3HOVG

Complete rna polymerase ii elongation complex ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hovG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hovG01
2K50A 4Y52H 1CSPA 5GADC 1IBKL 3UDFA 1XPOA 4IFDI 3W1GA 2XGTA 2DUDA 4R4CA 2L15A 4JCVE 2Z0SA 3GTMH 3AQQA 4JI2L 2IY5B 3H0GG 4DV5Q 1IXRA 4B3SQ 5FJ8H 3RNUA 2WB1E 4JI7L 4PZ8A 4AQYQ 4JBMA 1HZBA 4OX9L 3AFQA 4A3LH 1W2BA 1QUQA 2RHQB 3CQZH 3L2PA 5LMNW 3S24A 1E1TA 1HNZQ 1E1OA 3K7AH 4BXXH 2BH2A 3F8TA 3CCQA 4BXXG 1WOCA 2KHIA 4X64L 4POGA 2JA8H 1JE5A 3HKZG 2JA8G 4JI8Q 4BBSH 2KENA 5IP9H 2UXCL 1HNXL 5IP9G 4JI6Q 1Y1VH 4QGUA 1GD7A 1PH1A 4A3DG 1PH8A 1N9WA 1Y1VG 3GTPH 1VQ5A 3I4MG 3J81j 4LF4L 2V1CC 2OTJA 1O7IA 3T1YL 3RLNA 4DR3Q 3U4ZA 3RLOA 2I5MX 1B7YB 4GKJQ 1X6OA 3T1HL 4A3FH 2QA4A 2B63H 4R4TA 1YJ9A 2NVTH 2B63G 4A3FG 4JI0Q 1C9OA 4GLAC 5GQOA 5IWAL 1YEZA 4OONA 4L5RC 1YI2A 2LSSA 3H15A 3FKIH 3J81i 1C7YA 4B3TL 4LF8Q 4YY3L 2ZTDA 1X3FA 3FKIG 3RR5A 3W5OA 2EQSA 3CCVA 4POFA 3MEFA 3J81c 3PF5A 2XTIA 3CCLA 4XTCS 2OCEA 4TQUS 4QL5A 4HJAA 5J3BA 5BR8Q 4X66L 1N34L 4A3BH 1T9HA 3HKZE 3CAMA 5LMUQ 4DUYQ 4HIKA 1KRSA 3UDXA 2RHSB 5C3EH 4GLVB 4A3GH 4YHHQ 2CWAA 4GOPB 3S1RH 2K75A 1X56A 1UE6A 3PUWA 4ALPA 1IBLL 2JA7H 1IYJB 3HOUG 1DGSA 1SN8A 2F52A 2JA7G 3HOXG 3F2BA 4LFBL 4NXML 1Q7YC 3FP9A 4GS3A 2JA6H 5ELOA 2JA6G 5LMNQ 4WJ3M 1HNWL 1EUJA 2BA1A 3CCUA 1HR0W 2VNUD 3PO2G 2PQAA 4A76A 1QVGA 4OWWB 1Q1EA 1X65A 1JMCA 4B3ML 1LYLA 2AMCB 5IT9c 4QQBX 1K8AC 2F3IA 1Q81C 2VQFL 3UE0A 5C44H 1VQMA 4C3IH 1I3QH 2HT1A 3TRZA 5C44G 2Z6KC 1PYBA 1G51A 3H3VI 4DR7Q 4A3IG 3E9HA 3GTKH 1K3RA 2ZTCA 1A63A 2CKZB 3CCEA 2OQ0A 1HJPA 1Q8KA 1TWCH 2I5HA 2MO0A 3DM3A 4QIWE 1V9PA 5FLMH 2RCNA 2MNAA 4A75A 1XMQL 3A0JA 1V43A 2LXJA 5FLMG 4JI3L 1LM0A 3JAMc 3CCMA 4DK3C 4DR5Q 1YJNA 1XPRA 3GTGH 2UXBL 2NN6G 4BBRH 2ID0A 1VQAA 4BBRG 2FXQA 4GLXA 4LNQA 1N36Q 4B3RL 3PCOB 4B3SL 4IFDJ 3EIVA 4IJLA 4AIMA 4AQYL 1X9NA 2K5NA 1TXYA 2UXDQ 5GAGC 4JYAQ 1PH9A 1JJGA 4GNXA 1OXVA 3BZKA 2HHHQ 3G48A 3AFPA 2NZHA 4L5QA 4DK6C 3PIPA 1VQLA 1L1OA 4LFCL 4DUZQ 4GN4B 4JI4Q 4WJ4A 1FGUA 1PYSB 5IY0A 4OO1G 4NXNQ 2JJQA 5DLQE 4LW1A 1KRTA 1AE3A 5M3FH 1J6QA 4X62Q 4MTNA 1RIPA 2KHJA 3OW2A 4XIGS 1TWAH 3PUXA 1YHBA 1Y1WH 3J7ZC 3G6EA 4A93G 5AJ3Q 4JBWA 2A1AA 2HIXA 3I7FA 3KYHC 1BKBA 2IHFA 3GTOH 2D0OA 3S2HH 2KBNA 2R93G 4DV1Q 4JC0A 1VQDA 4LFAQ 2ZJQA 3KDFB 3DLLA 1HR0Q 1KIXA 1XNRL 1GO3E 3JC66 2N49A 1JJCB 2VQEQ 1VQ6A 5IYBH 4GOPC 4LF8L 5GAHC 3U58A 1CKNA 5IYBG 3E0EA 3H3VH 1HZCA 1OXUA 4HJ8A 1I94L 1Z9FA 3E9IA 2E5LQ 4X65Q 4HIDA 3ZJYC 3CCSA 1TWGH 1LUZA 3CC2A 3GTLH 2NVXH 2PNHA 5BR8L 5FJ8G 5ELNA 3K0XA 3Q8DA 3ULLA 2R92H 4A3CH 1L2FA 4DUYL 4A3LG 3A74A 4DV7Q 4A3CG 3K80C 2VL6A 4A3KH 3K81C 2YTYA 1VQ7A 4DAYB 4YHHL 3CP0A 4A3KG 1B8AA 3CPFA 1XNQQ 5M3MH 4H02A 3M4PA 1PH6A 1EYGA 4BBSG 3L0OA 2K4KA 3WWVA 4LF7Q 4JOIC 2E2HH 4BY1H 4DV2Q 2JE6I 2H5XA 5EAYA 1WCMH 3ER0A 3KF6A 3PSIA 3RLFA 2Y0SG 1PH3A 1N32Q 1K0RA 1WCMG 1YBYA 4DV4Q 5JJKA 4GKKL 2QGQA 3I4NH 1WI5A 1Q12A 1C0AA 1Y14B 4IO9A 3ULPA 2A8VA 1I6HH 3AYHB 5GAEC 3PO3H 2NVYH 2AWOA 2AWNA 3PUZA 1YHAA 1VQKA 2WP8J 3BJUA 1VQIA 2R7FA 2ALYB 4DV3Q 2JK8A 2E2JH 1XMOQ 2E2IH 1NMGA 3CPWA 4HJ7A 4UP9A 3CW2C 4DV0L 3NELA 3F1ZA 3D0FA 4R4IA 4R4OA 4A3MH 1EIYB 3STBC 5C0XJ 1PHJA 1PH2A 2D0PA 2DGYA 3ERSX 4ME3A 1J5EL 1NY4A 1IBML 2GVBA 2MFIA 2LXKA 1EFWA 2UUCQ 3HOVH 2UUBQ 3S17H 4A3BG 3HOVG 4IFDG 1VQPA 4DR1L 4IJHA 4EX5A 5C3EG 4DR2L 3STBD 1Q1BA 4DR6Q 2UUAQ 4A3GG 2BH8A 1PA6A 2UXDL 1YITA 1R9TH 2KCTA 4HJ5A 1ASZA 3S1NH 2Y0SE 2I5LX 2YU9H 4IPDA 2HHHL 1HH2P 1OXXK 5JEAG 2YTVA 4LUZA 4UP8A 3G71A 4NPSA 1OTCA 2E8GA 3KJPA 4HIMA 3PGZA 3S14H 2MQHA 2UU9L 4JI2Q 1BBWA 1A0IA 4LUVA 1NMFA 4NXNL 4OX9Q 5IYCH 3RN5A 4DNIA 4X62L 4GN3B 4UY8C 3NEMA 4JV5Q 4L5TA 3OTOL 3ULJA 1VQBA 3W1BA 1Z47A 3UDGA 4JBKA 4L5SA 1CUKA 1VCIA 4EQ5A 3CC4A 1UE7A 4X64Q 1NTGA 2Q2HA 1K8GA 4K0KQ 3JAMi 3J7A5 1PH5A 4DV6Q 5C0XI 2VW9A 2ZM6L 1YVCA 2UXCQ 2CWPA 3TREA 1YJWA 1W3SA 4R4QA 4IPCA 3SGIA 3TEHB 2VQEL 4KI0A 1N33Q 1JB7A 1VQGA 4R1JA 1VQJA 4A3JH 1QZHA 5IE8A 1KC8C 2K52A 2IX1A 1KL9A 3J80i 4DV5L 3GO5A 4X65L 2E5LL 2QEXA 2YV5A 1G6PA 1VQHA 1QZGA 2Q2TA 1MJEA 3J80c 4OWTB 2JA5H 3GTQH 4DAMA 4X6AH 2WAQE 2JA5G 4FDBA 2EXDA 5IWAQ 2AKWB 1HNZL 1VQ8A 1RL2A 4PG3A 4LUOA 1QUQB 1OXTA 3KOJA 4B3TQ 1G291 5C4XG 2MO1A 2ES2A 2EIFA 3F2DA 3PV0A 4JI8L 3CCRA 3M7NA 3IRBA 1QVFA 1Q86C 4MNOA 3HOYH 3PUYA 4JI6L 1PVOA 1X55A 4AYBG 1S40A 1N34Q 2KCMA 4X66Q 1GM5A 2ZJPA 4DR4Q 4DV2L 5M3FG 4GOPA 2R6GA 4P71A 1N32L 4PZ7A 5M5WH 4DR3L 3D31A 1Y1WG 1EQQA 1IL2A 4GKJL 3GDEA 1MJCA 1IBLQ 1BVSA 3NBHB 4JI0L 3S16H 1UE1A 1PH7A 2YTXA 4LFBQ 4AH6A 1MIUA 2D62A 3MXNB 1JJ2A 1E3PA 1OXSC 1P8LA 1I50H 4QJFA 2VZAA 4NB3A 4LF5Q 3RN2A 2N8NA 3CXCA 1D8LA 1NBWA 2N3SA 4A3EH 1NJIC 4B3MQ 4GNXC 4A3EG 5JJIA 3M85A 5LMUL 2R92G 2VQFQ 4HIOA 1L0WA 5FLXc 4C3JH 1FVIA 3PIOA 4IOCA 1YZ6A 1E7ZA 4AYBE 1H95A 1GVPA 1U0LA 3UDIA 5E7NA 4LF6Q 3HOWH 5C4XH 3PF4A 1SE8A 1SROA 3HOWG 3HFZB 3I2ZA 2BA0A 2VY3A 5M3MG 1XMQQ 3KF8B 4JI3Q 3CC7A 1AH9A 5HGQA 2ZJRA 2UXBQ 4J15A 1VQOA 3H0GH 3U4VA 1WYDA 5LMNL 4BY1G 4JI5Q 4RMFA 4B3RQ 1M1KC 1E22A 3RZDH 1D7QA 2A19A 4PZ6A 2F4VQ 3I4NG 2PQAB 1BBUA 1CKMA 2K5VA 1YIJA 4JV5L 4HJ9A 3PO3G 5K36G 4P74A 1WFQA 4KHPQ 4OWXB 1TWHH 3I56A 4DR7L 1FL0A 2Q2UA 1KHIA 4KHZA 1M90C 4K0KL 4LFCQ 1K9MC 4DV6L 3F2CA 1HZAA 2K14A 3S2DH 1FJGQ 4A3DH 2JQOA 4C2MH 1PV4A 3KJOA 3I4MH 2PMZE 4YCVA 3K7UC 1XPUA 4LF9Q 1N33L 4DR5L 1I5FA 3EN2A 1A8VA 3LGJA 4A3MG 1SR3A 3EBEA 3CD6A 1VQCA 1PFSA 5IYDH 1MKHA 1GKHA 1UE5A 3M9BA 4O2DA 5IYDG 1PH4A 1N36L 1VQNA 2JA9A 3L7ZC 2PI2A 3KDFA 1K83H 1YHQA 5IP7H 4JI1Q 2NN6I 5IP7G 4JYAL 4IPGA 2IHEA 1XNRQ 3M4QA 1Q82C 1S3OA 2B3GA 2IT1A 1VQ4A 1IBKQ 4BA1I 5M5XH 3S1QH 1SMXA 3BU2A 3KLWA 4GNXB 2Z6KA 4YWLA 3TQYA 2WAQG 4DUZL 3FHWA 1K73C 4JI4L 1P16A 4YWMA 2RF4A 1I94Q 1V1QA 1CKOA 1L1OB 4JI7Q 1EWIA 4PMWA 3A5UA 4DR4L 3I4OA 4BY7H 3GD7A 3A5ZB 1VS0A 2NVQH 5IYCG 2VUMH 4BY7G 3B6YA 2I0QA 2ATWA 2JEBI 2VUMG 4MZ9A 5M5YH 5H1SE 4BA2I 1EQRA 5AJ3L 3G4SA 4JG2A 4OO1I 2JEAI 3HOUH 1XTDA 5JJLA 5HY6A 3HOXH 2AHOB 1X54A 2NZOA 3S1MH 4DV1L 3K8AA 4LFAL 2OTLA 1HNXQ 1EOVA 1EIFA 1A62A 1SRUA 1WJJA 2C35B 3U50C 3I55A 2IX0A 3GTJH 1HR0L 1LTLA 3VDYA 4A4IA 4LWCA 2Q2IA 4LF5L 3PO2H 4LF4Q 1UEBA 1NE3A 3T1YQ 4YCUA 4A3JG 4GKKQ 1JT8A 1KXLA 1CKNB 2R7DA 3PUVA 3T1HQ 3UE1A 1E24A 3S15H 4YWKA 3TS0A 1X3GA 1SFOH 4DV7L 3ICEA 4A3IH 2N78A 4O0AA 3CCJA 4KLKA 3TS2A 5GROA 1VQ9A 2ZTEA 1XJVA 2CCZA 4LF6L 3AEVA 2R7ZH 1XNQL 4YY3Q 2YYZA 2R7ZG 1VQFA 1Q46A 2CFMA 1S72A 4DV0Q 3M3YH 2HIVA 3KFUA 1ASYA 4LF7L 3HOYG 1J5EQ 1SLJA 1IBMQ 3HKSA 4YCWA 4UPAA 4JI5L 1KD1C 4JBJA 3CMAA 1CSQA 2OQKA 4C3HH 4DV4L 4DR1Q 1N8RC 4DR2Q 3OYYA 3KF6B 2F4VL 4APVA 5JEAJ 2B29A 4OXPA 4DKAC 2OWOA 1YNXA 4QY7A 4NXMQ 4KHPL 2WB1G 1AE2A 4DV3L 1VQEA 2WFWA 1XMOL 1KQSA 1IZ6A 2UU9Q 2GN5A 3NENA 4RG1A 4P73A 1FJGL 2K5HA 5C4JH 3HOZH 1HNWQ 4Y7NH 3HOZG 1TWFH 4P72A 1B70B 4IOAA 2VS1A 4LF9L 1UWVA 4UP7A 1HZ9A 4IPHA 3RZOH 5C0XG 1QVCA 1U5KA 4A93H 3OTOQ 3M4OH 4JOIA 2UUCL 3CF5A 2UUBL 1L1OC 3CMEA 1X3EA 2PI2E 2R93H 2ASBA 4TVAB 2GVAA 3BZCA 4DR6L 2UUAL 4JI1L 2HQLA 4DPGA 4GN5A 2ZM6Q 2CQOA 4P75A 1KAWA
chains in the Genus database with same CATH superfamily
2K50A 2R7LA 1CSPA 1IBKL 3UDFA 1BCPF 3Q2OA 3VA5A 2Z0SA 5KG3A 3RBEA 4JI2L 1K1SA 1Y1WB 1IXRA 5FJ8H 3RNUA 1EZ6A 1EY9A 3K0YA 2CW7A 4M1UB 4DUZH 3LWUA 4OX9L 1QUQA 2RHQB 3CKIB 3L2PA 2GPSA 1LT5D 1LLRD 4JV1A 2PYKA 2A6HC 3G8CA 4ME6A 2XCAA 2WKCA 1VDZA 5CV4A 4A2BA 3PQIA 2JA8G 4BBSH 3MFYA 2I80A 4KJNA 2UXCL 1STNA 1HNXL 4O3OA 1TY2A 3IFDA 1GD7A 1TWGB 2A6HD 1N9WA 2R92B 3DEPA 1VQ5A 4OGQC 3JSNA 5KG1A 4TV8F 3BDOA 4KK7A 1SE2A 2V4DA 4G57A 1VMPA 5H80A 2PMZB 5CAEB 1EEFD 3G6XA 1TWCA 3GIKA 2HD3A 1A15A 3T1HL 1OO9B 3HOWB 4R4TA 2NVTH 2NWGA 4JI0Q 1C9OA 5M3MB 1RK5A 4GLAC 1LO5D 4X65H 3J81E 1YEZA 4S3SA 5DNFA 3IAYA 4IUQA 4FP5D 5C4ZA 1YI2A 1KJJA 3H15A 1SYEA 2NU6B 4EBEA 1D5XC 1H9SB 4LF8Q 4ZOLF 3W5OA 2A5HA 3TZDA 1A9XA 3H91A 2KEDA 5TSSA 3MEFA 3J81c 3CCLA 4XT1B 3I4NB 2FPGB 4HJAA 4X66L 3C0FB 5LMUQ 2AUKA 3HKZE 2AGQA 4EBCA 3QZ8A 2PPBC 1S5DD 4IUTA 3N42B 2VB3X 1IBLL 2E2IB 1V4YA 2RDIA 4H0LC 1E4EB 1KDAA 1S0MA 3VYUA 5CV6A 4LFBL 2YZGA 2F4VH 5L1JA 4I7ZC 2FINB 5ELOA 5CB4F 2R93A 2PQEA 1EUJA 3GTOA 4DV3H 2R8IA 4OWWB 1Q1EA 1FJGH 3HRZC 1VBGA 5KNBA 4QQBX 1S5FD 1Q81C 3JAME 3DF7A 4C5BA 4ZKBB 4U673 4KKTA 1G51A 1AZPA 4TSSA 2WAQB 1WTWA 4KY7A 1A63A 2CKZB 4RNOA 1HJPA 1D2BA 3L9AX 3JZIA 3JAMc 1V43A 4DR6H 4DR5Q 1XPRA 4BY7B 4J9KA 2NVQB 4MHEA 3RAQA 4BBRG 2FXQA 4HNTA 4IFDJ 4AIMA 3R2TA 4JPBW 4LMYA 4HNVA 5KFGA 2F0NA 1TXYA 4KY5A 4CDFC 3S1MB 2UXDQ 5GAGC 1PH9A 4JI7H 1S0OA 3ONAB 2B39A 2F4IA 3G48A 4UFZA 4DK6C 1BXTA 3N6XA 1LTGD 3BG5A 4QWDA 4DL3A 4LFCL 4GN4B 4MTKA 3HGBA 3KHRA 4X64H 2JYOA 5DLQE 3KALA 2YYAA 5M3FH 4F4WA 1S10A 4X62Q 5JVH3 1RIPA 2KHJA 4DXGA 2DJFC 3PUXA 4MV3A 1Q3LA 4JBWA 2R7ZB 3BA8A 2F0DA 3T1YH 2HDLA 3KYHC 1BKBA 3S2HH 2R93G 3M3YB 4RB2C 4JC0A 1DJRD 3K3PA 1GUGA 3KDFB 2JEIA 1HR0Q 2NUAB 1GO3E 1JJCB 5IWAH 4TQSA 4LF8L 1F2ZA 3N8DA 5BN3A 1OXUA 1PTOB 4C3HB 4HJ8A 1R9TA 2E5LQ 5CA0F 2JA7A 4HIDA 4K5XA 3CCSA 4DXFA 1LUZA 3DWPA 2QF7A 3GTLH 4O2BF 4DL5A 4IHJF 3U9TA 5ELNA 1YNJC 3K0XA 3ULLA 1V1PA 5KG7A 4A3LG 2V59A 1C3OA 3K81C 2YTYA 1VQ7A 1S5BD 1SJED 4A3KG 2K6AA 1I7LA 3CPFA 2F0LA 1XNQQ 5D14A 4TKOB 4V190 2K04A 1DYQA 5C4JB 2KQ3A 1PZID 4RGMA 5BN4A 3TQ1A 2V4RA 4NP5A 3OUUA 2EYMA 4LF7Q 4JOIC 4BY1H 4DV2Q 3VR6A 2H5XA 4NKLA 1WCMH 1M4VA 3OMGA 2VR1A 3RB4A 2ICEC 3ULPA 3A56A 4K6LA 2R6FA 4A2AA 3K5OA 3PUZA 3DM1A 1VQKA 1CE8A 2ASLA 1S5CD 3H0GB 2EOTA 3BVGA 3GTQA 5CV9A 2ZXOA 3NELA 3F1ZA 5KFTA 1VAJA 4R4OA 4A3MH 3RZDB 1EIYB 5IGFA 1PHJA 1EU4A 4ME3A 1XMQH 5KFPA 1NY4A 2UUCQ 2UXBH 5EWFA 2HUGA 1FD7D 3HKZB 4DR2L 5D3DA 1MD2D 2RDFA 1TU2B 3MC0B 4A3GG 2UXDL 4JI5H 3S2DB 2XIWA 3BZDB 3S1NH 3UFXB 2YU9H 5KT6A 1HH2P 2L1BA 1AN7A 1TWAA 3T13A 2E8GA 2NB0A 2FB9A 3KJPA 1E4FT 1TY0A 1A0IA 3KUPA 4IR9A 2F0VA 2NVTB 5LOVF 2W9BB 3RN5A 2MGSA 1K83B 4DNIA 4X62L 1CI3M 4UY8C 1LACA 4JV5Q 3H09A 4L5TA 3UDGA 3PIP3 3CC4A 3KBXA 2Q2HA 4DAPA 2GPWA 3JAMi 1PH5A 5KFCA 2K05A 2NVXA 1SNMA 1YVCA 2V58A 2YW2A 1CA5A 1EY4A 3J80E 1YJWA 4G4KA 1W3SA 3SGIA 4ETSA 3OHBA 4KI0A 1VQGA 2ICIA 4A3JH 5EKLA 4R8UA 4NLGA 5IGDA 4QW8A 4F4YA 3FEWX 1D1KA 2F0TA 2X69A 2Z4IA 3GO5A 2QEXA 1SBBB 2YV5A 2E5LL 1VQHA 1GHKA 1EUCB 4DAVA 3QOLA 3J80c 2JA5H 3MFIA 1DV1A 4ED6A 5C1OA 3VR5A 1HNZL 2WIIB 4DK1A 1I7NA 3NTIA 4DUYH 4B3TQ 1G291 2MO1A 4O4IF 4DL4A 3F2DA 3M9MB 5NUCA 1Q86C 1TS4A 4IZ8A 1CZGA 2ZT9C 4DV2L 5KFMA 1O7YA 3P1HA 1KJ9A 1E0BA 4GOPA 4PZ7A 4DR3L 4ZQ3A 2RSOA 5DG7A 4JV0A 3W2DA 1GSHA 3C1FA 4XT3B 5C3WA 3VPCA 4RGNA 3T1HH 4AH6A 1MIUA 3MXNB 1JJ2A 4CJ2C 1P8LA 3GIDA 3V4ZA 4OIKA 3SHLA 4MA0A 3Q1KA 3EVQA 4CKCA 2C28A 2J9GA 4P2CB 5C0XH 4A3EH 4HIOA 3PIOA 2E76C 1YZ6A 1IL8A 5DLFA 3R3OA 5E7NA 4FF1A 1FNWA 3PF4A 3E3XA 3FDSA 3R2IA 4J9QA 4IUNA 3KF8B 5FKAC 4JI3Q 2EYHA 1AH9A 5HGQA 3K3VA 3J7AK 1VQOA 3H40A 3U4VA 4RGOS 3M4OB 3F8NA 5C3XA 2XNAC 1M1KC 2UU9H 1E2ZA 4PZ6A 2F4VQ 1WVLA 3GTJA 5HGTA 5K36H 2K5VA 3K59A 4JV5L 4DLKA 3PO3G 1PMRA 4DL6A 2LKVA 3D4DA 4P74A 2K1BA 5A35A 1TWHH 2EYLA 1R4PB 2PZUA 3X3NA 3OTOH 1NNXA 1K9MC 3GTMB 3IG0A 3F2CA 4MV4A 1FJGQ 3N40P 4C2MH 1PV4A 1KC7A 2R82A 4J6HA 1I5FA 3EN2A 1A8VA 1STHA 4EQPA 1VQCA 1MHWC 1GKHA 1VQNA 