3HOVG

Complete rna polymerase ii elongation complex ii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hovG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hovG01
3CMAA 1CKMA 2WFWA 2R7FA 3G48A 3FKIG 4P72A 4EX5A 1EUJA 1EOVA 3HOXG 1VS0A 1E3PA 4DR2Q 4GLXA 3T1YL 2NN6G 4B3ML 5C0XJ 2B3GA 5M3MG 3J81j 4LF8L 3CP0A 1HZ9A 4JBWA 2MO1A 4R4CA 1M1KC 2WB1E 1LTLA 3BU2A 4KI0A 3OTOL 3CCSA 1WCMH 1X55A 4DR4L 3PUXA 4LUVA 3CMEA 4X62Q 4DR2L 2WP8J 4WJ4A 2Y0SG 2QGQA 3W5OA 3T1HL 1SE8A 5C4XG 1WJJA 4LF5Q 4LF7Q 3KLWA 1JE5A 4KHZA 4AQYQ 1KIXA 4HIMA 2I5LX 2LXJA 1YI2A 1Q12A 3FKIH 3PV0A 1MJEA 3ER0A 1AE2A 4J15A 1VQPA 3PIPA 4B3RL 1A62A 1C7YA 1YBYA 3CC7A 3HOWH 1VQAA 2OQ0A 4JI3L 1L1OC 3KOJA 2AKWB 3WWVA 1DGSA 3ULJA 3STBC 1HZBA 4GN3B 4DNIA 1LYLA 1Q1EA 1U0LA 1P16A 1OXTA 2GVAA 3KDFB 2R7DA 1PV4A 2K14A 2PMZE 4QY7A 5C44H 4X6AH 4C2MH 1PH3A 2JEAI 4B3RQ 1C0AA 1PH2A 4A4IA 1SMXA 4L5QA 3S17H 2HQLA 2R93H 4A3BG 4GS3A 2AMCB 3ICEA 4OWWB 3KJPA 5C44G 1WCMG 1EIYB 4X64Q 4A3MG 2UXDL 3U4ZA 3RN5A 4B3SQ 1X56A 2OCEA 3CAMA 3D0FA 4TQUS 1IBLQ 1CKNA 4XIGS 1Y1VH 3S16H 3GTQH 2CQOA 2VZAA 3K0XA 4JBJA 2A1AA 4JI5L 4HIKA 1KAWA 2JA5G 1JB7A 3D31A 3Q8DA 4POFA 5GROA 1K83H 2PQAB 2HHHQ 1W3SA 4UP7A 4DV4L 2Q2UA 2JA6H 4Y52H 3ULPA 4B3SL 3S1MH 3GTPH 3I56A 2KENA 4A3LH 1QUQA 1IBLL 3HOZG 4A75A 3DM3A 3PUWA 4A3JG 4JV5Q 2YV5A 3LGJA 1NE3A 3M9BA 3CC2A 2KCMA 1JJCB 1NBWA 2RHSB 3A5UA 2ZM6Q 4A3GH 1X65A 3CPFA 4MNOA 2HHHL 3M4OH 2VL6A 1B7YB 2UUCL 1L2FA 5ELOA 4X66Q 5FLMH 4DV0L 1X3EA 3HOZH 4GOPA 1IL2A 2R93G 1PYSB 3AYHB 4A3FG 3TS0A 4K0KL 2VUMG 1N8RC 5HY6A 1N36L 3BZCA 4LF6Q 1VQJA 3K8AA 4P73A 3F2BA 2A8VA 4GLVB 1X54A 2UUCQ 5FJ8G 4LFBQ 2EIFA 5C4JH 4GKKL 5M3FH 1TXYA 2I5MX 1PH6A 1J5EL 3K7AH 4IPGA 4UP9A 5H1SE 4BXXG 4GKJQ 1PH1A 3W1GA 4GOPB 3J7ZC 1YHQA 1FJGQ 3L2PA 4OO1G 5M3FG 3J80c 1KHIA 1Q1BA 3CW2C 3JAMi 1XPOA 1IBML 3TS2A 3CXCA 5C3EH 3S15H 1PH4A 3K7UC 3PF5A 2JA6G 4A3CG 3UE1A 1O7IA 4LFCL 3I4MG 2B29A 2ZJQA 1NY4A 2Q2HA 1N34Q 2FXQA 2JEBI 3AFQA 1HZCA 4R4IA 4A3KH 3AEVA 2K5HA 3CCVA 4NXML 2K75A 3HKSA 3HKZE 4JYAQ 1JJGA 1G51A 5C0XG 3RNUA 3CCRA 3UE0A 2VW9A 1S40A 4A3DG 3CCMA 1OXXK 2F4VQ 1HNWQ 3BJUA 2D0PA 2UXCL 3FP9A 3GTMH 1VQLA 3TQYA 3L0OA 4JCVE 4DV5Q 4DR3L 1K9MC 4YWLA 3MEFA 1VQ9A 3H0GG 1E22A 4JG2A 4BXXH 1ASZA 5DLQE 1CSQA 1GM5A 3GTJH 4JI4Q 2QEXA 4LF8Q 4DK6C 3RZDH 3RLOA 4NB3A 1SROA 4A3KG 2F4VL 1HNWL 2ZM6L 1VQ7A 1IZ6A 4IPDA 2Z6KA 3G71A 2MNAA 2YU9H 2JK8A 5ELNA 2VQFL 1VQFA 1HZAA 3F2DA 1CSPA 1SN8A 1Q46A 2I0QA 2ALYB 1MIUA 4K0KQ 4DR6Q 3KDFA 3HOUG 1S3OA 1E1OA 2AWOA 1L0WA 4HIDA 1Q82C 4DV2L 2NVTH 1P8LA 1KRTA 4JI1L 4OWXB 1VQKA 1PHJA 2UU9Q 4LNQA 1PH8A 1N33L 4BY7H 2R7ZG 1XPRA 4R1JA 4YWMA 1Z47A 2OTJA 5JJLA 1BVSA 3I4OA 1TWAH 4GLAC 1I50H 4QGUA 4DV2Q 1KRSA 4KHPL 1NJIC 3S1RH 3HFZB 1N33Q 3GTOH 3EIVA 2E5LL 3UDIA 3NENA 1I94L 2UUBL 4LFCQ 1HNXQ 2NVQH 1N36Q 1YEZA 2H5XA 4OONA 4QQBX 1WFQA 3B6YA 4LFAL 2HIVA 4NXNL 3U4VA 4A3CH 1UE5A 4IOAA 2NVYH 4GKKQ 4UP8A 2CWPA 2E2HH 3F2CA 4JI2L 4DR5L 4DV3L 3AQQA 3JC66 5LMNL 1HH2P 5IYBG 4L5SA 4LF4L 4NXNQ 4DUZQ 4AYBE 1VQ8A 3ERSX 4DR3Q 2V1CC 4YCVA 4FDBA 4L5RC 2XGTA 3U50C 4DV4Q 1VQBA 2WAQG 2NZOA 4A3MH 4LF5L 4LF7L 2D0OA 1PH7A 1E1TA 3PO2H 4JBMA 4A3FH 4LF9Q 5M3MH 2VQEQ 3GTLH 2PQAA 5LMUL 1K3RA 3H3VH 1VQGA 4QJFA 1XNRL 2ZJPA 5C0XI 1HR0W 3CF5A 4JYAL 2IX1A 2R92H 4OWTB 3PUVA 3CCQA 4JI0L 4DK3C 1U5KA 2VY3A 4PMWA 2K5NA 1WYDA 4HIOA 2JA5H 4BBRG 3I2ZA 4DR1L 2KHJA 4PZ8A 4LF9L 2QA4A 3J80i 3TREA 4B3MQ 1PYBA 4A3LG 2CCZA 3RLNA 1LUZA 4JI1Q 4DAYB 1NMGA 3CCEA 2VQEL 2L15A 3DLLA 2UU9L 4JI7L 2OTLA 1I3QH 4DV1Q 4DR4Q 3CCUA 4GN4B 2AHOB 2MO0A 1IXRA 4JI8L 1J5EQ 2XTIA 4DPGA 1SFOH 4UPAA 2WB1G 1YITA 2OWOA 4GKJL 4LFBL 5IYBH 1QZGA 4YHHL 2JE6I 3SGIA 4A93H 1HR0Q 1A63A 3F1ZA 5HGQA 3PF4A 1J6QA 1A8VA 1B70B 1NTGA 4LUZA 4LFAQ 2EXDA 4LWCA 3RR5A 1IBMQ 4GOPC 2IX0A 2F3IA 3H15A 4OXPA 1GO3E 4A3BH 3S1QH 1YVCA 4IPCA 2PNHA 3HOVG 4JI3Q 5IYCH 2K4KA 2YTYA 4YHHQ 3PSIA 3A74A 1H95A 4DR5Q 2Q2TA 1UWVA 1CUKA 2K52A 4P75A 1M90C 2JA7H 4YCWA 5IYCG 2CFMA 3EBEA 4C3HH 2EQSA 4YWKA 1YZ6A 2CWAA 5C3EG 1KC8C 2A19A 3HOWG 4GN5A 3NEMA 4AQYL 1Z9FA 1HNXL 4DR7L 3KFUA 2JA7G 3OYYA 4POGA 2JA8G 1XMQQ 2BH2A 3CPWA 4X62L 5AJ3Q 2KHIA 1K73C 2NN6I 4AH6A 3S14H 4A3JH 2IHEA 5FJ8H 3HOVH 4IO9A 2VUMH 4HJ8A 1OXUA 4NPSA 3E9HA 4DUYQ 1XTDA 2D62A 2VQFQ 3GTKH 1VQOA 5GAGC 1BBUA 4ALPA 1A0IA 2N3SA 3W1BA 4IFDI 4P74A 2HT1A 1QVGA 3K81C 2ES2A 4DR6L 1G6PA 4DV1L 3I4NH 1CKNB 3KF8B 3J7A5 1D7QA 4DAMA 3H0GH 4X65Q 2UXCQ 3RLFA 1EQQA 3AFPA 4GNXC 2JA8H 3PUZA 3PO3H 1VQMA 4GNXA 2E2JH 4P71A 1N32Q 1XPUA 2N49A 5IYDH 4HJ9A 1EYGA 1NMFA 3HKZG 2UUAL 2MQHA 2YTVA 4DV6L 2R6GA 4JI4L 4JI0Q 1Y14B 4A3EH 4RMFA 4A3GG 1QUQB 3HOUH 3HOYH 1VQEA 1YHAA 2Q2IA 2E5LQ 4A3EG 1G291 4MTNA 3M3YH 1JT8A 4JI7Q 4EQ5A 1XMOL 5GAEC 4OX9L 2R7ZH 5JJIA 3M85A 2RCNA 2JA9A 2YYZA 3F8TA 4AYBG 1VQCA 3I7FA 4LW1A 3I55A 1FJGL 2IY5B 1PVOA 5M5YH 2ZTDA 5EAYA 3PO3G 2JJQA 3S24A 4BBSH 3S1NH 1EWIA 2HIXA 4Y7NH 1XNQQ 3M4PA 2ATWA 1N34L 2B63H 4PZ7A 1XMOQ 2R92G 3I4NG 1IYJB 1TWGH 4BA1I 4BBSG 1W2BA 3VDYA 3KJOA 1VQDA 4KLKA 4A3IG 2DUDA 3A0JA 5M5XH 4JOIC 4QL5A 1C9OA 4JOIA 1N9WA 1UEBA 4R4QA 5IYDG 1I6HH 4BY7G 3MXNB 1PFSA 1R9TH 1V9PA 3KYHC 5IWAL 5LMNW 4DV7L 2UXBL 4O0AA 4IFDJ 5IP9G 1Y1WH 4IJLA 5C4XH 2VNUD 1FGUA 1RL2A 5JEAJ 1IBKL 3IRBA 4LUOA 2BA0A 2N8NA 4TVAB 1OXVA 2F52A 5BR8Q 4JI6L 2GN5A 1XJVA 4A3IH 1JMCA 1TWFH 2ASBA 4DUYL 3KF6A 1GVPA 1GKHA 3OTOQ 4JI8Q 2DGYA 4A3DH 2KCTA 1AH9A 2IHFA 1T9HA 4YCUA 3FHWA 4DV3Q 4APVA 4NXMQ 2UXDQ 4WJ3M 2Z0SA 1K8AC 1L1OA 3UDFA 3EN2A 1V43A 1EIFA 1KXLA 1WOCA 2MFIA 1VQ4A 4LF6L 3K80C 4PZ6A 4BBRH 3GO5A 1VQIA 2LXKA 4IPHA 3STBD 4DR1Q 3GTGH 3E0EA 5IY0A 4B3TL 3RZOH 3S2DH 1I94Q 2UUBQ 1VQ6A 1QZHA 4IFDG 2Z6KC 2ZTCA 1L1OB 1XNQL 1N32L 4IOCA 2JQOA 1S72A 1E7ZA 3OW2A 2GVBA 3PO2G 3E9IA 4ME3A 1I5FA 2VS1A 2PI2A 1YIJA 1AE3A 2WAQE 4HJ7A 4AIMA 1QVFA 1PA6A 4C3JH 4DUZL 1VQNA 5AJ3L 2NZHA 4JC0A 2B63G 3S2HH 1KQSA 5LMNQ 3NBHB 4DR7Q 1XMQL 1UE7A 4JI2Q 1K0RA 4BA2I 4PG3A 5J3BA 5GQOA 2I5HA 3PGZA 1LM0A 1EFWA 4RG1A 5IP7H 1YJNA 4X64L 3RN2A 1VCIA 3J81c 5JJKA 1X6OA 1BBWA 1K8GA 5LMUQ 2OQKA 5BR8L 5GADC 3PCOB 4HJ5A 1IBKQ 3T1HQ 3TEHB 1KD1C 4X65L 3HOXH 1Y1WG 5IE8A 1V1QA 3J81i 3HOYG 1YJWA 1HJPA 4UY8C 2K50A 3I4MH 5JEAG 1HNZQ 1ASYA 1PH9A 2KBNA 4MZ9A 3CD6A 2ZJRA 3PIOA 2C35B 3BZKA 4DV6Q 1JJ2A 1PH5A 4JBKA 5M5WH 5FLMG 2RHQB 3G4SA 4OO1I 4GNXB 1SR3A 1GD7A 5IWAQ 3NELA 1MJCA 1D8LA 4YY3L 4JV5L 2NVXH 4B3TQ 1OTCA 4A76A 2YTXA 4R4OA 5E7NA 3GDEA 1UE1A 2PI2E 2RF4A 3CC4A 2Y0SE 4JI6Q 4OX9Q 4QIWE 1SLJA 3ZJYC 1EQRA 4YY3Q 1OXSC 5GAHC 3G6EA 1HR0L 5IP7G 1Q81C 1TWHH 3L7ZC 1VQ5A 4KHPQ 4XTCS 2K5VA 4C3IH 3JAMc 2BA1A 4BY1G 1KL9A 1TWCH 1YNXA 1YJ9A 1BKBA 5IP9H 4A93G 3UDXA 4IJHA 4L5TA 1FL0A 1B8AA 4HJAA 1XNRQ 3U58A 5FLXc 4O2DA 4JI5Q 3UDGA 3TRZA 1CKOA 3M7NA 1SRUA 1Q8KA 1X3FA 1Q7YC 2BH8A 4H02A 5IT9c 1UE6A 1Q86C 2N78A 1X3GA 3KF6B 1WI5A 1E24A 2AWNA 3GD7A 3ULLA 4LF4Q 3H3VI 1VQHA 3CCLA 1QVCA 1Y1VG 1YHBA 3A5ZB 1MKHA 2UUAQ 4DKAC 4DV7Q 2UXBQ 3T1YQ 2E2IH 3PUYA 2CKZB 2E8GA 4BY1H 3CCJA 2LSSA 2ID0A 2ZTEA 5K36G 4R4TA 4DV5L 4X66L 4DV0Q 1HNZL 1RIPA 2IT1A 3CQZH 1X9NA 1FVIA 3M4QA
chains in the Genus database with same CATH superfamily
1S5DD 3CMAA 1CKMA 4P72A 2EYFA 5KG6A 1E3PA 4U673 2NU9B 2H1EA 2Z1CA 3RGXA 4DV6H 1IYVA 5A2QL 4C2MB 5M3MG 3C1EA 4JBWA 4ZI7F 2MO1A 4R4CA 1C48A 5KYIA 3CCSA 4FS1A 1SYEA 2Y0SA 5DLFA 3PUXA 4DR2L 2WP8J 3NTHA 3KHHA 3H94A 4LF5Q 4LF7Q 3KLWA 1JE5A 3J7AF 3FPUB 3K3PA 2K1BA 2LXJA 4OELB 5DM63 2VUMB 1AE2A 1NAPA 2IW3A 4J15A 1C7YA 3CC7A 4JI3L 1WTRA 4DL7A 3N6RA 4DR6H 1TWCA 5DQGA 1TIID 1U0LA 3KDFB 1S4ZA 4QY7A 4XYOA 3IFDA 1NR4A 4C2MH 5C44H 1PH3A 1C0AA 2FB9A 3S17H 2R93H 5FLXL 1EIYB 4LK1C 2F0UA 3D0FA 3GTMB 1Y1VH 1UNNC 4JBJA 3QR8A 1GJXA 5EDWA 2F0NA 2EJMA 4POFA 3H0GB 2EDGA 3MHBA 2PQAB 5GROA 1W3SA 2ICEC 1BR9A 2DZDA 4B3SL 4DV0H 3NTKA 3I56A 2KENA 1QUQA 5I9OA 5JJZA 1IBLL 4A75A 3DM3A 4JV5Q 2WAQB 3LGJA 1NE3A 3M9BA 1E4EB 2WB1A 4U6PA 1JJCB 2RHSB 3OHXC 3A5UA 3M4OB 1B6SA 4MNOA 2HHHL 3M4OH 4K5VA 4C3IG 4QCLA 5FPRA 1KDBA 4QW9A 5FLMH 3KHRA 3HKZB 3HOZH 4GOPA 1PYSB 3AYHB 4HNVA 1PYWD 2BQRA 4K2KA 4K0KL 1DIKA 2A8VA 5C0XH 1LTGD 1EYCA 2F0JA 2E74C 4X3UA 3GTQA 2D2CC 4HAEA 1TXYA 4XYQA 1PH6A 1J5EL 2NU7B 2D9UA 1SXTA 3W1GA 2BOSA 3GTOB 3ETJA 2FLPA 3HB9A 1FJGQ 3L2PA 3J80c 4MV7A 2J6UA 1TWAB 1Q1BA 3VR4A 1IBML 2JA6A 4HSPA 4C5AA 4EFEA 3D4RA 3PF5A 1IKMA 1AP0A 2C00A 1O7IA 2WV6D 3D4WA 3K5LA 4DLKA 2FXQA 4ECQA 4R4IA 1HZCA 2WDTA 2ASDA 1PX2A 2E75C 4JV5H 2GA4B 1KBLA 4RGMA 3HKSA 3IKJA 2K6AA 1G51A 4C3IB 5C0XG 3RAXA 3HOUB 5LA6F 2J6SA 3OWEB 1SNPA 2R7LA 4A3DG 3HOWB 1SNCA 2NTSA 1BOSA 2V4DA 3TSSA 4ZYSA 1HNWQ 3K5MA 5ISRA 2J6TA 3WOFA 2HUGA 3OIPA 5DLQE 4KJNA 2SCUB 2E2IA 2ZDQA 1AW7A 1W93A 2F0FA 3RLOA 1A3VA 1SROA 2F4VL 2ZXRA 4JUZA 5CYUA 3G71A 1MSGA 4G4KA 4AYBB 5CMDA 3VPDA 2VUGA 2XCPA 2VQFL 2Z6BA 1TWCB 2RVLA 3R5HA 4ZOLF 1SN8A 2EYLA 4O4IF 1MIUA 4DR6Q 3KDFA 3RB3A 3HOUG 5L1JA 4DK0A 1Q82C 4HIDA 3JRXA 4MV9A 1AN7A 2UU9Q 2LFNA 1R9TB 1PHJA 1N33L 3I73A 1BNZA 1XPRA 4IN3A 1Z47A 1FNWA 2OTJA 5JJLA 1F2YA 4HMJA 1M4VA 3BDLA 5I2YA 1SYFA 1Z2PX 3RTXA 4KHPL 2OT2A 3DXJC 1IW7C 3UDIA 2UUBL 5E1FA 1HNXQ 2NVQH 3SK5A 4O4LF 2H5XA 2VQDA 5KT5A 3EVQA 2YRXA 5GONF 1UE5A 4IOAA 1KABA 4UDUC 3PIO3 1RKNA 1S68A 5EPKA 1B2TA 4DV3L 4I7ZC 5KFYA 1HH2P 3C2PA 3K5IA 4DUYH 2DY7A 4JYAH 1GHKA 2XGTA 2NZOA 4Q0YA 3MXNA 3N41B 4H0LC 3NP8A 2R8KA 2QILA 1K3RA 3E5SA 3V05A 1VQGA 1HUNA 4MV1A 2EJFC 5C0XI 2IX1A 3N42B 1YNND 3CCQA 4UCOA 4DK3C 5KFVA 2JA5H 3I2ZA 5D3DA 1QNUA 4ME5A 4Q0FA 4DR1L 4L8JA 4J9SA 2CCZA 4DAYB 3R3OA 3CCEA 2VPQA 4LMYA 3LNNA 2OTLA 4DFAA 1CM9A 1K1SA 2RDJA 2C28A 3CCUA 2MO0A 3H4BA 2CQYA 2DLNA 2BR0A 4UPAA 2WB1G 5KT7A 3MR2A 5JAVA 4KHPH 5IYBH 3BG5A 4A93H 1A63A 3SGIA 4BY1B 3F1ZA 5HGQA 3N40P 1WTPA 2F0WA 4ZRZA 3BAAA 1LLRD 4I7HA 2EXDA 1A6XA 2IX0A 4A3BH 4OXPA 2CW0D 5I6WA 2PNHA 1B3QA 4IQZA 2BQ3A 1VKZA 2B8FA 1GUTA 2QEJC 2IPKD 3FRPB 3MAQA 2Q2TA 4EQNA 4P75A 3K7AB 2K52A 5KYLA 2JA7H 4I55F 4RH6A 1C30A 1AN8A 1U4PA 5C3EG 1KC8C 2A19A 1H9JA 3HOWG 3RBEA 2R87A 4DU9A 1SJHD 4FO2A 4AQYL 4FS2A 3T13A 3C3LA 1R4QB 1DXMA 4J9NA 2ZM6H 3VYRA 1R9TA 5M3MB 3WO1A 5JEAH 2YZMA 4C2MA 4YJ3F 3KHLA 1K73C 1I6VC 1PRTC 4AH6A 3S14H 2YCHA 1STNA 3I4LA 4UAIA 2VUMH 3I4MB 2RGRA 1ESFA 4ZQIA 1PXUA 2FKLA 5DAUA 4C56C 4ALPA 1PFMA 3CVZA 4CKCA 5DQIA 3GIJA 1FNUA 3SK4A 3W1BA 1TS4A 4ZCKA 4IFDI 3OHBA 3ZYYX 2XC9A 1EEID 2CQAA 4J1MA 4R9WA 3RF2A 1ZETA 1KNAA 2W6PA 4DAVA 4DV1L 1CKNB 4HCSA 4ECTA 3HGBA 3RV4A 4GC6A 2ASJA 3H0GH 3GV5B 1EQQA 3AFPA 3U9OA 4LFCH 3PO3H 1M8AA 1NMFA 1CA5A 3GTKB 4QUCA 2YTVA 4DV6L 5E4XA 1BQQT 3QB3A 1C4QA 1XX8A 2F3VA 3E3XA 2K5DA 4A3EG 2EY6A 4MTNA 3K58A 2A68C 4IUVA 4X3TA 5GAEC 3TMEA 4BWSC 3WOEA 1B6RA 3GQBA 1U4RA 3RAQA 3I7FA 4QWEA 2Q8RE 1WTWA 3S24A 1SYGA 4BBSH 4APMA 4I65A 3M4PA 4DAYA 2ATWA 2B63H 1LTTD 1XMOQ 3H0GA 2R8JA 4KY6A 4C3JB 4XYMB 4KLKA 1RJRA 4A3DB 4JOIC 1PZKD 4IRDA 1PZJD 4JOIA 1UEBA 3JSLA 4ECZA 1Y8OB 4BY7G 3BQ0A 1HQMC 5IGDA 1K1QA 1R9TH 2I8CA 3RZOB 5M9OA 2UXBL 4XZ3B 1XNRH 1MSHA 4O0AA 4IFDJ 1JWUD 5IP9G 1XTCD 4EQPA 4IJLA 3I8ZA 2VNUD 4HCEA 1FGUA 3OOCA 1B33N 3I3CA 1RK6A 4IRKA 3I91A 3T16A 2BA0A 3MFYA 5AFWA 2V9WA 1EWHA 1IOWA 1NR2A 4E4TA 5FD5A 3ND9A 5L1LA 3QOLA 3KF6A 5KFJA 4RZQA 4YCUA 4WJ3M 4APVA 