3HOUJ

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 65
sequence length 65
chains with identical sequence V
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3houJ00
2E2JJ 3GTOJ 2DA2A 2IBDA 5F0HA 4W1UA 4XRSG 3Q0VA 2Y31A 3PO2J 5J1RA 3UKGA 2ELKA 1F36A 2DMNA 1ETWA 1MSEC 3I4MJ 2XGEA 1JTXA 3PM1A 1T33A 3HGGA 5FJ8J 1IJWC 5FLVA 3BQZA 3G1LA 2LKXA 1U9OA 3I4NJ 3ZQHA 1F43A 2ZB9A 2CQXA 2Y30A 3TP3A 4D7MA 4MFDA 3K2AA 2TRTA 4DZPA 2NVQJ 4J19A 2AHQA 2GBYA 2ECCA 2EZIA 4QSHA 4LOCA 1GDTA 1UMQA 4A3KJ 2NVYJ 1P7IA 2DA5A 1JKPC 5C4JJ 5C4XJ 3M4OJ 1UG2A 3JRAA 1TWHJ 4W97A 2B63J 1U9NA 2PMZN 2HYJA 1EF4A 1JGGA 1RKTA 4BKXA 1TWGJ 3CCYA 4DZJA 5E3MA 2JWTA 4FTHA 4XK4A 5EG0A 1BW5A 3VPRA 2K9QA 2G0EA 4A3LJ 2LD5A 2LY9A 4HNVA 4I6ZA 4DYQA 1XC5A 3IH4A 5F0FA 1ZR4A 1VF9A 2HI3A 2MGQA 4A3MJ 3HBLA 1GV2A 2DJNA 3GTLJ 3QPLA 5F04A 3GTGJ 3TW7A 1HOMA 1BW6A 3OSFA 1JKQC 1BL0A 3LSGA 2HOAA 2AO9A 4D5CA 1CQTA 2NS7A 1RPWA 3BQYA 2X9DA 5K7ZA 4A69C 1HF0A 5IYDJ 3B6CA 3BR3A 3JRFA 5EG0B 1RKWA 3TP0A 1RESA 1WI3A 2E19A 1QVUA 1IV6A 3G1MA 1B72B 3HEFA 1NK3P 1S7EA 3IH3A 4CYCA 2LTPA 2Y9YA 1D5YA 3NAUA 1ENHA 3ZQCA 2NVTJ 2X48A 4D7NA 2YU9J 1MSFC 1WH5A 3K7AJ 2ID6A 2Y2ZA 2CU7A 2W48A 1Q1VA 2DA3A 5M5XJ 3QQAA 2YUSA 4CYCB 3BG9A 3JRDA 5EGOB 3JRHA 2R0QC 2MG4A 4EEFG 2R5YA 3OIOA 4C2MJ 4QIWN 1X2NA 3NARA 3HM5A 1MBKA 2EZLA 2I10A 1IG7A 5IP9J 2DMPA 1U78A 1JT0A 1JUSA 4ABZA 4M3DA 3ZQGA 2DMQA 4DYCA 5FLMJ 1WH7A 3S16J 5F08A 4FISA 4JYKA 4A3JJ 1ETKA 2L7FP 1IRZA 3ZQFA 3HOWJ 1ETXA 2K9SA 4QTRA 1TC3C 4BBRJ 3S1MJ 1OCPA 2H8RA 1LFBA 3BR0A 2ME0A 2EH3A 2OF7A 1OFCX 1HDDC 5J3LA 5E3OA 1AHDP 2LLKA 3GTKJ 2M8GX 3GTMJ 1FEXA 2LP0A 3FISA 3S15J 3Q0UA 1FIPA 2L7ZA 2E1OA 5FKKA 2EQRA 4BY1J 2RAEA 4M3EA 3TW6A 2FQ4A 5GPCA 2IEKA 1I6HJ 1X58A 3HGYA 5FKLA 3JR9A 5EZHA 2DA4A 2EBIA 2MSYA 4A3GJ 2XPUA 3H3VK 4IHWA 3ZQIA 2CUEA 4A93J 5EEAA 4M3BA 4C3IJ 1MBEA 2GM4A 1T56A 2HDDA 2XPWA 3HOZJ 1HDPA 1JUMA 3FIWA 3GTQJ 2YS9A 3OSGA 2KT0A 3A02A 2JA8J 4S0HB 5IOYA 4IEJA 3BTIA 3HOVJ 1TWAJ 2LVSA 2FX0A 3BR5A 2M2EA 1MBFA 3BR6A 1BJZA 4Y7NJ 1HCRA 1ZTRA 5F27A 3JRCA 3BTLA 3RZOJ 1JUPA 1FTTA 2VPRA 2O8KA 1PUFB 3BTCA 2L0KA 1Z77A 4MIMA 1VNDA 2DA1A 1QVTA 2WAQN 3SFIA 4FE4A 2Y0SN 4XRSA 4M3FA 4MO7A 4JP0A 2JA6J 2R5ZA 1R9TJ 1TWFJ 2E2IJ 1WPKA 2JJ7A 1IDYA 2QCOA 3O8HA 2LK2A 2XRLA 4RBOA 5JLWA 1AKHB 1H8AC 2X6OA 1QPIA 1RR7A 2JN6A 1JT6A 2LR8A 2JA7J 2NS8A 3BTJA 2Y9ZA 1YRNA 2JA5J 3FK6A 2DN0A 2JK3A 3GTPJ 1UHSA 2R7ZJ 3S17J 2DMUA 2N8GA 2XB0X 3OOUA 5IP7J 5FKMA 1LE8A 1GT0C 9ANTA 2R93J 5BNGA 3A03A 3BR1A 5E3NA 1VI0A 4XICA 2H1KA 1LFUP 4MLOA 4RDUA 4AC0A 2D5VA 3F0CA 4A3FJ 4BY7J 2COBA 5M3FJ 1ZK8A 4FE7A 4M3GA 2WB1N 1AKHA 3TEDA 3GBGA 3HOUJ 3SDGA 3M3YJ 1YRNB 2HOSA 1W0UA 1I3QJ 5FKNA 5M5WJ 3B6AA 4A3CJ 2WV1A 5IOZA 5K7HA 1NTCA 4B1RA 3G1OA 5FKOA 3S1RJ 1JJ8C 2M34A 1PUFA 1DU0A 5EGOA 4UUTA 2VKVA 3CQZJ 1ZKGA 2M9HA 5F0CA 5EYRA 3DCFA 2M0CA 1E3OC 4UUSA 5C3EJ 2O9LA 3CDLA 1APLC 2VI6A 1VFCA 1H89C 1NK2P 1A6IA 5EZGA 4B4CA 3HDDA 2L9RA 2QF7A 4D5FA 2IAIA 1Y1WJ 2HQ5A 4BXXJ 1IDZA 5DTDA 3HKZN 1SANA 2FD5A 3BR2A 5J1YA 3FKIJ 1JJ6C 3LSPA 3MVPA 4UUSB 5IPAA 1Z0XA 1B8IA 1HLVA 3W6VA 3S1QJ 4MFEA 3FK7A 1SFOJ 3JREA 1A5JA 1RETA 3RZDJ 4C3JJ 1W0TA 2P81A 1MBHA 4JX5A 2DA7A 2GLOA 1BA5A 5C44J 4Y52J 4GFBA 1GUUA 3IV5A 1IGNA 5JLXA 2XPVA 4I76A 3RQIA 2MW8A 2FJ1A 1XS9A 1ORKA 2NOGA 5E3LA 3HB9A 3QPSA 4A3BJ 3S2HJ 2ME6A 2CQQA 5IYCJ 4AUXA 1ETYA 4FCYA 3Q0WA 3Q3SA 1IC8A 3S1NJ 3S2DJ 2R5ZB 1H88C 2E2HJ 4V2GA 1WCMJ 1ZR2A 2XB5A 5M5YJ 1LE8B 2OPTA 1MBGA 4X1EA 2LFBA 2KDZA 4JX6A 3DEWA 3LSRA 4B3AA 4IHYA 1MBJA 3IH2A 2DTZA 3A01A 2NVXJ 4A3IJ 1U8BA 5J1UA 3C2BA 1I50J 1ZQ3P 1FJLA 3WHCA 2R5YB 2HOTA 3SJMA 1Y1VJ 5DS9A 4XIDA 3BG3A 1TWCJ 3L1PA 3D1NI 1FIAA 1GV5A 2K40A 4AYBN 2HXIA 2CRGA 1WGXA 3BG5A 1DU6A 3S14J 2K9NA 3A01B 3CMYA 4A3EJ 4A3DJ 1FTZA 3JRIA 1B8IB 3JRBA 4G12A 4C3HJ 1B72A 3RKQA 1X2MA 5EF6A 1O4XA 3HOYJ 2XGDA 2L7MP 4DYRA 5IP6A 2DA6A 3LNQA 1JKOC 1QRYA 2CJJA 5K7FA 3ZQLA 1P7JA 1IUFA 1AU7A 4V2FA 3PO3J 3MN2A 2VUMJ 1K83J 5GPAA 1POGA 4DW6A 2XSDC 3LOCA 5EDNA 4JX4A 3HOXJ 3LSJA 3E7LA 4L5EA 2EZKA 2ECBA 2DMTA 1GVDA 1G2HA 3O8GA 2R92J 1MNMC 1MH3A 5IYBJ 1OJLA 1JKRC 2CUFA 3ZOBA 2EZHA 2HXOA 1ETOA 5GP9A 5F1JA 3GTJJ 1ETVA 3MKLA 2JMWA 4IHXA 1JTYA 5M3MJ 4XRMA 2ID3A 4X6AJ 1OCTC 2TCTA 2O7OA 3WHBA 5HODA 4M6VA 1ETQA 3JRGA 4IHVA 3BT9A 3H0GJ 1ZGWA 1ITYA 1XG1A 2VKEA 4BBSJ 4NDLA 1MH4A 2XGCA 1K61A
chains in the Genus database with same CATH superfamily
5L3CA 3IP4B 2PJRA 2E36A 4XRSG 1REPC 2W7NA 4MTEA 4CCJA 3UKGA 1GHCA 2ELKA 3I54A 1KU9A 2JSPA 5D6FA 3GF2A 3OR2C 3I4MJ 2XGEA 3PFIA 4Q47A 3QU6A 1NHAA 2KQRA 3K2ZA 4WK8F 2P5VA 5FJ8J 5DUKA 1MMNA 1UELB 1L3LA 2NXNB 3IUOA 4N9IA 1R5HA 4WWCA 5F64A 4I2OA 2Y30A 3TP3A 4D7MA 3CDIA 1BR4A 2K5CA 1R58A 4MFDA 4DZPA 1VQ7I 3F8CA 2ZJRF 4HX7A 2EZIA 1UMQA 2XKOA 4A3KJ 1P7IA 2KRCA 3GZNB 1JKPC 4KISA 3J81K 3M4OJ 2VLAA 4XNFA 4IL6C 4IHSA 1K7AA 4BS9A 2PMZN 4BNCA 1BI1A 3OOPA 1R00A 3HJEA 2VN2A 3WE2A 1RKTA 5LEKA 4FASD 2IVMA 3KEOA 2H6BA 2MC3A 2FE3A 2X6WA 3M1EA 3BC8A 1ZG5A 1H9GA 5CPRB 4OMZA 1RIOH 2BV6A 5DD8A 2R3SA 4E7IA 3CP2A 1BIAA 3HSFA 2CQNA 3VPRA 3W2WA 2GA2A 5EG0A 3CLOA 2A5YB 2M1BA 1GXPA 6PAXA 1OYWA 2DOFA 2GA1A 4Y4RA 1KQ0A 3BJOA 4FETA 3V8JA 3OY9A 2KJBA 4I6ZA 4B48A 4DGWB 1OCRH 3IH4A 4E7ZA 1GV2A 1KU7A 2QGUA 2Y69H 3TW7A 5HS9A 3SZPA 1BL0A 4GYGA 2AO9A 4BQOA 4QPQA 4BQQA 1LNWA 1LDKB 3A0HC 3I5UA 2QWWA 4EJVA 4U7DA 3AAFA 3B6CA 2OQGA 3JRFA 1BOAA 1RKWA 1T38A 2LOOA 2WWYA 1QQIA 5HLHA 3LAJA 4LIUA 1WI3A 3CP8A 3SYTA 4JBAA 3CCQI 1RUOA 4PUSA 2G7HA 1LJ9A 4EQQA 2R7UA 3M8JA 1B72B 4I09A 2IS6A 3QP6A 3QP5A 4L18B 4UXNA 3A0BC 3ZQCA 2NVTJ 3OL4A 1WH5A 3J7AO 1V4RA 2Y2ZA 2HVQA 2W48A 5HLTA 4E7HA 4V19K 3KX2A 2BW3B 5LRSA 1ZN2A 3ULQB 1VQ4I 3F8FA 4XLFA 3JRHA 2DODA 2NOJB 4MGRA 2X1DA 1MMDA 4QIWN 4WX9A 2I10A 2IS4A 1BI2A 4N4NB 3ERMA 1HW2A 3CC7I 1XX5A 4M3DA 5D4RA 2WADA 3KP6A 3ZQGA 3SDBA 2DMQA 2VQHA 3CCEI 4EJTA 1DP7P 2F5DA 3ROUA 4KITB 1KA8A 4FISA 3E5XA 2PLYA 4BQNA 2VT3A 1ZHFA 3DU5A 2CW0F 3VYUB 4BBRJ 1OCPA 2E34A 3LA7A 3BR0A 4FQGA 3GO5A 2K3PA 1E17A 1QPMA 1L0OC 5LD2C 4XLAA 5J3LA 1QGPA 2D2WA 2UXXA 3W3CA 2DI3A 2H94A 2ADUA 1Z91A 3FISA 4XQFA 1YTYA 4ENKA 5BPDA 1FIPA 2CFOA 2O0YA 3J7ZI 3GX4X 1FYMA 3C2HA 4HAMA 4BH9A 2HNHA 2NYXA 5FKKA 3R6SA 4NQWA 1X1AA 3UR3C 4BY1J 1DPRA 2M4GA 1WVRA 5E18F 4I99C 4GRIA 4HDVA 5E1ZB 4Y17A 1I6HJ 1X58A 1R71A 5FKLA 3B02A 3GCMA 4A3GJ 3H3VK 1U0JA 3Q5FA 2DFFA 3VFZA 2MBFA 1D0ZA 3JW4A 5EEAA 2CG4A 2DLLA 1B1BA 2RN7A 1E3HA 2HDDA 3HOZJ 3S32A 4L9JA 1V3FA 4MQVA 5KVRA 2M7AA 2ICWG 2P7VB 3AFHA 2KT0A 2JA8J 2KMUA 2DYSH 1VZ0A 3CCSI 4HX8A 3OYGA 2R4GA 2LVSA 1J09A 4H4KC 4NB5A 4PJMA 5CVIA 1FX7A 5DDGA 2ZJQF 2HDWA 3JAMZ 1Z3XA 4UB8C 3S8PA 2GZWA 3HTUA 1D3YA 3BTCA 4L0YB 3L7WA 3M9AA 1D8JA 1FPQA 4PCQA 4MIMA 1SD7A 3L2RA 3K4CA 4HEA2 4D0PA 1Y56A 3TKYA 4RM3A 3SFIA 4AD9A 4P9FA 2Z16A 4XONA 3T8RA 2PI0A 1V54H 2BZTA 2UV1A 3J81Z 1TWFJ 1Y6IA 1FSHA 1WJFA 4Z2YA 3O8HA 1AKHB 1K4SA 1QU3A 1SVOA 1RR7A 3LQRA 2JN6A 2LR8A 2JA7J 4B3XA 1BBYA 3BTJA 3K1PA 4A0YA 4MNUA 4R8HA 2Y9ZA 3P9CA 3ONQA 1I1SA 4CHUA 3D0SA 2EV0A 3HRMA 3OYHA 1SVLA 1YE9A 5BNGA 3FXLA 2DOEA 2X1EA 5KK1A 2HTSA 5E3NA 3BOQA 1MJAA 1VI0A 4E7KA 2E7WA 5E17F 2DOAA 2VT2A 2JPBA 4RGSA 1FLIA 2D5VA 3DEUA 4A3FJ 1I1GA 3FXUA 2COBA 4KA4A 3VSLA 1OLTA 4M3GA 4NC8A 3FBNB 3GBGA 4DJAA 3HOUJ 3OWTA 2EFNA 3RKXA 4ENJA 1YRNB 1ODDA 1R1TA 4IRHA 5LHIA 4ON0A 3CCJI 4C2UA 3FXRA 3C1DA 3ZN1A 5K7HA 2L2OA 1PYVA 1XTAA 2X0LA 1JJ8C 2H1LA 3WGIA 2M34A 1PUFA 2ELHA 5EGOA 4UUTA 4EATA 2XVCA 1P6RA 5LGNA 2DTRA 3LFUA 1QO0D 2LREA 4U0VA 2ZNZA 3GLLA 3W2VA 5KAIC 5J8FA 3E5QA 2JRTA 4F52A 2DK8A 2O9LA 3CDHA 1ZELA 3KP7A 1X1DA 5HLIA 5TRDA 2VI6A 1VFCA 1FZPB 1H89C 3REOA 1V5GA 1A6IA 2QKMB 2HPIA 1UAAA 4JOMA 5EZGA 2XC7A 1R1UA 3HPHA 2A69F 2OAZA 2IAIA 1A35A 1EH6A 2HQ5A 3KLOA 2L4AA 4EVIA 1IDZA 2ZMEA 1X1CA 2EINH 2OTJI 3H92A 2FD5A 1LPQA 4LK1F 3LSPA 3MVPA 4UUSB 5IPAA 3BG6A 2QM3A 1Z0XA 4HBLA 1UHWA 1B8IA 2R7QA 1HLVA 1YI2I 2EFOA 3KP2A 1OKRA 2RDPA 3I4PA 4YRVA 2B9SA 1DPUA 2VODA 1RETA 3J80Z 1W0TA 4IQJA 4ZC3A 1BR1A 1MBHA 3L2QA 3DPLC 2EB7A 4XBFA 2K86A 3IV5A 1ZAOA 2XPVA 2ZFWA 3ASNH 3HG9A 4I76A 4U0WA 3RQIA 3OYMA 3WTVC 2EPFA 2ZJ2A 3RI4A 3HB9A 3QPSA 4A3BJ 2ZFUA 3DFGA 5IYCJ 4AUXA 4KIBA 1IC8A 3IWZA 2RREA 2R5ZB 2DK5A 3QYFA 2A6EF 1PP8F 1XPXA 5E79C 1Y8RB 2LRDA 2XB5A 2O03A 2OPTA 3L00A 4X1EA 2RNJA 4JX6A 3DEWA 4BL0B 3GYHX 4PSXA 2JPCA 3OS0A 2WTEA 1T0FA 2PX9A 3R60A 1U8BA 3C2BA 1FJLA 2JQ7A 5KHDA 2OQRA 2YSRA 3NEUA 1LDJA 5DS9A 3TQNA 2YU3A 3PL8A 2DO7A 3BG3A 4E70A 1YX3A 1UB9A 3L1PA 4XRFA 2GIZA 5CYVA 4AYBN 1WGXA 2BVMA 3S14J 3E97A 3C18A 1AWCA 4RGRA 3FHZA 1ZLKA 1VQMI 2H27A 4WXCA 5EJCA 4G7OF 3H0DA 3IAM2 2A3SA 2XHKA 5ILUA 2VPLA 3ABKH 1O3TA 4F93B 2MD0A 1YIJI 4HDUA 1X2MA 2I5UA 3HOYJ 