1N36L 1GUOA 2PI2A 5IP7H 2YL2A 1B44D 1TKWB 2IHEA 1XNRQ 1D5MC 3J81L 2F03A 4IUVA 1VQ4A 1G2TA 3JRWA 2DN8A 4KN4C 1K8MA 1SMXA 3FPUB 1WTHA 1WCMB 4YWLA 4DUZL 1I94Q 2RF4A 4RCNA 1V1QA 1RJTA 3I12A 4JI7Q 1ZETA 1L0XB 3GD7A 3OSPA 5KT4A 4L63B 1MGSA 3B6YA 1XXGA 5H1SE 1WTVA 1ET9A 4OO1I 1JE4A 2H1EA 5HY6A 1TS5A 4B9WA 4DNTB 3K8AA 2OTLA 1WJJA 1EIFA 3U50C 4A3MB 4JI0H 1PFMA 1LTLA 4J9SA 4A3BB 1UEBA 5EQ0A 1JWSD 3T1YQ 4YCUA 1B33N 1B6RA 4LF8H 3C46A 3Q23A 4M7EA 5IIFA 4HMJA 2B2TC 1E24A 3SR1A 4YB8B 5IODA 1IHZA 3FRPB 1LABA 3LP8A 5FOBB 1JCKB 4EQOA 2N78A 3JAML 1E2VA 2KCNA 1QJOA 2CCZA 1GGOA 5LMUH 2QYZA 5HURA 1IW7D 2YYZA 4K2LA 1S72A 1I4HA 4DV0Q 2QKIC 2B2YC 1EZ8A 2HIVA 5KFEA 2M9VA 1BDOA 3VYTA 4RUCA 2NU9B 4KD3A 3HOYG 1FGBD 2K5QA 4UPAA 4JBJA 3CMAA 2JSOA 4OELB 4DR1Q 2GA4B 2WKDA 4QWAA 3PZPA 3KF6B 1Y1VA 2F4VL 4TV9F 2D9UA 2KECA 1V1OA 2B29A 4OXPA 4DKAC 1I6VC 1ESFA 1NUCA 2W9CA 4CC6A 4HR7A 4DV3L 1RJQA 2B63A 1J9OA 1FJGL 1HNWQ 1Z6HA 3HOZH 4Y7NH 4IZOA 3I72A 5JPMC 5I9PA 4IOAA 2JA5B 1UWVA 2SEBD 1II3A 4K8IA 4ZQIA 4K5VA 5LXTF 3FKIA 3NGDA 1A3UA 2HQEA 3KHLA 4DR5H 3CF5A 3M4IA 1X3EA 1NR4A 1S5ED 2R93H 2HJWA 3MEHA 1KBLA 2GVAA 3BZCA 4DR6L 1TAEA 2EPBA 4WBNF 4WJWA 5GADC 2IBKA 4OIJA 4IFDI 2UXDH 2D5DA 1PFNA 4JCVE 3SK6A 5E3FA 3AQQA 2IY5B 1LT4D 1V51A 3TMEA 2CQYA 4B3SQ 1SXTA 2IPKD 2WB1E 4JI7L 4UCUA 4PZ8A 3MWEA 4A3LH 4XYLB 1GYFA 3AFQA 1W2BA 1D5ZC 4CKBA 5KFXA 4LSXA 5KT2A 2JA6A 3MJFA 2BH2A 1W93A 2PW7A 3LWBA 4QWCA 4BXXG 1WOCA 4QW9A 4X64L 3WDNA 1JWUD 4WD3A 3VYRA 4JI8Q 1PZJD 1YNNC 2KENA 4ZHQF 5J1ZA 2HCIA 4DL2A 5IP9G 4JI6Q 4A3EB 1SFOA 4A3DG 1G91A 1B04A 1Y1VG 3IN5A 2BCOA 1W6KA 3I4MG 2F0WA 3FMCA 3J81j 2NZ1D 2AQ1B 1VF5C 1HR0H 5DLGA 3T1YL 4XZ3B 2I5MX 1B7YB 2PCFB 4A3FH 2QA4A 3QR8A 1MBYA 2B63G 3BDLA 1RDPD 4FXGC 4APMA 4HNUA 2E5LH 1ZYRC 5IWAL 1O7ZA 4MV9A 4RGTA 2W71A 4F88A 1K3BC 3VPDA 2UVUA 2AUJD 3FKIG 1O7LA 1WR2A 3J81W 3T4AC 2O5IC 1IYVA 5KG2A 1STEA 4ABNA 1XNQH 2XTIA 1B50A 1EZ1A 4TQUS 2FHTA 4QL5A 5CV8A 2NVYB 2PO4A 4DUYQ 4RA8A 1GXDC 2FK3A 2W8KA 1TWHB 4LF7H 3KAJA 4GLVB 4L6TB 1HXYD 5CBAE 4A3GH 4DV2H 4I50F 1X56A 2K75A 1A3TA 4ALPA 2JA7H 5KT7A 1IYJB 3IL8A 1DGSA 3HOUG 2EXZA 4C2MB 3L3OC 1B6SA 2F3VA 4G3IA 3FP9A 1LTTD 2PZWA 4QWBA 2XVSA 3K57A 1EYCA 5LMNQ 2JA6G 1HNWL 3PO2G 5K2MA 4RAYA 3HXLA 3NWTA 3OIPA 1JMCA 2AMCB 2F0OA 1FNUA 3VYSA 2F3IA 5BN5A 5IGBA 3UE0A 5C44H 3GV7B 4LF9H 4C3IH 1I3QH 2HT1A 3AMUA 1XYIA 2PN1A 1KJIA 3GTKH 1S68A 5EPKA 1K3RA 2UUCH 3G7LA 3CCEA 2W7PA 2MP1A 2R7MA 2I5HA 2MO0A 3RTXA 3JAMW 2RCNA 3CQZA 4UCRA 4A75A 1XMQL 5FLMG 1U4LA 2LXJA 4LH6A 1LM0A 3J80L 2UXBL 1SNCA 4GC6A 2XRSD 1HUNA 1VQAA 5JUMA 4LNQA 3RUZA 4B3SL 3R8BA 3EIVA 4X3TA 4RHSA 4ZI7F 2K5NA 3N6RA 3VR2A 3GTPA 1BCPC 1JJGA 2CW8A 5DG9A 4GNXA 5KFQA 2Q8RE 2Y0SA 2HHHQ 2B2WA 3N41B 3C3LA 1CQJB 3AFPA 2ZDQA 2O4XA 1LV9A 2OXPA 4K14A 1CQIB 1UC9A 1L1OA 1I4QA 1B9NA 1S97A 1BCPD 1FGUA 4OO1H 4NXNQ 5ISRA 3VPBA 2L12A 3N43B 2A6EC 1M0TA 2CVRA 2D2CC 5I6WA 2FFKB 5T1IA 4HMIA 1TWAH 1SCUB 3A8KE 1YHBA 1SEBD 5D3IB 2F0UA 5AJ3Q 2A1AA 4LF4H 5CBEE 3H94A 1HQRD 3I7FA 2IHFA 3VMMA 2JEFA 4NDXA 2LFNA 4DV1Q 2I8CA 3T5HA 2LMCB 2NUCA 3U9SA 2ZJQA 3TQTA 3JC66 1E4GT 1JKJB 1RTOA 1JDBB 5GAHC 1Z2PX 4PMBA 5IYBG 3IFTA 2G5DA 1HZCA 3E9IA 3K5NA 2YRWA 2AQ3B 4B3TH 3ZJYC 5E4WC 2NVXH 4A3CH 4DUYL 1FKAH 2SNMA 3A74A 4ECUA 2WB1B 1F9QA 2KCCA 4M8AA 2QEJC 3WO0A 1I50B 1B8AA 1QNUA 2QK4A 4ECZA 3HS0C 4H02A 3HOZB 1EUDB 3NXWA 1EYGA 5FO9B 4J9RA 1SYDA 5KFJA 3V6HA 4N9TA 1Z7TA 3Q24A 2E2HH 5EAYA 5I4DA 2Y0SG 1K0RA 4DV4Q 4J9OA 3GV5B 1PRTD 1F2MA 1C0AA 2R93B 3LMLA 4IN3A 4IO9A 4YP3A 3GLKA 2A8VA 5C4XB 5GAEC 4U6PA 3PO3H 2DJGC 3GTGA 2AWOA 1RKNA 3BVMA 3BJUA 1D1IA 2W9AA 1A2UA 3AB9A 2E2JH 2ALYB 2IX3A 1QE6A 3PW0A 2I07B 4X3KA 4ED8A 5CC4A 3GP7A 2BDOA 3FPPA 1MSGA 3D0FA 2BOSA 4R4IA 3U9OA 1OWTA 3STBC 1RK6A 3ERSX 5DQHA 2WYOA 1PRTF 4JI3H 1TA8A 4IFDH 4C5AA 2UUBQ 1W6JA 3HOVG 3J7YW 4EX5A 5C3EG 4AYBA 3STBD 2R8KA 2UUAQ 2F1MA 1PA6A 5D1PA 4YJ2F 3I90A 5KFYA 4O4HF 3PW2A 2I5LX 2HHHL 2H4OA 1F9SA 1Y1WA 4LK1C 3X3MA 4EG0A 3S14H 2MQHA 2UU9L 2BQ3A 4FS2A 4LUVA 4HAEA 4NXNL 3Q8QB 4A3FB 4O42A 4E6IA 1EWHA 1ZXTA 1B53A 3OTOL 1VQBA 2A69C 4L5SA 5DM63 1BXRA 1VCIA 4EQ5A 2O5JC 5EWGA 2IL8A 3S1QB 4K0KQ 5F9LA 1TWGA 3RJ0A 1BOSA 4DV6Q 5C0XI 2VW9A 2R92A 4F50A 2A69D 2BDNA 5KFDA 4JV2A 2KA7A 4IPCA 4R4QA 3TEHB 2PMZA 3RBDA 3PN1A 2FMCA 4R1JA 2CH4W 2EE1A 1QZHA 2ZDHA 3ETHA 1XNRH 1XTCD 5COYA 4RUAA 2XC9A 3J80W 1G6PA 1Q8IA 1LTBD 4RU9A 1MJEA 2JA7B 3QOJA 4DAMA 3HOXB 3OWEB 1I94H 1MSHA 4B08A 4QUCA 3MXGA 4Q8FA 5KG5A 1LT6D 5ELDA 1T5EA 2VB2X 3PV0A 4O3QA 1ESRA 4ECTA 3IRBA 3GIQA 3HOYH 1PVOA 1X55A 2LY7A 4AYBG 1S40A 1N34Q 1IKMA 2F0SA 1C48A 2ZJPA 1B2TA 4LAAA 2QW7A 5C44B 4C3IB 1I3QB 4A3IB 5KFUA 4YR3A 2E2IA 5M5WH 1E4EA 3GTKB 1Y1WG 1IL2A 3GDEA 4QMGA 3M7GA 4JI0L 3S16H 4FF2A 1KAAA 2C5CA 1E3PA 2G9DA 3E5SA 4QJFA 2FPIB 1UAPA 2SOBA 2VZAA 2R8JA 2N8NA 3RIZA 3CXCA 4B3MQ 4YIJA 4YJ3F 4GNXC 4DV0H 5K5PA 3LWEA 5LMUL 1SYFA 2VQFQ 2R92G 5FLXc 2R87A 4C3JH 1FVIA 4IOCA 2WAQA 3NK9A 2NU7B 1SSOA 1GSOA 1H95A 1BNCA 4ECXA 3HOWG 3RV4A 5L1IA 4DR1H 3SI8A 1O78A 3DWQA 5M3MG 2K5WA 3NTHA 2R7KA 1DOLA 4J15A 1MZBA 3N44B 5KFHA 1TWAB 4A93B 3BAAA 4RMFA 4B3RQ 4IAJA 4J9NA 1EY6A 1D7QA 3R93A 2YS7A 1RF2D 3I4NG 1HNWH 2PQAB 1BBUA 1YIJA 4K2KA 4ECWA 3TP8A 4JUZA 1RYSA 3I56A 2Q2UA 1KHIA 2VUGA 4KHZA 1M90C 4K0KL 1JICA 4DV6L 3FVQA 2Z9HA 4A3DH 3KJOA 3I4MH 4HYKA 4YCVA 2NVXB 1XPUA 4LF9Q 4ZUJA 4DR5L 3LGJA 3SVMA 1Y8OB 1SR3A 2R7ZA 3CU7A 1MKHA 3M9BA 5IYDG 2JXMB 3D6WA 1XWEA 2YRXA 3L7ZC 1MI2A 3KDFA 4KY6A 1DZ1A 4JK1C 4BBSB 4B3SH 1Q82C 2B3GA 2IT1A 4BA1I 5M5XH 5I2YA 1QCBD 2E2HB 1CT1D 2WAQG 1K73C 5KYIA 1EWIA 4JI8H 3I4OA 5DGBA 3A5ZB 1DIKA 1VS0A 2VUMH 5IYCG 4BY7G 4JI6H 3TIIA 4WORA 4BA2I 3LX0A 4RAUC 4JG2A 5JJLA 5ELEA 1XTDA 3HOUH 4ED1A 3NUCA 1X54A 3R5FA 4GC7A 4LSAA 1EOVA 1HR0L 3I55A 2IX0A 4H7BA 2R85A 3VDYA 1QWYA 3TSSA 1A3VA 5G3LD 4LF4Q 3PO2H 4V0BA 2O2LD 2W6OA 1KXLA 2FLLA 4GKKQ 3KAKA 1CKNB 2WTFA 3UE1A 3S15H 1X3GA 1SFOH 3DMUA 1STGA 3SDZA 5CYUA 2RSNA 3CCJA 1GJXA 4KLKA 3H0GA 4ZCKA 4BWSC 2ALZA 3D6CA 4ECRA 1B3AA 4I7HA 2ZTEA 1D6EC 3NPPA 3AEVA 3S14B 1PX2A 1XNQL 2R7ZG 2OLSA 3WOEA 3KFUA 1DOKA 5G3LF 1CQVA 1ASYA 4LF7L 3BABA 1J5EQ 1IBMQ 3H3VC 2MUYA 4RB1A 5KX5F 1CSQA 2OQKA 1VF7A 1A6XA 4MV7A 3EPGA 2ASJA 4C3HG 3OYYA 5LMNH 4DK0A 2PBZA 4G7ZC 2C2DA 5DEHA 2K28A 3A54A 1SAPA 5CGKA 5JEAJ 5EGTA 3CHBD 3J7AV 4NXMQ 2OH2A 3MTSA 2WFWA 3TP6A 4HQ6A 1G6ZA 2NTSA 2F0MA 4RG1A 3VA7A 5FPOA 2KOLA 4U7CA 2W9BA 1K83A 5D8DA 4LJZC 1TWFH 1ENCA 4P72A 2L5TA 3DEOA 2VQDA 4LF9L 1AN8A 1HZ9A 2ENBA 3RZOH 4F4XA 3EQLC 1U5KA 1ZEQX 2UUCL 2IA6A 2B8FA 5E1FA 3CMEA 1VKZA 4N8FA 1C8CA 2ASBA 3ERQA 2ZM6Q 4P75A 1AUXA 3HOYB 3OHXC 4Y52H 3Q8SB 1L0YB 1JQYD 1XPOA 2XGTA 2DUDA 5M3FB 2MCTA 2ZDGA 2A68C 2Z1CA 2HHHH 1UC8A 5DQGA 1STAA 3H0GG 4DV5Q 5M5WB 1BBXC 4O3RA 4JBMA 1HZBA 1TS2A 1I6UA 1SE3A 2A68D 1SYBA 3CQZH 3SEBA 1ZKOA 3A7AB 3S24A 3S2HB 1RCVD 4NXNH 1E1OA 2F0FA 3F8TA 3CCQA 1GUSA 1U9RA 4ZKCB 4POGA 1SYCA 2JA8H 1JE5A 4ZLTF 3MXPA 3HKZG 1BO0A 1KLGD 2B2VA 5D65A 2XCPA 4OL7A 4QGUA 3GTLB 3MZ5A 3GTPH 4DV1H 1SYXB 4HN7A 4LF4L 3OWFA 1BCPB 4EGVA 4C3JB 2BQRA 2JEGA 3RLNA 2F0KA 4CDEC 1EHIA 3QFFA 3E6ZX 4GKJQ 1X6OA 2L9HA 4F87A 2P5ZX 4B9XA 1YJ9A 4ED0A 5LYJF 3MXNA 3I4LA 5KNDA 5GQOA 3PR5B 2UVWA 3Q0AA 1WTXA 3E0JA 4B3TL 4BY1B 3BQ0A 2MJ8A 1X3FA 2ZTDA 2RDJA 3W3AA 2EQSA 1ZHQA 3BS1A 2J7ZA 4EFEA 4XTCS 2OCEA 4BS9A 3GIIA 4C1NK 2E74C 2B2UA 1T9HA 1PZKD 3CAMA 1ONLA 1KRSA 2RHSB 1HCZA 5C3EH 5EPJA 2CWAA 4ZK9B 3S1RH 1IYUA 1UE6A 1I4RA 3KF8A 3GIPA 5LL6S 4DV4H 2KSWA 3GV8B 3EROA 3F2BA 1M8AA 3I4MB 4FXDA 1F2LA 5D1OA 4NXML 5KGUA 5IT9E 4GS3A 4PWQA 3QB3A 1H9JA 4WJ3M 3D4RA 3CCUA 2BA1A 5KFIA 1HR0W 4A76A 2F0EA 5C1PA 4O2AF 1AW7A 5M9OA 3WNZA 4H13C 5KEEA 5IT9c 3S1NB 4UDUC 4FO2A 1IW7C 1K8AC 2YU9B 3GTMA 5M5XB 3V05A 1PYBA 2N88A 4DR7Q 5KFSA 3E9HA 1GSAA 2YS6A 5KFOA 2ZTCA 2UUBH 2E75C 1Q8KA 2OQ0A 1TWCH 3EJIA 3DM3A 4QIWE 3VR4A 1JOQA 5LL6b 3A0JA 4O1NA 1VBHA 1YJNA 4JI3L 2C2RA 1RODA 2UUAH 3GTGH 4ZRZA 4PV1C 2NN6G 4BBRH 2VUMB 4QUFA 1WSCA 2ID0A 2Q8IB 4GLXA 1C4QA 4Q8EA 1Q90A 3PCOB 3GV3A 2RDHA 3A55A 4FVMA 4IJLA 4QIWA 3N52A 3T5LA 1X9NA 4YR0A 4YAJB 2IW3A 2WINB 4R9WA 4JYAQ 4KTAA 4KKSA 3BZKA 1GUNA 1WCMA 3RF2A 3G6VA 3DXJC 2NZHA 2K33A 4L5QA 3PIPA 1VQLA 1PTOF 4A3JB 3PVXA 2I87A 2W6MA 4JI4Q 4WJ4A 1PYSB 3FDTA 1SEIA 3RFCA 5IY0A 4FM9A 2JJQA 4LW1A 1KRTA 5I47A 4K0KH 1AE3A 4XYQA 4DV6H 1F9RA 1CQFA 4MTNA 3A7LA 1WH2A 1HRJA 2ZXPA 1Y1WH 1JIHA 3G6EA 4MA5A 1N48A 2A73B 3GQCA 2HIXA 2AGOA 3GTOH 2KBNA 4LFAQ 1I4GA 3DLLA 1KIXA 1XNRL 3PW7A 3V6JA 1EYAA 1HTPA 3TBIB 4GOPC 4Z9CB 1QG7A 3ND9A 3E0EA 3H3VH 5FLXL 3ITPA 5T1GA 1I94L 1G8ZD 3WOFA 4YY3H 1AFPA 1TWGH 2PVPA 2R92H 2PNHA 3BYYB 1L2FA 1KEEA 3CRLC 4DV7Q 2SNSA 4RHRA 4A3KH 1N34H 3T5JA 2XD4A 4DAYB 5J2TF 3OHAA 2DY7A 2EDGA 4FS1A 5M3MH 2RBMA 1AEXA 3M4PA 4FBUA 1TWFB 1M7JA 5BPHA 2RDGA 4NMZA 3L0OA 4UHVA 4XYOA 3RZOB 3KHHA 3MXUA 2JE6I 1L2ZA 4IR1A 3KF6A 1Z2NX 3PSIA 1N32Q 2R8HA 1WCMG 1YBYA 3RB0A 3NBHA 3I4NH 1WI5A 1Q12A 2FMMA 1Y14B 1JDEA 3BJYA 1I6HH 3AYHB 2IWHA 2M2LA 4Q44A 3TP5A 2XSCA 1RJRA 2AWNA 3NQIA 4HEDA 3KLSA 4B3MH 2WP8J 3KK7A 3NTKA 4ZYSA 4IALA 2JK8A 1XMOQ 2VQFH 4IRDA 2E2IH 1XDNA 2JA5A 3CPWA 3MR3A 1CZWA 2W6PA 4X3UA 4DV0L 3Q8PB 5FK9C 2IP4A 3UQ8A 1PH2A 2D0PA 2DGYA 2Z6BA 4C1NI 3ORQA 2M00A 5KKNB 5DQIA 4EYIB 1EFWA 2LXKA 4A3BG 3ORRA 2MHVA 4DR1L 2XWJB 4IJHA 2KEEA 1QOHA 2JA8B 4I65A 5EDWA 4B3RH 1R9TH 4HJ5A 1ASZA 4DN4M 4IPDA 2LS01 5JEAG 4UP8A 1OTCA 4PDBA 4NPSA 2BE5D 1HPCA 4JI2Q 4UCVA 1PXUA 1NMFA 4M9UA 4CDCC 1CHQD 4YBZB 2JEJA 4OX9Q 5IYCH 2EYFA 2AQ2B 3W1BA 1BJTA 1CUKA 4XQQA 5C4HA 1UE7A 1T36A 1K8GA 3J7A5 3I73A 2UXCQ 1CHPD 1BUVT 5JPNC 5FO7B 4CKEA 5A2QL 1DD2A 4QIWB 1NAPA 3PR4A 2K52A 4Q0FA 1PDQA 4HSVA 3K5HA 4RWSC 5EKIA 3HEJA 4OWTB 3PMFA 3GTQH 2R8GA 5JJZA 2WAQE 2JA5G 4FDBA 2EXDA 2AKWB 4ECYA 1EL0A 1B4OA 4PG3A 5BR8H 2QDLA 1QUQB 1OXTA 3KOJA 4KD4A 1W96A 2SDFA 2ES2A 2EIFA 4YHHH 4JI8L 1KLUD 3M7NA 2NVYA 3BYTB 4JI6L 2SCUB 3RGZA 4ZAIA 2KCMA 4TRDA 4X66Q 1GM5A 5ELFA 2Z4HA 2EY6A 4FBTA 1EIHA 4P71A 5ELCA 4CBVA 1N32L 4C2MA 3D31A 1ENFA 5EZYF 3P75A 1IBLQ 2DNCA 1TWCB 2VA2A 3T56B 5KFWA 4GKKH 1UE1A 1PH7A 2YTXA 5IGEA 2FJ2A 4LFBQ 4C5CA 2D62A 1S4ZA 3RD4A 3GTGB 1OXSC 3TINA 5HBRB 1CK1A 2G9HD 4BBRB 1CS0A 4NB3A 3VR3A 4MN3A 2N3SA 1TS3A 2L55A 4A3EG 3NSWA 3V96A 5JJIA 4RNNA 4N8X1 3M85A 3G6YA 1GUTA 1E7ZA 5LA6F 1FNVA 2J4XA 1J5EH 1IBMH 1U0LA 3UDIA 5J2UF 3V4SA 1EWCA 1SROA 3E5NA 3HFZB 2L0CA 2BA0A 2VY3A 3I2ZA 4C56C 4DGZA 4F8MA 4Y7NB 1T94A 1WTRA 1PRTC 2OT2A 3H0GH 4Q45A 1WYDA 3SK5A 2M05A 5LMNL 4O3NA 4NXMH 2K01A 1E22A 3RZDH 2WACA 4RKBA 3GTOB 2KUMA 1CKMA 1EU3A 2F0JA 2FP4B 4PMCA 4HJ9A 5K36G 1WFQA 4KHPQ 4OWXB 3EPIA 2VXWA 1FL0A 5DAUA 4L8JA 1RYRA 4LFCQ 3S2DH 1F2YA 1JORA 4L1KA 3SXHA 1O75A 2YZMA 3I70A 3HBLA 2VPSA 3K7UC 1M0WA 2ZM6H 3KTMA 2J6TA 3EBEA 3HB9A 2VQEH 4A3KB 3M9OB 2R61A 4O2DA 1B3QA 3TN2A 2HCCA 1LT3D 2Z8LA 3MHBA 3FMAA 3R23A 2QDBA 4I4TF 1K83H 1YHQA 5KFVA 3RB6A 4DV5H 3M9NB 5IP7G 3MR6A 5DG8A 3GV6A 3A8IE 3KLWA 1Z2OX 2Z6KA 3A8JE 1SNOA 4YWMA 2RGVA 2WB1A 1I6HB 4RAZA 4MV6A 2K7VA 1I50A 4UCOA 2R84A 1EQVA 1U4MA 2JEBI 4MZ9A 5M5YH 5AJ3L 3G4SA 2JEAI 4IUUA 5EKKA 2JP1A 4WRDA 2AHOB 2PW5A 1T5XD 1TVXA 1SJHD 4OHJA 4DV1L 4GKJH 1A62A 2C35B 