Q;  2RF4 A;  2R93 H;  4A3M H;  4JI3 L;  4P73 A;  1E7Z A;  2K5N A;  5C3E H;  1HR0 W;  1VQH A;  1HR0 Q;  4PZ7 A;  4HJA A;  1XNQ L;  4JYA L;  4XIG S;  3AFP A;  4LF8 L;  3K7A H;  4UP7 A;  4LF6 L;  3S1M H;  1V43 A;  1CKM A;  3A0J A;  1NBW A;  4A3E G;  4LFC L;  5GRO A;  2K4K A;  2WB1 E;  1XNR Q;  3GD7 A;  3K0X A;  3HOZ H;  4DR6 Q;  4YCW A;  4DUZ Q;  2F3I A;  1I94 L;  3J80 i;  1E24 A;  3KDF A;  4Y7N H;  2VQF L;  1GM5 A;  1GO3 E;  4PZ6 A;  4GN3 B;  4NXN L;  2E8G A;  1A8V A;  1E3P A;  2PI2 A;  1VQN A;  2CFM A;  5C44 H;  4A3J G;  2B63 G;  1QZH A;  3KFU A;  4BY7 H;  2ZM6 Q;  3KLW A;  1RL2 A;  1QVF A;  4A3B G;  1YJ9 A;  1K8A C;  1O7I A;  2DUD A;  3RN2 A;  2R7F A;  2LXK A;  1X6O A;  4DV7 Q;  4DPG A;  2JA7 H;  4DUY L;  4HJ8 A;  3T1Y Q;  2B29 A;  5LMN W;  5LMN Q;  4DR5 L;  2R92 G;  5M3M G;  4POF A;  5IWA L;  1CUK A;  2QGQ A;  2KCT A;  4TVA B;  1M1K C;  3L0O A;  4B3T L;  1ASZ A;  1BBW A;  5IYC G;  3UDX A;  4C3J H;  3NEN A;  4DV1 Q;  1EYG A;  3M7N A;  4A93 H;  2CQO A;  2BA0 A;  3W1B A;  2ZJP A;  1UEB A;  3RN5 A;  1HR0 L;  4LUV A;  3RLN A;  4JI4 Q;  3KF6 A;  2Q2U A;  5FLX c;  4BBR G;  4HJ5 A;  1QVC A;  3W1G A;  4C2M H;  1VQJ A;  1MJC A;  4DUZ L;  1XPO A;  2E2I H;  3H15 A;  1VQA A;  3F2B A;  1Q46 A;  4X66 Q;  3CCE A;  2JEA I;  1VQ6 A;  4JI7 L;  1K8G A;  1OXT A;  1N33 Q;  2FXQ A;  4OO1 G;  3I55 A;  3PUX A;  4AQY Q;  4LW1 A;  5GAH C;  1EWI A;  3GTG H;  2JA5 G;  1K83 H;  1X3G A;  1DGS A;  4LF5 L;  4MZ9 A;  4P75 A;  4ME3 A;  4JC0 A;  2KCM A;  2ID0 A;  2LSS A;  4YCV A;  4X62 Q;  3KJP A;  2N78 A;  4KHZ A;  1FGU A;  4DV7 L;  4HIO A;  3T1Y L;  1CSQ A;  1M90 C;  1PYB A;  2A8V A;  3I4M H;  3LGJ A;  1PH4 A;  4P74 A;  4PZ8 A;  2IY5 B;  4JI6 Q;  2KHJ A;  1PH1 A;  1X56 A;  2Q2I A;  1UWV A;  3D0F A;  4GN5 A;  3ZJY C;  1Q7Y C;  3M4O H;  1A0I A;  4B3R Q;  1TWF H;  4JI4 L;  2NVT H;  1SFO H;  3S17 H;  4LF4 L;  1FJG Q;  3GTK H;  2UUA Q;  2BH8 A;  2I5L X;  3I2Z A;  1W2B A;  1G51 A;  1A63 A;  1TXY A;  1PH9 A;  1X3F A;  2R7D A;  1KXL A;  1RIP A;  4DV4 Q;  1VQI A;  2UUB Q;  2UU9 Q;  3KF6 B;  3GTM H;  1KL9 A;  4A3M G;  2OTL A;  2ATW A;  3PSI A;  2JA6 H;  2UUC Q;  3MXN B;  4GLV B;  1EIF A;  2PNH A;  1GVP A;  2VS1 A;  5C4X H;  3PUV A;  1I5F A;  4FDB A;  5M3F G;  4GOP B;  1I6H H;  3EBE A;  4POG A;  2WP8 J;  1J5E L;  3UDF A;  1PHJ A;  4GLA C;  1EIY B;  2DGY A;  2R7Z H;  2IX1 A;  1VQK A;  1N8R C;  1V1Q A;  3G4S A;  2Y0S