2MP1A 2WE6A 1V43A 1KXLA 2R6FA 3PO2B 3K80C 3I90A 4O3PA 1VQIA 4ETSA 1HFGA 4JI0H 2IA6A 1H9KA 1PTOD 5EQ0A 1SAPA 2UUBQ 1VQ6A 5BPFA 2KOLA 1TVXA 4IFDG 1LTSD 4FXDA 4B3RH 5LMUH 1QG7A 3VA5A 4YBZB 3DWQA 2V59A 2LY7A 1MZBA 2SDFA 2VS1A 3N8DA 2WAQE 3E6ZX 3QIAA 1QVFA 4DUZL 1VQNA 4JC0A 5KFPA 3S2HH 3NBHB 4DR7Q 5IWAH 3O13A 1TWGA 4GKKH 4K0KH 5EPJA 1YJNA 1BGWA 3J81c 5JJKA 2K7VA 3P20A 1S5CD 2C2RA 3M9MB 3EPGA 3MR6A 2EY5A 4I7AA 1K8OA 5T1GA 1HJPA 1YJWA 5ELCA 2B39A 2F0DA 1EYDA 5JEAG 2JA8B 1SE3A 4IRCA 4YR0A 5IGGA 1W6JA 2YU9B 1JJ2A 5M5WH 3G4SA 4GNXB 2I80A 5IWAQ 3NELA 1EEFD 1KDCA 4B9XA 4C3JG 5CR3A 3FMAA 3MEHA 5KEEA 2YTXA 5C5JA 3JAML 3V6KA 1HQRD 2PI2E 2RF4A 4EGVA 1KAAA 1EQRA 3G6EA 2NUAB 5IP7G 3M4IA 5IIFA 5EOYA 1TWHH 3L7ZC 1VQ5A 2NB0A 1JLLB 3G6YA 3CKIB 1TWCH 1HXYD 1BKBA 4A93G 4IJHA 5LXTF 4HJAA 1XNRQ 4BWGB 5KFQA 2JN4A 4KD4A 3M7NA 1SRUA 1HCZA 1X3FA 4J9QA 2BH8A 4H02A 4DAPA 1UE6A 2A73B 5KFKA 1X3GA 3D4DA 3KF6B 3UI2A 1WI5A 4ZK9B 4LF4Q 3H3VI 1Y1VG 1YHBA 3JRWA 2KQ3A 4DV7Q 2UXBH 3T1YQ 2E2IH 4JI6H 3G6JB 1DCZA 2LSSA 5DGAA 1AZPA 1G2TA 2ATLA 4DV5L 2B2WC 5G3LD 1Z6HA 5J39A 2RSNA 1EY5A 1M90C 2R7ZH 4DA2A 2M2LA 5D14A 2WIIB 1EU4A 4GLXA 1EUJA 3HZXA 3HOXG 2NN6G 2PZTA 1SFOB 2C2DA 3HRZC 1GYFA 2B3GA 3J81j 4LF8L 4LF6H 3M9OB 1S97A 2WB1E 4KY5A 3BU2A 4DR4L 2W9BB 2AGQA 4WJ4A 4QWAA 1KJ8A 3W5OA 2KEEA 1TWGB 1XNQH 1I50A 1JWSD 4MN3A 3GTPA 5EBCA 2I5LX 4RUAA 5KFFA 1Q12A 2YYAA 1MJEA 5DQHA 1K83A 3U9SA 4ECXA 3ORQA 1K3BC 4CJ2C 1YBYA 4IR1A 2AKWB 1RK5A 3WWVA 5C4JB 1DGSA 3ULJA 1A15A 5LL6b 4ECWA 1Q1EA 3CU7A 1P16A 4JW0A 3QZ8A 1PV4A 2R84A 2K14A 2PMZE 3MXPA 1S0OA 3BABA 4IZ8A 3N43B 4L5QA 4OHJA 4A3BG 2AMCB 3BZDB 4GZYC 4X64Q 3Q24A 4BBSB 3U4ZA 4HYKA 2OCEA 1CKNA 4XIGS 2CW0C 3S16H 2XRQD 2CQOA 1JQYD 2A1AA 5ELEA 1CQJB 2B2YC 2J9GA 2Z4IA 4G7ZC 4DR5H 4O2AF 2BE5C 3OWFA 3Q8PB 4IUTA 4UP7A 2UXDH 3TN2A 2Q2UA 2JA6H 3A8KE 5I47A 4K8JA 4A3JG 1PTOC 4IWXA 3VYTA 2F0OA 1NBWA 2KCMA 3CC2A 5KFLA 4A3GH 1X65A 3SE7A 2VB3X 1B7YB 3C46A 2J4XA 4FF1A 3QO2A 5IODA 2R93G 1X3EA 4ULLA 2ZXOA 4KKSA 3TS0A 1N8RC 5HY6A 4LF6Q 3RJ0A 1ML0D 5DG9A 4P73A 3F2BA 4RB1A 3MXUA 2W7OA 3V6JA 1X54A 5FJ8G 5J1ZA 2L12A 4C5CA 2EIFA 3ND8A 4YHHH 2I5MX 5LHY1 2I87A 3KALA 1KHIA 3NK9A 3CW2C 1XPOA 2L0CA 4EYHB 3CXCA 5C3EH 4MTEA 3K7UC 1CZWA 3UE1A 3EYYA 4LFCL 2ZJQA 5LP6F 2Q2HA 1N34Q 1D5ZC 4OX9H 3KBGA 2K5HA 3CCVA 4O3OA 2L4NA 5KFBA 2K75A 4JYAQ 1JJGA 3GTGA 3RNUA 1TWHA 4BY7B 3CCRA 5E3FA 3UE0A 4EVOA 5KFRA 1CHPD 1S40A 1Q8IA 4P2CB 1XWEA 1OXXK 4E6IA 2EYMA 2F4VQ 3BJUA 3NWSA 1STGA 1VQLA 1I6UA 4OO1H 3RIZA 3MEFA 1S5BD 2MPMA 3GTJH 2QEXA 3PO3B 1HNXH 1RD9D 2HVSA 4NB3A 1HNWL 3VR5A 5IGEA 4F4XA 4YY3H 4IPDA 2Z6KA 2DPIA 2MNAA 5KFEA 1BCPF 1WCMB 2XVSA 5CV8A 3TIGA 1HZAA 3F2DA 4EYIB 1CSPA 1ZHSA 1AEXA 1Q46A 4A3EB 4K0KQ 3VA7A 4CDCC 3L9AX 5JH7F 1E1OA 3G6XA 1L0WA 1ICWA 2EYPA 1K28A 5DG8A 2G9HD 1KRTA 1EYZA 4J0MA 2VQFH 1PH8A 2R93A 2R7ZG 4X3SA 1Y69U 4R1JA 1WTHA 4J6HA 1ENCA 3BDCA 1BCPD 5E4WC 1A3UA 1KJIA 2E76C 4X64H 1SBBB 1E2ZA 1I50H 4QGUA 3NBHA 1W96A 3EIVA 5KT6A 1N33H 1JE4A 4JI4H 4OONA 1WFQA 3B6YA 4LFAL 4NXNL 1FD7D 4A3CH 2J7ZA 2NVYH 4GKKQ 1Q3LA 2R85A 2F0PA 2E2HH 4FF2A 4JI2L 4DR5L 2Z9HA 1K0SA 4B9WA 2RDHA 5LMNL 3V4ZA 4LF4L 3N44B 1VQ8A 4HN7A 2IWHA 3Q8RB 2V1CC 4Z9CB 3EFXD 5JVG3 1VQBA 2WAQG 4LF5L 4LF7L 5KX5F 2D0OA 3PO2H 1BNCA 5C3EB 4CDEC 4JBMA 1EY0A 1HR0H 2F0LA 2RDGA 3RB4A 3I70A 2PQAA 2A6ED 3PR5B 3J7AK 3NSWA 2ZJPA 3CF5A 4JYAL 2R92H 3K5OA 3CRLC 2C5CA 1U5KA 2VY3A 3PQIA 3G7LA 4CC5A 4UCRA 4BBRG 1ZKOA 2VB2X 4BS9A 3J80i 5JVLA 3MVVA 3GV8B 3RLNA 1KC7A 1JOKA 1RHPA 3DLLA 5CBEE 2AGPA 4DGZA 2C2EA 5LL6S 1F2ZA 3HKZA 4RNNA 4J9RA 2RCFA 4DV1Q 2NVTB 4GN4B 3GTGB 5M5YB 2AHOB 4JI8L 1TWHB 1J5EQ 1O7ZA 1YITA 1VAJA 4GKJL 3S9WA 1TR5A 2JE6I 4YHHL 1EL0A 3PW2A 1A8VA 1B70B 4LUZA 4DL6A 5KFIA 4LWCA 3RR5A 4R8IA 1IBMQ 4A3DH 4IWYA 5G3LF 1TWAA 3JAME 2NU6B 4YHHQ 4ED8A 2YTYA 2FMCA 1UUPA 2PPBC 2IBKA 1H95A 2AQ2B 4IR9A 2GPWA 4DR5Q 4B3MH 3OHAA 5IYCG 5KG2A 2CFMA 4C3HH 1MBYA 2EQSA 3Q6SA 5I6YA 1PMRA 1YZ6A 4F8MA 2R92A 2NZ1D 2W9CA 1PZID 2KCCA 3X3MA 1N36H 1CZGA 2KJXA 1Z9FA 1N32H 3KFUA 2JA7G 3IL8A 4L6TB 1AFPA 4YAKB 1SFOA 3K5HA 3QWNA 3CPWA 2CH4A 4X62L 2KHIA 3HOVH 3FKIB 2K05A 4IO9A 2BDOA 2PMZB 1F77A 2VQFQ 3GTKH 1VQOA 5GAGC 3V96A 2L55A 2DJFC 2DNCA 1I50B 2E2HB 4J9LA 1QVGA 4ECVA 1H9MA 3SHLA 2AQ1B 3PN1A 1LABA 3PR4A 4OIJA 1GSOA 4XQQA 4HNTA 4NLGA 2YRWA 1F9QA 4F4ZA 1B44D 3L3OC 4P71A 4H44C 5IYDH 2N49A 4O42A 2LMCB 4A3FB 2DWCA 2W6MA 2EY2A 2UUAL 2MQHA 1CFMA 2R6GA 1Y14B 4A3EH 4A3GG 4CDFC 3EJIA 1GUSA 1YHAA 1BJTA 2YS7A 2Q2IA 4WRDA 3J80E 1VDZA 1JT8A 3HOZB 4EQ5A 1XMOL 1A2UA 2D5DA 3M85A 2YYZA 3H3VC 1MI2A 4AYBG 3I55A 4LW1A 3R23A 2FFKB 5KT4A 1PVOA 4G3IA 5EKIA 1NNXA 4LH7A 3S1NH 1EWIA 4Y7NH 4LJZC 2R92G 2A6HC 4PZ7A 3GIMA 4J9KA 4X62H 4TRDA 4CJ0B 3VDYA 3J80L 1HRJA 1G6ZA 4CC6A 1JIHA 2QKIC 5M5XH 4DR4H 1SYBA 4QL5A 5IYDG 1N9WA 2LS01 3MXNB 4RFBA 4QWCA 2A6EC 1V9PA 2F4IA 3FEWX 4DV7L 3HOYB 1II3A 5H80A 2XNAC 4TKOB 4Q43A 5FO7B 3MWMA 2OF1A 4X66H 4WORA 1SNQA 3T5HA 2PW5A 1OXVA 1TQOA 5BR8Q 5KFWA 1EQVA 3A8IE 2Z8LA 2DY8A 4ILWA 1MGSA 3LWUA 5KFNA 1GVPA 3W3AA 2R92B 1H9SA 2DGYA 4JI8Q 2KCTA 4CKBA 1AH9A 1DZ1A 1PTOH 4GKJH 2TMPA 4DV3Q 3FHWA 2BDNA 2Z0SA 2OEOA 1K8AC 5IT9W 1L1OA 1V8QA 1EIFA 2MFIA 1VQ4A 2CVRA 4BBRH 4IPHA 3STBD 4YJ2F 4G57A 4QB4A 3E0EA 5IGFA 4B3TL 5KFCA 1J8IA 3TBIB 5EPLA 1ILPA 4O3QA 1N32L 4N9PA 4ZQ3A 1WR2A 2AU0A 1S72A 1E7ZA 2KA7A 3WDNA 4H7BA 4ME3A 3BA9A 3S16B 2PI2A 2CW7A 3IG0A 4AIMA 5KFDA 1DV2A 1PA6A 3D6WA 1JDEA 2DNEA 5LMNQ 1IW7D 1UE7A 1M6VA 1A9XA 4BA2I 5J3BA 2NVYA 1EY8A 4ODGA 2DJGC 3CRKC 1EZ6A 3PGZA 1LM0A 1A2TA 1N48A 1DOLA 2ZJTA 4RG1A 4IZOA 4X64L 3GV6A 3RN2A 2CZGA 1VCIA 1SMYC 2SOBA 3F8NA 1BBWA 4EGQA 4TSSA 5BR8L 3T1HQ 4A2BA 5KG4A 4PQXA 2ICIA 1I94H 3SI8A 3J81i 4L1KA 5I4DA 3I4MH 1HNZQ 3S14B 2JA7B 2KBNA 2ZJRA 1JC7A 1NCVA 1VMCA 2C35B 3PIOA 2VUMG 4JBKA 2IMWP 1SR3A 1GD7A 2PCFB 5EKLA 3SXHA 1HNWH 1MJCA 3RV3A 4YY3L 3T5LA 4C1NK 2F3WA 3BYTB 3I4NB 1Z2OX 1T5EA 5HURA 1PK8A 5C1OA 4B3TQ 1OTCA 1M0TA 4KK7A 3GDEA 5J2UF 4AQYH 1ET6A 3CC4A 1V1OA 4JI6Q 4OX9Q 3SK6A 3HOVB 1S03G 5ELBA 1BXTA 1SLJA 3ZJYC 4YY3Q 5IYZF 1X3QA 4IHJF 3PW5A 1JDBB 1L2ZA 1E2WA 1J5EH 5CV5A 2Q8TA 2BA1A 1KL9A 1PFNA 1YNXA 2HCCA 1YJ9A 5T14A 5IP9H 1CT1D 4DV1H 1G8ZD 1CK1A 1B04A 3U58A 1JXLA 5FLXc 5EWGA 2VA2A 3TRZA 1CKOA 5D3IB 5T1IA 3JSNA 1Q8KA 2EXZA 3J7AV 4JI3H 3OIQA 3TQ1A 3C1FA 1H9SB 2AWNA 4NP5A 3R5FA 3R2IA 5KIXA 1VQHA 4CHTB 1ULZA 3FDTA 5CB4F 4DKAC 2UXBQ 3JAMW 2FK1A 3SE0A 3NHHA 1KLGD 4KN4C 2AGOA 5KFUA 4I4TF 5K36G 4XX0B 4ED6A 4X66L 4DV0Q 1DM0B 2IT1A 1FVIA 2R8HA 2B2TC 2BCOA 2WFWA 1LTBD 2R7FA 3G48A 2NVTH 4JI5H 4B3ML 4DR2Q 3T1YL 2GPSA 4ECYA 1AUVA 1EIGA 4C3HB 2M05A 3ERQA 1M1KC 3IFTA 2YL2A 3A55A 1EIHA 5KG7A 1HNZH 4B3SH 1WCMH 2VUMA 1X55A 1S5ED 3J7YW 3HEJA 2Y0SG 4IALA 5C4ZA 4WFN3 1FKAH 3T1HL 5DGBA 1SE8A 4DF7A 5C4XG 2K33A 3SDZA 2A69C 2JSOA 1KIXA 2AQ4A 4XXEA 5IGCA 2EE1A 4B3TH 1V4YA 1YI2A 3PV0A 3GTLB 3ER0A 5A2QE 3GV3A 3H6MA 1VQPA 4EG0A 1TAEA 3E0JA 4DL2A 1RJPA 3UFXB 2OQ0A 2M00A 1L1OC 2FK2A 1SJED 1RCVD 2A5HA 1TY2A 4GN3B 4HEDA 4YQWA 1OXTA 1LT6D 3DWPA 3A7LA 3S2DB 4B3RQ 1PH2A 4A4IA 1WTQA 2JEGA 4GS3A 1H9RA 1HPCA 1X32A 4F88A 2MGSA 1WCMG 2A74C 3KJPA 3ICEA 4Q44A 4A3MG 2UXDL 2EPBA 3RN5A 1E0BA 1X56A 3CAMA 4TQUS 1PTOB 2VOBA 2YZNA 2JEJA 5L1KA 2B63B 3AMUA 4ED0A 3R5XA 1SEIA 1STYA 4JI5L 4HIKA 1KAWA 3MWDA 4I50F 2JA5G 3K57A 3OUZA 1K83H 1DONA 2HHHQ 3KUPA 5KT3A 5CA1F 2FJ2A 4Y52H 1QCBD 2F1MA 5DLGA 5FLXW 3S1MH 3GTPH 4OGQC 3HOZG 3JZIA 3ONAB 3PUWA 2W71A 1DJRD 2YV5A 5FO9B 4UFZA 2R7KA 4IUUA 3KBXA 2VL6A 4A3GB 5ELOA 2HQEA 2I07B 2R7MA 3NXWA 1IL2A 1STHA 1HA6A 4R8UB 1MD2D 3BZCA 1N36L 1VQJA 2JA6B 3OMGA 1E4EA 1BCPB 2ZXPA 2WAQA 1KNEA 1TU2B 2HD3A 1M7JA 2WKDA 1BBXC 4LFBQ 3D3RA 4GKKL 4RZRA 3K7AH 4UP9A 2WINB 3NPPA 1PH1A 4BXXG 4GOPB 4GKJQ 1RJQA 3PIP3 3D8GA 4OO1G 5M3FG 3MTSA 3JAMi 3TS2A 5KFTA 1U4LA 1Y1VA 4TQRA 2PZUA 3SR1A 4G7OC 2JA6G 3KK7A 1GSHA 4FF3A 1HFNA 1NY4A 3AEVA 5KNCA 2JEBI 1JWMD 3AFQA 3LWEA 1T94A 2YZGA 2M9VA 2B8GA 2MCTA 3HKZE 2FJZA 3DWAA 1STAA 1DOKA 2L11A 5KG5A 3MZ5A 4J9OA 1QILA 1S9FA 1KEEA 2IP4A 5EWFA 3RB6A 3CCMA 2F0IA 1AUXA 3V4SA 5EGTA 2UXCL 1HHVA 4AYBA 3FP9A 5FKAC 3GTMH 1SYXB 4JCVE 4DV5Q 4DR3L 1K9MC 2QW7A 4YWLA 1VQ9A 3PMFA 3J81E 1E22A 5IT9E 2R8IA 5JUMA 3LX0A 1G91A 1GM5A 1TWFB 2B2VC 4LF8Q 3AB9A 4HSVA 1IHZA 2K32A 1W6KA 1IZ6A 2KCNA 2ZM6L 4V190 2YW2A 2YU9H 2F0TA 2JK8A 5ELNA 3KLSX 4FNFA 2X6LA 2XCAA 3GV7B 2I0QA 2ALYB 2F0QA 5HBRB 3DUZA 5EJWA 2P5ZX 2R86A 3DEOA 1CE8A 4OWXB 4LNQA 2V5AA 2AUJD 2AQ3B 2F0KA 2PO4A 4BY7H 2UVUA 2RQXA 4ECSA 3GTPB 4MV4A 2EY1A 2XCLA 4O4HF 3RBDA 2B63A 3Q8SB 3I4OA 3H40A 1TWAH 4GLAC 3RUPA 4ECRA 3Q1KA 1CQIB 1NJIC 3S1RH 3HFZB 1N33Q 3GTOH 2E5LL 3BYYB 1SE2A 1I94L 4LFCQ 2NVQB 4QQBX 2FE3A 3J81L 2HIVA 3GIKA 4RKBA 1D6EC 2CWPA 1C8CA 1BXRA 5F2DA 4CGYB 3AQQA 3JC66 2K5QA 4RUCA 1KJJA 2W57A 4L5SA 1SEBD 4RB0A 4DUZQ 3MWYW 5D1PA 2B2YA 2QK4A 5DM73 4YCVA 1SNMA 4L5RC 3U50C 3VMMA 4DV4Q 1PRTF 4A3MH 4MTKA 4DXGA 1E1TA 3S15B 4RGTA 3TIIA 5J22A 2F0VA 4KJOA 5M3MH 2VQEQ 4NW2A 4LF9Q 2E2JB 1RYSA 1Q90A 5C1PA 1YNJD 4LF8H 3H3VH 3NBIA 1XNRL 1HR0W 5BN5A 1EUDB 5C5MA 3PUVA 4PMWA 2K5NA 3HS0C 4Q5VA 1WYDA 1Y1VB 4PZ8A 4LF9L 3TREA 1PYBA 1STBA 3URYA 1LUZA 2B2UA 2UU9L 1DD2A 3FDSA 5KKNB 1IL8A 5DNFA 4JI7L 1B4OA 4FXGC 3Q22A 1I3QH 3G8CA 1AZQA 2NWGA 2HVRA 1XXGA 1EUCB 4JV1A 1LT4D 4DPGA 2OWOA 5HV6A 1S5FD 3EROA 3I12A 1WTVA 4EBEA 1GLVA 2PNRC 4K5WA 1QOHA 3PF4A 1J6QA 4ZHQF 5KT2A 5EKKA 4DV4H 1JB3A 3SEBA 2RDFA 2OLSA 3HOVG 4O3SA 5BN3A 4JI3Q 1C3OA 2K4KA 4OIKA 1G2SA 1D1KA 1LACA 3A74A 2ZDGA 2PW7A 1UWVA 1CUKA 1VMPA 4K6DA 4K2LA 2UUCH 4YCWA 5C5LA 5C4XB 4YWKA 2ZDHA 3N6XA 3A7AB 4LMQD 5CAEB 2CWAA 5FO8B 1A3TA 3VR2A 3QG1A 1EYAA 2ZT9C 4GN5A 3M9NB 1D5XC 1WD1A 3K3VA 5L37A 4DR7L 1EZ8A 3RGZA 2KHSA 5BN4A 2R82A 5I2XA 1XMQQ 2BH2A 5KFMA 1LO5D 1GHJA 2R7ZA 1D1IA 5AJ3Q 2NN6I 1KDAA 1SE4A 2IHEA 3T51B 5FJ8H 1I3QA 1BDOA 4HJ8A 2I46A 4DUZH 3Q0AA 4DUYQ 1XTDA 2HDMA 2D62A 1EQTA 2UU9H 4JI7H 1A0IA 1ZYRD 2H4OA 2N3SA 5M3FB 2G5DA 4HMIA 3QFFA 4YB8B 3MR5A 4P74A 2ALZA 1BF4A 2VXWA 3K81C 1HUMA 2X69A 5CV6A 3MA2B 1G6PA 2CH4W 3I4NH 4CJ1B 5KFAA 3KF8B 4DAMA 4X65Q 4JPBW 2UXCQ 1WTXA 4F4WA 2JA8H 3PUZA 1VQMA 3ETHA 2UVRA 4KKUA 1SNDA 5K36H 3VR6A 4MV8A 3VPBA 4HJ9A 2Q8IB 2R93B 5HGTA 1T5XD 4EBDA 3A56A 4RMFA 4CDDC 1WSCA 1RYRA 1JCKB 3HOYH 1HTLD 3LMLA 1QE6A 1S0MA 1BO0A 1D2BA 1G291 5KFSA 3M3YH 4J8QA 4DR2H 4JI7Q 4OX9L 3M3YB 3MFIA 4RA8A 3F8TA 3GTKA 4B08A 1VQCA 3OMCA 3H20A 2IY5B 3BQ1A 3H09A 4A3KB 4XQNA 2CW8A 5M5YH 2ZTDA 5EAYA 5FD6A 2HIXA 3T1YH 5JPNC 2RGVA 1N34L 3BS1A 1WTOA 3KHGA 3FVQA 1IYJB 1TWGH 3KLRA 4BA1I 2WTFA 1W2BA 1EY6A 2XWBB 3M7GA 3N52A 1T36A 4A3BB 3A0JA 1SYCA 2F0SA 5CV7A 1U9RA 1FR3A 1E4FT 1O75A 2UVWA 2KECA 3T53B 4V0BA 1O7LA 2W7PA 5K2MA 3HG9A 1PFSA 1I6HB 5M5WB 1GXDC 4JI1H 4ZLTF 5IWAL 1GUWA 1I4QA 4O3RA 5C4XH 4IUQA 2RKSA 2FLNA 1DOMA 5LL6X 1RL2A 3R8BA 1IOVA 1ZXTA 3IRBA 4YIJA 3BVGA 4TVAB 2EJGC 4JI6L 2GN5A 3J80W 1JMCA 1OWTA 1TWFH 4LF4H 1JICA 1GKHA 3OTOQ 2Y0SB 2QCPX 2IHFA 2HGSA 2UXDQ 3OSOA 1TKWB 1TS5A 5JOBA 1ESRA 3PW0A 3EN2A 4HNUA 1MHWC 4O1NA 5ELDA 4LF6L 3K6OA 4PZ6A 5LOVF 3MR3A 3GO5A 4DR1Q 5CA0F 5CGKA 1I3QB 3P7JA 1GUOA 2N88A 5IY0A 3HOXB 2FP4B 4QIWB 3T5KA 