4IRKA 1F9PA 1G2SA 4ZUIA 3GTJH 1JWMD 2XWBB 4A4IA 2K32A 1ENAA 3IKJA 5IT9L 5JAVA 2WE6A 1NE3A 2NTTA 3EYYA 3DWAA 4A3GB 5A2QW 1UNSA 3PUVA 4J9MA 4J8QA 4CJ0B 1R9TB 1QILA 4FYDA 1GUWA 3K58A 1F77A 1H9SA 3SK4A 5AFWA 2W7OA 5KRUA 1V1PB 5GROA 4PQXA 1EQTA 2VOBA 1AZQA 1S9FA 1CFMA 2F0PA 1EY5A 2F0IA 4YY3Q 1I4XA 1Q46A 2CFMA 3K5MA 1KABA 4HSPA 3C1EA 4KN7C 2AU0A 3EFXD 2NN6H 3I8ZA 3GIJA 1B1ZA 4K8JA 1SLJA 3PIO3 3HKSA 5I6YA 4YCWA 1ML0D 5KG6A 2VA3A 2R7NA 2C2EA 1ZHSA 2J6SA 4DV4L 2CZGA 4DR2Q 4QWEA 3M4YA 5ELBA 3CRKC 2EVBA 3NE5B 3NQTA 4XXEA 4K5WA 4EGJA 1RJPA 1YNXA 4KHPL 4QF4A 2WB1G 4UAIA 1VQEA 1IZ6A 3P7JA 2GN5A 5FLXE 5CV5A 4P73A 2K5HA 4DR7H 1ET6A 1KDCA 1AP0A 1ICWA 3HOZG 1AUVA 2FK2A 1B70B 4RCOA 2A74C 2VS1A 3GTQB 2YZNA 5C8YF 4KMUC 2WDTA 1V8QA 3HG9A 4ME5A 2XGPA 1EOTA 2B2WC 3OSNA 3M4OH 1N33H 2UUBL 3KBGA 3T16A 3MWMA 1L1OC 1KTKA 2PI2E 2EYPA 4TVAB 2FMAA 3KLRA 4RB0A 5KG4A 2UUAL 4RB3C 5KFRA 2HQLA 3H6MA 1X32A 4PNYA 5C4XG 1KAWA 3S9WA 3L4JA 3TP7A 2QILA 2B8GA 3W1GA 1IOWA 4JYAH 1X3QA 3ND8A 4R4CA 3BG3A 2L15A 3GTMH 4EVOA 5BPFA 3AU7A 3SE7A 3BVZA 3QJYA 4HCSA 4AQYQ 4JI4H 1Y8NB 4EQNA 5LMNW 2R86A 1E1TA 4KJOA 1HNZQ 5KFAA 3K7AH 1ILQA 4BXXH 4DR4H 4FU0A 4N9PA 4CC5A 2KHIA 3JSLA 4RNMA 1K28A 1YNJD 3V2TA 2YCHA 2OF1A 5IP9H 2KJXA 1Y1VH 4R8IA 4UCSA 1PH1A 1PH8A 1I3QA 3V6KA 5F9NA 1TIID 4LFAH 3GTKA 4ED2A 2V1CC 2OTJA 1O7IA 1U4PA 3GQBA 4DR3Q 3U4ZA 2DZDA 2HVSA 3RLOA 1M6VA 4LF5H 4R8UB 2B63H 1IOVA 5C6AA 1IKLA 4A3FG 1WTPA 1Y69U 3WO1A 4RZRA 5EWEA 4L5RC 4OONA 5FPRA 3QWNA 2AQ4A 2LSSA 3NWSA 2J0TD 1XX8A 3FKIH 3J81i 1RTNA 1C7YA 2OEOA 4YY3L 4DV7H 3RR5A 3K5LA 3K5IA 1DV2A 1ICFB 2PNRC 3CCVA 4LF6H 4POFA 2E2DC 5L1KA 2UVVA 1JLLB 3PF5A 4LH7A 4QB4A 5J3BA 5BR8Q 1CTMA 1N34L 4A3BH 3PO3B 4HIKA 3UDXA 3RB3A 1KJQA 1B9MA 1UNNC 4I7AA 1PLFA 4YHHQ 2E2JB 2F3WA 4GOPB 3PUWA 4XX0B 2VPQA 1ILPA 1N32H 1C30A 1S0NA 2B2TA 1SN8A 2F52A 5EJWA 5JEAH 3HOXG 2JA7G 2HVQA 4RZQA 5CA1F 2TSSA 1DCZA 1NSNS 1R4QB 1Q7YC 1J8IA 5A2QE 1KNAA 5C5LA 2FJZA 2JA6H 5DGAA 2VNUD 4DL7A 2PQAA 3D4WA 1QVGA 1XMOH 1X65A 5CR3A 2B2YA 4B3ML 5IT9W 4UCTA 1LYLA 3RUPA 2VQFL 1VQMA 3TRZA 5C44G 2Z6KC 4C3IG 3H3VI 4A3IG 2FLPA 4BWGB 3OUZA 4DF7A 1QNKA 5FLMH 1V9PA 2F0QA 2MNAA 1KJ8A 3GILA 3KLSX 3CCMA 4JI1H 4CGYB 4DK3C 1HTLD 4X3SA 1RD9D 4OEMB 3DUZA 5E4XA 1IBKH 3MWYW 1UUPA 5M5YB 3HKZA 1N36Q 5I9OA 3K6OA 1H9MA 3URYA 4B3RL 1FR3A 4AQYL 4JI2H 4IRCA 3TZUA 2J6UA 2E2HA 5C5MA 1OXVA 4OX9H 3BQ2A 4WFN3 3GTJB 3OSOA 4K6DA 4F7XA 3ZYYX 3H4BA 2FE3A 2CHBD 4DUZQ 2EY5A 2DIKA 3ETJA 4OO1G 2UXCH 1J6QA 1HNXH 1NCVA 3OW2A 4XIGS 4ODGA 2W6ZA 3J7ZC 4A93G 4FF3A 2XCLA 1HQMC 1SE4A 3H4DA 1BR9A 2D0OA 4FF4A 1VQDA 4F4ZA 3OMCA 1LTAD 2N49A 3SK8A 2VQEQ 1VQ6A 3O13A 3TIGA 5IYBH 2EYOA 3U58A 2ATLA 1CKNA 1LTSD 2FKLA 1I4PA 3RAXA 4MIUA 1Z9FA 4YR2A 4X65Q 2HDMA 3CC2A 5BR8L 5FJ8G 1CA6A 3Q8DA 2K03A 4FXKC 2FK1A 2W8LA 3S16B 4A3CG 3NP8A 1SDFA 4O3PA 3K80C 2VL6A 4X66H 2N55A 4LMQD 4YHHL 2EJGC 3CP0A 3OOCA 4H44C 4ULLA 4DA2A 3OIQA 5FO8B 2NU8B 3PW4A 1VMCA 4DFAA 1PH6A 1H9KA 1O80A 1CM9A 1SYGA 2L4NA 4BBSG 1IBLH 3L4KA 4RH6A 2EZVA 2K4KA 3WWVA 2X6GA 4IURA 2DLNA 5D1OB 2CW0C 4LFBH 2RCFA 2C22A 2IMWP 3ER0A 4E4TA 5EBCA 3RLFA 1PH3A 2NBFA 2RVLA 5JJKA 4GKKL 2QGQA 4XQNA 5EBDA 4G7OC 2BQUA 2HVRA 3NHHA 3RV3A 2CW0D 3HZXA 1K1QA 2NVYH 4EBDA 2ASDA 1YHAA 1K0SA 1PFBA 1VQIA 2R7FA 2DWCA 4DV3Q 1EY8A 1NMGA 4HJ7A 2C00A 1HHVA 3BA9A 4UP9A 3CW2C 1SNQA 2F0HA 4ED3A 5KIXA 5C0XJ 3SE0A 4O4LF 1J5EL 1IBML 3K7AB 4G7HC 1HFGA 2GVBA 2MFIA 3HOVH 3S17H 1JB3A 4IFDG 1VQPA 5JVLA 5CMDA 2CQAA 4ED7A 1Q1BA 4DR6Q 5DM73 4MV8A 2BH8A 1YITA 3MR2A 2KCTA 2Y0SE 4A3DB 1Y1VB 1OXXK 3P20A 3EA6A 2YTVA 4LUZA 3G71A 4CHTB 4J9LA 4HIMA 3PGZA 4YQWA 3DHQA 1HA5A 1ULZA 5IGCA 1HA6A 3T5KA 1BBWA 5L1LA 2W9CB 4KHPH 4HR7B 1UEAB 2B63B 4LFCH 3H20A 2C9OA 4GN3B 3NEMA 2NYZD 3ULJA 1PTOC 1Z47A 5F2DA 4JBKA 5KFLA 1SNPA 4CJ1B 1PRTB 3OW7A 4X64Q 1NTGA 3FKIB 4DNRB 3PW5A 2RQXA 1EEID 4JVZA 3R5HA 3GTLA 3D8GA 2ZM6L 1HFNA 3RMHA 2RGRA 1PTOD 2CWPA 1SNDA 3TREA 5KT5A 2VQEL 5KFFA 1N33Q 1U4RA 1JXLA 3MFGA 1JB7A 4TQRA 1TT2A 4XDXA 1VQJA 4JW0A 1KC8C 5IE8A 2IX1A 3MR5A 1KL9A 3J80i 3Q22A 4Q43A 1EIGA 5EOYA 4DV5L 2Q8TA 4X65L 1GOZA 1QZGA 2P0AA 2Q2TA 4HTHA 3T53B 3HOUB 4X6AH 3D3RA 5IWAQ 3MA2B 1VQ8A 2F0GA 1RL2A 1BF4A 5KT3A 4LUOA 1EFID 1DM0B 2JA6B 5T14A 1BGWA 3PO2B 2FLNA 2RA4A 2X6LA 3CCRA 1QVFA 2QCPX 4O3SA 4MTEA 4MNOA 3PUYA 4Y8VB 3HP3A 2W70A 4DR4Q 4U68A 3S15B 1GLVA 2FPPB 2JN4A 1SFOB 5M3FG 2R6GA 1EYZA 2TMPA 2I46A 4HCEA 4ECSA 5I2XA 4MAMA 1EQQA 4GKJL 2L11A 3MWDA 4TUYF 5JH7F 3Q8RB 1MJCA 4R7RA 1BVSA 3NBHB 2CH4A 5L9XA 1WTOA 5J22A 1I50H 4LF5Q 2ZXRA 2DNEA 1STYA 3RN2A 1D8LA 3BDCA 2YU9A 1NBWA 5LHY1 1NJIC 1T3NA 1BQQT 3KHGA 2O03A 1L0WA 5FD5A 4C3JG 3I3CA 4AYBE 5KNCA 1GVPA 4LF6Q 3HOWH 5C4XH 1SE8A 1K8OA 3G6JB 4RKLA 4DR2H 1XMQQ 2VUMA 3QG1A 4Q0YA 3CC7A 1EY0A 4ID6A 2ZJRA 2UXBQ 2WV6D 5IYZF 4IUPA 3UI2A 4BY1G 4JI5Q 4XYMB 3T51B 1JR0D 2A19A 3LNNA 5KFNA 2EJFC 1HUMA 5JVG3 5CV7A 4EEQA 1TQOA 2ZJTA 5EPLA 1A2TA 4X62H 4DR7L 5L37A 4KHVA 1HZAA 2K14A 3MVVA 4EYHB 2JQOA 1FYCA 2KVMA 1DONA 2PMZE 4GZYC 3QZ7A 1N33L 2GLTA 4YAKB 3CQZB 2W57A 2EY2A 1YNND 2EY1A 4A3MG 3CD6A 4QCLA 1PFSA 1E2WA 5IYDH 4EFBA 1UE5A 1PH4A 2AGPA 2JA9A 5IGGA 1WTQA 4CDDC 2BE5C 2DY8A 2B2VC 5JQWA 4JI1Q 1LTRD 2NN6I 4JYAL 4IPGA 3I91A 5C5JA 3KXYT 4AQYH 3M4QA 3Q6SA 1S3OA 4ECQA 1IBKQ 1GHJA 1JOOA 3S1QH 3GTPB 3BU2A 1HNZH 4GNXB 2Y0SB 4IWYA 1ZYRD 3J7AF 3OPOA 3TQYA 2W6QA 3FHWA 4JI4L 1P16A 1S03G 1CKOA 1L1OB 5JVDF 5BMVF 4PMWA 3A5UA 4DR4L 2W6NA 5KYLA 4BY7H 4DAYA 4FNFA 4EGQA 2NVQH 4KV6A 3MFHA 2I0QA 1ZQ7A 2ATWA 2VUMG 2EYJA 1EQRA 2V4QA 2X0SA 4J0MA 1STBA 1TWFA 3HOXH 5LL6X 1H9RA 4DR3H 2NZOA 3S1MH 4LFAL 1JOKA 1RHPA 1HNXQ 1SRUA 2B2UC 4R8NA 1BNZA 3C2PA 4LWCA 2Q2IA 4LF5L 3HOVB 4NW2A 1N56A 3S17B 4A3JG 5C3EB 1JT8A 2V5AA 5HV6A 1LTID 2R7DA 5KG0A 3T1HQ 3F2UA 3MAQA 3S1RB 4EEYA 4YWKA 3TS0A 1KDBA 1X3PA 3JRXA 3CVZA 1EY7A 2K5DA 4DV7L 4A3IH 3ICEA 4O0AA 4XQJA 3R5XA 3TS2A 2XIGA 3TDQA 1PYWD 2V9WA 1PK8A 1SMYC 1VQ9A 4Q5VA 1XJVA 1DXMA 4LF6L 3BQ1A 2R7ZH 1JC7A 1Y8PB 4MTDA 2BR0A 1VQFA 3NBIA 3M3YH 2IJ0A 4J9PA 1WD0A 1DOMA 1SMYD 2HGSA 3QO2A 5GONF 2DPJA 2XRQD 2R3ZA 1TWHA 4JI5L 2XGQA 1KD1C 1PTOH 4C3HH 1N8RC 2DPIA 4KKUA 1QB5D 4APVA 1NR2A 3QIAA 1JX4A 5KFZA 5CORA 2OWOA 4QY7A 4JV5H 1AE2A 2PZTA 5KFBA 2EJMA 1XMOL 1KQSA 2UU9Q 3NENA 5JOBA 1TR5A 5C4JH 4J1MA 4ILWA 2RKSA 4UP7A 4MV1A 3GIMA 4ECVA 4IPHA 4DU9A 5J39A 5C0XG 5FD6A 3RGXA 1QVCA 4A93H 5KFKA 5FLXW 3OTOQ 4IQZA 4JOIA 5LP6F 2UVRA 2KHSA 2A6ED 4IWXA 4RFBA 2MPMA 1EYDA 4JI1L 4I55F 1KNEA 4DPGA 4GN5A 2XN9C 2CQOA 5IOCA 1N36H 1WD1A 4AYBB
chains in the Genus database with same CATH topology
2K50A 4Y52H 1CSPA 5GADC 1IBKL 3UDFA 1XPOA 4IFDI 3W1GA 2XGTA 2DUDA 4R4CA 2L15A 4JCVE 2Z0SA 3GTMH 3AQQA 4JI2L 2IY5B 3H0GG 4DV5Q 1IXRA 4B3SQ 5FJ8H 3RNUA 2WB1E 4JI7L 4PZ8A 4AQYQ 4JBMA 1HZBA 4OX9L 3AFQA 4A3LH 1W2BA 1QUQA 2RHQB 3CQZH 3L2PA 5LMNW 3S24A 1E1TA 1HNZQ 1E1OA 3K7AH 4BXXH 2BH2A 3F8TA 3CCQA 4BXXG 1WOCA 2KHIA 4X64L 4POGA 2JA8H 1JE5A 3HKZG 2JA8G 4JI8Q 4BBSH 2KENA 5IP9H 2UXCL 1HNXL 5IP9G 4JI6Q 1Y1VH 4QGUA 1GD7A 1PH1A 4A3DG 1PH8A 1N9WA 1Y1VG 3GTPH 1VQ5A 3I4MG 3J81j 4LF4L 2V1CC 2OTJA 1O7IA 3T1YL 3RLNA 4DR3Q 3U4ZA 3RLOA 2I5MX 1B7YB 4GKJQ 1X6OA 3T1HL 4A3FH 2QA4A 2B63H 4R4TA 1YJ9A 2NVTH 2B63G 4A3FG 4JI0Q 1C9OA 4GLAC 5GQOA 5IWAL 1YEZA 4OONA 4L5RC 1YI2A 2LSSA 3H15A 3FKIH 3J81i 1C7YA 4B3TL 4LF8Q 4YY3L 2ZTDA 1X3FA 3FKIG 3RR5A 3W5OA 2EQSA 3CCVA 4POFA 3MEFA 3J81c 3PF5A 2XTIA 3CCLA 4XTCS 2OCEA 4TQUS 4QL5A 4HJAA 5J3BA 5BR8Q 4X66L 1N34L 4A3BH 1T9HA 3HKZE 3CAMA 5LMUQ 4DUYQ 4HIKA 1KRSA 3UDXA 2RHSB 5C3EH 4GLVB 4A3GH 4YHHQ 2CWAA 4GOPB 3S1RH 2K75A 1X56A 1UE6A 3PUWA 4ALPA 1IBLL 2JA7H 1IYJB 3HOUG 1DGSA 1SN8A 2F52A 2JA7G 3HOXG 3F2BA 4LFBL 4NXML 1Q7YC 3FP9A 4GS3A 2JA6H 5ELOA 2JA6G 5LMNQ 4WJ3M 1HNWL 1EUJA 2BA1A 3CCUA 1HR0W 2VNUD 3PO2G 2PQAA 4A76A 1QVGA 4OWWB 1Q1EA 1X65A 1JMCA 4B3ML 1LYLA 2AMCB 5IT9c 4QQBX 1K8AC 2F3IA 1Q81C 2VQFL 3UE0A 5C44H 1VQMA 4C3IH 1I3QH 2HT1A 3TRZA 5C44G 2Z6KC 1PYBA 1G51A 3H3VI 4DR7Q 4A3IG 3E9HA 3GTKH 1K3RA 2ZTCA 1A63A 2CKZB 3CCEA 2OQ0A 1HJPA 1Q8KA 1TWCH 2I5HA 2MO0A 3DM3A 4QIWE 1V9PA 5FLMH 2RCNA 2MNAA 4A75A 1XMQL 3A0JA 1V43A 2LXJA 5FLMG 4JI3L 1LM0A 3JAMc 3CCMA 4DK3C 4DR5Q 1YJNA 1XPRA 3GTGH 2UXBL 2NN6G 4BBRH 2ID0A 1VQAA 4BBRG 2FXQA 4GLXA 4LNQA 1N36Q 4B3RL 3PCOB 4B3SL 4IFDJ 3EIVA 4IJLA 4AIMA 4AQYL 1X9NA 2K5NA 1TXYA 2UXDQ 5GAGC 4JYAQ 1PH9A 1JJGA 4GNXA 1OXVA 3BZKA 2HHHQ 3G48A 3AFPA 2NZHA 4L5QA 4DK6C 3PIPA 1VQLA 1L1OA 4LFCL 4DUZQ 4GN4B 4JI4Q 4WJ4A 1FGUA 1PYSB 5IY0A 4OO1G 4NXNQ 2JJQA 5DLQE 4LW1A 1KRTA 1AE3A 5M3FH 1J6QA 4X62Q 4MTNA 1RIPA 2KHJA 3OW2A 4XIGS 1TWAH 3PUXA 1YHBA 1Y1WH 3J7ZC 3G6EA 4A93G 5AJ3Q 4JBWA 2A1AA 2HIXA 3I7FA 3KYHC 1BKBA 2IHFA 3GTOH 2D0OA 3S2HH 2KBNA 2R93G 4DV1Q 4JC0A 1VQDA 4LFAQ 2ZJQA 3KDFB 3DLLA 1HR0Q 1KIXA 1XNRL 1GO3E 3JC66 2N49A 1JJCB 2VQEQ 1VQ6A 5IYBH 4GOPC 4LF8L 5GAHC 3U58A 1CKNA 5IYBG 3E0EA 3H3VH 1HZCA 1OXUA 4HJ8A 1I94L 1Z9FA 3E9IA 2E5LQ 4X65Q 4HIDA 3ZJYC 3CCSA 1TWGH 1LUZA 3CC2A 3GTLH 2NVXH 2PNHA 5BR8L 5FJ8G 5ELNA 3K0XA 3Q8DA 3ULLA 2R92H 4A3CH 1L2FA 4DUYL 4A3LG 3A74A 4DV7Q 4A3CG 3K80C 2VL6A 4A3KH 3K81C 2YTYA 1VQ7A 4DAYB 4YHHL 3CP0A 4A3KG 1B8AA 3CPFA 1XNQQ 5M3MH 4H02A 3M4PA 1PH6A 1EYGA 4BBSG 3L0OA 2K4KA 3WWVA 4LF7Q 4JOIC 2E2HH 4BY1H 4DV2Q 2JE6I 2H5XA 5EAYA 1WCMH 3ER0A 3KF6A 3PSIA 3RLFA 2Y0SG 1PH3A 1N32Q 1K0RA 1WCMG 1YBYA 4DV4Q 5JJKA 4GKKL 2QGQA 3I4NH 1WI5A 1Q12A 1C0AA 1Y14B 4IO9A 3ULPA 2A8VA 1I6HH 3AYHB 5GAEC 3PO3H 2NVYH 2AWOA 2AWNA 3PUZA 1YHAA 1VQKA 2WP8J 3BJUA 1VQIA 2R7FA 2ALYB 4DV3Q 2JK8A 2E2JH 1XMOQ 2E2IH 1NMGA 3CPWA 4HJ7A 4UP9A 3CW2C 4DV0L 3NELA 3F1ZA 3D0FA 4R4IA 4R4OA 4A3MH 1EIYB 3STBC 5C0XJ 1PHJA 1PH2A 2D0PA 2DGYA 3ERSX 4ME3A 1J5EL 1NY4A 1IBML 2GVBA 2MFIA 2LXKA 1EFWA 2UUCQ 3HOVH 2UUBQ 3S17H 4A3BG 3HOVG 4IFDG 1VQPA 4DR1L 4IJHA 4EX5A 5C3EG 4DR2L 3STBD 1Q1BA 4DR6Q 2UUAQ 4A3GG 2BH8A 1PA6A 2UXDL 1YITA 1R9TH 2KCTA 4HJ5A 1ASZA 3S1NH 2Y0SE 2I5LX 2YU9H 4IPDA 2HHHL 1HH2P 1OXXK 5JEAG 2YTVA 4LUZA 4UP8A 3G71A 4NPSA 1OTCA 2E8GA 3KJPA 4HIMA 3PGZA 3S14H 2MQHA 2UU9L 4JI2Q 1BBWA 1A0IA 4LUVA 1NMFA 4NXNL 4OX9Q 5IYCH 3RN5A 4DNIA 4X62L 4GN3B 4UY8C 3NEMA 4JV5Q 4L5TA 3OTOL 3ULJA 1VQBA 3W1BA 1Z47A 3UDGA 4JBKA 4L5SA 1CUKA 1VCIA 4EQ5A 3CC4A 1UE7A 4X64Q 1NTGA 2Q2HA 1K8GA 4K0KQ 3JAMi 3J7A5 1PH5A 4DV6Q 5C0XI 2VW9A 2ZM6L 1YVCA 2UXCQ 2CWPA 3TREA 1YJWA 1W3SA 4R4QA 4IPCA 3SGIA 3TEHB 2VQEL 4KI0A 1N33Q 1JB7A 1VQGA 4R1JA 1VQJA 4A3JH 1QZHA 5IE8A 1KC8C 2K52A 2IX1A 1KL9A 3J80i 4DV5L 3GO5A 4X65L 2E5LL 2QEXA 2YV5A 1G6PA 1VQHA 1QZGA 2Q2TA 1MJEA 3J80c 4OWTB 2JA5H 3GTQH 4DAMA 4X6AH 2WAQE 2JA5G 4FDBA 2EXDA 5IWAQ 2AKWB 1HNZL 1VQ8A 1RL2A 4PG3A 4LUOA 1QUQB 1OXTA 3KOJA 4B3TQ 1G291 5C4XG 2MO1A 2ES2A 2EIFA 3F2DA 3PV0A 4JI8L 3CCRA 3M7NA 3IRBA 1QVFA 1Q86C 4MNOA 3HOYH 3PUYA 4JI6L 1PVOA 1X55A 4AYBG 1S40A 1N34Q 2KCMA 4X66Q 1GM5A 2ZJPA 4DR4Q 4DV2L 5M3FG 4GOPA 2R6GA 4P71A 1N32L 4PZ7A 5M5WH 4DR3L 3D31A 1Y1WG 1EQQA 1IL2A 4GKJL 3GDEA 1MJCA 1IBLQ 1BVSA 3NBHB 4JI0L 3S16H 1UE1A 1PH7A 2YTXA 4LFBQ 4AH6A 1MIUA 2D62A 3MXNB 1JJ2A 1E3PA 1OXSC 1P8LA 1I50H 4QJFA 2VZAA 4NB3A 4LF5Q 3RN2A 2N8NA 3CXCA 1D8LA 1NBWA 2N3SA 4A3EH 1NJIC 4B3MQ 4GNXC 4A3EG 5JJIA 3M85A 5LMUL 