3HOUJ

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 16
structure length 65
sequence length 65
chains with identical sequence V
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3houJ00
4S0HB 3BG5A 3DCFA 2LD5A 3NAUA 5F0HA 5M3MJ 1DU0A 1JUPA 2X48A 3GTQJ 3GBGA 5EG0A 1OJLA 5BNGA 1B8IB 5DS9A 1RKTA 1W0UA 2Y31A 2H8RA 2AHQA 2DMPA 2XSDC 4MO7A 2DJNA 4DW6A 4XRMA 5M5WJ 3S1NJ 3B6CA 5E3LA 1JUSA 1ETKA 1JJ6C 3TW7A 3RQIA 4M3DA 5IOZA 4A69C 4QTRA 3HGYA 1K83J 1U8BA 4A93J 1GT0C 2H1KA 5FLVA 3JRDA 2ME6A 1VF9A 5E3OA 1HDDC 2MW8A 4A3GJ 1JT0A 1A6IA 4IHYA 1JUMA 2VPRA 1RKWA 4V2GA 2DMTA 3BR3A 5EEAA 1QVTA 3O8GA 4W1UA 2EBIA 1H89C 3JRBA 1MBFA 4JP0A 2PMZN 1NTCA 1S7EA 2LR8A 4BKXA 1H88C 5F0FA 2CUEA 2L7FP 2HOTA 2M34A 3TEDA 3OOUA 5GPCA 4JX6A 2R92J 1MBEA 1JT6A 4IEJA 4C3IJ 3BTIA 5C3EJ 2E2IJ 2DA4A 3NARA 2ELKA 3IH2A 2HQ5A 2R5YB 4A3MJ 3JR9A 3GTOJ 3Q3SA 4XICA 4DYRA 3E7LA 5EZGA 2M2EA 4D7MA 4A3CJ 4Y7NJ 3HB9A 4C3JJ 1AU7A 4B1RA 1MBHA 3JRGA 3RKQA 1QVUA 1IUFA 3HKZN 3S2HJ 1FJLA 1SFOJ 3FKIJ 2TRTA 1X2MA 1ETQA 2Y30A 3S17J 1H8AC 3F0CA 1WH5A 1U9OA 5FKLA 3ZOBA 2N8GA 4FE4A 3G1OA 5IYBJ 2XB5A 1RPWA 2E1OA 2DA1A 3GTJJ 1MNMC 2DA3A 3LNQA 2LVSA 5M5YJ 1LFBA 1HF0A 2R93J 2JK3A 2DA6A 2DN0A 1GV2A 5M5XJ 3IH3A 1ZTRA 3HOWJ 1BJZA 1OFCX 5GP9A 1B72B 3JRAA 2XRLA 2AO9A 5J1UA 5JLXA 2DMUA 5FLMJ 2DA7A 3CCYA 1HDPA 3JRIA 3GTLJ 4A3LJ 4XK4A 2JA7J 2CJJA 4AC0A 1JKOC 1WH7A 4D5CA 3QQAA 3IH4A 1QRYA 4A3KJ 3HBLA 1IGNA 1IDZA 2L7MP 3IV5A 2KDZA 2W48A 2HOAA 3ZQCA 4IHWA 2Y9ZA 4UUSA 1FIAA 2NVYJ 4MIMA 5E3MA 2LFBA 2IBDA 1Y1WJ 3A03A 3JRFA 4D5FA 1ZR2A 2NS8A 1NK2P 2ID3A 2EH3A 4UUTA 5IYDJ 2Y2ZA 3C2BA 4FE7A 2XB0X 5J1YA 3RZOJ 5FJ8J 2YU9J 1BW6A 1D5YA 1TWGJ 1F36A 2X6OA 3B6AA 2YUSA 4C3HJ 3ZQLA 1VI0A 4I6ZA 1TWCJ 2EZKA 4XRSG 2O7OA 1X58A 1MBJA 2NVQJ 3BR6A 3HOUJ 3K2AA 4DZPA 3D1NI 1ZQ3P 1ORKA 3LSJA 5GPAA 1UMQA 2NOGA 4M3BA 3JRCA 4QSHA 5E3NA 1YRNB 2CRGA 2P81A 4BXXJ 1FEXA 1JJ8C 1SANA 3PM1A 1JKPC 2DMNA 1B8IA 2E2JJ 4B3AA 1NK3P 2O8KA 1CQTA 2DTZA 5EGOB 1ETXA 2EQRA 2IAIA 4X1EA 2JA8J 2XPWA 4MLOA 1K61A 1VFCA 3DEWA 2ECBA 3SFIA 5IP9J 2EZIA 2MG4A 1T33A 1RR7A 2LLKA 2Y9YA 1JTXA 1IDYA 2DMQA 2D5VA 4FCYA 4EEFG 1FTTA 3ZQGA 2RAEA 3BT9A 2L7ZA 3CQZJ 1ENHA 5FKMA 5EYRA 1HLVA 4C2MJ 3BR5A 4JX4A 1JGGA 3Q0VA 3S16J 3Q0WA 3A01B 2GLOA 2HI3A 5JLWA 5K7HA 2NVTJ 4BY1J 4Y52J 5DTDA 4LOCA 1HOMA 4XIDA 2XGEA 5J3LA 4L5EA 2R0QC 4M6VA 3HEFA 5J1RA 2X9DA 1UHSA 1ZR4A 3BTJA 4RDUA 1WPKA 4JYKA 1GV5A 2E2HJ 4W97A 3BTCA 3MKLA 3ZQFA 5IYCJ 3RZDJ 5FKOA 1ZK8A 1I3QJ 1RETA 2VI6A 1RESA 1WGXA 2JN6A 3BR1A 3PO2J 5EGOA 2G0EA 2KT0A 2L9RA 4GFBA 2M0CA 1XS9A 5IP7J 4FTHA 1LFUP 5EG0B 1U9NA 3H3VK 3HGGA 3ZQHA 1ETYA 3GTKJ 1FIPA 1WI3A 4BBRJ 3LOCA 2I10A 4IHVA 2R5YA 1TWAJ 4JX5A 3G1LA 1IRZA 2WAQN 3M4OJ 1MH3A 3BTLA 2L0KA 2LY9A 3LSGA 3HOZJ 1X2NA 3A01A 3S1QJ 2TCTA 2Y0SN 4RBOA 4V2FA 2LP0A 2XPVA 2ECCA 4BY7J 5EF6A 2NVXJ 3WHBA 3Q0UA 5FKKA 5C44J 1AHDP 4D7NA 3SJMA 4CYCB 5IPAA 3ZQIA 3HOVJ 4A3FJ 2HXIA 2NS7A 1BL0A 2GM4A 3BR0A 5EDNA 1DU6A 2E19A 1IG7A 3G1MA 5F27A 1G2HA 2M9HA 1IV6A 3TP3A 1APLC 1AKHB 1Y1VJ 1P7JA 1JTYA 1ZKGA 3L1PA 1O4XA 1B72A 2CUFA 3MVPA 1R9TJ 2HOSA 1PUFB 3TW6A 1ETVA 2EZLA 2K9QA 1A5JA 1OCPA 1BA5A 1T56A 3FIWA 4M3EA 2DA5A 4DYQA 2CQQA 5EZHA 1ETWA 3GTMJ 2VKVA 3HM5A 1Z0XA 1UG2A 1I50J 5FKNA 2OPTA 3JRHA 4A3BJ 2HYJA 1TC3C 4A3EJ 3FK7A 1ETOA 4IHXA 9ANTA 5F04A 1I6HJ 1IJWC 1HCRA 2CU7A 2QCOA 4QIWN 2K9SA 3LSPA 2ZB9A 3GTPJ 1BW5A 5HODA 5F08A 3S2DJ 4M3GA 4CYCA 3S14J 3A02A 3WHCA 3K7AJ 5C4XJ 3S1MJ 3BQYA 1F43A 1MH4A 2K9NA 4M3FA 3FK6A 1TWHJ 3HDDA 1AKHA 1MSFC 2WB1N 4J19A 1MBKA 4AYBN 4X6AJ 1LE8B 3S15J 1Z77A 3I4MJ 2R7ZJ 1EF4A 2R5ZB 5F1JA 1PUFA 4A3JJ 3TP0A 1MSEC 2FX0A 3BQZA 2HDDA 4XRSA 4A3IJ 4MFEA 1ZGWA 5F0CA 3UKGA 1JKRC 2MGQA 1MBGA 1WCMJ 4I76A 4NDLA 1POGA 1Q1VA 2XPUA 4ABZA 1YRNA 5IOYA 2CQXA 2VKEA 2VUMJ 3OIOA 2JWTA 3H0GJ 3QPLA 2LTPA 3HOXJ 2LK2A 1XC5A 2HXOA 2DA2A 2ID6A 4G12A 3OSGA 2B63J 1FTZA 2FQ4A 2QF7A 2JA6J 3MN2A 1GDTA 4B4CA 3I4NJ 2GBYA 2XGCA 4DZJA 2XGDA 1E3OC 2FD5A 1GVDA 4UUSB 3PO3J 2JA5J 1VNDA 4FISA 1U78A 2MSYA 2K40A 2OF7A 1OCTC 5M3FJ 3M3YJ 5C4JJ 1GUUA 1LE8A 1IC8A 1P7IA 3BR2A 2M8GX 3SDGA 5K7ZA 3O8HA 1JKQC 2JMWA 1W0TA 2R5ZA 3CDLA 2ME0A 1XG1A 2EZHA 3VPRA 1TWFJ 2WV1A 3S1RJ 2LKXA 4AUXA 4MFDA 3GTGJ 1ITYA 3LSRA 3CMYA 2FJ1A 2IEKA 5IP6A 4HNVA 3QPSA 3HOYJ 5K7FA 4DYCA 1QPIA 2YS9A 2JJ7A 3JREA 3OSFA 2O9LA 4A3DJ 3BG9A 3FISA 2COBA 4BBSJ 3BG3A 3W6VA
chains in the Genus database with same CATH superfamily
1UELB 1S29A 4Z6YA 3FHNA 3GW2A 3AAFA 2A5WA 4GO1A 1R71A 1F5TA 5M3MJ 1JUPA 1N78A 3GBGA 2EK5A 5CVVA 2KLOA 3CCJI 6PAXA 2DFEA 1LVKA 1W7PA 3CZ6A 1P4AA 1VQNI 2PJRB 2XF5A 3NWSA 2FBKA 3TO6A 3GEZA 1WQ2A 4P96A 2ZJPF 3S1NJ 1IAWA 3B6CA 2OA4A 2IA0A 2R7DA 3BC8A 1EKEA 1ETKA 4ESJA 2VBZA 2E5ZA 4A69C 1E17A 1U3EM 2ME6A 3GX4X 1X1BA 4FX0A 1K4TA 4ZDOA 4A0ZA 2RC4A 4IL6C 4BDYA 3K4MA 1ZRCA 2HKXA 4D9JA 3GWZA 2W25A 2VPRA 2DMTA 1U2WA 2KZGA 4KIBA 2MLGA 2MH2A 2VBWA 4XLCA 2BXYA 2HYGD 4CICA 4EQQA 1I6XA 5B5EC 3E6MA 4W1UA 3I55I 2EBIA 2ETHA 5D5WB 2PLYA 2KDOA 1IV8A 3L2UA 4JP0A 2PMZN 4XKCA 2M1BA 4BKXA 1H88C 4M6YA 2CUEA 2DI3A 1W5SA 1YOVB 1FBUA 3KE2A 2DYRH 1UFMA 4F91B 3ML6A 4BYYA 4RB3C 5ICFA 3OYJA 3DPLC 3K70C 3BTIA 4RLQA 5C3EJ 2E2IJ 4XLAA 2R5YB 3CCQI 2Z9OA 4NC6A 1BOAA 3J81K 4A3MJ 1WKMA 1I1SA 1YLFA 3WTXC 3E7LA 2ADUA 5EZGA 2M2EA 3SEQA 3K4NA 4A3CJ 1GLNA 3J80Z 1S7OA 2MLKA 1IUFA 4Q48A 4S05A 3R0AA 2ZJQF 2E60A 3CF2A 1I5ZA 3DP7A 4LFUA 3GYHX 5ILUA 3TDUC 4BAYA 1FJLA 4IHSA 2W7NA 2P0WA 3K0LA 1ETQA 2Y30A 2JVHA 2PI0A 1VZ0A 3PSIA 1XMAA 5DCMA 3S17J 2Z1DA 3N05A 5FKLA 4YIIA 3T0YA 3KYCB 3G1OA 2W84A 1T0FC 2XB5A 1WVRA 3F3XA 1T2KA 2RREA 3ZCOA 1A04A 2R93J 2JK3A 4BE0A 2W82A 1Z7LA 1ZTRA 1U0JA 2XVCA 1BJZA 3KP7A 2Z3YA 2NVUB 2UUZA 1OFCX 3F22A 1B72B 3CESA 4G8XA 2R7OA 2DA7A 3CCYA 1HDPA 5J8FA 3CO7C 1WH7A 1TW2A 2OUMA 4D5CA 2QBYB 4BNCA 2VONA 2XV4S 4I2OA 4BEHA 1IDZA 2L7MP 1LDJA 3D5SC 3IV5A 2W48A 2LRDA 2Y9ZA 4CO8A 4UUSA 2HQNA 4Y3OA 3EETA 3RTRA 2LFBA 4D5FA 1ZR2A 4XKWA 2ID3A 2K02A 3IP4B 3ZRGA 3OYBA 4IVNA 4L9JA 3PL8A 2F4IA 3OMYA 1VQ7I 2OJED 3CCVI 3QRFF 4FE7A 2JUCA 1HW2A 2XB0X 1D1BA 2K85A 5FJ8J 1YYVA 2R3SA 2QSHX 1TWGJ 1F36A 1YO5C 1R5ID 2DK8A 3OYHA 4U87A 1XCVA 3SHFA 4DOZA 4BHCA 2RVCA 1VI0A 1XGSA 4RS8A 4ZDLA 4ZTJA 4ANJA 1WHUA 1Z7UA 2KP6A 4PZJA 3OYGA 4UUVA 3GVAA 5F64A 3OY9A 5DV5A 1XMKA 3T8RA 2P5LC 2NVQJ 3J7YJ 1MIJA 3CO6C 2HPMA 3K2AA 4DZPA 2BY1A 2HTJA 3D1NI 3LSJA 2P4WA 1UMQA 4A2UA 5DEQA 5K5RA 3JRCA 1YFHA 1RIOH 5JR3A 3V7RA 5J8CA 4BU2A 5E3NA 1X3ZB 3RKYA 2GOXB 3EUHC 4BXXJ 1JKPC 4BJ5C 1ZGJA 4ZH4F 1U8RA 4R8HA 4B3AA 2PMUA 3ISPA 4F52A 2DPDA 2DTZA 3CTAA 1ETXA 2M30A 3QWLA 1W7PD 4HPQA 2XPWA 2CQ7A 2F2EA 3A0HC 2CYYA 1IN7A 2OCCH 4YG2F 3FXQA 1MDMA 4N9HA 1T33A 3FXOA 2VBXA 1ZYRF 1J0RA 3ERED 3PQKA 1IDYA 2D5VA 2WA0A 4HW0A 3GCMA 3CQZJ 4LB5A 1SVLA 3Q0VA 4EV0A 2A07F 1QQIA 3A01B 3QYBA 4GXOA 1N25A 4CCJA 5JLWA 1OCRH 3KFWX 5GTHC 5E1XA 4LOCA 1XDUA 2AS5F 1QZEA 2VLAA 2DLLA 2NNNA 5CQGA 3TBIA 1I39A 2AQEA 3I9V2 1T38A 1W5CC 3RI4A 1YJWI 1Z9CA 1U5TB 1F4KA 3RDIA 1Y0NA 3H35A 3BTCA 4W97A 3ZQFA 2KPMA 2ZXHA 1I3QJ 4KT6A 1J09A 2QM3A 3BR1A 5EGOA 2KT0A 2VE9A 2Z99A 3VDXA 2JUGA 5CPRB 3OS0A 1FOXA 1LFUP 1OYWA 1T6SA 4QPQA 2F48A 3GTKJ 1J9IA 4JK1X 5CQEA 3HJEA 4IHVA 2ZSIB 1M1EB 2M7AA 5ERIA 3RJPA 4JX5A 4L5JA 2WAQN 2STTA 3M1EA 2MC4A 1NHAA 3BZKA 2L0KA 3DU6A 2QQBA 1BR2A 3J7ZI 2Y0SN 3PFYA 2ESNA 4RBOA 1QO0D 4HX7A 3FDYA 3CJTB 4BY7J 1XDSA 2FRHA 3WHBA 5FKKA 1AHDP 2E5NA 1OR7A 2DU9A 4CYCB 4BE1A 3HOTA 1SFXA 4NNJA 4A3FJ 2HXIA 2UV1A 2DO7A 4E7SA 3RPQA 1O57A 1IG7A 2WC2A 1G2HA 1X4OA 3TP3A 5BMZA 1APLC 3DV8A 1V54H 1P7JA 3DTIA 1OCZH 1QZYA 1S9HA 1Y6IA 2KRFA 1JTYA 2KIQA 1HBXG 1ZKGA 3I71A 3QOEA 4HQEA 1S6LA 3W2WA 1R9TJ 2K3FA 2QEXI 3WU0A 3CUQA 3GZNB 3TW6A 3I5UA 5EEGA 3PJRA 2AQFA 3DTEA 5TRDA 4M3EA 1RZ4A 1TTYA 2DA5A 4U0VA 2F5EA 1KA8A 5EZHA 1Z0XA 4MQ9F 2XRNA 3AG2H 4A3BJ 2XF6A 3HTUA 3FK7A 4XSXF 1ETOA 3VODA 3MWMA 4LJZF 5D5UB 3W2AA 3E97A 2QYOA 1G3SA 2EIJH 2CU7A 2DQRA 3GFJA 5TGTA 2QCOA 5TISC 4QIWN 2MFZA 2QKLB 2ZB9A 1UHWA 4WXHA 3DLAA 3S2DJ 2I8DA 3NQOA 4HNUA 4RB1A 3K7AJ 3O6BB 3JTHA 3BP8A 1VQMI 1Z21A 4M3FA 4UB8C 1VQOI 1K6YA 5EEHA 5LBQA 3HDDA 2WY7Q 1MSFC 2WB1N 5KCMA 1LE8B 3DXJF 1U5TC 3C2HA 3DFGA 4OMZA 4U0WA 3K9TA 3K1PA 1OLTA 2BBYA 2GQQA 1PUFA 3VWBA 2P6SA 2EFNA 3KZYA 2ZKZA 4G6QA 3TP0A 3SDBA 1UG0A 2EV0A 1XGMA 1FWZA 4OWRB 4EM2A 3AG4H 3KYLA 2AXLA 4XRSA 2O61A 5JVGF 3AG3H 2TDXA 5LHIA 3UKGA 4BHBA 1VQ5I 1MBGA 5HS7A 3C18A 4Q4ZF 2XPUA 1OMIA 4CCNA 2JWTA 5L3EA 4CCKA 2HXOA 2DA2A 2ID6A 2EWNA 1Z1DA 4O6JA 3OSGA 1FTZA 3VYTB 1R1VA 2FQ4A 4LLNA 2JVGA 4BGDA 3OR2C 1WI9A 1KQ0A 3WTTC 4DZJA 3K4CA 1A35A 3ABTA 1E3OC 1DPRA 5H6RA 1D1AA 4KFCA 1D0XA 1GVDA 2CW8A 2ZXJA 3P9KA 1VNDA 4HF0A 2PMZA 4FISA 3FWEA 4LIUA 