1I94Q 5CV4A 3T56B 2FPGB 4A2AA 5EWEA 2Z6KC 1S0NA 1DYQA 2ZTCA 1XNQL 2JEIA 4IOCA 2GVBA 4UCUA 4KKTA 1B1ZA 3E9IA 1I5FA 2MHVA 4EEYA 4ED7A 2B2WA 4IFDH 1TWFA 2B63G 2NZHA 2HHHH 2VR1A 4JI2Q 4PG3A 2FHTA 4A3MB 1EFID 4WBNF 3NQIA 5C44B 2I5HA 2XRSD 4MA5A 1CS0A 5KFHA 1EFWA 4N9TA 1F2LA 3HP3A 3L4JA 3FKIA 2V4QA 1LTAD 2PMZA 1ICFB 1WH2A 1Z7TA 1X6OA 1LT3D 2YU9A 1XMQH 4FF4A 1K8GA 4A93B 2OQKA 5GADC 1IBKQ 4HJ5A 1EY7A 2K5WA 3TEHB 4X3KA 3HOXH 1Y1WG 3HOYG 3NE5B 2K50A 2PQEA 4ME6A 5JQWA 2PBZA 2SNSA 1PH9A 4R8NA 3CD6A 1ILQA 4DV5H 4OO1I 2FINB 2RHQB 5A35A 5CBAE 3VYSA 2K04A 4F4YA 2F4VH 1D8LA 4JV5L 3KAKA 4KN7C 4M1UB 2NVXB 4FP5D 3RB0A 1RTNA 1VF5C 2MJ8A 1UE1A 5CORA 4YAJB 4RB2C 1FGBD 1K8MA 5GAHC 5KFGA 1OXSC 1RODA 2XWJB 4C3HG 1HR0L 2O5IC 4QMGA 4ED2A 3T5JA 4C3IH 3JAMc 4Q8EA 5C3WA 4QW8A 1NUCA 5LYJF 4DR1H 2QDBA 4L5TA 3UDXA 1VBHA 3D6CA 3GILA 2R8GA 4ID6A 4UHVA 4O2DA 4RAUC 3UDGA 4JI5Q 3TP6A 4PMBA 5I9PA 4KMUC 2YS6A 2NYZD 2N78A 2W8KA 3ULLA 1E24A 1U4MA 4EBCA 4F87A 2NU8B 3CCLA 1L0XB 2UUAQ 1MKHA 2XD4A 4FBTA 3BVZA 3PUYA 2UUAH 1TY0A 2CKZB 2E8GA 2O5JC 4BY1H 3CCJA 3GIQA 2OH2A 4JK1C 5IGBA 2W9AA 4R4TA 4XYLB 1FJGH 2IX3A 1HNZL 5C4JH 3MC0B 3VYUA 1Y8NB 2W9BA 3M4QA 4PV1C 3ITPA 4N8X1 4EX5A 3FKIG 4PWQA 2C9OA 2A68D 4MHEA 1EOVA 1CA6A 1VS0A 3MWEA 3PW4A 4F7XA 3PW7A 5C0XJ 2PN1A 3P75A 4RB3C 1R4PB 1LTRD 3CP0A 1HZ9A 3NTIA 1WD0A 4KI0A 1LTLA 2EYHA 1I4XA 2Z4HA 3OTOL 4LH6A 4RAZA 4LUVA 3CMEA 4MAMA 4X62Q 1XMOH 2FPPB 4LF9H 2QGQA 4WD3A 1FNVA 3L4KA 1WJJA 4DV2H 5D1OB 1YNJC 2L5TA 2XSCA 4KHZA 4AQYQ 1D5MC 4HIMA 2R3ZA 5ELFA 3IAYA 3EQLC 1B9NA 2E2DC 2RSOA 3FKIH 4NKLA 1RDPD 4ECUA 3PIPA 4B3RL 1A62A 3GQCA 4EFBA 3HOWH 1VQAA 3KOJA 3GLKA 5KFOA 1Y1WB 2R7ZB 4JVZA 4RHRA 1SSOA 4HR7A 3U9TA 3STBC 1HZBA 4DNIA 1LYLA 1GUGA 4O3NA 1F9RA 2GVAA 1K83B 1M0WA 1OO9B 2R7DA 5CC4A 4X6AH 2EOTA 2JEAI 5NUCA 1SMXA 2HQLA 1EY9A 2NVYB 4QUFA 5JVDF 4J9PA 2C22A 4OWWB 3TP7A 5C44G 3BA8A 2NVXA 4B3SQ 4FBUA 3V2TA 3KF8A 1IBLQ 3GTQH 2VZAA 3K0XA 4M7EA 1JB7A 3D31A 3Q8DA 3MJFA 3P1HA 1XYIA 4JI2H 4DR7H 5LMNH 2LKVA 4DV4L 4TUYF 3ULPA 3OTOH 2R61A 2OXPA 4A3LH 4MV6A 1BCPC 5D65A 3OSNA 2ZM6Q 3KXYT 1N34H 3CPFA 2UUCL 2XGQA 2K28A 2SNMA 1B9MA 3FMCA 1L2FA 3RD4A 3Q8QB 4N8FA 4X66Q 1TS2A 4DV0L 4ZUJA 5EBDA 2F0MA 1PRTD 4A3FG 1TT2A 3IN5A 5IT9L 3K8AA 1Z2NX 4GLVB 2UUCQ 4PDBA 3MXGA 5FOBB 4LFBH 3GTJB 5M3FH 5KNDA 3DM1A 4IPGA 5H1SE 4Y7NB 2QYZA 3ORRA 3J7ZC 1F2MA 1YNNC 1YHQA 4JI8H 4LSXA 2XN9C 1CQFA 5KG3A 2DN8A 1PH4A 3S15H 3S1QB 4A3CG 4XT1B 3I4MG 2B29A 4NXNH 5DEHA 4A3KH 3GIDA 2V58A 4NXML 1LV9A 4UCVA 2F0GA 4DR3H 4XT3B 1JKJB 4C1NI 2VW9A 1UAPA 1B50A 4KY7A 2HVQA 3DMUA 3FPPA 2DPJA 2D0PA 5FK9C 4CKEA 2PYKA 1PRTB 1JR0D 4RWSC 3L0OA 3TQYA 4TQSA 3H0GG 4JG2A 4BXXH 4EGJA 1ASZA 4IAJA 1I4HA 1CSQA 4L63B 4JI4Q 1UNSA 2F0EA 3HXLA 4DK6C 3RZDH 4MV3A 4A3KG 1VQ7A 2A6HD 2O03A 4Q8FA 2RA4A 1VQFA 4KHVA 4PNYA 3QJYA 4RAYA 1KTKA 4QIWA 4FYDA 2W8LA 1KLUD 1F9PA 2K03A 1S3OA 2AWOA 3CQZA 4DV2L 1P8LA 4XQJA 4JI1L 1VQKA 4RU9A 2E5LH 1QWYA 1WCMA 4ABNA 3S1MB 2TSSA 1ZHQA 4YWMA 1I4PA 2X0SA 2L9HA 1ZEQX 2MUYA 1BVSA 1SYDA 1CTMA 3GTLA 4PMCA 4DV2Q 4HQ6A 4H13C 4RNMA 1KRSA 4TV9F 3BJYA 3NENA 1SNOA 2BE5D 4U68A 2W70A 1N36Q 1YEZA 1I7LA 4X65H 3U4VA 5DG7A 4J9MA 4Y8VB 3NUCA 4UP8A 1L0YB 2W6NA 3MFHA 3F2CA 4HTHA 1DV1A 3DHQA 5IYBG 4YR2A 3BVMA 3I72A 4NXNQ 4AYBE 2EYJA 3ERSX 3W2DA 4DR3Q 2JXMB 4FDBA 1VF7A 5BMVF 4A3JB 1PH7A 2QDLA 2PVPA 2W6ZA 2L1BA 4A3FH 4CBVA 3GTLH 1HTPA 3WNZA 5LMUL 5TSSA 4ZAIA 3Q2OA 4QJFA 4OWTB 4JI0L 4MA0A 4S3SA 2JA5B 1I7NA 4HIOA 1I4RA 1V1PA 2KHJA 4KV6A 4DNTB 4DNRB 2QA4A 4B3MQ 4A3LG 3T4AC 2G9DA 3OPOA 4JI1Q 1NMGA 5KRUA 2VQEL 2L15A 2V4RA 4MTDA 1ENAA 1X3PA 3H91A 2J0TD 4DR4Q 3OUUA 1B3AA 4K6LA 4R8UA 4Q45A 1IXRA 4ZUIA 2XTIA 1O7YA 1SFOH 1QB5D 4C5BA 4LFBL 2O2LD 1QZGA 1HR0Q 1VBGA 4K8IA 3TP8A 1BUVT 2WKCA 1NTGA 4DN4M 4LFAQ 2EYOA 3S1QH 4GOPC 2F3IA 3H15A 2KEDA 1GO3E 5KG0A 3OW7A 1F9SA 1YVCA 3F2UA 1EWCA 4IPCA 4YP3A 4BBRB 3H4DA 3VR3A 5IYCH 4NMZA 1EY4A 2XIWA 3PSIA 1TS3A 3S2HB 4M8AA 3GIPA 3PVXA 2A69D 2WYOA 1JORA 3EBEA 3OSPA 1CHQD 1E4GT 1IBLH 1B53A 1GOZA 4RGNA 3Q23A 4R7RA 3TZUA 3NEMA 2FPIB 4O2BF 1HNXL 1N56A 1J9OA 3CQZB 3OYYA 5JVH3 4XDXA 4POGA 2JA8G 4RHSA 4DL3A 1TA8A 4RNOA 4JV2A 2B2VA 4A3JH 2X6GA 4RGOS 2NN6H 3K59A 4EEQA 2W9CB 1OXUA 4NPSA 3E9HA 1BBUA 5CV9A 2IL8A 1LT5D 1KJQA 2SEBD 3AU7A 2HT1A 5D1OA 1E2VA 2NTTA 1T3NA 2PZWA 3DF7A 2UVVA 3CHBD 2ES2A 4DR6L 4FVMA 1D7QA 3J7A5 3GTMA 3RLFA 4MIUA 4GNXC 1QNKA 1GUNA 4GNXA 2E2JH 1IBKH 5F9LA 1ZYRC 1N32Q 1XPUA 5J2TF 1EYGA 5K5PA 3LWBA 3HKZG 5C6AA 2UXCH 1NSNS 4HR7B 2E2HA 1Y1WA 4JI4L 4JI0Q 1I4GA 1QUQB 2WACA 3HOUH 4QWBA 1PTOF 4IURA 2FK3A 4ZKCB 1VQEA 2F03A 4ED3A 2E5LQ 1KJ9A 5F9NA 1S10A 1SDFA 3BDOA 2P0AA 5JJIA 4IUPA 2RCNA 2JA9A 3RZDB 1IKLA 2F0HA 4JV0A 3A54A 1FJGL 5KNBA 1O78A 5COYA 3PO3G 2JJQA 4U7CA 4NDXA 4LF5H 4DK1A 1XNQQ 1EOTA 3V6HA 4LF7H 2EVBA 1CI3M 5JPMC 3GTQB 3S1RB 3I4NG 4BBSG 1HA5A 3E5NA 5EZYF 3GTOA 1ENFA 3KJOA 5BPHA 1VQDA 1ET9A 4A3IG 2DUDA 1LTID 2VA3A 5C3XA 3SVMA 1JX4A 1C9OA 1UEAB 4R4QA 1I6HH 4RCOA 2KUMA 5KG1A 3KYHC 2DIKA 5LMNW 1GGOA 1Y1WH 4ED1A 2AUKA 2CHBD 1SMYD 5JEAJ 2KVMA 2JP1A 2EZVA 1CQVA 3R93A 1IBKL 4LUOA 2VQEH 5KFZA 1V51A 3DEPA 2N8NA 2F52A 4A3IB 3NGDA 3GP7A 3GTJA 1XJVA 4A3IH 3K0YA 2XGPA 1PLFA 2ASBA 4DUYL 5D8DA 3X3NA 2KSWA 2VPSA 4ZKBB 2E2IB 3R2TA 1T9HA 4NXMQ 3WO0A 3TINA 2BQUA 3UDFA 3EPIA 3BQ2A 1WOCA 4RCNA 5IOCA 3GTGH 4OEMB 2LXKA 2B2TA 3MFGA 2NUCA 5KGUA 1EU3A 3NWTA 2K01A 5FLXE 3RZOH 3S2DH 3HBLA 1QZHA 3T1HH 2O4XA 4FXKC 1L1OB 3J81W 2JQOA 3OW2A 3PO2G 3QOJA 1YIJA 1AE3A 1PDQA 4HJ7A 2JYOA 5C8YF 1UC8A 1JOQA 4C3JH 5AJ3L 5L9XA 1KQSA 1XMQL 1K0RA 1FYCA 4KD3A 5GQOA 2R7NA 2FLLA 3RMHA 1RTOA 3PZPA 3RUZA 5IP7H 3RFCA 1ONLA 4LSAA 2JA7A 4DXFA 4IUNA 2IJ0A 2GLTA 5LMUQ 5FPOA 3PCOB 4UCTA 2NBFA 1KD1C 4X65L 2UUBH 5IE8A 1V1QA 3C0FB 4KTAA 4UY8C 5A2QW 2ENBA 4F50A 1STEA 1ASYA 2HJWA 1RJTA 1JOOA 4QF4A 4MZ9A 4FM9A 3SK8A 4LAAA 2ASLA 4DL4A 3BZKA 4DV6Q 2W6QA 1PH5A 5FLMG 4OL7A 4GC7A 5L1IA 3TQTA 4FU0A 1EHIA 4NXMH 3UQ8A 2NVXH 1XDNA 4DV3H 1RF2D 1Y8PB 4A76A 3GIIA 3KTMA 4R4OA 5E7NA 2HDLA 2RDIA 4K5XA 2Y0SE 2JEFA 4QIWE 3VPCA 3G6VA 3TDQA 3NQTA 4QWDA 1Q81C 3EA6A 4KHPQ 4UCSA 4XTCS 1GSAA 2K5VA 2HCIA 4BY1G 1QJOA 4DL5A 3LP8A 2FMMA 3QZ7A 1PFBA 2WB1B 1FL0A 1B8AA 2B2UC 4M9UA 2W6OA 4YR3A 3TZDA 2XIGA 5M5XB 1Q7YC 4EQOA 1Q86C 5IT9c 1ZQ7A 5KFXA 3K5NA 4RKLA 4K14A 3TP5A 1WVLA 4TV8F 1IBMH 2JA5A 1EZ1A 3GD7A 3BG3A 4LFAH 3A8JE 1O80A 1QVCA 1V1PB 1UC9A 3A5ZB 5BR8H 1IYUA 3S17B 3S1NB 3KLSA 3M4YA 2N55A 4DV7H 4G7HC 1SCUB 2RBMA 2ID0A 2ZTEA 3KAJA 1RIPA 3CQZH 2QF7A 2FMAA 4WJWA 1X9NA 5C4HA
chains in the Genus database with same CATH topology
3CMAA 1CKMA 2WFWA 2R7FA 3G48A 3FKIG 4P72A 4EX5A 1EUJA 1EOVA 3HOXG 1VS0A 1E3PA 4DR2Q 4GLXA 3T1YL 2NN6G 4B3ML 5C0XJ 2B3GA 5M3MG 3J81j 4LF8L 3CP0A 1HZ9A 4JBWA 2MO1A 4R4CA 1M1KC 2WB1E 1LTLA 3BU2A 4KI0A 3OTOL 3CCSA 1WCMH 1X55A 4DR4L 3PUXA 4LUVA 3CMEA 4X62Q 4DR2L 2WP8J 4WJ4A 2Y0SG 2QGQA 3W5OA 3T1HL 1SE8A 5C4XG 1WJJA 4LF5Q 4LF7Q 3KLWA 1JE5A 4KHZA 4AQYQ 1KIXA 4HIMA 2I5LX 2LXJA 1YI2A 1Q12A 3FKIH 3PV0A 1MJEA 3ER0A 1AE2A 4J15A 1VQPA 3PIPA 4B3RL 1A62A 1C7YA 1YBYA 3CC7A 3HOWH 1VQAA 2OQ0A 4JI3L 1L1OC 3KOJA 2AKWB 3WWVA 1DGSA 3ULJA 3STBC 1HZBA 4GN3B 4DNIA 1LYLA 1Q1EA 1U0LA 1P16A 1OXTA 2GVAA 3KDFB 2R7DA 1PV4A 2K14A 2PMZE 4QY7A 5C44H 4X6AH 4C2MH 1PH3A 2JEAI 4B3RQ 1C0AA 1PH2A 4A4IA 1SMXA 4L5QA 3S17H 2HQLA 2R93H 4A3BG 4GS3A 2AMCB 3ICEA 4OWWB 3KJPA 5C44G 1WCMG 1EIYB 4X64Q 4A3MG 2UXDL 3U4ZA 3RN5A 4B3SQ 1X56A 2OCEA 3CAMA 3D0FA 4TQUS 1IBLQ 1CKNA 4XIGS 1Y1VH 3S16H 3GTQH 2CQOA 2VZAA 3K0XA 4JBJA 2A1AA 4JI5L 4HIKA 1KAWA 2JA5G 1JB7A 3D31A 3Q8DA 4POFA 5GROA 1K83H 2PQAB 2HHHQ 1W3SA 4UP7A 4DV4L 2Q2UA 2JA6H 4Y52H 3ULPA 4B3SL 3S1MH 3GTPH 3I56A 2KENA 4A3LH 1QUQA 1IBLL 3HOZG 4A75A 3DM3A 3PUWA 4A3JG 4JV5Q 2YV5A 3LGJA 1NE3A 3M9BA 3CC2A 2KCMA 1JJCB 1NBWA 2RHSB 3A5UA 2ZM6Q 4A3GH 1X65A 3CPFA 4MNOA 2HHHL 3M4OH 2VL6A 1B7YB 2UUCL 1L2FA 5ELOA 4X66Q 5FLMH 4DV0L 1X3EA 3HOZH 4GOPA 1IL2A 2R93G 1PYSB 3AYHB 4A3FG 3TS0A 4K0KL 2VUMG 1N8RC 5HY6A 1N36L 3BZCA 4LF6Q 1VQJA 3K8AA 4P73A 3F2BA 2A8VA 4GLVB 1X54A 2UUCQ 5FJ8G 4LFBQ 2EIFA 5C4JH 4GKKL 5M3FH 1TXYA 2I5MX 1PH6A 1J5EL 3K7AH 4IPGA 4UP9A 5H1SE 4BXXG 4GKJQ 1PH1A 3W1GA 4GOPB 3J7ZC 1YHQA 1FJGQ 3L2PA 4OO1G 5M3FG 3J80c 1KHIA 1Q1BA 3CW2C 3JAMi 1XPOA 1IBML 3TS2A 3CXCA 5C3EH 3S15H 1PH4A 3K7UC 3PF5A 2JA6G 4A3CG 3UE1A 1O7IA 4LFCL 3I4MG 2B29A 2ZJQA 1NY4A 2Q2HA 1N34Q 2FXQA 2JEBI 3AFQA 1HZCA 4R4IA 4A3KH 3AEVA 2K5HA 3CCVA 4NXML 2K75A 3HKSA 3HKZE 4JYAQ 1JJGA 1G51A 5C0XG 3RNUA 3CCRA 3UE0A 2VW9A 1S40A 4A3DG 3CCMA 1OXXK 2F4VQ 1HNWQ 3BJUA 2D0PA 2UXCL 3FP9A 3GTMH 1VQLA 3TQYA 3L0OA 4JCVE 4DV5Q 4DR3L 1K9MC 4YWLA 3MEFA 1VQ9A 3H0GG 1E22A 4JG2A 4BXXH 1ASZA 5DLQE 1CSQA 1GM5A 3GTJH 4JI4Q 2QEXA 4LF8Q 4DK6C 3RZDH 3RLOA 4NB3A 1SROA 4A3KG 2F4VL 1HNWL 2ZM6L 1VQ7A 1IZ6A 4IPDA 2Z6KA 3G71A 2MNAA 2YU9H 2JK8A 5ELNA 2VQFL 1VQFA 1HZAA 3F2DA 1CSPA 1SN8A 1Q46A 2I0QA 2ALYB 1MIUA 4K0KQ 4DR6Q 3KDFA 3HOUG 1S3OA 1E1OA 2AWOA 1L0WA 4HIDA 1Q82C 4DV2L 2NVTH 1P8LA 1KRTA 4JI1L 4OWXB 1VQKA 1PHJA 2UU9Q 4LNQA 1PH8A 1N33L 4BY7H 2R7ZG 1XPRA 4R1JA 4YWMA 1Z47A 2OTJA 5JJLA 1BVSA 3I4OA 1TWAH 4GLAC 1I50H 4QGUA 4DV2Q 1KRSA 4KHPL 1NJIC 3S1RH 3HFZB 1N33Q 3GTOH 3EIVA 2E5LL 3UDIA 3NENA 1I94L 2UUBL 4LFCQ 1HNXQ 2NVQH 1N36Q 1YEZA 2H5XA 4OONA 4QQBX 1WFQA 3B6YA 4LFAL 2HIVA 4NXNL 3U4VA 4A3CH 1UE5A 4IOAA 2NVYH 4GKKQ 4UP8A 2CWPA 2E2HH 3F2CA 4JI2L 4DR5L 4DV3L 3AQQA 3JC66 5LMNL 1HH2P 5IYBG 4L5SA 4LF4L 4NXNQ 4DUZQ 4AYBE 1VQ8A 3ERSX 4DR3Q 2V1CC 4YCVA 4FDBA 4L5RC 2XGTA 3U50C 4DV4Q 1VQBA 2WAQG 2NZOA 4A3MH 4LF5L 4LF7L 2D0OA 1PH7A 1E1TA 3PO2H 4JBMA 4A3FH 4LF9Q 5M3MH 2VQEQ 3GTLH 2PQAA 5LMUL 1K3RA 3H3VH 1VQGA 4QJFA 1XNRL 2ZJPA 5C0XI 1HR0W 3CF5A 4JYAL 2IX1A 2R92H 4OWTB 3PUVA 3CCQA 4JI0L 4DK3C 1U5KA 2VY3A 4PMWA 2K5NA 1WYDA 4HIOA 2JA5H 4BBRG 3I2ZA 4DR1L 2KHJA 4PZ8A 4LF9L 2QA4A 3J80i 3TREA 4B3MQ 1PYBA 4A3LG 2CCZA 3RLNA 1LUZA 4JI1Q 4DAYB 1NMGA 3CCEA 2VQEL 2L15A 3DLLA 2UU9L 4JI7L 2OTLA 1I3QH 4DV1Q 4DR4Q 3CCUA 4GN4B 2AHOB 2MO0A 1IXRA 4JI8L 1J5EQ 2XTIA 4DPGA 1SFOH 4UPAA 2WB1G 1YITA 2OWOA 4GKJL 4LFBL 5IYBH 1QZGA 4YHHL 2JE6I 3SGIA 4A93H 1HR0Q 1A63A 3F1ZA 5HGQA 3PF4A 1J6QA 1A8VA 1B70B 1NTGA 4LUZA 4LFAQ 2EXDA 4LWCA 3RR5A 1IBMQ 4GOPC 2IX0A 2F3IA 3H15A 4OXPA 1GO3E 4A3BH 3S1QH 1YVCA 4IPCA 2PNHA 3HOVG 4JI3Q 5IYCH 2K4KA 2YTYA 4YHHQ 3PSIA 3A74A 1H95A 4DR5Q 2Q2TA 1UWVA 1CUKA 2K52A 4P75A 1M90C 2JA7H 4YCWA 5IYCG 2CFMA 3EBEA 4C3HH 2EQSA 4YWKA 1YZ6A 2CWAA 5C3EG 1KC8C 2A19A 3HOWG 4GN5A 3NEMA 4AQYL 1Z9FA 1HNXL 4DR7L 3KFUA 2JA7G 3OYYA 4POGA 2JA8G 1XMQQ 2BH2A 3CPWA 4X62L 5AJ3Q 2KHIA 1K73C 2NN6I 4AH6A 3S14H 4A3JH 2IHEA 5FJ8H 3HOVH 4IO9A 2VUMH 4HJ8A 1OXUA 4NPSA 3E9HA 4DUYQ 1XTDA 2D62A 2VQFQ 3GTKH 1VQOA 5GAGC 1BBUA 4ALPA 1A0IA 2N3SA 3W1BA 4IFDI 4P74A 2HT1A 1QVGA 3K81C 2ES2A 4DR6L 1G6PA 4DV1L 3I4NH 1CKNB 3KF8B 3J7A5 1D7QA 4DAMA 3H0GH 4X65Q 2UXCQ 3RLFA 1EQQA 3AFPA 4GNXC 2JA8H 3PUZA 3PO3H 1VQMA 4GNXA 2E2JH 4P71A 1N32Q 1XPUA 2N49A 5IYDH 4HJ9A 1EYGA 1NMFA 3HKZG 2UUAL 2MQHA 2YTVA 4DV6L 2R6GA 4JI4L 4JI0Q 1Y14B 4A3EH 4RMFA 4A3GG 1QUQB 3HOUH 3HOYH 1VQEA 1YHAA 2Q2IA 2E5LQ 4A3EG 1G291 4MTNA 3M3YH 1JT8A 4JI7Q 4EQ5A 1XMOL 5GAEC 4OX9L 