3HOVK

Complete rna polymerase ii elongation complex ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hovK00
2WB1D 2JA7C 3M4OC 4G7OA 3M3YK 1I6HK 5TMCA 4A3BK 2NVYC 5FLMC 2VUMK 2R92K 2PMZL 4BY1C 2NVTC 3S1MC 2B63K 1HQMA 2NVQK 2O5IA 3GTLC 4A3DC 1TWAK 4YFNA 3S16K 3S17K 2A69A 4MEYA 4AYBD 5C4XK 2JA5C 1BDFA 1SFOK 3S2HC 3FKIK 5IP9C 5C44K 4A3EC 4A3MC 2R7ZC 4XLPA 3S1NK 4Y52C 3I4NK 2B63C 3HOXC 1I50C 1SMYA 3HOZC 1I6HC 2A68A 5TMFA 5IYCK 2JA8K 3S15C 4A3BC 5IP7K 1R9TC 3FKIC 4QIWD 5IP9K 3S2DC 3GTPC 2YU9K 4BBRC 4A3FK 4Q5SA 5FJ8K 4A3JC 2JA5K 1TWGC 3I4MC 5C44C 4Q4ZA 4C2MK 4A3EK 4BY1K 3PO3C 4A3GK 4BBSK 2R93K 1YNJA 1Y1WC 2NVXK 3GTLK 2O5JA 5C4JC 3M3YC 3GTGC 5M5WK 1I50K 4XSXA 3S14K 3S16C 4QJVA 5FLMK 5IYCC 4OIQA 4QJVB 2JA7K 2VUMC 3GTKC 3S1MK 4LLGA 3RZDC 4A3MK 2NVYK 4NOIA 4A3LK 3K7AK 1I3QC 2WAQD 1SFOC 3S17C 4OIRA 3S1RK 4YG2A 2Y0SD 4A3IK 4A3JK 4MEXA 3S2HK 4JK1A 4Y7NK 2E2HK 2JA6K 2E2IK 2NVTK 3RZDK 2NVQC 3GTPK 2E2JK 5M3MK 3HOVK 3PO2C 1I6VA 5IYDK 5M3FK 1YNNA 3HOUK 3PO3K 4X6AK 1WCMK 3I4NC 2Y0SL 1K83C 4A3FC 1TWHK 2PMZD 1Y1VC 3H0GK 4OIPA 3GTGK 3HOWK 4YFKA 4A3KC 4KN4A 4BBSC 1IW7A 2A6EA 3RZOK 3HOYC 1TWGK 1TWAC 4LJZA 3GTQC 4KN7A 3HKZD 3HOXK 3GTKK 4ZH4A 4QIWL 3S1NC 3GTOK 1ZYRA 1TWCC 4AYBL 1Y1WK 2CW0A 3GTMC 3H0GC 3RZOC 4BY7C 3HOUC 1TWFC 5C3EK 3GTOC 3K7AC 1TWHC 3CQZK 4A3CC 4GZYA 4X6AC 2E2IC 4OIOA 5IYBC 4C3JK 5C4JK 4C3IK 3GTQK 4KMUA 3S14C 1TWFK 3M4OK 3DXJA 1I3QK 5C3EC 5C4XC 3S1RC 4OINA 3S1QC 3HOWC 3S1QK 4A3KK 3H3VL 4MQ9A 5IYBK 2BE5A 4A93C 2YU9C 3WODA 5D4DA 4A3CK 5IYDC 2JA8C 5IP7C 3GTJK 1R9TK 3HOYK 4BY7K 3PO2K 1XPPA 4LK1A 1Y1VK 3GTMK 4XLNA 3H3VD 1WCMC 4A3GC 2R93C 2A6HA 4G7HA 4BXXK 2WB1L 1K83K 1TWCK 4A3DK 2PA8L 3HOZK 4C3HK 4BBRK 4A93K 2PA8D 4XSZA 3CQZC 3GTJC 2R92C 3S15K 4Y7NC 2E2HC 4Y52K 2NVXC 4YFXA 5M5YK 4BXXC 3EQLA 2E2JC 3HOVC 3I4MK 5M5XK 4G7ZA 4A3IC 4LK0A 2WAQL 2PPBA 2JA6C 3HKZL 2R7ZK 3S2DK 4A3LC
chains in the Genus database with same CATH superfamily