1U78A 2P7CB 3FXKA 3E0JB 1AOYA 3GO5A 4BL0B 2V1NA 3BR2A 1VQ9I 4D1QA 1MJ9A 2COMA 2R5ZA 4BDZA 1XG1A 1SVOA 2EZHA 1HXDA 3DEEA 1TWFJ 2LSOA 4AUXA 3BCAA 3CJRB 4OAZA 5H6QA 4DBQA 3KEQA 3WGIA 2LY2A 3RYPA 3RKXA 3LSIA 3MKWB 1BC7C 1MNDA 5IP6A 2CV0A 4M72A 2VXDA 3HUGA 3FX3A 1ON2A 2LKSA 2E71A 2YS9A 3QYEA 5K7FA 3J80K 1QPIA 2WV0A 3JREA 4NC7A 3GLXA 3FM5A 3QOPA 1H0MA 2COBA 4BBSJ 4NQWA 3Q9VA 4QWQA 3MKYB 3OWTA 2H09A 3BG5A 4WCGA 2HS5A 3EUAA 2LD5A 2ICWG 5F0HA 3GTQJ 2ZMEB 2EA4A 5EG0A 3AL0B 4AVZA 3H9GA 1KU9A 5JVTA 3L00A 1B8IB 2LH9A 2W1OA 2F4MB 3OYLA 2H8RA 3GZ5A 5J4VA 4L9NA 2XSDC 4MO7A 3ZQ7A 2M5WA 1VQPI 1UB9A 2XKPA 5EJCA 4HSTA 5E3LA 2O03A 1JJ6C 5DM6F 2XDVA 1UJ8A 1I27A 2DDAA 2HVQA 2M45A 1USTA 2C6YA 1GT0C 2H1KA 1YX5A 5FLVA 3H92A 3Q9SA 2DXIA 4A3GJ 1YX3A 4XOPA 2DODA 4LG0A 4IHYA 1RKWA 2E1NA 2XAUA 4KMUX 2H94A 4WXDA 3BPVA 4C9YA 3E6CC 1BOBA 3O8GA 2W85A 5KAFC 3OS2A 2X6XA 3JRBA 3HRSA 2DTRA 3DEUA 3MZYA 1WZ2A 5JFRA 1WJBA 1KU7A 3CD6I 4YFXF 2CH0A 4P55A 2Y69H 3OYDA 2DJIA 5F0FA 2XAQA 5AIQA 2PJRA 4JX6A 3WE2A 4HLYA 1MBEA 2K5CA 2R92J 4IEJA 1B9NA 2ISYA 4EMSA 4XLNF 3L2WA 3ZGKA 2K9MA 3NARA 2ELKA 3CP2A 3IH2A 2OZUA 3EUKL 2VC0A 5D6EA 4MNUA 1YJNI 3GTOJ 3FBNB 1BR1A 2WBMA 4KDPA 4B44A 4BHPA 4Y7NJ 2KMUA 2V79A 3HB9A 3KX2A 1NG6A 4C3JJ 1AWCA 1MBHA 1YW7A 3RKQA 2OTJI 2L02A 2XAHA 3HKZN 4HSRA 5IT3A 1FZPB 3CCEI 5K1YA 3PIPF 4LK0F 2E1CA 1B9MA 1Y56A 2TRTA 2PN6A 2X51A 4UVAA 4CZZA 3F0CA 2VJ4A 1EJ9A 2VN2A 1X3WB 3ZOBA 4IXAA 1SMTA 4FE4A 3T8TA 2X1EA 4HF1A 4RAYA 2DA1A 4FHTA 4IF4A 2RDPA 1C0WA 3J7AY 4XLEA 5E79C 1QHHD 1LFBA 3QYFA 1XMXA 1K6OA 1PJRA 5FFXA 4XLFA 1LDKB 5M5XJ 1YI2I 1RNLA 1YW8A 2F5CA 3S3MA 5GP9A 2ZMEC 3AL0C 1D8KA 2KL4A 3OYCA 3F72A 1D8JA 4J01A 4E7ZA 2KJCA 1K78B 2PFBA 1R49A 4B09A 3F9KA 1GVJA 2KIMA 3IH4A 1ZHFA 3EPZA 2CS3A 1IGNA 4RLFA 2XC7A 5GADJ 1T98A 2X0LA 3H5AA 2MA3A 5D4SA 3Q5FA 3CC4I 5CLSA 1TQPA 2IBDA 2ISZA 3A03A 5FD5A 3JRFA 2NS8A 2IT0A 1XGNA 4CGZA 1FBSA 3A2KA 2FMLA 3F6OA 4BQQA 2LDUA 4XR6A 3SZPA 2QSGX 4UUTA 5IYDJ 4RMNA 2EIKH 3C2BA 1QNTA 2OU2A 4E6KG 2FEZA 1IN5A 2YR2A 2DFFA 4R79A 2OQGA 3LFUA 3CDHA 2FBHA 1BW6A 2QLZA 1D5YA 5J40A 1MGTA 3LA3A 5D6FA 3B6AA 2WAQA 1HKSA 2V26A 4OIQF 3NRVA 2BEOA 3PNYA 3FXMA 4I6ZA 3IRRA 1ZGAA 2O0YA 3QODA 1LDDA 4XRSG 4TV7A 3KP6A 2CSOA 3R61A 4XLPF 3CC2I 4E7HA 2Y0SA 3UNGC 2WY8Q 1X58A 5L3FA 2R7QA 4RAFA 1WJAA 2JPBA 1SMYF 5B1BH 3QP5A 5E20A 5FRMA 5K5QA 1ORKA 4L9VA 2I5UA 2K7LA 4M3BA 2HVRA 3ASNH 1YIOA 2L5QA 2IGMA 5LRSA 4CZCA 2HR3A 4RGXA 1JJ8C 5LEJA 1ONVA 3OIPA 2IS6A 4U7BA 2PG4A 1P4WA 2A6HF 3L7WA 1CQTA 2O8KA 1STZA 2IAIA 2EQRA 4A0XA 2KIUA 2JA8J 4MLOA 1K61A 1VFCA 5ICCA 1ULYA 3HSRA 2ECBA 3KP3A 5IP9J 1VTNC 3H9QA 1FP2A 3OV8A 1RR7A 2LLKA 3WTUC 3LAPA 1JTXA 2DMQA 3OIQA 4GGGA 4EEFG 1FTTA 2RAEA 3P5JA 1R5GA 2OCEA 2HZDA 4I01A 3BZCA 3QP6A 2E7XA 3OL3A 1FC3A 3BR5A 1JGGA 4KIFA 4ZYAA 2L9SA 1FSHA 1MKMA 2VT2A 3FKJA 2GLOA 4II3A 2HI3A 4CUGA 1DP7P 4F92B 2L9VA 3HPHA 4YIFA 5DTDA 4IO9F 3L2VA 4UY8I 4HOBA 2V6EA 4PFPA 2QUFA 2XGEA 5BPDA 3JW4A 4L5EA 3GFLA 4UV8A 1DDNA 2OC6A 1IUYA 2JSPA 3L2QA 2Q8KA 4G7ZF 1UHSA 3BTJA 1LKXA 3JSPA 1JE8A 3FBIB 4C2UA 2LOOA 3GLLA 1ZH5A 5FKOA 1OKRA 3EQLF 3ZR8X 2MC3A 1RESA 2XAGA 1K4SA 4FASD 3DBHB 3PO2J 2L9RA 2E1MB 2WB1A 4GFBA 3R6SA 1E2XA 2V9PA 4U7DA 4HDUA 5IP7J 4FTHA 2QA4I 2P5KA 3F8BA 3LL7A 1U9NA 4ENJA 3H3VK 2ZXWH 2V9VA 5ICGA 1Z3YA 3LOCA 2HOEA 4IX7A 4GDFA 5E17F 1JI8A 1W7PB 5FGMA 2D45A 2FQ3A 3G1LA 2H6BA 1LUJB 1KU2A 1MH3A 2BY0A 1TP4A 2Q0OA 3BTLA 3ZMTA 4DNCA 2XUBA 3CCMI 4PJLA 3A01A 2CFOA 2TCTA 3GZ6A 4HNTA 1E0EA 3BOQA 2XASA 4V2FA 3BCBA 4YFNF 3MEXA 3GXOA 3C2GA 3PSFA 3RSNA 5EF6A 2NVXJ 3FM3A 2CW7A 1PP7U 2CQKA 4RB2C 3H1CA 1KZHA 2HZTA 3F21A 5TJJA 1QHGA 5FB2A 3ECHA 3EYIA 2ZCWA 4D7NA 1LJ9A 2RN7A 4XKVA 1VQ4I 2F5VA 1BL0A 1OISA 3BR0A 1DU6A 2MBFA 3I53A 1N75A 3LSKA 3G1MA 1P4XA 4RGRA 3O2PE 2KRCA 5F27A 3IC7A 4GYGA 4BJ6C 1IV6A 2GXAA 1W36D 2VL8A 1Y1VJ 5E18F 3TOAA 4DQ2A 2PX9A 4M6XA 3U2RA 2Z16A 3CCLI 3L1PA 1FLIA 3M9AA 4RA2A 1SFUA 1OCOH 4ZDPA 2FNAA 3EYYA 2CUZA 3I64A 2HOSA 5GAGJ 5JI6A 3HSEA 3RKWA 1A5JA 3WTSC 4LITA 2X6WA 3KCCA 3FIWA 1X1AA 4PK4A 1J59A 3OS1A 2CQQA 1WJCA 2A68F 2Q1ZB 4UVCA 4ENNA 1ETWA 2ZSHB 1UG2A 4RM2A 2HYJA 1LQ1A 4IHXA 1I6HJ 3CCSI 5IY5H 1R4MB 1MD0A 1W1WE 1Z6RA 3VOEA 3W6KB 4EJVA 3LSPA 1MMDA 4BXFA 4ON0A 4CYCA 4DJAA 4WWCA 2HQAA 4CA0A 1ODDA 3M8FA 1XTAA 3A02A 3IL2A 1S8NA 4CCLA 2O8XA 3WHCA 3S1MJ 1ZAOA 2EFPA 2GZWA 4ZYHA 2M8EA 4ASNA 2A61A 1TT0A 4ZZLA 1MH4A 1J75A 3F8MA 2GWRA 3F6VA 4L0YB 4AM3A 2UXNA 1MJAA 4EGZA 2LY1A 3HHHA 3LQQA 1MBKA 4MEYF 5DCMB 2D2WA 4AYBN 4Y17A 2GXGA 3CMMA 1J2XA 2D1HA 2VQCA 2W57A 3C1DA 2QQAA 4PGHA 2R7ZJ 3E6DA 5HDKA 1IN6A 2YSRA 4HV5A 3DBRB 4A3JJ 2A69F 1XN7A 4I0BA 2QVOA 2E1MC 3I4PA 4N0BA 1MMAA 1ZGWA 3K2ZA 3MZ8A 1YIJI 2VKHA 3F8CA 2MGQA 1WCMJ 4I76A 1BN5A 4ZYGA 4MHGA 3PIOF 1Q1VA 5CYVA 1YRNA 4HYEA 2VKEA 3OIOA 3HOXJ 4A12A 4KYWA 1MNEA 3QU6A 2LK2A 4FETA 2HYFA 2R7WA 2R7TA 2EINH 4XN0A 3RCOA 2F6CA 2QF7A 3KEOA 1GDTA 4B4CA 3AG1H 1MMSA 1FP1D 4ETSA 5GTIC 2BY3A 3KYDB 4IRHA 1O3QA 3MFKA 2FD5A 4UUSB 2JA5J 4G7HF 2HFHA 2CFXA 4AIHA 3KP4A 1GUUA 2CWEA 4Y33A 1LE8A 1HSJA 1IC8A 2CUJA 2RNGA 2OBPA 2BW3A 2QWWA 3HXLA 3TDZC 5K7ZA 5KHDA 2EIMH 1FBQA 3CDLA 2ME0A 5B3SH 2RQPA 3T1BA 4UXNA 5CVRA 4IPAA 2MH9A 2PQ8A 4YEJA 3OOPA 1ITYA 2R7VA 1VQKI 2VBYA 1OYIA 4RGSA 3CMYA 1WRJA 1V55H 3QPSA 1E3PA 4HNVA 5KNLA 4L18B 3HOYJ 3WU2C 2HDCA 3I59B 3HKZA 1WJ5A 4M9SA 3I56I 3BG3A 4S0HB 4BE2A 3CC7I 2V9KA 4RB0A 3NAUA 3V8LA 2X48A 1JHHA 3HYIA 3GMEA 1OJLA 1IXSB 1LEAA 1W0UA 2AHQA 2DMPA 5F6FA 5HOOA 3S3NA 3G3ZA 4HRIA 4HAMA 2L2OA 1D1CA 2B0LA 5L3BA 4A6DA 1R36A 2DJNA 4WF2A 4DW6A 5M5WJ 3DBLB 4ITVA 4IOCF 2KQRA 1JUSA 1KGSA 1OPCA 2R7UA 2FU4A 4ENMA 3CUOA 1K83J 4PJNA 1U8BA 1IF1A 2FUG2 3JRDA 1VF9A 1HDDC 3TL4X 2O6GE 1DP3A 4EVIA 2EV5A 2M4KA 2JPCA 1JUMA 2R7SA 2IJLA 3RQ4A 4RAGA 3BR3A 4LGWA 3KIOA 2OAZA 2NNYA 2O3FA 1VQ6I 1QVTA 1F9NA 3D0SA 5ICEA 1D5VA 3SZTA 4ESFA 2OTLI 1V3FA 1MBFA 4M71A 2ZMEA 1HW5A 5JHUA 1OCCH 2VJIA 2VT3A 3G2BA 4ZJZA 2L7FP 5BQTA 1HA8A 1ZG5A 2M34A 4IJAA 3TEDA 5HS9A 2NRAC 2YX7A 3OOUA 4LK1F 2L7KA 1YTYA 1JT6A 3S2WA 2A05A 2X4HA 4C3IJ 3IKTA 1ZRFA 2DA4A 1BI3A 2V6CA 3RPUA 3PQJA 4MEXF 3JR9A 2FOKA 1V5FA 3Q3SA 4M74A 4ZZDA 2B9SA 4BS9A 1AU7A 4B1RA 2P7VB 5LGTA 4O5VA 3JRGA 3J7AO 1QVUA 2FMYA 2RGVA 2JT1A 3S2HJ 2DFHA 2WAFA 4XRFA 3WGGA 1SFOJ 3G71I 3DLLF 4LD5A 4UHTA 4PDKA 5E1WA 1WH5A 2EPFA 2N8GA 1XGOA 3B02A 5FRNA 2IP2A 2OQRA 2L01A 1G59A 2YX4A 1IRGA 3OYEA 1W4MA 3K4LA 3IRQA 2ZFWA 1RPWA 2IW5A 3CLOA 3GTJJ 1RI7A 2DA3A 1MNMC 1RRJA 3DKXA 3LNQA 2LVSA 3CCUI 2L54A 1ZRDA 2VQLA 3BROA 3V7CA 2DA6A 3R4KA 2CV2A 2QQ9A 1GV2A 2Q2EA 2Y0MA 3HOWJ 3K1MA 1SFEA 1OYYA 4NUBA 5CVUA 2XRLA 3CUQB 5J1UA 5JLXA 2DMUA 1FNNA 3VYRB 5FLMJ 2DFIA 3JRIA 3GTLJ 4A3LJ 4XK4A 2W24A 2CJJA 4AC0A 1XPXA 1JKOC 2JA7J 1BIAA 4Q5SF 1QRYA 2H1LA 1NH3A 2EJRA 5DYMA 3IHUA 2WWYA 1UCRA 3LWFA 2KDZA 2X6YA 1GXPA 4IHWA 1S7AA 3U21A 3IAS2 3LSMA 2HKOA 2NVYJ 1D3YA 4WK8F 2RKHA 1Y1WJ 2R4GA 1WJEA 3M7GA 3JTGA 1NK2P 3K4BA 1R5HA 3CLQA 1ZN2A 1IO2A 1KU3A 1V4RA 4I02A 3R0JA 4YFKF 2Y2ZA 4G94A 3BPXA 4OINF 4E7LA 3P9IA 3K10A 3VFZA 3RZOJ 2YU9J 3HRMA 3BJAA 3PFIA 3KP5A 2W4SA 2X6OA 2PJPA 2IVMA 4AIJA 4NHJA 2M87A 4AIKA 1HKQA 4C3HJ 4OIRF 3G4SI 3COAC 1XSXA 1A36A 3F23A 3L09A 1BJAA 1TWCJ 2QKMB 1P9QC 2O7OA 4KISA 2FF4A 3FMQA 1MBJA 1T0FA 1WWXA 4YELA 1ZG1A 3ZMDA 2YU3A 4E4HA 3HOUJ 2GOMA 4MTEA 3CCRI 2CO5A 1USSA 5GPAA 2NOGA 3FHZA 5LHHA 4LIVA 2QGUA 1S5LC 4FQGA 3H5RA 1SANA 3PM1A 4XQFA 2K86A 2J5PA 3E5UA 2E2JJ 1NK3P 1Y8RB 3E5QA 5IT9K 1YE9A 1E3HA 4BXUA 5J47A 3G6EI 1TW3A 4OIOF 2ESHA 5B1AH 3WTVC 3ZP5A 4IKFA 3DEWA 3HHGA 1ZLJA 1TNTA 2VC1A 2ZNZA 3TKYA 2EZIA 2MG4A 3IKVA 2Y9YA 3JCUC 1O7FA 2GIVA 1DPUA 1Z05A 2WADA 4OOIA 3OYAA 1SD4A 4GCVA 1O3TA 4G6TB 2OZ6A 2P6TA 3BT9A 4WXCA 1HW1A 2CGPA 3FF5A 1TL8A 1RUOA 4J00A 4PGGA 3ECOA 1HLVA 1XD7A 3S16J 2ZJ2A 3E1SA 1DGRM 2RNJA 3Q0WA 5E8GA 4B48A 3KEYA 2WTEA 4H4KC 2WAEA 4BY1J 1G3WA 4XM3A 3KZZA 3WE3A 2P8TA 1HOMA 4XIDA 3C7JA 2LKPA 1R23A 3QU3A 4XORA 4XBFA 5J3LA 2R0QC 4M6VA 3FXJA 4EM1A 5J1RA 2X9DA 3IAM2 3K4JA 3CUQC 4RDUA 1WPKA 3ESWB 2FXAA 1G4DA 1SFKA 4MQVA 1Q1HA 3MKLA 3ZMSA 2DPUA 5IYCJ 2K27A 3DKWA 2EV6A 2VI6A 3O3KA 1KYWA 3BG7A 4NQWB 2F5DA 2BVMA 2ZNYA 3KPHA 2XF7A 2G7UA 2JTVA 4AYBA 1F1ZA 1XS9A 4A5MA 3SZGA 3LQRA 2CMPA 5JHFA 5EG0B 2GXBA 3HGGA 5HNFA 3FXUA 2EILH 3ZQHA 3V4GA 1FIPA 1SD7A 1WI3A 3BLYA 3EUHA 3S3OA 4NC8A 3RPUD 2M0MA 2R5YA 3OR1C 1TWAJ 1YS6A 2KKOA 1BI0A 3BJOA 1PP8F 2LY9A 3LSGA 3V8JA 4E7IA 4U0YA 1MMGA 3G73A 1H9TA 2BY2A 2LP0A 4EM0B 2JQ7A 4CYDA 2ZXIA 3HZJA 4XMYA 4DBRA 1CF7B 2CV1A 1B6AA 1Z3XA 3Q0UA 3TQNA 4B8XA 3S32A 3WU1B 2JSCA 4F93B 1Y39A 5IPAA 3ZQIA 2A3SA 2MABA 1JXSA 4XNFA 2R7XA 4P5OA 2NS7A 4LG0B 4I7HA 3U1KA 2E19A 5LLQA 2M3AA 2M9HA 