2R7ZH 5JJIA 3M85A 2RCNA 2JA9A 2YYZA 3F8TA 4AYBG 1VQCA 3I7FA 4LW1A 3I55A 1FJGL 2IY5B 1PVOA 5M5YH 2ZTDA 5EAYA 3PO3G 2JJQA 3S24A 4BBSH 3S1NH 1EWIA 2HIXA 4Y7NH 1XNQQ 3M4PA 2ATWA 1N34L 2B63H 4PZ7A 1XMOQ 2R92G 3I4NG 1IYJB 1TWGH 4BA1I 4BBSG 1W2BA 3VDYA 3KJOA 1VQDA 4KLKA 4A3IG 2DUDA 3A0JA 5M5XH 4JOIC 4QL5A 1C9OA 4JOIA 1N9WA 1UEBA 4R4QA 5IYDG 1I6HH 4BY7G 3MXNB 1PFSA 1R9TH 1V9PA 3KYHC 5IWAL 5LMNW 4DV7L 2UXBL 4O0AA 4IFDJ 5IP9G 1Y1WH 4IJLA 5C4XH 2VNUD 1FGUA 1RL2A 5JEAJ 1IBKL 3IRBA 4LUOA 2BA0A 2N8NA 4TVAB 1OXVA 2F52A 5BR8Q 4JI6L 2GN5A 1XJVA 4A3IH 1JMCA 1TWFH 2ASBA 4DUYL 3KF6A 1GVPA 1GKHA 3OTOQ 4JI8Q 2DGYA 4A3DH 2KCTA 1AH9A 2IHFA 1T9HA 4YCUA 3FHWA 4DV3Q 4APVA 4NXMQ 2UXDQ 4WJ3M 2Z0SA 1K8AC 1L1OA 3UDFA 3EN2A 1V43A 1EIFA 1KXLA 1WOCA 2MFIA 1VQ4A 4LF6L 3K80C 4PZ6A 4BBRH 3GO5A 1VQIA 2LXKA 4IPHA 3STBD 4DR1Q 3GTGH 3E0EA 5IY0A 4B3TL 3RZOH 3S2DH 1I94Q 2UUBQ 1VQ6A 1QZHA 4IFDG 2Z6KC 2ZTCA 1L1OB 1XNQL 1N32L 4IOCA 2JQOA 1S72A 1E7ZA 3OW2A 2GVBA 3PO2G 3E9IA 4ME3A 1I5FA 2VS1A 2PI2A 1YIJA 1AE3A 2WAQE 4HJ7A 4AIMA 1QVFA 1PA6A 4C3JH 4DUZL 1VQNA 5AJ3L 2NZHA 4JC0A 2B63G 3S2HH 1KQSA 5LMNQ 3NBHB 4DR7Q 1XMQL 1UE7A 4JI2Q 1K0RA 4BA2I 4PG3A 5J3BA 5GQOA 2I5HA 3PGZA 1LM0A 1EFWA 4RG1A 5IP7H 1YJNA 4X64L 3RN2A 1VCIA 3J81c 5JJKA 1X6OA 1BBWA 1K8GA 5LMUQ 2OQKA 5BR8L 5GADC 3PCOB 4HJ5A 1IBKQ 3T1HQ 3TEHB 1KD1C 4X65L 3HOXH 1Y1WG 5IE8A 1V1QA 3J81i 3HOYG 1YJWA 1HJPA 4UY8C 2K50A 3I4MH 5JEAG 1HNZQ 1ASYA 1PH9A 2KBNA 4MZ9A 3CD6A 2ZJRA 3PIOA 2C35B 3BZKA 4DV6Q 1JJ2A 1PH5A 4JBKA 5M5WH 5FLMG 2RHQB 3G4SA 4OO1I 4GNXB 1SR3A 1GD7A 5IWAQ 3NELA 1MJCA 1D8LA 4YY3L 4JV5L 2NVXH 4B3TQ 1OTCA 4A76A 2YTXA 4R4OA 5E7NA 3GDEA 1UE1A 2PI2E 2RF4A 3CC4A 2Y0SE 4JI6Q 4OX9Q 4QIWE 1SLJA 3ZJYC 1EQRA 4YY3Q 1OXSC 5GAHC 3G6EA 1HR0L 5IP7G 1Q81C 1TWHH 3L7ZC 1VQ5A 4KHPQ 4XTCS 2K5VA 4C3IH 3JAMc 2BA1A 4BY1G 1KL9A 1TWCH 1YNXA 1YJ9A 1BKBA 5IP9H 4A93G 3UDXA 4IJHA 4L5TA 1FL0A 1B8AA 4HJAA 1XNRQ 3U58A 5FLXc 4O2DA 4JI5Q 3UDGA 3TRZA 1CKOA 3M7NA 1SRUA 1Q8KA 1X3FA 1Q7YC 2BH8A 4H02A 5IT9c 1UE6A 1Q86C 2N78A 1X3GA 3KF6B 1WI5A 1E24A 2AWNA 3GD7A 3ULLA 4LF4Q 3H3VI 1VQHA 3CCLA 1QVCA 1Y1VG 1YHBA 3A5ZB 1MKHA 2UUAQ 4DKAC 4DV7Q 2UXBQ 3T1YQ 2E2IH 3PUYA 2CKZB 2E8GA 4BY1H 3CCJA 2LSSA 2ID0A 2ZTEA 5K36G 4R4TA 4DV5L 4X66L 4DV0Q 1HNZL 1RIPA 2IT1A 3CQZH 1X9NA 1FVIA 3M4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA A;  1CKM A;  2WFW A;  2R7F A;  3G48 A;  3FKI G;  4P72 A;  4EX5 A;  1EUJ A;  1EOV A;  3HOX G;  1VS0 A;  1E3P A;  4DR2 Q;  4GLX A;  3T1Y L;  2NN6 G;  4B3M L;  5C0X J;  2B3G A;  5M3M G;  3J81 j;  4LF8 L;  3CP0 A;  1HZ9 A;  4JBW A;  2MO1 A;  4R4C A;  1M1K C;  2WB1 E;  1LTL A;  3BU2 A;  4KI0 A;  3OTO L;  3CCS A;  1WCM H;  1X55 A;  4DR4 L;  3PUX A;  4LUV A;  3CME A;  4X62 Q;  4DR2 L;  2WP8 J;  4WJ4 A;  2Y0S G;  2QGQ A;  3W5O A;  3T1H L;  1SE8 A;  5C4X G;  1WJJ A;  4LF5 Q;  4LF7 Q;  3KLW A;  1JE5 A;  4KHZ A;  4AQY Q;  1KIX A;  4HIM A;  2I5L X;  2LXJ A;  1YI2 A;  1Q12 A;  3FKI H;  3PV0 A;  1MJE A;  3ER0 A;  1AE2 A;  4J15 A;  1VQP A;  3PIP A;  4B3R L;  1A62 A;  1C7Y A;  1YBY A;  3CC7 A;  3HOW H;  1VQA A;  2OQ0 A;  4JI3 L;  1L1O C;  3KOJ A;  2AKW B;  3WWV A;  1DGS A;  3ULJ A;  3STB C;  1HZB A;  4GN3 B;  4DNI A;  1LYL A;  1Q1E A;  1U0L A;  1P16 A;  1OXT A;  2GVA A;  3KDF B;  2R7D A;  1PV4 A;  2K14 A;  2PMZ E;  4QY7 A;  5C44 H;  4X6A H;  4C2M H;  1PH3 A;  2JEA I;  4B3R Q;  1C0A A;  1PH2 A;  4A4I A;  1SMX A;  4L5Q A;  3S17 H;  2HQL A;  2R93 H;  4A3B G;  4GS3 A;  2AMC B;  3ICE A;  4OWW B;  3KJP A;  5C44 G;  1WCM G;  1EIY B;  4X64 Q;  4A3M G;  2UXD L;  3U4Z A;  3RN5 A;  4B3S Q;  1X56 A;  2OCE A;  3CAM A;  3D0F A;  4TQU S;  1IBL Q;  1CKN A;  4XIG S;  1Y1V H;  3S16 H;  3GTQ H;  2CQO A;  2VZA A;  3K0X A;  4JBJ A;  2A1A A;  4JI5 L;  4HIK A;  1KAW A;  2JA5 G;  1JB7 A;  3D31 A;  3Q8D A;  4POF A;  5GRO A;  1K83 H;  2PQA B;  2HHH Q;  1W3S A;  4UP7 A;  4DV4 L;  2Q2U A;  2JA6 H;  4Y52 H;  3ULP A;  4B3S L;  3S1M H;  3GTP H;  3I56 A;  2KEN A;  4A3L H;  1QUQ A;  1IBL L;  3HOZ G;  4A75 A;  3DM3 A;  3PUW A;  4A3J G;  4JV5 Q;  2YV5 A;  3LGJ A;  1NE3 A;  3M9B A;  3CC2 A;  2KCM A;  1JJC B;  1NBW A;  2RHS B;  3A5U A;  2ZM6 Q;  4A3G H;  1X65 A;  3CPF A;  4MNO A;  2HHH L;  3M4O H;  2VL6 A;  1B7Y B;  2UUC L;  1L2F A;  5ELO A;  4X66 Q;  5FLM H;  4DV0 L;  1X3E A;  3HOZ H;  4GOP A;  1IL2 A;  2R93 G;  1PYS B;  3AYH B;  4A3F G;  3TS0 A;  4K0K L;  2VUM G;  1N8R C;  5HY6 A;  1N36 L;  3BZC A;  4LF6 Q;  1VQJ A;  3K8A A;  4P73 A;  3F2B A;  2A8V A;  4GLV B;  1X54 A;  2UUC Q;  5FJ8 G;  4LFB Q;  2EIF A;  5C4J H;  4GKK L;  5M3F H;  1TXY A;  2I5M X;  1PH6 A;  1J5E L;  3K7A H;  4IPG A;  4UP9 A;  5H1S E;  4BXX G;  4GKJ Q;  1PH1 A;  3W1G A;  4GOP B;  3J7Z C;  1YHQ A;  1FJG Q;  3L2P A;  4OO1 G;  5M3F G;  3J80 c;  1KHI A;  1Q1B A;  3CW2 C;  3JAM i;  1XPO A;  1IBM L;  3TS2 A;  3CXC A;  5C3E H;  3S15 H;  1PH4 A;  3K7U C;  3PF5 A;  2JA6 G;  4A3C G;  3UE1 A;  1O7I A;  4LFC L;  3I4M G;  2B29 A;  2ZJQ A;  1NY4 A;  2Q2H A;  1N34 Q;  2FXQ A;  2JEB I;  3AFQ A;  1HZC A;  4R4I A;  4A3K H;  3AEV A;  2K5H A;  3CCV A;  4NXM L;  2K75 A;  3HKS A;  3HKZ E;  4JYA Q;  1JJG A;  1G51 A;  5C0X G;  3RNU A;  3CCR A;  3UE0 A;  2VW9 A;  1S40 A;  4A3D G;  3CCM A;  1OXX K;  2F4V Q;  1HNW Q;  3BJU A;  2D0P A;  2UXC L;  3FP9 A;  3GTM H;  1VQL A;  3TQY A;  3L0O A;  4JCV E;  4DV5 Q;  4DR3 L;  1K9M C;  4YWL A;  3MEF A;  1VQ9 A;  3H0G G;  1E22 A;  4JG2 A;  4BXX H;  1ASZ A;  5DLQ E;  1CSQ A;  1GM5 A;  3GTJ H;  4JI4 Q;  2QEX A;  4LF8 Q;  4DK6 C;  3RZD H;  3RLO A;  4NB3 A;  1SRO A;  4A3K G;  2F4V L;  1HNW L;  2ZM6 L;  1VQ7 A;  1IZ6 A;  4IPD A;  2Z6K A;  3G71 A;  2MNA A;  2YU9 H;  2JK8 A;  5ELN A;  2VQF L;  1VQF A;  1HZA A;  3F2D A;  1CSP A;  1SN8 A;  1Q46 A;  2I0Q A;  2ALY B;  1MIU A;  4K0K Q;  4DR6 Q;  3KDF A;  3HOU G;  1S3O A;  1E1O A;  2AWO A;  1L0W A;  4HID A;  1Q82 C;  4DV2 L;  2NVT H;  1P8L A;  1KRT A;  4JI1 L;  4OWX B;  1VQK A;  1PHJ A;  2UU9 Q;  4LNQ A;  1PH8 A;  1N33 L;  4BY7 H;  2R7Z G;  1XPR A;  4R1J A;  4YWM A;  1Z47 A;  2OTJ A;  5JJL A;  1BVS A;  3I4O A;  1TWA H;  4GLA C;  1I50 H;  4QGU A;  4DV2 Q;  1KRS A;  4KHP L;  1NJI C;  3S1R H;  3HFZ B;  1N33 Q;  3GTO H;  3EIV A;  2E5L L;  3UDI A;  3NEN A;  1I94 L;  2UUB L;  4LFC Q;  1HNX Q;  2NVQ H;  1N36 Q;  1YEZ A;  2H5X A;  4OON A;  4QQB X;  1WFQ A;  3B6Y A;  4LFA L;  2HIV A;  4NXN L;  3U4V A;  4A3C H;  1UE5 A;  4IOA A;  2NVY H;  4GKK Q;  4UP8 A;  2CWP A;  2E2H H;  3F2C A;  4JI2 L;  4DR5 L;  4DV3 L;  3AQQ A;  3JC6 6;  5LMN L;  1HH2 P;  5IYB G;  4L5S A;  4LF4 L;  4NXN Q;  4DUZ Q;  4AYB E;  1VQ8 A;  3ERS X;  4DR3 Q;  2V1C C;  4YCV A;  4FDB A;  4L5R C;  2XGT A;  3U50 C;  4DV4 Q;  1VQB A;  2WAQ G;  2NZO A;  4A3M H;  4LF5 L;  4LF7 L;  2D0O A;  1PH7 A;  1E1T A;  3PO2 H;  4JBM A;  4A3F H;  4LF9 Q;  5M3M H;  2VQE Q;  3GTL H;  2PQA A;  5LMU L;  1K3R A;  3H3V H;  1VQG A;  4QJF A;  1XNR L;  2ZJP A;  5C0X I;  1HR0 W;  3CF5 A;  4JYA L;  2IX1 A;  2R92 H;  4OWT B;  3PUV A;  3CCQ A;  4JI0 L;  4DK3 C;  1U5K A;  2VY3 A;  4PMW A;  2K5N A;  1WYD A;  4HIO A;  2JA5 H;  4BBR G;  3I2Z A;  4DR1 L;  2KHJ A;  4PZ8 A;  4LF9 L;  2QA4 A;  3J80 i;  3TRE A;  4B3M Q;  1PYB A;  4A3L G;  2CCZ A;  3RLN A;  1LUZ A;  4JI1 Q;  4DAY B;  1NMG A;  3CCE A;  2VQE L;  2L15 A;  3DLL A;  2UU9 L;  4JI7 L;  2OTL A;  1I3Q H;  4DV1 Q;  4DR4 Q;  3CCU A;  4GN4 B;  2AHO B;  2MO0 A;  1IXR A;  4JI8 L;  1J5E Q;  2XTI A;  4DPG A;  1SFO H;  4UPA A;  2WB1 G;  1YIT A;  2OWO A;  4GKJ L;  4LFB L;  5IYB H;  1QZG A;  4YHH L;  2JE6 I;  3SGI A;  4A93 H;  1HR0 Q;  1A63 A;  3F1Z A;  5HGQ A;  3PF4 A;  1J6Q A;  1A8V A;  1B70 B;  1NTG A;  4LUZ A;  4LFA Q;  2EXD A;  4LWC A;  3RR5 A;  1IBM Q;  4GOP C;  2IX0 A;  2F3I A;  3H15 A;  4OXP A;  1GO3 E;  4A3B H;  3S1Q H;  1YVC A;  4IPC A;  2PNH A;  3HOV G;  4JI3 Q;  5IYC H;  2K4K A;  2YTY A;  4YHH Q;  3PSI A;  3A74 A;  1H95 A;  4DR5 Q;  2Q2T A;  1UWV A;  1CUK A;  2K52 A;  4P75 A;  1M90 C;  2JA7 H;  4YCW A;  5IYC G;  2CFM A;  3EBE A;  4C3H H;  2EQS A;  4YWK A;  1YZ6 A;  2CWA A;  5C3E G;  1KC8 C;  2A19 A;  3HOW G;  4GN5 A;  3NEM A;  4AQY L;  1Z9F A;  1HNX L;  4DR7 L;  3KFU A;  2JA7 G;  3OYY A;  4POG A;  2JA8 G;  1XMQ Q;  2BH2 A;  3CPW A;  4X62 L;  5AJ3 Q;  2KHI A;  1K73 C;  2NN6 I;  4AH6 A;  3S14 H;  4A3J H;  2IHE A;  5FJ8 H;  3HOV H;  4IO9 A;  2VUM H;  4HJ8 A;  1OXU A;  4NPS A;  3E9H A;  4DUY Q;  1XTD A;  2D62 A;  2VQF Q;  3GTK H;  1VQO A;  5GAG C;  1BBU A;  4ALP A;  1A0I A;  2N3S A;  3W1B A;  4IFD I;  4P74 A;  2HT1 A;  1QVG A;  3K81 C;  2ES2 A;  4DR6 L;  1G6P A;  4DV1 L;  3I4N H;  1CKN B;  3KF8 B;  3J7A 5;  1D7Q A;  4DAM A;  3H0G H;  4X65 Q;  2UXC Q;  3RLF A;  1EQQ A;  3AFP A;  4GNX C;  2JA8 H;  3PUZ A;  3PO3 H;  1VQM A;  4GNX A;  2E2J H;  4P71 A;  1N32 Q;  1XPU A;  2N49 A;  5IYD H;  4HJ9 A;  1EYG A;  1NMF A;  3HKZ G;  2UUA L;  2MQH A;  2YTV A;  4DV6 L;  2R6G A;  4JI4 L;  4JI0 Q;  1Y14 B;  4A3E H;  4RMF A;  4A3G G;  1QUQ B;  3HOU H;  3HOY H;  1VQE A;  1YHA A;  2Q2I A;  2E5L Q;  4A3E G;  1G29 1;  4MTN A;  3M3Y H;  1JT8 A;  4JI7 Q;  4EQ5 A;  1XMO L;  5GAE C;  4OX9 L;  2R7Z H;  5JJI A;  3M85 A;  2RCN A;  2JA9 A;  2YYZ A;  3F8T A;  4AYB G;  1VQC A;  3I7F A;  4LW1 A;  3I55 A;  1FJG L;  2IY5 B;  1PVO A;  5M5Y H;  2ZTD A;  5EAY A;  3PO3 G;  2JJQ A;  3S24 A;  4BBS H;  3S1N H;  1EWI A;  2HIX A;  4Y7N H;  1XNQ Q;  3M4P A;  2ATW A;  1N34 L;  2B63 H;  4PZ7 A;  1XMO Q;  2R92 G;  3I4N G;  1IYJ B;  1TWG H;  4BA1 I;  4BBS G;  1W2B A;  3VDY A;  3KJO A;  1VQD A;  4KLK A;  4A3I G;  2DUD A;  3A0J A;  5M5X H;  4JOI C;  4QL5 A;  1C9O A;  4JOI A;  1N9W A;  1UEB A;  4R4Q A;  5IYD G;  1I6H H;  4BY7 G;  3MXN B;  1PFS A;  1R9T H;  1V9P A;  3KYH C;  5IWA L;  5LMN W;  4DV7 L;  2UXB L;  4O0A A;  4IFD J;  5IP9 G;  1Y1W H;  4IJL A;  5C4X H;  2VNU D;  1FGU A;  1RL2 A;  5JEA J;  1IBK L;  3IRB A;  4LUO A;  2BA0 A;  2N8N A;  4TVA B;  1OXV A;  2F52 A;  5BR8 Q;  4JI6 L;  2GN5 A;  1XJV A;  4A3I H;  1JMC A;  1TWF H;  2ASB A;  4DUY L;  3KF6 A;  1GVP A;  1GKH A;  3OTO Q;  4JI8 Q;  2DGY A;  4A3D H;  2KCT A;  1AH9 A;  2IHF A;  1T9H A;  4YCU A;  3FHW A;  4DV3 Q;  4APV A;  4NXM Q;  2UXD Q;  4WJ3 M;  2Z0S A;  1K8A C;  1L1O A;  3UDF A;  3EN2 A;  1V43 A;  1EIF A;  1KXL A;  1WOC A;  2MFI A;  1VQ4 A;  4LF6 L;  3K80 C;  4PZ6 A;  4BBR H;  3GO5 A;  1VQI A;  2LXK A;  4IPH A;  3STB D;  4DR1 Q;  3GTG H;  3E0E A;  5IY0 A;  4B3T L;  3RZO H;  3S2D H;  1I94 Q;  2UUB Q;  1VQ6 A;  1QZH A;  4IFD G;  2Z6K C;  2ZTC A;  1L1O B;  1XNQ L;  1N32 L;  4IOC A;  2JQO A;  1S72 A;  1E7Z A;  3OW2 A;  2GVB A;  3PO2 G;  3E9I A;  4ME3 A;  1I5F A;  2VS1 A;  2PI2 A;  1YIJ A;  1AE3 A;  2WAQ E;  4HJ7 A;  4AIM A;  1QVF A;  1PA6 A;  4C3J H;  4DUZ L;  1VQN A;  5AJ3 L;  2NZH A;  4JC0 A;  2B63 G;  3S2H H;  1KQS A;  5LMN Q;  3NBH B;  4DR7 Q;  1XMQ L;  1UE7 A;  4JI2 Q;  1K0R A;  4BA2 I;  4PG3 A;  5J3B A;  5GQO A;  2I5H A;  3PGZ A;  1LM0 A;  1EFW A;  4RG1 A;  5IP7 H;  1YJN A;  4X64 L;  3RN2 A;  1VCI A;  3J81 c;  5JJK A;  1X6O A;  1BBW A;  1K8G A;  5LMU Q;  2OQK A;  5BR8 L;  5GAD C;  3PCO B;  4HJ5 A;  1IBK Q;  3T1H Q;  3TEH B;  1KD1 C;  4X65 L;  3HOX H;  1Y1W G;  5IE8 A;  1V1Q A;  3J81 i;  3HOY G;  1YJW A;  1HJP A;  4UY8 C;  2K50 A;  3I4M H;  5JEA G;  1HNZ Q;  1ASY A;  1PH9 A;  2KBN A;  4MZ9 A;  3CD6 A;  2ZJR A;  3PIO A;  2C35 B;  3BZK A;  4DV6 Q;  1JJ2 A;  1PH5 A;  4JBK A;  5M5W H;  5FLM G;  2RHQ B;  3G4S A;  4OO1 I;  4GNX B;  1SR3 A;  1GD7 A;  5IWA Q;  3NEL A;  1MJC A;  1D8L A;  4YY3 L;  4JV5 L;  2NVX H;  4B3T Q;  1OTC A;  4A76 A;  2YTX A;  4R4O A;  5E7N A;  3GDE A;  1UE1 A;  2PI2 E;  2RF4 A;  3CC4 A;  2Y0S E;  4JI6 Q;  4OX9 Q;  4QIW E;  1SLJ A;  3ZJY C;  1EQR A;  4YY3 Q;  1OXS C;  5GAH C;  3G6E A;  1HR0 L;  5IP7 G;  1Q81 C;  1TWH H;  3L7Z C;  1VQ5 A;  4KHP Q;  4XTC S;  2K5V A;  4C3I H;  3JAM c;  2BA1 A;  4BY1 G;  1KL9 A;  1TWC H;  1YNX A;  1YJ9 A;  1BKB A;  5IP9 H;  4A93 G;  3UDX A;  4IJH A;  4L5T A;  1FL0 A;  1B8A A;  4HJA A;  1XNR Q;  3U58 A;  5FLX c;  4O2D A;  4JI5 Q;  3UDG A;  3TRZ A;  1CKO A;  3M7N A;  1SRU A;  1Q8K A;  1X3F A;  1Q7Y C;  2BH8 A;  4H02 A;  5IT9 c;  1UE6 A;  1Q86 C;  2N78 A;  1X3G A;  3KF6 B;  1WI5 A;  1E24 A;  2AWN A;  3GD7 A;  3ULL A;  4LF4 Q;  3H3V I;  1VQH A;  3CCL A;  1QVC A;  1Y1V G;  1YHB A;  3A5Z B;  1MKH A;  2UUA Q;  4DKA C;  4DV7 Q;  2UXB Q;  3T1Y Q;  2E2I H;  3PUY A;  2CKZ B;  2E8G A;  4BY1 H;  3CCJ A;  2LSS A;  2ID0 A;  2ZTE A;  5K36 G;  4R4T A;  4DV5 L;  4X66 L;  4DV0 Q;  1HNZ L;  1RIP A;  2IT1 A;  3CQZ H;  1X9N A;  1FVI A;  3M4Q A; 