2R92G 2VQFQ 4HIOA 1L0WA 5FLXc 4C3JH 1FVIA 3PIOA 4IOCA 1YZ6A 1E7ZA 4AYBE 1H95A 1GVPA 1U0LA 3UDIA 5E7NA 4LF6Q 3HOWH 5C4XH 3PF4A 1SE8A 1SROA 3HOWG 3HFZB 3I2ZA 2BA0A 2VY3A 5M3MG 1XMQQ 3KF8B 4JI3Q 3CC7A 1AH9A 5HGQA 2ZJRA 2UXBQ 4J15A 1VQOA 3H0GH 3U4VA 1WYDA 5LMNL 4BY1G 4JI5Q 4RMFA 4B3RQ 1M1KC 1E22A 3RZDH 1D7QA 2A19A 4PZ6A 2F4VQ 3I4NG 2PQAB 1BBUA 1CKMA 2K5VA 1YIJA 4JV5L 4HJ9A 3PO3G 5K36G 4P74A 1WFQA 4KHPQ 4OWXB 1TWHH 3I56A 4DR7L 1FL0A 2Q2UA 1KHIA 4KHZA 1M90C 4K0KL 4LFCQ 1K9MC 4DV6L 3F2CA 1HZAA 2K14A 3S2DH 1FJGQ 4A3DH 2JQOA 4C2MH 1PV4A 3KJOA 3I4MH 2PMZE 4YCVA 3K7UC 1XPUA 4LF9Q 1N33L 4DR5L 1I5FA 3EN2A 1A8VA 3LGJA 4A3MG 1SR3A 3EBEA 3CD6A 1VQCA 1PFSA 5IYDH 1MKHA 1GKHA 1UE5A 3M9BA 4O2DA 5IYDG 1PH4A 1N36L 1VQNA 2JA9A 3L7ZC 2PI2A 3KDFA 1K83H 1YHQA 5IP7H 4JI1Q 2NN6I 5IP7G 4JYAL 4IPGA 2IHEA 1XNRQ 3M4QA 1Q82C 1S3OA 2B3GA 2IT1A 1VQ4A 1IBKQ 4BA1I 5M5XH 3S1QH 1SMXA 3BU2A 3KLWA 4GNXB 2Z6KA 4YWLA 3TQYA 2WAQG 4DUZL 3FHWA 1K73C 4JI4L 1P16A 4YWMA 2RF4A 1I94Q 1V1QA 1CKOA 1L1OB 4JI7Q 1EWIA 4PMWA 3A5UA 4DR4L 3I4OA 4BY7H 3GD7A 3A5ZB 1VS0A 2NVQH 5IYCG 2VUMH 4BY7G 3B6YA 2I0QA 2ATWA 2JEBI 2VUMG 4MZ9A 5M5YH 5H1SE 4BA2I 1EQRA 5AJ3L 3G4SA 4JG2A 4OO1I 2JEAI 3HOUH 1XTDA 5JJLA 5HY6A 3HOXH 2AHOB 1X54A 2NZOA 3S1MH 4DV1L 3K8AA 4LFAL 2OTLA 1HNXQ 1EOVA 1EIFA 1A62A 1SRUA 1WJJA 2C35B 3U50C 3I55A 2IX0A 3GTJH 1HR0L 1LTLA 3VDYA 4A4IA 4LWCA 2Q2IA 4LF5L 3PO2H 4LF4Q 1UEBA 1NE3A 3T1YQ 4YCUA 4A3JG 4GKKQ 1JT8A 1KXLA 1CKNB 2R7DA 3PUVA 3T1HQ 3UE1A 1E24A 3S15H 4YWKA 3TS0A 1X3GA 1SFOH 4DV7L 3ICEA 4A3IH 2N78A 4O0AA 3CCJA 4KLKA 3TS2A 5GROA 1VQ9A 2ZTEA 1XJVA 2CCZA 4LF6L 3AEVA 2R7ZH 1XNQL 4YY3Q 2YYZA 2R7ZG 1VQFA 1Q46A 2CFMA 1S72A 4DV0Q 3M3YH 2HIVA 3KFUA 1ASYA 4LF7L 3HOYG 1J5EQ 1SLJA 1IBMQ 3HKSA 4YCWA 4UPAA 4JI5L 1KD1C 4JBJA 3CMAA 1CSQA 2OQKA 4C3HH 4DV4L 4DR1Q 1N8RC 4DR2Q 3OYYA 3KF6B 2F4VL 4APVA 5JEAJ 2B29A 4OXPA 4DKAC 2OWOA 1YNXA 4QY7A 4NXMQ 4KHPL 2WB1G 1AE2A 4DV3L 1VQEA 2WFWA 1XMOL 1KQSA 1IZ6A 2UU9Q 2GN5A 3NENA 4RG1A 4P73A 1FJGL 2K5HA 5C4JH 3HOZH 1HNWQ 4Y7NH 3HOZG 1TWFH 4P72A 1B70B 4IOAA 2VS1A 4LF9L 1UWVA 4UP7A 1HZ9A 4IPHA 3RZOH 5C0XG 1QVCA 1U5KA 4A93H 3OTOQ 3M4OH 4JOIA 2UUCL 3CF5A 2UUBL 1L1OC 3CMEA 1X3EA 2PI2E 2R93H 2ASBA 4TVAB 2GVAA 3BZCA 4DR6L 2UUAL 4JI1L 2HQLA 4DPGA 4GN5A 2ZM6Q 2CQOA 4P75A 1KAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K50 A;  4Y52 H;  1CSP A;  5GAD C;  1IBK L;  3UDF A;  1XPO A;  4IFD I;  3W1G A;  2XGT A;  2DUD A;  4R4C A;  2L15 A;  4JCV E;  2Z0S A;  3GTM H;  3AQQ A;  4JI2 L;  2IY5 B;  3H0G G;  4DV5 Q;  1IXR A;  4B3S Q;  5FJ8 H;  3RNU A;  2WB1 E;  4JI7 L;  4PZ8 A;  4AQY Q;  4JBM A;  1HZB A;  4OX9 L;  3AFQ A;  4A3L H;  1W2B A;  1QUQ A;  2RHQ B;  3CQZ H;  3L2P A;  5LMN W;  3S24 A;  1E1T A;  1HNZ Q;  1E1O A;  3K7A H;  4BXX H;  2BH2 A;  3F8T A;  3CCQ A;  4BXX G;  1WOC A;  2KHI A;  4X64 L;  4POG A;  2JA8 H;  1JE5 A;  3HKZ G;  2JA8 G;  4JI8 Q;  4BBS H;  2KEN A;  5IP9 H;  2UXC L;  1HNX L;  5IP9 G;  4JI6 Q;  1Y1V H;  4QGU A;  1GD7 A;  1PH1 A;  4A3D G;  1PH8 A;  1N9W A;  1Y1V G;  3GTP H;  1VQ5 A;  3I4M G;  3J81 j;  4LF4 L;  2V1C C;  2OTJ A;  1O7I A;  3T1Y L;  3RLN A;  4DR3 Q;  3U4Z A;  3RLO A;  2I5M X;  1B7Y B;  4GKJ Q;  1X6O A;  3T1H L;  4A3F H;  2QA4 A;  2B63 H;  4R4T A;  1YJ9 A;  2NVT H;  2B63 G;  4A3F G;  4JI0 Q;  1C9O A;  4GLA C;  5GQO A;  5IWA L;  1YEZ A;  4OON A;  4L5R C;  1YI2 A;  2LSS A;  3H15 A;  3FKI H;  3J81 i;  1C7Y A;  4B3T L;  4LF8 Q;  4YY3 L;  2ZTD A;  1X3F A;  3FKI G;  3RR5 A;  3W5O A;  2EQS A;  3CCV A;  4POF A;  3MEF A;  3J81 c;  3PF5 A;  2XTI A;  3CCL A;  4XTC S;  2OCE A;  4TQU S;  4QL5 A;  4HJA A;  5J3B A;  5BR8 Q;  4X66 L;  1N34 L;  4A3B H;  1T9H A;  3HKZ E;  3CAM A;  5LMU Q;  4DUY Q;  4HIK A;  1KRS A;  3UDX A;  2RHS B;  5C3E H;  4GLV B;  4A3G H;  4YHH Q;  2CWA A;  4GOP B;  3S1R H;  2K75 A;  1X56 A;  1UE6 A;  3PUW A;  4ALP A;  1IBL L;  2JA7 H;  1IYJ B;  3HOU G;  1DGS A;  1SN8 A;  2F52 A;  2JA7 G;  3HOX G;  3F2B A;  4LFB L;  4NXM L;  1Q7Y C;  3FP9 A;  4GS3 A;  2JA6 H;  5ELO A;  2JA6 G;  5LMN Q;  4WJ3 M;  1HNW L;  1EUJ A;  2BA1 A;  3CCU A;  1HR0 W;  2VNU D;  3PO2 G;  2PQA A;  4A76 A;  1QVG A;  4OWW B;  1Q1E A;  1X65 A;  1JMC A;  4B3M L;  1LYL A;  2AMC B;  5IT9 c;  4QQB X;  1K8A C;  2F3I A;  1Q81 C;  2VQF L;  3UE0 A;  5C44 H;  1VQM A;  4C3I H;  1I3Q H;  2HT1 A;  3TRZ A;  5C44 G;  2Z6K C;  1PYB A;  1G51 A;  3H3V I;  4DR7 Q;  4A3I G;  3E9H A;  3GTK H;  1K3R A;  2ZTC A;  1A63 A;  2CKZ B;  3CCE A;  2OQ0 A;  1HJP A;  1Q8K A;  1TWC H;  2I5H A;  2MO0 A;  3DM3 A;  4QIW E;  1V9P A;  5FLM H;  2RCN A;  2MNA A;  4A75 A;  1XMQ L;  3A0J A;  1V43 A;  2LXJ A;  5FLM G;  4JI3 L;  1LM0 A;  3JAM c;  3CCM A;  4DK3 C;  4DR5 Q;  1YJN A;  1XPR A;  3GTG H;  2UXB L;  2NN6 G;  4BBR H;  2ID0 A;  1VQA A;  4BBR G;  2FXQ A;  4GLX A;  4LNQ A;  1N36 Q;  4B3R L;  3PCO B;  4B3S L;  4IFD J;  3EIV A;  4IJL A;  4AIM A;  4AQY L;  1X9N A;  2K5N A;  1TXY A;  2UXD Q;  5GAG C;  4JYA Q;  1PH9 A;  1JJG A;  4GNX A;  1OXV A;  3BZK A;  2HHH Q;  3G48 A;  3AFP A;  2NZH A;  4L5Q A;  4DK6 C;  3PIP A;  1VQL A;  1L1O A;  4LFC L;  4DUZ Q;  4GN4 B;  4JI4 Q;  4WJ4 A;  1FGU A;  1PYS B;  5IY0 A;  4OO1 G;  4NXN Q;  2JJQ A;  5DLQ E;  4LW1 A;  1KRT A;  1AE3 A;  5M3F H;  1J6Q A;  4X62 Q;  4MTN A;  1RIP A;  2KHJ A;  3OW2 A;  4XIG S;  1TWA H;  3PUX A;  1YHB A;  1Y1W H;  3J7Z C;  3G6E A;  4A93 G;  5AJ3 Q;  4JBW A;  2A1A A;  2HIX A;  3I7F A;  3KYH C;  1BKB A;  2IHF A;  3GTO H;  2D0O A;  3S2H H;  2KBN A;  2R93 G;  4DV1 Q;  4JC0 A;  1VQD A;  4LFA Q;  2ZJQ A;  3KDF B;  3DLL A;  1HR0 Q;  1KIX A;  1XNR L;  1GO3 E;  3JC6 6;  2N49 A;  1JJC B;  2VQE Q;  1VQ6 A;  5IYB H;  4GOP C;  4LF8 L;  5GAH C;  3U58 A;  1CKN A;  5IYB G;  3E0E A;  3H3V H;  1HZC A;  1OXU A;  4HJ8 A;  1I94 L;  1Z9F A;  3E9I A;  2E5L Q;  4X65 Q;  4HID A;  3ZJY C;  3CCS A;  1TWG H;  1LUZ A;  3CC2 A;  3GTL H;  2NVX H;  2PNH A;  5BR8 L;  5FJ8 G;  5ELN A;  3K0X A;  3Q8D A;  3ULL A;  2R92 H;  4A3C H;  1L2F A;  4DUY L;  4A3L G;  3A74 A;  4DV7 Q;  4A3C G;  3K80 C;  2VL6 A;  4A3K H;  3K81 C;  2YTY A;  1VQ7 A;  4DAY B;  4YHH L;  3CP0 A;  4A3K G;  1B8A A;  3CPF A;  1XNQ Q;  5M3M H;  4H02 A;  3M4P A;  1PH6 A;  1EYG A;  4BBS G;  3L0O A;  2K4K A;  3WWV A;  4LF7 Q;  4JOI C;  2E2H H;  4BY1 H;  4DV2 Q;  2JE6 I;  2H5X A;  5EAY A;  1WCM H;  3ER0 A;  3KF6 A;  3PSI A;  3RLF A;  2Y0S G;  1PH3 A;  1N32 Q;  1K0R A;  1WCM G;  1YBY A;  4DV4 Q;  5JJK A;  4GKK L;  2QGQ A;  3I4N H;  1WI5 A;  1Q12 A;  1C0A A;  1Y14 B;  4IO9 A;  3ULP A;  2A8V A;  1I6H H;  3AYH B;  5GAE C;  3PO3 H;  2NVY H;  2AWO A;  2AWN A;  3PUZ A;  1YHA A;  1VQK A;  2WP8 J;  3BJU A;  1VQI A;  2R7F A;  2ALY B;  4DV3 Q;  2JK8 A;  2E2J H;  1XMO Q;  2E2I H;  1NMG A;  3CPW A;  4HJ7 A;  4UP9 A;  3CW2 C;  4DV0 L;  3NEL A;  3F1Z A;  3D0F A;  4R4I A;  4R4O A;  4A3M H;  1EIY B;  3STB C;  5C0X J;  1PHJ A;  1PH2 A;  2D0P A;  2DGY A;  3ERS X;  4ME3 A;  1J5E L;  1NY4 A;  1IBM L;  2GVB A;  2MFI A;  2LXK A;  1EFW A;  2UUC Q;  3HOV H;  2UUB Q;  3S17 H;  4A3B G;  3HOV G;  4IFD G;  1VQP A;  4DR1 L;  4IJH A;  4EX5 A;  5C3E G;  4DR2 L;  3STB D;  1Q1B A;  4DR6 Q;  2UUA Q;  4A3G G;  2BH8 A;  1PA6 A;  2UXD L;  1YIT A;  1R9T H;  2KCT A;  4HJ5 A;  1ASZ A;  3S1N H;  2Y0S E;  2I5L X;  2YU9 H;  4IPD A;  2HHH L;  1HH2 P;  1OXX K;  5JEA G;  2YTV A;  4LUZ A;  4UP8 A;  3G71 A;  4NPS A;  1OTC A;  2E8G A;  3KJP A;  4HIM A;  3PGZ A;  3S14 H;  2MQH A;  2UU9 L;  4JI2 Q;  1BBW A;  1A0I A;  4LUV A;  1NMF A;  4NXN L;  4OX9 Q;  5IYC H;  3RN5 A;  4DNI A;  4X62 L;  4GN3 B;  4UY8 C;  3NEM A;  4JV5 Q;  4L5T A;  3OTO L;  3ULJ A;  1VQB A;  3W1B A;  1Z47 A;  3UDG A;  4JBK A;  4L5S A;  1CUK A;  1VCI A;  4EQ5 A;  3CC4 A;  1UE7 A;  4X64 Q;  1NTG A;  2Q2H A;  1K8G A;  4K0K Q;  3JAM i;  3J7A 5;  1PH5 A;  4DV6 Q;  5C0X I;  2VW9 A;  2ZM6 L;  1YVC A;  2UXC Q;  2CWP A;  3TRE A;  1YJW A;  1W3S A;  4R4Q A;  4IPC A;  3SGI A;  3TEH B;  2VQE L;  4KI0 A;  1N33 Q;  1JB7 A;  1VQG A;  4R1J A;  1VQJ A;  4A3J H;  1QZH A;  5IE8 A;  1KC8 C;  2K52 A;  2IX1 A;  1KL9 A;  3J80 i;  4DV5 L;  3GO5 A;  4X65 L;  2E5L L;  2QEX A;  2YV5 A;  1G6P A;  1VQH A;  1QZG A;  2Q2T A;  1MJE A;  3J80 c;  4OWT B;  2JA5 H;  3GTQ H;  4DAM A;  4X6A H;  2WAQ E;  2JA5 G;  4FDB A;  2EXD A;  5IWA Q;  2AKW B;  1HNZ L;  1VQ8 A;  1RL2 A;  4PG3 A;  4LUO A;  1QUQ B;  1OXT A;  3KOJ A;  4B3T Q;  1G29 1;  5C4X G;  2MO1 A;  2ES2 A;  2EIF A;  3F2D A;  3PV0 A;  4JI8 L;  3CCR A;  3M7N A;  3IRB A;  1QVF A;  1Q86 C;  4MNO A;  3HOY H;  3PUY A;  4JI6 L;  1PVO A;  1X55 A;  4AYB G;  1S40 A;  1N34 Q;  2KCM A;  4X66 Q;  1GM5 A;  2ZJP A;  4DR4 Q;  4DV2 L;  5M3F G;  4GOP A;  2R6G A;  4P71 A;  1N32 L;  4PZ7 A;  5M5W H;  4DR3 L;  3D31 A;  1Y1W G;  1EQQ A;  1IL2 A;  4GKJ L;  3GDE A;  1MJC A;  1IBL Q;  1BVS A;  3NBH B;  4JI0 L;  3S16 H;  1UE1 A;  1PH7 A;  2YTX A;  4LFB Q;  4AH6 A;  1MIU A;  2D62 A;  3MXN B;  1JJ2 A;  1E3P A;  1OXS C;  1P8L A;  1I50 H;  4QJF A;  2VZA A;  4NB3 A;  4LF5 Q;  3RN2 A;  2N8N A;  3CXC A;  1D8L A;  1NBW A;  2N3S A;  4A3E H;  1NJI C;  4B3M Q;  4GNX C;  4A3E G;  5JJI A;  3M85 A;  5LMU L;  2R92 G;  2VQF Q;  4HIO A;  1L0W A;  5FLX c;  4C3J H;  1FVI A;  3PIO A;  4IOC A;  1YZ6 A;  1E7Z A;  4AYB E;  1H95 A;  1GVP A;  1U0L A;  3UDI A;  5E7N A;  4LF6 Q;  3HOW H;  5C4X H;  3PF4 A;  1SE8 A;  1SRO A;  3HOW G;  3HFZ B;  3I2Z A;  2BA0 A;  2VY3 A;  5M3M G;  1XMQ Q;  3KF8 B;  4JI3 Q;  3CC7 A;  1AH9 A;  5HGQ A;  2ZJR A;  2UXB Q;  4J15 A;  1VQO A;  3H0G H;  3U4V A;  1WYD A;  5LMN L;  4BY1 G;  4JI5 Q;  4RMF A;  4B3R Q;  1M1K C;  1E22 A;  3RZD H;  1D7Q A;  2A19 A;  4PZ6 A;  2F4V Q;  3I4N G;  2PQA B;  1BBU A;  1CKM A;  2K5V A;  1YIJ A;  4JV5 L;  4HJ9 A;  3PO3 G;  5K36 G;  4P74 A;  1WFQ A;  4KHP Q;  4OWX B;  1TWH H;  3I56 A;  4DR7 L;  1FL0 A;  2Q2U A;  1KHI A;  4KHZ A;  1M90 C;  4K0K L;  4LFC Q;  1K9M C;  4DV6 L;  3F2C A;  1HZA A;  2K14 A;  3S2D H;  1FJG Q;  4A3D H;  2JQO A;  4C2M H;  1PV4 A;  3KJO A;  3I4M H;  2PMZ E;  4YCV A;  3K7U C;  1XPU A;  4LF9 Q;  1N33 L;  4DR5 L;  1I5F A;  3EN2 A;  1A8V A;  3LGJ A;  4A3M G;  1SR3 A;  3EBE A;  3CD6 A;  1VQC A;  1PFS A;  5IYD H;  1MKH A;  1GKH A;  1UE5 A;  3M9B A;  4O2D A;  5IYD G;  1PH4 A;  1N36 L;  1VQN A;  2JA9 A;  3L7Z C;  2PI2 A;  3KDF A;  1K83 H;  1YHQ A;  5IP7 H;  4JI1 Q;  2NN6 I;  5IP7 G;  4JYA L;  4IPG A;  2IHE A;  1XNR Q;  3M4Q A;  1Q82 C;  1S3O A;  2B3G A;  2IT1 A;  1VQ4 A;  1IBK Q;  4BA1 I;  5M5X H;  3S1Q H;  1SMX A;  3BU2 A;  3KLW A;  4GNX B;  2Z6K A;  4YWL A;  3TQY A;  2WAQ G;  4DUZ L;  3FHW A;  1K73 C;  4JI4 L;  1P16 A;  4YWM A;  2RF4 A;  1I94 Q;  1V1Q A;  1CKO A;  1L1O B;  4JI7 Q;  1EWI A;  4PMW A;  3A5U A;  4DR4 L;  3I4O A;  4BY7 H;  3GD7 A;  3A5Z B;  1VS0 A;  2NVQ H;  5IYC G;  2VUM H;  4BY7 G;  3B6Y A;  2I0Q A;  2ATW A;  2JEB I;  2VUM G;  4MZ9 A;  5M5Y H;  5H1S E;  4BA2 I;  1EQR A;  5AJ3 L;  3G4S A;  4JG2 A;  4OO1 I;  2JEA I;  3HOU H;  1XTD A;  5JJL A;  5HY6 A;  3HOX H;  2AHO B;  1X54 A;  2NZO A;  3S1M H;  4DV1 L;  3K8A A;  4LFA L;  2OTL A;  1HNX Q;  1EOV A;  1EIF A;  1A62 A;  1SRU A;  1WJJ A;  2C35 B;  3U50 C;  3I55 A;  2IX0 A;  3GTJ H;  1HR0 L;  1LTL A;  3VDY A;  4A4I A;  4LWC A;  2Q2I A;  4LF5 L;  3PO2 H;  4LF4 Q;  1UEB A;  1NE3 A;  3T1Y Q;  4YCU A;  4A3J G;  4GKK Q;  1JT8 A;  1KXL A;  1CKN B;  2R7D A;  3PUV A;  3T1H Q;  3UE1 A;  1E24 A;  3S15 H;  4YWK A;  3TS0 A;  1X3G A;  1SFO H;  4DV7 L;  3ICE A;  4A3I H;  2N78 A;  4O0A A;  3CCJ A;  4KLK A;  3TS2 A;  5GRO A;  1VQ9 A;  2ZTE A;  1XJV A;  2CCZ A;  4LF6 L;  3AEV A;  2R7Z H;  1XNQ L;  4YY3 Q;  2YYZ A;  2R7Z G;  1VQF A;  1Q46 A;  2CFM A;  1S72 A;  4DV0 Q;  3M3Y H;  2HIV A;  3KFU A;  1ASY A;  4LF7 L;  3HOY G;  1J5E Q;  1SLJ A;  1IBM Q;  3HKS A;  4YCW A;  4UPA A;  4JI5 L;  1KD1 C;  4JBJ A;  3CMA A;  1CSQ A;  2OQK A;  4C3H H;  4DV4 L;  4DR1 Q;  1N8R C;  4DR2 Q;  3OYY A;  3KF6 B;  2F4V L;  4APV A;  5JEA J;  2B29 A;  4OXP A;  4DKA C;  2OWO A;  1YNX A;  4QY7 A;  4NXM Q;  4KHP L;  2WB1 G;  1AE2 A;  4DV3 L;  1VQE A;  2WFW A;  1XMO L;  1KQS A;  1IZ6 A;  2UU9 Q;  2GN5 A;  3NEN A;  4RG1 A;  4P73 A;  1FJG L;  2K5H A;  5C4J H;  3HOZ H;  1HNW Q;  4Y7N H;  3HOZ G;  1TWF H;  4P72 A;  1B70 B;  4IOA A;  2VS1 A;  4LF9 L;  1UWV A;  4UP7 A;  1HZ9 A;  4IPH A;  3RZO H;  5C0X G;  1QVC A;  1U5K A;  4A93 H;  3OTO Q;  3M4O H;  4JOI A;  2UUC L;  3CF5 A;  2UUB L;  1L1O C;  3CME A;  1X3E A;  2PI2 E;  2R93 H;  2ASB A;  4TVA B;  2GVA A;  3BZC A;  4DR6 L;  2UUA L;  4JI1 L;  2HQL A;  4DPG A;  4GN5 A;  2ZM6 Q;  2CQO A;  4P75 A;  1KAW A; 