1DCOA 2XCRB 4G7OA 2NVYC 5FLMC 1PJ7A 4BY1C 1J98A 3BP8C 2B63K 2NVQK 2O5IA 3GTLC 1ZVUA 4AH6A 3S16K 4MEYA 1B4BA 5IP9C 4A3MC 1VRQC 4XLPA 4GT9A 3AD8C 3S15C 1F7UA 1INNA 3GTPC 2YU9K 3GTLA 4KAWX 4A3FK 4Q5SA 4A3JC 4A3EK 2R93K 5IOSA 4BBSK 3GTLK 3HXAA 3M3YC 4XSXA 5FLMK 5IYCC 2GSNA 1EH1A 4P5BA 1K83A 3GTPA 3S2HK 2RH6A 4KMAA 4MEXA 4Y7NK 2NVTK 3RZDK 2XCQA 3HOVK 4GTAA 5M3FK 4C2MC 3T01A 1K83C 1TWHK 1ISEA 3A8KA 3FOEA 3HOWK 2CFAB 4KN4A 2A6EA 1IS1A 2GAHC 1TWGK 1TWAC 4LJZA 3GTQC 3HOXK 4QIWL 1TWGA 4G0WA 4AYBL 4KMDA 1GE9A 3ADAC 3CQZA 3RZOC 3HOUC 1TWAA 5C3EK 3GTQA 3CQZK 4GZYA 2E2IC 4C3IK 3Q3QA 1TWFK 3AQPA 3DXJA 5C4XC 1G51A 3TFIA 1XZQB 4MQ9A 3G4AA 4A93C 1Y1VA 2JA5A 1YCLA 2D6FC 3HOYK 2E2IA 3TTGA 2NVXA 3T00A 1XXAA 3LAJA 3GTMK 3H3VD 5EGHA 4BXXK 3NUHA 1RU0A 2PA8L 4BBRK 1O2BA 3GTMA 1F7VA 2PA8D 1EQRA 3N3YA 4O2DA 4YFXA 2NVXC 4BXXC 1EFWA 2E2JC 3I4MK 2ZFZA 4A3LC 5IOQA 2WB1D 3M4OC 3FOFA 5TMCA 4A3BK 2PMZL 3S1MC 1O26A 4GTBA 1HQMA 4DDQA 4GTLA 4ILDA 3S17K 3IPJA 1JOEA 2FQOA 1L0WA 5C4XK 3S2HC 2R7ZC 1I50C 3A8IA 4KM8A 3HOZC 5IYCK 5TMFA 2JA8K 2R93A 4KATA 4QIWD 1XZPB 1XZQA 3L4KA 3TFHA 1O2FB 2JA5K 3I4MC 3PO3C 1YNJA 1J6VA 4P9SA 3VA7A 5C4JC 3GTGC 3LAPA 4OIQA 2VUMC 3S1MK 2JA6A 2PHCB 1I3QC 2JA7A 3S1RK 4YG2A 3S1QK 2NVQC 4KMHA 4LQYA 2E2JK 1WOSA 1I6VA 3GTGA 5TJ3A 1O28A 1BS2A 3PO3K 3I4NC 3GTGK 3H0GK 1UV7A 2CFAA 1VH2A 1XXBA 3HOYC 3AH5A 4C3IC 3GTOA 1HI9A 3HKZD 3GEEA 3GDZA 1J6WA 5JFEA 2V6TA 3GTOK 3H0GC 2R92A 5E68A 1WQHA 4KC6A 1VLOA 1O29A 3GTOC 2YU9A 4KARA 1SFOA 4FZBA 4C3JK 5JVOA 3GIRA 3M4OK 1I3QK 5C3EC 4OINA 3HOWC 1WORA 1ZBSA 2JH3A 2Y3PA 3H3VL 2BE5A 3S0XA 2KWAA 5D4DA 2YU9C 4A3CK 4BLBA 2GAGC 4LOWA 4WILA 4FM9A 3OREA 4A3DK 3HOZK 4A93K 1F9NA 1O27A 4XSZA 1IL2A 4Y7NC 4Y52K 5M5YK 3EQLA 3HOVC 1WIHA 3OPFA 5M5XK 3JSTA 5CHPA 4A3IC 2V6SA 2WAQL 2R7ZK 1IBAA 2B63A 2XCOA 3M3YK 1C0AA 2R92K 3AD9C 4KB4A 4A3DC 1WSRA 4C3HC 2ZUFA 1SFOK 4A3EC 3I4NK 2B63C 3HOXC 3CAGA 4A3BC 1IE0A 1R9TC 5IP9K 4RMFA 1DCPA 3S2DC 4BBRC 1V5VA 5IOTA 1TWGC 4KASA 4C2MK 4BY1K 3GTJA 2NVXK 1WQFA 4C3JC 4WJ4A 3S16C 1I50K 1JVIA 4QJVB 3GTKC 4LLGA 3RZDC 1USMA 2NVYK 1VJEA 4GFQA 3K7AK 3S17C 2Y0SD 4A3IK 2E2HK 2NVYA 1BJTA 1WOOA 2E2IK 3A8JA 1IQ0A 1DD5A 1ZQ1C 5M3MK 5IYDK 3HOUK 1TWCA 1WCMK 3AQOA 3QX3A 4A3FC 1Y1VC 4OIPA 4YFKA 4BBSC 3N0CA 3RZOK 5CJ9A 2GSUA 4KN7A 1TWHA 4ZH4A 4GTEA 4GTCA 4GTFA 1Y1WK 1TWCC 3GTMC 2GSOA 1TWHC 1USOA 5IYBC 5C4JK 4WJ3M 3GTQK 3S14C 3N0BA 1XXCA 5HL8A 5IYBK 3FHZA 1PJ5A 3WODA 2JA8C 1KQ4A 5IP7C 3GTJK 3SZZA 1J6XA 1XPPA 4LK1A 1I50A 4XLNA 2R93C 1TWCK 4PABA 4J3NA 1B4AA 1O2AA 3CQZC 3S15K 4LR2A 3LPXA 4G7ZA 