1AOYA 3L2WA 3HPGA 3LNQA 1J59A 2LF7A 3ZQLA 4PFPA 2QQ8A 5H20A 2Y48A 4XKWA 3MN2A 5DYMA 2A05A 1QNTA 4RGUA 2Z1DA 3LSHA 2BYVE 1FC3A 2HR3A 1DQUA 3HYIA 3KZZA 1JI8A 1G3YA 4IOAF 4L5EA 2ZSHB 4IVNA 2EZKA 2ECBA 2FQ3A 3I59B 3OYEA 3WU0A 5LFAA 2DQLA 3QWLA 2HYFA 1JKRC 1NG6A 1FOWA 2CUFA 3DKYA 3VB2A 5FLXZ 3DEEA 3KYLA 1T98A 4UV8A 2JSCA 3D5RC 5EEHA 3BPVA 1JTYA 1HKQA 4IHXA 4OIPF 1M1EB 1OR7C 1X3UA 2LKPA 3WHBA 4BHBA 1TT0A 4MTDA 5F1RA 3G73A 2CW7A 1WRJA 3JRGA 3QRFF 2ZXWH 4UB6C 5HS8A 1X19A 4FHTA 2BHZA 3F3XA 2AQEA 3MD2A 4E7SA 2VBWA 2X4HA 2A61A 4Z6YA 2CSOA 1USTA 3GTOJ 3HRTA 2IBDA 1D1CA 3BY6A 1IXRC 4BDZA 5GAEJ 5F0HA 2HKOA 3ABTA 1SC7A 2GXGA 3Q0VA 3U21A 1OISA 2K4JA 3CC4I 2ZXHA 5J1RA 3Q9VA 3PQKA 2DMNA 1LB2A 2FF4A 3J7YJ 2PFBA 1S5LC 2L01A 1JTXA 5DV5A 5FFZA 1T33A 4CH7A 2R7VA 5E8GA 1HW1A 3QPHA 4CZZA 1IZ1A 3F21A 3I9V2 4UVBA 4CUGA 2L5QA 4M73A 3CUQA 4AWXB 2ESHA 2BY1A 3KEYA 2CQXA 2FRHA 3EETA 2EFPA 3K2AA 2TRTA 2E1CA 1YJWI 2XUBA 4IJAA 3WTXC 2HFHA 2AHQA 2GBYA 2ECCA 2KRHA 2KDOA 4QSHA 1GDTA 3S93A 2L02A 1K78B 3FX3A 2DA5A 3G3ZA 4LK0F 3BWGA 2AXLA 1JHHA 2A6TA 3WTUC 5C4XJ 4PK4A 3CUOA 1TNSA 4LB5A 1TWHJ 3EUHC 4W97A 3VWBA 1IXCA 4J01A 2B63J 3O6BB 1EF4A 1BM9A 1BI0A 2NNYA 5K1YA 1TWGJ 1RR8C 5TJJA 4UV9A 4XK4A 2DXIA 1I6XA 2K9QA 1W5CC 3BCAA 2DBBA 4B47A 1YFHA 3RTRA 2DW4A 2F4MB 3WODF 1S7OA 2LY9A 2R7SA 2XKPA 1HKTA 2WV0A 3GZ6A 4DYQA 5F0FA 3M8EA 2OCCH 3ZRGA 2Z3YA 2COMA 1Z9CA 1BW6A 3RCOA 3OSFA 2NAZA 1MKMA 3RPUA 4D5CA 1HBXG 1PDNC 1HF0A 2X9DA 2QA4I 3CJRB 5D5VB 2JTVA 5J8CA 1UG0A 5EG0B 4ESJA 3ELKA 3V7SA 4BEHA 1QVUA 1O3SA 1YG2A 2V1DA 3ZMTA 4IZZA 5JFRA 1XGMA 4BU2A 3FXJA 1NK3P 5FD6A 1QZYA 4CICA 1X4OA 4RLFA 2HOEA 1HW5A 3CUQC 3R0JA 3MKZA 2OZUA 4XMYA 2DA3A 4BEHB 1RC9A 4XLCA 1UHMA 2E1NA 3VODA 3JRDA 5HDNA 2FU4A 3OIOA 5FRNA 2DDBA 1YW7A 2QVOA 4C2MJ 1XD7A 3MEXA 3NARA 1PP7U 2WBMA 3H36A 5IP9J 3N97A 1VQ6I 1U78A 3FXQA 4GCVA 1ZG1A 2HWVA 1XCBA 4IOCF 2FBHA 4IHTA 1WI9A 2BY2A 4QPOA 2X6YA 3TDUC 3AG1H 4O6JA 3OIPA 3K70D 3S16J 3GWZA 5F08A 1J7KA 1ZG3A 1ETKA 2L7FP 2M4KA 3HOWJ 2BVLA 1ETXA 2Z33A 3PNYA 4QTRA 2CMPA 4GDFA 3R61A 2H8RA 1LFBA 1LVKA 1QHHD 3GW2A 1Z67A 2ZMEB 3BPXA 2EH3A 3FXKA 4YFKF 3HUGB 3JCUC 2JVGA 1W1WE 4LG0A 1YLFA 2ZKZA 1AHDP 5E3OA 5LGTA 4HG2A 2DT7B 2WAQA 1FEXA 3PIPF 5FGMA 3SXYA 1YHQI 3S15J 1G3WA 2L7ZA 3OS1A 4WF2A 4L5IA 4BACA 1SAXA 3TBIA 1S3JA 3C7JA 3LSIA 4M3EA 5GTHC 1TQMA 2FQ4A 2GOMA 2BXZA 2J5PA 2JRMA 5GPCA 2GOXB 3HGYA 3JR9A 1P4AA 1JHFA 2EBIA 2ZC2A 5IT9Z 1XSVA 2VB6A 1SFXA 5K5OA 2MABA 1ZRFA 1HC8A 1PVEA 1BC7C 1G8XA 3VYTB 1T56A 3BZKA 2CGPA 5EEGA 2XPWA 1MD0A 1W7PD 1HDPA 1XCVA 2E7XA 2DT5A 3AL0B 2YS9A 1UFMA 4XKCA 1KZHA 2B0LA 3PSIA 1TZLA 5ICFA 3AG4H 3GZ5A 3FM5A 4XSXF 3IWFA 5D6EA 5IOYA 1Z05A 5BMZA 2DU9A 4PDKA 3GFLA 1ZTRA 3NQOA 3JRCA 2GXAA 4CDGA 3CJQB 3RZOJ 1ULYA 2FSWA 2QQ9A 2UXNA 4N4OB 3ECOA 3KLNA 4F3QA 1LQ1A 3G4SI 2BBYA 1X1PA 5CJ9A 4YIIA 2O8KA 2IPQX 5FRMA 2R7RA 4ZTFA 2L0KA 2VJIA 3HRUA 2MLKA 3DBLB 2DFHA 2HEOA 2DA1A 1BC8C 4XOTA 4CCOA 4LGWA 3EYIA 3U2RA 2Y0SN 4XRSA 1BR2A 1HSJA 3DQVC 4MO7A 3WTTC 5IT9K 2QSHX 4CSWA 1W36C 1Z7LA 3LWFA 1EJ9A 1GXQA 5FROA 2XRLA 5KNLA 2VQLA 5JLWA 1H8AC 2E5ZA 3E6MA 3CMMA 1G3TA 3LL7A 1QPIA 2QBYA 4M9XA 5TGTA 3WU2C 4UUVA 3FK6A 2VC0A 2R7ZJ 2QYOA 1SFEA 3H5RA 5KAFC 3HOTA 1VQNI 4E7LA 3HTSB 2QSFX 3TO6A 5IP7J 5FKMA 5AIPA 3OYJA 3K1MA 1S7AA 4PZJA 1TQPA 1S29A 1XB4A 4HF2A 4KMFA 3K4KA 4EJUA 3MKWB 2P6TA 2RVCA 2HS5A 2GWRA 1T39A 2H1KA 4MQ9F 3IKTA 1V5FA 5ICGA 3H1CA 4ZYGA 1WJDA 1H9TA 2EIJH 3DTIA 1IXSB 1UJ8A 4AC0A 3F0CA 3I59A 5CQGA 3HHGA 4BY7J 1IO2A 5M3FJ 1N78A 4FE7A 4K2EA 2WB1N 1Z3YA 3TEDA 3OL3A 3SEZA 4D1QA 2QSGX 4NC7A 1YQAA 2CH0A 3S3OA 4M74A 4A3CJ 2QKLB 4BDYA 2WV1A 3K4JA 1ZRDA 4ZTJA 3TO7A 4B1RA 1RNLA 1XN7A 2K9LA 3ISPA 1U5TB 2P0WA 2E35A 2OC6A 2LG4A 3CQZJ 4BUPA 1ZKGA 1S6LA 3FMQA 2FBIA 4IX7A 3DCFA 4OWRB 1MDMA 5E1XA 1E3OC 1W5SA 5C3EJ 1XSDA 3O2PE 1I39A 5GAGJ 3CMEI 1APLC 2HTJA 3MZ8A 3CJTB 3SQNA 5GTIC 1WJEA 4KUMA 2P4WA 4TV7A 1YW8A 3BP8A 4XM3A 4BE2A 1Y1WJ 5DTDA 1DUXC 2BXYA 5CVJA 2EFQA 2X6XA 1RI7A 3F8MA 3W6VA 4D9JA 1KYZA 2DT6A 2W85A 1SFOJ 1S8NA 3JREA 5CQEA 4BHPA 1FWZA 2MA3A 3RZDJ 2AS5F 2EIKH 4JX5A 3PIOF 2DA7A 3F6OA 1BA5A 5C44J 2LY1A 5DD4A 1IGNA 2LC2A 2OZ6A 2DCEA 4KIGA 2FJ1A 2L9NA 5DCMB 3FHNA 5CVUA 3E3VA 2HU9A 1PJRA 2ME6A 2CQQA 4XSZF 2A5WA 1ETYA 3Q0WA 5GAHJ 5B1AH 3S1NJ 4LFUA 3DTKA 1MMGA 3CCVI 1H88C 3CZ6A 3P9IA 4V2GA 5D5UB 1IRGA 2CW8A 4I0AA 3I56I 1ZR2A 5M5YJ 1LE8B 3ABLH 1B59A 2JUCA 2EFWA 1YX5A 1R4MB 1OPCA 4RA2A 2QENA 2NVXJ 4CGZA 3A2KA 2IA2A 4CCNA 5J6XA 3VDXA 2O5RA 2R7XA 1ZQ3P 1MJBA 2LY2A 4EGYA 3WHCA 4I7HA 3HSRA 2HOTA 3SJMA 4G94A 1C0WA 4FT8A 1TP4A 1TW2A 4DBQA 1FIAA 2V9PA 5FFXA 1MJ9A 5LBQA 2CRGA 1HSTA 2L9VA 2XAGA 4E6KG 5J4VA 2LBFB 2K9NA 3ZMZA 3A01B 3CC2I 3GUDA 2BHYA 3DP7A 1KGSA 2CQ7A 3K4MA 2M5WA 4A3DJ 3F6VA 5JR3A 2EV5A 1B8IB 4C3HJ 1O7FA 4I0BA 3RKQA 1B72A 2IS2A 2XGDA 3OR1C 2DA6A 1JKOC 3J7AY 3S3MA 1RRJA 1QRYA 2CJJA 5K7FA 1P7JA 2VBZA 4YFXF 5LEJA 4P9UA 3L2UA 1ON2A 3Q9SA 2XSDC 3FMRA 1Q1HA 5D4SA 1SD4A 3HL2A 5EDNA 3L2VA 2VOPA 1FOKA 3HUGA 4U7BA 1R7JA 1V55H 2EJRA 2F5EA 2FMYA 4RMNA 1F5TA 1V5EA 3SZTA 5FO5A 1G2HA 4NC6A 3RYPA 2ZXJA 5IYBJ 4XLPF 1G4DA 5CVVA 2VBXA 4KN7X 1T8IA 3OS2A 2LDUA 3NRVA 4IPAA 2EZHA 3GTJJ 1O3RA 2HGCA 1CF7B 3ZMDA 1VQLI 3HRSA 3MCZA 4RS8A 3CESA 4ZJZA 2NNNA 5H6QA 3TGNA 3FMSA 2L7KA 4XRMA 1K6OA 3KEQA 1TT5B 5HDKA 2TCTA 1ETQA 4U0YA 4Y3OA 1X4PA 3SHFA 2MFZA 4ENNA 3BT9A 4WCGA 2Q8KA 3MAJA 4BBSJ 1YOVB 2K3FA 2XGCA 4ESBA 4AIJA 1N25A 3EUAA 3L09A 4KN4X 2E2JJ 3OMYA 4H0EA 5L3DA 1X1BA 3DV8A 1W5TA 1U3EM 1W7PA 2H09A 2Y31A 3PO2J 4AIDA 4AVZA 3RKYA 1YIOA 3DTEA 4OAYA 1F36A 3D5SC 2ZXIA 1IN7A 4A2UA 2K7LA 2Z2SB 1MSEC 4PJNA 2PN6A 2CYYA 3F22A 3R4KA 4RAYA 3ZMVA 2P7CB 4BQAA 3BQZA 1ZRCA 1U9OA 4LJZF 3ZQHA 4I01A 3N05A 4GO1A 5BQTA 2DPUA 4OOIA 4Q4ZF 1EV7A 3K4NA 2ISYA 1JE8A 1SFKA 2FOWA 2X1CA 2HQNA 2NVYJ 4KT6A 2OJED 3HSEA 2MC4A 1XMXA 1A04A 2F5FA 1UG2A 5LLQA 2HKXA 1R6RA 3OYNA 3V8LA 2HYJA 2W00A 2E1MB 4KMUX 5IY5H 1YITI 1JGGA 3FF5A 1FYLA 1X3ZB 3ABMH 2OTLI 2KIMA 3E6BA 4MEYF 2F6CA 1FMWA 2JWTA 4FTHA 2XGXA 1MNEA 4L0ZB 5K5QA 1FBQA 1MIJA 3MWMA 2G0EA 4HLXA 2V1NA 2QEXI 4OIOF 2LD5A 2YR2A 4EM2A 4HNVA 4G7HF 4G6DA 1QBJA 3GFMA 3ZPLA 4DNCA 1XC5A 2HI3A 2VJ5A 1U2WA 1R5ID 1WJAA 4U87A 4A3MJ 3HBLA 3WGHA 4NBQA 3GTLJ 3GTGJ 2FBKA 1HOMA 1JKQC 1E2XA 2HOAA 3LSGA 2KHMA 4RM2A 4LLGF 1SVMA 1YJ9I 2WC2A 5J40A 3WGGA 1CQTA 1D5VA 3BQYA 3RQ4A 4A12A 2LBFA 4II2A 5IYDJ 2IJLA 2EILH 2XAHA 3BR3A 4B43A 2Q2EB 1RESA 3CO6C 2ZSIB 3SZGA 2E19A 3HKZA 1IV6A 4A5NA 3V7RA 4EM0B 3HEFA 4O3MA 3EQLF 3IH3A 4CYCA 2Y9YA 4XKBA 1D5YA 2A68F 3OYFA 1ENHA 4HZFA 5CVRA 3ZQ7A 2X48A 4D7NA 4KIFA 2Q0OA 4ITVA 2NVUB 2QQAA 5LHGA 2CUJA 4IRIA 3NWSA 4HV5A 2KZGA 2F48A 1OR7A 2Q2EA 2YUSA 4BAYA 4N0BA 4CYCB 2MD5A 3ERED 1P92A 5EGOB 2XSJC 2R0QC 2DFIA 4EEFG 2D1HA 2R5YA 5E1WA 2W25A 3KIOA 4CO8A 5J47A 3KE2A 4II3A 5DCFA 3HM5A 1MBKA 3TO9A 5DEQA 3RKWA 3V4GA 3UNGC 1JT0A 1JUSA 4WXHA 2R7DA 3N4MA 2MYSA 3FZVA 2BW3A 1BN5A 3B73A 2KIQA 4JYKA 4Q5SF 3O3KA 3ZQFA 2KFDA 2K9SA 1KU2A 1TC3C 4Y13A 2R7OA 3S1MJ 2ME0A 4Y15A 1D1AA 1XDSA 5AONA 1HDDC 4L9TA 2M8GX 2Z5UA 2VXDA 4KNYA 1Z6TA 5HDGA 2E71A 3Q0UA 2V4JC 2BY0A 2K02A 4M72A 4BYYA 2JVHA 2M45A 3P7NA 2E1OA 5D5WB 2EQRA 2HZDA 1S9HA 3U1KA 2RAEA 1MDMB 2O6GE 2WAFA 3CF2A 2IEKA 2HZTA 1P2FA 2PG4A 4BHCA 5B5EC 1A31A 3CTAA 5EZHA 4HX4A 1ERDA 4RB1A 1FSEA 2MSYA 1X3WB 2HPMA 4IHWA 3ZQIA 2BEOA 3CCRI 4A93J 4M3BA 5HOOA 1MBEA 5FD5A 4LITA 3OIQA 1WJCA 1FOYA 1JUMA 1IF1A 3WTWC 2H8WA 3KFWX 3GTQJ 1HQCA 2BY3A 4FX0A 3K10A 3ZGKA 4HRIA 2RQQA 1VQKI 4ZDPA 3PSFA 4IEJA 3BTIA 2E5NA 1D0XA 2XAFA 1W7PB 3BR5A 1J2XA 2KRFA 1BJZA 1HCRA 2UWMA 1ACIA 2GAUA 5F27A 1K79A 1R36A 3BTLA 3JAMK 4CCLA 2IA0A 4E7JA 1Y39A 3ZMSA 1WKMA 2XAQA 1VTNC 2HYGD 5IT3A 2CUZA 2KIFA 2R7TA 3DPTA 3LQQA 4ENMA 1Z77A 2RNGA 3BJAA 3I3LA 1OYYA 1Z21A 2NS0A 2V1UA 4C2TA 1QVTA 5LRRA 1XGNA 4DQ2A 2K4BA 3R0AA 2WA0A 2JA6J 2R5ZA 1R9TJ 1IDYA 4G8XA 2LK2A 4RBOA 1ZLJA 3G6EI 2IW5A 2M3AA 2NS8A 2DN0A 3TOAA 2JK3A 2P6SA 2FEZA 1LFPA 3ZN0A 1K6YA 2DDAA 2DMUA 2N8GA 3OOUA 2W84A 2RV8A 1GT0C 9ANTA 2R93J 2XF6A 4A5MA 3LA3A 1SD5A 2STTA 1GVJA 3QU3A 1UCRA 3DLLF 4IO9F 1LFUP 1KONA 2XV4S 2OV7A 4MLOA 2KKOA 2L54A 1LEBA 5D8LB 2FMLA 1ZK8A 3NWTA 3E0JB 2HQAA 3CJNA 4HSRA 4OU0A 1FMVA 3M3YJ 2HOSA 4R1HA 3E1SA 1W0UA 1I3QJ 1OCOH 3JSOA 1TL8A 3T1BA 2G9WA 2M8EA 2LH9A 1BI3A 2VQCA 2OA4A 4LIVA 2VKVA 4HV6A 1N77A 5ILVA 2M9HA 4RB0A 5F0CA 5LHHA 2KIUA 4P55A 3K70C 2FNAA 4G6QA 2OBPA 3RYRA 3ZMUA 1JXSA 1CGPA 1E3PA 4BE1A 4UY8I 2ISZA 4UUSA 3T0YA 2FA5A 2Y0SA 4ZZLA 3CDLA 2HDCA 3KZYA 4FX4A 4XN3A 3OYLA 1B4AA 4B4CA 3ASOH 1USSA 2QF7A 4D5FA 1K4TA 4BXXJ 3F8BA 1LVAA 1ON1A 2V26A 3V42A 3PUFA 4A6DA 3FKIJ 4C9YA 1G6NA 1JJ6C 3CD6I 1EA3A 1FT9A 4BXFA 