3HOVK

Complete rna polymerase ii elongation complex ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hovK00
4XSZA 4G7HA 4AYBL 3I4NK 1TWHK 2PA8D 2NVQC 4AYBD 4A3GC 3RZDC 3GTKC 3HOYC 4X6AK 4X6AC 3S1RC 2YU9K 5FLMK 2R92C 3HOXC 3HOUC 3I4MK 2A68A 3S1NK 3RZDK 2NVYK 2JA5C 2NVQK 3EQLA 4YFNA 4OINA 4A3GK 1I6HC 2R7ZK 2B63C 4XSXA 1I50K 3HOZC 3S2HK 4A3LK 3I4MC 4A93K 3S16K 5IP9K 1WCMC 2E2JC 5C3EK 4OIPA 4C3HK 2PMZD 1I6VA 1K83C 3S2HC 4A3LC 5IYCK 3GTLK 3GTOC 1WCMK 2E2JK 1SFOC 4MEXA 4BBSC 4A3MK 1TWGC 2NVYC 3M4OK 4BBRK 3S15K 3S1MC 4A3JK 4BY1C 4C2MK 1Y1VK 5M3MK 3PO3C 1TWHC 3H0GK 3HOVK 4BXXC 2WB1D 4A3EK 4Y52K 4QJVA 4ZH4A 4MEYA 3I4NC 2E2HK 3GTMC 3HOWC 2PA8L 4A3DC 3RZOC 4A3KK 1TWGK 4BY7K 4C3JK 4YG2A 4QIWD 4A3FC 4BY1K 5IYCC 3GTJC 3CQZC 3K7AC 4C3IK 5C4JC 5IP7C 2O5IA 3GTOK 4KN4A 4GZYA 4A3MC 2NVTC 5TMFA 4Y7NC 3GTLC 4A3BC 5C4XK 5M5XK 2VUMK 5IP7K 1I50C 4G7ZA 3HOZK 5IYBC 1SMYA 3GTMK 3HKZD 4KMUA 2PPBA 3RZOK 4BY7C 4A3DK 4A3EC 2R93C 2JA6C 2JA8K 1Y1WC 2WAQL 3HOVC 5M5WK 2E2HC 2A6HA 3HOWK 2WAQD 4BXXK 3S2DK 1TWCK 3GTPK 4Q5SA 3S1NC 4Y52C 4LK1A 3WODA 1TWFK 5FLMC 1Y1WK 2Y0SD 1YNJA 2JA6K 2O5JA 4A3JC 4LK0A 5IYDK 5C44C 2E2IC 2NVXK 4Q4ZA 3S14K 3S2DC 1Y1VC 4QJVB 5FJ8K 4A3IK 3PO2C 4BBSK 3FKIC 4QIWL 3M3YK 2JA7K 3DXJA 5C4XC 2A69A 5C3EC 1R9TC 1XPPA 5IP9C 5IYBK 1IW7A 4OIQA 1I3QC 1BDFA 3S16C 4A3CK 2VUMC 2JA7C 5M3FK 1I6HK 3S1QK 4A3FK 2A6EA 2PMZL 4Y7NK 4A93C 3S14C 5C4JK 2R92K 3HOUK 3S1RK 3FKIK 2YU9C 2WB1L 2JA5K 1TWCC 3GTPC 3H3VD 5C44K 2E2IK 4YFXA 3HOXK 1YNNA 2NVXC 3H3VL 4G7OA 5IYDC 4JK1A 1TWFC 2R93K 3GTQK 3GTKK 3HOYK 4LJZA 4KN7A 2JA8C 4MQ9A 2BE5A 4YFKA 3S1MK 3H0GC 3S15C 3PO3K 4A3BK 4XLNA 1SFOK 3GTGC 4OIRA 5TMCA 4NOIA 4BBRC 2NVTK 1TWAK 3M4OC 4A3CC 3S17K 3CQZK 3K7AK 3GTGK 3S1QC 2CW0A 4A3KC 5M5YK 1K83K 3S17C 1TWAC 1I3QK 3GTJK 1HQMA 2R7ZC 1ZYRA 1R9TK 4A3IC 3PO2K 5D4DA 4XLPA 3GTQC 2Y0SL 3M3YC 2B63K 3HKZL 4OIOA 4LLGA
chains in the Genus database with same CATH superfamily
1WIHA 1JVIA 2PA8D 5EGHA 4AYBD 4A3GC 4GTBA 1ZXOA 1VH2A 2YU9K 3I4MK 5FLMK 1IBAA 3SZYA 2NVYK 4KASA 2NVQK 2FQTA 1C0AA 3GTQA 4XSXA 3HOZC 3Q3QA 2E2JC 5C3EK 2GSUA 4OIPA 3GTOC 1XXBA 2E2JK 4WILA 4A3MK 1O24A 3S1MC 4KDDA 4A3JK 3G4AA 1J98A 1EFWA 5M3MK 1F93A 3GTJA 2JH3A 1IL2A 4A3EK 1TWGA 3HOWC 2GSOA 1EI6A 2RH6A 1TWGK 1J6XA 4A3FC 3GEEA 3GTOK 3GTJC 1VRQC 3K7AC 1X31C 4KN4A 3V4GA 4A3MC 3GTLC 4KB4A 4A3BC 4G7ZA 3HOZK 1BS2A 2E2IA 4KMUA 3RZOK 3LAPA 4A3EC 3TFHA 2R93C 2WAQL 3HOVC 5M5WK 4GTFA 3HOWK 4BXXK 4Q5SA 4GTDA 4Y52C 4LK1A 3WODA 5FLMC 2Y0SD 5IYDK 4A3JC 5C44C 2E2IC 3S14K 3S2DC 5FJ8K 3PO2C 2R93A 3M3YK 2JA7K 3GSIA 1G51A 3T01A 4WJ3M 2YU9A 3MMLB 2GSNA 4OIQA 3S16C 1BDFA 4KM9A 2VUMC 1UV7A 4C3IC 3T02A 4Y7NK 1INNA 2V6TA 2V6UA 2R92K 3S1RK 2WB1L 4FM9A 2P8TA 1TWCC 2ZFZA 2VUMA 5C44K 2E2IK 3H3VL 3GTKK 4LJZA 5CHPA 3A8IA 1PJ7A 3PO3K 1IE0A 5IOQA 3OREA 1TWAK 4LQYA 1IS1A 1VJEA 3GTJK 1WQFA 5EGEA 2R7ZC 4A3IC 4C3JC 3OEPA 1WSVA 1DD5A 3I4MC 4C3HK 1JQWA 4XSZA 4G7HA 2NVQC 4KATA 4C3HC 2R7ZA 3S1NK 2R92C 3HOXC 2JA5C 4KC6A 4KMHA 1I6HC 1F7VA 2B63C 5TJ3A 4LOWA 1ZBSA 4A93K 3AD8C 2R92A 1I6VA 3S2HC 4A3LC 4MEXA 1USOA 1WCMA 3PO3C 3H0GK 5IOSA 3L4JA 2WB1D 1SFOA 3VA7A 4QJVA 4ZH4A 4GTCA 4MEYA 2E2HK 4XCHA 2XCOA 3RZOC 1B4BA 2RGRA 4BY1K 4C3IK 4RMFA 5C4JC 3LPXA 3L4KA 5TMFA 4Y7NC 3GTMA 4KB2A 3T00A 5M5XK 1XZPB 3GIRA 5IYBC 3GTMK 2PPBA 4A3DK 4GFQA 4KMDA 1Y1WC 1I6HK 2E2HC 2A6HA 2WAQD 3S2DK 3GTPK 1PJ6A 4C2MC 1TWFK 1Y1WK 2JA7A 4O2DA 4BBSK 2JA6A 4PAAA 1Y1WA 4QIWL 2E2HA 2A69A 1DCPA 5C3EC 1F9NA 2CFAB 5IP9C 5IYBK 1IW7A 4A3FK 4A93C 1L0WA 5C4JK 3FKIK 1EK8A 3HOXK 1YNNA 4P5BA 4G7OA 4JK1A 3GTQK 3HOYK 4KN7A 3TFIA 4GT9A 3S1MK 3H0GC 1DCOA 3HXAA 3GEIA 1SFOK 3GTGC 4OIRA 3NUHA 4NOIA 5TMCA 1IQ0A 3M4OC 4A3CC 3S17K 3N0CA 3CQZK 1GE9A 3GTGK 3S1QC 3H0GA 5M5YK 3S17C 1O2BA 2KWAA 1I3QK 1WOSA 5D4DA 3GTQC 2Y0SL 4J3NA 3GDZA 1HI9A 1O26A 3S1NC 1TWHK 3ADAC 4G0VA 1XZQB 3RZDC 2GAHC 3GTKC 4X6AC 2PHCB 3S1RC 3BP8C 3RZDK 4OINA 4YFNA 3GTOA 3FOEA 1I50K 3S2HK 3AQPA 4A3LK 3GTKA 3S16K 5IP9K 3FOFA 4GTLA 2PMZD 5CJ9A 1K83C 5IYCK 3AD9C 1TWGC 4GTAA 3S15K 1J6VA 1BGWA 4C2MK 1K83A 4FZBA 1O2AA 2GAGC 3I4NC 1XZPA 5IORA 1WQHA 4P9SA 1JOEA 5JFEA 3SZZA 4YG2A 5IYCC 1O25A 2NVTC 1YX2A 2VUMK 5IP7K 1I50C 4PABA 1SMYA 1XZQA 5IOTA 4BY7C 2JA8K 