2XIGA 1AKHB 4D0PA 3CMAI 3H0DA 5E8IA 1B1BA 2KRHA 2JRMA 1EA3A 1O4XA 3AFHA 1MJBA 1B72A 2CUFA 1LVAA 3ABLH 2XSJC 1YQAA 1TLHB 2KZVA 1HSTA 5LGNA 2H27A 2IS1A 3WGHA 5H20A 3GUDA 1OCPA 4OMYA 1BA5A 1HQCA 2OV7A 3NEUA 1T56A 2QQ8A 5LHGA 5KK1A 5ED4A 1U6GA 2VQGA 1SAXA 2QBYA 3GTMJ 2JRTA 4JBAA 3HM5A 4P9UA 2LF7A 2RQQA 1BI2A 2OPTA 1TC3C 2JZYA 4FX4A 1RUNA 4IQJA 3JSOA 5F04A 1IJWC 1HCRA 1DQUA 4EJOA 3GFMA 3ZMUA 3UR3C 3K70D 5F1RA 5D8KB 4Y4RA 3OYIA 2V4JC 1V5EA 4HG2A 5HODA 5F08A 4PJMA 3S14J 4CCOA 3L2RA 5ILSA 5KVRA 4LLLA 5DDGA 3BQYA 2R7RA 4AIDA 2DK5A 2XAFA 2G7HA 1KQ9A 4CXFA 5HLGA 3PNTA 4KN7X 4XOTA 3MKZA 2KISA 4J19A 2BOLA 4P1WA 3T5XA 4X6AJ 2GAUA 2CG4A 3ABUA 3S15J 2DQLA 4P9FA 1VQ8I 1DGWY 2E36A 2O5RA 5F1JA 4M73A 4BACA 3ZXSA 5HLHA 1MSEC 4PUSA 2DBBA 2H8WA 2GA1A 2FX0A 3WG7H 4YRVA 3A4CA 2LBFB 2VXZA 2H6CA 3LA7A 4A3IJ 1TBXA 4MFEA 5DUIA 2BYVE 1LEBA 2X1CA 5F0CA 5CJ9A 1JKRC 2BHYA 2V7FA 1IZ1A 3ZQQA 5IOYA 2VUMJ 4BH9A 3H0GJ 3QPLA 2LTPA 5AIPA 4XKBA 5DUKA 1FY7A 1H9GA 3MCZA 4HA8A 4KITB 1JGSA 1MW7A 2GBYA 1QBJA 2XGCA 2HQRA 5L3DA 1VQLI 1S3JA 2XGDA 2Z33A 1FX7A 2LF8A 2VOPA 3HSFA 1RR8C 2PBIA 1X1CA 2BE5F 4PSXA 3PO3J 1ON1A 3VB2A 4B43A 1YHQI 5FLXK 3P7NA 4RM3A 2DCEA 2K40A 2MSYA 4NB5A 3SYTA 1OCTC 5M3FJ 3OL4A 2CW0F 2DAOA 4LMYA 3BG6A 4XONA 1QZZA 5H2FC 1KQ8A 1P7IA 4XLHA 2IPQX 4BQNA 3SDGA 5HVQC 1Y0UA 2HNHA 5KAIC 1W0TA 1GXQA 3HRUA 2JA2A 1PDNC 2NS0A 1R1UA 4OU0A 4L5IA 1X4PA 2QENA 3VPRA 2MYSA 3ONQA 4XN3A 3ULQB 4MFDA 3W2VA 1UZCA 3GTGJ 4CH7A 1FMWA 2XKOA 2ELHA 1LNWA 4G7OF 4B3XA 4XSZF 1LB2A 1X3UA 1RC9A 4N4NB 2IEKA 2GIZA 2ZBKA 1U5TA 3H3ZA 4O3MA 2JJ7A 1MZBA 2O9LA 5B66C 3IUOA 1SAUA 3KZIC 4XL9A 4EATA 4ENKA 4AVPA 4E70A 5IT9Z 3DCFA 1PUEE 3ZMVA 1DU0A 4G6DA 4EGYA 2PMHA 2IS2A 1YW9A 5BNGA 2FNPA 3SXYA 3MD2A 5DS9A 5E1ZB 2BGCA 1RKTA 3BY6A 3KLNA 2Y31A 4KJZA 3VSKA 2V1XA 3BWGA 5HLIA 2DOFA 1B4AA 1R7JA 3CMEI 1FYLA 5DD4A 4XRMA 5A2QK 1Z6TA 4E7JA 3RIRA 3CP8A 2Y75A 3MZHA 2QSFX 3TW7A 3HG9A 3RQIA 4M3DA 5IOZA 3VYSB 4QTRA 1YJ9I 1A6QA 2LG4A 3HGYA 5BS6A 1IRXA 3FXLA 4A93J 3ABKH 5LGUA 1HC8A 5E3OA 4PCQA 3BDDA 4R1HA 1W36C 3I59A 4IRIA 2MW8A 1JT0A 4IHTA 1A6IA 2BV6A 1REPC 2FOWA 1B59A 4V2GA 1R00A 4L0ZB 1G3YA 5EEAA 4LB6B 4NBQA 1X1DA 1H89C 1I1GA 2UXXA 3HC7A 2BHZA 2K4BA 2OD5A 3DWLE 5D8LB 1FYMA 2LMDA 3WTYC 2DW4A 3F8FA 1L0OC 1NTCA 2L9NA 2DYSH 3JAMK 4I09A 4AU7A 2BXZA 1ERDA 1S7EA 2LR8A 3VEPA 2X85A 5FROA 4HLXA 2HOTA 3IWFA 2E34A 2HU9A 2VJ5A 5GPCA 3OYKA 2IGOA 5DD8A 3E3VA 1FT9A 1QGPA 3M8EA 2HQ5A 2IGKA 1FOKA 3DTKA 4HEA2 4QPOA 3SFZA 3TMOA 2K4JA 4F3QA 3MMYB 1YS7A 4XICA 1G8XA 4BUPA 4DYRA 1ZELA 1Z91A 3ZN1A 4D7MA 3LA2A 4BEHB 3RYRA 3HTSB 3ELKA 2DDBA 3GF2A 4ESBA 5GAEJ 2FE3A 2D1VA 3CJQB 2ZC2A 1ZLKA 4FT8A 3FKIJ 1X2MA 3U9GA 1PYVA 2W00A 1H8AC 3C3WA 1U9OA 2HGCA 5HDNA 1I3AA 5L3GA 4WX9A 1XX5A 4DGWB 5IYBJ 3TO7A 1T08B 2VOOA 1K79A 2E1OA 1FSEA 4KICA 2L4AA 2E7WA 2DT5A 2VKDA 5M5YJ 3H36A 3MAJA 3WTZA 1HF0A 2DN0A 4EJUA 3IH3A 5K5OA 4S04A 1KONA 4CCMA 3JRAA 1BC8C 1R6RA 2DT6A 1K7AA 2AO9A 5FO5A 3L2CA 3DF8A 1T39A 3M07A 3K4KA 5BPIA 3PUBA 2NXNB 3QQAA 4A0YA 4A3KJ 2NAZA 4F55A 3GFIA 3HBLA 1X1PA 2NYXA 4I99C 1GHCA 5CVJA 1FOWA 2HOAA 1T95A 3ZQCA 1O3SA 3K6GA 1FIAA 4MIMA 5E3MA 3B73A 2ACJA 2HEOA 2M7BA 2Y48A 5FFZA 2IRFG 1IN4A 4PFOA 4CHUA 1XSVA 4HZFA 4LG3A 4G9YA 2EH3A 3A0BC 4KNYA 3AKZA 3QPTA 1MDMB 4I0AA 5J4YA 1IN8A 4II2A 3ZPLA 5J1YA 2F4OB 4Z2YA 2STWA 2B7EA 1DUXC 2YUSA 3ZQLA 1KYZA 3VYUB 3LAJA 1O3RA 2BVLA 2HDWA 2XHKA 2EZKA 1IXCA 3H9JA 4U88A 1OQYA 4B47A 3J81Z 4ZYDA 1TQIA 3BR6A 5HNHA 2M4GA 1J7KA 3N4MA 1ZQ3P 1Y8QB 5DM7F 4HX4A 1J5YA 4QSHA 3S93A 1YRNB 2CRGA 2P81A 3S8PA 4MGRA 3FZVA 1FEXA 3QAHA 1P2FA 2AXTC 1FYKA 2DMNA 1IW7F 1B8IA 3DPTA 4F7ZA 4HV6A 4JQFA 5FLXZ 4KMFA 2EFQA 4L9TA 4RGUA 3CF5F 2RV8A 5EGOB 4C30A 4X1EA 4ZYEA 1R1TA 3EDPA 3N97A 1ZREA 3ERMA 5FD6A 2IGNA 4RAZA 4I98B 3SFIA 4A6EA 3FMSA 2HVSA 4CSWA 4A5NA 4PSWA 3E6BA 1EH7A 4FCYA 3ABMH 1FMVA 1TQMA 5LRRA 4YIRX 3ZQGA 2L7ZA 4UVBA 2BW3B 1ENHA 5FKMA 1FOYA 5EYRA 4C2MJ 3P9CA 5LFAA 2VQHA 4JX4A 3OYFA 3V7SA 3DQVC 5K7HA 2NVTJ 4Y52J 1FPQA 4EJWA 1L3LA 2V1UA 1QA6A 3VSLA 1BI1A 2ELJA 4LLGF 3X2QH 3ZMZA 2MD5A 3F8NA 3DU5A 3HEFA 1ZR4A 2BZTA 2E35A 4JYKA 1GV5A 3HRTA 2E2HJ 4E7KA 1XB4A 2A6TA 2DT7B 3A1YA 1TNSA 3RZDJ 1ZK8A 2KHMA 4KUMA 4KIGA 4GRIA 1RETA 4EJTA 1WFXA 1WGXA 2JN6A 2A6EF 1SC7A 2G0EA 1CGPA 4IRGA 2M0CA 1MMNA 5AONA 2R7FA 1T8IA 3M1CA 3D5LA 1TT5B 5A2QZ 2LYCA 1ETYA 2XAJA 5CKTA 5CVIA 4BBRJ 2I10A 2IA2A 1UHMA 2LNBA 2VASA 4ZTFA 1IRZA 3M4OJ 3DKYA 1ACIA 3HOZJ 1HKTA 1PVEA 1X2NA 1W5TA 4IOAF 3E5XA 3S1QJ 1WJDA 1YITI 2FA5A 1EV7A 3H3UA 2XPVA 1EH6A 2IA1A 2ECCA 3FXRA 3NWTA 3HL2A 3I0TA 2XGXA 3D5RC 5DCFA 1N77A 1BR4A 4DIQA 5C44J 1JHFA 3SJMA 3I58A 4BJTA 2DOEA 1LPQA 3HOVJ 3KETA 4HQMA 4AD9A 2GM4A 5EDNA 3V42A 2IS4A 5D5XB 1UAAA 4KA4A 3JAMZ 1D0YA 2QZ8A 4M9ZA 4Y13A 3IWZA 1IXRC 2EB7A 2HPIA 2L3DA 2KFDA 3SQNA 3BZ6A 3FMRA 3M8JA 3MVPA 1PUFB 1ETVA 2EZLA 2K9QA 2LC2A 4PJ0C 3ROUA 4V19K 1K78A 4IZZA 3KP2A 5HDGA 1IRFA 3BJ6A 4DYQA 4M9XA 3HPGA 2VKVA 2ZFUA 4GYIA 4QLCU 1I50J 5FKNA 3JRHA 3TO9A 3QPHA 4UB6C 3W6JB 1BBYA 4A3EJ 3ASOH 9ANTA 1EH8A 2VE8A 4OAYA 3OYNA 3LSTA 4K2EA 1BIBA 1CF7A 2VIXA 2K9SA 2ZO4A 4OIPF 1LFPA 3GTPJ 1BW5A 4JOMA 4BQOA 5D5VB 4M3GA 1S72I 2FBIA 3WODF 2VODA 4KT5C 2UWMA 2K3PA 2VJJA 5C4XJ 4HDVA 3CJNA 1F43A 1P6RA 1X19A 2K9NA 1WSUA 3FK6A 3WG9A 1TWHJ 1AKHA 4AWXB 3TGNA 3K69A 1ZG3A 5BOXA 4H0EA 1R22A 3K1NA 4Y15A 1A31A 1OR7C 1Z77A 4ZC3A 3I4MJ 3LFKA 1EF4A 2R5ZB 3CDIA 1V5GA 2Z5UA 3W3CA 2FSWA 4BQAA 2YPRA 4HF2A 1R58A 3BQZA 2HDDA 3ZN0A 3U1DA 2PEXA 2Q2EB 4HBLA 5J6XA 1TZLA 4NDLA 4HX8A 1G6NA 2ZJRF 2G9WA 1POGA 4X0GA 4IQ4A 1SD6A 2NOJB 4ABZA 3HUGB 2CQXA 2CQNA 2V1DA 3TOBA 1XC5A 2GA2A 3V8KA 3LMMA 2EA2A 4G12A 2Z2SB 2J5OA 3L9FA 2EFOA 5HS8A 2B63J 1D0ZA 1AA7A 2JA6J 3MN2A 1QPMA 2IXSA 3MQ0A 3I4NJ 1XSDA 2F5FA 1ZARA 2VB6A 1SEUA 5HLTA 2KJBA 1P92A 5D4RA 2HWVA 2K9LA 1SD5A 4C2TA 4PJJA 2UZKA 1Z67A 2OF7A 2VPLA 3I3LA 4Q47A 2L4MA 2A5YB 3M3YJ 5C4JJ 3REOA 5GAHJ 2LREA 4UV9A 2X1DA 1WJFA 2M8GX 5L3CA 2HTSA 5ILVA 3O8HA 1JKQC 2JMWA 3DPUA 1NG7A 2MD0A 4N4OB 5LD2C 3SEZA 5LEKA 3S1RJ 2WV1A 2LKXA 3HOSA 2LBFA 1G3TA 3R60A 3I54A 2P5VA 3PNVA 4CDGA 2KIFA 1R4NB 3LSHA 1SVMA 2EFWA 3LSRA 2XROA 4UNOA 3KLOA 4N9IA 2FJ1A 3WTWC 1BM9A 4DYCA 4MTDA 1YG2A 3PUFA 3OSFA 3OYMA 1O7LA 1XCBA 3H5NA 3BG9A 3FISA 4KN4X 4A3DJ 1QU3A 3W6VA 2DOAA 3HIFA
chains in the Genus database with same CATH topology
4S0HB 3BG5A 3DCFA 2LD5A 3NAUA 5F0HA 5M3MJ 1DU0A 1JUPA 2X48A 3GTQJ 3GBGA 5EG0A 1OJLA 5BNGA 1B8IB 5DS9A 1RKTA 1W0UA 2Y31A 2H8RA 2AHQA 2DMPA 2XSDC 4MO7A 2DJNA 4DW6A 4XRMA 5M5WJ 3S1NJ 3B6CA 5E3LA 1JUSA 1ETKA 1JJ6C 3TW7A 3RQIA 4M3DA 5IOZA 4A69C 4QTRA 3HGYA 1K83J 1U8BA 4A93J 1GT0C 2H1KA 5FLVA 3JRDA 2ME6A 1VF9A 5E3OA 1HDDC 2MW8A 4A3GJ 1JT0A 1A6IA 4IHYA 1JUMA 2VPRA 1RKWA 4V2GA 2DMTA 3BR3A 5EEAA 1QVTA 3O8GA 4W1UA 2EBIA 1H89C 3JRBA 1MBFA 4JP0A 2PMZN 1NTCA 1S7EA 2LR8A 4BKXA 1H88C 5F0FA 2CUEA 2L7FP 2HOTA 2M34A 3TEDA 3OOUA 5GPCA 4JX6A 2R92J 1MBEA 1JT6A 4IEJA 4C3IJ 3BTIA 5C3EJ 2E2IJ 2DA4A 3NARA 2ELKA 3IH2A 2HQ5A 2R5YB 4A3MJ 3JR9A 3GTOJ 3Q3SA 4XICA 4DYRA 3E7LA 5EZGA 2M2EA 4D7MA 4A3CJ 4Y7NJ 3HB9A 4C3JJ 1AU7A 4B1RA 1MBHA 3JRGA 3RKQA 1QVUA 1IUFA 3HKZN 3S2HJ 1FJLA 1SFOJ 3FKIJ 2TRTA 1X2MA 1ETQA 2Y30A 3S17J 1H8AC 3F0CA 1WH5A 1U9OA 5FKLA 3ZOBA 2N8GA 4FE4A 3G1OA 5IYBJ 2XB5A 1RPWA 2E1OA 2DA1A 3GTJJ 1MNMC 2DA3A 3LNQA 2LVSA 5M5YJ 1LFBA 1HF0A 2R93J 2JK3A 2DA6A 2DN0A 1GV2A 5M5XJ 3IH3A 1ZTRA 3HOWJ 1BJZA 1OFCX 5GP9A 1B72B 3JRAA 2XRLA 2AO9A 5J1UA 5JLXA 2DMUA 5FLMJ 2DA7A 3CCYA 1HDPA 3JRIA 3GTLJ 4A3LJ 4XK4A 2JA7J 2CJJA 4AC0A 1JKOC 1WH7A 4D5CA 3QQAA 3IH4A 1QRYA 4A3KJ 3HBLA 1IGNA 1IDZA 2L7MP 3IV5A 2KDZA 2W48A 2HOAA 3ZQCA 4IHWA 2Y9ZA 4UUSA 1FIAA 2NVYJ 4MIMA 5E3MA 2LFBA 2IBDA 1Y1WJ 3A03A 3JRFA 4D5FA 1ZR2A 2NS8A 1NK2P 2ID3A 2EH3A 4UUTA 5IYDJ 2Y2ZA 3C2BA 4FE7A 2XB0X 5J1YA 3RZOJ 5FJ8J 2YU9J 1BW6A 1D5YA 1TWGJ 1F36A 2X6OA 3B6AA 2YUSA 4C3HJ 3ZQLA 1VI0A 4I6ZA 1TWCJ 2EZKA 4XRSG 2O7OA 1X58A 1MBJA 2NVQJ 3BR6A 3HOUJ 3K2AA 4DZPA 3D1NI 1ZQ3P 1ORKA 3LSJA 5GPAA 1UMQA 2NOGA 4M3BA 3JRCA 4QSHA 5E3NA 1YRNB 2CRGA 2P81A 4BXXJ 1FEXA 1JJ8C 1SANA 3PM1A 1JKPC 2DMNA 1B8IA 2E2JJ 4B3AA 1NK3P 2O8KA 1CQTA 2DTZA 5EGOB 1ETXA 2EQRA 2IAIA 4X1EA 2JA8J 2XPWA 4MLOA 1K61A 1VFCA 3DEWA 2ECBA 3SFIA 5IP9J 2EZIA 2MG4A 1T33A 1RR7A 2LLKA 2Y9YA 1JTXA 1IDYA 2DMQA 2D5VA 4FCYA 4EEFG 1FTTA 3ZQGA 2RAEA 3BT9A 2L7ZA 3CQZJ 1ENHA 5FKMA 5EYRA 1HLVA 4C2MJ 3BR5A 4JX4A 1JGGA 3Q0VA 3S16J 3Q0WA 3A01B 2GLOA 2HI3A 5JLWA 5K7HA 2NVTJ 4BY1J 4Y52J 5DTDA 4LOCA 1HOMA 4XIDA 2XGEA 5J3LA 4L5EA 2R0QC 4M6VA 3HEFA 5J1RA 2X9DA 1UHSA 1ZR4A 3BTJA 4RDUA 1WPKA 4JYKA 1GV5A 2E2HJ 4W97A 3BTCA 3MKLA 3ZQFA 5IYCJ 3RZDJ 5FKOA 1ZK8A 1I3QJ 1RETA 2VI6A 1RESA 1WGXA 2JN6A 