G;  1Q8K A;  4DK3 C;  4GOP C;  2BA1 A;  4L5T A;  4DK6 C;  3F2C A;  4JV5 Q;  3CC7 A;  2WFW A;  4LF7 Q;  4JI6 L;  4IPH A;  2VUM H;  3HOU H;  5C0X I;  2E5L L;  4BY7 G;  4A3L G;  2AWO A;  3RNU A;  1KD1 C;  1S3O A;  1N34 Q;  1LUZ A;  1E1T A;  4JBJ A;  4X64 L;  4A3K H;  1EQQ A;  4OX9 Q;  1YIJ A;  4B3R L;  4QY7 A;  1FJG L;  4JI3 Q;  1VQB A;  4R4O A;  3CCR A;  3GTJ H;  4HIK A;  4A3G G;  4APV A;  4J15 A;  1WOC A;  4LF8 Q;  2MQH A;  1K9M C;  4LF6 Q;  1Y1W H;  2BH2 A;  4YCU A;  2UUB L;  1D8L A;  1PYS B;  2MO0 A;  3M4P A;  5EAY A;  5FJ8 H;  4IOC A;  1I94 Q;  2UUC L;  1YHB A;  1VQE A;  1UE1 A;  2ALY B;  3ULL A;  4DV0 L;  2VQF Q;  3PF4 A;  1N36 L;  3GO5 A;  4H02 A;  1U0L A;  1YNX A;  4YWM A;  3B6Y A;  4OXP A;  4AIM A;  3J81 c;  3F2D A;  4DV2 L;  2ASB A;  2ZTD A;  3HOW H;  3I4N H;  3PO3 H;  3HFZ B;  3CPW A;  2VNU D;  3HOV H;  4JV5 L;  2YTV A;  1Z47 A;  4R1J A;  1YBY A;  1YVC A;  4LF7 L;  3I56 A;  2MO1 A;  1WYD A;  4P71 A;  3ULP A;  1X65 A;  4DV6 L;  4DR1 Q;  3GTO H;  4R4C A;  3FKI G;  5E7N A;  5JEA G;  4Y52 H;  1N34 L;  1X3E A;  3U4V A;  5IWA Q;  4BA1 I;  4OX9 L;  2IT1 A;  2F4V Q;  3M85 A;  4B3T Q;  3NBH B;  1VQL A;  2NVY H;  4DV5 L;  1VQ4 A;  1PH8 A;  5IYB H;  1N9W A;  1PH6 A;  1K0R A;  1HNZ L;  1KQS A;  5JJI A;  3OTO L;  3F1Z A;  3OW2 A;  3PIP A;  1Q12 A;  4WJ3 M;  2IHF A;  2RHS B;  1Y1V G;  2Q2H A;  4LFA L;  4R4Q A;  4GNX B;  3RLO A;  1IBK L;  4LNQ A;  4QQB X;  4NXM L;  2JA8 H;  3GDE A;  3AEV A;  1X55 A;  1Z9F A;  2Z0S A;  3ERS X;  4EQ5 A;  1JE5 A;  2AMC B;  2XTI A;  5GQO A;  4JI7 Q;  3TRZ A;  1PFS A;  1TWA H;  4JCV E;  5GAE C;  5GAD C;  4GNX C;  4GLX A;  1YIT A;  1PH7 A;  1OXU A;  1C0A A;  5JJL A;  2IX0 A;  3KOJ A;  2GVB A;  1Y14 B;  4LF5 Q;  2Q2T A;  2UXB Q;  4UP8 A;  3PF5 A;  4O0A A;  3HKZ E;  4DR1 L;  3M4Q A;  3J81 j;  1QZG A;  3CC4 A;  2JA6 G;  3PO2 H;  4JI1 Q;  1PV4 A;  1G6P A;  1NMG A;  1X54 A;  3TS2 A;  2F4V L;  3HKS A;  2R6G A;  1W3S A;  2YV5 A;  2L15 A;  2HQL A;  3J7A 5;  5IYD H;  1JJG A;  1HH2 P;  1QVG A;  1HZB A;  2PQA B;  2ES2 A;  1VQ7 A;  4LF4 Q;  1N32 L;  1XMO Q;  3H3V H;  1HJP A;  3HOY G;  1SRO A;  2B3G A;  4GOP A;  1HZC A;  2OWO A;  4LF9 Q;  4IOA A;  1WCM G;  1Q1E A;  4EX5 A;  4DV3 L;  5FLM G;  2IHE A;  1X9N A;  4A3D G;  4MNO A;  1E22 A;  3H0G G;  4IPG A;  4IO9 A;  3CCL A;  1BBU A;  2VQE Q;  4BY1 H;  3PUW A;  2UXC L;  1AE2 A;  3CPF A;  4A3I G;  2JQO A;  1SMX A;  4JBW