4LG0B 1OYIA 3EDPA 1R1VA 1E0EA 3S1QJ 1BIBA 3CO7C 4B44A 1A5JA 2ELJA 4AIHA 2VJ4A 4P5OA 4P96A 2P81A 2PQ8A 4LD5A 2H6CA 2V6CA 1PUEE 2GLOA 1YJNI 3W6KB 1MMAA 3DF8A 4Y52J 2G7UA 1A6QA 1DDNA 1I3AA 3I53A 1KYWA 2MW8A 4G9YA 2F5VA 2JT1A 3CF5F 1ORKA 2TDXA 4QLCU 1EH7A 1ONVA 2DFEA 4IF4A 4BJTA 1FBSA 3K0LA 5DM7F 3K1NA 3GXOA 2E2HJ 1STZA 3PUBA 3BZCA 3RSNA 2KL4A 2YPRA 3H9JA 5B1BH 5BS6A 2GIVA 1EKEA 2KDZA 3LSRA 5L3GA 1MBJA 3IH2A 1VQPI 3L9FA 3I0TA 2CO5A 2RQPA 4A3IJ 5FB2A 3IRQA 3BZ6A 5J1UA 1R5GA 4GGGA 2YX4A 3WG9A 3I58A 4RB2C 1Y1VJ 5HLGA 4IQ4A 4LG3A 3WE3A 3H35A 2HVRA 1KU3A 3LMMA 5LGUA 2K40A 4HQMA 4YG2F 4CXFA 3BG5A 3SEQA 4AVPA 1DP3A 4LB6B 3FXOA 3CMYA 2WY7Q 4GYIA 5JVTA 2PJRB 1O7LA 1F9NA 2XDVA 4A6EA 3F23A 2ACJA 3OYKA 2PBIA 1A36A 1QZZA 1FTZA 2E1MC 2VL8A 4G12A 3G71I 1R49A 2LSOA 2CQKA 2BE5F 5IP6A 1U5TA 2V9KA 2EWNA 4F92B 4F55A 4ANJA 1TBXA 1KQ8A 3E6DA 4MHGA 2IS1A 1K83J 5GPAA 1D0YA 3RPUD 4AU7A 3E5UA 4DW6A 1NG7A 3LOCA 2DJIA 2IGOA 4M71A 3JSPA 4LLLA 4HF1A 4S04A 1MNDA 3HOXJ 3HHHA 1FNNA 2W4SA 4XOPA 4BGDA 4UNOA 4XLEA 3HXLA 2DMTA 3QPTA 4IXAA 1GVDA 4ZYEA 3O8GA 2R92J 2K85A 3GMEA 2O3FA 2VXZA 1OJLA 3MZYA 2VJJA 3ZXSA 3BROA 1TQIA 4LMYA 3AG3H 4ZYAA 3ZOBA 3DWLE 1QZEA 5GP9A 5F1JA 1WQ2A 1ETVA 3G2BA 2QUFA 2JMWA 4MEXF 4Y33A 3KYCB 5M3MJ 5D8KB 3DBHB 4X6AJ 2XF7A 4A0XA 2PMUA 4XLHA 4F91B 2O7OA 5HODA 4PJJA 4EMSA 2VKDA 1WJ5A 1XGSA 1LKXA 1YO5C 3WU1B 1S72I 2GQQA 3H0GJ 2GXBA 2XIGA 1ZGWA 3A1YA 1MH4A 5HNHA 1P4XA 3QYBA 1K61A 1WHUA 4UHTA 3RIRA 4DBRA 2DA2A 4RLQA 4W1UA 3ZQQA 3H9GA 4XR6A 5D5XB 1KQ9A 3PNVA 2V7FA 1T95A 3AG2H 4HPQA 2UZKA 1FYKA 2VC1A 3FXMA 1ETWA 4PJ0C 3AKZA 2CV0A 1B6AA 1IV8A 4BJ6C 1HA8A 3DXJF 3PM1A 3LAPA 3IL2A 3HGGA 2VBYA 3HOSA 1OMIA 1IJWC 2XAJA 5FLVA 3G1LA 4I98B 3WTSC 2LKXA 1SFUA 3T5XA 3I4NJ 1F43A 2ZB9A 2CWEA 3DPUA 3DBRB 1IUYA 2NVQJ 3KETA 1IRFA 4J19A 1IRXA 4LOCA 2P5LC 3IRRA 5C4JJ 4E4HA 2DPDA 1WZ2A 2UUZA 3TMOA 5A2QZ 3LA2A 2VONA 1WSUA 4HNTA 3JRAA 3FWEA 3PNTA 1DGRM 2FUG2 3I71A 3ML6A 1U9NA 4HQEA 4YIRX 3KCCA 3E6CC 1TLHB 4BKXA 3LSKA 1H0MA 3KPHA 2L9SA 3CCYA 4DZJA 5E3MA 1BW5A 2Y0MA 5ICEA 1Y8QB 2F4IA 1UZCA 4A3LJ 3ESWB 4JQFA 4IKFA 4CA0A 1YS7A 2Z99A 3GFIA 4L9NA 1IAWA 1ZR4A 2I8DA 1Z6RA 1VF9A 1ZGAA 2MGQA 4HOBA 3F72A 3KP3A 3SFZA 3VSKA 2QLZA 3AL0C 2DJNA 3QPLA 5F04A 2KPMA 4O5VA 3I64A 1BJAA 4CCKA 5L3FA 2NS7A 1RPWA 5K7ZA 2ZJPF 4A69C 3WTYC 1G3SA 4ESFA 4M9SA 4C30A 1G59A 3TP0A 2DAOA 5J4YA 4CYDA 1IW7F 2PJPA 3G1MA 3MMYB 3VYRB 3OYAA 2JA2A 1IN5A 1S7EA 2J5OA 2LTPA 4L5JA 3VYSB 3NAUA 3U9GA 2VASA 4RAZA 2LYCA 2YU9J 2VOOA 3PQJA 1VQ9I 1O3QA 3VOEA 1MSFC 4EV0A 3EPZA 3K7AJ 2B7EA 4KJZA 2ID6A 4HLYA 4OINF 2CU7A 3VEPA 1Q1VA 5M5XJ 2HVSA 3BLYA 3QQAA 4NQWB 3M8FA 4YELA 4XLNF 1ZYRF 2RGVA 5F6FA 2ZCWA 1J75A 2LKSA 3BG9A 2RC4A 1J9IA 2MG4A 1I5ZA 2EK5A 4R79A 1X2NA 2EZLA 3EUHA 1IG7A 1CF7A 2DMPA 4Q48A 5K5RA 4S05A 4ABZA 4ETSA 2AQFA 3K69A 3U1DA 1TNTA 4DYCA 5FLMJ 1GLNA 1WH7A 2A07F 2VQGA 3J80K 1MGTA 1ZGJA 1B9MA 4A3JJ 1IRZA 3DKXA 2KLOA 2E60A 3WG7H 4OMYA 4U88A 2LNBA 4HW0A 4I02A 4L9VA 1I27A 2D1VA 2M30A 4G6TB 1ZREA 2OF7A 4KFCA 3QOPA 1OFCX 4BJ5C 3CMAI 4AM3A 2C6YA 2ZBKA 2QBYB 2LLKA 4OIQF 3GTKJ 3C3WA 3RDIA 2OCEA 4ASNA 5E8IA 3GTMJ 5JHFA 1HKSA 1FP1D 2LP0A 1SMTA 1U5TC 1XSXA 2OD5A 5TISC 4PGHA 4X0GA 4B8XA 1J5YA 2K9MA 1R22A 2IGMA 4BXUA 3W2AA 2R7FA 1IN8A 4EJWA 1T2KA 4JK1X 3TW6A 4N9HA 3F9KA 2PMHA 4RAGA 3QAHA 2CFXA 2DA4A 3V7CA 2M87A 5B3SH 1ZH5A 2XPUA 3BCBA 2M7BA 2A6HF 2CUEA 3PFYA 1TTYA 4C3IJ 2GM4A 3IAS2 1SD6A 2JUGA 3FIWA 1LDDA 4OIRF 4NUBA 4ZZDA 2RKHA 3OSGA 4QWQA 1YW9A 2IP2A 3A02A 3WTZA 3KYDB 3DKWA 3H3ZA 4S0HB 4BE0A 5FLXK 2WB1A 3EUKL 3HOVJ 3BDDA 1TWAJ 3LSTA 4Y7NJ 2FX0A 2M2EA 1MBFA 3BR6A 2P8TA 1IN6A 4ZDOA 2BOLA 3P9KA 3F8NA 2MH9A 1JUPA 2NRAC 4DOZA 5JHUA 1FTTA 5L3EA 3H9QA 2VPRA 2AXTC 1PUFB 3L2CA 3K4LA 5H2FC 2LF8A 2WY8Q 1OCCH 3W6JB 1VNDA 2W82A 3LFKA 2WAQN 4FE4A 2CV2A 4M3FA 4B09A 2L4MA 4JP0A 2E2IJ 1WPKA 1YYVA 2JJ7A 2QQBA 4YFNF 5DM6F 3MZHA 1FY7A 3CUQB 2EV6A 2QCOA 3CCLI 3RPQA 2X6OA 3JTHA 1F4KA 1JT6A 3P5JA 4G7ZF 1YRNA 2JA5J 2V6EA 3GTPJ 1UHSA 4NNJA 3COAC 3S17J 2WAEA 2XB0X 4XORA 1VQ8I 2OUMA 1LE8A 1YS6A 4HA8A 4YEJA 2V79A 3A03A 2V9VA 3T8TA 3BR1A 3K6GA 1D1BA 4XICA 3OYDA 1OCZH 1T6SA 2KP6A 1IN4A 3FBIB 5L3BA 4RDUA 3ZP5A 1EH8A 4XKVA 3EYYA 1LUJB 1AKHA 3GLXA 5CLSA 4GXOA 1N75A 2ZMEC 3SDGA 2KJCA 2XROA 3KZIC 5FKNA 2HQRA 2D45A 5M5WJ 2VE9A 5AIQA 5DCMA 4KDPA 5A2QK 3B6AA 1J0RA 2YX7A 2F2EA 5IOZA 1R4NB 3GVAA 3JTGA 1NTCA 4PFOA 1P4WA 3M7GA 2F5CA 3G1OA 5FKOA 3S1RJ 3HC7A 3OV8A 1Y0UA 2O61A 3I55I 1FP2A 1DU0A 1TW3A 4KT5C 1XDUA 1Y0NA 3ZCOA 1QA6A 4KICA 4UVAA 4OAZA 5EYRA 1B9NA 2M0CA 4RB3C 3K4BA 3OYCA 2DYRH 4DIQA 3X2QH 3BJ6A 3KP4A 3S2WA 4YIFA 1FOXA 4ZH4F 2ESNA 1NK2P 5ILSA 4M6XA 3ABUA 2QZ8A 3QYEA 3FM3A 3HDDA 2M0MA 3GFJA 1W36D 1T0FC 1LEAA 2L9RA 5B66C 1XMAA 1SAUA 3QODA 5KCMA 3D5LA 2JZYA 3H5NA 4AYBA 1U8RA 3HKZN 4M6YA 4AIKA 1SANA 2P5KA 3CCMI 3BR2A 5J1YA 2PEXA 1O57A 2Y75A 4PSWA 1K78A 4M9ZA 4MFEA 1RUNA 3FK7A 3V8KA 1MZBA 1OQYA 4J00A 1W4MA 1RZ4A 5JI6A 4KYWA 1F1ZA 2IGNA 2PMZA 4C3JJ 4P1WA 1R23A 1SMYF 2X51A 4GFBA 1GUUA 3OYBA 5JLXA 4WXDA 4LLNA 2ZO4A 2R7WA 1WFXA 2KZVA 3OYIA 1XS9A 2NOGA 4NHJA 5E3LA 4EJOA 2ETHA 5E20A 3S2HJ 1WWXA 2Z9OA 4FCYA 3CCUI 3PJRA 2XAUA 3Q3SA 3S2DJ 4A0ZA 3TDZC 2XRNA 4EM1A 3K9TA 1WCMJ 1XGOA 5GADJ 3TOBA 1MBGA 2L3DA 2CV1A 2LFBA 3M07A 2FOKA 3IC7A 2W57A 4B3AA 4CCMA 2F4OB 3IKVA 4IHYA 2DTZA 3A01A 1NH3A 2STWA 4PJLA 3MKYB 3H3UA 1I50J 1U6GA 2EIMH 2K27A 5BPIA 3HZJA 2X85A 3M1CA 2R5YB 2MLGA 5ED4A 4IRGA 4XIDA 2W1OA 3BG7A 2CS3A 4ZDLA 1WJBA 1TWCJ 1Z1DA 3IHUA 4PGGA 2EA2A 2FNPA 3D1NI 1GV5A 2VKHA 2HXIA 2O8XA 1SEUA 5HNFA 1DU6A 1QHGA 1ZARA 2IT0A 5HS7A 1MW7A 3GEZA 1Z7UA 4EGZA 4RGXA 1DGWY 4HNUA 2DQRA 1D8KA 4A3EJ 2W24A 4F7ZA 3JRIA 3JRBA 2EA4A 1O4XA 5EF6A 1AA7A 2L7MP 4DYRA 5BOXA 2MH2A 3HIFA 2XF5A 1IUFA 3RJPA 4V2FA 1AU7A 3PO3J 1MMSA 2VUMJ 2IXSA 2IRFG 1POGA 3DLAA 1T08B 2XASA 2IGKA 3FKJA 4XL9A 5CKTA 4JX4A 2V1XA 1P9QC 3LSJA 3E7LA 1VQOI 4XN0A 5DUIA 4CZCA 1XMKA 2OU2A 2VIXA 4UVCA 5JVGF 2VE8A 3FDYA 1FBUA 1MNMC 1MH3A 3S3NA 3C2GA 5ICCA 4HF0A 5H6RA 3MQ0A 3TL4X 4RAFA 3ZR8X 5ERIA 3A4CA 5HVQC 2FXAA 2ZNYA 2HXOA 1ETOA 3MKLA 1JGSA 3CLQA 4HSTA 2IA1A 2LMDA 2ID3A 4HYEA 1OCTC 4ZYHA 2Q1ZB 1HXDA 3KP5A 1BOBA 3DU6A 3QOEA 4M6VA 4ZYDA 2KISA 3MFKA 4IHVA 3LSMA 1VQ5I 3ECHA 3H5AA 1ITYA 1XG1A 2VKEA 4NDLA 2BGCA
chains in the Genus database with same CATH topology
2E2JJ 3GTOJ 2DA2A 2IBDA 5F0HA 4W1UA 4XRSG 3Q0VA 2Y31A 3PO2J 5J1RA 3UKGA 2ELKA 1F36A 2DMNA 1ETWA 1MSEC 3I4MJ 2XGEA 1JTXA 3PM1A 1T33A 3HGGA 5FJ8J 1IJWC 5FLVA 3BQZA 3G1LA 2LKXA 1U9OA 3I4NJ 3ZQHA 1F43A 2ZB9A 2CQXA 2Y30A 3TP3A 4D7MA 4MFDA 3K2AA 2TRTA 4DZPA 2NVQJ 4J19A 2AHQA 2GBYA 2ECCA 2EZIA 4QSHA 4LOCA 1GDTA 1UMQA 4A3KJ 2NVYJ 1P7IA 2DA5A 1JKPC 5C4JJ 5C4XJ 3M4OJ 1UG2A 3JRAA 1TWHJ 4W97A 2B63J 1U9NA 2PMZN 2HYJA 1EF4A 1JGGA 1RKTA 4BKXA 1TWGJ 3CCYA 4DZJA 5E3MA 2JWTA 4FTHA 4XK4A 5EG0A 1BW5A 3VPRA 2K9QA 2G0EA 4A3LJ 2LD5A 2LY9A 4HNVA 4I6ZA 4DYQA 1XC5A 3IH4A 5F0FA 1ZR4A 1VF9A 2HI3A 2MGQA 4A3MJ 3HBLA 1GV2A 2DJNA 3GTLJ 3QPLA 5F04A 3GTGJ 3TW7A 1HOMA 1BW6A 3OSFA 1JKQC 1BL0A 3LSGA 2HOAA 2AO9A 4D5CA 1CQTA 2NS7A 1RPWA 3BQYA 2X9DA 5K7ZA 4A69C 1HF0A 5IYDJ 3B6CA 3BR3A 3JRFA 5EG0B 1RKWA 3TP0A 1RESA 1WI3A 2E19A 1QVUA 1IV6A 3G1MA 1B72B 3HEFA 1NK3P 1S7EA 3IH3A 4CYCA 2LTPA 2Y9YA 1D5YA 3NAUA 1ENHA 3ZQCA 2NVTJ 2X48A 4D7NA 2YU9J 1MSFC 1WH5A 3K7AJ 2ID6A 2Y2ZA 2CU7A 2W48A 1Q1VA 2DA3A 5M5XJ 3QQAA 2YUSA 4CYCB 3BG9A 3JRDA 5EGOB 3JRHA 2R0QC 2MG4A 4EEFG 2R5YA 3OIOA 4C2MJ 4QIWN 1X2NA 3NARA 3HM5A 1MBKA 2EZLA 2I10A 1IG7A 5IP9J 2DMPA 1U78A 1JT0A 1JUSA 4ABZA 4M3DA 3ZQGA 2DMQA 4DYCA 5FLMJ 1WH7A 3S16J 5F08A 4FISA 4JYKA 4A3JJ 1ETKA 2L7FP 1IRZA 3ZQFA 3HOWJ 1ETXA 2K9SA 4QTRA 1TC3C 4BBRJ 3S1MJ 1OCPA 2H8RA 1LFBA 3BR0A 2ME0A 2EH3A 2OF7A 1OFCX 1HDDC 5J3LA 5E3OA 1AHDP 2LLKA 3GTKJ 2M8GX 3GTMJ 1FEXA 2LP0A 3FISA 3S15J 3Q0UA 1FIPA 2L7ZA 2E1OA 5FKKA 2EQRA 4BY1J 2RAEA 4M3EA 3TW6A 2FQ4A 5GPCA 2IEKA 1I6HJ 1X58A 3HGYA 5FKLA 3JR9A 5EZHA 2DA4A 2EBIA 2MSYA 4A3GJ 2XPUA 3H3VK 4IHWA 3ZQIA 2CUEA 4A93J 5EEAA 4M3BA 4C3IJ 1MBEA 2GM4A 1T56A 2HDDA 2XPWA 3HOZJ 1HDPA 1JUMA 3FIWA 3GTQJ 2YS9A 3OSGA 2KT0A 3A02A 2JA8J 4S0HB 5IOYA 4IEJA 3BTIA 3HOVJ 1TWAJ 2LVSA 2FX0A 3BR5A 2M2EA 1MBFA 3BR6A 1BJZA 4Y7NJ 1HCRA 1ZTRA 5F27A 3JRCA 3BTLA 3RZOJ 1JUPA 1FTTA 2VPRA 2O8KA 1PUFB 3BTCA 2L0KA 1Z77A 4MIMA 1VNDA 2DA1A 1QVTA 2WAQN 3SFIA 4FE4A 2Y0SN 4XRSA 4M3FA 4MO7A 4JP0A 2JA6J 2R5ZA 1R9TJ 1TWFJ 2E2IJ 1WPKA 2JJ7A 1IDYA 2QCOA 3O8HA 2LK2A 2XRLA 4RBOA 5JLWA 1AKHB 1H8AC 2X6OA 1QPIA 1RR7A 2JN6A 1JT6A 2LR8A 2JA7J 2NS8A 3BTJA 2Y9ZA 1YRNA 2JA5J 3FK6A 2DN0A 2JK3A 3GTPJ 1UHSA 2R7ZJ 3S17J 2DMUA 2N8GA 2XB0X 3OOUA 5IP7J 5FKMA 1LE8A 1GT0C 9ANTA 2R93J 5BNGA 3A03A 3BR1A 