4LK0A 3G4CA 4G0VA 2JA6C 3HKZL 1WQGA 1AB4A 2JA7C 3GSIA 1I6HK 2VUMK 3FKIA 2NVTC 3AD7C 1TWAK 4YFNA 2A69A 3BUEA 4AYBD 2JA5C 1BDFA 3FKIK 5C44K 1Y1WA 3S1NK 4M1XA 4Y52C 1SMYA 1DCHA 1I6HC 2A68A 4PAAA 4KB2A 5IP7K 3FKIC 4GTDA 2FQTA 2V6UA 1EI6A 5FJ8K 3OEPA 5C44C 4Q4ZA 4A3GK 1BGWA 2O5JA 1VGXA 1Y1WC 5M5WK 4XCHA 3S14K 4QJVA 2JA7K 4A3MK 4NOIA 4A3LK 2WAQD 4KDDA 1SFOC 4OIRA 4A3JK 4JK1A 2JA6K 1WOPA 1F93A 3GTPK 3PO2C 3ERED 3L4JA 1YX2A 4KM9A 1YNNA 1ZXOA 2R7ZA 4X6AK 2Y0SL 2PMZD 3BP3A 4A3KC 1IW7A 1XZPA 3GTKK 3S1NC 4C45A 4BLAA 1ZYRA 2CW0A 3GEIA 4G0UA 2VUMA 4BY7C 2RGRA 1TWFC 2P5MA 3GEHA 3K7AC 1I3QA 4A3CC 4X6AC 1X31C 4OIOA 4KMUA 3T02A 1O24A 3V4GA 3S1RC 3S1QC 3SZYA 2EBBA 4A3KK 5IORA 1TWFA 3TFJA 3MMLB 5EGEA 5L46A 5IYDC 1R9TK 2E2HA 4BY7K 3PO2K 4P5AA 2P8TA 1Y1VK 1O25A 1R9TA 1WCMC 4A3GC 1JQWA 2A6HA 4G7HA 2WB1L 1K83K 1WSVA 4C3HK 3H0GA 2ZUEA 3GTJC 1EK8A 4BKWA 2R92C 2E2HC 3GTKA 2W7VA 2PPBA 1PJ6A 1WCMA 3S2DK
chains in the Genus database with same CATH topology
2WB1D 2JA7C 3M4OC 4G7OA 3M3YK 1I6HK 5TMCA 4A3BK 2NVYC 5FLMC 2VUMK 2R92K 2PMZL 4BY1C 2NVTC 3S1MC 2B63K 1HQMA 2NVQK 2O5IA 3GTLC 4A3DC 1TWAK 4YFNA 3S16K 3S17K 2A69A 4MEYA 4AYBD 5C4XK 2JA5C 1BDFA 1SFOK 3S2HC 3FKIK 5IP9C 5C44K 4A3EC 4A3MC 2R7ZC 4XLPA 3S1NK 4Y52C 3I4NK 2B63C 3HOXC 1I50C 1SMYA 3HOZC 1I6HC 2A68A 5TMFA 5IYCK 2JA8K 3S15C 4A3BC 5IP7K 1R9TC 3FKIC 4QIWD 5IP9K 3S2DC 3GTPC 2YU9K 4BBRC 4A3FK 4Q5SA 5FJ8K 4A3JC 2JA5K 1TWGC 3I4MC 5C44C 4Q4ZA 4C2MK 4A3EK 4BY1K 3PO3C 4A3GK 4BBSK 2R93K 1YNJA 1Y1WC 2NVXK 3GTLK 2O5JA 5C4JC 3M3YC 3GTGC 5M5WK 1I50K 4XSXA 3S14K 3S16C 4QJVA 5FLMK 5IYCC 4OIQA 4QJVB 2JA7K 2VUMC 3GTKC 3S1MK 4LLGA 3RZDC 4A3MK 2NVYK 4NOIA 4A3LK 3K7AK 1I3QC 2WAQD 1SFOC 3S17C 4OIRA 3S1RK 4YG2A 2Y0SD 4A3IK 4A3JK 4MEXA 3S2HK 4JK1A 4Y7NK 2E2HK 2JA6K 2E2IK 2NVTK 3RZDK 2NVQC 3GTPK 2E2JK 5M3MK 3HOVK 3PO2C 1I6VA 5IYDK 5M3FK 1YNNA 3HOUK 3PO3K 4X6AK 1WCMK 3I4NC 2Y0SL 1K83C 4A3FC 1TWHK 2PMZD 1Y1VC 3H0GK 4OIPA 3GTGK 3HOWK 4YFKA 4A3KC 4KN4A 4BBSC 1IW7A 2A6EA 3RZOK 3HOYC 1TWGK 1TWAC 4LJZA 3GTQC 4KN7A 3HKZD 3HOXK 3GTKK 4ZH4A 4QIWL 3S1NC 3GTOK 1ZYRA 1TWCC 4AYBL 1Y1WK 2CW0A 3GTMC 3H0GC 3RZOC 4BY7C 3HOUC 1TWFC 5C3EK 3GTOC 3K7AC 1TWHC 3CQZK 4A3CC 4GZYA 4X6AC 2E2IC 4OIOA 5IYBC 4C3JK 5C4JK 4C3IK 3GTQK 