A;  4QL5 A;  2AWN A;  4MTN A;  3G48 A;  5C0X J;  4X65 L;  2K5V A;  2UXB L;  3HOX H;  1J5E Q;  1BVS A;  4KI0 A;  3BZC A;  5ELN A;  2YTY A;  3PUY A;  1CKN B;  2JJQ A;  2HIV A;  4JI1 L;  1J6Q A;  3JAM c;  3D31 A;  3TRE A;  1G29 1;  5AJ3 Q;  2N49 A;  4BXX H;  4DR2 L;  3E9I A;  4HIM A;  2E5L Q;  3PUZ A;  5IP7 G;  5C0X G;  4X64 Q;  3I4N G;  2MFI A;  3DM3 A;  2ZTE A;  4DR4 L;  3KJO A;  3HOV G;  3AFQ A;  5LMU Q;  1R9T H;  1WFQ A;  1KRT A;  2A1A A;  5IP9 H;  1XMO L;  3GTP H;  4AH6 A;  3S16 H;  4LF9 L;  1UE7 A;  4DR7 L;  2D62 A;  3Q8D A;  4LWC A;  3STB C;  1XJV A;  1EFW A;  4A3C G;  2R93 G;  2VQE L;  2UXD Q;  2CWA A;  2NZO A;  4DAY B;  3J81 i;  1VQM A;  1NY4 A;  5JJK A;  1L1O A;  5C3E G;  4DV0 Q;  1CSP A;  1U5K A;  1N36 Q;  4A3E H;  1KC8 C;  1YI2 A;  4IJH A;  3A5U A;  3CF5 A;  3TEH B;  2RHQ B;  5C4J H;  3HOZ G;  4DV2 Q;  2JEB I;  2Z6K C;  3L7Z C;  2VW9 A;  3G71 A;  1EOV A;  4AYB E;  5HGQ A;  1B70 B;  2A19 A;  3U58 A;  1XMQ Q;  2OTJ A;  4A3J H;  5AJ3 L;  1S40 A;  4IFD I;  1SR3 A;  4QJF A;  4DKA C;  4DV6 Q;  4A3B H;  5C44 G;  1JJC B;  3CXC A;  3AQQ A;  4L5R C;  1WI5 A;  4GNX A;  5LMU L;  2N8N A;  2K75 A;  4DV5 Q;  2R92 H;  5M3M H;  2JA7 G;  3K80 C;  1HNZ Q;  3OTO Q;  2NN6 I;  1PVO A;  4UP9 A;  5IYC H;  2YTX A;  1XPR A;  3KF8 B;  4TQU S;  4YHH Q;  1TWG H;  4LFA Q;  2HIX A;  2UXD L;  3RLF A;  4A93 G;  5K36 G;  1IBK Q;  2N3S A;  1JMC A;  4L5S A;  4NXM Q;  3I7F A;  3BZK A;  4C3H H;  1PH2 A;  1QUQ A;  4DR3 L;  4R4I A;  2I0Q A;  4JI0 L;  1IBL L;  4GKK Q;  1MJE A;  4LFB Q;  1LYL A;  3TQY A;  4K0K Q;  4NB3 A;  2KEN A;  3S24 A;  3UDG A;  4PMW A;  4ALP A;  4A3F H;  2K5H A;  4HJ7 A;  4BBS H;  2E2H H;  1L1O B;  4HID A;  1XMQ L;  2PQA A;  5BR8 Q;  2RCN A;  1YJW A;  4JI8 Q;  2WB1 G;  2D0P A;  2JA5 H;  1IZ6 A;  1P16 A;  4P72 A;  1L1O C;  4IPC A;  4OON A;  1PH5 A;  5DLQ E;  1JT8 A;  1Q1B A;  4B3M L;  3I4M G;  3K8A A;  1N32 Q;  2H5X A;  1NJI C;  3TS0 A;  2JE6 I;  3S1Q H;  4YHH L;  2I5H A;  1NMF A;  3FP9 A;  2YU9 H;  2AHO B;  1KIX A;  1OXX K;  2ZTC A;  4O2D A;  4DV3 Q;  2LXJ A;  1HNW Q;  4A76 A;  1SRU A;  2GVA A;  5H1S E;  1C7Y A;  1YEZ A;  2WAQ E;  3JC6 6;  2VY3 A;  1CKN A;  4GKK L;  2UXC Q;  4YY3 L;  4K0K L;  1KRS A;  4RMF A;  1LM0 A;  1LTL A;  2VL6 A;  4C3I H;  3JAM i;  3CMA A;  3S2D H;  3E0E A;  3BJU A;  4X65 Q;  4HJ9 A;  3M9B A;  1YZ6 A;  1QUQ B;  3KYH C;  5M3F H;  5BR8 L;  3CCM A;  4JI8 L;  4JOI