3BR1A 3PO2J 5EGOA 2G0EA 2KT0A 2L9RA 4GFBA 2M0CA 1XS9A 5IP7J 4FTHA 1LFUP 5EG0B 1U9NA 3H3VK 3HGGA 3ZQHA 1ETYA 3GTKJ 1FIPA 1WI3A 4BBRJ 3LOCA 2I10A 4IHVA 2R5YA 1TWAJ 4JX5A 3G1LA 1IRZA 2WAQN 3M4OJ 1MH3A 3BTLA 2L0KA 2LY9A 3LSGA 3HOZJ 1X2NA 3A01A 3S1QJ 2TCTA 2Y0SN 4RBOA 4V2FA 2LP0A 2XPVA 2ECCA 4BY7J 5EF6A 2NVXJ 3WHBA 3Q0UA 5FKKA 5C44J 1AHDP 4D7NA 3SJMA 4CYCB 5IPAA 3ZQIA 3HOVJ 4A3FJ 2HXIA 2NS7A 1BL0A 2GM4A 3BR0A 5EDNA 1DU6A 2E19A 1IG7A 3G1MA 5F27A 1G2HA 2M9HA 1IV6A 3TP3A 1APLC 1AKHB 1Y1VJ 1P7JA 1JTYA 1ZKGA 3L1PA 1O4XA 1B72A 2CUFA 3MVPA 1R9TJ 2HOSA 1PUFB 3TW6A 1ETVA 2EZLA 2K9QA 1A5JA 1OCPA 1BA5A 1T56A 3FIWA 4M3EA 2DA5A 4DYQA 2CQQA 5EZHA 1ETWA 3GTMJ 2VKVA 3HM5A 1Z0XA 1UG2A 1I50J 5FKNA 2OPTA 3JRHA 4A3BJ 2HYJA 1TC3C 4A3EJ 3FK7A 1ETOA 4IHXA 9ANTA 5F04A 1I6HJ 1IJWC 1HCRA 2CU7A 2QCOA 4QIWN 2K9SA 3LSPA 2ZB9A 3GTPJ 1BW5A 5HODA 5F08A 3S2DJ 4M3GA 4CYCA 3S14J 3A02A 3WHCA 3K7AJ 5C4XJ 3S1MJ 3BQYA 1F43A 1MH4A 2K9NA 4M3FA 3FK6A 1TWHJ 3HDDA 1AKHA 1MSFC 2WB1N 4J19A 1MBKA 4AYBN 4X6AJ 1LE8B 3S15J 1Z77A 3I4MJ 2R7ZJ 1EF4A 2R5ZB 5F1JA 1PUFA 4A3JJ 3TP0A 1MSEC 2FX0A 3BQZA 2HDDA 4XRSA 4A3IJ 4MFEA 1ZGWA 5F0CA 3UKGA 1JKRC 2MGQA 1MBGA 1WCMJ 4I76A 4NDLA 1POGA 1Q1VA 2XPUA 4ABZA 1YRNA 5IOYA 2CQXA 2VKEA 2VUMJ 3OIOA 2JWTA 3H0GJ 3QPLA 2LTPA 3HOXJ 2LK2A 1XC5A 2HXOA 2DA2A 2ID6A 4G12A 3OSGA 2B63J 1FTZA 2FQ4A 2QF7A 2JA6J 3MN2A 1GDTA 4B4CA 3I4NJ 2GBYA 2XGCA 4DZJA 2XGDA 1E3OC 2FD5A 1GVDA 4UUSB 3PO3J 2JA5J 1VNDA 4FISA 1U78A 2MSYA 2K40A 2OF7A 1OCTC 5M3FJ 3M3YJ 5C4JJ 1GUUA 1LE8A 1IC8A 1P7IA 3BR2A 2M8GX 3SDGA 5K7ZA 3O8HA 1JKQC 2JMWA 1W0TA 2R5ZA 3CDLA 2ME0A 1XG1A 2EZHA 3VPRA 1TWFJ 2WV1A 3S1RJ 2LKXA 4AUXA 4MFDA 3GTGJ 1ITYA 3LSRA 3CMYA 2FJ1A 2IEKA 5IP6A 4HNVA 3QPSA 3HOYJ 5K7FA 4DYCA 1QPIA 2YS9A 2JJ7A 3JREA 3OSFA 2O9LA 4A3DJ 3BG9A 3FISA 2COBA 4BBSJ 3BG3A 3W6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0H B;  3BG5 A;  3DCF A;  2LD5 A;  3NAU A;  5F0H A;  5M3M J;  1DU0 A;  1JUP A;  2X48 A;  3GTQ J;  3GBG A;  5EG0 A;  1OJL A;  5BNG A;  1B8I B;  5DS9 A;  1RKT A;  1W0U A;  2Y31 A;  2H8R A;  2AHQ A;  2DMP A;  2XSD C;  4MO7 A;  2DJN A;  4DW6 A;  4XRM A;  5M5W J;  3S1N J;  3B6C A;  5E3L A;  1JUS A;  1ETK A;  1JJ6 C;  3TW7 A;  3RQI A;  4M3D A;  5IOZ A;  4A69 C;  4QTR A;  3HGY A;  1K83 J;  1U8B A;  4A93 J;  1GT0 C;  2H1K A;  5FLV A;  3JRD A;  2ME6 A;  1VF9 A;  5E3O A;  1HDD C;  2MW8 A;  4A3G J;  1JT0 A;  1A6I A;  4IHY A;  1JUM A;  2VPR A;  1RKW A;  4V2G A;  2DMT A;  3BR3 A;  5EEA A;  1QVT A;  3O8G A;  4W1U A;  2EBI A;  1H89 C;  3JRB A;  1MBF A;  4JP0 A;  2PMZ N;  1NTC A;  1S7E A;  2LR8 A;  4BKX A;  1H88 C;  5F0F A;  2CUE A;  2L7F P;  2HOT A;  2M34 A;  3TED A;  3OOU A;  5GPC A;  4JX6 A;  2R92 J;  1MBE A;  1JT6 A;  4IEJ A;  4C3I J;  3BTI A;  5C3E J;  2E2I J;  2DA4 A;  3NAR A;  2ELK A;  3IH2 A;  2HQ5 A;  2R5Y B;  4A3M J;  3JR9 A;  3GTO J;  3Q3S A;  4XIC A;  4DYR A;  3E7L A;  5EZG A;  2M2E A;  4D7M A;  4A3C J;  4Y7N J;  3HB9 A;  4C3J J;  1AU7 A;  4B1R A;  1MBH A;  3JRG A;  3RKQ A;  1QVU A;  1IUF A;  3HKZ N;  3S2H J;  1FJL A;  1SFO J;  3FKI J;  2TRT A;  1X2M A;  1ETQ A;  2Y30 A;  3S17 J;  1H8A C;  3F0C A;  1WH5 A;  1U9O A;  5FKL A;  3ZOB A;  2N8G A;  4FE4 A;  3G1O A;  5IYB J;  2XB5 A;  1RPW A;  2E1O A;  2DA1 A;  3GTJ J;  1MNM C;  2DA3 A;  3LNQ A;  2LVS A;  5M5Y J;  1LFB A;  1HF0 A;  2R93 J;  2JK3 A;  2DA6 A;  2DN0 A;  1GV2 A;  5M5X J;  3IH3 A;  1ZTR A;  3HOW J;  1BJZ A;  1OFC X;  5GP9 A;  1B72 B;  3JRA A;  2XRL A;  2AO9 A;  5J1U A;  5JLX A;  2DMU A;  5FLM J;  2DA7 A;  3CCY A;  1HDP A;  3JRI A;  3GTL J;  4A3L J;  4XK4 A;  2JA7 J;  2CJJ A;  4AC0 A;  1JKO C;  1WH7 A;  4D5C A;  3QQA A;  3IH4 A;  1QRY A;  4A3K J;  3HBL A;  1IGN A;  1IDZ A;  2L7M P;  3IV5 A;  2KDZ A;  2W48 A;  2HOA A;  3ZQC A;  4IHW A;  2Y9Z A;  4UUS A;  1FIA A;  2NVY J;  4MIM A;  5E3M A;  2LFB A;  2IBD A;  1Y1W J;  3A03 A;  3JRF A;  4D5F A;  1ZR2 A;  2NS8 A;  1NK2 P;  2ID3 A;  2EH3 A;  4UUT A;  5IYD J;  2Y2Z A;  3C2B A;  4FE7 A;  2XB0 X;  5J1Y A;  3RZO J;  5FJ8 J;  2YU9 J;  1BW6 A;  1D5Y A;  1TWG J;  1F36 A;  2X6O A;  3B6A A;  2YUS A;  4C3H J;  3ZQL A;  1VI0 A;  4I6Z A;  1TWC J;  2EZK A;  4XRS G;  2O7O A;  1X58 A;  1MBJ A;  2NVQ J;  3BR6 A;  3HOU J;  3K2A A;  4DZP A;  3D1N I;  1ZQ3 P;  1ORK A;  3LSJ A;  5GPA A;  1UMQ A;  2NOG A;  4M3B A;  3JRC A;  4QSH A;  5E3N A;  1YRN B;  2CRG A;  2P81 A;  4BXX J;  1FEX A;  1JJ8 C;  1SAN A;  3PM1 A;  1JKP C;  2DMN A;  1B8I A;  2E2J J;  4B3A A;  1NK3 P;  2O8K A;  1CQT A;  2DTZ A;  5EGO B;  1ETX A;  2EQR A;  2IAI A;  4X1E A;  2JA8 J;  2XPW A;  4MLO A;  1K61 A;  1VFC A;  3DEW A;  2ECB A;  3SFI A;  5IP9 J;  2EZI A;  2MG4 A;  1T33 A;  1RR7 A;  2LLK A;  2Y9Y A;  1JTX A;  1IDY A;  2DMQ A;  2D5V A;  4FCY A;  4EEF G;  1FTT A;  3ZQG A;  2RAE A;  3BT9 A;  2L7Z A;  3CQZ J;  1ENH A;  5FKM A;  5EYR A;  1HLV A;  4C2M J;  3BR5 A;  4JX4 A;  1JGG A;  3Q0V A;  3S16 J;  3Q0W A;  3A01 B;  2GLO A;  2HI3 A;  5JLW A;  5K7H A;  2NVT J;  4BY1 J;  4Y52 J;  5DTD A;  4LOC A;  1HOM A;  4XID A;  2XGE A;  5J3L A;  4L5E A;  2R0Q C;  4M6V A;  3HEF A;  5J1R A;  2X9D A;  1UHS A;  1ZR4 A;  3BTJ A;  4RDU A;  1WPK A;  4JYK A;  1GV5 A;  2E2H J;  4W97 A;  3BTC A;  3MKL A;  3ZQF A;  5IYC J;  3RZD J;  5FKO A;  1ZK8 A;  1I3Q J;  1RET A;  2VI6 A;  1RES A;  1WGX A;  2JN6 A;  3BR1 A;  3PO2 J;  5EGO A;  2G0E A;  2KT0 A;  2L9R A;  4GFB A;  2M0C A;  1XS9 A;  5IP7 J;  4FTH A;  1LFU P;  5EG0 B;  1U9N A;  3H3V K;  3HGG A;  3ZQH A;  1ETY A;  3GTK J;  1FIP A;  1WI3 A;  4BBR J;  3LOC A;  2I10 A;  4IHV A;  2R5Y A;  1TWA J;  4JX5 A;  3G1L A;  1IRZ A;  2WAQ N;  3M4O J;  1MH3 A;  3BTL A;  2L0K A;  2LY9 A;  3LSG A;  3HOZ J;  1X2N A;  3A01 A;  3S1Q J;  2TCT A;  2Y0S N;  4RBO A;  4V2F A;  2LP0 A;  2XPV A;  2ECC A;  4BY7 J;  5EF6 A;  2NVX J;  3WHB A;  3Q0U A;  5FKK A;  5C44 J;  1AHD P;  4D7N A;  3SJM A;  4CYC B;  5IPA A;  3ZQI A;  3HOV J;  4A3F J;  2HXI A;  2NS7 A;  1BL0 A;  2GM4 A;  3BR0 A;  5EDN A;  1DU6 A;  2E19 A;  1IG7 A;  3G1M A;  5F27 A;  1G2H A;  2M9H A;  1IV6 A;  3TP3 A;  1APL C;  1AKH B;  1Y1V J;  1P7J A;  1JTY A;  1ZKG A;  3L1P A;  1O4X A;  1B72 A;  2CUF A;  3MVP A;  1R9T J;  2HOS A;  1PUF B;  3TW6 A;  1ETV A;  2EZL A;  2K9Q A;  1A5J A;  1OCP A;  1BA5 A;  1T56 A;  3FIW A;  4M3E A;  2DA5 A;  4DYQ A;  2CQQ A;  5EZH A;  1ETW A;  3GTM J;  2VKV A;  3HM5 A;  1Z0X A;  1UG2 A;  1I50 J;  5FKN A;  2OPT A;  3JRH A;  4A3B J;  2HYJ A;  1TC3 C;  4A3E J;  3FK7 A;  1ETO A;  4IHX A;  9ANT A;  5F04 A;  1I6H J;  1IJW C;  1HCR A;  2CU7 A;  2QCO A;  4QIW N;  2K9S A;  3LSP A;  2ZB9 A;  3GTP J;  1BW5 A;  5HOD A;  5F08 A;  3S2D J;  4M3G A;  4CYC A;  3S14 J;  3A02 A;  3WHC A;  3K7A J;  5C4X J;  3S1M J;  3BQY A;  1F43 A;  1MH4 A;  2K9N A;  4M3F A;  3FK6 A;  1TWH J;  3HDD A;  1AKH A;  1MSF C;  2WB1 N;  4J19 A;  1MBK A;  4AYB N;  4X6A J;  1LE8 B;  3S15 J;  1Z77 A;  3I4M J;  2R7Z J;  1EF4 A;  2R5Z B;  5F1J A;  1PUF A;  4A3J J;  3TP0 A;  1MSE C;  2FX0 A;  3BQZ A;  2HDD A;  4XRS A;  4A3I J;  4MFE A;  1ZGW A;  5F0C A;  3UKG A;  1JKR C;  2MGQ A;  1MBG A;  1WCM J;  4I76 A;  4NDL A;  1POG A;  1Q1V A;  2XPU A;  4ABZ A;  1YRN A;  5IOY A;  2CQX A;  2VKE A;  2VUM J;  3OIO A;  2JWT A;  3H0G J;  3QPL A;  2LTP A;  3HOX J;  2LK2 A;  1XC5 A;  2HXO A;  2DA2 A;  2ID6 A;  4G12 A;  3OSG A;  2B63 J;  1FTZ A;  2FQ4 A;  2QF7 A;  2JA6 J;  3MN2 A;  1GDT A;  4B4C A;  3I4N J;  2GBY A;  2XGC A;  4DZJ A;  2XGD A;  1E3O C;  2FD5 A;  1GVD A;  4UUS B;  3PO3 J;  2JA5 J;  1VND A;  4FIS A;  1U78 A;  2MSY A;  2K40 A;  2OF7 A;  1OCT C;  5M3F J;  3M3Y J;  5C4J J;  1GUU A;  1LE8 A;  1IC8 A;  1P7I A;  3BR2 A;  2M8G X;  3SDG A;  5K7Z A;  3O8H A;  1JKQ C;  2JMW A;  1W0T A;  2R5Z A;  3CDL A;  2ME0 A;  1XG1 A;  2EZH A;  3VPR A;  1TWF J;  2WV1 A;  3S1R J;  2LKX A;  4AUX A;  4MFD A;  3GTG J;  1ITY A;  3LSR A;  3CMY A;  2FJ1 A;  2IEK A;  5IP6 A;  4HNV A;  3QPS A;  3HOY J;  5K7F A;  4DYC A;  1QPI A;  2YS9 A;  2JJ7 A;  3JRE A;  3OSF A;  2O9L A;  4A3D J;  3BG9 A;  3FIS A;  2COB A;  4BBS J;  3BG3 A;  3W6V A; 
#chains in the Genus database with same CATH topology