5E3NA 1VI0A 4XICA 2H1KA 1LFUP 4MLOA 4RDUA 4AC0A 2D5VA 3F0CA 4A3FJ 4BY7J 2COBA 5M3FJ 1ZK8A 4FE7A 4M3GA 2WB1N 1AKHA 3TEDA 3GBGA 3HOUJ 3SDGA 3M3YJ 1YRNB 2HOSA 1W0UA 1I3QJ 5FKNA 5M5WJ 3B6AA 4A3CJ 2WV1A 5IOZA 5K7HA 1NTCA 4B1RA 3G1OA 5FKOA 3S1RJ 1JJ8C 2M34A 1PUFA 1DU0A 5EGOA 4UUTA 2VKVA 3CQZJ 1ZKGA 2M9HA 5F0CA 5EYRA 3DCFA 2M0CA 1E3OC 4UUSA 5C3EJ 2O9LA 3CDLA 1APLC 2VI6A 1VFCA 1H89C 1NK2P 1A6IA 5EZGA 4B4CA 3HDDA 2L9RA 2QF7A 4D5FA 2IAIA 1Y1WJ 2HQ5A 4BXXJ 1IDZA 5DTDA 3HKZN 1SANA 2FD5A 3BR2A 5J1YA 3FKIJ 1JJ6C 3LSPA 3MVPA 4UUSB 5IPAA 1Z0XA 1B8IA 1HLVA 3W6VA 3S1QJ 4MFEA 3FK7A 1SFOJ 3JREA 1A5JA 1RETA 3RZDJ 4C3JJ 1W0TA 2P81A 1MBHA 4JX5A 2DA7A 2GLOA 1BA5A 5C44J 4Y52J 4GFBA 1GUUA 3IV5A 1IGNA 5JLXA 2XPVA 4I76A 3RQIA 2MW8A 2FJ1A 1XS9A 1ORKA 2NOGA 5E3LA 3HB9A 3QPSA 4A3BJ 3S2HJ 2ME6A 2CQQA 5IYCJ 4AUXA 1ETYA 4FCYA 3Q0WA 3Q3SA 1IC8A 3S1NJ 3S2DJ 2R5ZB 1H88C 2E2HJ 4V2GA 1WCMJ 1ZR2A 2XB5A 5M5YJ 1LE8B 2OPTA 1MBGA 4X1EA 2LFBA 2KDZA 4JX6A 3DEWA 3LSRA 4B3AA 4IHYA 1MBJA 3IH2A 2DTZA 3A01A 2NVXJ 4A3IJ 1U8BA 5J1UA 3C2BA 1I50J 1ZQ3P 1FJLA 3WHCA 2R5YB 2HOTA 3SJMA 1Y1VJ 5DS9A 4XIDA 3BG3A 1TWCJ 3L1PA 3D1NI 1FIAA 1GV5A 2K40A 4AYBN 2HXIA 2CRGA 1WGXA 3BG5A 1DU6A 3S14J 2K9NA 3A01B 3CMYA 4A3EJ 4A3DJ 1FTZA 3JRIA 1B8IB 3JRBA 4G12A 4C3HJ 1B72A 3RKQA 1X2MA 5EF6A 1O4XA 3HOYJ 2XGDA 2L7MP 4DYRA 5IP6A 2DA6A 3LNQA 1JKOC 1QRYA 2CJJA 5K7FA 3ZQLA 1P7JA 1IUFA 1AU7A 4V2FA 3PO3J 3MN2A 2VUMJ 1K83J 5GPAA 1POGA 4DW6A 2XSDC 3LOCA 5EDNA 4JX4A 3HOXJ 3LSJA 3E7LA 4L5EA 2EZKA 2ECBA 2DMTA 1GVDA 1G2HA 3O8GA 2R92J 1MNMC 1MH3A 5IYBJ 1OJLA 1JKRC 2CUFA 3ZOBA 2EZHA 2HXOA 1ETOA 5GP9A 5F1JA 3GTJJ 1ETVA 3MKLA 2JMWA 4IHXA 1JTYA 5M3MJ 4XRMA 2ID3A 4X6AJ 1OCTC 2TCTA 2O7OA 3WHBA 5HODA 4M6VA 1ETQA 3JRGA 4IHVA 3BT9A 3H0GJ 1ZGWA 1ITYA 1XG1A 2VKEA 4BBSJ 4NDLA 1MH4A 2XGCA 1K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J J;  3GTO J;  2DA2 A;  2IBD A;  5F0H A;  4W1U A;  4XRS G;  3Q0V A;  2Y31 A;  3PO2 J;  5J1R A;  3UKG A;  2ELK A;  1F36 A;  2DMN A;  1ETW A;  1MSE C;  3I4M J;  2XGE A;  1JTX A;  3PM1 A;  1T33 A;  3HGG A;  5FJ8 J;  1IJW C;  5FLV A;  3BQZ A;  3G1L A;  2LKX A;  1U9O A;  3I4N J;  3ZQH A;  1F43 A;  2ZB9 A;  2CQX A;  2Y30 A;  3TP3 A;  4D7M A;  4MFD A;  3K2A A;  2TRT A;  4DZP A;  2NVQ J;  4J19 A;  2AHQ A;  2GBY A;  2ECC A;  2EZI A;  4QSH A;  4LOC A;  1GDT A;  1UMQ A;  4A3K J;  2NVY J;  1P7I A;  2DA5 A;  1JKP C;  5C4J J;  5C4X J;  3M4O J;  1UG2 A;  3JRA A;  1TWH J;  4W97 A;  2B63 J;  1U9N A;  2PMZ N;  2HYJ A;  1EF4 A;  1JGG A;  1RKT A;  4BKX A;  1TWG J;  3CCY A;  4DZJ A;  5E3M A;  2JWT A;  4FTH A;  4XK4 A;  5EG0 A;  1BW5 A;  3VPR A;  2K9Q A;  2G0E A;  4A3L J;  2LD5 A;  2LY9 A;  4HNV A;  4I6Z A;  4DYQ A;  1XC5 A;  3IH4 A;  5F0F A;  1ZR4 A;  1VF9 A;  2HI3 A;  2MGQ A;  4A3M J;  3HBL A;  1GV2 A;  2DJN A;  3GTL J;  3QPL A;  5F04 A;  3GTG J;  3TW7 A;  1HOM A;  1BW6 A;  3OSF A;  1JKQ C;  1BL0 A;  3LSG A;  2HOA A;  2AO9 A;  4D5C A;  1CQT A;  2NS7 A;  1RPW A;  3BQY A;  2X9D A;  5K7Z A;  4A69 C;  1HF0 A;  5IYD J;  3B6C A;  3BR3 A;  3JRF A;  5EG0 B;  1RKW A;  3TP0 A;  1RES A;  1WI3 A;  2E19 A;  1QVU A;  1IV6 A;  3G1M A;  1B72 B;  3HEF A;  1NK3 P;  1S7E A;  3IH3 A;  4CYC A;  2LTP A;  2Y9Y A;  1D5Y A;  3NAU A;  1ENH A;  3ZQC A;  2NVT J;  2X48 A;  4D7N A;  2YU9 J;  1MSF C;  1WH5 A;  3K7A J;  2ID6 A;  2Y2Z A;  2CU7 A;  2W48 A;  1Q1V A;  2DA3 A;  5M5X J;  3QQA A;  2YUS A;  4CYC B;  3BG9 A;  3JRD A;  5EGO B;  3JRH A;  2R0Q C;  2MG4 A;  4EEF G;  2R5Y A;  3OIO A;  4C2M J;  4QIW N;  1X2N A;  3NAR A;  3HM5 A;  1MBK A;  2EZL A;  2I10 A;  1IG7 A;  5IP9 J;  2DMP A;  1U78 A;  1JT0 A;  1JUS A;  4ABZ A;  4M3D A;  3ZQG A;  2DMQ A;  4DYC A;  5FLM J;  1WH7 A;  3S16 J;  5F08 A;  4FIS A;  4JYK A;  4A3J J;  1ETK A;  2L7F P;  1IRZ A;  3ZQF A;  3HOW J;  1ETX A;  2K9S A;  4QTR A;  1TC3 C;  4BBR J;  3S1M J;  1OCP A;  2H8R A;  1LFB A;  3BR0 A;  2ME0 A;  2EH3 A;  2OF7 A;  1OFC X;  1HDD C;  5J3L A;  5E3O A;  1AHD P;  2LLK A;  3GTK J;  2M8G X;  3GTM J;  1FEX A;  2LP0 A;  3FIS A;  3S15 J;  3Q0U A;  1FIP A;  2L7Z A;  2E1O A;  5FKK A;  2EQR A;  4BY1 J;  2RAE A;  4M3E A;  3TW6 A;  2FQ4 A;  5GPC A;  2IEK A;  1I6H J;  1X58 A;  3HGY A;  5FKL A;  3JR9 A;  5EZH A;  2DA4 A;  2EBI A;  2MSY A;  4A3G J;  2XPU A;  3H3V K;  4IHW A;  3ZQI A;  2CUE A;  4A93 J;  5EEA A;  4M3B A;  4C3I J;  1MBE A;  2GM4 A;  1T56 A;  2HDD A;  2XPW A;  3HOZ J;  1HDP A;  1JUM A;  3FIW A;  3GTQ J;  2YS9 A;  3OSG A;  2KT0 A;  3A02 A;  2JA8 J;  4S0H B;  5IOY A;  4IEJ A;  3BTI A;  3HOV J;  1TWA J;  2LVS A;  2FX0 A;  3BR5 A;  2M2E A;  1MBF A;  3BR6 A;  1BJZ A;  4Y7N J;  1HCR A;  1ZTR A;  5F27 A;  3JRC A;  3BTL A;  3RZO J;  1JUP A;  1FTT A;  2VPR A;  2O8K A;  1PUF B;  3BTC A;  2L0K A;  1Z77 A;  4MIM A;  1VND A;  2DA1 A;  1QVT A;  2WAQ N;  3SFI A;  4FE4 A;  2Y0S N;  4XRS A;  4M3F A;  4MO7 A;  4JP0 A;  2JA6 J;  2R5Z A;  1R9T J;  1TWF J;  2E2I J;  1WPK A;  2JJ7 A;  1IDY A;  2QCO A;  3O8H A;  2LK2 A;  2XRL A;  4RBO A;  5JLW A;  1AKH B;  1H8A C;  2X6O A;  1QPI A;  1RR7 A;  2JN6 A;  1JT6 A;  2LR8 A;  2JA7 J;  2NS8 A;  3BTJ A;  2Y9Z A;  1YRN A;  2JA5 J;  3FK6 A;  2DN0 A;  2JK3 A;  3GTP J;  1UHS A;  2R7Z J;  3S17 J;  2DMU A;  2N8G A;  2XB0 X;  3OOU A;  5IP7 J;  5FKM A;  1LE8 A;  1GT0 C;  9ANT A;  2R93 J;  5BNG A;  3A03 A;  3BR1 A;  5E3N A;  1VI0 A;  4XIC A;  2H1K A;  1LFU P;  4MLO A;  4RDU A;  4AC0 A;  2D5V A;  3F0C A;  4A3F J;  4BY7 J;  2COB A;  5M3F J;  1ZK8 A;  4FE7 A;  4M3G A;  2WB1 N;  1AKH A;  3TED A;  3GBG A;  3HOU J;  3SDG A;  3M3Y J;  1YRN B;  2HOS A;  1W0U A;  1I3Q J;  5FKN A;  5M5W J;  3B6A A;  4A3C J;  2WV1 A;  5IOZ A;  5K7H A;  1NTC A;  4B1R A;  3G1O A;  5FKO A;  3S1R J;  1JJ8 C;  2M34 A;  1PUF A;  1DU0 A;  5EGO A;  4UUT A;  2VKV A;  3CQZ J;  1ZKG A;  2M9H A;  5F0C A;  5EYR A;  3DCF A;  2M0C A;  1E3O C;  4UUS A;  5C3E J;  2O9L A;  3CDL A;  1APL C;  2VI6 A;  1VFC A;  1H89 C;  1NK2 P;  1A6I A;  5EZG A;  4B4C A;  3HDD A;  2L9R A;  2QF7 A;  4D5F A;  2IAI A;  1Y1W J;  2HQ5 A;  4BXX J;  1IDZ A;  5DTD A;  3HKZ N;  1SAN A;  2FD5 A;  3BR2 A;  5J1Y A;  3FKI J;  1JJ6 C;  3LSP A;  3MVP A;  4UUS B;  5IPA A;  1Z0X A;  1B8I A;  1HLV A;  3W6V A;  3S1Q J;  4MFE A;  3FK7 A;  1SFO J;  3JRE A;  1A5J A;  1RET A;  3RZD J;  4C3J J;  1W0T A;  2P81 A;  1MBH A;  4JX5 A;  2DA7 A;  2GLO A;  1BA5 A;  5C44 J;  4Y52 J;  4GFB A;  1GUU A;  3IV5 A;  1IGN A;  5JLX A;  2XPV A;  4I76 A;  3RQI A;  2MW8 A;  2FJ1 A;  1XS9 A;  1ORK A;  2NOG A;  5E3L A;  3HB9 A;  3QPS A;  4A3B J;  3S2H J;  2ME6 A;  2CQQ A;  5IYC J;  4AUX A;  1ETY A;  4FCY A;  3Q0W A;  3Q3S A;  1IC8 A;  3S1N J;  3S2D J;  2R5Z B;  1H88 C;  2E2H J;  4V2G A;  1WCM J;  1ZR2 A;  2XB5 A;  5M5Y J;  1LE8 B;  2OPT A;  1MBG A;  4X1E A;  2LFB A;  2KDZ A;  4JX6 A;  3DEW A;  3LSR A;  4B3A A;  4IHY A;  1MBJ A;  3IH2 A;  2DTZ A;  3A01 A;  2NVX J;  4A3I J;  1U8B A;  5J1U A;  3C2B A;  1I50 J;  1ZQ3 P;  1FJL A;  3WHC A;  2R5Y B;  2HOT A;  3SJM A;  1Y1V J;  5DS9 A;  4XID A;  3BG3 A;  1TWC J;  3L1P A;  3D1N I;  1FIA A;  1GV5 A;  2K40 A;  4AYB N;  2HXI A;  2CRG A;  1WGX A;  3BG5 A;  1DU6 A;  3S14 J;  2K9N A;  3A01 B;  3CMY A;  4A3E J;  4A3D J;  1FTZ A;  3JRI A;  1B8I B;  3JRB A;  4G12 A;  4C3H J;  1B72 A;  3RKQ A;  1X2M A;  5EF6 A;  1O4X A;  3HOY J;  2XGD A;  2L7M P;  4DYR A;  5IP6 A;  2DA6 A;  3LNQ A;  1JKO C;  1QRY A;  2CJJ A;  5K7F A;  3ZQL A;  1P7J A;  1IUF A;  1AU7 A;  4V2F A;  3PO3 J;  3MN2 A;  2VUM J;  1K83 J;  5GPA A;  1POG A;  4DW6 A;  2XSD C;  3LOC A;  5EDN A;  4JX4 A;  3HOX J;  3LSJ A;  3E7L A;  4L5E A;  2EZK A;  2ECB A;  2DMT A;  1GVD A;  1G2H A;  3O8G A;  2R92 J;  1MNM C;  1MH3 A;  5IYB J;  1OJL A;  1JKR C;  2CUF A;  3ZOB A;  2EZH A;  2HXO A;  1ETO A;  5GP9 A;  5F1J A;  3GTJ J;  1ETV A;  3MKL A;  2JMW A;  4IHX A;  1JTY A;  5M3M J;  4XRM A;  2ID3 A;  4X6A J;  1OCT C;  2TCT A;  2O7O A;  3WHB A;  5HOD A;  4M6V A;  1ETQ A;  3JRG A;  4IHV A;  3BT9 A;  3H0G J;  1ZGW A;  1ITY A;  1XG1 A;  2VKE A;  4BBS J;  4NDL A;  1MH4 A;  2XGC A;  1K61 A; 
#chains in the Genus database with same CATH topology