#chains in the Genus database with same CATH topology
 1S5D D;  3CMA A;  1CKM A;  4P72 A;  2EYF A;  5KG6 A;  1E3P A;  4U67 3;  2NU9 B;  2H1E A;  2Z1C A;  3RGX A;  4DV6 H;  1IYV A;  5A2Q L;  4C2M B;  5M3M G;  3C1E A;  4JBW A;  4ZI7 F;  2MO1 A;  4R4C A;  1C48 A;  5KYI A;  3CCS A;  4FS1 A;  1SYE A;  2Y0S A;  5DLF A;  3PUX A;  4DR2 L;  2WP8 J;  3NTH A;  3KHH A;  3H94 A;  4LF5 Q;  4LF7 Q;  3KLW A;  1JE5 A;  3J7A F;  3FPU B;  3K3P A;  2K1B A;  2LXJ A;  4OEL B;  5DM6 3;  2VUM B;  1AE2 A;  1NAP A;  2IW3 A;  4J15 A;  1C7Y A;  3CC7 A;  4JI3 L;  1WTR A;  4DL7 A;  3N6R A;  4DR6 H;  1TWC A;  5DQG A;  1TII D;  1U0L A;  3KDF B;  1S4Z A;  4QY7 A;  4XYO A;  3IFD A;  1NR4 A;  4C2M H;  5C44 H;  1PH3 A;  1C0A A;  2FB9 A;  3S17 H;  2R93 H;  5FLX L;  1EIY B;  4LK1 C;  2F0U A;  3D0F A;  3GTM B;  1Y1V H;  1UNN C;  4JBJ A;  3QR8 A;  1GJX A;  5EDW A;  2F0N A;  2EJM A;  4POF A;  3H0G B;  2EDG A;  3MHB A;  2PQA B;  5GRO A;  1W3S A;  2ICE C;  1BR9 A;  2DZD A;  4B3S L;  4DV0 H;  3NTK A;  3I56 A;  2KEN A;  1QUQ A;  5I9O A;  5JJZ A;  1IBL L;  4A75 A;  3DM3 A;  4JV5 Q;  2WAQ B;  3LGJ A;  1NE3 A;  3M9B A;  1E4E B;  2WB1 A;  4U6P A;  1JJC B;  2RHS B;  3OHX C;  3A5U A;  3M4O B;  1B6S A;  4MNO A;  2HHH L;  3M4O H;  4K5V A;  4C3I G;  4QCL A;  5FPR A;  1KDB A;  4QW9 A;  5FLM H;  3KHR A;  3HKZ B;  3HOZ H;  4GOP A;  1PYS B;  3AYH B;  4HNV A;  1PYW D;  2BQR A;  4K2K A;  4K0K L;  1DIK A;  2A8V A;  5C0X H;  1LTG D;  1EYC A;  2F0J A;  2E74 C;  4X3U A;  3GTQ A;  2D2C C;  4HAE A;  1TXY A;  4XYQ A;  1PH6 A;  1J5E L;  2NU7 B;  2D9U A;  1SXT A;  3W1G A;  2BOS A;  3GTO B;  3ETJ A;  2FLP A;  3HB9 A;  1FJG Q;  3L2P A;  3J80 c;  4MV7 A;  2J6U A;  1TWA B;  1Q1B A;  3VR4 A;  1IBM L;  2JA6 A;  4HSP A;  4C5A A;  4EFE A;  3D4R A;  3PF5 A;  1IKM A;  1AP0 A;  2C00 A;  1O7I A;  2WV6 D;  3D4W A;  3K5L A;  4DLK A;  2FXQ A;  4ECQ A;  4R4I A;  1HZC A;  2WDT A;  2ASD A;  1PX2 A;  2E75 C;  4JV5 H;  2GA4 B;  1KBL A;  4RGM A;  3HKS A;  3IKJ A;  2K6A A;  1G51 A;  4C3I B;  5C0X G;  3RAX A;  3HOU B;  5LA6 F;  2J6S A;  3OWE B;  1SNP A;  2R7L A;  4A3D G;  3HOW B;  1SNC A;  2NTS A;  1BOS A;  2V4D A;  3TSS A;  4ZYS A;  1HNW Q;  3K5M A;  5ISR A;  2J6T A;  3WOF A;  2HUG A;  3OIP A;  5DLQ E;  4KJN A;  2SCU B;  2E2I A;  2ZDQ A;  1AW7 A;  1W93 A;  2F0F A;  3RLO A;  1A3V A;  1SRO A;  2F4V L;  2ZXR A;  4JUZ A;  5CYU A;  3G71 A;  1MSG A;  4G4K A;  4AYB B;  5CMD A;  3VPD A;  2VUG A;  2XCP A;  2VQF L;  2Z6B A;  1TWC B;  2RVL A;  3R5H A;  4ZOL F;  1SN8 A;  2EYL A;  4O4I F;  1MIU A;  4DR6 Q;  3KDF A;  3RB3 A;  3HOU G;  5L1J A;  4DK0 A;  1Q82 C;  4HID A;  3JRX A;  4MV9 A;  1AN7 A;  2UU9 Q;  2LFN A;  1R9T B;  1PHJ A;  1N33 L;  3I73 A;  1BNZ A;  1XPR A;  4IN3 A;  1Z47 A;  1FNW A;  2OTJ A;  5JJL A;  1F2Y A;  4HMJ A;  1M4V A;  3BDL A;  5I2Y A;  1SYF A;  1Z2P X;  3RTX A;  4KHP L;  2OT2 A;  3DXJ C;  1IW7 C;  3UDI A;  2UUB L;  5E1F A;  1HNX Q;  2NVQ H;  3SK5 A;  4O4L F;  2H5X A;  2VQD A;  5KT5 A;  3EVQ A;  2YRX A;  5GON F;  1UE5 A;  4IOA A;  1KAB A;  4UDU C;  3PIO 3;  1RKN A;  1S68 A;  5EPK A;  1B2T A;  4DV3 L;  4I7Z C;  5KFY A;  1HH2 P;  3C2P A;  3K5I A;  4DUY H;  2DY7 A;  4JYA H;  1GHK A;  2XGT A;  2NZO A;  4Q0Y A;  3MXN A;  3N41 B;  4H0L C;  3NP8 A;  2R8K A;  2QIL A;  1K3R A;  3E5S A;  3V05 A;  1VQG A;  1HUN A;  4MV1 A;  2EJF C;  5C0X I;  2IX1 A;  3N42 B;  1YNN D;  3CCQ A;  4UCO A;  4DK3 C;  5KFV A;  2JA5 H;  3I2Z A;  5D3D A;  1QNU A;  4ME5 A;  4Q0F A;  4DR1 L;  4L8J A;  4J9S A;  2CCZ A;  4DAY B;  3R3O A;  3CCE A;  2VPQ A;  4LMY A;  3LNN A;  2OTL A;  4DFA A;  1CM9 A;  1K1S A;  2RDJ A;  2C28 A;  3CCU A;  2MO0 A;  3H4B A;  2CQY A;  2DLN A;  2BR0 A;  4UPA A;  2WB1 G;  5KT7 A;  3MR2 A;  5JAV A;  4KHP H;  5IYB H;  3BG5 A;  4A93 H;  1A63 A;  3SGI A;  4BY1 B;  3F1Z A;  5HGQ A;  3N40 P;  1WTP A;  2F0W A;  4ZRZ A;  3BAA A;  1LLR D;  4I7H A;  2EXD A;  1A6X A;  2IX0 A;  4A3B H;  4OXP A;  2CW0 D;  5I6W A;  2PNH A;  1B3Q A;  4IQZ A;  2BQ3 A;  1VKZ A;  2B8F A;  1GUT A;  2QEJ C;  2IPK D;  3FRP B;  3MAQ A;  2Q2T A;  4EQN A;  4P75 A;  3K7A B;  2K52 A;  5KYL A;  2JA7 H;  4I55 F;  4RH6 A;  1C30 A;  1AN8 A;  1U4P A;  5C3E G;  1KC8 C;  2A19 A;  1H9J A;  3HOW G;  3RBE A;  2R87 A;  4DU9 A;  1SJH D;  4FO2 A;  4AQY L;  4FS2 A;  3T13 A;  3C3L A;  1R4Q B;  1DXM A;  4J9N A;  2ZM6 H;  3VYR A;  1R9T A;  5M3M B;  3WO1 A;  5JEA H;  2YZM A;  4C2M A;  4YJ3 F;  3KHL A;  1K73 C;  1I6V C;  1PRT C;  4AH6 A;  3S14 H;  2YCH A;  1STN A;  3I4L A;  4UAI A;  2VUM H;  3I4M B;  2RGR A;  1ESF A;  4ZQI A;  1PXU A;  2FKL A;  5DAU A;  4C56 C;  4ALP A;  1PFM A;  3CVZ A;  4CKC A;  5DQI A;  3GIJ A;  1FNU A;  3SK4 A;  3W1B A;  1TS4 A;  4ZCK A;  4IFD I;  3OHB A;  3ZYY X;  2XC9 A;  1EEI D;  2CQA A;  4J1M A;  4R9W A;  3RF2 A;  1ZET A;  1KNA A;  2W6P A;  4DAV A;  4DV1 L;  1CKN B;  4HCS A;  4ECT A;  3HGB A;  3RV4 A;  4GC6 A;  2ASJ A;  3H0G H;  3GV5 B;  1EQQ A;  3AFP A;  3U9O A;  4LFC H;  3PO3 H;  1M8A A;  1NMF A;  1CA5 A;  3GTK B;  4QUC A;  2YTV A;  4DV6 L;  5E4X A;  1BQQ T;  3QB3 A;  1C4Q A;  1XX8 A;  2F3V A;  3E3X A;  2K5D A;  4A3E G;  2EY6 A;  4MTN A;  3K58 A;  2A68 C;  4IUV A;  4X3T A;  5GAE C;  3TME A;  4BWS C;  3WOE A;  1B6R A;  3GQB A;  1U4R A;  3RAQ A;  3I7F A;  4QWE A;  2Q8R E;  1WTW A;  3S24 A;  1SYG A;  4BBS H;  4APM A;  4I65 A;  3M4P A;  4DAY A;  2ATW A;  2B63 H;  1LTT D;  1XMO Q;  3H0G A;  2R8J A;  4KY6 A;  4C3J B;  4XYM B;  4KLK A;  1RJR A;  4A3D B;  4JOI C;  1PZK D;  4IRD A;  1PZJ D;  4JOI A;  1UEB A;  3JSL A;  4ECZ A;  1Y8O B;  4BY7 G;  3BQ0 A;  1HQM C;  5IGD A;  1K1Q A;  1R9T H;  2I8C A;  3RZO B;  5M9O A;  2UXB L;  4XZ3 B;  1XNR H;  1MSH A;  4O0A A;  4IFD J;  1JWU D;  5IP9 G;  1XTC D;  4EQP A;  4IJL A;  3I8Z A;  2VNU D;  4HCE A;  1FGU A;  3OOC A;  1B33 N;  3I3C A;  1RK6 A;  4IRK A;  3I91 A;  3T16 A;  2BA0 A;  3MFY A;  5AFW A;  2V9W A;  1EWH A;  1IOW A;  1NR2 A;  4E4T A;  5FD5 A;  3ND9 A;  5L1L A;  3QOL A;  3KF6 A;  5KFJ A;  4RZQ A;  4YCU A;  4WJ3 M;  4APV A;  2MP1 A;  2WE6 A;  1V43 A;  1KXL A;  2R6F A;  3PO2 B;  3K80 C;  3I90 A;  4O3P A;  1VQI A;  4ETS A;  1HFG A;  4JI0 H;  2IA6 A;  1H9K A;  1PTO D;  5EQ0 A;  1SAP A;  2UUB Q;  1VQ6 A;  5BPF A;  2KOL A;  1TVX A;  4IFD G;  1LTS D;  4FXD A;  4B3R H;  5LMU H;  1QG7 A;  3VA5 A;  4YBZ B;  3DWQ A;  2V59 A;  2LY7 A;  1MZB A;  2SDF A;  2VS1 A;  3N8D A;  2WAQ E;  3E6Z X;  3QIA A;  1QVF A;  4DUZ L;  1VQN A;  4JC0 A;  5KFP A;  3S2H H;  3NBH B;  4DR7 Q;  5IWA H;  3O13 A;  1TWG A;  4GKK H;  4K0K H;  5EPJ A;  1YJN A;  1BGW A;  3J81 c;  5JJK A;  2K7V A;  3P20 A;  1S5C D;  2C2R A;  3M9M B;  3EPG A;  3MR6 A;  2EY5 A;  4I7A A;  1K8O A;  5T1G A;  1HJP A;  1YJW A;  5ELC A;  2B39 A;  2F0D A;  1EYD A;  5JEA G;  2JA8 B;  1SE3 A;  4IRC A;  4YR0 A;  5IGG A;  1W6J A;  2YU9 B;  1JJ2 A;  5M5W H;  3G4S A;  4GNX B;  2I80 A;  5IWA Q;  3NEL A;  1EEF D;  1KDC A;  4B9X A;  4C3J G;  5CR3 A;  3FMA A;  3MEH A;  5KEE A;  2YTX A;  5C5J A;  3JAM L;  3V6K A;  1HQR D;  2PI2 E;  2RF4 A;  4EGV A;  1KAA A;  1EQR A;  3G6E A;  2NUA B;  5IP7 G;  3M4I A;  5IIF A;  5EOY A;  1TWH H;  3L7Z C;  1VQ5 A;  2NB0 A;  1JLL B;  3G6Y A;  3CKI B;  1TWC H;  1HXY D;  1BKB A;  4A93 G;  4IJH A;  5LXT F;  4HJA A;  1XNR Q;  4BWG B;  5KFQ A;  2JN4 A;  4KD4 A;  3M7N A;  1SRU A;  1HCZ A;  1X3F A;  4J9Q A;  2BH8 A;  4H02 A;  4DAP A;  1UE6 A;  2A73 B;  5KFK A;  1X3G A;  3D4D A;  3KF6 B;  3UI2 A;  1WI5 A;  4ZK9 B;  4LF4 Q;  3H3V I;  1Y1V G;  1YHB A;  3JRW A;  2KQ3 A;  4DV7 Q;  2UXB H;  3T1Y Q;  2E2I H;  4JI6 H;  3G6J B;  1DCZ A;  2LSS A;  5DGA A;  1AZP A;  1G2T A;  2ATL A;  4DV5 L;  2B2W C;  5G3L D;  1Z6H A;  5J39 A;  2RSN A;  1EY5 A;  1M90 C;  2R7Z H;  4DA2 A;  2M2L A;  5D14 A;  2WII B;  1EU4 A;  4GLX A;  1EUJ A;  3HZX A;  3HOX G;  2NN6 G;  2PZT A;  1SFO B;  2C2D A;  3HRZ C;  1GYF A;  2B3G A;  3J81 j;  4LF8 L;  4LF6 H;  3M9O B;  1S97 A;  2WB1 E;  4KY5 A;  3BU2 A;  4DR4 L;  2W9B B;  2AGQ A;  4WJ4 A;  4QWA A;  1KJ8 A;  3W5O A;  2KEE A;  1TWG B;  1XNQ H;  1I50 A;  1JWS D;  4MN3 A;  3GTP A;  5EBC A;  2I5L X;  4RUA A;  5KFF A;  1Q12 A;  2YYA A;  1MJE A;  5DQH A;  1K83 A;  3U9S A;  4ECX A;  3ORQ A;  1K3B C;  4CJ2 C;  1YBY A;  4IR1 A;  2AKW B;  1RK5 A;  3WWV A;  5C4J B;  1DGS A;  3ULJ A;  1A15 A;  5LL6 b;  4ECW A;  1Q1E A;  3CU7 A;  1P16 A;  4JW0 A;  3QZ8 A;  1PV4 A;  2R84 A;  2K14 A;  2PMZ E;  3MXP A;  1S0O A;  3BAB A;  4IZ8 A;  3N43 B;  4L5Q A;  4OHJ A;  4A3B G;  2AMC B;  3BZD B;  4GZY C;  4X64 Q;  3Q24 A;  4BBS B;  3U4Z A;  4HYK A;  2OCE A;  1CKN A;  4XIG S;  2CW0 C;  3S16 H;  2XRQ D;  2CQO A;  1JQY D;  2A1A A;  5ELE A;  1CQJ B;  2B2Y C;  2J9G A;  2Z4I A;  4G7Z C;  4DR5 H;  4O2A F;  2BE5 C;  3OWF A;  3Q8P B;  4IUT A;  4UP7 A;  2UXD H;  3TN2 A;  2Q2U A;  2JA6 H;  3A8K E;  5I47 A;  4K8J A;  4A3J G;  1PTO C;  4IWX A;  3VYT A;  2F0O A;  1NBW A;  2KCM A;  3CC2 A;  5KFL A;  4A3G H;  1X65 A;  3SE7 A;  2VB3 X;  1B7Y B;  3C46 A;  2J4X A;  4FF1 A;  3QO2 A;  5IOD A;  2R93 G;  1X3E A;  4ULL A;  2ZXO A;  4KKS A;  3TS0 A;  1N8R C;  5HY6 A;  4LF6 Q;  3RJ0 A;  1ML0 D;  5DG9 A;  4P73 A;  3F2B A;  4RB1 A;  3MXU A;  2W7O A;  3V6J A;  1X54 A;  5FJ8 G;  5J1Z A;  2L12 A;  4C5C A;  2EIF A;  3ND8 A;  4YHH H;  2I5M X;  5LHY 1;  2I87 A;  3KAL A;  1KHI A;  3NK9 A;  3CW2 C;  1XPO A;  2L0C A;  4EYH B;  3CXC A;  5C3E H;  4MTE A;  3K7U C;  1CZW A;  3UE1 A;  3EYY A;  4LFC L;  2ZJQ A;  5LP6 F;  2Q2H A;  1N34 Q;  1D5Z C;  4OX9 H;  3KBG A;  2K5H A;  