#chains in the Genus database with same CATH topology
 2K50 A;  2R7L A;  1CSP A;  1IBK L;  3UDF A;  1BCP F;  3Q2O A;  3VA5 A;  2Z0S A;  5KG3 A;  3RBE A;  4JI2 L;  1K1S A;  1Y1W B;  1IXR A;  5FJ8 H;  3RNU A;  1EZ6 A;  1EY9 A;  3K0Y A;  2CW7 A;  4M1U B;  4DUZ H;  3LWU A;  4OX9 L;  1QUQ A;  2RHQ B;  3CKI B;  3L2P A;  2GPS A;  1LT5 D;  1LLR D;  4JV1 A;  2PYK A;  2A6H C;  3G8C A;  4ME6 A;  2XCA A;  2WKC A;  1VDZ A;  5CV4 A;  4A2B A;  3PQI A;  2JA8 G;  4BBS H;  3MFY A;  2I80 A;  4KJN A;  2UXC L;  1STN A;  1HNX L;  4O3O A;  1TY2 A;  3IFD A;  1GD7 A;  1TWG B;  2A6H D;  1N9W A;  2R92 B;  3DEP A;  1VQ5 A;  4OGQ C;  3JSN A;  5KG1 A;  4TV8 F;  3BDO A;  4KK7 A;  1SE2 A;  2V4D A;  4G57 A;  1VMP A;  5H80 A;  2PMZ B;  5CAE B;  1EEF D;  3G6X A;  1TWC A;  3GIK A;  2HD3 A;  1A15 A;  3T1H L;  1OO9 B;  3HOW B;  4R4T A;  2NVT H;  2NWG A;  4JI0 Q;  1C9O A;  5M3M B;  1RK5 A;  4GLA C;  1LO5 D;  4X65 H;  3J81 E;  1YEZ A;  4S3S A;  5DNF A;  3IAY A;  4IUQ A;  4FP5 D;  5C4Z A;  1YI2 A;  1KJJ A;  3H15 A;  1SYE A;  2NU6 B;  4EBE A;  1D5X C;  1H9S B;  4LF8 Q;  4ZOL F;  3W5O A;  2A5H A;  3TZD A;  1A9X A;  3H91 A;  2KED A;  5TSS A;  3MEF A;  3J81 c;  3CCL A;  4XT1 B;  3I4N B;  2FPG B;  4HJA A;  4X66 L;  3C0F B;  5LMU Q;  2AUK A;  3HKZ E;  2AGQ A;  4EBC A;  3QZ8 A;  2PPB C;  1S5D D;  4IUT A;  3N42 B;  2VB3 X;  1IBL L;  2E2I B;  1V4Y A;  2RDI A;  4H0L C;  1E4E B;  1KDA A;  1S0M A;  3VYU A;  5CV6 A;  4LFB L;  2YZG A;  2F4V H;  5L1J A;  4I7Z C;  2FIN B;  5ELO A;  5CB4 F;  2R93 A;  2PQE A;  1EUJ A;  3GTO A;  4DV3 H;  2R8I A;  4OWW B;  1Q1E A;  1FJG H;  3HRZ C;  1VBG A;  5KNB A;  4QQB X;  1S5F D;  1Q81 C;  3JAM E;  3DF7 A;  4C5B A;  4ZKB B;  4U67 3;  4KKT A;  1G51 A;  1AZP A;  4TSS A;  2WAQ B;  1WTW A;  4KY7 A;  1A63 A;  2CKZ B;  4RNO A;  1HJP A;  1D2B A;  3L9A X;  3JZI A;  3JAM c;  1V43 A;  4DR6 H;  4DR5 Q;  1XPR A;  4BY7 B;  4J9K A;  2NVQ B;  4MHE A;  3RAQ A;  4BBR G;  2FXQ A;  4HNT A;  4IFD J;  4AIM A;  3R2T A;  4JPB W;  4LMY A;  4HNV A;  5KFG A;  2F0N A;  1TXY A;  4KY5 A;  4CDF C;  3S1M B;  2UXD Q;  5GAG C;  1PH9 A;  4JI7 H;  1S0O A;  3ONA B;  2B39 A;  2F4I A;  3G48 A;  4UFZ A;  4DK6 C;  1BXT A;  3N6X A;  1LTG D;  3BG5 A;  4QWD A;  4DL3 A;  4LFC L;  4GN4 B;  4MTK A;  3HGB A;  3KHR A;  4X64 H;  2JYO A;  5DLQ E;  3KAL A;  2YYA A;  5M3F H;  4F4W A;  1S10 A;  4X62 Q;  5JVH 3;  1RIP A;  2KHJ A;  4DXG A;  2DJF C;  3PUX A;  4MV3 A;  1Q3L A;  4JBW A;  2R7Z B;  3BA8 A;  2F0D A;  3T1Y H;  2HDL A;  3KYH C;  1BKB A;  3S2H H;  2R93 G;  3M3Y B;  4RB2 C;  4JC0 A;  1DJR D;  3K3P A;  1GUG A;  3KDF B;  2JEI A;  1HR0 Q;  2NUA B;  1GO3 E;  1JJC B;  5IWA H;  4TQS A;  4LF8 L;  1F2Z A;  3N8D A;  5BN3 A;  1OXU A;  1PTO B;  4C3H B;  4HJ8 A;  1R9T A;  2E5L Q;  5CA0 F;  2JA7 A;  4HID A;  4K5X A;  3CCS A;  4DXF A;  1LUZ A;  3DWP A;  2QF7 A;  3GTL H;  4O2B F;  4DL5 A;  4IHJ F;  3U9T A;  5ELN A;  1YNJ C;  3K0X A;  3ULL A;  1V1P A;  5KG7 A;  4A3L G;  2V59 A;  1C3O A;  3K81 C;  2YTY A;  1VQ7 A;  1S5B D;  1SJE D;  4A3K G;  2K6A A;  1I7L A;  3CPF A;  2F0L A;  1XNQ Q;  5D14 A;  4TKO B;  4V19 0;  2K04 A;  1DYQ A;  5C4J B;  2KQ3 A;  1PZI D;  4RGM A;  5BN4 A;  3TQ1 A;  2V4R A;  4NP5 A;  3OUU A;  2EYM A;  4LF7 Q;  4JOI C;  4BY1 H;  4DV2 Q;  3VR6 A;  2H5X A;  4NKL A;  1WCM H;  1M4V A;  3OMG A;  2VR1 A;  3RB4 A;  2ICE C;  3ULP A;  3A56 A;  4K6L A;  2R6F A;  4A2A A;  3K5O A;  3PUZ A;  3DM1 A;  1VQK A;  1CE8 A;  2ASL A;  1S5C D;  3H0G B;  2EOT A;  3BVG A;  3GTQ A;  5CV9 A;  2ZXO A;  3NEL A;  3F1Z A;  5KFT A;  1VAJ A;  4R4O A;  4A3M H;  3RZD B;  1EIY B;  5IGF A;  1PHJ A;  1EU4 A;  4ME3 A;  1XMQ H;  5KFP A;  1NY4 A;  2UUC Q;  2UXB H;  5EWF A;  2HUG A;  1FD7 D;  3HKZ B;  4DR2 L;  5D3D A;  1MD2 D;  2RDF A;  1TU2 B;  3MC0 B;  4A3G G;  2UXD L;  4JI5 H;  3S2D B;  2XIW A;  3BZD B;  3S1N H;  3UFX B;  2YU9 H;  5KT6 A;  1HH2 P;  2L1B A;  1AN7 A;  1TWA A;  3T13 A;  2E8G A;  2NB0 A;  2FB9 A;  3KJP A;  1E4F T;  1TY0 A;  1A0I A;  3KUP A;  4IR9 A;  2F0V A;  2NVT B;  5LOV F;  2W9B B;  3RN5 A;  2MGS A;  1K83 B;  4DNI A;  4X62 L;  1CI3 M;  4UY8 C;  1LAC A;  4JV5 Q;  3H09 A;  4L5T A;  3UDG A;  3PIP 3;  3CC4 A;  3KBX A;  2Q2H A;  4DAP A;  2GPW A;  3JAM i;  1PH5 A;  5KFC A;  2K05 A;  2NVX A;  1SNM A;  1YVC A;  2V58 A;  2YW2 A;  1CA5 A;  1EY4 A;  3J80 E;  1YJW A;  4G4K A;  1W3S A;  3SGI A;  4ETS A;  3OHB A;  4KI0 A;  1VQG A;  2ICI A;  4A3J H;  5EKL A;  4R8U A;  4NLG A;  5IGD A;  4QW8 A;  4F4Y A;  3FEW X;  1D1K A;  2F0T A;  2X69 A;  2Z4I A;  3GO5 A;  2QEX A;  1SBB B;  2YV5 A;  2E5L L;  1VQH A;  1GHK A;  1EUC B;  4DAV A;  3QOL A;  3J80 c;  2JA5 H;  3MFI A;  1DV1 A;  4ED6 A;  5C1O A;  3VR5 A;  1HNZ L;  2WII B;  4DK1 A;  1I7N A;  3NTI A;  4DUY H;  4B3T Q;  1G29 1;  2MO1 A;  4O4I F;  4DL4 A;  3F2D A;  3M9M B;  5NUC A;  1Q86 C;  1TS4 A;  4IZ8 A;  1CZG A;  2ZT9 C;  4DV2 L;  5KFM A;  1O7Y A;  3P1H A;  1KJ9 A;  1E0B A;  4GOP A;  4PZ7 A;  4DR3 L;  4ZQ3 A;  2RSO A;  5DG7 A;  4JV0 A;  3W2D A;  1GSH A;  3C1F A;  4XT3 B;  5C3W A;  3VPC A;  4RGN A;  3T1H H;  4AH6 A;  1MIU A;  3MXN B;  1JJ2 A;  4CJ2 C;  1P8L A;  3GID A;  3V4Z A;  4OIK A;  3SHL A;  4MA0 A;  3Q1K A;  3EVQ A;  4CKC A;  2C28 A;  2J9G A;  4P2C B;  5C0X H;  4A3E H;  4HIO A;  3PIO A;  2E76 C;  1YZ6 A;  1IL8 A;  5DLF A;  3R3O A;  5E7N A;  4FF1 A;  1FNW A;  3PF4 A;  3E3X A;  3FDS A;  3R2I A;  4J9Q A;  4IUN A;  3KF8 B;  5FKA C;  4JI3 Q;  2EYH A;  1AH9 A;  5HGQ A;  3K3V A;  3J7A K;  1VQO A;  3H40 A;  3U4V A;  4RGO S;  3M4O B;  3F8N A;  5C3X A;  2XNA C;  1M1K C;  2UU9 H;  1E2Z A;  4PZ6 A;  2F4V Q;  1WVL A;  3GTJ A;  5HGT A;  5K36 H;  2K5V A;  3K59 A;  4JV5 L;  4DLK A;  3PO3 G;  1PMR A;  4DL6 A;  2LKV A;  3D4D A;  4P74 A;  2K1B A;  5A35 A;  1TWH H;  2EYL A;  1R4P B;  2PZU A;  3X3N A;  3OTO H;  1NNX A;  1K9M C;  3GTM B;  3IG0 A;  3F2C A;  4MV4 A;  1FJG Q;  3N40 P;  4C2M H;  1PV4 A;  1KC7 A;  2R82 A;  4J6H A;  1I5F A;  3EN2 A;  1A8V A;  1STH A;  4EQP A;  1VQC A;  1MHW C;  1GKH A;  1VQN A;  1N36 L;  1GUO A;  2PI2 A;  5IP7 H;  2YL2 A;  1B44 D;  1TKW B;  2IHE A;  1XNR Q;  1D5M C;  3J81 L;  2F03 A;  4IUV A;  1VQ4 A;  1G2T A;  3JRW A;  2DN8 A;  4KN4 C;  1K8M A;  1SMX A;  3FPU B;  1WTH A;  1WCM B;  4YWL A;  4DUZ L;  1I94 Q;  2RF4 A;  4RCN A;  1V1Q A;  1RJT A;  3I12 A;  4JI7 Q;  1ZET A;  1L0X B;  3GD7 A;  3OSP A;  5KT4 A;  4L63 B;  1MGS A;  3B6Y A;  1XXG A;  5H1S E;  1WTV A;  1ET9 A;  4OO1 I;  1JE4 A;  2H1E A;  5HY6 A;  1TS5 A;  4B9W A;  4DNT B;  3K8A A;  2OTL A;  1WJJ A;  1EIF A;  3U50 C;  4A3M B;  4JI0 H;  1PFM A;  1LTL A;  4J9S A;  4A3B B;  1UEB A;  5EQ0 A;  1JWS D;  3T1Y Q;  4YCU A;  1B33 N;  1B6R A;  4LF8 H;  3C46 A;  3Q23 A;  4M7E A;  5IIF A;  4HMJ A;  2B2T C;  1E24 A;  3SR1 A;  4YB8 B;  5IOD A;  1IHZ A;  3FRP B;  1LAB A;  3LP8 A;  5FOB B;  1JCK B;  4EQO A;  2N78 A;  3JAM L;  1E2V A;  2KCN A;  1QJO A;  2CCZ A;  1GGO A;  5LMU H;  2QYZ A;  5HUR A;  1IW7 D;  2YYZ A;  4K2L A;  1S72 A;  1I4H A;  4DV0 Q;  2QKI C;  2B2Y C;  1EZ8 A;  2HIV A;  5KFE A;  2M9V A;  1BDO A;  3VYT A;  4RUC A;  2NU9 B;  4KD3 A;  3HOY G;  1FGB D;  2K5Q A;  4UPA A;  4JBJ A;  3CMA A;  2JSO A;  4OEL B;  4DR1 Q;  2GA4 B;  2WKD A;  4QWA A;  3PZP A;  3KF6 B;  1Y1V A;  2F4V L;  4TV9 F;  2D9U A;  2KEC A;  1V1O A;  2B29 A;  4OXP A;  4DKA C;  1I6V C;  1ESF A;  1NUC A;  2W9C A;  4CC6 A;  4HR7 A;  4DV3 L;  1RJQ A;  2B63 A;  1J9O A;  1FJG L;  1HNW Q;  1Z6H A;  3HOZ H;  4Y7N H;  4IZO A;  3I72 A;  5JPM C;  5I9P A;  4IOA A;  2JA5 B;  1UWV A;  2SEB D;  1II3 A;  4K8I A;  4ZQI A;  4K5V A;  5LXT F;  3FKI A;  3NGD A;  1A3U A;  2HQE A;  3KHL A;  4DR5 H;  3CF5 A;  3M4I A;  1X3E A;  1NR4 A;  1S5E D;  2R93 H;  2HJW A;  3MEH A;  1KBL A;  2GVA A;  3BZC A;  4DR6 L;  1TAE A;  2EPB A;  4WBN F;  4WJW A;  5GAD C;  2IBK A;  4OIJ A;  4IFD I;  2UXD H;  2D5D A;  1PFN A;  4JCV E;  3SK6 A;  5E3F A;  3AQQ A;  2IY5 B;  1LT4 D;  1V51 A;  3TME A;  2CQY A;  4B3S Q;  1SXT A;  2IPK D;  2WB1 E;  4JI7 L;  4UCU A;  4PZ8 A;  3MWE A;  4A3L H;  4XYL B;  1GYF A;  3AFQ A;  1W2B A;  1D5Z C;  4CKB A;  5KFX A;  4LSX A;  5KT2 A;  2JA6 A;  3MJF A;  2BH2 A;  1W93 A;  2PW7 A;  3LWB A;  4QWC A;  4BXX G;  1WOC A;  4QW9 A;  4X64 L;  3WDN A;  1JWU D;  4WD3 A;  3VYR A;  4JI8 Q;  1PZJ D;  1YNN C;  2KEN A;  4ZHQ F;  5J1Z A;  2HCI A;  4DL2 A;  5IP9 G;  4JI6 Q;  4A3E B;  1SFO A;  4A3D G;  1G91 A;  1B04 A;  1Y1V G;  3IN5 A;  2BCO A;  1W6K A;  3I4M G;  2F0W A;  3FMC A;  3J81 j;  2NZ1 D;  2AQ1 B;  1VF5 C;  1HR0 H;  5DLG A;  3T1Y L;  4XZ3 B;  2I5M X;  1B7Y B;  2PCF B;  4A3F H;  2QA4 A;  3QR8 A;  1MBY A;  2B63 G;  3BDL A;  1RDP D;  4FXG C;  4APM A;  4HNU A;  2E5L H;  1ZYR C;  5IWA L;  1O7Z A;  4MV9 A;  4RGT A;  2W71 A;  4F88 A;  1K3B C;  3VPD A;  2UVU A;  2AUJ D;  3FKI G;  1O7L A;  1WR2 A;  3J81 W;  3T4A C;  2O5I C;  1IYV A;  5KG2 A;  1STE A;  4ABN A;  1XNQ H;  2XTI A;  1B50 A;  1EZ1 A;  4TQU S;  2FHT A;  4QL5 A;  5CV8 A;  2NVY B;  2PO4 A;  4DUY Q;  4RA8 A;  1GXD C;  2FK3 A;  2W8K A;  1TWH B;  4LF7 H;  3KAJ A;  4GLV B;  4L6T B;  1HXY D;  5CBA E;  4A3G H;  4DV2 H;  4I50 F;  1X56 A;  2K75 A;  1A3T A;  4ALP A;  2JA7 H;  5KT7 A;  1IYJ B;  3IL8 A;  1DGS A;  3HOU G;  2EXZ A;  4C2M B;  3L3O C;  1B6S A;  2F3V A;  4G3I A;  3FP9 A;  1LTT D;  2PZW A;  4QWB A;  2XVS A;  3K57 A;  1EYC A;  5LMN Q;  2JA6 G;  1HNW L;  3PO2 G;  5K2M A;  4RAY A;  3HXL A;  3NWT A;  3OIP A;  1JMC A;  2AMC B;  2F0O A;  1FNU A;  3VYS A;  2F3I A;  5BN5 A;  5IGB A;  