 1UEL B;  1S29 A;  4Z6Y A;  3FHN A;  3GW2 A;  3AAF A;  2A5W A;  4GO1 A;  1R71 A;  1F5T A;  5M3M J;  1JUP A;  1N78 A;  3GBG A;  2EK5 A;  5CVV A;  2KLO A;  3CCJ I;  6PAX A;  2DFE A;  1LVK A;  1W7P A;  3CZ6 A;  1P4A A;  1VQN I;  2PJR B;  2XF5 A;  3NWS A;  2FBK A;  3TO6 A;  3GEZ A;  1WQ2 A;  4P96 A;  2ZJP F;  3S1N J;  1IAW A;  3B6C A;  2OA4 A;  2IA0 A;  2R7D A;  3BC8 A;  1EKE A;  1ETK A;  4ESJ A;  2VBZ A;  2E5Z A;  4A69 C;  1E17 A;  1U3E M;  2ME6 A;  3GX4 X;  1X1B A;  4FX0 A;  1K4T A;  4ZDO A;  4A0Z A;  2RC4 A;  4IL6 C;  4BDY A;  3K4M A;  1ZRC A;  2HKX A;  4D9J A;  3GWZ A;  2W25 A;  2VPR A;  2DMT A;  1U2W A;  2KZG A;  4KIB A;  2MLG A;  2MH2 A;  2VBW A;  4XLC A;  2BXY A;  2HYG D;  4CIC A;  4EQQ A;  1I6X A;  5B5E C;  3E6M A;  4W1U A;  3I55 I;  2EBI A;  2ETH A;  5D5W B;  2PLY A;  2KDO A;  1IV8 A;  3L2U A;  4JP0 A;  2PMZ N;  4XKC A;  2M1B A;  4BKX A;  1H88 C;  4M6Y A;  2CUE A;  2DI3 A;  1W5S A;  1YOV B;  1FBU A;  3KE2 A;  2DYR H;  1UFM A;  4F91 B;  3ML6 A;  4BYY A;  4RB3 C;  5ICF A;  3OYJ A;  3DPL C;  3K70 C;  3BTI A;  4RLQ A;  5C3E J;  2E2I J;  4XLA A;  2R5Y B;  3CCQ I;  2Z9O A;  4NC6 A;  1BOA A;  3J81 K;  4A3M J;  1WKM A;  1I1S A;  1YLF A;  3WTX C;  3E7L A;  2ADU A;  5EZG A;  2M2E A;  3SEQ A;  3K4N A;  4A3C J;  1GLN A;  3J80 Z;  1S7O A;  2MLK A;  1IUF A;  4Q48 A;  4S05 A;  3R0A A;  2ZJQ F;  2E60 A;  3CF2 A;  1I5Z A;  3DP7 A;  4LFU A;  3GYH X;  5ILU A;  3TDU C;  4BAY A;  1FJL A;  4IHS A;  2W7N A;  2P0W A;  3K0L A;  1ETQ A;  2Y30 A;  2JVH A;  2PI0 A;  1VZ0 A;  3PSI A;  1XMA A;  5DCM A;  3S17 J;  2Z1D A;  3N05 A;  5FKL A;  4YII A;  3T0Y A;  3KYC B;  3G1O A;  2W84 A;  1T0F C;  2XB5 A;  1WVR A;  3F3X A;  1T2K A;  2RRE A;  3ZCO A;  1A04 A;  2R93 J;  2JK3 A;  4BE0 A;  2W82 A;  1Z7L A;  1ZTR A;  1U0J A;  2XVC A;  1BJZ A;  3KP7 A;  2Z3Y A;  2NVU B;  2UUZ A;  1OFC X;  3F22 A;  1B72 B;  3CES A;  4G8X A;  2R7O A;  2DA7 A;  3CCY A;  1HDP A;  5J8F A;  3CO7 C;  1WH7 A;  1TW2 A;  2OUM A;  4D5C A;  2QBY B;  4BNC A;  2VON A;  2XV4 S;  4I2O A;  4BEH A;  1IDZ A;  2L7M P;  1LDJ A;  3D5S C;  3IV5 A;  2W48 A;  2LRD A;  2Y9Z A;  4CO8 A;  4UUS A;  2HQN A;  4Y3O A;  3EET A;  3RTR A;  2LFB A;  4D5F A;  1ZR2 A;  4XKW A;  2ID3 A;  2K02 A;  3IP4 B;  3ZRG A;  3OYB A;  4IVN A;  4L9J A;  3PL8 A;  2F4I A;  3OMY A;  1VQ7 I;  2OJE D;  3CCV I;  3QRF F;  4FE7 A;  2JUC A;  1HW2 A;  2XB0 X;  1D1B A;  2K85 A;  5FJ8 J;  1YYV A;  2R3S A;  2QSH X;  1TWG J;  1F36 A;  1YO5 C;  1R5I D;  2DK8 A;  3OYH A;  4U87 A;  1XCV A;  3SHF A;  4DOZ A;  4BHC A;  2RVC A;  1VI0 A;  1XGS A;  4RS8 A;  4ZDL A;  4ZTJ A;  4ANJ A;  1WHU A;  1Z7U A;  2KP6 A;  4PZJ A;  3OYG A;  4UUV A;  3GVA A;  5F64 A;  3OY9 A;  5DV5 A;  1XMK A;  3T8R A;  2P5L C;  2NVQ J;  3J7Y J;  1MIJ A;  3CO6 C;  2HPM A;  3K2A A;  4DZP A;  2BY1 A;  2HTJ A;  3D1N I;  3LSJ A;  2P4W A;  1UMQ A;  4A2U A;  5DEQ A;  5K5R A;  3JRC A;  1YFH A;  1RIO H;  5JR3 A;  3V7R A;  5J8C A;  4BU2 A;  5E3N A;  1X3Z B;  3RKY A;  2GOX B;  3EUH C;  4BXX J;  1JKP C;  4BJ5 C;  1ZGJ A;  4ZH4 F;  1U8R A;  4R8H A;  4B3A A;  2PMU A;  3ISP A;  4F52 A;  2DPD A;  2DTZ A;  3CTA A;  1ETX A;  2M30 A;  3QWL A;  1W7P D;  4HPQ A;  2XPW A;  2CQ7 A;  2F2E A;  3A0H C;  2CYY A;  1IN7 A;  2OCC H;  4YG2 F;  3FXQ A;  1MDM A;  4N9H A;  1T33 A;  3FXO A;  2VBX A;  1ZYR F;  1J0R A;  3ERE D;  3PQK A;  1IDY A;  2D5V A;  2WA0 A;  4HW0 A;  3GCM A;  3CQZ J;  4LB5 A;  1SVL A;  3Q0V A;  4EV0 A;  2A07 F;  1QQI A;  3A01 B;  3QYB A;  4GXO A;  1N25 A;  4CCJ A;  5JLW A;  1OCR H;  3KFW X;  5GTH C;  5E1X A;  4LOC A;  1XDU A;  2AS5 F;  1QZE A;  2VLA A;  2DLL A;  2NNN A;  5CQG A;  3TBI A;  1I39 A;  2AQE A;  3I9V 2;  1T38 A;  1W5C C;  3RI4 A;  1YJW I;  1Z9C A;  1U5T B;  1F4K A;  3RDI A;  1Y0N A;  3H35 A;  3BTC A;  4W97 A;  3ZQF A;  2KPM A;  2ZXH A;  1I3Q J;  4KT6 A;  1J09 A;  2QM3 A;  3BR1 A;  5EGO A;  2KT0 A;  2VE9 A;  2Z99 A;  3VDX A;  2JUG A;  5CPR B;  3OS0 A;  1FOX A;  1LFU P;  1OYW A;  1T6S A;  4QPQ A;  2F48 A;  3GTK J;  1J9I A;  4JK1 X;  5CQE A;  3HJE A;  4IHV A;  2ZSI B;  1M1E B;  2M7A A;  5ERI A;  3RJP A;  4JX5 A;  4L5J A;  2WAQ N;  2STT A;  3M1E A;  2MC4 A;  1NHA A;  3BZK A;  2L0K A;  3DU6 A;  2QQB A;  1BR2 A;  3J7Z I;  2Y0S N;  3PFY A;  2ESN A;  4RBO A;  1QO0 D;  4HX7 A;  3FDY A;  3CJT B;  4BY7 J;  1XDS A;  2FRH A;  3WHB A;  5FKK A;  1AHD P;  2E5N A;  1OR7 A;  2DU9 A;  4CYC B;  4BE1 A;  3HOT A;  1SFX A;  4NNJ A;  4A3F J;  2HXI A;  2UV1 A;  2DO7 A;  4E7S A;  3RPQ A;  1O57 A;  1IG7 A;  2WC2 A;  1G2H A;  1X4O A;  3TP3 A;  5BMZ A;  1APL C;  3DV8 A;  1V54 H;  1P7J A;  3DTI A;  1OCZ H;  1QZY A;  1S9H A;  1Y6I A;  2KRF A;  1JTY A;  2KIQ A;  1HBX G;  1ZKG A;  3I71 A;  3QOE A;  4HQE A;  1S6L A;  3W2W A;  1R9T J;  2K3F A;  2QEX I;  3WU0 A;  3CUQ A;  3GZN B;  3TW6 A;  3I5U A;  5EEG A;  3PJR A;  2AQF A;  3DTE A;  5TRD A;  4M3E A;  1RZ4 A;  1TTY A;  2DA5 A;  4U0V A;  2F5E A;  1KA8 A;  5EZH A;  1Z0X A;  4MQ9 F;  2XRN A;  3AG2 H;  4A3B J;  2XF6 A;  3HTU A;  3FK7 A;  4XSX F;  1ETO A;  3VOD A;  3MWM A;  4LJZ F;  5D5U B;  3W2A A;  3E97 A;  2QYO A;  1G3S A;  2EIJ H;  2CU7 A;  2DQR A;  3GFJ A;  5TGT A;  2QCO A;  5TIS C;  4QIW N;  2MFZ A;  2QKL B;  2ZB9 A;  1UHW A;  4WXH A;  3DLA A;  3S2D J;  2I8D A;  3NQO A;  4HNU A;  4RB1 A;  3K7A J;  3O6B B;  3JTH A;  3BP8 A;  1VQM I;  1Z21 A;  4M3F A;  4UB8 C;  1VQO I;  1K6Y A;  5EEH A;  5LBQ A;  3HDD A;  2WY7 Q;  1MSF C;  2WB1 N;  5KCM A;  1LE8 B;  3DXJ F;  1U5T C;  3C2H A;  3DFG A;  4OMZ A;  4U0W A;  3K9T A;  3K1P A;  1OLT A;  2BBY A;  2GQQ A;  1PUF A;  3VWB A;  2P6S A;  2EFN A;  3KZY A;  2ZKZ A;  4G6Q A;  3TP0 A;  3SDB A;  1UG0 A;  2EV0 A;  1XGM A;  1FWZ A;  4OWR B;  4EM2 A;  3AG4 H;  3KYL A;  2AXL A;  4XRS A;  2O61 A;  5JVG F;  3AG3 H;  2TDX A;  5LHI A;  3UKG A;  4BHB A;  1VQ5 I;  1MBG A;  5HS7 A;  3C18 A;  4Q4Z F;  2XPU A;  1OMI A;  4CCN A;  2JWT A;  5L3E A;  4CCK A;  2HXO A;  2DA2 A;  2ID6 A;  2EWN A;  1Z1D A;  4O6J A;  3OSG A;  1FTZ A;  3VYT B;  1R1V A;  2FQ4 A;  4LLN A;  2JVG A;  4BGD A;  3OR2 C;  1WI9 A;  1KQ0 A;  3WTT C;  4DZJ A;  3K4C A;  1A35 A;  3ABT A;  1E3O C;  1DPR A;  5H6R A;  1D1A A;  4KFC A;  1D0X A;  1GVD A;  2CW8 A;  2ZXJ A;  3P9K A;  1VND A;  4HF0 A;  2PMZ A;  4FIS A;  3FWE A;  4LIU A;  1U78 A;  2P7C B;  3FXK A;  3E0J B;  1AOY A;  3GO5 A;  4BL0 B;  2V1N A;  3BR2 A;  1VQ9 I;  4D1Q A;  1MJ9 A;  2COM A;  2R5Z A;  4BDZ A;  1XG1 A;  1SVO A;  2EZH A;  1HXD A;  3DEE A;  1TWF J;  2LSO A;  4AUX A;  3BCA A;  3CJR B;  4OAZ A;  5H6Q A;  4DBQ A;  3KEQ A;  3WGI A;  2LY2 A;  3RYP A;  3RKX A;  3LSI A;  3MKW B;  1BC7 C;  1MND A;  5IP6 A;  2CV0 A;  4M72 A;  2VXD A;  3HUG A;  3FX3 A;  1ON2 A;  2LKS A;  2E71 A;  2YS9 A;  3QYE A;  5K7F A;  3J80 K;  1QPI A;  2WV0 A;  3JRE A;  4NC7 A;  3GLX A;  3FM5 A;  3QOP A;  1H0M A;  2COB A;  4BBS J;  4NQW A;  3Q9V A;  4QWQ A;  3MKY B;  3OWT A;  2H09 A;  3BG5 A;  4WCG A;  2HS5 A;  3EUA A;  2LD5 A;  2ICW G;  5F0H A;  3GTQ J;  2ZME B;  2EA4 A;  5EG0 A;  3AL0 B;  4AVZ A;  3H9G A;  1KU9 A;  5JVT A;  3L00 A;  1B8I B;  2LH9 A;  2W1O A;  2F4M B;  3OYL A;  2H8R A;  3GZ5 A;  5J4V A;  4L9N A;  2XSD C;  4MO7 A;  3ZQ7 A;  2M5W A;  1VQP I;  1UB9 A;  2XKP A;  5EJC A;  4HST A;  5E3L A;  2O03 A;  1JJ6 C;  5DM6 F;  2XDV A;  1UJ8 A;  1I27 A;  2DDA A;  2HVQ A;  2M45 A;  1UST A;  2C6Y A;  1GT0 C;  2H1K A;  1YX5 A;  5FLV A;  3H92 A;  3Q9S A;  2DXI A;  4A3G J;  1YX3 A;  4XOP A;  2DOD A;  4LG0 A;  4IHY A;  1RKW A;  2E1N A;  2XAU A;  4KMU X;  2H94 A;  4WXD A;  3BPV A;  4C9Y A;  3E6C C;  1BOB A;  3O8G A;  2W85 A;  5KAF C;  3OS2 A;  2X6X A;  3JRB A;  3HRS A;  2DTR A;  3DEU A;  3MZY A;  1WZ2 A;  5JFR A;  1WJB A;  1KU7 A;  3CD6 I;  4YFX F;  2CH0 A;  4P55 A;  2Y69 H;  3OYD A;  2DJI A;  5F0F A;  2XAQ A;  5AIQ A;  2PJR A;  4JX6 A;  3WE2 A;  4HLY A;  1MBE A;  2K5C A;  2R92 J;  4IEJ A;  1B9N A;  2ISY A;  4EMS A;  4XLN F;  3L2W A;  3ZGK A;  2K9M A;  3NAR A;  2ELK A;  3CP2 A;  3IH2 A;  2OZU A;  3EUK L;  2VC0 A;  5D6E A;  4MNU A;  1YJN I;  3GTO J;  3FBN B;  1BR1 A;  2WBM A;  4KDP A;  4B44 A;  4BHP A;  4Y7N J;  2KMU A;  2V79 A;  3HB9 A;  3KX2 A;  1NG6 A;  4C3J J;  1AWC A;  1MBH A;  1YW7 A;  3RKQ A;  2OTJ I;  2L02 A;  2XAH A;  3HKZ N;  4HSR A;  5IT3 A;  1FZP B;  3CCE I;  5K1Y A;  3PIP F;  4LK0 F;  2E1C A;  1B9M A;  1Y56 A;  2TRT A;  2PN6 A;  2X51 A;  4UVA A;  4CZZ A;  3F0C A;  2VJ4 A;  1EJ9 A;  2VN2 A;  1X3W B;  3ZOB A;  4IXA A;  1SMT A;  4FE4 A;  3T8T A;  2X1E A;  4HF1 A;  4RAY A;  2DA1 A;  4FHT A;  4IF4 A;  2RDP A;  1C0W A;  3J7A Y;  4XLE A;  5E79 C;  1QHH D;  1LFB A;  3QYF A;  1XMX A;  1K6O A;  1PJR A;  5FFX A;  4XLF A;  1LDK B;  5M5X J;  1YI2 I;  1RNL A;  1YW8 A;  2F5C A;  3S3M A;  5GP9 A;  2ZME C;  3AL0 C;  1D8K A;  2KL4 A;  3OYC A;  3F72 A;  1D8J A;  4J01 A;  4E7Z A;  2KJC A;  1K78 B;  2PFB A;  1R49 A;  4B09 A;  3F9K A;  1GVJ A;  2KIM A;  3IH4 A;  1ZHF A;  3EPZ A;  2CS3 A;  1IGN A;  4RLF A;  2XC7 A;  5GAD J;  1T98 A;  2X0L A;  3H5A A;  2MA3 A;  5D4S A;  3Q5F A;  3CC4 I;  5CLS