3CCV A;  4O3O A;  2L4N A;  5KFB A;  2K75 A;  4JYA Q;  1JJG A;  3GTG A;  3RNU A;  1TWH A;  4BY7 B;  3CCR A;  5E3F A;  3UE0 A;  4EVO A;  5KFR A;  1CHP D;  1S40 A;  1Q8I A;  4P2C B;  1XWE A;  1OXX K;  4E6I A;  2EYM A;  2F4V Q;  3BJU A;  3NWS A;  1STG A;  1VQL A;  1I6U A;  4OO1 H;  3RIZ A;  3MEF A;  1S5B D;  2MPM A;  3GTJ H;  2QEX A;  3PO3 B;  1HNX H;  1RD9 D;  2HVS A;  4NB3 A;  1HNW L;  3VR5 A;  5IGE A;  4F4X A;  4YY3 H;  4IPD A;  2Z6K A;  2DPI A;  2MNA A;  5KFE A;  1BCP F;  1WCM B;  2XVS A;  5CV8 A;  3TIG A;  1HZA A;  3F2D A;  4EYI B;  1CSP A;  1ZHS A;  1AEX A;  1Q46 A;  4A3E B;  4K0K Q;  3VA7 A;  4CDC C;  3L9A X;  5JH7 F;  1E1O A;  3G6X A;  1L0W A;  1ICW A;  2EYP A;  1K28 A;  5DG8 A;  2G9H D;  1KRT A;  1EYZ A;  4J0M A;  2VQF H;  1PH8 A;  2R93 A;  2R7Z G;  4X3S A;  1Y69 U;  4R1J A;  1WTH A;  4J6H A;  1ENC A;  3BDC A;  1BCP D;  5E4W C;  1A3U A;  1KJI A;  2E76 C;  4X64 H;  1SBB B;  1E2Z A;  1I50 H;  4QGU A;  3NBH A;  1W96 A;  3EIV A;  5KT6 A;  1N33 H;  1JE4 A;  4JI4 H;  4OON A;  1WFQ A;  3B6Y A;  4LFA L;  4NXN L;  1FD7 D;  4A3C H;  2J7Z A;  2NVY H;  4GKK Q;  1Q3L A;  2R85 A;  2F0P A;  2E2H H;  4FF2 A;  4JI2 L;  4DR5 L;  2Z9H A;  1K0S A;  4B9W A;  2RDH A;  5LMN L;  3V4Z A;  4LF4 L;  3N44 B;  1VQ8 A;  4HN7 A;  2IWH A;  3Q8R B;  2V1C C;  4Z9C B;  3EFX D;  5JVG 3;  1VQB A;  2WAQ G;  4LF5 L;  4LF7 L;  5KX5 F;  2D0O A;  3PO2 H;  1BNC A;  5C3E B;  4CDE C;  4JBM A;  1EY0 A;  1HR0 H;  2F0L A;  2RDG A;  3RB4 A;  3I70 A;  2PQA A;  2A6E D;  3PR5 B;  3J7A K;  3NSW A;  2ZJP A;  3CF5 A;  4JYA L;  2R92 H;  3K5O A;  3CRL C;  2C5C A;  1U5K A;  2VY3 A;  3PQI A;  3G7L A;  4CC5 A;  4UCR A;  4BBR G;  1ZKO A;  2VB2 X;  4BS9 A;  3J80 i;  5JVL A;  3MVV A;  3GV8 B;  3RLN A;  1KC7 A;  1JOK A;  1RHP A;  3DLL A;  5CBE E;  2AGP A;  4DGZ A;  2C2E A;  5LL6 S;  1F2Z A;  3HKZ A;  4RNN A;  4J9R A;  2RCF A;  4DV1 Q;  2NVT B;  4GN4 B;  3GTG B;  5M5Y B;  2AHO B;  4JI8 L;  1TWH B;  1J5E Q;  1O7Z A;  1YIT A;  1VAJ A;  4GKJ L;  3S9W A;  1TR5 A;  2JE6 I;  4YHH L;  1EL0 A;  3PW2 A;  1A8V A;  1B70 B;  4LUZ A;  4DL6 A;  5KFI A;  4LWC A;  3RR5 A;  4R8I A;  1IBM Q;  4A3D H;  4IWY A;  5G3L F;  1TWA A;  3JAM E;  2NU6 B;  4YHH Q;  4ED8 A;  2YTY A;  2FMC A;  1UUP A;  2PPB C;  2IBK A;  1H95 A;  2AQ2 B;  4IR9 A;  2GPW A;  4DR5 Q;  4B3M H;  3OHA A;  5IYC G;  5KG2 A;  2CFM A;  4C3H H;  1MBY A;  2EQS A;  3Q6S A;  5I6Y A;  1PMR A;  1YZ6 A;  4F8M A;  2R92 A;  2NZ1 D;  2W9C A;  1PZI D;  2KCC A;  3X3M A;  1N36 H;  1CZG A;  2KJX A;  1Z9F A;  1N32 H;  3KFU A;  2JA7 G;  3IL8 A;  4L6T B;  1AFP A;  4YAK B;  1SFO A;  3K5H A;  3QWN A;  3CPW A;  2CH4 A;  4X62 L;  2KHI A;  3HOV H;  3FKI B;  2K05 A;  4IO9 A;  2BDO A;  2PMZ B;  1F77 A;  2VQF Q;  3GTK H;  1VQO A;  5GAG C;  3V96 A;  2L55 A;  2DJF C;  2DNC A;  1I50 B;  2E2H B;  4J9L A;  1QVG A;  4ECV A;  1H9M A;  3SHL A;  2AQ1 B;  3PN1 A;  1LAB A;  3PR4 A;  4OIJ A;  1GSO A;  4XQQ A;  4HNT A;  4NLG A;  2YRW A;  1F9Q A;  4F4Z A;  1B44 D;  3L3O C;  4P71 A;  4H44 C;  5IYD H;  2N49 A;  4O42 A;  2LMC B;  4A3F B;  2DWC A;  2W6M A;  2EY2 A;  2UUA L;  2MQH A;  1CFM A;  2R6G A;  1Y14 B;  4A3E H;  4A3G G;  4CDF C;  3EJI A;  1GUS A;  1YHA A;  1BJT A;  2YS7 A;  2Q2I A;  4WRD A;  3J80 E;  1VDZ A;  1JT8 A;  3HOZ B;  4EQ5 A;  1XMO L;  1A2U A;  2D5D A;  3M85 A;  2YYZ A;  3H3V C;  1MI2 A;  4AYB G;  3I55 A;  4LW1 A;  3R23 A;  2FFK B;  5KT4 A;  1PVO A;  4G3I A;  5EKI A;  1NNX A;  4LH7 A;  3S1N H;  1EWI A;  4Y7N H;  4LJZ C;  2R92 G;  2A6H C;  4PZ7 A;  3GIM A;  4J9K A;  4X62 H;  4TRD A;  4CJ0 B;  3VDY A;  3J80 L;  1HRJ A;  1G6Z A;  4CC6 A;  1JIH A;  2QKI C;  5M5X H;  4DR4 H;  1SYB A;  4QL5 A;  5IYD G;  1N9W A;  2LS0 1;  3MXN B;  4RFB A;  4QWC A;  2A6E C;  1V9P A;  2F4I A;  3FEW X;  4DV7 L;  3HOY B;  1II3 A;  5H80 A;  2XNA C;  4TKO B;  4Q43 A;  5FO7 B;  3MWM A;  2OF1 A;  4X66 H;  4WOR A;  1SNQ A;  3T5H A;  2PW5 A;  1OXV A;  1TQO A;  5BR8 Q;  5KFW A;  1EQV A;  3A8I E;  2Z8L A;  2DY8 A;  4ILW A;  1MGS A;  3LWU A;  5KFN A;  1GVP A;  3W3A A;  2R92 B;  1H9S A;  2DGY A;  4JI8 Q;  2KCT A;  4CKB A;  1AH9 A;  1DZ1 A;  1PTO H;  4GKJ H;  2TMP A;  4DV3 Q;  3FHW A;  2BDN A;  2Z0S A;  2OEO A;  1K8A C;  5IT9 W;  1L1O A;  1V8Q A;  1EIF A;  2MFI A;  1VQ4 A;  2CVR A;  4BBR H;  4IPH A;  3STB D;  4YJ2 F;  4G57 A;  4QB4 A;  3E0E A;  5IGF A;  4B3T L;  5KFC A;  1J8I A;  3TBI B;  5EPL A;  1ILP A;  4O3Q A;  1N32 L;  4N9P A;  4ZQ3 A;  1WR2 A;  2AU0 A;  1S72 A;  1E7Z A;  2KA7 A;  3WDN A;  4H7B A;  4ME3 A;  3BA9 A;  3S16 B;  2PI2 A;  2CW7 A;  3IG0 A;  4AIM A;  5KFD A;  1DV2 A;  1PA6 A;  3D6W A;  1JDE A;  2DNE A;  5LMN Q;  1IW7 D;  1UE7 A;  1M6V A;  1A9X A;  4BA2 I;  5J3B A;  2NVY A;  1EY8 A;  4ODG A;  2DJG C;  3CRK C;  1EZ6 A;  3PGZ A;  1LM0 A;  1A2T A;  1N48 A;  1DOL A;  2ZJT A;  4RG1 A;  4IZO A;  4X64 L;  3GV6 A;  3RN2 A;  2CZG A;  1VCI A;  1SMY C;  2SOB A;  3F8N A;  1BBW A;  4EGQ A;  4TSS A;  5BR8 L;  3T1H Q;  4A2B A;  5KG4 A;  4PQX A;  2ICI A;  1I94 H;  3SI8 A;  3J81 i;  4L1K A;  5I4D A;  3I4M H;  1HNZ Q;  3S14 B;  2JA7 B;  2KBN A;  2ZJR A;  1JC7 A;  1NCV A;  1VMC A;  2C35 B;  3PIO A;  2VUM G;  4JBK A;  2IMW P;  1SR3 A;  1GD7 A;  2PCF B;  5EKL A;  3SXH A;  1HNW H;  1MJC A;  3RV3 A;  4YY3 L;  3T5L A;  4C1N K;  2F3W A;  3BYT B;  3I4N B;  1Z2O X;  1T5E A;  5HUR A;  1PK8 A;  5C1O A;  4B3T Q;  1OTC A;  1M0T A;  4KK7 A;  3GDE A;  5J2U F;  4AQY H;  1ET6 A;  3CC4 A;  1V1O A;  4JI6 Q;  4OX9 Q;  3SK6 A;  3HOV B;  1S03 G;  5ELB A;  1BXT A;  1SLJ A;  3ZJY C;  4YY3 Q;  5IYZ F;  1X3Q A;  4IHJ F;  3PW5 A;  1JDB B;  1L2Z A;  1E2W A;  1J5E H;  5CV5 A;  2Q8T A;  2BA1 A;  1KL9 A;  1PFN A;  1YNX A;  2HCC A;  1YJ9 A;  5T14 A;  5IP9 H;  1CT1 D;  4DV1 H;  1G8Z D;  1CK1 A;  1B04 A;  3U58 A;  1JXL A;  5FLX c;  5EWG A;  2VA2 A;  3TRZ A;  1CKO A;  5D3I B;  5T1I A;  3JSN A;  1Q8K A;  2EXZ A;  3J7A V;  4JI3 H;  3OIQ A;  3TQ1 A;  3C1F A;  1H9S B;  2AWN A;  4NP5 A;  3R5F A;  3R2I A;  5KIX A;  1VQH A;  4CHT B;  1ULZ A;  3FDT A;  5CB4 F;  4DKA C;  2UXB Q;  3JAM W;  2FK1 A;  3SE0 A;  3NHH A;  1KLG D;  4KN4 C;  2AGO A;  5KFU A;  4I4T F;  5K36 G;  4XX0 B;  4ED6 A;  4X66 L;  4DV0 Q;  1DM0 B;  2IT1 A;  1FVI A;  2R8H A;  2B2T C;  2BCO A;  2WFW A;  1LTB D;  2R7F A;  3G48 A;  2NVT H;  4JI5 H;  4B3M L;  4DR2 Q;  3T1Y L;  2GPS A;  4ECY A;  1AUV A;  1EIG A;  4C3H B;  2M05 A;  3ERQ A;  1M1K C;  3IFT A;  2YL2 A;  3A55 A;  1EIH A;  5KG7 A;  1HNZ H;  4B3S H;  1WCM H;  2VUM A;  1X55 A;  1S5E D;  3J7Y W;  3HEJ A;  2Y0S G;  4IAL A;  5C4Z A;  4WFN 3;  1FKA H;  3T1H L;  5DGB A;  1SE8 A;  4DF7 A;  5C4X G;  2K33 A;  3SDZ A;  2A69 C;  2JSO A;  1KIX A;  2AQ4 A;  4XXE A;  5IGC A;  2EE1 A;  4B3T H;  1V4Y A;  1YI2 A;  3PV0 A;  3GTL B;  3ER0 A;  5A2Q E;  3GV3 A;  3H6M A;  1VQP A;  4EG0 A;  1TAE A;  3E0J A;  4DL2 A;  1RJP A;  3UFX B;  2OQ0 A;  2M00 A;  1L1O C;  2FK2 A;  1SJE D;  1RCV D;  2A5H A;  1TY2 A;  4GN3 B;  4HED A;  4YQW A;  1OXT A;  1LT6 D;  3DWP A;  3A7L A;  3S2D B;  4B3R Q;  1PH2 A;  4A4I A;  1WTQ A;  2JEG A;  4GS3 A;  1H9R A;  1HPC A;  1X32 A;  4F88 A;  2MGS A;  1WCM G;  2A74 C;  3KJP A;  3ICE A;  4Q44 A;  4A3M G;  2UXD L;  2EPB A;  3RN5 A;  1E0B A;  1X56 A;  3CAM A;  4TQU S;  1PTO B;  2VOB A;  2YZN A;  2JEJ A;  5L1K A;  2B63 B;  3AMU A;  4ED0 A;  3R5X A;  1SEI A;  1STY A;  4JI5 L;  4HIK A;  1KAW A;  3MWD A;  4I50 F;  2JA5 G;  3K57 A;  3OUZ A;  1K83 H;  1DON A;  2HHH Q;  3KUP A;  5KT3 A;  5CA1 F;  2FJ2 A;  4Y52 H;  1QCB D;  2F1M A;  5DLG A;  5FLX W;  3S1M H;  3GTP H;  4OGQ C;  3HOZ G;  3JZI A;  3ONA B;  3PUW A;  2W71 A;  1DJR D;  2YV5 A;  5FO9 B;  4UFZ A;  2R7K A;  4IUU A;  3KBX A;  2VL6 A;  4A3G B;  5ELO A;  2HQE A;  2I07 B;  2R7M A;  3NXW A;  1IL2 A;  1STH A;  1HA6 A;  4R8U B;  1MD2 D;  3BZC A;  1N36 L;  1VQJ A;  2JA6 B;  3OMG A;  1E4E A;  1BCP B;  2ZXP A;  2WAQ A;  1KNE A;  1TU2 B;  2HD3 A;  1M7J A;  2WKD A;  1BBX C;  4LFB Q;  3D3R A;  4GKK L;  4RZR A;  3K7A H;  4UP9 A;  2WIN B;  3NPP A;  1PH1 A;  4BXX G;  4GOP B;  4GKJ Q;  1RJQ A;  3PIP 3;  3D8G A;  4OO1 G;  5M3F G;  3MTS A;  3JAM i;  3TS2 A;  5KFT A;  1U4L A;  1Y1V A;  4TQR A;  2PZU A;  3SR1 A;  4G7O C;  2JA6 G;  3KK7 A;  1GSH A;  4FF3 A;  1HFN A;  1NY4 A;  3AEV A;  5KNC A;  2JEB I;  1JWM D;  3AFQ A;  3LWE A;  1T94 A;  2YZG A;  2M9V A;  2B8G A;  2MCT A;  3HKZ E;  2FJZ A;  3DWA A;  1STA A;  1DOK A;  2L11 A;  5KG5 A;  3MZ5 A;  4J9O A;  1QIL A;  1S9F A;  1KEE A;  2IP4 A;  5EWF A;  3RB6 A;  3CCM A;  2F0I A;  1AUX A;  3V4S A;  5EGT A;  2UXC L;  1HHV A;  4AYB A;  3FP9 A;  5FKA C;  3GTM H;  1SYX B;  4JCV E;  4DV5 Q;  4DR3 L;  1K9M C;  2QW7 A;  4YWL A;  1VQ9 A;  3PMF A;  3J81 E;  1E22 A;  5IT9 E;  2R8I A;  5JUM A;  3LX0 A;  1G91 A;  1GM5 A;  1TWF B;  2B2V C;  4LF8 Q;  3AB9 A;  4HSV A;  1IHZ A;  2K32 A;  1W6K A;  1IZ6 A;  2KCN A;  2ZM6 L;  4V19 0;  2YW2 A;  2YU9 H;  2F0T A;  2JK8 A;  5ELN A;  3KLS X;  4FNF A;  2X6L A;  2XCA A;  3GV7 B;  2I0Q A;  2ALY B;  2F0Q A;  5HBR B;  3DUZ A;  5EJW A;  2P5Z X;  2R86 A;  3DEO A;  1CE8 A;  4OWX B;  4LNQ A;  2V5A A;  2AUJ D;  2AQ3 B;  2F0K A;  2PO4 A;  4BY7 H;  2UVU A;  2RQX A;  4ECS A;  3GTP B;  4MV4 A;  2EY1 A;  2XCL A;  4O4H F;  3RBD A;  2B63 A;  3Q8S B;  3I4O A;  3H40 A;  1TWA H;  4GLA C;  3RUP A;  4ECR A;  3Q1K A;  1CQI B;  1NJI C;  3S1R H;  3HFZ B;  1N33 Q;  3GTO H;  2E5L L;  3BYY B;  1SE2 A;  1I94 L;  4LFC Q;  2NVQ B;  4QQB X;  2FE3 A;  3J81 L;  2HIV A;  3GIK A;  4RKB A;  1D6E C;  2CWP A;  1C8C A;  1BXR A;  5F2D A;  4CGY B;  3AQQ A;  3JC6 6;  2K5Q A;  4RUC A;  1KJJ A;  2W57 A;  4L5S A;  1SEB D;  4RB0 A;  4DUZ Q;  3MWY W;  5D1P A;  2B2Y A;  2QK4 A;  5DM7 3;  4YCV A;  1SNM A;  4L5R C;  3U50 C;  3VMM A;  4DV4 Q;  1PRT F;  4A3M H;  4MTK A;  4DXG A;  1E1T A;  3S15 B;  4RGT A;  3TII A;  5J22 A;  2F0V A;  4KJO A;  5M3M H;  2VQE Q;  4NW2 A;  4LF9 Q;  2E2J B;  1RYS A;  1Q90 A;  5C1P A;  1YNJ D;  4LF8 H;  3H3V H;  3NBI A;  1XNR L;  1HR0 W;  5BN5 A;  1EUD B;  5C5M A;  3PUV A;  4PMW A;  2K5N A;  3HS0 C;  4Q5V A;  1WYD A;  1Y1V B;  4PZ8 A;  4LF9 L;  3TRE A;  1PYB A;  1STB A;  3URY A;  1LUZ A;  2B2U A;  2UU9 L;  1DD2 A;  3FDS A;  5KKN B;  1IL8 A;  5DNF A;  4JI7 L;  1B4O A;  4FXG C;  3Q22 A;  1I3Q H;  3G8C A;  1AZQ A;  2NWG A;  2HVR A;  1XXG A;  1EUC B;  4JV1 A;  1LT4 D;  4DPG A;  2OWO A;  5HV6 A;  1S5F D;  3ERO A;  3I12 A;  1WTV A;  4EBE A;  1GLV A;  2PNR C;  4K5W A;  1QOH A;  3PF4 A;  1J6Q A;  4ZHQ F;  5KT2 A;  5EKK A;  4DV4 H;  1JB3 A;  3SEB A;  2RDF A;  2OLS A;  3HOV G;  4O3S A;  5BN3 A;  4JI3 Q;  1C3O A;  2K4K A;  4OIK A;  1G2S A;  1D1K A;  1LAC A;  3A74 A;  2ZDG A;  2PW7 A;  1UWV A;  1CUK A;  1VMP A;  4K6D A;  4K2L A;  2UUC H;  4YCW A;  5C5L A;  5C4X B;  4YWK A;  2ZDH A;  3N6X A;  3A7A B;  4LMQ D;  5CAE B;  2CWA A;  5FO8 B;  1A3T A;  3VR2 A;  3QG1 A;  1EYA A;  2ZT9 C;  4GN5 A;  3M9N B;  1D5X C;  1WD1 A;  3K3V A;  5L37 A;  4DR7 L;  1EZ8 A;  3RGZ A;  2KHS A;  5BN4 A;  2R82 A;  5I2X A;  1XMQ Q;  2BH2 A;  5KFM A;  1LO5 D;  1GHJ A;  2R7Z A;  1D1I A;  5AJ3 Q;  2NN6 I;  1KDA A;  1SE4 A;  2IHE A;  3T51 B;  5FJ8 H;  1I3Q A;  1BDO A;  4HJ8 A;  2I46 A;  4DUZ H;  3Q0A A;  4DUY Q;  1XTD A;  2HDM A;  2D62 A;  1EQT A;  2UU9 H;  4JI7 H;  1A0I A;  1ZYR D;  2H4O A;  2N3S A;  5M3F B;  2G5D A;  4HMI A;  3QFF A;  4YB8 B;  3MR5 A;  4P74 A;  2ALZ A;  1BF4 A;  2VXW A;  3K81 C;  1HUM A;  2X69 A;  5CV6 A;  3MA2 B;  1G6P A;  2CH4 W;  3I4N H;  4CJ1 B;  5KFA A;  3KF8 B;  4DAM A;  4X65 Q;  4JPB W;  2UXC Q;  1WTX A;  4F4W A;  2JA8 H;  3PUZ A;  1VQM A;  3ETH A;  2UVR A;  4KKU A;  1SND A;  5K36 H;  3VR6 A;  4MV8 A;  3VPB A;  4HJ9 A;  2Q8I B;  2R93 B;  5HGT A;  1T5X D;  4EBD A;  3A56 A;  4RMF A;  4CDD C;  1WSC A;  1RYR A;  1JCK B;  3HOY H;  1HTL D;  3LML A;  1QE6 A;  1S0M A;  1BO0 A;  1D2B A;  1G29 1;  5KFS A;  3M3Y H;  4J8Q A;  4DR2 H;  4JI7 Q;  4OX9 L;  3M3Y B;  3MFI A;  4RA8 A;  3F8T A;  3GTK A;  4B08 A;  1VQC A;  3OMC A;  3H20 A;  2IY5 B;  3BQ1 A;  3H09 A;  4A3K B;  4XQN A;  2CW8 A;  5M5Y H;  2ZTD A;  5EAY A;  5FD6 A;  2HIX A;  3T1Y H;  5JPN C;  2RGV A;  1N34 L;  3BS1 A;  1WTO A;  3KHG A;  3FVQ A;  1IYJ B;  1TWG H;  3KLR A;  4BA1 I;  2WTF A;  1W2B A;  1EY6 A;  2XWB B;  3M7G A;  3N52 A;  1T36 A;  4A3B B;  3A0J A;  1SYC A;  2F0S A;  5CV7 A;  1U9R A;  1FR3 A;  1E4F T;  1O75 A;  2UVW A;  2KEC A;  3T53 B;  4V0B A;  1O7L A;  2W7P A;  5K2M A;  3HG9 A;  1PFS A;  1I6H B;  5M5W B;  1GXD C;  4JI1 H;  4ZLT F;  5IWA L;  1GUW A;  1I4Q A;  4O3R A;  5C4X H;  4IUQ A;  2RKS A;  2FLN A;  1DOM A;  5LL6 X;  1RL2 A;  3R8B A;  1IOV A;  1ZXT A;  3IRB A;  4YIJ A;  3BVG A;  4TVA B;  2EJG C;  4JI6 L;  2GN5 A;  3J80 W;  1JMC A;  1OWT A;  1TWF H;  4LF4 H;  1JIC A;  1GKH A;  3OTO Q;  2Y0S B;  2QCP X;  2IHF A;  2HGS A;  2UXD Q;  3OSO A;  1TKW B;  1TS5 A;  5JOB A;  1ESR A;  3PW0 A;  3EN2 A;  4HNU A;  1MHW C;  4O1N A;  5ELD A;  4LF6 L;  3K6O A;  4PZ6 A;  5LOV F;  3MR3 A;  3GO5 A;  4DR1 Q;  5CA0 F;  5CGK A;  1I3Q B;  3P7J A;  1GUO A;  2N88 A;  5IY0 A;  3HOX B;  2FP4 B;  4QIW B;  3T5K A;  1I94 Q;  5CV4 A;  3T56 B;  2FPG B;  4A2A A;  5EWE A;  2Z6K C;  1S0N A;  1DYQ A;  2ZTC A;  1XNQ L;  2JEI A;  4IOC A;  2GVB A;  4UCU A;  4KKT A;  1B1Z A;  3E9I A;  1I5F A;  2MHV A;  4EEY A;  4ED7 A;  2B2W A;  4IFD H;  1TWF A;  2B63 G;  2NZH A;  2HHH H;  2VR1 A;  4JI2 Q;  4PG3 A;  2FHT A;  4A3M B;  1EFI D;  4WBN F;  3NQI A;  5C44 B;  2I5H A;  2XRS D;  4MA5 A;  1CS0 A;  5KFH A;  1EFW A;  4N9T A;  1F2L A;  3HP3 A;  3L4J A;  3FKI A;  2V4Q A;  1LTA D;  2PMZ A;  1ICF B;  1WH2 A;  1Z7T A;  1X6O A;  1LT3 D;  2YU9 A;  1XMQ H;  4FF4 A;  1K8G A;  4A93 B;  2OQK A;  5GAD C;  1IBK Q;  4HJ5 A;  1EY7 A;  2K5W A;  3TEH B;  4X3K A;  3HOX H;  1Y1W G;  3HOY G;  3NE5 B;  2K50 A;  2PQE A;  4ME6 A;  5JQW A;  2PBZ A;  2SNS A;  1PH9 A;  4R8N A;  3CD6 A;  1ILQ A;  4DV5 H;  4OO1 I;  2FIN B;  2RHQ B;  5A35 A;  5CBA E;  3VYS A;  2K04 A;  4F4Y A;  2F4V H;  1D8L A;  4JV5 L;  3KAK A;  4KN7 C;  4M1U B;  2NVX B;  4FP5 D;  3RB0 A;  1RTN A;  1VF5 C;  2MJ8 A;  1UE1 A;  5COR A;  4YAJ B;  4RB2 C;  1FGB D;  1K8M A;  5GAH C;  5KFG A;  1OXS C;  1ROD A;  2XWJ B;  4C3H G;  1HR0 L;  2O5I C;  4QMG A;  4ED2 A;  3T5J A;  4C3I H;  3JAM c;  4Q8E A;  5C3W A;  4QW8 A;  1NUC A;  5LYJ F;  4DR1 H;  2QDB A;  4L5T A;  3UDX A;  1VBH A;  3D6C A;  3GIL A;  2R8G A;  4ID6 A;  4UHV A;  4O2D A;  4RAU C;  3UDG A;  4JI5 Q;  3TP6 A;  4PMB A;  5I9P A;  4KMU C;  2YS6 A;  2NYZ D;  2N78 A;  2W8K A;  3ULL A;  1E24 A;  1U4M A;  4EBC A;  4F87 A;  2NU8 B;  3CCL A;  1L0X B;  2UUA Q;  1MKH A;  2XD4 A;  4FBT A;  3BVZ A;  3PUY A;  2UUA H;  1TY0 A;  2CKZ B;  2E8G A;  2O5J C;  4BY1 H;  3CCJ A;  3GIQ A;  2OH2 A;  4JK1 C;  5IGB A;  2W9A A;  4R4T A;  4XYL B;  1FJG H;  2IX3 A;  1HNZ L;  5C4J H;  3MC0 B;  3VYU A;  1Y8N B;  2W9B A;  3M4Q A;  4PV1 C;  3ITP A;  4N8X 1;  4EX5 A;  3FKI G;  4PWQ A;  2C9O A;  2A68 D;  4MHE A;  1EOV A;  1CA6 A;  1VS0 A;  3MWE A;  3PW4 A;  4F7X A;  3PW7 A;  5C0X J;  2PN1 A;  3P75 A;  4RB3 C;  1R4P B;  1LTR D;  3CP0 A;  1HZ9 A;  3NTI A;  1WD0 A;  4KI0 A;  1LTL A;  2EYH A;  1I4X A;  2Z4H A;  3OTO L;  4LH6 A;  4RAZ A;  4LUV A;  3CME A;  4MAM A;  4X62 Q;  1XMO H;  2FPP B;  4LF9 H;  2QGQ A;  4WD3 A;  1FNV A;  3L4K A;  1WJJ A;  4DV2 H;  5D1O B;  1YNJ C;  2L5T A;  2XSC A;  4KHZ A;  4AQY Q;  1D5M C;  4HIM A;  2R3Z A;  5ELF A;  3IAY A;  3EQL C;  1B9N A;  2E2D C;  2RSO A;  3FKI H;  4NKL A;  1RDP D;  4ECU A;  3PIP A;  4B3R L;  1A62 A;  3GQC A;  4EFB A;  3HOW H;  1VQA A;  3KOJ A;  3GLK A;  5KFO A;  1Y1W B;  2R7Z B;  4JVZ A;  4RHR A;  1SSO A;  4HR7 A;  3U9T A;  3STB C;  1HZB A;  4DNI A;  1LYL A;  1GUG A;  4O3N A;  1F9R A;  2GVA A;  1K83 B;  1M0W A;  1OO9 B;  2R7D A;  5CC4 A;  4X6A H;  2EOT A;  2JEA I;  5NUC A;  1SMX A;  2HQL A;  1EY9 A;  2NVY B;  4QUF A;  5JVD F;  4J9P A;  2C22 A;  4OWW B;  3TP7 A;  5C44 G;  3BA8 A;  2NVX A;  4B3S Q;  4FBU A;  3V2T A;  3KF8 A;  1IBL Q;  3GTQ H;  2VZA A;  3K0X A;  4M7E A;  1JB7 A;  3D31 A;  3Q8D A;  3MJF A;  3P1H A;  1XYI A;  4JI2 H;  4DR7 H;  5LMN H;  2LKV A;  4DV4 L;  4TUY F;  3ULP A;  3OTO H;  2R61 A;  2OXP A;  4A3L H;  4MV6 A;  1BCP C;  5D65 A;  3OSN A;  2ZM6 Q;  3KXY T;  1N34 H;  3CPF A;  2UUC L;  2XGQ A;  2K28 A;  2SNM A;  1B9M A;  3FMC A;  1L2F A;  3RD4 A;  3Q8Q B;  4N8F A;  4X66 Q;  1TS2 A;  4DV0 L;  4ZUJ A;  5EBD A;  2F0M A;  1PRT D;  4A3F G;  1TT2 A;  3IN5 A;  5IT9 L;  3K8A A;  1Z2N X;  4GLV B;  2UUC Q;  4PDB A;  3MXG A;  5FOB B;  4LFB H;  3GTJ B;  5M3F H;  5KND A;  3DM1 A;  4IPG A;  5H1S E;  4Y7N B;  2QYZ A;  3ORR A;  3J7Z C;  1F2M A;  1YNN C;  1YHQ A;  4JI8 H;  4LSX A;  2XN9 C;  1CQF A;  5KG3 A;  2DN8 A;  1PH4 A;  3S15 H;  3S1Q B;  4A3C G;  4XT1 B;  3I4M G;  2B29 A;  4NXN H;  5DEH A;  4A3K H;  3GID A;  2V58 A;  4NXM L;  1LV9 A;  4UCV A;  2F0G A;  4DR3 H;  4XT3 B;  1JKJ B;  4C1N I;  2VW9 A;  1UAP A;  1B50 A;  4KY7 A;  2HVQ A;  3DMU A;  3FPP A;  2DPJ A;  2D0P A;  5FK9 C;  4CKE A;  2PYK A;  1PRT B;  1JR0 D;  4RWS C;  3L0O A;  3TQY A;  4TQS A;  3H0G G;  4JG2 A;  4BXX H;  4EGJ A;  1ASZ A;  4IAJ A;  1I4H A;  1CSQ A;  4L63 B;  4JI4 Q;  1UNS A;  2F0E A;  3HXL A;  4DK6 C;  3RZD H;  4MV3 A;  4A3K G;  1VQ7 A;  2A6H D;  2O03 A;  4Q8F A;  2RA4 A;  1VQF A;  4KHV A;  4PNY A;  3QJY A;  4RAY A;  1KTK A;  4QIW A;  4FYD A;  2W8L A;  1KLU D;  1F9P A;  2K03 A;  1S3O A;  2AWO A;  3CQZ A;  4DV2 L;  1P8L A;  4XQJ A;  4JI1 L;  1VQK A;  4RU9 A;  2E5L H;  1QWY A;  1WCM A;  4ABN A;  3S1M B;  2TSS A;  1ZHQ A;  4YWM A;  1I4P A;  2X0S A;  2L9H A;  1ZEQ X;  2MUY A;  1BVS A;  1SYD A;  1CTM A;  3GTL A;  4PMC A;  4DV2 Q;  4HQ6 A;  4H13 C;  4RNM A;  1KRS A;  4TV9 F;  3BJY A;  3NEN A;  1SNO A;  2BE5 D;  4U68 A;  2W70 A;  1N36 Q;  1YEZ A;  1I7L A;  4X65 H;  3U4V A;  5DG7 A;  4J9M A;  4Y8V B;  3NUC A;  4UP8 A;  1L0Y B;  2W6N A;  3MFH A;  3F2C A;  4HTH A;  1DV1 A;  3DHQ A;  5IYB G;  4YR2 A;  3BVM A;  3I72 A;  4NXN Q;  4AYB E;  2EYJ A;  3ERS X;  3W2D A;  4DR3 Q;  2JXM B;  4FDB A;  1VF7 A;  5BMV F;  4A3J B;  1PH7 A;  2QDL A;  2PVP A;  2W6Z A;  2L1B A;  4A3F H;  4CBV A;  3GTL H;  1HTP A;  3WNZ A;  5LMU L;  5TSS A;  4ZAI A;  3Q2O A;  4QJF A;  4OWT B;  4JI0 L;  4MA0 A;  4S3S A;  2JA5 B;  1I7N A;  4HIO A;  1I4R A;  1V1P A;  2KHJ A;  4KV6 A;  4DNT B;  4DNR B;  2QA4 A;  4B3M Q;  4A3L G;  3T4A C;  2G9D A;  3OPO A;  4JI1 Q;  1NMG A;  5KRU A;  2VQE L;  2L15 A;  2V4R A;  4MTD A;  1ENA A;  1X3P A;  3H91 A;  2J0T D;  4DR4 Q;  3OUU A;  1B3A A;  4K6L A;  4R8U A;  4Q45 A;  1IXR A;  4ZUI A;  2XTI A;  1O7Y A;  1SFO H;  1QB5 D;  4C5B A;  4LFB L;  2O2L D;  1QZG A;  1HR0 Q;  1VBG A;  4K8I A;  3TP8 A;  1BUV T;  2WKC A;  1NTG A;  4DN4 M;  4LFA Q;  2EYO A;  3S1Q H;  4GOP C;  2F3I A;  3H15 A;  2KED A;  1GO3 E;  5KG0 A;  3OW7 A;  1F9S A;  1YVC A;  3F2U A;  1EWC A;  4IPC A;  4YP3 A;  4BBR B;  3H4D A;  3VR3 A;  5IYC H;  4NMZ A;  1EY4 A;  2XIW A;  3PSI A;  1TS3 A;  3S2H B;  4M8A A;  3GIP A;  3PVX A;  2A69 D;  2WYO A;  1JOR A;  3EBE A;  3OSP A;  1CHQ D;  1E4G T;  1IBL H;  1B53 A;  1GOZ A;  4RGN A;  3Q23 A;  4R7R A;  3TZU A;  3NEM A;  2FPI B;  4O2B F;  1HNX L;  1N56 A;  1J9O A;  3CQZ B;  3OYY A;  5JVH 3;  4XDX A;  4POG A;  2JA8 G;  4RHS A;  4DL3 A;  1TA8 A;  4RNO A;  4JV2 A;  2B2V A;  4A3J H;  2X6G A;  4RGO S;  2NN6 H;  3K59 A;  4EEQ A;  2W9C B;  1OXU A;  4NPS A;  3E9H A;  1BBU A;  5CV9 A;  2IL8 A;  1LT5 D;  1KJQ A;  2SEB D;  3AU7 A;  2HT1 A;  5D1O A;  1E2V A;  2NTT A;  1T3N A;  2PZW A;  3DF7 A;  2UVV A;  3CHB D;  2ES2 A;  4DR6 L;  4FVM A;  1D7Q A;  3J7A 5;  3GTM A;  3RLF A;  4MIU A;  4GNX C;  1QNK A;  1GUN A;  4GNX A;  2E2J H;  1IBK H;  5F9L A;  1ZYR C;  1N32 Q;  1XPU A;  5J2T F;  1EYG A;  5K5P A;  3LWB A;  3HKZ G;  5C6A A;  2UXC H;  1NSN S;  4HR7 B;  2E2H A;  1Y1W A;  4JI4 L;  4JI0 Q;  1I4G A;  1QUQ B;  2WAC A;  3HOU H;  4QWB A;  1PTO F;  4IUR A;  2FK3 A;  4ZKC B;  1VQE A;  2F03 A;  4ED3 A;  2E5L Q;  1KJ9 A;  5F9N A;  1S10 A;  1SDF A;  3BDO A;  2P0A A;  5JJI A;  4IUP A;  2RCN A;  2JA9 A;  3RZD B;  1IKL A;  2F0H A;  4JV0 A;  3A54 A;  1FJG L;  5KNB A;  1O78 A;  5COY A;  3PO3 G;  2JJQ A;  4U7C A;  4NDX A;  4LF5 H;  4DK1 A;  1XNQ Q;  1EOT A;  3V6H A;  4LF7 H;  2EVB A;  1CI3 M;  5JPM C;  3GTQ B;  3S1R B;  3I4N G;  4BBS G;  1HA5 A;  3E5N A;  5EZY F;  3GTO A;  1ENF A;  3KJO A;  5BPH A;  1VQD A;  1ET9 A;  4A3I G;  2DUD A;  1LTI D;  2VA3 A;  5C3X A;  3SVM A;  1JX4 A;  1C9O A;  1UEA B;  4R4Q A;  1I6H H;  4RCO A;  2KUM A;  5KG1 A;  3KYH C;  2DIK A;  5LMN W;  1GGO A;  1Y1W H;  4ED1 A;  2AUK A;  2CHB D;  1SMY D;  5JEA J;  2KVM A;  2JP1 A;  2EZV A;  1CQV A;  3R93 A;  1IBK L;  4LUO A;  2VQE H;  5KFZ A;  1V51 A;  3DEP A;  2N8N A;  2F52 A;  4A3I B;  3NGD A;  3GP7 A;  3GTJ A;  1XJV A;  4A3I H;  3K0Y A;  2XGP A;  1PLF A;  2ASB A;  4DUY L;  5D8D A;  3X3N A;  2KSW A;  2VPS A;  4ZKB B;  2E2I B;  3R2T A;  1T9H A;  4NXM Q;  3WO0 A;  3TIN A;  2BQU A;  3UDF A;  3EPI A;  3BQ2 A;  1WOC A;  4RCN A;  5IOC A;  3GTG H;  4OEM B;  2LXK A;  2B2T A;  3MFG A;  2NUC A;  5KGU A;  1EU3 A;  3NWT A;  2K01 A;  5FLX E;  3RZO H;  3S2D H;  3HBL A;  1QZH A;  3T1H H;  2O4X A;  4FXK C;  1L1O B;  3J81 W;  2JQO A;  3OW2 A;  3PO2 G;  3QOJ A;  1YIJ A;  1AE3 A;  1PDQ A;  4HJ7 A;  2JYO A;  5C8Y F;  1UC8 A;  1JOQ A;  4C3J H;  5AJ3 L;  5L9X A;  1KQS A;  1XMQ L;  1K0R A;  1FYC A;  4KD3 A;  5GQO A;  2R7N A;  2FLL A;  3RMH A;  1RTO A;  3PZP A;  3RUZ A;  5IP7 H;  3RFC A;  1ONL A;  4LSA A;  2JA7 A;  4DXF A;  4IUN A;  2IJ0 A;  2GLT A;  5LMU Q;  5FPO A;  3PCO B;  4UCT A;  2NBF A;  1KD1 C;  4X65 L;  2UUB H;  5IE8 A;  1V1Q A;  3C0F B;  4KTA A;  4UY8 C;  5A2Q W;  2ENB A;  4F50 A;  1STE A;  1ASY A;  2HJW A;  1RJT A;  1JOO A;  4QF4 A;  4MZ9 A;  4FM9 A;  3SK8 A;  4LAA A;  2ASL A;  4DL4 A;  3BZK A;  4DV6 Q;  2W6Q A;  1PH5 A;  5FLM G;  4OL7 A;  4GC7 A;  5L1I A;  3TQT A;  4FU0 A;  1EHI A;  4NXM H;  3UQ8 A;  2NVX H;  1XDN A;  4DV3 H;  1RF2 D;  1Y8P B;  4A76 A;  3GII A;  3KTM A;  4R4O A;  5E7N A;  2HDL A;  2RDI A;  4K5X A;  2Y0S E;  2JEF A;  4QIW E;  3VPC A;  3G6V A;  3TDQ A;  3NQT A;  4QWD A;  1Q81 C;  3EA6 A;  4KHP Q;  4UCS A;  4XTC S;  1GSA A;  2K5V A;  2HCI A;  4BY1 G;  1QJO A;  4DL5 A;  3LP8 A;  2FMM A;  3QZ7 A;  1PFB A;  2WB1 B;  1FL0 A;  1B8A A;  2B2U C;  4M9U A;  2W6O A;  4YR3 A;  3TZD A;  2XIG A;  5M5X B;  1Q7Y C;  4EQO A;  1Q86 C;  5IT9 c;  1ZQ7 A;  5KFX A;  3K5N A;  4RKL A;  4K14 A;  3TP5 A;  1WVL A;  4TV8 F;  1IBM H;  2JA5 A;  1EZ1 A;  3GD7 A;  3BG3 A;  4LFA H;  3A8J E;  1O80 A;  1QVC A;  1V1P B;  1UC9 A;  3A5Z B;  5BR8 H;  1IYU A;  3S17 B;  3S1N B;  3KLS A;  3M4Y A;  2N55 A;  4DV7 H;  4G7H C;  1SCU B;  2RBM A;  2ID0 A;  2ZTE A;  3KAJ A;  1RIP A;  3CQZ H;  2QF7 A;  2FMA A;  4WJW A;  1X9N A;  5C4H A; 