3UE0 A;  5C44 H;  3GV7 B;  4LF9 H;  4C3I H;  1I3Q H;  2HT1 A;  3AMU A;  1XYI A;  2PN1 A;  1KJI A;  3GTK H;  1S68 A;  5EPK A;  1K3R A;  2UUC H;  3G7L A;  3CCE A;  2W7P A;  2MP1 A;  2R7M A;  2I5H A;  2MO0 A;  3RTX A;  3JAM W;  2RCN A;  3CQZ A;  4UCR A;  4A75 A;  1XMQ L;  5FLM G;  1U4L A;  2LXJ A;  4LH6 A;  1LM0 A;  3J80 L;  2UXB L;  1SNC A;  4GC6 A;  2XRS D;  1HUN A;  1VQA A;  5JUM A;  4LNQ A;  3RUZ A;  4B3S L;  3R8B A;  3EIV A;  4X3T A;  4RHS A;  4ZI7 F;  2K5N A;  3N6R A;  3VR2 A;  3GTP A;  1BCP C;  1JJG A;  2CW8 A;  5DG9 A;  4GNX A;  5KFQ A;  2Q8R E;  2Y0S A;  2HHH Q;  2B2W A;  3N41 B;  3C3L A;  1CQJ B;  3AFP A;  2ZDQ A;  2O4X A;  1LV9 A;  2OXP A;  4K14 A;  1CQI B;  1UC9 A;  1L1O A;  1I4Q A;  1B9N A;  1S97 A;  1BCP D;  1FGU A;  4OO1 H;  4NXN Q;  5ISR A;  3VPB A;  2L12 A;  3N43 B;  2A6E C;  1M0T A;  2CVR A;  2D2C C;  5I6W A;  2FFK B;  5T1I A;  4HMI A;  1TWA H;  1SCU B;  3A8K E;  1YHB A;  1SEB D;  5D3I B;  2F0U A;  5AJ3 Q;  2A1A A;  4LF4 H;  5CBE E;  3H94 A;  1HQR D;  3I7F A;  2IHF A;  3VMM A;  2JEF A;  4NDX A;  2LFN A;  4DV1 Q;  2I8C A;  3T5H A;  2LMC B;  2NUC A;  3U9S A;  2ZJQ A;  3TQT A;  3JC6 6;  1E4G T;  1JKJ B;  1RTO A;  1JDB B;  5GAH C;  1Z2P X;  4PMB A;  5IYB G;  3IFT A;  2G5D A;  1HZC A;  3E9I A;  3K5N A;  2YRW A;  2AQ3 B;  4B3T H;  3ZJY C;  5E4W C;  2NVX H;  4A3C H;  4DUY L;  1FKA H;  2SNM A;  3A74 A;  4ECU A;  2WB1 B;  1F9Q A;  2KCC A;  4M8A A;  2QEJ C;  3WO0 A;  1I50 B;  1B8A A;  1QNU A;  2QK4 A;  4ECZ A;  3HS0 C;  4H02 A;  3HOZ B;  1EUD B;  3NXW A;  1EYG A;  5FO9 B;  4J9R A;  1SYD A;  5KFJ A;  3V6H A;  4N9T A;  1Z7T A;  3Q24 A;  2E2H H;  5EAY A;  5I4D A;  2Y0S G;  1K0R A;  4DV4 Q;  4J9O A;  3GV5 B;  1PRT D;  1F2M A;  1C0A A;  2R93 B;  3LML A;  4IN3 A;  4IO9 A;  4YP3 A;  3GLK A;  2A8V A;  5C4X B;  5GAE C;  4U6P A;  3PO3 H;  2DJG C;  3GTG A;  2AWO A;  1RKN A;  3BVM A;  3BJU A;  1D1I A;  2W9A A;  1A2U A;  3AB9 A;  2E2J H;  2ALY B;  2IX3 A;  1QE6 A;  3PW0 A;  2I07 B;  4X3K A;  4ED8 A;  5CC4 A;  3GP7 A;  2BDO A;  3FPP A;  1MSG A;  3D0F A;  2BOS A;  4R4I A;  3U9O A;  1OWT A;  3STB C;  1RK6 A;  3ERS X;  5DQH A;  2WYO A;  1PRT F;  4JI3 H;  1TA8 A;  4IFD H;  4C5A A;  2UUB Q;  1W6J A;  3HOV G;  3J7Y W;  4EX5 A;  5C3E G;  4AYB A;  3STB D;  2R8K A;  2UUA Q;  2F1M A;  1PA6 A;  5D1P A;  4YJ2 F;  3I90 A;  5KFY A;  4O4H F;  3PW2 A;  2I5L X;  2HHH L;  2H4O A;  1F9S A;  1Y1W A;  4LK1 C;  3X3M A;  4EG0 A;  3S14 H;  2MQH A;  2UU9 L;  2BQ3 A;  4FS2 A;  4LUV A;  4HAE A;  4NXN L;  3Q8Q B;  4A3F B;  4O42 A;  4E6I A;  1EWH A;  1ZXT A;  1B53 A;  3OTO L;  1VQB A;  2A69 C;  4L5S A;  5DM6 3;  1BXR A;  1VCI A;  4EQ5 A;  2O5J C;  5EWG A;  2IL8 A;  3S1Q B;  4K0K Q;  5F9L A;  1TWG A;  3RJ0 A;  1BOS A;  4DV6 Q;  5C0X I;  2VW9 A;  2R92 A;  4F50 A;  2A69 D;  2BDN A;  5KFD A;  4JV2 A;  2KA7 A;  4IPC A;  4R4Q A;  3TEH B;  2PMZ A;  3RBD A;  3PN1 A;  2FMC A;  4R1J A;  2CH4 W;  2EE1 A;  1QZH A;  2ZDH A;  3ETH A;  1XNR H;  1XTC D;  5COY A;  4RUA A;  2XC9 A;  3J80 W;  1G6P A;  1Q8I A;  1LTB D;  4RU9 A;  1MJE A;  2JA7 B;  3QOJ A;  4DAM A;  3HOX B;  3OWE B;  1I94 H;  1MSH A;  4B08 A;  4QUC A;  3MXG A;  4Q8F A;  5KG5 A;  1LT6 D;  5ELD A;  1T5E A;  2VB2 X;  3PV0 A;  4O3Q A;  1ESR A;  4ECT A;  3IRB A;  3GIQ A;  3HOY H;  1PVO A;  1X55 A;  2LY7 A;  4AYB G;  1S40 A;  1N34 Q;  1IKM A;  2F0S A;  1C48 A;  2ZJP A;  1B2T A;  4LAA A;  2QW7 A;  5C44 B;  4C3I B;  1I3Q B;  4A3I B;  5KFU A;  4YR3 A;  2E2I A;  5M5W H;  1E4E A;  3GTK B;  1Y1W G;  1IL2 A;  3GDE A;  4QMG A;  3M7G A;  4JI0 L;  3S16 H;  4FF2 A;  1KAA A;  2C5C A;  1E3P A;  2G9D A;  3E5S A;  4QJF A;  2FPI B;  1UAP A;  2SOB A;  2VZA A;  2R8J A;  2N8N A;  3RIZ A;  3CXC A;  4B3M Q;  4YIJ A;  4YJ3 F;  4GNX C;  4DV0 H;  5K5P A;  3LWE A;  5LMU L;  1SYF A;  2VQF Q;  2R92 G;  5FLX c;  2R87 A;  4C3J H;  1FVI A;  4IOC A;  2WAQ A;  3NK9 A;  2NU7 B;  1SSO A;  1GSO A;  1H95 A;  1BNC A;  4ECX A;  3HOW G;  3RV4 A;  5L1I A;  4DR1 H;  3SI8 A;  1O78 A;  3DWQ A;  5M3M G;  2K5W A;  3NTH A;  2R7K A;  1DOL A;  4J15 A;  1MZB A;  3N44 B;  5KFH A;  1TWA B;  4A93 B;  3BAA A;  4RMF A;  4B3R Q;  4IAJ A;  4J9N A;  1EY6 A;  1D7Q A;  3R93 A;  2YS7 A;  1RF2 D;  3I4N G;  1HNW H;  2PQA B;  1BBU A;  1YIJ A;  4K2K A;  4ECW A;  3TP8 A;  4JUZ A;  1RYS A;  3I56 A;  2Q2U A;  1KHI A;  2VUG A;  4KHZ A;  1M90 C;  4K0K L;  1JIC A;  4DV6 L;  3FVQ A;  2Z9H A;  4A3D H;  3KJO A;  3I4M H;  4HYK A;  4YCV A;  2NVX B;  1XPU A;  4LF9 Q;  4ZUJ A;  4DR5 L;  3LGJ A;  3SVM A;  1Y8O B;  1SR3 A;  2R7Z A;  3CU7 A;  1MKH A;  3M9B A;  5IYD G;  2JXM B;  3D6W A;  1XWE A;  2YRX A;  3L7Z C;  1MI2 A;  3KDF A;  4KY6 A;  1DZ1 A;  4JK1 C;  4BBS B;  4B3S H;  1Q82 C;  2B3G A;  2IT1 A;  4BA1 I;  5M5X H;  5I2Y A;  1QCB D;  2E2H B;  1CT1 D;  2WAQ G;  1K73 C;  5KYI A;  1EWI A;  4JI8 H;  3I4O A;  5DGB A;  3A5Z B;  1DIK A;  1VS0 A;  2VUM H;  5IYC G;  4BY7 G;  4JI6 H;  3TII A;  4WOR A;  4BA2 I;  3LX0 A;  4RAU C;  4JG2 A;  5JJL A;  5ELE A;  1XTD A;  3HOU H;  4ED1 A;  3NUC A;  1X54 A;  3R5F A;  4GC7 A;  4LSA A;  1EOV A;  1HR0 L;  3I55 A;  2IX0 A;  4H7B A;  2R85 A;  3VDY A;  1QWY A;  3TSS A;  1A3V A;  5G3L D;  4LF4 Q;  3PO2 H;  4V0B A;  2O2L D;  2W6O A;  1KXL A;  2FLL A;  4GKK Q;  3KAK A;  1CKN B;  2WTF A;  3UE1 A;  3S15 H;  1X3G A;  1SFO H;  3DMU A;  1STG A;  3SDZ A;  5CYU A;  2RSN A;  3CCJ A;  1GJX A;  4KLK A;  3H0G A;  4ZCK A;  4BWS C;  2ALZ A;  3D6C A;  4ECR A;  1B3A A;  4I7H A;  2ZTE A;  1D6E C;  3NPP A;  3AEV A;  3S14 B;  1PX2 A;  1XNQ L;  2R7Z G;  2OLS A;  3WOE A;  3KFU A;  1DOK A;  5G3L F;  1CQV A;  1ASY A;  4LF7 L;  3BAB A;  1J5E Q;  1IBM Q;  3H3V C;  2MUY A;  4RB1 A;  5KX5 F;  1CSQ A;  2OQK A;  1VF7 A;  1A6X A;  4MV7 A;  3EPG A;  2ASJ A;  4C3H G;  3OYY A;  5LMN H;  4DK0 A;  2PBZ A;  4G7Z C;  2C2D A;  5DEH A;  2K28 A;  3A54 A;  1SAP A;  5CGK A;  5JEA J;  5EGT A;  3CHB D;  3J7A V;  4NXM Q;  2OH2 A;  3MTS A;  2WFW A;  3TP6 A;  4HQ6 A;  1G6Z A;  2NTS A;  2F0M A;  4RG1 A;  3VA7 A;  5FPO A;  2KOL A;  4U7C A;  2W9B A;  1K83 A;  5D8D A;  4LJZ C;  1TWF H;  1ENC A;  4P72 A;  2L5T A;  3DEO A;  2VQD A;  4LF9 L;  1AN8 A;  1HZ9 A;  2ENB A;  3RZO H;  4F4X A;  3EQL C;  1U5K A;  1ZEQ X;  2UUC L;  2IA6 A;  2B8F A;  5E1F A;  3CME A;  1VKZ A;  4N8F A;  1C8C A;  2ASB A;  3ERQ A;  2ZM6 Q;  4P75 A;  1AUX A;  3HOY B;  3OHX C;  4Y52 H;  3Q8S B;  1L0Y B;  1JQY D;  1XPO A;  2XGT A;  2DUD A;  5M3F B;  2MCT A;  2ZDG A;  2A68 C;  2Z1C A;  2HHH H;  1UC8 A;  5DQG A;  1STA A;  3H0G G;  4DV5 Q;  5M5W B;  1BBX C;  4O3R A;  4JBM A;  1HZB A;  1TS2 A;  1I6U A;  1SE3 A;  2A68 D;  1SYB A;  3CQZ H;  3SEB A;  1ZKO A;  3A7A B;  3S24 A;  3S2H B;  1RCV D;  4NXN H;  1E1O A;  2F0F A;  3F8T A;  3CCQ A;  1GUS A;  1U9R A;  4ZKC B;  4POG A;  1SYC A;  2JA8 H;  1JE5 A;  4ZLT F;  3MXP A;  3HKZ G;  1BO0 A;  1KLG D;  2B2V A;  5D65 A;  2XCP A;  4OL7 A;  4QGU A;  3GTL B;  3MZ5 A;  3GTP H;  4DV1 H;  1SYX B;  4HN7 A;  4LF4 L;  3OWF A;  1BCP B;  4EGV A;  4C3J B;  2BQR A;  2JEG A;  3RLN A;  2F0K A;  4CDE C;  1EHI A;  3QFF A;  3E6Z X;  4GKJ Q;  1X6O A;  2L9H A;  4F87 A;  2P5Z X;  4B9X A;  1YJ9 A;  4ED0 A;  5LYJ F;  3MXN A;  3I4L A;  5KND A;  5GQO A;  3PR5 B;  2UVW A;  3Q0A A;  1WTX A;  3E0J A;  4B3T L;  4BY1 B;  3BQ0 A;  2MJ8 A;  1X3F A;  2ZTD A;  2RDJ A;  3W3A A;  2EQS A;  1ZHQ A;  3BS1 A;  2J7Z A;  4EFE A;  4XTC S;  2OCE A;  4BS9 A;  3GII A;  4C1N K;  2E74 C;  2B2U A;  1T9H A;  1PZK D;  3CAM A;  1ONL A;  1KRS A;  2RHS B;  1HCZ A;  5C3E H;  5EPJ A;  2CWA A;  4ZK9 B;  3S1R H;  1IYU A;  1UE6 A;  1I4R A;  3KF8 A;  3GIP A;  5LL6 S;  4DV4 H;  2KSW A;  3GV8 B;  3ERO A;  3F2B A;  1M8A A;  3I4M B;  4FXD A;  1F2L A;  5D1O A;  4NXM L;  5KGU A;  5IT9 E;  4GS3 A;  4PWQ A;  3QB3 A;  1H9J A;  4WJ3 M;  3D4R A;  3CCU A;  2BA1 A;  5KFI A;  1HR0 W;  4A76 A;  2F0E A;  5C1P A;  4O2A F;  1AW7 A;  5M9O A;  3WNZ A;  4H13 C;  5KEE A;  5IT9 c;  3S1N B;  4UDU C;  4FO2 A;  1IW7 C;  1K8A C;  2YU9 B;  3GTM A;  5M5X B;  3V05 A;  1PYB A;  2N88 A;  4DR7 Q;  5KFS A;  3E9H A;  1GSA A;  2YS6 A;  5KFO A;  2ZTC A;  2UUB H;  2E75 C;  1Q8K A;  2OQ0 A;  1TWC H;  3EJI A;  3DM3 A;  4QIW E;  3VR4 A;  1JOQ A;  5LL6 b;  3A0J A;  4O1N A;  1VBH A;  1YJN A;  4JI3 L;  2C2R A;  1ROD A;  2UUA H;  3GTG H;  4ZRZ A;  4PV1 C;  2NN6 G;  4BBR H;  2VUM B;  4QUF A;  1WSC A;  2ID0 A;  2Q8I B;  4GLX A;  1C4Q A;  4Q8E A;  1Q90 A;  3PCO B;  3GV3 A;  2RDH A;  3A55 A;  4FVM A;  4IJL A;  4QIW A;  3N52 A;  3T5L A;  1X9N A;  4YR0 A;  4YAJ B;  2IW3 A;  2WIN B;  4R9W A;  4JYA Q;  4KTA A;  4KKS A;  3BZK A;  1GUN A;  1WCM A;  3RF2 A;  3G6V A;  3DXJ C;  2NZH A;  2K33 A;  4L5Q A;  3PIP A;  1VQL A;  1PTO F;  4A3J B;  3PVX A;  2I87 A;  2W6M A;  4JI4 Q;  4WJ4 A;  1PYS B;  3FDT A;  1SEI A;  3RFC A;  5IY0 A;  4FM9 A;  2JJQ A;  4LW1 A;  1KRT A;  5I47 A;  4K0K H;  1AE3 A;  4XYQ A;  4DV6 H;  1F9R A;  1CQF A;  4MTN A;  3A7L A;  1WH2 A;  1HRJ A;  2ZXP A;  1Y1W H;  1JIH A;  3G6E A;  4MA5 A;  1N48 A;  2A73 B;  3GQC A;  2HIX A;  2AGO A;  3GTO H;  2KBN A;  4LFA Q;  1I4G A;  3DLL A;  1KIX A;  1XNR L;  3PW7 A;  3V6J A;  1EYA A;  1HTP A;  3TBI B;  4GOP C;  4Z9C B;  1QG7 A;  3ND9 A;  3E0E A;  3H3V H;  5FLX L;  3ITP A;  5T1G A;  1I94 L;  1G8Z D;  3WOF A;  4YY3 H;  1AFP A;  1TWG H;  2PVP A;  2R92 H;  2PNH A;  3BYY B;  1L2F A;  1KEE A;  3CRL C;  4DV7 Q;  2SNS A;  4RHR A;  4A3K H;  1N34 H;  3T5J A;  2XD4 A;  4DAY B;  5J2T F;  3OHA A;  2DY7 A;  2EDG A;  4FS1 A;  5M3M H;  2RBM A;  1AEX A;  3M4P A;  4FBU A;  1TWF B;  1M7J A;  5BPH A;  2RDG A;  4NMZ A;  3L0O A;  4UHV A;  4XYO A;  3RZO B;  3KHH A;  3MXU A;  2JE6 I;  1L2Z A;  4IR1 A;  3KF6 A;  1Z2N X;  3PSI A;  1N32 Q;  2R8H A;  1WCM G;  1YBY A;  3RB0 A;  3NBH A;  3I4N H;  1WI5 A;  1Q12 A;  2FMM A;  1Y14 B;  1JDE A;  3BJY A;  1I6H H;  3AYH B;  2IWH A;  2M2L A;  4Q44 A;  3TP5 A;  2XSC A;  1RJR A;  2AWN A;  3NQI A;  4HED A;  3KLS A;  4B3M H;  2WP8 J;  3KK7 A;  3NTK A;  4ZYS A;  4IAL A;  2JK8 A;  1XMO Q;  2VQF H;  4IRD A;  2E2I H;  1XDN A;  2JA5 A;  3CPW A;  3MR3 A;  1CZW A;  2W6P A;  4X3U A;  4DV0 L;  3Q8P B;  5FK9 C;  2IP4 A;  3UQ8 A;  1PH2 A;  2D0P A;  2DGY A;  2Z6B A;  4C1N I;  3ORQ A;  2M00 A;  5KKN B;  5DQI A;  4EYI B;  1EFW A;  2LXK A;  4A3B G;  3ORR A;  2MHV A;  4DR1 L;  2XWJ B;  4IJH A;  2KEE A;  1QOH A;  2JA8 B;  4I65 A;  5EDW A;  4B3R H;  1R9T H;  4HJ5 A;  1ASZ A;  4DN4 M;  4IPD A;  2LS0 1;  5JEA G;  4UP8 A;  1OTC A;  4PDB A;  4NPS A;  2BE5 D;  1HPC A;  4JI2 Q;  4UCV A;  1PXU A;  1NMF A;  4M9U A;  4CDC C;  1CHQ D;  4YBZ B;  2JEJ A;  4OX9 Q;  5IYC H;  2EYF A;  2AQ2 B;  3W1B A;  1BJT A;  1CUK A;  4XQQ A;  5C4H A;  1UE7 A;  1T36 A;  1K8G A;  3J7A 5;  3I73 A;  2UXC Q;  1CHP D;  1BUV T;  5JPN C;  5FO7 B;  4CKE A;  5A2Q L;  1DD2 A;  4QIW B;  1NAP A;  3PR4 A;  2K52 A;  4Q0F A;  1PDQ A;  4HSV A;  3K5H A;  4RWS C;  5EKI A;  3HEJ A;  4OWT B;  3PMF A;  3GTQ H;  2R8G A;  5JJZ A;  2WAQ E;  2JA5 G;  4FDB A;  2EXD A;  2AKW B;  4ECY A;  1EL0 A;  1B4O A;  4PG3 