 5L3C A;  3IP4 B;  2PJR A;  2E36 A;  4XRS G;  1REP C;  2W7N A;  4MTE A;  4CCJ A;  3UKG A;  1GHC A;  2ELK A;  3I54 A;  1KU9 A;  2JSP A;  5D6F A;  3GF2 A;  3OR2 C;  3I4M J;  2XGE A;  3PFI A;  4Q47 A;  3QU6 A;  1NHA A;  2KQR A;  3K2Z A;  4WK8 F;  2P5V A;  5FJ8 J;  5DUK A;  1MMN A;  1UEL B;  1L3L A;  2NXN B;  3IUO A;  4N9I A;  1R5H A;  4WWC A;  5F64 A;  4I2O A;  2Y30 A;  3TP3 A;  4D7M A;  3CDI A;  1BR4 A;  2K5C A;  1R58 A;  4MFD A;  4DZP A;  1VQ7 I;  3F8C A;  2ZJR F;  4HX7 A;  2EZI A;  1UMQ A;  2XKO A;  4A3K J;  1P7I A;  2KRC A;  3GZN B;  1JKP C;  4KIS A;  3J81 K;  3M4O J;  2VLA A;  4XNF A;  4IL6 C;  4IHS A;  1K7A A;  4BS9 A;  2PMZ N;  4BNC A;  1BI1 A;  3OOP A;  1R00 A;  3HJE A;  2VN2 A;  3WE2 A;  1RKT A;  5LEK A;  4FAS D;  2IVM A;  3KEO A;  2H6B A;  2MC3 A;  2FE3 A;  2X6W A;  3M1E A;  3BC8 A;  1ZG5 A;  1H9G A;  5CPR B;  4OMZ A;  1RIO H;  2BV6 A;  5DD8 A;  2R3S A;  4E7I A;  3CP2 A;  1BIA A;  3HSF A;  2CQN A;  3VPR A;  3W2W A;  2GA2 A;  5EG0 A;  3CLO A;  2A5Y B;  2M1B A;  1GXP A;  6PAX A;  1OYW A;  2DOF A;  2GA1 A;  4Y4R A;  1KQ0 A;  3BJO A;  4FET A;  3V8J A;  3OY9 A;  2KJB A;  4I6Z A;  4B48 A;  4DGW B;  1OCR H;  3IH4 A;  4E7Z A;  1GV2 A;  1KU7 A;  2QGU A;  2Y69 H;  3TW7 A;  5HS9 A;  3SZP A;  1BL0 A;  4GYG A;  2AO9 A;  4BQO A;  4QPQ A;  4BQQ A;  1LNW A;  1LDK B;  3A0H C;  3I5U A;  2QWW A;  4EJV A;  4U7D A;  3AAF A;  3B6C A;  2OQG A;  3JRF A;  1BOA A;  1RKW A;  1T38 A;  2LOO A;  2WWY A;  1QQI A;  5HLH A;  3LAJ A;  4LIU A;  1WI3 A;  3CP8 A;  3SYT A;  4JBA A;  3CCQ I;  1RUO A;  4PUS A;  2G7H A;  1LJ9 A;  4EQQ A;  2R7U A;  3M8J A;  1B72 B;  4I09 A;  2IS6 A;  3QP6 A;  3QP5 A;  4L18 B;  4UXN A;  3A0B C;  3ZQC A;  2NVT J;  3OL4 A;  1WH5 A;  3J7A O;  1V4R A;  2Y2Z A;  2HVQ A;  2W48 A;  5HLT A;  4E7H A;  4V19 K;  3KX2 A;  2BW3 B;  5LRS A;  1ZN2 A;  3ULQ B;  1VQ4 I;  3F8F A;  4XLF A;  3JRH A;  2DOD A;  2NOJ B;  4MGR A;  2X1D A;  1MMD A;  4QIW N;  4WX9 A;  2I10 A;  2IS4 A;  1BI2 A;  4N4N B;  3ERM A;  1HW2 A;  3CC7 I;  1XX5 A;  4M3D A;  5D4R A;  2WAD A;  3KP6 A;  3ZQG A;  3SDB A;  2DMQ A;  2VQH A;  3CCE I;  4EJT A;  1DP7 P;  2F5D A;  3ROU A;  4KIT B;  1KA8 A;  4FIS A;  3E5X A;  2PLY A;  4BQN A;  2VT3 A;  1ZHF A;  3DU5 A;  2CW0 F;  3VYU B;  4BBR J;  1OCP A;  2E34 A;  3LA7 A;  3BR0 A;  4FQG A;  3GO5 A;  2K3P A;  1E17 A;  1QPM A;  1L0O C;  5LD2 C;  4XLA A;  5J3L A;  1QGP A;  2D2W A;  2UXX A;  3W3C A;  2DI3 A;  2H94 A;  2ADU A;  1Z91 A;  3FIS A;  4XQF A;  1YTY A;  4ENK A;  5BPD A;  1FIP A;  2CFO A;  2O0Y A;  3J7Z I;  3GX4 X;  1FYM A;  3C2H A;  4HAM A;  4BH9 A;  2HNH A;  2NYX A;  5FKK A;  3R6S A;  4NQW A;  1X1A A;  3UR3 C;  4BY1 J;  1DPR A;  2M4G A;  1WVR A;  5E18 F;  4I99 C;  4GRI A;  4HDV A;  5E1Z B;  4Y17 A;  1I6H J;  1X58 A;  1R71 A;  5FKL A;  3B02 A;  3GCM A;  4A3G J;  3H3V K;  1U0J A;  3Q5F A;  2DFF A;  3VFZ A;  2MBF A;  1D0Z A;  3JW4 A;  5EEA A;  2CG4 A;  2DLL A;  1B1B A;  2RN7 A;  1E3H A;  2HDD A;  3HOZ J;  3S32 A;  4L9J A;  1V3F A;  4MQV A;  5KVR A;  2M7A A;  2ICW G;  2P7V B;  3AFH A;  2KT0 A;  2JA8 J;  2KMU A;  2DYS H;  1VZ0 A;  3CCS I;  4HX8 A;  3OYG A;  2R4G A;  2LVS A;  1J09 A;  4H4K C;  4NB5 A;  4PJM A;  5CVI A;  1FX7 A;  5DDG A;  2ZJQ F;  2HDW A;  3JAM Z;  1Z3X A;  4UB8 C;  3S8P A;  2GZW A;  3HTU A;  1D3Y A;  3BTC A;  4L0Y B;  3L7W A;  3M9A A;  1D8J A;  1FPQ A;  4PCQ A;  4MIM A;  1SD7 A;  3L2R A;  3K4C A;  4HEA 2;  4D0P A;  1Y56 A;  3TKY A;  4RM3 A;  3SFI A;  4AD9 A;  4P9F A;  2Z16 A;  4XON A;  3T8R A;  2PI0 A;  1V54 H;  2BZT A;  2UV1 A;  3J81 Z;  1TWF J;  1Y6I A;  1FSH A;  1WJF A;  4Z2Y A;  3O8H A;  1AKH B;  1K4S A;  1QU3 A;  1SVO A;  1RR7 A;  3LQR A;  2JN6 A;  2LR8 A;  2JA7 J;  4B3X A;  1BBY A;  3BTJ A;  3K1P A;  4A0Y A;  4MNU A;  4R8H A;  2Y9Z A;  3P9C A;  3ONQ A;  1I1S A;  4CHU A;  3D0S A;  2EV0 A;  3HRM A;  3OYH A;  1SVL A;  1YE9 A;  5BNG A;  3FXL A;  2DOE A;  2X1E A;  5KK1 A;  2HTS A;  5E3N A;  3BOQ A;  1MJA A;  1VI0 A;  4E7K A;  2E7W A;  5E17 F;  2DOA A;  2VT2 A;  2JPB A;  4RGS A;  1FLI A;  2D5V A;  3DEU A;  4A3F J;  1I1G A;  3FXU A;  2COB A;  4KA4 A;  3VSL A;  1OLT A;  4M3G A;  4NC8 A;  3FBN B;  3GBG A;  4DJA A;  3HOU J;  3OWT A;  2EFN A;  3RKX A;  4ENJ A;  1YRN B;  1ODD A;  1R1T A;  4IRH A;  5LHI A;  4ON0 A;  3CCJ I;  4C2U A;  3FXR A;  3C1D A;  3ZN1 A;  5K7H A;  2L2O A;  1PYV A;  1XTA A;  2X0L A;  1JJ8 C;  2H1L A;  3WGI A;  2M34 A;  1PUF A;  2ELH A;  5EGO A;  4UUT A;  4EAT A;  2XVC A;  1P6R A;  5LGN A;  2DTR A;  3LFU A;  1QO0 D;  2LRE A;  4U0V A;  2ZNZ A;  3GLL A;  3W2V A;  5KAI C;  5J8F A;  3E5Q A;  2JRT A;  4F52 A;  2DK8 A;  2O9L A;  3CDH A;  1ZEL A;  3KP7 A;  1X1D A;  5HLI A;  5TRD A;  2VI6 A;  1VFC A;  1FZP B;  1H89 C;  3REO A;  1V5G A;  1A6I A;  2QKM B;  2HPI A;  1UAA A;  4JOM A;  5EZG A;  2XC7 A;  1R1U A;  3HPH A;  2A69 F;  2OAZ A;  2IAI A;  1A35 A;  1EH6 A;  2HQ5 A;  3KLO A;  2L4A A;  4EVI A;  1IDZ A;  2ZME A;  1X1C A;  2EIN H;  2OTJ I;  3H92 A;  2FD5 A;  1LPQ A;  4LK1 F;  3LSP A;  3MVP A;  4UUS B;  5IPA A;  3BG6 A;  2QM3 A;  1Z0X A;  4HBL A;  1UHW A;  1B8I A;  2R7Q A;  1HLV A;  1YI2 I;  2EFO A;  3KP2 A;  1OKR A;  2RDP A;  3I4P A;  4YRV A;  2B9S A;  1DPU A;  2VOD A;  1RET A;  3J80 Z;  1W0T A;  4IQJ A;  4ZC3 A;  1BR1 A;  1MBH A;  3L2Q A;  3DPL C;  2EB7 A;  4XBF A;  2K86 A;  3IV5 A;  1ZAO A;  2XPV A;  2ZFW A;  3ASN H;  3HG9 A;  4I76 A;  4U0W A;  3RQI A;  3OYM A;  3WTV C;  2EPF A;  2ZJ2 A;  3RI4 A;  3HB9 A;  3QPS A;  4A3B J;  2ZFU A;  3DFG A;  5IYC J;  4AUX A;  4KIB A;  1IC8 A;  3IWZ A;  2RRE A;  2R5Z B;  2DK5 A;  3QYF A;  2A6E F;  1PP8 F;  1XPX A;  5E79 C;  1Y8R B;  2LRD A;  2XB5 A;  2O03 A;  2OPT A;  3L00 A;  4X1E A;  2RNJ A;  4JX6 A;  3DEW A;  4BL0 B;  3GYH X;  4PSX A;  2JPC A;  3OS0 A;  2WTE A;  1T0F A;  2PX9 A;  3R60 A;  1U8B A;  3C2B A;  1FJL A;  2JQ7 A;  5KHD A;  2OQR A;  2YSR A;  3NEU A;  1LDJ A;  5DS9 A;  3TQN A;  2YU3 A;  3PL8 A;  2DO7 A;  3BG3 A;  4E70 A;  1YX3 A;  1UB9 A;  3L1P A;  4XRF A;  2GIZ A;  5CYV A;  4AYB N;  1WGX A;  2BVM A;  3S14 J;  3E97 A;  3C18 A;  1AWC A;  4RGR A;  3FHZ A;  1ZLK A;  1VQM I;  2H27 A;  4WXC A;  5EJC A;  4G7O F;  3H0D A;  3IAM 2;  2A3S A;  2XHK A;  5ILU A;  2VPL A;  3ABK H;  1O3T A;  4F93 B;  2MD0 A;  1YIJ I;  4HDU A;  1X2M A;  2I5U A;  3HOY J;  1AOY A;  3L2W A;  3HPG A;  3LNQ A;  1J59 A;  2LF7 A;  3ZQL A;  4PFP A;  2QQ8 A;  5H20 A;  2Y48 A;  4XKW A;  3MN2 A;  5DYM A;  2A05 A;  1QNT A;  4RGU A;  2Z1D A;  3LSH A;  2BYV E;  1FC3 A;  2HR3 A;  1DQU A;  3HYI A;  3KZZ A;  1JI8 A;  1G3Y A;  4IOA F;  4L5E A;  2ZSH B;  4IVN A;  2EZK A;  2ECB A;  2FQ3 A;  3I59 B;  3OYE A;  3WU0 A;  5LFA A;  2DQL A;  3QWL A;  2HYF A;  1JKR C;  1NG6 A;  1FOW A;  2CUF A;  3DKY A;  3VB2 A;  5FLX Z;  3DEE A;  3KYL A;  1T98 A;  4UV8 A;  2JSC A;  3D5R C;  5EEH A;  3BPV A;  1JTY A;  1HKQ A;  4IHX A;  4OIP F;  1M1E B;  1OR7 C;  1X3U A;  2LKP A;  3WHB A;  4BHB A;  1TT0 A;  4MTD A;  5F1R A;  3G73 A;  2CW7 A;  1WRJ A;  3JRG A;  3QRF F;  2ZXW H;  4UB6 C;  5HS8 A;  1X19 A;  4FHT A;  2BHZ A;  3F3X A;  2AQE A;  3MD2 A;  4E7S A;  2VBW A;  2X4H A;  2A61 A;  4Z6Y A;  2CSO A;  1UST A;  3GTO J;  3HRT A;  2IBD A;  1D1C A;  3BY6 A;  1IXR C;  4BDZ A;  5GAE J;  5F0H A;  2HKO A;  3ABT A;  1SC7 A;  2GXG A;  3Q0V A;  3U21 A;  1OIS A;  2K4J A;  3CC4 I;  2ZXH A;  5J1R A;  3Q9V A;  3PQK A;  2DMN A;  1LB2 A;  2FF4 A;  3J7Y J;  2PFB A;  1S5L C;  2L01 A;  1JTX A;  5DV5 A;  5FFZ A;  1T33 A;  4CH7 A;  2R7V A;  5E8G A;  1HW1 A;  3QPH A;  4CZZ A;  1IZ1 A;  3F21 A;  3I9V 2;  4UVB A;  4CUG A;  2L5Q A;  4M73 A;  3CUQ A;  4AWX B;  2ESH A;  2BY1 A;  3KEY A;  2CQX A;  2FRH A;  3EET A;  2EFP A;  3K2A A;  2TRT A;  2E1C A;  1YJW I;  2XUB A;  4IJA A;  3WTX C;  2HFH A;  2AHQ A;  2GBY A;  2ECC A;  2KRH A;  2KDO A;  4QSH A;  1GDT A;  3S93 A;  2L02 A;  1K78 B;  3FX3 A;  2DA5 A;  3G3Z A;  4LK0 F;  3BWG A;  2AXL A;  1JHH A;  2A6T A;  3WTU C;  5C4X J;  4PK4 A;  3CUO A;  1TNS A;  4LB5 A;  1TWH J;  3EUH C;  4W97 A;  3VWB A;  1IXC A;  4J01 A;  2B63 J;  3O6B B;  1EF4 A;  1BM9 A;  1BI0 A;  2NNY A;  5K1Y A;  1TWG J;  1RR8 C;  5TJJ A;  4UV9 A;  4XK4 A;  2DXI A;  1I6X A;  2K9Q A;  1W5C C;  3BCA A;  2DBB A;  4B47 A;  1YFH A;  3RTR A;  2DW4 A;  2F4M B;  3WOD F;  1S7O A;  2LY9 A;  2R7S A;  2XKP A;  1HKT A;  2WV0 A;  3GZ6 A;  4DYQ A;  5F0F A;  3M8E A;  2OCC H;  3ZRG A;  2Z3Y A;  2COM A;  1Z9C A;  1BW6 A;  3RCO A;  3OSF A;  2NAZ A;  1MKM A;  3RPU A;  4D5C A;  1HBX G;  1PDN C;  1HF0 A;  2X9D A;  2QA4 I;  3CJR B;  5D5V B;  2JTV A;  5J8C A;  1UG0 A;  5EG0 B;  4ESJ A;  3ELK A;  3V7S A;  4BEH A;  1QVU A;  1O3S A;  1YG2 A;  2V1D A;  3ZMT A;  4IZZ A;  5JFR A;  1XGM A;  4BU2 A;  3FXJ A;  1NK3 P;  5FD6 A;  1QZY A;  4CIC A;  1X4O A;  4RLF A;  2HOE A;  1HW5 A;  3CUQ C;  3R0J A;  3MKZ A;  2OZU A;  4XMY A;  2DA3 A;  4BEH B;  1RC9 A;  4XLC A;  1UHM A;  2E1N A;  3VOD A;  3JRD A;  5HDN A;  2FU4 A;  3OIO A;  5FRN A;  2DDB A;  1YW7 A;  2QVO A;  4C2M J;  1XD7 A;  3MEX A;  3NAR A;  1PP7 U;  2WBM A;  3H36 A;  