A;  1TQP A;  2IBD A;  2ISZ A;  3A03 A;  5FD5 A;  3JRF A;  2NS8 A;  2IT0 A;  1XGN A;  4CGZ A;  1FBS A;  3A2K A;  2FML A;  3F6O A;  4BQQ A;  2LDU A;  4XR6 A;  3SZP A;  2QSG X;  4UUT A;  5IYD J;  4RMN A;  2EIK H;  3C2B A;  1QNT A;  2OU2 A;  4E6K G;  2FEZ A;  1IN5 A;  2YR2 A;  2DFF A;  4R79 A;  2OQG A;  3LFU A;  3CDH A;  2FBH A;  1BW6 A;  2QLZ A;  1D5Y A;  5J40 A;  1MGT A;  3LA3 A;  5D6F A;  3B6A A;  2WAQ A;  1HKS A;  2V26 A;  4OIQ F;  3NRV A;  2BEO A;  3PNY A;  3FXM A;  4I6Z A;  3IRR A;  1ZGA A;  2O0Y A;  3QOD A;  1LDD A;  4XRS G;  4TV7 A;  3KP6 A;  2CSO A;  3R61 A;  4XLP F;  3CC2 I;  4E7H A;  2Y0S A;  3UNG C;  2WY8 Q;  1X58 A;  5L3F A;  2R7Q A;  4RAF A;  1WJA A;  2JPB A;  1SMY F;  5B1B H;  3QP5 A;  5E20 A;  5FRM A;  5K5Q A;  1ORK A;  4L9V A;  2I5U A;  2K7L A;  4M3B A;  2HVR A;  3ASN H;  1YIO A;  2L5Q A;  2IGM A;  5LRS A;  4CZC A;  2HR3 A;  4RGX A;  1JJ8 C;  5LEJ A;  1ONV A;  3OIP A;  2IS6 A;  4U7B A;  2PG4 A;  1P4W A;  2A6H F;  3L7W A;  1CQT A;  2O8K A;  1STZ A;  2IAI A;  2EQR A;  4A0X A;  2KIU A;  2JA8 J;  4MLO A;  1K61 A;  1VFC A;  5ICC A;  1ULY A;  3HSR A;  2ECB A;  3KP3 A;  5IP9 J;  1VTN C;  3H9Q A;  1FP2 A;  3OV8 A;  1RR7 A;  2LLK A;  3WTU C;  3LAP A;  1JTX A;  2DMQ A;  3OIQ A;  4GGG A;  4EEF G;  1FTT A;  2RAE A;  3P5J A;  1R5G A;  2OCE A;  2HZD A;  4I01 A;  3BZC A;  3QP6 A;  2E7X A;  3OL3 A;  1FC3 A;  3BR5 A;  1JGG A;  4KIF A;  4ZYA A;  2L9S A;  1FSH A;  1MKM A;  2VT2 A;  3FKJ A;  2GLO A;  4II3 A;  2HI3 A;  4CUG A;  1DP7 P;  4F92 B;  2L9V A;  3HPH A;  4YIF A;  5DTD A;  4IO9 F;  3L2V A;  4UY8 I;  4HOB A;  2V6E A;  4PFP A;  2QUF A;  2XGE A;  5BPD A;  3JW4 A;  4L5E A;  3GFL A;  4UV8 A;  1DDN A;  2OC6 A;  1IUY A;  2JSP A;  3L2Q A;  2Q8K A;  4G7Z F;  1UHS A;  3BTJ A;  1LKX A;  3JSP A;  1JE8 A;  3FBI B;  4C2U A;  2LOO A;  3GLL A;  1ZH5 A;  5FKO A;  1OKR A;  3EQL F;  3ZR8 X;  2MC3 A;  1RES A;  2XAG A;  1K4S A;  4FAS D;  3DBH B;  3PO2 J;  2L9R A;  2E1M B;  2WB1 A;  4GFB A;  3R6S A;  1E2X A;  2V9P A;  4U7D A;  4HDU A;  5IP7 J;  4FTH A;  2QA4 I;  2P5K A;  3F8B A;  3LL7 A;  1U9N A;  4ENJ A;  3H3V K;  2ZXW H;  2V9V A;  5ICG A;  1Z3Y A;  3LOC A;  2HOE A;  4IX7 A;  4GDF A;  5E17 F;  1JI8 A;  1W7P B;  5FGM A;  2D45 A;  2FQ3 A;  3G1L A;  2H6B A;  1LUJ B;  1KU2 A;  1MH3 A;  2BY0 A;  1TP4 A;  2Q0O A;  3BTL A;  3ZMT A;  4DNC A;  2XUB A;  3CCM I;  4PJL A;  3A01 A;  2CFO A;  2TCT A;  3GZ6 A;  4HNT A;  1E0E A;  3BOQ A;  2XAS A;  4V2F A;  3BCB A;  4YFN F;  3MEX A;  3GXO A;  3C2G A;  3PSF A;  3RSN A;  5EF6 A;  2NVX J;  3FM3 A;  2CW7 A;  1PP7 U;  2CQK A;  4RB2 C;  3H1C A;  1KZH A;  2HZT A;  3F21 A;  5TJJ A;  1QHG A;  5FB2 A;  3ECH A;  3EYI A;  2ZCW A;  4D7N A;  1LJ9 A;  2RN7 A;  4XKV A;  1VQ4 I;  2F5V A;  1BL0 A;  1OIS A;  3BR0 A;  1DU6 A;  2MBF A;  3I53 A;  1N75 A;  3LSK A;  3G1M A;  1P4X A;  4RGR A;  3O2P E;  2KRC A;  5F27 A;  3IC7 A;  4GYG A;  4BJ6 C;  1IV6 A;  2GXA A;  1W36 D;  2VL8 A;  1Y1V J;  5E18 F;  3TOA A;  4DQ2 A;  2PX9 A;  4M6X A;  3U2R A;  2Z16 A;  3CCL I;  3L1P A;  1FLI A;  3M9A A;  4RA2 A;  1SFU A;  1OCO H;  4ZDP A;  2FNA A;  3EYY A;  2CUZ A;  3I64 A;  2HOS A;  5GAG J;  5JI6 A;  3HSE A;  3RKW A;  1A5J A;  3WTS C;  4LIT A;  2X6W A;  3KCC A;  3FIW A;  1X1A A;  4PK4 A;  1J59 A;  3OS1 A;  2CQQ A;  1WJC A;  2A68 F;  2Q1Z B;  4UVC A;  4ENN A;  1ETW A;  2ZSH B;  1UG2 A;  4RM2 A;  2HYJ A;  1LQ1 A;  4IHX A;  1I6H J;  3CCS I;  5IY5 H;  1R4M B;  1MD0 A;  1W1W E;  1Z6R A;  3VOE A;  3W6K B;  4EJV A;  3LSP A;  1MMD A;  4BXF A;  4ON0 A;  4CYC A;  4DJA A;  4WWC A;  2HQA A;  4CA0 A;  1ODD A;  3M8F A;  1XTA A;  3A02 A;  3IL2 A;  1S8N A;  4CCL A;  2O8X A;  3WHC A;  3S1M J;  1ZAO A;  2EFP A;  2GZW A;  4ZYH A;  2M8E A;  4ASN A;  2A61 A;  1TT0 A;  4ZZL A;  1MH4 A;  1J75 A;  3F8M A;  2GWR A;  3F6V A;  4L0Y B;  4AM3 A;  2UXN A;  1MJA A;  4EGZ A;  2LY1 A;  3HHH A;  3LQQ A;  1MBK A;  4MEY F;  5DCM B;  2D2W A;  4AYB N;  4Y17 A;  2GXG A;  3CMM A;  1J2X A;  2D1H A;  2VQC A;  2W57 A;  3C1D A;  2QQA A;  4PGH A;  2R7Z J;  3E6D A;  5HDK A;  1IN6 A;  2YSR A;  4HV5 A;  3DBR B;  4A3J J;  2A69 F;  1XN7 A;  4I0B A;  2QVO A;  2E1M C;  3I4P A;  4N0B A;  1MMA A;  1ZGW A;  3K2Z A;  3MZ8 A;  1YIJ I;  2VKH A;  3F8C A;  2MGQ A;  1WCM J;  4I76 A;  1BN5 A;  4ZYG A;  4MHG A;  3PIO F;  1Q1V A;  5CYV A;  1YRN A;  4HYE A;  2VKE A;  3OIO A;  3HOX J;  4A12 A;  4KYW A;  1MNE A;  3QU6 A;  2LK2 A;  4FET A;  2HYF A;  2R7W A;  2R7T A;  2EIN H;  4XN0 A;  3RCO A;  2F6C A;  2QF7 A;  3KEO A;  1GDT A;  4B4C A;  3AG1 H;  1MMS A;  1FP1 D;  4ETS A;  5GTI C;  2BY3 A;  3KYD B;  4IRH A;  1O3Q A;  3MFK A;  2FD5 A;  4UUS B;  2JA5 J;  4G7H F;  2HFH A;  2CFX A;  4AIH A;  3KP4 A;  1GUU A;  2CWE A;  4Y33 A;  1LE8 A;  1HSJ A;  1IC8 A;  2CUJ A;  2RNG A;  2OBP A;  2BW3 A;  2QWW A;  3HXL A;  3TDZ C;  5K7Z A;  5KHD A;  2EIM H;  1FBQ A;  3CDL A;  2ME0 A;  5B3S H;  2RQP A;  3T1B A;  4UXN A;  5CVR A;  4IPA A;  2MH9 A;  2PQ8 A;  4YEJ A;  3OOP A;  1ITY A;  2R7V A;  1VQK I;  2VBY A;  1OYI A;  4RGS A;  3CMY A;  1WRJ A;  1V55 H;  3QPS A;  1E3P A;  4HNV A;  5KNL A;  4L18 B;  3HOY J;  3WU2 C;  2HDC A;  3I59 B;  3HKZ A;  1WJ5 A;  4M9S A;  3I56 I;  3BG3 A;  4S0H B;  4BE2 A;  3CC7 I;  2V9K A;  4RB0 A;  3NAU A;  3V8L A;  2X48 A;  1JHH A;  3HYI A;  3GME A;  1OJL A;  1IXS B;  1LEA A;  1W0U A;  2AHQ A;  2DMP A;  5F6F A;  5HOO A;  3S3N A;  3G3Z A;  4HRI A;  4HAM A;  2L2O A;  1D1C A;  2B0L A;  5L3B A;  4A6D A;  1R36 A;  2DJN A;  4WF2 A;  4DW6 A;  5M5W J;  3DBL B;  4ITV A;  4IOC F;  2KQR A;  1JUS A;  1KGS A;  1OPC A;  2R7U A;  2FU4 A;  4ENM A;  3CUO A;  1K83 J;  4PJN A;  1U8B A;  1IF1 A;  2FUG 2;  3JRD A;  1VF9 A;  1HDD C;  3TL4 X;  2O6G E;  1DP3 A;  4EVI A;  2EV5 A;  2M4K A;  2JPC A;  1JUM A;  2R7S A;  2IJL A;  3RQ4 A;  4RAG A;  3BR3 A;  4LGW A;  3KIO A;  2OAZ A;  2NNY A;  2O3F A;  1VQ6 I;  1QVT A;  1F9N A;  3D0S A;  5ICE A;  1D5V A;  3SZT A;  4ESF A;  2OTL I;  1V3F A;  1MBF A;  4M71 A;  2ZME A;  1HW5 A;  5JHU A;  1OCC H;  2VJI A;  2VT3 A;  3G2B A;  4ZJZ A;  2L7F P;  5BQT A;  1HA8 A;  1ZG5 A;  2M34 A;  4IJA A;  3TED A;  5HS9 A;  2NRA C;  2YX7 A;  3OOU A;  4LK1 F;  2L7K A;  1YTY A;  1JT6 A;  3S2W A;  2A05 A;  2X4H A;  4C3I J;  3IKT A;  1ZRF A;  2DA4 A;  1BI3 A;  2V6C A;  3RPU A;  3PQJ A;  4MEX F;  3JR9 A;  2FOK A;  1V5F A;  3Q3S A;  4M74 A;  4ZZD A;  2B9S A;  4BS9 A;  1AU7 A;  4B1R A;  2P7V B;  5LGT A;  4O5V A;  3JRG A;  3J7A O;  1QVU A;  2FMY A;  2RGV A;  2JT1 A;  3S2H J;  2DFH A;  2WAF A;  4XRF A;  3WGG A;  1SFO J;  3G71 I;  3DLL F;  4LD5 A;  4UHT A;  4PDK A;  5E1W A;  1WH5 A;  2EPF A;  2N8G A;  1XGO A;  3B02 A;  5FRN A;  2IP2 A;  2OQR A;  2L01 A;  1G59 A;  2YX4 A;  1IRG A;  3OYE A;  1W4M A;  3K4L A;  3IRQ A;  2ZFW A;  1RPW A;  2IW5 A;  3CLO A;  3GTJ J;  1RI7 A;  2DA3 A;  1MNM C;  1RRJ A;  3DKX A;  3LNQ A;  2LVS A;  3CCU I;  2L54 A;  1ZRD A;  2VQL A;  3BRO A;  3V7C A;  2DA6 A;  3R4K A;  2CV2 A;  2QQ9 A;  1GV2 A;  2Q2E A;  2Y0M A;  3HOW J;  3K1M A;  1SFE A;  1OYY A;  4NUB A;  5CVU A;  2XRL A;  3CUQ B;  5J1U A;  5JLX A;  2DMU A;  1FNN A;  3VYR B;  5FLM J;  2DFI A;  3JRI A;  3GTL J;  4A3L J;  4XK4 A;  2W24 A;  2CJJ A;  4AC0 A;  1XPX A;  1JKO C;  2JA7 J;  1BIA A;  4Q5S F;  1QRY A;  2H1L A;  1NH3 A;  2EJR A;  5DYM A;  3IHU A;  2WWY A;  1UCR A;  3LWF A;  2KDZ A;  2X6Y A;  1GXP A;  4IHW A;  1S7A A;  3U21 A;  3IAS 2;  3LSM A;  2HKO A;  2NVY J;  1D3Y A;  4WK8 F;  2RKH A;  1Y1W J;  2R4G A;  1WJE A;  3M7G A;  3JTG A;  1NK2 P;  3K4B A;  1R5H A;  3CLQ A;  1ZN2 A;  1IO2 A;  1KU3 A;  1V4R A;  4I02 A;  3R0J A;  4YFK F;  2Y2Z A;  4G94 A;  3BPX A;  4OIN F;  4E7L A;  3P9I A;  3K10 A;  3VFZ A;  3RZO J;  2YU9 J;  3HRM A;  3BJA A;  3PFI A;  3KP5 A;  2W4S A;  2X6O A;  2PJP A;  2IVM A;  4AIJ A;  4NHJ A;  2M87 A;  4AIK A;  1HKQ A;  4C3H J;  4OIR F;  3G4S I;  3COA C;  1XSX A;  1A36 A;  3F23 A;  3L09 A;  1BJA A;  1TWC J;  2QKM B;  1P9Q C;  2O7O A;  4KIS A;  2FF4 A;  3FMQ A;  1MBJ A;  1T0F A;  1WWX A;  4YEL A;  1ZG1 A;  3ZMD A;  2YU3 A;  4E4H A;  3HOU J;  2GOM A;  4MTE A;  3CCR I;  2CO5 A;  1USS A;  5GPA A;  2NOG A;  3FHZ A;  5LHH A;  4LIV A;  2QGU A;  1S5L C;  4FQG A;  3H5R A;  1SAN A;  3PM1 A;  4XQF A;  2K86 A;  2J5P A;  3E5U A;  2E2J J;  1NK3 P;  1Y8R B;  3E5Q A;  5IT9 K;  1YE9 A;  1E3H A;  4BXU A;  5J47 A;  3G6E I;  1TW3 A;  4OIO F;  2ESH A;  5B1A H;  3WTV C;  3ZP5 A;  4IKF A;  3DEW A;  3HHG A;  1ZLJ A;  1TNT A;  2VC1 A;  2ZNZ A;  3TKY A;  2EZI A;  2MG4 A;  3IKV A;  2Y9Y A;  3JCU C;  1O7F A;  2GIV A;  1DPU A;  1Z05 A;  2WAD