#chains in the Genus database with same CATH homology
 3CMA A;  1CKM A;  2WFW A;  2R7F A;  3G48 A;  3FKI G;  4P72 A;  4EX5 A;  1EUJ A;  1EOV A;  3HOX G;  1VS0 A;  1E3P A;  4DR2 Q;  4GLX A;  3T1Y L;  2NN6 G;  4B3M L;  5C0X J;  2B3G A;  5M3M G;  3J81 j;  4LF8 L;  3CP0 A;  1HZ9 A;  4JBW A;  2MO1 A;  4R4C A;  1M1K C;  2WB1 E;  1LTL A;  3BU2 A;  4KI0 A;  3OTO L;  3CCS A;  1WCM H;  1X55 A;  4DR4 L;  3PUX A;  4LUV A;  3CME A;  4X62 Q;  4DR2 L;  2WP8 J;  4WJ4 A;  2Y0S G;  2QGQ A;  3W5O A;  3T1H L;  1SE8 A;  5C4X G;  1WJJ A;  4LF5 Q;  4LF7 Q;  3KLW A;  1JE5 A;  4KHZ A;  4AQY Q;  1KIX A;  4HIM A;  2I5L X;  2LXJ A;  1YI2 A;  1Q12 A;  3FKI H;  3PV0 A;  1MJE A;  3ER0 A;  1AE2 A;  4J15 A;  1VQP A;  3PIP A;  4B3R L;  1A62 A;  1C7Y A;  1YBY A;  3CC7 A;  3HOW H;  1VQA A;  2OQ0 A;  4JI3 L;  1L1O C;  3KOJ A;  2AKW B;  3WWV A;  1DGS A;  3ULJ A;  3STB C;  1HZB A;  4GN3 B;  4DNI A;  1LYL A;  1Q1E A;  1U0L A;  1P16 A;  1OXT A;  2GVA A;  3KDF B;  2R7D A;  1PV4 A;  2K14 A;  2PMZ E;  4QY7 A;  5C44 H;  4X6A H;  4C2M H;  1PH3 A;  2JEA I;  4B3R Q;  1C0A A;  1PH2 A;  4A4I A;  1SMX A;  4L5Q A;  3S17 H;  2HQL A;  2R93 H;  4A3B G;  4GS3 A;  2AMC B;  3ICE A;  4OWW B;  3KJP A;  5C44 G;  1WCM G;  1EIY B;  4X64 Q;  4A3M G;  2UXD L;  3U4Z A;  3RN5 A;  4B3S Q;  1X56 A;  2OCE A;  3CAM A;  3D0F A;  4TQU S;  1IBL Q;  1CKN A;  4XIG S;  1Y1V H;  3S16 H;  3GTQ H;  2CQO A;  2VZA A;  3K0X A;  4JBJ A;  2A1A A;  4JI5 L;  4HIK A;  1KAW A;  2JA5 G;  1JB7 A;  3D31 A;  3Q8D A;  4POF A;  5GRO A;  1K83 H;  2PQA B;  2HHH Q;  1W3S A;  4UP7 A;  4DV4 L;  2Q2U A;  2JA6 H;  4Y52 H;  3ULP A;  4B3S L;  3S1M H;  3GTP H;  3I56 A;  2KEN A;  4A3L H;  1QUQ A;  1IBL L;  3HOZ G;  4A75 A;  3DM3 A;  3PUW A;  4A3J G;  4JV5 Q;  2YV5 A;  3LGJ A;  1NE3 A;  3M9B A;  3CC2 A;  2KCM A;  1JJC B;  1NBW A;  2RHS B;  3A5U A;  2ZM6 Q;  4A3G H;  1X65 A;  3CPF A;  4MNO A;  2HHH L;  3M4O H;  2VL6 A;  1B7Y B;  2UUC L;  1L2F A;  5ELO A;  4X66 Q;  5FLM H;  4DV0 L;  1X3E A;  3HOZ H;  4GOP A;  1IL2 A;  2R93 G;  1PYS B;  3AYH B;  4A3F G;  3TS0 A;  4K0K L;  2VUM G;  1N8R C;  5HY6 A;  1N36 L;  3BZC A;  4LF6 Q;  1VQJ A;  3K8A A;  4P73 A;  3F2B A;  2A8V A;  4GLV B;  1X54 A;  2UUC Q;  5FJ8 G;  4LFB Q;  2EIF A;  5C4J H;  4GKK L;  5M3F H;  1TXY A;  2I5M X;  1PH6 A;  1J5E L;  3K7A H;  4IPG A;  4UP9 A;  5H1S E;  4BXX G;  4GKJ Q;  1PH1 A;  3W1G A;  4GOP B;  3J7Z C;  1YHQ A;  1FJG Q;  3L2P A;  4OO1 G;  5M3F G;  3J80 c;  1KHI A;  1Q1B A;  3CW2 C;  3JAM i;  1XPO A;  1IBM L;  3TS2 A;  3CXC A;  5C3E H;  3S15 H;  1PH4 A;  3K7U C;  3PF5 A;  2JA6 G;  4A3C G;  3UE1 A;  1O7I A;  4LFC L;  3I4M G;  2B29 A;  2ZJQ A;  1NY4 A;  2Q2H A;  1N34 Q;  2FXQ A;  2JEB I;  3AFQ A;  1HZC A;  4R4I A;  4A3K H;  3AEV A;  2K5H A;  3CCV A;  4NXM L;  2K75 A;  3HKS A;  3HKZ E;  4JYA Q;  1JJG A;  1G51 A;  5C0X G;  3RNU A;  3CCR A;  3UE0 A;  2VW9 A;  1S40 A;  4A3D G;  3CCM A;  1OXX K;  2F4V Q;  1HNW Q;  3BJU A;  2D0P A;  2UXC L;  3FP9 A;  3GTM H;  1VQL A;  3TQY A;  3L0O A;  4JCV E;  4DV5 Q;  4DR3 L;  1K9M C;  4YWL A;  3MEF A;  1VQ9 A;  3H0G G;  1E22 A;  4JG2 A;  4BXX H;  1ASZ A;  5DLQ E;  1CSQ A;  1GM5 A;  3GTJ H;  4JI4 Q;  2QEX A;  4LF8 Q;  4DK6 C;  3RZD H;  3RLO A;  4NB3 A;  1SRO A;  4A3K G;  2F4V L;  1HNW L;  2ZM6 L;  1VQ7 A;  1IZ6 A;  4IPD A;  2Z6K A;  3G71 A;  2MNA A;  2YU9 H;  2JK8 A;  5ELN A;  2VQF L;  1VQF A;  1HZA A;  3F2D A;  1CSP A;  1SN8 A;  1Q46 A;  2I0Q A;  2ALY B;  1MIU A;  4K0K Q;  4DR6 Q;  3KDF A;  3HOU G;  1S3O A;  1E1O A;  2AWO A;  1L0W A;  4HID A;  1Q82 C;  4DV2 L;  2NVT H;  1P8L A;  1KRT A;  4JI1 L;  4OWX B;  1VQK A;  1PHJ A;  2UU9 Q;  4LNQ A;  1PH8 A;  1N33 L;  4BY7 H;  2R7Z G;  1XPR A;  4R1J A;  4YWM A;  1Z47 A;  2OTJ A;  5JJL A;  1BVS A;  3I4O A;  1TWA H;  4GLA C;  1I50 H;  4QGU A;  4DV2 Q;  1KRS A;  4KHP L;  1NJI C;  3S1R H;  3HFZ B;  1N33 Q;  3GTO H;  3EIV A;  2E5L L;  3UDI A;  3NEN A;  1I94 L;  2UUB L;  4LFC Q;  1HNX Q;  2NVQ H;  1N36 Q;  1YEZ A;  2H5X A;  4OON A;  4QQB X;  1WFQ A;  3B6Y A;  4LFA L;  2HIV A;  4NXN L;  3U4V A;  4A3C H;  1UE5 A;  4IOA A;  2NVY H;  4GKK Q;  4UP8 A;  2CWP A;  2E2H H;  3F2C A;  4JI2 L;  4DR5 L;  4DV3 L;  3AQQ A;  3JC6 6;  5LMN L;  1HH2 P;  5IYB G;  4L5S A;  4LF4 L;  4NXN Q;  4DUZ Q;  4AYB E;  1VQ8 A;  3ERS X;  4DR3 Q;  2V1C C;  4YCV A;  4FDB A;  4L5R C;  2XGT A;  3U50 C;  4DV4 Q;  1VQB A;  2WAQ G;  2NZO A;  4A3M H;  4LF5 L;  4LF7 L;  2D0O A;  1PH7 A;  1E1T A;  3PO2 H;  4JBM A;  4A3F H;  4LF9 Q;  5M3M H;  2VQE Q;  3GTL H;  2PQA A;  5LMU L;  1K3R A;  3H3V H;  1VQG A;  4QJF A;  1XNR L;  2ZJP A;  5C0X I;  1HR0 W;  3CF5 A;  4JYA L;  2IX1 A;  2R92 H;  4OWT B;  3PUV A;  3CCQ A;  4JI0 L;  4DK3 C;  1U5K A;  2VY3 A;  4PMW A;  2K5N A;  1WYD A;  4HIO A;  2JA5 H;  4BBR G;  3I2Z A;  4DR1 L;  2KHJ A;  4PZ8 A;  4LF9 L;  2QA4 A;  3J80 i;  3TRE A;  4B3M Q;  1PYB A;  4A3L G;  2CCZ A;  3RLN A;  1LUZ A;  4JI1 Q;  4DAY B;  1NMG A;  3CCE A;  2VQE L;  2L15 A;  3DLL A;  2UU9 L;  4JI7 L;  2OTL A;  1I3Q H;  4DV1 Q;  4DR4 Q;  3CCU A;  4GN4 B;  2AHO B;  2MO0 A;  1IXR A;  4JI8 L;  1J5E Q;  2XTI A;  4DPG A;  1SFO H;  4UPA A;  2WB1 G;  1YIT A;  2OWO A;  4GKJ L;  4LFB L;  5IYB H;  1QZG A;  4YHH L;  2JE6 I;  3SGI A;  4A93 H;  1HR0 Q;  1A63 A;  3F1Z A;  5HGQ A;  3PF4 A;  1J6Q A;  1A8V A;  1B70 B;  1NTG A;  4LUZ A;  4LFA Q;  2EXD A;  4LWC A;  3RR5 A;  1IBM Q;  4GOP C;  2IX0 A;  2F3I A;  3H15 A;  4OXP A;  1GO3 E;  4A3B H;  3S1Q H;  1YVC A;  4IPC A;  2PNH A;  3HOV G;  4JI3 Q;  5IYC H;  2K4K A;  2YTY A;  4YHH Q;  3PSI A;  3A74 A;  1H95 A;  4DR5 Q;  2Q2T A;  1UWV A;  1CUK A;  2K52 A;  4P75 A;  1M90 C;  2JA7 H;  4YCW A;  5IYC G;  2CFM A;  3EBE A;  4C3H H;  2EQS A;  4YWK A;  1YZ6 A;  2CWA A;  5C3E G;  1KC8 C;  2A19 A;  3HOW G;  4GN5 A;  3NEM A;  4AQY L;  1Z9F A;  1HNX L;  4DR7 L;  3KFU A;  2JA7 G;  3OYY A;  4POG A;  2JA8 G;  1XMQ Q;  2BH2 A;  3CPW A;  4X62 L;  5AJ3 Q;  2KHI A;  1K73 C;  2NN6 I;  4AH6 A;  3S14 H;  4A3J H;  2IHE A;  5FJ8 H;  3HOV H;  4IO9 A;  2VUM H;  4HJ8 A;  1OXU A;  4NPS A;  3E9H A;  4DUY Q;  1XTD A;  2D62 A;  2VQF Q;  3GTK H;  1VQO A;  5GAG C;  1BBU A;  4ALP A;  1A0I A;  2N3S A;  3W1B A;  4IFD I;  4P74 A;  2HT1 A;  1QVG A;  3K81 C;  2ES2 A;  4DR6 L;  1G6P A;  4DV1 L;  3I4N H;  1CKN B;  3KF8 B;  3J7A 5;  1D7Q A;  4DAM A;  3H0G H;  4X65 Q;  2UXC Q;  3RLF A;  1EQQ A;  3AFP A;  4GNX C;  2JA8 H;  3PUZ A;  3PO3 H;  1VQM A;  4GNX A;  2E2J H;  4P71 A;  1N32 Q;  1XPU A;  2N49 A;  5IYD H;  4HJ9 A;  1EYG A;  1NMF A;  3HKZ G;  2UUA L;  2MQH A;  2YTV A;  4DV6 L;  2R6G A;  4JI4 L;  4JI0 Q;  1Y14 B;  4A3E H;  4RMF A;  4A3G G;  1QUQ B;  3HOU H;  3HOY H;  1VQE A;  1YHA A;  2Q2I A;  2E5L Q;  4A3E G;  1G29 1;  4MTN A;  3M3Y H;  1JT8 A;  4JI7 Q;  4EQ5 A;  1XMO L;  5GAE C;  4OX9 L;  2R7Z H;  5JJI A;  3M85 A;  2RCN A;  2JA9 A;  2YYZ A;  3F8T A;  4AYB G;  1VQC A;  3I7F A;  4LW1 A;  3I55 A;  1FJG L;  2IY5 B;  1PVO A;  5M5Y H;  2ZTD A;  5EAY A;  3PO3 G;  2JJQ A;  3S24 A;  4BBS H;  3S1N H;  1EWI A;  2HIX A;  4Y7N H;  1XNQ Q;  3M4P A;  2ATW A;  1N34 L;  2B63 H;  4PZ7 A;  1XMO Q;  2R92 G;  3I4N G;  1IYJ B;  1TWG H;  4BA1 I;  4BBS G;  1W2B A;  3VDY A;  3KJO A;  1VQD A;  4KLK A;  4A3I G;  2DUD A;  3A0J A;  5M5X H;  4JOI C;  4QL5 A;  1C9O A;  4JOI A;  1N9W A;  1UEB A;  4R4Q A;  5IYD G;  1I6H H;  4BY7 G;  3MXN B;  1PFS A;  1R9T H;  1V9P A;  3KYH C;  5IWA L;  5LMN W;  4DV7 L;  2UXB L;  4O0A A;  4IFD J;  5IP9 G;  1Y1W H;  4IJL A;  5C4X H;  2VNU D;  1FGU A;  1RL2 A;  5JEA J;  1IBK L;  3IRB A;  4LUO A;  2BA0 A;  2N8N A;  4TVA B;  1OXV A;  2F52 A;  5BR8 Q;  4JI6 L;  2GN5 A;  1XJV A;  4A3I H;  1JMC A;  1TWF H;  2ASB A;  4DUY L;  3KF6 A;  1GVP A;  1GKH A;  3OTO Q;  4JI8 Q;  2DGY A;  4A3D H;  2KCT A;  1AH9 A;  2IHF A;  1T9H A;  4YCU A;  3FHW A;  4DV3 Q;  4APV A;  4NXM Q;  2UXD Q;  4WJ3 M;  2Z0S A;  1K8A C;  1L1O A;  3UDF A;  3EN2 A;  1V43 A;  1EIF A;  1KXL A;  1WOC A;  2MFI A;  1VQ4 A;  4LF6 L;  3K80 C;  4PZ6 A;  4BBR H;  3GO5 A;  1VQI A;  2LXK A;  4IPH A;  3STB D;  4DR1 Q;  3GTG H;  3E0E A;  5IY0 A;  4B3T L;  3RZO H;  3S2D H;  1I94 Q;  2UUB Q;  1VQ6 A;  1QZH A;  4IFD G;  2Z6K C;  2ZTC A;  1L1O B;  1XNQ L;  1N32 L;  4IOC A;  2JQO A;  1S72 A;  1E7Z A;  3OW2 A;  2GVB A;  3PO2 G;  3E9I A;  4ME3 A;  1I5F A;  2VS1 A;  2PI2 A;  1YIJ A;  1AE3 A;  2WAQ E;  4HJ7 A;  4AIM A;  1QVF A;  1PA6 A;  4C3J H;  4DUZ L;  1VQN A;  5AJ3 L;  2NZH A;  4JC0 A;  2B63 G;  3S2H H;  1KQS A;  5LMN Q;  3NBH B;  4DR7 Q;  1XMQ L;  1UE7 A;  4JI2 Q;  1K0R A;  4BA2 I;  4PG3 A;  5J3B A;  5GQO A;  2I5H A;  3PGZ A;  1LM0 A;  1EFW A;  4RG1 A;  5IP7 H;  1YJN A;  4X64 L;  3RN2 A;  1VCI A;  3J81 c;  5JJK A;  1X6O A;  1BBW A;  1K8G A;  5LMU Q;  2OQK A;  5BR8 L;  5GAD C;  3PCO B;  4HJ5 A;  1IBK Q;  3T1H Q;  3TEH B;  1KD1 C;  4X65 L;  3HOX H;  1Y1W G;  5IE8 A;  1V1Q A;  3J81 i;  3HOY G;  1YJW A;  1HJP A;  4UY8 C;  2K50 A;  3I4M H;  5JEA G;  1HNZ Q;  1ASY A;  1PH9 A;  2KBN A;  4MZ9 A;  3CD6 A;  2ZJR A;  3PIO A;  2C35 B;  3BZK A;  4DV6 Q;  1JJ2 A;  1PH5 A;  4JBK A;  5M5W H;  5FLM G;  2RHQ B;  3G4S A;  4OO1 I;  4GNX B;  1SR3 A;  1GD7 A;  5IWA Q;  3NEL A;  1MJC A;  1D8L A;  4YY3 L;  4JV5 L;  2NVX H;  4B3T Q;  1OTC A;  4A76 A;  2YTX A;  4R4O A;  5E7N A;  3GDE A;  1UE1 A;  2PI2 E;  2RF4 A;  3CC4 A;  2Y0S E;  4JI6 Q;  4OX9 Q;  4QIW E;  1SLJ A;  3ZJY C;  1EQR A;  4YY3 Q;  1OXS C;  5GAH C;  3G6E A;  1HR0 L;  5IP7 G;  1Q81 C;  1TWH H;  3L7Z C;  1VQ5 A;  4KHP Q;  4XTC S;  2K5V A;  4C3I H;  3JAM c;  2BA1 A;  4BY1 G;  1KL9 A;  1TWC H;  1YNX A;  1YJ9 A;  1BKB A;  5IP9 H;  4A93 G;  3UDX A;  4IJH A;  4L5T A;  1FL0 A;  1B8A A;  4HJA A;  1XNR Q;  3U58 A;  5FLX c;  4O2D A;  4JI5 Q;  3UDG A;  3TRZ A;  1CKO A;  3M7N A;  1SRU A;  1Q8K A;  1X3F A;  1Q7Y C;  2BH8 A;  4H02 A;  5IT9 c;  1UE6 A;  1Q86 C;  2N78 A;  1X3G A;  3KF6 B;  1WI5 A;  1E24 A;  2AWN A;  3GD7 A;  3ULL A;  4LF4 Q;  3H3V I;  1VQH A;  3CCL A;  1QVC A;  1Y1V G;  1YHB A;  3A5Z B;  1MKH A;  2UUA Q;  4DKA C;  4DV7 Q;  2UXB Q;  3T1Y Q;  2E2I H;  3PUY A;  2CKZ B;  2E8G A;  4BY1 H;  3CCJ A;  2LSS A;  2ID0 A;  2ZTE A;  5K36 G;  4R4T A;  4DV5 L;  4X66 L;  4DV0 Q;  1HNZ L;  1RIP A;  2IT1 A;  3CQZ H;  1X9N A;  1FVI A;  3M4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...