5IP9 J;  3N97 A;  1VQ6 I;  1U78 A;  3FXQ A;  4GCV A;  1ZG1 A;  2HWV A;  1XCB A;  4IOC F;  2FBH A;  4IHT A;  1WI9 A;  2BY2 A;  4QPO A;  2X6Y A;  3TDU C;  3AG1 H;  4O6J A;  3OIP A;  3K70 D;  3S16 J;  3GWZ A;  5F08 A;  1J7K A;  1ZG3 A;  1ETK A;  2L7F P;  2M4K A;  3HOW J;  2BVL A;  1ETX A;  2Z33 A;  3PNY A;  4QTR A;  2CMP A;  4GDF A;  3R61 A;  2H8R A;  1LFB A;  1LVK A;  1QHH D;  3GW2 A;  1Z67 A;  2ZME B;  3BPX A;  2EH3 A;  3FXK A;  4YFK F;  3HUG B;  3JCU C;  2JVG A;  1W1W E;  4LG0 A;  1YLF A;  2ZKZ A;  1AHD P;  5E3O A;  5LGT A;  4HG2 A;  2DT7 B;  2WAQ A;  1FEX A;  3PIP F;  5FGM A;  3SXY A;  1YHQ I;  3S15 J;  1G3W A;  2L7Z A;  3OS1 A;  4WF2 A;  4L5I A;  4BAC A;  1SAX A;  3TBI A;  1S3J A;  3C7J A;  3LSI A;  4M3E A;  5GTH C;  1TQM A;  2FQ4 A;  2GOM A;  2BXZ A;  2J5P A;  2JRM A;  5GPC A;  2GOX B;  3HGY A;  3JR9 A;  1P4A A;  1JHF A;  2EBI A;  2ZC2 A;  5IT9 Z;  1XSV A;  2VB6 A;  1SFX A;  5K5O A;  2MAB A;  1ZRF A;  1HC8 A;  1PVE A;  1BC7 C;  1G8X A;  3VYT B;  1T56 A;  3BZK A;  2CGP A;  5EEG A;  2XPW A;  1MD0 A;  1W7P D;  1HDP A;  1XCV A;  2E7X A;  2DT5 A;  3AL0 B;  2YS9 A;  1UFM A;  4XKC A;  1KZH A;  2B0L A;  3PSI A;  1TZL A;  5ICF A;  3AG4 H;  3GZ5 A;  3FM5 A;  4XSX F;  3IWF A;  5D6E A;  5IOY A;  1Z05 A;  5BMZ A;  2DU9 A;  4PDK A;  3GFL A;  1ZTR A;  3NQO A;  3JRC A;  2GXA A;  4CDG A;  3CJQ B;  3RZO J;  1ULY A;  2FSW A;  2QQ9 A;  2UXN A;  4N4O B;  3ECO A;  3KLN A;  4F3Q A;  1LQ1 A;  3G4S I;  2BBY A;  1X1P A;  5CJ9 A;  4YII A;  2O8K A;  2IPQ X;  5FRM A;  2R7R A;  4ZTF A;  2L0K A;  2VJI A;  3HRU A;  2MLK A;  3DBL B;  2DFH A;  2HEO A;  2DA1 A;  1BC8 C;  4XOT A;  4CCO A;  4LGW A;  3EYI A;  3U2R A;  2Y0S N;  4XRS A;  1BR2 A;  1HSJ A;  3DQV C;  4MO7 A;  3WTT C;  5IT9 K;  2QSH X;  4CSW A;  1W36 C;  1Z7L A;  3LWF A;  1EJ9 A;  1GXQ A;  5FRO A;  2XRL A;  5KNL A;  2VQL A;  5JLW A;  1H8A C;  2E5Z A;  3E6M A;  3CMM A;  1G3T A;  3LL7 A;  1QPI A;  2QBY A;  4M9X A;  5TGT A;  3WU2 C;  4UUV A;  3FK6 A;  2VC0 A;  2R7Z J;  2QYO A;  1SFE A;  3H5R A;  5KAF C;  3HOT A;  1VQN I;  4E7L A;  3HTS B;  2QSF X;  3TO6 A;  5IP7 J;  5FKM A;  5AIP A;  3OYJ A;  3K1M A;  1S7A A;  4PZJ A;  1TQP A;  1S29 A;  1XB4 A;  4HF2 A;  4KMF A;  3K4K A;  4EJU A;  3MKW B;  2P6T A;  2RVC A;  2HS5 A;  2GWR A;  1T39 A;  2H1K A;  4MQ9 F;  3IKT A;  1V5F A;  5ICG A;  3H1C A;  4ZYG A;  1WJD A;  1H9T A;  2EIJ H;  3DTI A;  1IXS B;  1UJ8 A;  4AC0 A;  3F0C A;  3I59 A;  5CQG A;  3HHG A;  4BY7 J;  1IO2 A;  5M3F J;  1N78 A;  4FE7 A;  4K2E A;  2WB1 N;  1Z3Y A;  3TED A;  3OL3 A;  3SEZ A;  4D1Q A;  2QSG X;  4NC7 A;  1YQA A;  2CH0 A;  3S3O A;  4M74 A;  4A3C J;  2QKL B;  4BDY A;  2WV1 A;  3K4J A;  1ZRD A;  4ZTJ A;  3TO7 A;  4B1R A;  1RNL A;  1XN7 A;  2K9L A;  3ISP A;  1U5T B;  2P0W A;  2E35 A;  2OC6 A;  2LG4 A;  3CQZ J;  4BUP A;  1ZKG A;  1S6L A;  3FMQ A;  2FBI A;  4IX7 A;  3DCF A;  4OWR B;  1MDM A;  5E1X A;  1E3O C;  1W5S A;  5C3E J;  1XSD A;  3O2P E;  1I39 A;  5GAG J;  3CME I;  1APL C;  2HTJ A;  3MZ8 A;  3CJT B;  3SQN A;  5GTI C;  1WJE A;  4KUM A;  2P4W A;  4TV7 A;  1YW8 A;  3BP8 A;  4XM3 A;  4BE2 A;  1Y1W J;  5DTD A;  1DUX C;  2BXY A;  5CVJ A;  2EFQ A;  2X6X A;  1RI7 A;  3F8M A;  3W6V A;  4D9J A;  1KYZ A;  2DT6 A;  2W85 A;  1SFO J;  1S8N A;  3JRE A;  5CQE A;  4BHP A;  1FWZ A;  2MA3 A;  3RZD J;  2AS5 F;  2EIK H;  4JX5 A;  3PIO F;  2DA7 A;  3F6O A;  1BA5 A;  5C44 J;  2LY1 A;  5DD4 A;  1IGN A;  2LC2 A;  2OZ6 A;  2DCE A;  4KIG A;  2FJ1 A;  2L9N A;  5DCM B;  3FHN A;  5CVU A;  3E3V A;  2HU9 A;  1PJR A;  2ME6 A;  2CQQ A;  4XSZ F;  2A5W A;  1ETY A;  3Q0W A;  5GAH J;  5B1A H;  3S1N J;  4LFU A;  3DTK A;  1MMG A;  3CCV I;  1H88 C;  3CZ6 A;  3P9I A;  4V2G A;  5D5U B;  1IRG A;  2CW8 A;  4I0A A;  3I56 I;  1ZR2 A;  5M5Y J;  1LE8 B;  3ABL H;  1B59 A;  2JUC A;  2EFW A;  1YX5 A;  1R4M B;  1OPC A;  4RA2 A;  2QEN A;  2NVX J;  4CGZ A;  3A2K A;  2IA2 A;  4CCN A;  5J6X A;  3VDX A;  2O5R A;  2R7X A;  1ZQ3 P;  1MJB A;  2LY2 A;  4EGY A;  3WHC A;  4I7H A;  3HSR A;  2HOT A;  3SJM A;  4G94 A;  1C0W A;  4FT8 A;  1TP4 A;  1TW2 A;  4DBQ A;  1FIA A;  2V9P A;  5FFX A;  1MJ9 A;  5LBQ A;  2CRG A;  1HST A;  2L9V A;  2XAG A;  4E6K G;  5J4V A;  2LBF B;  2K9N A;  3ZMZ A;  3A01 B;  3CC2 I;  3GUD A;  2BHY A;  3DP7 A;  1KGS A;  2CQ7 A;  3K4M A;  2M5W A;  4A3D J;  3F6V A;  5JR3 A;  2EV5 A;  1B8I B;  4C3H J;  1O7F A;  4I0B A;  3RKQ A;  1B72 A;  2IS2 A;  2XGD A;  3OR1 C;  2DA6 A;  1JKO C;  3J7A Y;  3S3M A;  1RRJ A;  1QRY A;  2CJJ A;  5K7F A;  1P7J A;  2VBZ A;  4YFX F;  5LEJ A;  4P9U A;  3L2U A;  1ON2 A;  3Q9S A;  2XSD C;  3FMR A;  1Q1H A;  5D4S A;  1SD4 A;  3HL2 A;  5EDN A;  3L2V A;  2VOP A;  1FOK A;  3HUG A;  4U7B A;  1R7J A;  1V55 H;  2EJR A;  2F5E A;  2FMY A;  4RMN A;  1F5T A;  1V5E A;  3SZT A;  5FO5 A;  1G2H A;  4NC6 A;  3RYP A;  2ZXJ A;  5IYB J;  4XLP F;  1G4D A;  5CVV A;  2VBX A;  4KN7 X;  1T8I A;  3OS2 A;  2LDU A;  3NRV A;  4IPA A;  2EZH A;  3GTJ J;  1O3R A;  2HGC A;  1CF7 B;  3ZMD A;  1VQL I;  3HRS A;  3MCZ A;  4RS8 A;  3CES A;  4ZJZ A;  2NNN A;  5H6Q A;  3TGN A;  3FMS A;  2L7K A;  4XRM A;  1K6O A;  3KEQ A;  1TT5 B;  5HDK A;  2TCT A;  1ETQ A;  4U0Y A;  4Y3O A;  1X4P A;  3SHF A;  2MFZ A;  4ENN A;  3BT9 A;  4WCG A;  2Q8K A;  3MAJ A;  4BBS J;  1YOV B;  2K3F A;  2XGC A;  4ESB A;  4AIJ A;  1N25 A;  3EUA A;  3L09 A;  4KN4 X;  2E2J J;  3OMY A;  4H0E A;  5L3D A;  1X1B A;  3DV8 A;  1W5T A;  1U3E M;  1W7P A;  2H09 A;  2Y31 A;  3PO2 J;  4AID A;  4AVZ A;  3RKY A;  1YIO A;  3DTE A;  4OAY A;  1F36 A;  3D5S C;  2ZXI A;  1IN7 A;  4A2U A;  2K7L A;  2Z2S B;  1MSE C;  4PJN A;  2PN6 A;  2CYY A;  3F22 A;  3R4K A;  4RAY A;  3ZMV A;  2P7C B;  4BQA A;  3BQZ A;  1ZRC A;  1U9O A;  4LJZ F;  3ZQH A;  4I01 A;  3N05 A;  4GO1 A;  5BQT A;  2DPU A;  4OOI A;  4Q4Z F;  1EV7 A;  3K4N A;  2ISY A;  1JE8 A;  1SFK A;  2FOW A;  2X1C A;  2HQN A;  2NVY J;  4KT6 A;  2OJE D;  3HSE A;  2MC4 A;  1XMX A;  1A04 A;  2F5F A;  1UG2 A;  5LLQ A;  2HKX A;  1R6R A;  3OYN A;  3V8L A;  2HYJ A;  2W00 A;  2E1M B;  4KMU X;  5IY5 H;  1YIT I;  1JGG A;  3FF5 A;  1FYL A;  1X3Z B;  3ABM H;  2OTL I;  2KIM A;  3E6B A;  4MEY F;  2F6C A;  1FMW A;  2JWT A;  4FTH A;  2XGX A;  1MNE A;  4L0Z B;  5K5Q A;  1FBQ A;  1MIJ A;  3MWM A;  2G0E A;  4HLX A;  2V1N A;  2QEX I;  4OIO F;  2LD5 A;  2YR2 A;  4EM2 A;  4HNV A;  4G7H F;  4G6D A;  1QBJ A;  3GFM A;  3ZPL A;  4DNC A;  1XC5 A;  2HI3 A;  2VJ5 A;  1U2W A;  1R5I D;  1WJA A;  4U87 A;  4A3M J;  3HBL A;  3WGH A;  4NBQ A;  3GTL J;  3GTG J;  2FBK A;  1HOM A;  1JKQ C;  1E2X A;  2HOA A;  3LSG A;  2KHM A;  4RM2 A;  4LLG F;  1SVM A;  1YJ9 I;  2WC2 A;  5J40 A;  3WGG A;  1CQT A;  1D5V A;  3BQY A;  3RQ4 A;  4A12 A;  2LBF A;  4II2 A;  5IYD J;  2IJL A;  2EIL H;  2XAH A;  3BR3 A;  4B43 A;  2Q2E B;  1RES A;  3CO6 C;  2ZSI B;  3SZG A;  2E19 A;  3HKZ A;  1IV6 A;  4A5N A;  3V7R A;  4EM0 B;  3HEF A;  4O3M A;  3EQL F;  3IH3 A;  4CYC A;  2Y9Y A;  4XKB A;  1D5Y A;  2A68 F;  3OYF A;  1ENH A;  4HZF A;  5CVR A;  3ZQ7 A;  2X48 A;  4D7N A;  4KIF A;  2Q0O A;  4ITV A;  2NVU B;  2QQA A;  5LHG A;  2CUJ A;  4IRI A;  3NWS A;  4HV5 A;  2KZG A;  2F48 A;  1OR7 A;  2Q2E A;  2YUS A;  4BAY A;  4N0B A;  4CYC B;  2MD5 A;  3ERE D;  1P92 A;  5EGO B;  2XSJ C;  2R0Q C;  2DFI A;  4EEF G;  2D1H A;  2R5Y A;  5E1W A;  2W25 A;  3KIO A;  4CO8 A;  5J47 A;  3KE2 A;  4II3 A;  5DCF A;  3HM5 A;  1MBK A;  3TO9 A;  5DEQ A;  3RKW A;  3V4G A;  3UNG C;  1JT0 A;  1JUS A;  4WXH A;  2R7D A;  3N4M A;  2MYS A;  3FZV A;  2BW3 A;  1BN5 A;  3B73 A;  2KIQ A;  4JYK A;  4Q5S F;  3O3K A;  3ZQF A;  2KFD A;  2K9S A;  1KU2 A;  1TC3 C;  4Y13 A;  2R7O A;  3S1M J;  2ME0 A;  4Y15 A;  1D1A A;  1XDS A;  5AON A;  1HDD C;  4L9T A;  2M8G X;  2Z5U A;  2VXD A;  4KNY A;  1Z6T A;  5HDG A;  2E71 A;  3Q0U A;  2V4J C;  2BY0 A;  2K02 A;  4M72 A;  4BYY A;  2JVH A;  2M45 A;  3P7N A;  2E1O A;  5D5W B;  2EQR A;  2HZD A;  1S9H A;  3U1K A;  2RAE A;  1MDM B;  2O6G E;  2WAF A;  3CF2 A;  2IEK A;  2HZT A;  1P2F A;  2PG4 A;  4BHC A;  5B5E C;  1A31 A;  3CTA A;  5EZH A;  4HX4 A;  1ERD A;  4RB1 A;  1FSE A;  2MSY A;  1X3W B;  2HPM A;  4IHW A;  3ZQI A;  2BEO A;  3CCR I;  4A93 J;  4M3B A;  5HOO A;  1MBE A;  5FD5 A;  4LIT A;  3OIQ A;  1WJC A;  1FOY A;  1JUM A;  1IF1 A;  3WTW C;  2H8W A;  3KFW X;  3GTQ J;  1HQC A;  2BY3 A;  4FX0 A;  3K10 A;  3ZGK A;  4HRI A;  2RQQ A;  1VQK I;  4ZDP A;  3PSF A;  4IEJ A;  3BTI A;  2E5N A;  1D0X A;  2XAF A;  1W7P B;  3BR5 A;  1J2X A;  2KRF A;  1BJZ A;  1HCR A;  2UWM A;  1ACI A;  2GAU A;  5F27 A;  1K79 A;  1R36 A;  3BTL A;  