A;  4OOI A;  3OYA A;  1SD4 A;  4GCV A;  1O3T A;  4G6T B;  2OZ6 A;  2P6T A;  3BT9 A;  4WXC A;  1HW1 A;  2CGP A;  3FF5 A;  1TL8 A;  1RUO A;  4J00 A;  4PGG A;  3ECO A;  1HLV A;  1XD7 A;  3S16 J;  2ZJ2 A;  3E1S A;  1DGR M;  2RNJ A;  3Q0W A;  5E8G A;  4B48 A;  3KEY A;  2WTE A;  4H4K C;  2WAE A;  4BY1 J;  1G3W A;  4XM3 A;  3KZZ A;  3WE3 A;  2P8T A;  1HOM A;  4XID A;  3C7J A;  2LKP A;  1R23 A;  3QU3 A;  4XOR A;  4XBF A;  5J3L A;  2R0Q C;  4M6V A;  3FXJ A;  4EM1 A;  5J1R A;  2X9D A;  3IAM 2;  3K4J A;  3CUQ C;  4RDU A;  1WPK A;  3ESW B;  2FXA A;  1G4D A;  1SFK A;  4MQV A;  1Q1H A;  3MKL A;  3ZMS A;  2DPU A;  5IYC J;  2K27 A;  3DKW A;  2EV6 A;  2VI6 A;  3O3K A;  1KYW A;  3BG7 A;  4NQW B;  2F5D A;  2BVM A;  2ZNY A;  3KPH A;  2XF7 A;  2G7U A;  2JTV A;  4AYB A;  1F1Z A;  1XS9 A;  4A5M A;  3SZG A;  3LQR A;  2CMP A;  5JHF A;  5EG0 B;  2GXB A;  3HGG A;  5HNF A;  3FXU A;  2EIL H;  3ZQH A;  3V4G A;  1FIP A;  1SD7 A;  1WI3 A;  3BLY A;  3EUH A;  3S3O A;  4NC8 A;  3RPU D;  2M0M A;  2R5Y A;  3OR1 C;  1TWA J;  1YS6 A;  2KKO A;  1BI0 A;  3BJO A;  1PP8 F;  2LY9 A;  3LSG A;  3V8J A;  4E7I A;  4U0Y A;  1MMG A;  3G73 A;  1H9T A;  2BY2 A;  2LP0 A;  4EM0 B;  2JQ7 A;  4CYD A;  2ZXI A;  3HZJ A;  4XMY A;  4DBR A;  1CF7 B;  2CV1 A;  1B6A A;  1Z3X A;  3Q0U A;  3TQN A;  4B8X A;  3S32 A;  3WU1 B;  2JSC A;  4F93 B;  1Y39 A;  5IPA A;  3ZQI A;  2A3S A;  2MAB A;  1JXS A;  4XNF A;  2R7X A;  4P5O A;  2NS7 A;  4LG0 B;  4I7H A;  3U1K A;  2E19 A;  5LLQ A;  2M3A A;  2M9H A;  2XIG A;  1AKH B;  4D0P A;  3CMA I;  3H0D A;  5E8I A;  1B1B A;  2KRH A;  2JRM A;  1EA3 A;  1O4X A;  3AFH A;  1MJB A;  1B72 A;  2CUF A;  1LVA A;  3ABL H;  2XSJ C;  1YQA A;  1TLH B;  2KZV A;  1HST A;  5LGN A;  2H27 A;  2IS1 A;  3WGH A;  5H20 A;  3GUD A;  1OCP A;  4OMY A;  1BA5 A;  1HQC A;  2OV7 A;  3NEU A;  1T56 A;  2QQ8 A;  5LHG A;  5KK1 A;  5ED4 A;  1U6G A;  2VQG A;  1SAX A;  2QBY A;  3GTM J;  2JRT A;  4JBA A;  3HM5 A;  4P9U A;  2LF7 A;  2RQQ A;  1BI2 A;  2OPT A;  1TC3 C;  2JZY A;  4FX4 A;  1RUN A;  4IQJ A;  3JSO A;  5F04 A;  1IJW C;  1HCR A;  1DQU A;  4EJO A;  3GFM A;  3ZMU A;  3UR3 C;  3K70 D;  5F1R A;  5D8K B;  4Y4R A;  3OYI A;  2V4J C;  1V5E A;  4HG2 A;  5HOD A;  5F08 A;  4PJM A;  3S14 J;  4CCO A;  3L2R A;  5ILS A;  5KVR A;  4LLL A;  5DDG A;  3BQY A;  2R7R A;  4AID A;  2DK5 A;  2XAF A;  2G7H A;  1KQ9 A;  4CXF A;  5HLG A;  3PNT A;  4KN7 X;  4XOT A;  3MKZ A;  2KIS A;  4J19 A;  2BOL A;  4P1W A;  3T5X A;  4X6A J;  2GAU A;  2CG4 A;  3ABU A;  3S15 J;  2DQL A;  4P9F A;  1VQ8 I;  1DGW Y;  2E36 A;  2O5R A;  5F1J A;  4M73 A;  4BAC A;  3ZXS A;  5HLH A;  1MSE C;  4PUS A;  2DBB A;  2H8W A;  2GA1 A;  2FX0 A;  3WG7 H;  4YRV A;  3A4C A;  2LBF B;  2VXZ A;  2H6C A;  3LA7 A;  4A3I J;  1TBX A;  4MFE A;  5DUI A;  2BYV E;  1LEB A;  2X1C A;  5F0C A;  5CJ9 A;  1JKR C;  2BHY A;  2V7F A;  1IZ1 A;  3ZQQ A;  5IOY A;  2VUM J;  4BH9 A;  3H0G J;  3QPL A;  2LTP A;  5AIP A;  4XKB A;  5DUK A;  1FY7 A;  1H9G A;  3MCZ A;  4HA8 A;  4KIT B;  1JGS A;  1MW7 A;  2GBY A;  1QBJ A;  2XGC A;  2HQR A;  5L3D A;  1VQL I;  1S3J A;  2XGD A;  2Z33 A;  1FX7 A;  2LF8 A;  2VOP A;  3HSF A;  1RR8 C;  2PBI A;  1X1C A;  2BE5 F;  4PSX A;  3PO3 J;  1ON1 A;  3VB2 A;  4B43 A;  1YHQ I;  5FLX K;  3P7N A;  4RM3 A;  2DCE A;  2K40 A;  2MSY A;  4NB5 A;  3SYT A;  1OCT C;  5M3F J;  3OL4 A;  2CW0 F;  2DAO A;  4LMY A;  3BG6 A;  4XON A;  1QZZ A;  5H2F C;  1KQ8 A;  1P7I A;  4XLH A;  2IPQ X;  4BQN A;  3SDG A;  5HVQ C;  1Y0U A;  2HNH A;  5KAI C;  1W0T A;  1GXQ A;  3HRU A;  2JA2 A;  1PDN C;  2NS0 A;  1R1U A;  4OU0 A;  4L5I A;  1X4P A;  2QEN A;  3VPR A;  2MYS A;  3ONQ A;  4XN3 A;  3ULQ B;  4MFD A;  3W2V A;  1UZC A;  3GTG J;  4CH7 A;  1FMW A;  2XKO A;  2ELH A;  1LNW A;  4G7O F;  4B3X A;  4XSZ F;  1LB2 A;  1X3U A;  1RC9 A;  4N4N B;  2IEK A;  2GIZ A;  2ZBK A;  1U5T A;  3H3Z A;  4O3M A;  2JJ7 A;  1MZB A;  2O9L A;  5B66 C;  3IUO A;  1SAU A;  3KZI C;  4XL9 A;  4EAT A;  4ENK A;  4AVP A;  4E70 A;  5IT9 Z;  3DCF A;  1PUE E;  3ZMV A;  1DU0 A;  4G6D A;  4EGY A;  2PMH A;  2IS2 A;  1YW9 A;  5BNG A;  2FNP A;  3SXY A;  3MD2 A;  5DS9 A;  5E1Z B;  2BGC A;  1RKT A;  3BY6 A;  3KLN A;  2Y31 A;  4KJZ A;  3VSK A;  2V1X A;  3BWG A;  5HLI A;  2DOF A;  1B4A A;  1R7J A;  3CME I;  1FYL A;  5DD4 A;  4XRM A;  5A2Q K;  1Z6T A;  4E7J A;  3RIR A;  3CP8 A;  2Y75 A;  3MZH A;  2QSF X;  3TW7 A;  3HG9 A;  3RQI A;  4M3D A;  5IOZ A;  3VYS B;  4QTR A;  1YJ9 I;  1A6Q A;  2LG4 A;  3HGY A;  5BS6 A;  1IRX A;  3FXL A;  4A93 J;  3ABK H;  5LGU A;  1HC8 A;  5E3O A;  4PCQ A;  3BDD A;  4R1H A;  1W36 C;  3I59 A;  4IRI A;  2MW8 A;  1JT0 A;  4IHT A;  1A6I A;  2BV6 A;  1REP C;  2FOW A;  1B59 A;  4V2G A;  1R00 A;  4L0Z B;  1G3Y A;  5EEA A;  4LB6 B;  4NBQ A;  1X1D A;  1H89 C;  1I1G A;  2UXX A;  3HC7 A;  2BHZ A;  2K4B A;  2OD5 A;  3DWL E;  5D8L B;  1FYM A;  2LMD A;  3WTY C;  2DW4 A;  3F8F A;  1L0O C;  1NTC A;  2L9N A;  2DYS H;  3JAM K;  4I09 A;  4AU7 A;  2BXZ A;  1ERD A;  1S7E A;  2LR8 A;  3VEP A;  2X85 A;  5FRO A;  4HLX A;  2HOT A;  3IWF A;  2E34 A;  2HU9 A;  2VJ5 A;  5GPC A;  3OYK A;  2IGO A;  5DD8 A;  3E3V A;  1FT9 A;  1QGP A;  3M8E A;  2HQ5 A;  2IGK A;  1FOK A;  3DTK A;  4HEA 2;  4QPO A;  3SFZ A;  3TMO A;  2K4J A;  4F3Q A;  3MMY B;  1YS7 A;  4XIC A;  1G8X A;  4BUP A;  4DYR A;  1ZEL A;  1Z91 A;  3ZN1 A;  4D7M A;  3LA2 A;  4BEH B;  3RYR A;  3HTS B;  3ELK A;  2DDB A;  3GF2 A;  4ESB A;  5GAE J;  2FE3 A;  2D1V A;  3CJQ B;  2ZC2 A;  1ZLK A;  4FT8 A;  3FKI J;  1X2M A;  3U9G A;  1PYV A;  2W00 A;  1H8A C;  3C3W A;  1U9O A;  2HGC A;  5HDN A;  1I3A A;  5L3G A;  4WX9 A;  1XX5 A;  4DGW B;  5IYB J;  3TO7 A;  1T08 B;  2VOO A;  1K79 A;  2E1O A;  1FSE A;  4KIC A;  2L4A A;  2E7W A;  2DT5 A;  2VKD A;  5M5Y J;  3H36 A;  3MAJ A;  3WTZ A;  1HF0 A;  2DN0 A;  4EJU A;  3IH3 A;  5K5O A;  4S04 A;  1KON A;  4CCM A;  3JRA A;  1BC8 C;  1R6R A;  2DT6 A;  1K7A A;  2AO9 A;  5FO5 A;  3L2C A;  3DF8 A;  1T39 A;  3M07 A;  3K4K A;  5BPI A;  3PUB A;  2NXN B;  3QQA A;  4A0Y A;  4A3K J;  2NAZ A;  4F55 A;  3GFI A;  3HBL A;  1X1P A;  2NYX A;  4I99 C;  1GHC A;  5CVJ A;  1FOW A;  2HOA A;  1T95 A;  3ZQC A;  1O3S A;  3K6G A;  1FIA A;  4MIM A;  5E3M A;  3B73 A;  2ACJ A;  2HEO A;  2M7B A;  2Y48 A;  5FFZ A;  2IRF G;  1IN4 A;  4PFO A;  4CHU A;  1XSV A;  4HZF A;  4LG3 A;  4G9Y A;  2EH3 A;  3A0B C;  4KNY A;  3AKZ A;  3QPT A;  1MDM B;  4I0A A;  5J4Y A;  1IN8 A;  4II2 A;  3ZPL A;  5J1Y A;  2F4O B;  4Z2Y A;  2STW A;  2B7E A;  1DUX C;  2YUS A;  3ZQL A;  1KYZ A;  3VYU B;  3LAJ A;  1O3R A;  2BVL A;  2HDW A;  2XHK A;  2EZK A;  1IXC A;  3H9J A;  4U88 A;  1OQY A;  4B47 A;  3J81 Z;  4ZYD A;  1TQI A;  3BR6 A;  5HNH A;  2M4G A;  1J7K A;  3N4M A;  1ZQ3 P;  1Y8Q B;  5DM7 F;  4HX4 A;  1J5Y A;  4QSH A;  3S93 A;  1YRN B;  2CRG A;  2P81 A;  3S8P A;  4MGR A;  3FZV A;  1FEX A;  3QAH A;  1P2F A;  2AXT C;  1FYK A;  2DMN A;  1IW7 F;  1B8I A;  3DPT A;  4F7Z A;  4HV6 A;  4JQF A;  5FLX Z;  4KMF A;  2EFQ A;  4L9T A;  4RGU A;  3CF5 F;  2RV8 A;  5EGO B;  4C30 A;  4X1E A;  4ZYE A;  1R1T A;  3EDP A;  3N97 A;  1ZRE A;  3ERM A;  5FD6 A;  2IGN A;  4RAZ A;  4I98 B;  3SFI A;  4A6E A;  3FMS A;  2HVS A;  4CSW A;  4A5N A;  4PSW A;  3E6B A;  1EH7 A;  4FCY A;  3ABM H;  1FMV A;  1TQM A;  5LRR A;  4YIR X;  3ZQG A;  2L7Z A;  4UVB A;  2BW3 B;  1ENH A;  5FKM A;  1FOY A;  5EYR A;  4C2M J;  3P9C A;  5LFA A;  2VQH A;  4JX4 A;  3OYF A;  3V7S A;  3DQV C;  5K7H A;  2NVT J;  4Y52 J;  1FPQ A;  4EJW A;  1L3L A;  2V1U A;  1QA6 A;  3VSL A;  1BI1 A;  2ELJ A;  4LLG F;  3X2Q H;  3ZMZ A;  2MD5 A;  3F8N A;  3DU5 A;  3HEF A;  1ZR4 A;  2BZT A;  2E35 A;  4JYK A;  1GV5 A;  3HRT A;  2E2H J;  4E7K A;  1XB4 A;  2A6T A;  2DT7 B;  3A1Y A;  1TNS A;  3RZD J;  1ZK8 A;  2KHM A;  4KUM A;  4KIG A;  4GRI A;  1RET A;  4EJT A;  1WFX A;  1WGX A;  2JN6 A;  2A6E F;  1SC7 A;  2G0E A;  1CGP A;  4IRG A;  2M0C A;  1MMN A;  5AON A;  2R7F A;  1T8I A;  3M1C A;  3D5L A;  1TT5 B;  5A2Q Z;  2LYC A;  1ETY A;  2XAJ A;  5CKT A;  5CVI A;  4BBR J;  2I10 A;  2IA2 A;  1UHM A;  2LNB A;  2VAS A;  4ZTF A;  1IRZ A;  3M4O J;  3DKY A;  1ACI A;  3HOZ J;  1HKT A;  1PVE A;  1X2N A;  1W5T A;  4IOA F;  3E5X A;  3S1Q J;  1WJD A;  1YIT I;  2FA5 A;  1EV7 A;  3H3U A;  2XPV A;  1EH6 A;  2IA1 A;  2ECC A;  3FXR A;  3NWT A;  3HL2 A;  3I0T A;  2XGX A;  3D5R C;  5DCF A;  1N77 A;  1BR4 A;  4DIQ A;  5C44 J;  1JHF A;  3SJM A;  3I58 A;  4BJT A;  2DOE A;  1LPQ A;  3HOV J;  3KET A;  4HQM A;  4AD9 A;  2GM4 A;  5EDN A;  3V42 A;  2IS4 A;  5D5X B;  1UAA A;  4KA4 A;  3JAM Z;  1D0Y