4KMUA 3S14C 1TWFK 3M4OK 3DXJA 1I3QK 5C3EC 5C4XC 3S1RC 4OINA 3S1QC 3HOWC 3S1QK 4A3KK 3H3VL 4MQ9A 5IYBK 2BE5A 4A93C 2YU9C 3WODA 5D4DA 4A3CK 5IYDC 2JA8C 5IP7C 3GTJK 1R9TK 3HOYK 4BY7K 3PO2K 1XPPA 4LK1A 1Y1VK 3GTMK 4XLNA 3H3VD 1WCMC 4A3GC 2R93C 2A6HA 4G7HA 4BXXK 2WB1L 1K83K 1TWCK 4A3DK 2PA8L 3HOZK 4C3HK 4BBRK 4A93K 2PA8D 4XSZA 3CQZC 3GTJC 2R92C 3S15K 4Y7NC 2E2HC 4Y52K 2NVXC 4YFXA 5M5YK 4BXXC 3EQLA 2E2JC 3HOVC 3I4MK 5M5XK 4G7ZA 4A3IC 4LK0A 2WAQL 2PPBA 2JA6C 3HKZL 2R7ZK 3S2DK 4A3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 D;  2JA7 C;  3M4O C;  4G7O A;  3M3Y K;  1I6H K;  5TMC A;  4A3B K;  2NVY C;  5FLM C;  2VUM K;  2R92 K;  2PMZ L;  4BY1 C;  2NVT C;  3S1M C;  2B63 K;  1HQM A;  2NVQ K;  2O5I A;  3GTL C;  4A3D C;  1TWA K;  4YFN A;  3S16 K;  3S17 K;  2A69 A;  4MEY A;  4AYB D;  5C4X K;  2JA5 C;  1BDF A;  1SFO K;  3S2H C;  3FKI K;  5IP9 C;  5C44 K;  4A3E C;  4A3M C;  2R7Z C;  4XLP A;  3S1N K;  4Y52 C;  3I4N K;  2B63 C;  3HOX C;  1I50 C;  1SMY A;  3HOZ C;  1I6H C;  2A68 A;  5TMF A;  5IYC K;  2JA8 K;  3S15 C;  4A3B C;  5IP7 K;  1R9T C;  3FKI C;  4QIW D;  5IP9 K;  3S2D C;  3GTP C;  2YU9 K;  4BBR C;  4A3F K;  4Q5S A;  5FJ8 K;  4A3J C;  2JA5 K;  1TWG C;  3I4M C;  5C44 C;  4Q4Z A;  4C2M K;  4A3E K;  4BY1 K;  3PO3 C;  4A3G K;  4BBS K;  2R93 K;  1YNJ A;  1Y1W C;  2NVX K;  3GTL K;  2O5J A;  5C4J C;  3M3Y C;  3GTG C;  5M5W K;  1I50 K;  4XSX A;  3S14 K;  3S16 C;  4QJV A;  5FLM K;  5IYC C;  4OIQ A;  4QJV B;  2JA7 K;  2VUM C;  3GTK C;  3S1M K;  4LLG A;  3RZD C;  4A3M K;  2NVY K;  4NOI A;  4A3L K;  3K7A K;  1I3Q C;  2WAQ D;  1SFO C;  3S17 C;  4OIR A;  3S1R K;  4YG2 A;  2Y0S D;  4A3I K;  4A3J K;  4MEX A;  3S2H K;  4JK1 A;  4Y7N K;  2E2H K;  2JA6 K;  2E2I K;  2NVT K;  3RZD K;  2NVQ C;  3GTP K;  2E2J K;  5M3M K;  3HOV K;  3PO2 C;  1I6V A;  5IYD K;  5M3F K;  1YNN A;  3HOU K;  3PO3 K;  4X6A K;  1WCM K;  3I4N C;  2Y0S L;  1K83 C;  4A3F C;  1TWH K;  2PMZ D;  1Y1V C;  3H0G K;  4OIP A;  3GTG K;  3HOW K;  4YFK A;  4A3K C;  4KN4 A;  4BBS C;  1IW7 A;  2A6E A;  3RZO K;  3HOY C;  1TWG K;  1TWA C;  4LJZ A;  3GTQ C;  4KN7 A;  3HKZ D;  3HOX K;  3GTK K;  4ZH4 A;  4QIW L;  3S1N C;  3GTO K;  1ZYR A;  1TWC C;  4AYB L;  1Y1W K;  2CW0 A;  3GTM C;  