3JAM K;  4CCL A;  2IA0 A;  4E7J A;  1Y39 A;  3ZMS A;  1WKM A;  2XAQ A;  1VTN C;  2HYG D;  5IT3 A;  2CUZ A;  2KIF A;  2R7T A;  3DPT A;  3LQQ A;  4ENM A;  1Z77 A;  2RNG A;  3BJA A;  3I3L A;  1OYY A;  1Z21 A;  2NS0 A;  2V1U A;  4C2T A;  1QVT A;  5LRR A;  1XGN A;  4DQ2 A;  2K4B A;  3R0A A;  2WA0 A;  2JA6 J;  2R5Z A;  1R9T J;  1IDY A;  4G8X A;  2LK2 A;  4RBO A;  1ZLJ A;  3G6E I;  2IW5 A;  2M3A A;  2NS8 A;  2DN0 A;  3TOA A;  2JK3 A;  2P6S A;  2FEZ A;  1LFP A;  3ZN0 A;  1K6Y A;  2DDA A;  2DMU A;  2N8G A;  3OOU A;  2W84 A;  2RV8 A;  1GT0 C;  9ANT A;  2R93 J;  2XF6 A;  4A5M A;  3LA3 A;  1SD5 A;  2STT A;  1GVJ A;  3QU3 A;  1UCR A;  3DLL F;  4IO9 F;  1LFU P;  1KON A;  2XV4 S;  2OV7 A;  4MLO A;  2KKO A;  2L54 A;  1LEB A;  5D8L B;  2FML A;  1ZK8 A;  3NWT A;  3E0J B;  2HQA A;  3CJN A;  4HSR A;  4OU0 A;  1FMV A;  3M3Y J;  2HOS A;  4R1H A;  3E1S A;  1W0U A;  1I3Q J;  1OCO H;  3JSO A;  1TL8 A;  3T1B A;  2G9W A;  2M8E A;  2LH9 A;  1BI3 A;  2VQC A;  2OA4 A;  4LIV A;  2VKV A;  4HV6 A;  1N77 A;  5ILV A;  2M9H A;  4RB0 A;  5F0C A;  5LHH A;  2KIU A;  4P55 A;  3K70 C;  2FNA A;  4G6Q A;  2OBP A;  3RYR A;  3ZMU A;  1JXS A;  1CGP A;  1E3P A;  4BE1 A;  4UY8 I;  2ISZ A;  4UUS A;  3T0Y A;  2FA5 A;  2Y0S A;  4ZZL A;  3CDL A;  2HDC A;  3KZY A;  4FX4 A;  4XN3 A;  3OYL A;  1B4A A;  4B4C A;  3ASO H;  1USS A;  2QF7 A;  4D5F A;  1K4T A;  4BXX J;  3F8B A;  1LVA A;  1ON1 A;  2V26 A;  3V42 A;  3PUF A;  4A6D A;  3FKI J;  4C9Y A;  1G6N A;  1JJ6 C;  3CD6 I;  1EA3 A;  1FT9 A;  4BXF A;  4LG0 B;  1OYI A;  3EDP A;  1R1V A;  1E0E A;  3S1Q J;  1BIB A;  3CO7 C;  4B44 A;  1A5J A;  2ELJ A;  4AIH A;  2VJ4 A;  4P5O A;  4P96 A;  2P81 A;  2PQ8 A;  4LD5 A;  2H6C A;  2V6C A;  1PUE E;  2GLO A;  1YJN I;  3W6K B;  1MMA A;  3DF8 A;  4Y52 J;  2G7U A;  1A6Q A;  1DDN A;  1I3A A;  3I53 A;  1KYW A;  2MW8 A;  4G9Y A;  2F5V A;  2JT1 A;  3CF5 F;  1ORK A;  2TDX A;  4QLC U;  1EH7 A;  1ONV A;  2DFE A;  4IF4 A;  4BJT A;  1FBS A;  3K0L A;  5DM7 F;  3K1N A;  3GXO A;  2E2H J;  1STZ A;  3PUB A;  3BZC A;  3RSN A;  2KL4 A;  2YPR A;  3H9J A;  5B1B H;  5BS6 A;  2GIV A;  1EKE A;  2KDZ A;  3LSR A;  5L3G A;  1MBJ A;  3IH2 A;  1VQP I;  3L9F A;  3I0T A;  2CO5 A;  2RQP A;  4A3I J;  5FB2 A;  3IRQ A;  3BZ6 A;  5J1U A;  1R5G A;  4GGG A;  2YX4 A;  3WG9 A;  3I58 A;  4RB2 C;  1Y1V J;  5HLG A;  4IQ4 A;  4LG3 A;  3WE3 A;  3H35 A;  2HVR A;  1KU3 A;  3LMM A;  5LGU A;  2K40 A;  4HQM A;  4YG2 F;  4CXF A;  3BG5 A;  3SEQ A;  4AVP A;  1DP3 A;  4LB6 B;  3FXO A;  3CMY A;  2WY7 Q;  4GYI A;  5JVT A;  2PJR B;  1O7L A;  1F9N A;  2XDV A;  4A6E A;  3F23 A;  2ACJ A;  3OYK A;  2PBI A;  1A36 A;  1QZZ A;  1FTZ A;  2E1M C;  2VL8 A;  4G12 A;  3G71 I;  1R49 A;  2LSO A;  2CQK A;  2BE5 F;  5IP6 A;  1U5T A;  2V9K A;  2EWN A;  4F92 B;  4F55 A;  4ANJ A;  1TBX A;  1KQ8 A;  3E6D A;  4MHG A;  2IS1 A;  1K83 J;  5GPA A;  1D0Y A;  3RPU D;  4AU7 A;  3E5U A;  4DW6 A;  1NG7 A;  3LOC A;  2DJI A;  2IGO A;  4M71 A;  3JSP A;  4LLL A;  4HF1 A;  4S04 A;  1MND A;  3HOX J;  3HHH A;  1FNN A;  2W4S A;  4XOP A;  4BGD A;  4UNO A;  4XLE A;  3HXL A;  2DMT A;  3QPT A;  4IXA A;  1GVD A;  4ZYE A;  3O8G A;  2R92 J;  2K85 A;  3GME A;  2O3F A;  2VXZ A;  1OJL A;  3MZY A;  2VJJ A;  3ZXS A;  3BRO A;  1TQI A;  4LMY A;  3AG3 H;  4ZYA A;  3ZOB A;  3DWL E;  1QZE A;  5GP9 A;  5F1J A;  1WQ2 A;  1ETV A;  3G2B A;  2QUF A;  2JMW A;  4MEX F;  4Y33 A;  3KYC B;  5M3M J;  5D8K B;  3DBH B;  4X6A J;  2XF7 A;  4A0X A;  2PMU A;  4XLH A;  4F91 B;  2O7O A;  5HOD A;  4PJJ A;  4EMS A;  2VKD A;  1WJ5 A;  1XGS A;  1LKX A;  1YO5 C;  3WU1 B;  1S72 I;  2GQQ A;  3H0G J;  2GXB A;  2XIG A;  1ZGW A;  3A1Y A;  1MH4 A;  5HNH A;  1P4X A;  3QYB A;  1K61 A;  1WHU A;  4UHT A;  3RIR A;  4DBR A;  2DA2 A;  4RLQ A;  4W1U A;  3ZQQ A;  3H9G A;  4XR6 A;  5D5X B;  1KQ9 A;  3PNV A;  2V7F A;  1T95 A;  3AG2 H;  4HPQ A;  2UZK A;  1FYK A;  2VC1 A;  3FXM A;  1ETW A;  4PJ0 C;  3AKZ A;  2CV0 A;  1B6A A;  1IV8 A;  4BJ6 C;  1HA8 A;  3DXJ F;  3PM1 A;  3LAP A;  3IL2 A;  3HGG A;  2VBY A;  3HOS A;  1OMI A;  1IJW C;  2XAJ A;  5FLV A;  3G1L A;  4I98 B;  3WTS C;  2LKX A;  1SFU A;  3T5X A;  3I4N J;  1F43 A;  2ZB9 A;  2CWE A;  3DPU A;  3DBR B;  1IUY A;  2NVQ J;  3KET A;  1IRF A;  4J19 A;  1IRX A;  4LOC A;  2P5L C;  3IRR A;  5C4J J;  4E4H A;  2DPD A;  1WZ2 A;  2UUZ A;  3TMO A;  5A2Q Z;  3LA2 A;  2VON A;  1WSU A;  4HNT A;  3JRA A;  3FWE A;  3PNT A;  1DGR M;  2FUG 2;  3I71 A;  3ML6 A;  1U9N A;  4HQE A;  4YIR X;  3KCC A;  3E6C C;  1TLH B;  4BKX A;  3LSK A;  1H0M A;  3KPH A;  2L9S A;  3CCY A;  4DZJ A;  5E3M A;  1BW5 A;  2Y0M A;  5ICE A;  1Y8Q B;  2F4I A;  1UZC A;  4A3L J;  3ESW B;  4JQF A;  4IKF A;  4CA0 A;  1YS7 A;  2Z99 A;  3GFI A;  4L9N A;  1IAW A;  1ZR4 A;  2I8D A;  1Z6R A;  1VF9 A;  1ZGA A;  2MGQ A;  4HOB A;  3F72 A;  3KP3 A;  3SFZ A;  3VSK A;  2QLZ A;  3AL0 C;  2DJN A;  3QPL A;  5F04 A;  2KPM A;  4O5V A;  3I64 A;  1BJA A;  4CCK A;  5L3F A;  2NS7 A;  1RPW A;  5K7Z A;  2ZJP F;  4A69 C;  3WTY C;  1G3S A;  4ESF A;  4M9S A;  4C30 A;  1G59 A;  3TP0 A;  2DAO A;  5J4Y A;  4CYD A;  1IW7 F;  2PJP A;  3G1M A;  3MMY B;  3VYR B;  3OYA A;  2JA2 A;  1IN5 A;  1S7E A;  2J5O A;  2LTP A;  4L5J A;  3VYS B;  3NAU A;  3U9G A;  2VAS A;  4RAZ A;  2LYC A;  2YU9 J;  2VOO A;  3PQJ A;  1VQ9 I;  1O3Q A;  3VOE A;  1MSF C;  4EV0 A;  3EPZ A;  3K7A J;  2B7E A;  4KJZ A;  2ID6 A;  4HLY A;  4OIN F;  2CU7 A;  3VEP A;  1Q1V A;  5M5X J;  2HVS A;  3BLY A;  3QQA A;  4NQW B;  3M8F A;  4YEL A;  4XLN F;  1ZYR F;  2RGV A;  5F6F A;  2ZCW A;  1J75 A;  2LKS A;  3BG9 A;  2RC4 A;  1J9I A;  2MG4 A;  1I5Z A;  2EK5 A;  4R79 A;  1X2N A;  2EZL A;  3EUH A;  1IG7 A;  1CF7 A;  2DMP A;  4Q48 A;  5K5R A;  4S05 A;  4ABZ A;  4ETS A;  2AQF A;  3K69 A;  3U1D A;  1TNT A;  4DYC A;  5FLM J;  1GLN A;  1WH7 A;  2A07 F;  2VQG A;  3J80 K;  1MGT A;  1ZGJ A;  1B9M A;  4A3J J;  1IRZ A;  3DKX A;  2KLO A;  2E60 A;  3WG7 H;  4OMY A;  4U88 A;  2LNB A;  4HW0 A;  4I02 A;  4L9V A;  1I27 A;  2D1V A;  2M30 A;  4G6T B;  1ZRE A;  2OF7 A;  4KFC A;  3QOP A;  1OFC X;  4BJ5 C;  3CMA I;  4AM3 A;  2C6Y A;  2ZBK A;  2QBY B;  2LLK A;  4OIQ F;  3GTK J;  3C3W A;  3RDI A;  2OCE A;  4ASN A;  5E8I A;  3GTM J;  5JHF A;  1HKS A;  1FP1 D;  2LP0 A;  1SMT A;  1U5T C;  1XSX A;  2OD5 A;  5TIS C;  4PGH A;  4X0G A;  4B8X A;  1J5Y A;  2K9M A;  1R22 A;  2IGM A;  4BXU A;  3W2A A;  2R7F A;  1IN8 A;  4EJW A;  1T2K A;  4JK1 X;  3TW6 A;  4N9H A;  3F9K A;  2PMH A;  4RAG A;  3QAH A;  2CFX A;  2DA4 A;  3V7C A;  2M87 A;  5B3S H;  1ZH5 A;  2XPU A;  3BCB A;  2M7B A;  2A6H F;  2CUE A;  3PFY A;  1TTY A;  4C3I J;  2GM4 A;  3IAS 2;  1SD6 A;  2JUG A;  3FIW A;  1LDD A;  4OIR F;  4NUB A;  4ZZD A;  2RKH A;  3OSG A;  4QWQ A;  1YW9 A;  2IP2 A;  3A02 A;  3WTZ A;  3KYD B;  3DKW A;  3H3Z A;  4S0H B;  4BE0 A;  5FLX K;  2WB1 A;  3EUK L;  3HOV J;  3BDD A;  1TWA J;  3LST A;  4Y7N J;  2FX0 A;  2M2E A;  1MBF A;  3BR6 A;  2P8T A;  1IN6 A;  4ZDO A;  2BOL A;  3P9K A;  3F8N A;  2MH9 A;  1JUP A;  2NRA C;  4DOZ A;  5JHU A;  1FTT A;  5L3E A;  3H9Q A;  2VPR A;  2AXT C;  1PUF B;  3L2C A;  3K4L A;  5H2F C;  2LF8 A;  2WY8 Q;  1OCC H;  3W6J B;  1VND A;  2W82 A;  3LFK A;  2WAQ N;  4FE4 A;  2CV2 A;  4M3F A;  4B09 A;  2L4M A;  4JP0 A;  2E2I J;  1WPK A;  1YYV A;  2JJ7 A;  2QQB A;  4YFN F;  5DM6 F;  3MZH A;  1FY7 A;  3CUQ B;  2EV6 A;  2QCO A;  3CCL I;  3RPQ A;  2X6O A;  3JTH A;  1F4K A;  1JT6 A;  3P5J A;  4G7Z F;  1YRN A;  2JA5 J;  2V6E A;  3GTP J;  1UHS A;  4NNJ A;  3COA C;  3S17 J;  2WAE A;  2XB0 X;  4XOR A;  1VQ8 I;  2OUM A;  1LE8 A;  1YS6 A;  4HA8 A;  4YEJ A;  2V79 A;  3A03 A;  2V9V A;  3T8T A;  3BR1 A;  3K6G A;  1D1B A;  4XIC A;  3OYD A;  1OCZ H;  1T6S A;  2KP6 A;  1IN4 A;  3FBI B;  5L3B A;  4RDU A;  3ZP5 A;  1EH8 A;  4XKV A;  3EYY A;  1LUJ B;  1AKH A;  3GLX A;  5CLS A;  4GXO A;  1N75 A;  2ZME C;  3SDG A;  2KJC A;  2XRO A;  3KZI C;  5FKN A;  2HQR A;  2D45 A;  5M5W J;  2VE9 A;  5AIQ A;  5DCM A;  4KDP A;  5A2Q K;  3B6A A;  1J0R A;  2YX7 A;  2F2E A;  5IOZ A;  1R4N B;  3GVA A;  3JTG A;  1NTC A;  4PFO A;  1P4W A;  3M7G A;  2F5C A;  3G1O A;  5FKO A;  3S1R J;  3HC7 A;  3OV8 A;  1Y0U A;  2O61 A;  3I55 I;  1FP2 A;  1DU0 A;  1TW3 A;  4KT5 C;  1XDU A;  1Y0N A;  3ZCO A;  1QA6 A;  4KIC A;  4UVA A;  4OAZ A;  5EYR A;  1B9N A;  2M0C A;  4RB3 C;  3K4B A;  3OYC A;  2DYR H;  4DIQ A;  3X2Q H;  3BJ6 A;  3KP4 A;  3S2W A;  4YIF A;  1FOX A;  4ZH4 F;  2ESN A;  1NK2 P;  5ILS A;  4M6X A;  3ABU A;  2QZ8 A;  3QYE A;  3FM3 A;  3HDD A;  2M0M A;  3GFJ A;  1W36 D;  1T0F C;  1LEA A;  2L9R