A;  2QZ8 A;  4M9Z A;  4Y13 A;  3IWZ A;  1IXR C;  2EB7 A;  2HPI A;  2L3D A;  2KFD A;  3SQN A;  3BZ6 A;  3FMR A;  3M8J A;  3MVP A;  1PUF B;  1ETV A;  2EZL A;  2K9Q A;  2LC2 A;  4PJ0 C;  3ROU A;  4V19 K;  1K78 A;  4IZZ A;  3KP2 A;  5HDG A;  1IRF A;  3BJ6 A;  4DYQ A;  4M9X A;  3HPG A;  2VKV A;  2ZFU A;  4GYI A;  4QLC U;  1I50 J;  5FKN A;  3JRH A;  3TO9 A;  3QPH A;  4UB6 C;  3W6J B;  1BBY A;  4A3E J;  3ASO H;  9ANT A;  1EH8 A;  2VE8 A;  4OAY A;  3OYN A;  3LST A;  4K2E A;  1BIB A;  1CF7 A;  2VIX A;  2K9S A;  2ZO4 A;  4OIP F;  1LFP A;  3GTP J;  1BW5 A;  4JOM A;  4BQO A;  5D5V B;  4M3G A;  1S72 I;  2FBI A;  3WOD F;  2VOD A;  4KT5 C;  2UWM A;  2K3P A;  2VJJ A;  5C4X J;  4HDV A;  3CJN A;  1F43 A;  1P6R A;  1X19 A;  2K9N A;  1WSU A;  3FK6 A;  3WG9 A;  1TWH J;  1AKH A;  4AWX B;  3TGN A;  3K69 A;  1ZG3 A;  5BOX A;  4H0E A;  1R22 A;  3K1N A;  4Y15 A;  1A31 A;  1OR7 C;  1Z77 A;  4ZC3 A;  3I4M J;  3LFK A;  1EF4 A;  2R5Z B;  3CDI A;  1V5G A;  2Z5U A;  3W3C A;  2FSW A;  4BQA A;  2YPR A;  4HF2 A;  1R58 A;  3BQZ A;  2HDD A;  3ZN0 A;  3U1D A;  2PEX A;  2Q2E B;  4HBL A;  5J6X A;  1TZL A;  4NDL A;  4HX8 A;  1G6N A;  2ZJR F;  2G9W A;  1POG A;  4X0G A;  4IQ4 A;  1SD6 A;  2NOJ B;  4ABZ A;  3HUG B;  2CQX A;  2CQN A;  2V1D A;  3TOB A;  1XC5 A;  2GA2 A;  3V8K A;  3LMM A;  2EA2 A;  4G12 A;  2Z2S B;  2J5O A;  3L9F A;  2EFO A;  5HS8 A;  2B63 J;  1D0Z A;  1AA7 A;  2JA6 J;  3MN2 A;  1QPM A;  2IXS A;  3MQ0 A;  3I4N J;  1XSD A;  2F5F A;  1ZAR A;  2VB6 A;  1SEU A;  5HLT A;  2KJB A;  1P92 A;  5D4R A;  2HWV A;  2K9L A;  1SD5 A;  4C2T A;  4PJJ A;  2UZK A;  1Z67 A;  2OF7 A;  2VPL A;  3I3L A;  4Q47 A;  2L4M A;  2A5Y B;  3M3Y J;  5C4J J;  3REO A;  5GAH J;  2LRE A;  4UV9 A;  2X1D A;  1WJF A;  2M8G X;  5L3C A;  2HTS A;  5ILV A;  3O8H A;  1JKQ C;  2JMW A;  3DPU A;  1NG7 A;  2MD0 A;  4N4O B;  5LD2 C;  3SEZ A;  5LEK A;  3S1R J;  2WV1 A;  2LKX A;  3HOS A;  2LBF A;  1G3T A;  3R60 A;  3I54 A;  2P5V A;  3PNV A;  4CDG A;  2KIF A;  1R4N B;  3LSH A;  1SVM A;  2EFW A;  3LSR A;  2XRO A;  4UNO A;  3KLO A;  4N9I A;  2FJ1 A;  3WTW C;  1BM9 A;  4DYC A;  4MTD A;  1YG2 A;  3PUF A;  3OSF A;  3OYM A;  1O7L A;  1XCB A;  3H5N A;  3BG9 A;  3FIS A;  4KN4 X;  4A3D J;  1QU3 A;  3W6V A;  2DOA A;  3HIF A; 
#chains in the Genus database with same CATH homology
 4S0H B;  3BG5 A;  3DCF A;  2LD5 A;  3NAU A;  5F0H A;  5M3M J;  1DU0 A;  1JUP A;  2X48 A;  3GTQ J;  3GBG A;  5EG0 A;  1OJL A;  5BNG A;  1B8I B;  5DS9 A;  1RKT A;  1W0U A;  2Y31 A;  2H8R A;  2AHQ A;  2DMP A;  2XSD C;  4MO7 A;  2DJN A;  4DW6 A;  4XRM A;  5M5W J;  3S1N J;  3B6C A;  5E3L A;  1JUS A;  1ETK A;  1JJ6 C;  3TW7 A;  3RQI A;  4M3D A;  5IOZ A;  4A69 C;  4QTR A;  3HGY A;  1K83 J;  1U8B A;  4A93 J;  1GT0 C;  2H1K A;  5FLV A;  3JRD A;  2ME6 A;  1VF9 A;  5E3O A;  1HDD C;  2MW8 A;  4A3G J;  1JT0 A;  1A6I A;  4IHY A;  1JUM A;  2VPR A;  1RKW A;  4V2G A;  2DMT A;  3BR3 A;  5EEA A;  1QVT A;  3O8G A;  4W1U A;  2EBI A;  1H89 C;  3JRB A;  1MBF A;  4JP0 A;  2PMZ N;  1NTC A;  1S7E A;  2LR8 A;  4BKX A;  1H88 C;  5F0F A;  2CUE A;  2L7F P;  2HOT A;  2M34 A;  3TED A;  3OOU A;  5GPC A;  4JX6 A;  2R92 J;  1MBE A;  1JT6 A;  4IEJ A;  4C3I J;  3BTI A;  5C3E J;  2E2I J;  2DA4 A;  3NAR A;  2ELK A;  3IH2 A;  2HQ5 A;  2R5Y B;  4A3M J;  3JR9 A;  3GTO J;  3Q3S A;  4XIC A;  4DYR A;  3E7L A;  5EZG A;  2M2E A;  4D7M A;  4A3C J;  4Y7N J;  3HB9 A;  4C3J J;  1AU7 A;  4B1R A;  1MBH A;  3JRG A;  3RKQ A;  1QVU A;  1IUF A;  3HKZ N;  3S2H J;  1FJL A;  1SFO J;  3FKI J;  2TRT A;  1X2M A;  1ETQ A;  2Y30 A;  3S17 J;  1H8A C;  3F0C A;  1WH5 A;  1U9O A;  5FKL A;  3ZOB A;  2N8G A;  4FE4 A;  3G1O A;  5IYB J;  2XB5 A;  1RPW A;  2E1O A;  2DA1 A;  3GTJ J;  1MNM C;  2DA3 A;  3LNQ A;  2LVS A;  5M5Y J;  1LFB A;  1HF0 A;  2R93 J;  2JK3 A;  2DA6 A;  2DN0 A;  1GV2 A;  5M5X J;  3IH3 A;  1ZTR A;  3HOW J;  1BJZ A;  1OFC X;  5GP9 A;  1B72 B;  3JRA A;  2XRL A;  2AO9 A;  5J1U A;  5JLX A;  2DMU A;  5FLM J;  2DA7 A;  3CCY A;  1HDP A;  3JRI A;  3GTL J;  4A3L J;  4XK4 A;  2JA7 J;  2CJJ A;  4AC0 A;  1JKO C;  1WH7 A;  4D5C A;  3QQA A;  3IH4 A;  1QRY A;  4A3K J;  3HBL A;  1IGN A;  1IDZ A;  2L7M P;  3IV5 A;  2KDZ A;  2W48 A;  2HOA A;  3ZQC A;  4IHW A;  2Y9Z A;  4UUS A;  1FIA A;  2NVY J;  4MIM A;  5E3M A;  2LFB A;  2IBD A;  1Y1W J;  3A03 A;  3JRF A;  4D5F A;  1ZR2 A;  2NS8 A;  1NK2 P;  2ID3 A;  2EH3 A;  4UUT A;  5IYD J;  2Y2Z A;  3C2B A;  4FE7 A;  2XB0 X;  5J1Y A;  3RZO J;  5FJ8 J;  2YU9 J;  1BW6 A;  1D5Y A;  1TWG J;  1F36 A;  2X6O A;  3B6A A;  2YUS A;  4C3H J;  3ZQL A;  1VI0 A;  4I6Z A;  1TWC J;  2EZK A;  4XRS G;  2O7O A;  1X58 A;  1MBJ A;  2NVQ J;  3BR6 A;  3HOU J;  3K2A A;  4DZP A;  3D1N I;  1ZQ3 P;  1ORK A;  3LSJ A;  5GPA A;  1UMQ A;  2NOG A;  4M3B A;  3JRC A;  4QSH A;  5E3N A;  1YRN B;  2CRG A;  2P81 A;  4BXX J;  1FEX A;  1JJ8 C;  1SAN A;  3PM1 A;  1JKP C;  2DMN A;  1B8I A;  2E2J J;  4B3A A;  1NK3 P;  2O8K A;  1CQT A;  2DTZ A;  5EGO B;  1ETX A;  2EQR A;  2IAI A;  4X1E A;  2JA8 J;  2XPW A;  4MLO A;  1K61 A;  1VFC A;  3DEW A;  2ECB A;  3SFI A;  5IP9 J;  2EZI A;  2MG4 A;  1T33 A;  1RR7 A;  2LLK A;  2Y9Y A;  1JTX A;  1IDY A;  2DMQ A;  2D5V A;  4FCY A;  4EEF G;  1FTT A;  3ZQG A;  2RAE A;  3BT9 A;  2L7Z A;  3CQZ J;  1ENH A;  5FKM A;  5EYR A;  1HLV A;  4C2M J;  3BR5 A;  4JX4 A;  1JGG A;  3Q0V A;  3S16 J;  3Q0W A;  3A01 B;  2GLO A;  2HI3 A;  5JLW A;  5K7H A;  2NVT J;  4BY1 J;  4Y52 J;  5DTD A;  4LOC A;  1HOM A;  4XID A;  2XGE A;  5J3L A;  4L5E A;  2R0Q C;  4M6V A;  3HEF A;  5J1R A;  2X9D A;  1UHS A;  1ZR4 A;  3BTJ A;  4RDU A;  1WPK A;  4JYK A;  1GV5 A;  2E2H J;  4W97 A;  3BTC A;  3MKL A;  3ZQF A;  5IYC J;  3RZD J;  5FKO A;  1ZK8 A;  1I3Q J;  1RET A;  2VI6 A;  1RES A;  1WGX A;  2JN6 A;  3BR1 A;  3PO2 J;  5EGO A;  2G0E A;  2KT0 A;  2L9R A;  4GFB A;  2M0C A;  1XS9 A;  5IP7 J;  4FTH A;  1LFU P;  5EG0 B;  1U9N A;  3H3V K;  3HGG A;  3ZQH A;  1ETY A;  3GTK J;  1FIP A;  1WI3 A;  4BBR J;  3LOC A;  2I10 A;  4IHV A;  2R5Y A;  1TWA J;  4JX5 A;  3G1L A;  1IRZ A;  2WAQ N;  3M4O J;  1MH3 A;  3BTL A;  2L0K A;  2LY9 A;  3LSG A;  3HOZ J;  1X2N A;  3A01 A;  3S1Q J;  2TCT A;  2Y0S N;  4RBO A;  4V2F A;  2LP0 A;  2XPV A;  2ECC A;  4BY7 J;  5EF6 A;  2NVX J;  3WHB A;  3Q0U A;  5FKK A;  5C44 J;  1AHD P;  4D7N A;  3SJM A;  4CYC B;  5IPA A;  3ZQI A;  3HOV J;  4A3F J;  2HXI A;  2NS7 A;  1BL0 A;  2GM4 A;  3BR0 A;  5EDN A;  1DU6 A;  2E19 A;  1IG7 A;  3G1M A;  5F27 A;  1G2H A;  2M9H A;  1IV6 A;  3TP3 A;  1APL C;  1AKH B;  1Y1V J;  1P7J A;  1JTY A;  1ZKG A;  3L1P A;  1O4X A;  1B72 A;  2CUF A;  3MVP A;  1R9T J;  2HOS A;  1PUF B;  3TW6 A;  1ETV A;  2EZL A;  2K9Q A;  1A5J A;  1OCP A;  1BA5 A;  1T56 A;  3FIW A;  4M3E A;  2DA5 A;  4DYQ A;  2CQQ A;  5EZH A;  1ETW A;  3GTM J;  2VKV A;  3HM5 A;  1Z0X A;  1UG2 A;  1I50 J;  5FKN A;  2OPT A;  3JRH A;  4A3B J;  2HYJ A;  1TC3 C;  4A3E J;  3FK7 A;  1ETO A;  4IHX A;  9ANT A;  5F04 A;  1I6H J;  1IJW C;  1HCR A;  2CU7 A;  2QCO A;  4QIW N;  2K9S A;  3LSP A;  2ZB9 A;  3GTP J;  1BW5 A;  5HOD A;  5F08 A;  3S2D J;  4M3G A;  4CYC A;  3S14 J;  3A02 A;  3WHC A;  3K7A J;  5C4X J;  3S1M J;  3BQY A;  1F43 A;  1MH4 A;  2K9N A;  4M3F A;  3FK6 A;  1TWH J;  3HDD A;  1AKH A;  1MSF C;  2WB1 N;  4J19 A;  1MBK A;  4AYB N;  4X6A J;  1LE8 B;  3S15 J;  1Z77 A;  3I4M J;  2R7Z J;  1EF4 A;  2R5Z B;  5F1J A;  1PUF A;  4A3J J;  3TP0 A;  1MSE C;  2FX0 A;  3BQZ A;  2HDD A;  4XRS A;  4A3I J;  4MFE A;  1ZGW A;  5F0C A;  3UKG A;  1JKR C;  2MGQ A;  1MBG A;  1WCM J;  4I76 A;  4NDL A;  1POG A;  1Q1V A;  2XPU A;  4ABZ A;  1YRN A;  5IOY A;  2CQX A;  2VKE A;  2VUM J;  3OIO A;  2JWT A;  3H0G J;  3QPL A;  2LTP A;  3HOX J;  2LK2 A;  1XC5 A;  2HXO A;  2DA2 A;  2ID6 A;  4G12 A;  3OSG A;  2B63 J;  1FTZ A;  2FQ4 A;  2QF7 A;  2JA6 J;  3MN2 A;  1GDT A;  4B4C A;  3I4N J;  2GBY A;  2XGC A;  4DZJ A;  2XGD A;  1E3O C;  2FD5 A;  1GVD A;  4UUS B;  3PO3 J;  2JA5 J;  1VND A;  4FIS A;  1U78 A;  2MSY A;  2K40 A;  2OF7 A;  1OCT C;  5M3F J;  3M3Y J;  5C4J J;  1GUU A;  1LE8 A;  1IC8 A;  1P7I A;  3BR2 A;  2M8G X;  3SDG A;  5K7Z A;  3O8H A;  1JKQ C;  2JMW A;  1W0T A;  2R5Z A;  3CDL A;  2ME0 A;  1XG1 A;  2EZH A;  3VPR A;  1TWF J;  2WV1 A;  3S1R J;  2LKX A;  4AUX A;  4MFD A;  3GTG J;  1ITY A;  3LSR A;  3CMY A;  2FJ1 A;  2IEK A;  5IP6 A;  4HNV A;  3QPS A;  3HOY J;  5K7F A;  4DYC A;  1QPI A;  2YS9 A;  2JJ7 A;  3JRE A;  3OSF A;  2O9L A;  4A3D J;  3BG9 A;  3FIS A;  2COB A;  4BBS J;  3BG3 A;  3W6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...