3H0G C;  3RZO C;  4BY7 C;  3HOU C;  1TWF C;  5C3E K;  3GTO C;  3K7A C;  1TWH C;  3CQZ K;  4A3C C;  4GZY A;  4X6A C;  2E2I C;  4OIO A;  5IYB C;  4C3J K;  5C4J K;  4C3I K;  3GTQ K;  4KMU A;  3S14 C;  1TWF K;  3M4O K;  3DXJ A;  1I3Q K;  5C3E C;  5C4X C;  3S1R C;  4OIN A;  3S1Q C;  3HOW C;  3S1Q K;  4A3K K;  3H3V L;  4MQ9 A;  5IYB K;  2BE5 A;  4A93 C;  2YU9 C;  3WOD A;  5D4D A;  4A3C K;  5IYD C;  2JA8 C;  5IP7 C;  3GTJ K;  1R9T K;  3HOY K;  4BY7 K;  3PO2 K;  1XPP A;  4LK1 A;  1Y1V K;  3GTM K;  4XLN A;  3H3V D;  1WCM C;  4A3G C;  2R93 C;  2A6H A;  4G7H A;  4BXX K;  2WB1 L;  1K83 K;  1TWC K;  4A3D K;  2PA8 L;  3HOZ K;  4C3H K;  4BBR K;  4A93 K;  2PA8 D;  4XSZ A;  3CQZ C;  3GTJ C;  2R92 C;  3S15 K;  4Y7N C;  2E2H C;  4Y52 K;  2NVX C;  4YFX A;  5M5Y K;  4BXX C;  3EQL A;  2E2J C;  3HOV C;  3I4M K;  5M5X K;  4G7Z A;  4A3I C;  4LK0 A;  2WAQ L;  2PPB A;  2JA6 C;  3HKZ L;  2R7Z K;  3S2D K;  4A3L C; 
#chains in the Genus database with same CATH topology
 1DCO A;  2XCR B;  4G7O A;  2NVY C;  5FLM C;  1PJ7 A;  4BY1 C;  1J98 A;  3BP8 C;  2B63 K;  2NVQ K;  2O5I A;  3GTL C;  1ZVU A;  4AH6 A;  3S16 K;  4MEY A;  1B4B A;  5IP9 C;  4A3M C;  1VRQ C;  4XLP A;  4GT9 A;  3AD8 C;  3S15 C;  1F7U A;  1INN A;  3GTP C;  2YU9 K;  3GTL A;  4KAW X;  4A3F K;  4Q5S A;  4A3J C;  4A3E K;  2R93 K;  5IOS A;  4BBS K;  3GTL K;  3HXA A;  3M3Y C;  4XSX A;  5FLM K;  5IYC C;  2GSN A;  1EH1 A;  4P5B A;  1K83 A;  3GTP A;  3S2H K;  2RH6 A;  4KMA A;  4MEX A;  4Y7N K;  2NVT K;  3RZD K;  2XCQ A;  3HOV K;  4GTA A;  5M3F K;  4C2M C;  3T01 A;  1K83 C;  1TWH K;  1ISE A;  3A8K A;  3FOE A;  3HOW K;  2CFA B;  4KN4 A;  2A6E A;  1IS1 A;  2GAH C;  1TWG K;  1TWA C;  4LJZ A;  3GTQ C;  3HOX K;  4QIW L;  1TWG A;  4G0W A;  4AYB L;  4KMD A;  1GE9 A;  3ADA C;  3CQZ A;  3RZO C;  3HOU C;  1TWA A;  5C3E K;  3GTQ A;  3CQZ K;  4GZY A;  2E2I C;  4C3I K;  3Q3Q A;  1TWF K;  3AQP A;  3DXJ A;  5C4X C;  1G51 A;  3TFI A;  1XZQ B;  4MQ9 A;  3G4A A;  4A93 C;  1Y1V A;  2JA5 A;  1YCL A;  2D6F C;  3HOY K;  2E2I A;  3TTG A;  2NVX A;  3T00 A;  1XXA A;  3LAJ A;  3GTM K;  3H3V D;  5EGH A;  4BXX K;  3NUH A;  1RU0 A;  2PA8 L;  4BBR K;  1O2B A;  3GTM A;  1F7V A;  2PA8 D;  1EQR A;  3N3Y A;  4O2D A;  