A;  5B66 C;  1XMA A;  1SAU A;  3QOD A;  5KCM A;  3D5L A;  2JZY A;  3H5N A;  4AYB A;  1U8R A;  3HKZ N;  4M6Y A;  4AIK A;  1SAN A;  2P5K A;  3CCM I;  3BR2 A;  5J1Y A;  2PEX A;  1O57 A;  2Y75 A;  4PSW A;  1K78 A;  4M9Z A;  4MFE A;  1RUN A;  3FK7 A;  3V8K A;  1MZB A;  1OQY A;  4J00 A;  1W4M A;  1RZ4 A;  5JI6 A;  4KYW A;  1F1Z A;  2IGN A;  2PMZ A;  4C3J J;  4P1W A;  1R23 A;  1SMY F;  2X51 A;  4GFB A;  1GUU A;  3OYB A;  5JLX A;  4WXD A;  4LLN A;  2ZO4 A;  2R7W A;  1WFX A;  2KZV A;  3OYI A;  1XS9 A;  2NOG A;  4NHJ A;  5E3L A;  4EJO A;  2ETH A;  5E20 A;  3S2H J;  1WWX A;  2Z9O A;  4FCY A;  3CCU I;  3PJR A;  2XAU A;  3Q3S A;  3S2D J;  4A0Z A;  3TDZ C;  2XRN A;  4EM1 A;  3K9T A;  1WCM J;  1XGO A;  5GAD J;  3TOB A;  1MBG A;  2L3D A;  2CV1 A;  2LFB A;  3M07 A;  2FOK A;  3IC7 A;  2W57 A;  4B3A A;  4CCM A;  2F4O B;  3IKV A;  4IHY A;  2DTZ A;  3A01 A;  1NH3 A;  2STW A;  4PJL A;  3MKY B;  3H3U A;  1I50 J;  1U6G A;  2EIM H;  2K27 A;  5BPI A;  3HZJ A;  2X85 A;  3M1C A;  2R5Y B;  2MLG A;  5ED4 A;  4IRG A;  4XID A;  2W1O A;  3BG7 A;  2CS3 A;  4ZDL A;  1WJB A;  1TWC J;  1Z1D A;  3IHU A;  4PGG A;  2EA2 A;  2FNP A;  3D1N I;  1GV5 A;  2VKH A;  2HXI A;  2O8X A;  1SEU A;  5HNF A;  1DU6 A;  1QHG A;  1ZAR A;  2IT0 A;  5HS7 A;  1MW7 A;  3GEZ A;  1Z7U A;  4EGZ A;  4RGX A;  1DGW Y;  4HNU A;  2DQR A;  1D8K A;  4A3E J;  2W24 A;  4F7Z A;  3JRI A;  3JRB A;  2EA4 A;  1O4X A;  5EF6 A;  1AA7 A;  2L7M P;  4DYR A;  5BOX A;  2MH2 A;  3HIF A;  2XF5 A;  1IUF A;  3RJP A;  4V2F A;  1AU7 A;  3PO3 J;  1MMS A;  2VUM J;  2IXS A;  2IRF G;  1POG A;  3DLA A;  1T08 B;  2XAS A;  2IGK A;  3FKJ A;  4XL9 A;  5CKT A;  4JX4 A;  2V1X A;  1P9Q C;  3LSJ A;  3E7L A;  1VQO I;  4XN0 A;  5DUI A;  4CZC A;  1XMK A;  2OU2 A;  2VIX A;  4UVC A;  5JVG F;  2VE8 A;  3FDY A;  1FBU A;  1MNM C;  1MH3 A;  3S3N A;  3C2G A;  5ICC A;  4HF0 A;  5H6R A;  3MQ0 A;  3TL4 X;  4RAF A;  3ZR8 X;  5ERI A;  3A4C A;  5HVQ C;  2FXA A;  2ZNY A;  2HXO A;  1ETO A;  3MKL A;  1JGS A;  3CLQ A;  4HST A;  2IA1 A;  2LMD A;  2ID3 A;  4HYE A;  1OCT C;  4ZYH A;  2Q1Z B;  1HXD A;  3KP5 A;  1BOB A;  3DU6 A;  3QOE A;  4M6V A;  4ZYD A;  2KIS A;  3MFK A;  4IHV A;  3LSM A;  1VQ5 I;  3ECH A;  3H5A A;  1ITY A;  1XG1 A;  2VKE A;  4NDL A;  2BGC A; 
#chains in the Genus database with same CATH homology
 2E2J J;  3GTO J;  2DA2 A;  2IBD A;  5F0H A;  4W1U A;  4XRS G;  3Q0V A;  2Y31 A;  3PO2 J;  5J1R A;  3UKG A;  2ELK A;  1F36 A;  2DMN A;  1ETW A;  1MSE C;  3I4M J;  2XGE A;  1JTX A;  3PM1 A;  1T33 A;  3HGG A;  5FJ8 J;  1IJW C;  5FLV A;  3BQZ A;  3G1L A;  2LKX A;  1U9O A;  3I4N J;  3ZQH A;  1F43 A;  2ZB9 A;  2CQX A;  2Y30 A;  3TP3 A;  4D7M A;  4MFD A;  3K2A A;  2TRT A;  4DZP A;  2NVQ J;  4J19 A;  2AHQ A;  2GBY A;  2ECC A;  2EZI A;  4QSH A;  4LOC A;  1GDT A;  1UMQ A;  4A3K J;  2NVY J;  1P7I A;  2DA5 A;  1JKP C;  5C4J J;  5C4X J;  3M4O J;  1UG2 A;  3JRA A;  1TWH J;  4W97 A;  2B63 J;  1U9N A;  2PMZ N;  2HYJ A;  1EF4 A;  1JGG A;  1RKT A;  4BKX A;  1TWG J;  3CCY A;  4DZJ A;  5E3M A;  2JWT A;  4FTH A;  4XK4 A;  5EG0 A;  1BW5 A;  3VPR A;  2K9Q A;  2G0E A;  4A3L J;  2LD5 A;  2LY9 A;  4HNV A;  4I6Z A;  4DYQ A;  1XC5 A;  3IH4 A;  5F0F A;  1ZR4 A;  1VF9 A;  2HI3 A;  2MGQ A;  4A3M J;  3HBL A;  1GV2 A;  2DJN A;  3GTL J;  3QPL A;  5F04 A;  3GTG J;  3TW7 A;  1HOM A;  1BW6 A;  3OSF A;  1JKQ C;  1BL0 A;  3LSG A;  2HOA A;  2AO9 A;  4D5C A;  1CQT A;  2NS7 A;  1RPW A;  3BQY A;  2X9D A;  5K7Z A;  4A69 C;  1HF0 A;  5IYD J;  3B6C A;  3BR3 A;  3JRF A;  5EG0 B;  1RKW A;  3TP0 A;  1RES A;  1WI3 A;  2E19 A;  1QVU A;  1IV6 A;  3G1M A;  1B72 B;  3HEF A;  1NK3 P;  1S7E A;  3IH3 A;  4CYC A;  2LTP A;  2Y9Y A;  1D5Y A;  3NAU A;  1ENH A;  3ZQC A;  2NVT J;  2X48 A;  4D7N A;  2YU9 J;  1MSF C;  1WH5 A;  3K7A J;  2ID6 A;  2Y2Z A;  2CU7 A;  2W48 A;  1Q1V A;  2DA3 A;  5M5X J;  3QQA A;  2YUS A;  4CYC B;  3BG9 A;  3JRD A;  5EGO B;  3JRH A;  2R0Q C;  2MG4 A;  4EEF G;  2R5Y A;  3OIO A;  4C2M J;  4QIW N;  1X2N A;  3NAR A;  3HM5 A;  1MBK A;  2EZL A;  2I10 A;  1IG7 A;  5IP9 J;  2DMP A;  1U78 A;  1JT0 A;  1JUS A;  4ABZ A;  4M3D A;  3ZQG A;  2DMQ A;  4DYC A;  5FLM J;  1WH7 A;  3S16 J;  5F08 A;  4FIS A;  4JYK A;  4A3J J;  1ETK A;  2L7F P;  1IRZ A;  3ZQF A;  3HOW J;  1ETX A;  2K9S A;  4QTR A;  1TC3 C;  4BBR J;  3S1M J;  1OCP A;  2H8R A;  1LFB A;  3BR0 A;  2ME0 A;  2EH3 A;  2OF7 A;  1OFC X;  1HDD C;  5J3L A;  5E3O A;  1AHD P;  2LLK A;  3GTK J;  2M8G X;  3GTM J;  1FEX A;  2LP0 A;  3FIS A;  3S15 J;  3Q0U A;  1FIP A;  2L7Z A;  2E1O A;  5FKK A;  2EQR A;  4BY1 J;  2RAE A;  4M3E A;  3TW6 A;  2FQ4 A;  5GPC A;  2IEK A;  1I6H J;  1X58 A;  3HGY A;  5FKL A;  3JR9 A;  5EZH A;  2DA4 A;  2EBI A;  2MSY A;  4A3G J;  2XPU A;  3H3V K;  4IHW A;  3ZQI A;  2CUE A;  4A93 J;  5EEA A;  4M3B A;  4C3I J;  1MBE A;  2GM4 A;  1T56 A;  2HDD A;  2XPW A;  3HOZ J;  1HDP A;  1JUM A;  3FIW A;  3GTQ J;  2YS9 A;  3OSG A;  2KT0 A;  3A02 A;  2JA8 J;  4S0H B;  5IOY A;  4IEJ A;  3BTI A;  3HOV J;  1TWA J;  2LVS A;  2FX0 A;  3BR5 A;  2M2E A;  1MBF A;  3BR6 A;  1BJZ A;  4Y7N J;  1HCR A;  1ZTR A;  5F27 A;  3JRC A;  3BTL A;  3RZO J;  1JUP A;  1FTT A;  2VPR A;  2O8K A;  1PUF B;  3BTC A;  2L0K A;  1Z77 A;  4MIM A;  1VND A;  2DA1 A;  1QVT A;  2WAQ N;  3SFI A;  4FE4 A;  2Y0S N;  4XRS A;  4M3F A;  4MO7 A;  4JP0 A;  2JA6 J;  2R5Z A;  1R9T J;  1TWF J;  2E2I J;  1WPK A;  2JJ7 A;  1IDY A;  2QCO A;  3O8H A;  2LK2 A;  2XRL A;  4RBO A;  5JLW A;  1AKH B;  1H8A C;  2X6O A;  1QPI A;  1RR7 A;  2JN6 A;  1JT6 A;  2LR8 A;  2JA7 J;  2NS8 A;  3BTJ A;  2Y9Z A;  1YRN A;  2JA5 J;  3FK6 A;  2DN0 A;  2JK3 A;  3GTP J;  1UHS A;  2R7Z J;  3S17 J;  2DMU A;  2N8G A;  2XB0 X;  3OOU A;  5IP7 J;  5FKM A;  1LE8 A;  1GT0 C;  9ANT A;  2R93 J;  5BNG A;  3A03 A;  3BR1 A;  5E3N A;  1VI0 A;  4XIC A;  2H1K A;  1LFU P;  4MLO A;  4RDU A;  4AC0 A;  2D5V A;  3F0C A;  4A3F J;  4BY7 J;  2COB A;  5M3F J;  1ZK8 A;  4FE7 A;  4M3G A;  2WB1 N;  1AKH A;  3TED A;  3GBG A;  3HOU J;  3SDG A;  3M3Y J;  1YRN B;  2HOS A;  1W0U A;  1I3Q J;  5FKN A;  5M5W J;  3B6A A;  4A3C J;  2WV1 A;  5IOZ A;  5K7H A;  1NTC A;  4B1R A;  3G1O A;  5FKO A;  3S1R J;  1JJ8 C;  2M34 A;  1PUF A;  1DU0 A;  5EGO A;  4UUT A;  2VKV A;  3CQZ J;  1ZKG A;  2M9H A;  5F0C A;  5EYR A;  3DCF A;  2M0C A;  1E3O C;  4UUS A;  5C3E J;  2O9L A;  3CDL A;  1APL C;  2VI6 A;  1VFC A;  1H89 C;  1NK2 P;  1A6I A;  5EZG A;  4B4C A;  3HDD A;  2L9R A;  2QF7 A;  4D5F A;  2IAI A;  1Y1W J;  2HQ5 A;  4BXX J;  1IDZ A;  5DTD A;  3HKZ N;  1SAN A;  2FD5 A;  3BR2 A;  5J1Y A;  3FKI J;  1JJ6 C;  3LSP A;  3MVP A;  4UUS B;  5IPA A;  1Z0X A;  1B8I A;  1HLV A;  3W6V A;  3S1Q J;  4MFE A;  3FK7 A;  1SFO J;  3JRE A;  1A5J A;  1RET A;  3RZD J;  4C3J J;  1W0T A;  2P81 A;  1MBH A;  4JX5 A;  2DA7 A;  2GLO A;  1BA5 A;  5C44 J;  4Y52 J;  4GFB A;  1GUU A;  3IV5 A;  1IGN A;  5JLX A;  2XPV A;  4I76 A;  3RQI A;  2MW8 A;  2FJ1 A;  1XS9 A;  1ORK A;  2NOG A;  5E3L A;  3HB9 A;  3QPS A;  4A3B J;  3S2H J;  2ME6 A;  2CQQ A;  5IYC J;  4AUX A;  1ETY A;  4FCY A;  3Q0W A;  3Q3S A;  1IC8 A;  3S1N J;  3S2D J;  2R5Z B;  1H88 C;  2E2H J;  4V2G A;  1WCM J;  1ZR2 A;  2XB5 A;  5M5Y J;  1LE8 B;  2OPT A;  1MBG A;  4X1E A;  2LFB A;  2KDZ A;  4JX6 A;  3DEW A;  3LSR A;  4B3A A;  4IHY A;  1MBJ A;  3IH2 A;  2DTZ A;  3A01 A;  2NVX J;  4A3I J;  1U8B A;  5J1U A;  3C2B A;  1I50 J;  1ZQ3 P;  1FJL A;  3WHC A;  2R5Y B;  2HOT A;  3SJM A;  1Y1V J;  5DS9 A;  4XID A;  3BG3 A;  1TWC J;  3L1P A;  3D1N I;  1FIA A;  1GV5 A;  2K40 A;  4AYB N;  2HXI A;  2CRG A;  1WGX A;  3BG5 A;  1DU6 A;  3S14 J;  2K9N A;  3A01 B;  3CMY A;  4A3E J;  4A3D J;  1FTZ A;  3JRI A;  1B8I B;  3JRB A;  4G12 A;  4C3H J;  1B72 A;  3RKQ A;  1X2M A;  5EF6 A;  1O4X A;  3HOY J;  2XGD A;  2L7M P;  4DYR A;  5IP6 A;  2DA6 A;  3LNQ A;  1JKO C;  1QRY A;  2CJJ A;  5K7F A;  3ZQL A;  1P7J A;  1IUF A;  1AU7 A;  4V2F A;  3PO3 J;  3MN2 A;  2VUM J;  1K83 J;  5GPA A;  1POG A;  4DW6 A;  2XSD C;  3LOC A;  5EDN A;  4JX4 A;  3HOX J;  3LSJ A;  3E7L A;  4L5E A;  2EZK A;  2ECB A;  2DMT A;  1GVD A;  1G2H A;  3O8G A;  2R92 J;  1MNM C;  1MH3 A;  5IYB J;  1OJL A;  1JKR C;  2CUF A;  3ZOB A;  2EZH A;  2HXO A;  1ETO A;  5GP9 A;  5F1J A;  3GTJ J;  1ETV A;  3MKL A;  2JMW A;  4IHX A;  1JTY A;  5M3M J;  4XRM A;  2ID3 A;  4X6A J;  1OCT C;  2TCT A;  2O7O A;  3WHB A;  5HOD A;  4M6V A;  1ETQ A;  3JRG A;  4IHV A;  3BT9 A;  3H0G J;  1ZGW A;  1ITY A;  1XG1 A;  2VKE A;  4BBS J;  4NDL A;  1MH4 A;  2XGC A;  1K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...