A;  5BR8 H;  2QDL A;  1QUQ B;  1OXT A;  3KOJ A;  4KD4 A;  1W96 A;  2SDF A;  2ES2 A;  2EIF A;  4YHH H;  4JI8 L;  1KLU D;  3M7N A;  2NVY A;  3BYT B;  4JI6 L;  2SCU B;  3RGZ A;  4ZAI A;  2KCM A;  4TRD A;  4X66 Q;  1GM5 A;  5ELF A;  2Z4H A;  2EY6 A;  4FBT A;  1EIH A;  4P71 A;  5ELC A;  4CBV A;  1N32 L;  4C2M A;  3D31 A;  1ENF A;  5EZY F;  3P75 A;  1IBL Q;  2DNC A;  1TWC B;  2VA2 A;  3T56 B;  5KFW A;  4GKK H;  1UE1 A;  1PH7 A;  2YTX A;  5IGE A;  2FJ2 A;  4LFB Q;  4C5C A;  2D62 A;  1S4Z A;  3RD4 A;  3GTG B;  1OXS C;  3TIN A;  5HBR B;  1CK1 A;  2G9H D;  4BBR B;  1CS0 A;  4NB3 A;  3VR3 A;  4MN3 A;  2N3S A;  1TS3 A;  2L55 A;  4A3E G;  3NSW A;  3V96 A;  5JJI A;  4RNN A;  4N8X 1;  3M85 A;  3G6Y A;  1GUT A;  1E7Z A;  5LA6 F;  1FNV A;  2J4X A;  1J5E H;  1IBM H;  1U0L A;  3UDI A;  5J2U F;  3V4S A;  1EWC A;  1SRO A;  3E5N A;  3HFZ B;  2L0C A;  2BA0 A;  2VY3 A;  3I2Z A;  4C56 C;  4DGZ A;  4F8M A;  4Y7N B;  1T94 A;  1WTR A;  1PRT C;  2OT2 A;  3H0G H;  4Q45 A;  1WYD A;  3SK5 A;  2M05 A;  5LMN L;  4O3N A;  4NXM H;  2K01 A;  1E22 A;  3RZD H;  2WAC A;  4RKB A;  3GTO B;  2KUM A;  1CKM A;  1EU3 A;  2F0J A;  2FP4 B;  4PMC A;  4HJ9 A;  5K36 G;  1WFQ A;  4KHP Q;  4OWX B;  3EPI A;  2VXW A;  1FL0 A;  5DAU A;  4L8J A;  1RYR A;  4LFC Q;  3S2D H;  1F2Y A;  1JOR A;  4L1K A;  3SXH A;  1O75 A;  2YZM A;  3I70 A;  3HBL A;  2VPS A;  3K7U C;  1M0W A;  2ZM6 H;  3KTM A;  2J6T A;  3EBE A;  3HB9 A;  2VQE H;  4A3K B;  3M9O B;  2R61 A;  4O2D A;  1B3Q A;  3TN2 A;  2HCC A;  1LT3 D;  2Z8L A;  3MHB A;  3FMA A;  3R23 A;  2QDB A;  4I4T F;  1K83 H;  1YHQ A;  5KFV A;  3RB6 A;  4DV5 H;  3M9N B;  5IP7 G;  3MR6 A;  5DG8 A;  3GV6 A;  3A8I E;  3KLW A;  1Z2O X;  2Z6K A;  3A8J E;  1SNO A;  4YWM A;  2RGV A;  2WB1 A;  1I6H B;  4RAZ A;  4MV6 A;  2K7V A;  1I50 A;  4UCO A;  2R84 A;  1EQV A;  1U4M A;  2JEB I;  4MZ9 A;  5M5Y H;  5AJ3 L;  3G4S A;  2JEA I;  4IUU A;  5EKK A;  2JP1 A;  4WRD A;  2AHO B;  2PW5 A;  1T5X D;  1TVX A;  1SJH D;  4OHJ A;  4DV1 L;  4GKJ H;  1A62 A;  2C35 B;  4IRK A;  1F9P A;  1G2S A;  4ZUI A;  3GTJ H;  1JWM D;  2XWB B;  4A4I A;  2K32 A;  1ENA A;  3IKJ A;  5IT9 L;  5JAV A;  2WE6 A;  1NE3 A;  2NTT A;  3EYY A;  3DWA A;  4A3G B;  5A2Q W;  1UNS A;  3PUV A;  4J9M A;  4J8Q A;  4CJ0 B;  1R9T B;  1QIL A;  4FYD A;  1GUW A;  3K58 A;  1F77 A;  1H9S A;  3SK4 A;  5AFW A;  2W7O A;  5KRU A;  1V1P B;  5GRO A;  4PQX A;  1EQT A;  2VOB A;  1AZQ A;  1S9F A;  1CFM A;  2F0P A;  1EY5 A;  2F0I A;  4YY3 Q;  1I4X A;  1Q46 A;  2CFM A;  3K5M A;  1KAB A;  4HSP A;  3C1E A;  4KN7 C;  2AU0 A;  3EFX D;  2NN6 H;  3I8Z A;  3GIJ A;  1B1Z A;  4K8J A;  1SLJ A;  3PIO 3;  3HKS A;  5I6Y A;  4YCW A;  1ML0 D;  5KG6 A;  2VA3 A;  2R7N A;  2C2E A;  1ZHS A;  2J6S A;  4DV4 L;  2CZG A;  4DR2 Q;  4QWE A;  3M4Y A;  5ELB A;  3CRK C;  2EVB A;  3NE5 B;  3NQT A;  4XXE A;  4K5W A;  4EGJ A;  1RJP A;  1YNX A;  4KHP L;  4QF4 A;  2WB1 G;  4UAI A;  1VQE A;  1IZ6 A;  3P7J A;  2GN5 A;  5FLX E;  5CV5 A;  4P73 A;  2K5H A;  4DR7 H;  1ET6 A;  1KDC A;  1AP0 A;  1ICW A;  3HOZ G;  1AUV A;  2FK2 A;  1B70 B;  4RCO A;  2A74 C;  2VS1 A;  3GTQ B;  2YZN A;  5C8Y F;  4KMU C;  2WDT A;  1V8Q A;  3HG9 A;  4ME5 A;  2XGP A;  1EOT A;  2B2W C;  3OSN A;  3M4O H;  1N33 H;  2UUB L;  3KBG A;  3T16 A;  3MWM A;  1L1O C;  1KTK A;  2PI2 E;  2EYP A;  4TVA B;  2FMA A;  3KLR A;  4RB0 A;  5KG4 A;  2UUA L;  4RB3 C;  5KFR A;  2HQL A;  3H6M A;  1X32 A;  4PNY A;  5C4X G;  1KAW A;  3S9W A;  3L4J A;  3TP7 A;  2QIL A;  2B8G A;  3W1G A;  1IOW A;  4JYA H;  1X3Q A;  3ND8 A;  4R4C A;  3BG3 A;  2L15 A;  3GTM H;  4EVO A;  5BPF A;  3AU7 A;  3SE7 A;  3BVZ A;  3QJY A;  4HCS A;  4AQY Q;  4JI4 H;  1Y8N B;  4EQN A;  5LMN W;  2R86 A;  1E1T A;  4KJO A;  1HNZ Q;  5KFA A;  3K7A H;  1ILQ A;  4BXX H;  4DR4 H;  4FU0 A;  4N9P A;  4CC5 A;  2KHI A;  3JSL A;  4RNM A;  1K28 A;  1YNJ D;  3V2T A;  2YCH A;  2OF1 A;  5IP9 H;  2KJX A;  1Y1V H;  4R8I A;  4UCS A;  1PH1 A;  1PH8 A;  1I3Q A;  3V6K A;  5F9N A;  1TII D;  4LFA H;  3GTK A;  4ED2 A;  2V1C C;  2OTJ A;  1O7I A;  1U4P A;  3GQB A;  4DR3 Q;  3U4Z A;  2DZD A;  2HVS A;  3RLO A;  1M6V A;  4LF5 H;  4R8U B;  2B63 H;  1IOV A;  5C6A A;  1IKL A;  4A3F G;  1WTP A;  1Y69 U;  3WO1 A;  4RZR A;  5EWE A;  4L5R C;  4OON A;  5FPR A;  3QWN A;  2AQ4 A;  2LSS A;  3NWS A;  2J0T D;  1XX8 A;  3FKI H;  3J81 i;  1RTN A;  1C7Y A;  2OEO A;  4YY3 L;  4DV7 H;  3RR5 A;  3K5L A;  3K5I A;  1DV2 A;  1ICF B;  2PNR C;  3CCV A;  4LF6 H;  4POF A;  2E2D C;  5L1K A;  2UVV A;  1JLL B;  3PF5 A;  4LH7 A;  4QB4 A;  5J3B A;  5BR8 Q;  1CTM A;  1N34 L;  4A3B H;  3PO3 B;  4HIK A;  3UDX A;  3RB3 A;  1KJQ A;  1B9M A;  1UNN C;  4I7A A;  1PLF A;  4YHH Q;  2E2J B;  2F3W A;  4GOP B;  3PUW A;  4XX0 B;  2VPQ A;  1ILP A;  1N32 H;  1C30 A;  1S0N A;  2B2T A;  1SN8 A;  2F52 A;  5EJW A;  5JEA H;  3HOX G;  2JA7 G;  2HVQ A;  4RZQ A;  5CA1 F;  2TSS A;  1DCZ A;  1NSN S;  1R4Q B;  1Q7Y C;  1J8I A;  5A2Q E;  1KNA A;  5C5L A;  2FJZ A;  2JA6 H;  5DGA A;  2VNU D;  4DL7 A;  2PQA A;  3D4W A;  1QVG A;  1XMO H;  1X65 A;  5CR3 A;  2B2Y A;  4B3M L;  5IT9 W;  4UCT A;  1LYL A;  3RUP A;  2VQF L;  1VQM A;  3TRZ A;  5C44 G;  2Z6K C;  4C3I G;  3H3V I;  4A3I G;  2FLP A;  4BWG B;  3OUZ A;  4DF7 A;  1QNK A;  5FLM H;  1V9P A;  2F0Q A;  2MNA A;  1KJ8 A;  3GIL A;  3KLS X;  3CCM A;  4JI1 H;  4CGY B;  4DK3 C;  1HTL D;  4X3S A;  1RD9 D;  4OEM B;  3DUZ A;  5E4X A;  1IBK H;  3MWY W;  1UUP A;  5M5Y B;  3HKZ A;  1N36 Q;  5I9O A;  3K6O A;  1H9M A;  3URY A;  4B3R L;  1FR3 A;  4AQY L;  4JI2 H;  4IRC A;  3TZU A;  2J6U A;  2E2H A;  5C5M A;  1OXV A;  4OX9 H;  3BQ2 A;  4WFN 3;  3GTJ B;  3OSO A;  4K6D A;  4F7X A;  3ZYY X;  3H4B A;  2FE3 A;  2CHB D;  4DUZ Q;  2EY5 A;  2DIK A;  3ETJ A;  4OO1 G;  2UXC H;  1J6Q A;  1HNX H;  1NCV A;  3OW2 A;  4XIG S;  4ODG A;  2W6Z A;  3J7Z C;  4A93 G;  4FF3 A;  2XCL A;  1HQM C;  1SE4 A;  3H4D A;  1BR9 A;  2D0O A;  4FF4 A;  1VQD A;  4F4Z A;  3OMC A;  1LTA D;  2N49 A;  3SK8 A;  2VQE Q;  1VQ6 A;  3O13 A;  3TIG A;  5IYB H;  2EYO A;  3U58 A;  2ATL A;  1CKN A;  1LTS D;  2FKL A;  1I4P A;  3RAX A;  4MIU A;  1Z9F A;  4YR2 A;  4X65 Q;  2HDM A;  3CC2 A;  5BR8 L;  5FJ8 G;  1CA6 A;  3Q8D A;  2K03 A;  4FXK C;  2FK1 A;  2W8L A;  3S16 B;  4A3C G;  3NP8 A;  1SDF A;  4O3P A;  3K80 C;  2VL6 A;  4X66 H;  2N55 A;  4LMQ D;  4YHH L;  2EJG C;  3CP0 A;  3OOC A;  4H44 C;  4ULL A;  4DA2 A;  3OIQ A;  5FO8 B;  2NU8 B;  3PW4 A;  1VMC A;  4DFA A;  1PH6 A;  1H9K A;  1O80 A;  1CM9 A;  1SYG A;  2L4N A;  4BBS G;  1IBL H;  3L4K A;  4RH6 A;  2EZV A;  2K4K A;  3WWV A;  2X6G A;  4IUR A;  2DLN A;  5D1O B;  2CW0 C;  4LFB H;  2RCF A;  2C22 A;  2IMW P;  3ER0 A;  4E4T A;  5EBC A;  3RLF A;  1PH3 A;  2NBF A;  2RVL A;  5JJK A;  4GKK L;  2QGQ A;  4XQN A;  5EBD A;  4G7O C;  2BQU A;  2HVR A;  3NHH A;  3RV3 A;  2CW0 D;  3HZX A;  1K1Q A;  2NVY H;  4EBD A;  2ASD A;  1YHA A;  1K0S A;  1PFB A;  1VQI A;  2R7F A;  2DWC A;  4DV3 Q;  1EY8 A;  1NMG A;  4HJ7 A;  2C00 A;  1HHV A;  3BA9 A;  4UP9 A;  3CW2 C;  1SNQ A;  2F0H A;  4ED3 A;  5KIX A;  5C0X J;  3SE0 A;  4O4L F;  1J5E L;  1IBM L;  3K7A B;  4G7H C;  1HFG A;  2GVB A;  2MFI A;  3HOV H;  3S17 H;  1JB3 A;  4IFD G;  1VQP A;  5JVL A;  5CMD A;  2CQA A;  4ED7 A;  1Q1B A;  4DR6 Q;  5DM7 3;  4MV8 A;  2BH8 A;  1YIT A;  3MR2 A;  2KCT A;  2Y0S E;  4A3D B;  1Y1V B;  1OXX K;  3P20 A;  3EA6 A;  2YTV A;  4LUZ A;  3G71 A;  4CHT B;  4J9L A;  4HIM A;  3PGZ A;  4YQW A;  3DHQ A;  1HA5 A;  1ULZ A;  5IGC A;  1HA6 A;  3T5K A;  1BBW A;  5L1L A;  2W9C B;  4KHP H;  4HR7 B;  1UEA B;  2B63 B;  4LFC H;  3H20 A;  2C9O A;  4GN3 B;  3NEM A;  2NYZ D;  3ULJ A;  1PTO C;  1Z47 A;  5F2D A;  4JBK A;  5KFL A;  1SNP A;  4CJ1 B;  1PRT B;  3OW7 A;  4X64 Q;  1NTG A;  3FKI B;  4DNR B;  3PW5 A;  2RQX A;  1EEI D;  4JVZ A;  3R5H A;  3GTL A;  3D8G A;  2ZM6 L;  1HFN A;  3RMH A;  2RGR A;  1PTO D;  2CWP A;  1SND A;  3TRE A;  5KT5 A;  2VQE L;  5KFF A;  1N33 Q;  1U4R A;  1JXL A;  3MFG A;  1JB7 A;  4TQR A;  1TT2 A;  4XDX A;  1VQJ A;  4JW0 A;  1KC8 C;  5IE8 A;  2IX1 A;  3MR5 A;  1KL9 A;  3J80 i;  3Q22 A;  4Q43 A;  1EIG A;  5EOY A;  4DV5 L;  2Q8T A;  4X65 L;  1GOZ A;  1QZG A;  2P0A A;  2Q2T A;  4HTH A;  3T53 B;  3HOU B;  4X6A H;  3D3R A;  5IWA Q;  3MA2 B;  1VQ8 A;  2F0G A;  1RL2 A;  1BF4 A;  5KT3 A;  4LUO A;  1EFI D;  1DM0 B;  2JA6 B;  5T14 A;  1BGW A;  3PO2 B;  2FLN A;  2RA4 A;  2X6L A;  3CCR A;  1QVF A;  2QCP X;  4O3S A;  4MTE A;  4MNO A;  3PUY A;  4Y8V B;  3HP3 A;  2W70 A;  4DR4 Q;  4U68 A;  3S15 B;  1GLV A;  2FPP B;  2JN4 A;  1SFO B;  5M3F G;  2R6G A;  1EYZ A;  2TMP A;  2I46 A;  4HCE A;  4ECS A;  5I2X A;  4MAM A;  1EQQ A;  4GKJ L;  2L11 A;  3MWD A;  4TUY F;  5JH7 F;  3Q8R B;  1MJC A;  4R7R A;  1BVS A;  3NBH B;  2CH4 A;  5L9X A;  1WTO A;  5J22 A;  1I50 H;  4LF5 Q;  2ZXR A;  2DNE A;  1STY A;  3RN2 A;  1D8L A;  3BDC A;  2YU9 A;  1NBW A;  5LHY 1;  1NJI C;  1T3N A;  1BQQ T;  3KHG A;  2O03 A;  1L0W A;  5FD5 A;  4C3J G;  3I3C A;  4AYB E;  5KNC A;  1GVP A;  4LF6 Q;  3HOW H;  5C4X H;  1SE8 A;  1K8O A;  3G6J B;  4RKL A;  4DR2 H;  1XMQ Q;  2VUM A;  3QG1 A;  4Q0Y A;  3CC7 A;  1EY0 A;  4ID6 A;  2ZJR A;  2UXB Q;  2WV6 D;  5IYZ F;  4IUP A;  3UI2 A;  4BY1 G;  4JI5 Q;  4XYM B;  3T51 B;  1JR0 D;  2A19 A;  3LNN A;  5KFN A;  2EJF C;  1HUM A;  5JVG 3;  5CV7 A;  4EEQ A;  1TQO A;  2ZJT A;  5EPL A;  1A2T A;  4X62 H;  4DR7 L;  5L37 A;  4KHV A;  1HZA A;  2K14 A;  3MVV A;  4EYH B;  2JQO A;  1FYC A;  2KVM A;  1DON A;  2PMZ E;  4GZY C;  3QZ7 A;  1N33 L;  2GLT A;  4YAK B;  3CQZ B;  2W57 A;  2EY2 A;  1YNN D;  2EY1 A;  4A3M G;  3CD6 A;  4QCL A;  1PFS A;  1E2W A;  5IYD H;  4EFB A;  1UE5 A;  1PH4 A;  2AGP A;  2JA9 A;  5IGG A;  1WTQ A;  4CDD C;  2BE5 C;  2DY8 A;  2B2V C;  5JQW A;  4JI1 Q;  1LTR D;  2NN6 I;  4JYA L;  4IPG A;  3I91 A;  5C5J A;  3KXY T;  4AQY H;  3M4Q A;  3Q6S A;  1S3O A;  4ECQ A;  1IBK Q;  1GHJ A;  1JOO A;  3S1Q H;  3GTP B;  3BU2 A;  1HNZ H;  4GNX B;  2Y0S B;  4IWY A;  1ZYR D;  3J7A F;  3OPO A;  3TQY A;  2W6Q A;  3FHW A;  4JI4 L;  1P16 A;  1S03 G;  1CKO A;  1L1O B;  5JVD F;  5BMV F;  4PMW A;  3A5U A;  4DR4 L;  2W6N A;  5KYL A;  4BY7 H;  4DAY A;  4FNF A;  4EGQ A;  2NVQ H;  4KV6 A;  3MFH A;  2I0Q A;  1ZQ7 A;  2ATW A;  2VUM G;  2EYJ A;  1EQR A;  2V4Q A;  2X0S A;  4J0M A;  1STB A;  1TWF A;  3HOX H;  5LL6 X;  1H9R A;  4DR3 H;  2NZO A;  3S1M H;  4LFA L;  1JOK A;  1RHP A;  1HNX Q;  1SRU A;  2B2U C;  4R8N A;  1BNZ A;  3C2P A;  4LWC A;  2Q2I A;  4LF5 L;  3HOV B;  4NW2 A;  1N56 A;  3S17 B;  4A3J G;  5C3E B;  1JT8 A;  2V5A A;  5HV6 A;  1LTI D;  2R7D A;  5KG0 A;  3T1H Q;  3F2U A;  3MAQ A;  3S1R B;  4EEY A;  4YWK A;  3TS0 A;  1KDB A;  1X3P A;  3JRX A;  3CVZ A;  1EY7 A;  2K5D A;  4DV7 L;  4A3I H;  3ICE A;  4O0A A;  4XQJ A;  3R5X A;  3TS2 A;  2XIG A;  3TDQ A;  1PYW D;  2V9W A;  1PK8 A;  1SMY C;  1VQ9 A;  4Q5V A;  1XJV A;  1DXM A;  4LF6 L;  3BQ1 A;  2R7Z H;  1JC7 A;  1Y8P B;  4MTD A;  2BR0 A;  1VQF A;  3NBI A;  3M3Y H;  2IJ0 A;  4J9P A;  1WD0 A;  1DOM A;  1SMY D;  2HGS A;  3QO2 A;  5GON F;  2DPJ A;  2XRQ D;  2R3Z A;  1TWH A;  4JI5 L;  2XGQ A;  1KD1 C;  1PTO H;  4C3H H;  1N8R C;  2DPI A;  4KKU A;  1QB5 D;  4APV A;  1NR2 A;  3QIA A;  1JX4 A;  5KFZ A;  5COR A;  2OWO A;  4QY7 A;  4JV5 H;  1AE2 A;  2PZT A;  5KFB A;  2EJM A;  1XMO L;  1KQS A;  2UU9 Q;  3NEN A;  5JOB A;  1TR5 A;  5C4J H;  4J1M A;  4ILW A;  2RKS A;  4UP7 A;  4MV1 A;  3GIM A;  4ECV A;  4IPH A;  4DU9 A;  5J39 A;  5C0X G;  5FD6 A;  3RGX A;  1QVC A;  4A93 H;  5KFK A;  5FLX W;  3OTO Q;  4IQZ A;  4JOI A;  5LP6 F;  2UVR A;  2KHS A;  2A6E D;  4IWX A;  4RFB A;  2MPM A;  1EYD A;  4JI1 L;  4I55 F;  1KNE A;  4DPG A;  4GN5 A;  2XN9 C;  2CQO A;  5IOC A;  1N36 H;  1WD1 A;  4AYB B; 