4YFX A;  2NVX C;  4BXX C;  1EFW A;  2E2J C;  3I4M K;  2ZFZ A;  4A3L C;  5IOQ A;  2WB1 D;  3M4O C;  3FOF A;  5TMC A;  4A3B K;  2PMZ L;  3S1M C;  1O26 A;  4GTB A;  1HQM A;  4DDQ A;  4GTL A;  4ILD A;  3S17 K;  3IPJ A;  1JOE A;  2FQO A;  1L0W A;  5C4X K;  3S2H C;  2R7Z C;  1I50 C;  3A8I A;  4KM8 A;  3HOZ C;  5IYC K;  5TMF A;  2JA8 K;  2R93 A;  4KAT A;  4QIW D;  1XZP B;  1XZQ A;  3L4K A;  3TFH A;  1O2F B;  2JA5 K;  3I4M C;  3PO3 C;  1YNJ A;  1J6V A;  4P9S A;  3VA7 A;  5C4J C;  3GTG C;  3LAP A;  4OIQ A;  2VUM C;  3S1M K;  2JA6 A;  2PHC B;  1I3Q C;  2JA7 A;  3S1R K;  4YG2 A;  3S1Q K;  2NVQ C;  4KMH A;  4LQY A;  2E2J K;  1WOS A;  1I6V A;  3GTG A;  5TJ3 A;  1O28 A;  1BS2 A;  3PO3 K;  3I4N C;  3GTG K;  3H0G K;  1UV7 A;  2CFA A;  1VH2 A;  1XXB A;  3HOY C;  3AH5 A;  4C3I C;  3GTO A;  1HI9 A;  3HKZ D;  3GEE A;  3GDZ A;  1J6W A;  5JFE A;  2V6T A;  3GTO K;  3H0G C;  2R92 A;  5E68 A;  1WQH A;  4KC6 A;  1VLO A;  1O29 A;  3GTO C;  2YU9 A;  4KAR A;  1SFO A;  4FZB A;  4C3J K;  5JVO A;  3GIR A;  3M4O K;  1I3Q K;  5C3E C;  4OIN A;  3HOW C;  1WOR A;  1ZBS A;  2JH3 A;  2Y3P A;  3H3V L;  2BE5 A;  3S0X A;  2KWA A;  5D4D A;  2YU9 C;  4A3C K;  4BLB A;  2GAG C;  4LOW A;  4WIL A;  4FM9 A;  3ORE A;  4A3D K;  3HOZ K;  4A93 K;  1F9N A;  1O27 A;  4XSZ A;  1IL2 A;  4Y7N C;  4Y52 K;  5M5Y K;  3EQL A;  3HOV C;  1WIH A;  3OPF A;  5M5X K;  3JST A;  5CHP A;  4A3I C;  2V6S A;  2WAQ L;  2R7Z K;  1IBA A;  2B63 A;  2XCO A;  3M3Y K;  1C0A A;  2R92 K;  3AD9 C;  4KB4 A;  4A3D C;  1WSR A;  4C3H C;  2ZUF A;  1SFO K;  4A3E C;  3I4N K;  2B63 C;  3HOX C;  3CAG A;  4A3B C;  1IE0 A;  1R9T C;  5IP9 K;  4RMF A;  1DCP A;  3S2D C;  4BBR C;  1V5V A;  5IOT A;  1TWG C;  4KAS A;  4C2M K;  4BY1 K;  3GTJ A;  2NVX K;  1WQF A;  4C3J C;  4WJ4 A;  3S16 C;  1I50 K;  1JVI A;  4QJV B;  3GTK C;  4LLG A;  3RZD C;  1USM A;  2NVY K;  1VJE A;  4GFQ A;  3K7A K;  3S17 C;  2Y0S D;  4A3I K;  2E2H K;  2NVY A;  1BJT A;  1WOO A;  2E2I K;  3A8J A;  1IQ0 A;  1DD5 A;  1ZQ1 C;  5M3M K;  5IYD K;  3HOU K;  1TWC A;  1WCM K;  3AQO A;  3QX3 A;  4A3F C;  1Y1V C;  4OIP A;  4YFK A;  4BBS C;  3N0C A;  3RZO K;  5CJ9 A;  2GSU A;  4KN7 A;  1TWH A;  4ZH4 A;  4GTE A;  4GTC A;  4GTF A;  1Y1W K;  1TWC C;  