A;  3ICE A;  5C4X G;  3T1H L;  1PA6 A;  1VS0 A;  1WJJ A;  1XPU A;  2QEX A;  1YHQ A;  4DR2 Q;  4WJ4 A;  3ER0 A;  1Q81 C;  3U50 C;  1HNX L;  4PG3 A;  4JBM A;  2R7Z G;  1NE3 A;  3EIV A;  4QGU A;  1NTG A;  3CW2 C;  4DR4 Q;  4RG1 A;  1P8L A;  1OTC A;  1HZ9 A;  3FHW A;  5GAG C;  2QA4 A;  4A3L H;  2Z6K A;  3CQZ H;  2VUM G;  3U4Z A;  3HOU G;  2K14 A;  2V1C C;  4A4I A;  4DR7 Q;  3A5Z B;  4GKJ L;  4A3K G;  1HNW L;  4BA2 I;  1IBM Q;  2NVX H;  4A3G H;  3PIO A;  2OQK A;  4JI2 L;  4YWK A;  2I5M X;  3MEF A;  1CKO A;  3CME A;  3PCO B;  1IXR A;  4B3S L;  1AE3 A;  1MIU A;  4IFD J;  1Y1W G;  3PGZ A;  2XGT A;  1KHI A;  3CD6 A;  3UE1 A;  4DNI A;  1OXV A;  3CCS A;  4JI5 Q;  4DAM A;  5FJ8 G;  1VQ8 A;  1UE6 A;  2D0O A;  2C35 B;  2PMZ E;  3J7Z C;  3G6E A;  1VQF A;  2KBN A;  1XNR L;  1PH3 A;  3S15 H;  4DR6 L;  2CCZ A;  4IFD G;  1VQ5 A;  2HT1 A;  3EN2 A;  5IE8 A;  3ULJ A;  5IY0 A;  4A3F G;  4GS3 A;  3HOW G;  1IL2 A;  3PO3 G;  4BBS G;  2NVQ H;  3NEL A;  3FKI H;  1VQD A;  3K7U C;  2OCE A;  3NEM A;  2MNA A;  2ZM6 L;  4QIW E;  3J80 c;  1VCI A;  4NPS A;  1HZA A;  3A74 A;  3KDF B;  4OWX B;  3VDY A;  1IYJ B;  2NN6 G;  4JOI C;  3WWV A;  2OQ0 A;  1IBM L;  4AYB G;  3GTL H;  1H95 A;  5LMN L;  5IYB G;  3K81 C;  1B8A A;  4XTC S;  3UDI A;  4DR3 Q;  3S14 H;  4JI0 Q;  1Y1V H;  1IBL Q;  1OXS C;  4DV1 L;  1B7Y B;  1GD7 A;  4JI5 L;  3SGI A;  3L2P A;  1VQO A;  2ZJQ A;  3CCJ A;  1EUJ A;  1VQG A;  4R4T A;  5M5W H;  1S72 A;  3CAM A;  3RZD H;  3GTQ H;  1V9P A;  2B63 H;  2JA8 G;  4KHP Q;  1D7Q A;  3I4O A;  1XTD A;  3OYY A;  3RZO H;  1TWH H;  4OO1 I;  4OWT B;  2F52 A;  4X66 L;  1GKH A;  3DLL A;  2ZJR A;  1N33 L;  1K73 C;  3STB D;  1Q82 C;  4AQY L;  1JB7 A;  1SN8 A;  4KLK A;  4B3M Q;  2YYZ A;  4UY8 C;  3PO2 G;  1MKH A;  4JG2 A;  1FL0 A;  1T9H A;  4YWL A;  1KAW A;  2GN5 A;  4GN4 B;  1BKB A;  1L0W A;  4X62 L;  1I50 H;  2HHH L;  2PI2 E;  2E2J H;  1Q86 C;  4A75 A;  5IYD G;  5M5Y H;  2VZA A;  1YJN A;  4BBR H;  1SE8 A;  3S1R H;  1ASY A;  4LUO A;  3HOY H;  5M5X H;  4IPD A;  3M3Y H;  2AKW B;  4LFB L;  2K50 A;  3S2H H;  4X6A H;  4YY3 Q;  1WCM H;  5IT9 c;  4JBK A;  1I3Q H;  4A3D H;  5J3B A;  1VQC A;  5FLM H;  2KHI A;  1E1O A;  1YHA A;  3H0G H;  2CKZ B;  1C9O A;  3E9H A;  3CP0 A;  4BY1 G;  4KHP L;  2UUA L;  3RR5 A;  1XNQ Q;  2Y0S E;  4A3I H;  4JYA Q;  1VQP A;  1SLJ A;  1VQ9 A;  5ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...