#chains in the Genus database with same CATH homology
 2K50 A;  4Y52 H;  1CSP A;  5GAD C;  1IBK L;  3UDF A;  1XPO A;  4IFD I;  3W1G A;  2XGT A;  2DUD A;  4R4C A;  2L15 A;  4JCV E;  2Z0S A;  3GTM H;  3AQQ A;  4JI2 L;  2IY5 B;  3H0G G;  4DV5 Q;  1IXR A;  4B3S Q;  5FJ8 H;  3RNU A;  2WB1 E;  4JI7 L;  4PZ8 A;  4AQY Q;  4JBM A;  1HZB A;  4OX9 L;  3AFQ A;  4A3L H;  1W2B A;  1QUQ A;  2RHQ B;  3CQZ H;  3L2P A;  5LMN W;  3S24 A;  1E1T A;  1HNZ Q;  1E1O A;  3K7A H;  4BXX H;  2BH2 A;  3F8T A;  3CCQ A;  4BXX G;  1WOC A;  2KHI A;  4X64 L;  4POG A;  2JA8 H;  1JE5 A;  3HKZ G;  2JA8 G;  4JI8 Q;  4BBS H;  2KEN A;  5IP9 H;  2UXC L;  1HNX L;  5IP9 G;  4JI6 Q;  1Y1V H;  4QGU A;  1GD7 A;  1PH1 A;  4A3D G;  1PH8 A;  1N9W A;  1Y1V G;  3GTP H;  1VQ5 A;  3I4M G;  3J81 j;  4LF4 L;  2V1C C;  2OTJ A;  1O7I A;  3T1Y L;  3RLN A;  4DR3 Q;  3U4Z A;  3RLO A;  2I5M X;  1B7Y B;  4GKJ Q;  1X6O A;  3T1H L;  4A3F H;  2QA4 A;  2B63 H;  4R4T A;  1YJ9 A;  2NVT H;  2B63 G;  4A3F G;  4JI0 Q;  1C9O A;  4GLA C;  5GQO A;  5IWA L;  1YEZ A;  4OON A;  4L5R C;  1YI2 A;  2LSS A;  3H15 A;  3FKI H;  3J81 i;  1C7Y A;  4B3T L;  4LF8 Q;  4YY3 L;  2ZTD A;  1X3F A;  3FKI G;  3RR5 A;  3W5O A;  2EQS A;  3CCV A;  4POF A;  3MEF A;  3J81 c;  3PF5 A;  2XTI A;  3CCL A;  4XTC S;  2OCE A;  4TQU S;  4QL5 A;  4HJA A;  5J3B A;  5BR8 Q;  4X66 L;  1N34 L;  4A3B H;  1T9H A;  3HKZ E;  3CAM A;  5LMU Q;  4DUY Q;  4HIK A;  1KRS A;  3UDX A;  2RHS B;  5C3E H;  4GLV B;  4A3G H;  4YHH Q;  2CWA A;  4GOP B;  3S1R H;  2K75 A;  1X56 A;  1UE6 A;  3PUW A;  4ALP A;  1IBL L;  2JA7 H;  1IYJ B;  3HOU G;  1DGS A;  1SN8 A;  2F52 A;  2JA7 G;  3HOX G;  3F2B A;  4LFB L;  4NXM L;  1Q7Y C;  3FP9 A;  4GS3 A;  2JA6 H;  5ELO A;  2JA6 G;  5LMN Q;  4WJ3 M;  1HNW L;  1EUJ A;  2BA1 A;  3CCU A;  1HR0 W;  2VNU D;  3PO2 G;  2PQA A;  4A76 A;  1QVG A;  4OWW B;  1Q1E A;  1X65 A;  1JMC A;  4B3M L;  1LYL A;  2AMC B;  5IT9 c;  4QQB X;  1K8A C;  2F3I A;  1Q81 C;  2VQF L;  3UE0 A;  5C44 H;  1VQM A;  4C3I H;  1I3Q H;  2HT1 A;  3TRZ A;  5C44 G;  2Z6K C;  1PYB A;  1G51 A;  3H3V I;  4DR7 Q;  4A3I G;  3E9H A;  3GTK H;  1K3R A;  2ZTC A;  1A63 A;  2CKZ B;  3CCE A;  2OQ0 A;  1HJP A;  1Q8K A;  1TWC H;  2I5H A;  2MO0 A;  3DM3 A;  4QIW E;  1V9P A;  5FLM H;  2RCN A;  2MNA A;  4A75 A;  1XMQ L;  3A0J A;  1V43 A;  2LXJ A;  5FLM G;  4JI3 L;  1LM0 A;  3JAM c;  3CCM A;  4DK3 C;  4DR5 Q;  1YJN A;  1XPR A;  3GTG H;  2UXB L;  2NN6 G;  4BBR H;  2ID0 A;  1VQA A;  4BBR G;  2FXQ A;  4GLX A;  4LNQ A;  1N36 Q;  4B3R L;  3PCO B;  4B3S L;  4IFD J;  3EIV A;  4IJL A;  4AIM A;  4AQY L;  1X9N A;  2K5N A;  1TXY A;  2UXD Q;  5GAG C;  4JYA Q;  1PH9 A;  1JJG A;  4GNX A;  1OXV A;  3BZK A;  2HHH Q;  3G48 A;  3AFP A;  2NZH A;  4L5Q A;  4DK6 C;  3PIP A;  1VQL A;  1L1O A;  4LFC L;  4DUZ Q;  4GN4 B;  4JI4 Q;  4WJ4 A;  1FGU A;  1PYS B;  5IY0 A;  4OO1 G;  4NXN Q;  2JJQ A;  5DLQ E;  4LW1 A;  1KRT A;  1AE3 A;  5M3F H;  1J6Q A;  4X62 Q;  4MTN A;  1RIP A;  2KHJ A;  3OW2 A;  4XIG S;  1TWA H;  3PUX A;  1YHB A;  1Y1W H;  3J7Z C;  3G6E A;  4A93 G;  5AJ3 Q;  4JBW A;  2A1A A;  2HIX A;  3I7F A;  3KYH C;  1BKB A;  2IHF A;  3GTO H;  2D0O A;  3S2H H;  2KBN A;  2R93 G;  4DV1 Q;  4JC0 A;  1VQD A;  4LFA Q;  2ZJQ A;  3KDF B;  3DLL A;  1HR0 Q;  1KIX A;  1XNR L;  1GO3 E;  3JC6 6;  2N49 A;  1JJC B;  2VQE Q;  1VQ6 A;  5IYB H;  4GOP C;  4LF8 L;  5GAH C;  3U58 A;  1CKN A;  5IYB G;  3E0E A;  3H3V H;  1HZC A;  1OXU A;  4HJ8 A;  1I94 L;  1Z9F A;  3E9I A;  2E5L Q;  4X65 Q;  4HID A;  3ZJY C;  3CCS A;  1TWG H;  1LUZ A;  3CC2 A;  3GTL H;  2NVX H;  2PNH A;  5BR8 L;  5FJ8 G;  5ELN A;  3K0X A;  3Q8D A;  3ULL A;  2R92 H;  4A3C H;  1L2F A;  4DUY L;  4A3L G;  3A74 A;  4DV7 Q;  4A3C G;  3K80 C;  2VL6 A;  4A3K H;  3K81 C;  2YTY A;  1VQ7 A;  4DAY B;  4YHH L;  3CP0 A;  4A3K G;  1B8A A;  3CPF A;  1XNQ Q;  5M3M H;  4H02 A;  3M4P A;  1PH6 A;  1EYG A;  4BBS G;  3L0O A;  2K4K A;  3WWV A;  4LF7 Q;  4JOI C;  2E2H H;  4BY1 H;  4DV2 Q;  2JE6 I;  2H5X A;  5EAY A;  1WCM H;  3ER0 A;  3KF6 A;  3PSI A;  3RLF A;  2Y0S G;  1PH3 A;  1N32 Q;  1K0R A;  1WCM G;  1YBY A;  4DV4 Q;  5JJK A;  4GKK L;  2QGQ A;  3I4N H;  1WI5 A;  1Q12 A;  1C0A A;  1Y14 B;  4IO9 A;  3ULP A;  2A8V A;  1I6H H;  3AYH B;  5GAE C;  3PO3 H;  2NVY H;  2AWO A;  2AWN A;  3PUZ A;  1YHA A;  1VQK A;  2WP8 J;  3BJU A;  1VQI A;  2R7F A;  2ALY B;  4DV3 Q;  2JK8 A;  2E2J H;  1XMO Q;  2E2I H;  1NMG A;  3CPW A;  4HJ7 A;  4UP9 A;  3CW2 C;  4DV0 L;  3NEL A;  3F1Z A;  3D0F A;  4R4I A;  4R4O A;  4A3M H;  1EIY B;  3STB C;  5C0X J;  1PHJ A;  1PH2 A;  2D0P A;  2DGY A;  3ERS X;  4ME3 A;  1J5E L;  1NY4 A;  1IBM L;  2GVB A;  2MFI A;  2LXK A;  1EFW A;  2UUC Q;  3HOV H;  2UUB Q;  3S17 H;  4A3B G;  3HOV G;  4IFD G;  1VQP A;  4DR1 L;  4IJH A;  4EX5 A;  5C3E G;  4DR2 L;  3STB D;  1Q1B A;  4DR6 Q;  2UUA Q;  4A3G G;  2BH8 A;  1PA6 A;  2UXD L;  1YIT A;  1R9T H;  2KCT A;  4HJ5 A;  1ASZ A;  3S1N H;  2Y0S E;  2I5L X;  2YU9 H;  4IPD A;  2HHH L;  1HH2 P;  1OXX K;  5JEA G;  2YTV A;  4LUZ A;  4UP8 A;  3G71 A;  4NPS A;  1OTC A;  2E8G A;  3KJP A;  4HIM A;  3PGZ A;  3S14 H;  2MQH A;  2UU9 L;  4JI2 Q;  1BBW A;  1A0I A;  4LUV A;  1NMF A;  4NXN L;  4OX9 Q;  5IYC H;  3RN5 A;  4DNI A;  4X62 L;  4GN3 B;  4UY8 C;  3NEM A;  4JV5 Q;  4L5T A;  3OTO L;  3ULJ A;  1VQB A;  3W1B A;  1Z47 A;  3UDG A;  4JBK A;  4L5S A;  1CUK A;  1VCI A;  4EQ5 A;  3CC4 A;  1UE7 A;  4X64 Q;  1NTG A;  2Q2H A;  1K8G A;  4K0K Q;  3JAM i;  3J7A 5;  1PH5 A;  4DV6 Q;  5C0X I;  2VW9 A;  2ZM6 L;  1YVC A;  2UXC Q;  2CWP A;  3TRE A;  1YJW A;  1W3S A;  4R4Q A;  4IPC A;  3SGI A;  3TEH B;  2VQE L;  4KI0 A;  1N33 Q;  1JB7 A;  1VQG A;  4R1J A;  1VQJ A;  4A3J H;  1QZH A;  5IE8 A;  1KC8 C;  2K52 A;  2IX1 A;  1KL9 A;  3J80 i;  4DV5 L;  3GO5 A;  4X65 L;  2E5L L;  2QEX A;  2YV5 A;  1G6P A;  1VQH A;  1QZG A;  2Q2T A;  1MJE A;  3J80 c;  4OWT B;  2JA5 H;  3GTQ H;  4DAM A;  4X6A H;  2WAQ E;  2JA5 G;  4FDB A;  2EXD A;  5IWA Q;  2AKW B;  1HNZ L;  1VQ8 A;  1RL2 A;  4PG3 A;  4LUO A;  1QUQ B;  1OXT A;  3KOJ A;  4B3T Q;  1G29 1;  5C4X G;  2MO1 A;  2ES2 A;  2EIF A;  3F2D A;  3PV0 A;  4JI8 L;  3CCR A;  3M7N A;  3IRB A;  1QVF A;  1Q86 C;  4MNO A;  3HOY H;  3PUY A;  4JI6 L;  1PVO A;  1X55 A;  4AYB G;  1S40 A;  1N34 Q;  2KCM A;  4X66 Q;  1GM5 A;  2ZJP A;  4DR4 Q;  4DV2 L;  5M3F G;  4GOP A;  2R6G A;  4P71 A;  1N32 L;  4PZ7 A;  5M5W H;  4DR3 L;  3D31 A;  1Y1W G;  1EQQ A;  1IL2 A;  4GKJ L;  3GDE A;  1MJC A;  1IBL Q;  1BVS A;  3NBH B;  4JI0 L;  3S16 H;  1UE1 A;  1PH7 A;  2YTX A;  4LFB Q;  4AH6 A;  1MIU A;  2D62 A;  3MXN B;  1JJ2 A;  1E3P A;  1OXS C;  1P8L A;  1I50 H;  4QJF A;  2VZA A;  4NB3 A;  4LF5 Q;  3RN2 A;  2N8N A;  3CXC A;  1D8L A;  1NBW A;  2N3S A;  4A3E H;  1NJI C;  4B3M Q;  4GNX C;  4A3E G;  5JJI A;  3M85 A;  5LMU L;  2R92 G;  2VQF Q;  4HIO A;  1L0W A;  5FLX c;  4C3J H;  1FVI A;  3PIO A;  4IOC A;  1YZ6 A;  1E7Z A;  4AYB E;  1H95 A;  1GVP A;  1U0L A;  3UDI A;  5E7N A;  4LF6 Q;  3HOW H;  5C4X H;  3PF4 A;  1SE8 A;  1SRO A;  3HOW G;  3HFZ B;  3I2Z A;  2BA0 A;  2VY3 A;  5M3M G;  1XMQ Q;  3KF8 B;  4JI3 Q;  3CC7 A;  1AH9 A;  5HGQ A;  2ZJR A;  2UXB Q;  4J15 A;  1VQO A;  3H0G H;  3U4V A;  1WYD A;  5LMN L;  4BY1 G;  4JI5 Q;  4RMF A;  4B3R Q;  1M1K C;  1E22 A;  3RZD H;  1D7Q A;  2A19 A;  4PZ6 A;  2F4V Q;  3I4N G;  2PQA B;  1BBU A;  1CKM A;  2K5V A;  1YIJ A;  4JV5 L;  4HJ9 A;  3PO3 G;  5K36 G;  4P74 A;  1WFQ A;  4KHP Q;  4OWX B;  1TWH H;  3I56 A;  4DR7 L;  1FL0 A;  2Q2U A;  1KHI A;  4KHZ A;  1M90 C;  4K0K L;  4LFC Q;  1K9M C;  4DV6 L;  3F2C A;  1HZA A;  2K14 A;  3S2D H;  1FJG Q;  4A3D H;  2JQO A;  4C2M H;  1PV4 A;  3KJO A;  3I4M H;  2PMZ E;  4YCV A;  3K7U C;  1XPU A;  4LF9 Q;  1N33 L;  4DR5 L;  1I5F A;  3EN2 A;  1A8V A;  3LGJ A;  4A3M G;  1SR3 A;  3EBE A;  3CD6 A;  1VQC A;  1PFS A;  5IYD H;  1MKH A;  1GKH A;  1UE5 A;  3M9B A;  4O2D A;  5IYD G;  1PH4 A;  1N36 L;  1VQN A;  2JA9 A;  3L7Z C;  2PI2 A;  3KDF A;  1K83 H;  1YHQ A;  5IP7 H;  4JI1 Q;  2NN6 I;  5IP7 G;  4JYA L;  4IPG A;  2IHE A;  1XNR Q;  3M4Q A;  1Q82 C;  1S3O A;  2B3G A;  2IT1 A;  1VQ4 A;  1IBK Q;  4BA1 I;  5M5X H;  3S1Q H;  1SMX A;  3BU2 A;  3KLW A;  4GNX B;  2Z6K A;  4YWL A;  3TQY A;  2WAQ G;  4DUZ L;  3FHW A;  1K73 C;  4JI4 L;  1P16 A;  4YWM A;  2RF4 A;  1I94 Q;  1V1Q A;  1CKO A;  1L1O B;  4JI7 Q;  1EWI A;  4PMW A;  3A5U A;  4DR4 L;  3I4O A;  4BY7 H;  3GD7 A;  3A5Z B;  1VS0 A;  2NVQ H;  5IYC G;  2VUM H;  4BY7 G;  3B6Y A;  2I0Q A;  2ATW A;  2JEB I;  2VUM G;  4MZ9 A;  5M5Y H;  5H1S E;  4BA2 I;  1EQR A;  5AJ3 L;  3G4S A;  4JG2 A;  4OO1 I;  2JEA I;  3HOU H;  1XTD A;  5JJL A;  5HY6 A;  3HOX H;  2AHO B;  1X54 A;  2NZO A;  3S1M H;  4DV1 L;  3K8A A;  4LFA L;  2OTL A;  1HNX Q;  1EOV A;  1EIF A;  1A62 A;  1SRU A;  1WJJ A;  2C35 B;  3U50 C;  3I55 A;  2IX0 A;  3GTJ H;  1HR0 L;  1LTL A;  3VDY A;  4A4I A;  4LWC A;  2Q2I A;  4LF5 L;  3PO2 H;  4LF4 Q;  1UEB A;  1NE3 A;  3T1Y Q;  4YCU A;  4A3J G;  4GKK Q;  1JT8 A;  1KXL A;  1CKN B;  2R7D A;  3PUV A;  3T1H Q;  3UE1 A;  1E24 A;  3S15 H;  4YWK A;  3TS0 A;  1X3G A;  1SFO H;  4DV7 L;  3ICE A;  4A3I H;  2N78 A;  4O0A A;  3CCJ A;  4KLK A;  3TS2 A;  5GRO A;  1VQ9 A;  2ZTE A;  1XJV A;  2CCZ A;  4LF6 L;  3AEV A;  2R7Z H;  1XNQ L;  4YY3 Q;  2YYZ A;  2R7Z G;  1VQF A;  1Q46 A;  2CFM A;  1S72 A;  4DV0 Q;  3M3Y H;  2HIV A;  3KFU A;  1ASY A;  4LF7 L;  3HOY G;  1J5E Q;  1SLJ A;  1IBM Q;  3HKS A;  4YCW A;  4UPA A;  4JI5 L;  1KD1 C;  4JBJ A;  3CMA A;  1CSQ A;  2OQK A;  4C3H H;  4DV4 L;  4DR1 Q;  1N8R C;  4DR2 Q;  3OYY A;  3KF6 B;  2F4V L;  4APV A;  5JEA J;  2B29 A;  4OXP A;  4DKA C;  2OWO A;  1YNX A;  4QY7 A;  4NXM Q;  4KHP L;  2WB1 G;  1AE2 A;  4DV3 L;  1VQE A;  2WFW A;  1XMO L;  1KQS A;  1IZ6 A;  2UU9 Q;  2GN5 A;  3NEN A;  4RG1 A;  4P73 A;  1FJG L;  2K5H A;  5C4J H;  3HOZ H;  1HNW Q;  4Y7N H;  3HOZ G;  1TWF H;  4P72 A;  1B70 B;  4IOA A;  2VS1 A;  4LF9 L;  1UWV A;  4UP7 A;  1HZ9 A;  4IPH A;  3RZO H;  5C0X G;  1QVC A;  1U5K A;  4A93 H;  3OTO Q;  3M4O H;  4JOI A;  2UUC L;  3CF5 A;  2UUB L;  1L1O C;  3CME A;  1X3E A;  2PI2 E;  2R93 H;  2ASB A;  4TVA B;  2GVA A;  3BZC A;  4DR6 L;  2UUA L;  4JI1 L;  2HQL A;  4DPG A;  4GN5 A;  2ZM6 Q;  2CQO A;  4P75 A;  1KAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...