3GTM C;  2GSO A;  1TWH C;  1USO A;  5IYB C;  5C4J K;  4WJ3 M;  3GTQ K;  3S14 C;  3N0B A;  1XXC A;  5HL8 A;  5IYB K;  3FHZ A;  1PJ5 A;  3WOD A;  2JA8 C;  1KQ4 A;  5IP7 C;  3GTJ K;  3SZZ A;  1J6X A;  1XPP A;  4LK1 A;  1I50 A;  4XLN A;  2R93 C;  1TWC K;  4PAB A;  4J3N A;  1B4A A;  1O2A A;  3CQZ C;  3S15 K;  4LR2 A;  3LPX A;  4G7Z A;  4LK0 A;  3G4C A;  4G0V A;  2JA6 C;  3HKZ L;  1WQG A;  1AB4 A;  2JA7 C;  3GSI A;  1I6H K;  2VUM K;  3FKI A;  2NVT C;  3AD7 C;  1TWA K;  4YFN A;  2A69 A;  3BUE A;  4AYB D;  2JA5 C;  1BDF A;  3FKI K;  5C44 K;  1Y1W A;  3S1N K;  4M1X A;  4Y52 C;  1SMY A;  1DCH A;  1I6H C;  2A68 A;  4PAA A;  4KB2 A;  5IP7 K;  3FKI C;  4GTD A;  2FQT A;  2V6U A;  1EI6 A;  5FJ8 K;  3OEP A;  5C44 C;  4Q4Z A;  4A3G K;  1BGW A;  2O5J A;  1VGX A;  1Y1W C;  5M5W K;  4XCH A;  3S14 K;  4QJV A;  2JA7 K;  4A3M K;  4NOI A;  4A3L K;  2WAQ D;  4KDD A;  1SFO C;  4OIR A;  4A3J K;  4JK1 A;  2JA6 K;  1WOP A;  1F93 A;  3GTP K;  3PO2 C;  3ERE D;  3L4J A;  1YX2 A;  4KM9 A;  1YNN A;  1ZXO A;  2R7Z A;  4X6A K;  2Y0S L;  2PMZ D;  3BP3 A;  4A3K C;  1IW7 A;  1XZP A;  3GTK K;  3S1N C;  4C45 A;  4BLA A;  1ZYR A;  2CW0 A;  3GEI A;  4G0U A;  2VUM A;  4BY7 C;  2RGR A;  1TWF C;  2P5M A;  3GEH A;  3K7A C;  1I3Q A;  4A3C C;  4X6A C;  1X31 C;  4OIO A;  4KMU A;  3T02 A;  1O24 A;  3V4G A;  3S1R C;  3S1Q C;  3SZY A;  2EBB A;  4A3K K;  5IOR A;  1TWF A;  3TFJ A;  3MML B;  5EGE A;  5L46 A;  5IYD C;  1R9T K;  2E2H A;  4BY7 K;  3PO2 K;  4P5A A;  2P8T A;  1Y1V K;  1O25 A;  1R9T A;  1WCM C;  4A3G C;  1JQW A;  2A6H A;  4G7H A;  2WB1 L;  1K83 K;  1WSV A;  4C3H K;  3H0G A;  2ZUE A;  3GTJ C;  1EK8 A;  4BKW A;  2R92 C;  2E2H C;  3GTK A;  2W7V A;  2PPB A;  1PJ6 A;  1WCM A;  3S2D K; 
#chains in the Genus database with same CATH homology
 2WB1 D;  2JA7 C;  3M4O C;  4G7O A;  3M3Y K;  1I6H K;  5TMC A;  4A3B K;  2NVY C;  5FLM C;  2VUM K;  2R92 K;  2PMZ L;  4BY1 C;  2NVT C;  3S1M C;  2B63 K;  1HQM A;  2NVQ K;  2O5I A;  3GTL C;  4A3D C;  1TWA K;  4YFN A;  3S16 K;  3S17 K;  2A69 A;  4MEY A;  4AYB D;  5C4X K;  2JA5 C;  1BDF A;  1SFO K;  3S2H C;  3FKI K;  5IP9 C;  5C44 K;  4A3E C;  4A3M C;  2R7Z C;  4XLP A;  3S1N K;  4Y52 C;  3I4N K;  2B63 C;  3HOX C;  1I50 C;  1SMY A;  3HOZ C;  1I6H C;  2A68 A;  5TMF A;  5IYC K;  2JA8 K;  3S15 C;  4A3B C;  5IP7 K;  1R9T C;  3FKI C;  4QIW D;  5IP9 K;  3S2D C;  3GTP C;  2YU9 K;  4BBR C;  4A3F K;  4Q5S A;  5FJ8 K;  4A3J C;  2JA5 K;  1TWG C;  3I4M C;  5C44 C;  4Q4Z A;  4C2M K;  4A3E K;  4BY1 K;  3PO3 C;  4A3G K;  4BBS K;  2R93 K;  1YNJ A;  1Y1W C;  2NVX K;  3GTL K;  2O5J A;  5C4J C;  3M3Y C;  3GTG C;  5M5W K;  1I50 K;  4XSX A;  3S14 K;  3S16 C;  4QJV A;  5FLM K;  5IYC C;  4OIQ A;  4QJV B;  2JA7 K;  2VUM C;  3GTK C;  3S1M K;  4LLG A;  3RZD C;  4A3M K;  2NVY K;  4NOI A;  4A3L K;  3K7A K;  1I3Q C;  2WAQ D;  1SFO C;  3S17 C;  4OIR A;  3S1R K;  4YG2 A;  2Y0S D;  4A3I K;  4A3J K;  4MEX A;  3S2H K;  4JK1 A;  4Y7N K;  2E2H K;  2JA6 K;  2E2I K;  2NVT K;  3RZD K;  2NVQ C;  3GTP K;  2E2J K;  5M3M K;  3HOV K;  3PO2 C;  1I6V A;  5IYD K;  5M3F K;  1YNN A;  3HOU K;  3PO3 K;  4X6A K;  1WCM K;  3I4N C;  2Y0S L;  1K83 C;  4A3F C;  1TWH K;  2PMZ D;  1Y1V C;  3H0G K;  4OIP A;  3GTG K;  3HOW K;  4YFK A;  4A3K C;  4KN4 A;  4BBS C;  1IW7 A;  2A6E A;  3RZO K;  3HOY C;  1TWG K;  1TWA C;  4LJZ A;  3GTQ C;  4KN7 A;  3HKZ D;  3HOX K;  3GTK K;  4ZH4 A;  4QIW L;  3S1N C;  3GTO K;  1ZYR A;  1TWC C;  4AYB L;  1Y1W K;  2CW0 A;  3GTM C;  3H0G C;  3RZO C;  4BY7 C;  3HOU C;  1TWF C;  5C3E K;  3GTO C;  3K7A C;  1TWH C;  3CQZ K;  4A3C C;  4GZY A;  4X6A C;  2E2I C;  4OIO A;  5IYB C;  4C3J K;  5C4J K;  4C3I K;  3GTQ K;  4KMU A;  3S14 C;  1TWF K;  3M4O K;  3DXJ A;  1I3Q K;  5C3E C;  5C4X C;  3S1R C;  4OIN A;  3S1Q C;  3HOW C;  3S1Q K;  4A3K K;  3H3V L;  4MQ9 A;  5IYB K;  2BE5 A;  4A93 C;  2YU9 C;  3WOD A;  5D4D A;  4A3C K;  5IYD C;  2JA8 C;  5IP7 C;  3GTJ K;  1R9T K;  3HOY K;  4BY7 K;  3PO2 K;  1XPP A;  4LK1 A;  1Y1V K;  3GTM K;  4XLN A;  3H3V D;  1WCM C;  4A3G C;  2R93 C;  2A6H A;  4G7H A;  4BXX K;  2WB1 L;  1K83 K;  1TWC K;  4A3D K;  2PA8 L;  3HOZ K;  4C3H K;  4BBR K;  4A93 K;  2PA8 D;  4XSZ A;  3CQZ C;  3GTJ C;  2R92 C;  3S15 K;  4Y7N C;  2E2H C;  4Y52 K;  2NVX C;  4YFX A;  5M5Y K;  4BXX C;  3EQL A;  2E2J C;  3HOV C;  3I4M K;  5M5X K;  4G7Z A;  4A3I C;  4LK0 A;  2WAQ L;  2PPB A;  2JA6 C;  3HKZ L;  2R7Z K;  3S2D K;  4A3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...