1AB4A 3GTLA 1TWCK 1I50A 2O5JA 2JA6K 4LK0A 3BP3A 4A3IK 4GTEA 3FKIC 1WOPA 5HL8A 1XPPA 3QX3A 1I3QC 2A6EA 3FKIA 2PMZL 2P5MA 1VGXA 3HOUK 4KM8A 2YU9C 3AD7C 1I3QA 4G0UA 5IYDC 4BLAA 3ERED 1TWFC 1F7UA 1XXAA 4ILDA 4DDQA 4MQ9A 2BE5A 1O28A 1TWCA 1TWFA 4BBRC 1YCLA 3K7AK 3OPFA 3FHZA 4P5AA 3N3YA 4A3KC 1HQMA 1ZYRA 2XCQA 3PO2K 4XLPA 3M3YC 4KMAA 4LLGA 4AYBL 3I4NK 1O27A 1WQGA 3HOYC 1ISEA 3HOUC 3N0BA 4LR2A 2A68A 4A3GK 3EQLA 4KAWX 1BJTA 4C45A 1XXCA 4BKWA 2R7ZK 5JVOA 1PJ5A 2FQOA 2NVYA 1VLOA 1WCMC 4WJ4A 2W7VA 2JA5A 3GTLK 2XCRB 1WCMK 1SFOC 1ZVUA 4BBSC 2B63A 2NVYC 3S0XA 3M4OK 4BBRK 4BY1C 1Y1VK 1O29A 1TWHC 3HOVK 4BXXC 3GEHA 2V6SA 4Y52K 1B4AA 3GTMC 2PA8L 4A3DC 4BY7K 4A3KK 4BLBA 1TWHA 4C3JK 1WSRA 4AH6A 4QIWD 1USMA 3CQZC 4G0WA 2D6FC 5IP7C 3AH5A 2O5IA 2ZUEA 4GZYA 5C4XK 3HKZD 1KQ4A 3CQZA 4M1XA 5E68A 3LAJA 2JA6C 3BUEA 1EQRA 4X6AK 3IPJA 1R9TA 3TFJA 1V5VA 1YNJA 3JSTA 2NVXK 4Q4ZA 2ZUFA 1Y1VC 4QJVB 5L46A 2CFAA 3DXJA 2EBBA 5C4XC 1WORA 1R9TC 1RU0A 4A3CK 2JA7C 5M3FK 1Y1VA 1J6WA 3S1QK 3TTGA 1O2FB 3S14C 2JA5K 3GTPC 3A8JA 3H3VD 2NVXC 4YFXA 2R93K 4KARA 2JA8C 4YFKA 3S15C 1WOOA 1TWAA 3GTPA 4A3BK 2NVXA 4XLNA 3AQOA 2NVTK 3CAGA 3G4CA 2CW0A 3A8KA 1ZQ1C 1K83K 1TWAC 1DCHA 3GTGA 1R9TK 2Y3PA 1EH1A 2B63K 3HKZL 4OIOA
chains in the Genus database with same CATH topology
4XSZA 4G7HA 4AYBL 3I4NK 1TWHK 2PA8D 2NVQC 4AYBD 4A3GC 3RZDC 3GTKC 3HOYC 4X6AK 4X6AC 3S1RC 2YU9K 5FLMK 2R92C 3HOXC 3HOUC 3I4MK 2A68A 3S1NK 3RZDK 2NVYK 2JA5C 2NVQK 3EQLA 4YFNA 4OINA 4A3GK 1I6HC 2R7ZK 2B63C 4XSXA 1I50K 3HOZC 3S2HK 4A3LK 3I4MC 4A93K 3S16K 5IP9K 1WCMC 2E2JC 5C3EK 4OIPA 4C3HK 2PMZD 1I6VA 1K83C 3S2HC 4A3LC 5IYCK 3GTLK 3GTOC 1WCMK 2E2JK 1SFOC 4MEXA 4BBSC 4A3MK 1TWGC 2NVYC 3M4OK 4BBRK 3S15K 3S1MC 4A3JK 4BY1C 4C2MK 1Y1VK 5M3MK 3PO3C 1TWHC 3H0GK 3HOVK 4BXXC 2WB1D 4A3EK 4Y52K 4QJVA 4ZH4A 4MEYA 3I4NC 2E2HK 3GTMC 3HOWC 2PA8L 4A3DC 3RZOC 4A3KK 1TWGK 4BY7K 4C3JK 4YG2A 4QIWD 4A3FC 4BY1K 5IYCC 3GTJC 3CQZC 3K7AC 4C3IK 5C4JC 5IP7C 2O5IA 3GTOK 4KN4A 4GZYA 4A3MC 2NVTC 5TMFA 4Y7NC 3GTLC 4A3BC 5C4XK 5M5XK 2VUMK 5IP7K 1I50C 4G7ZA 3HOZK 5IYBC 1SMYA 3GTMK 3HKZD 4KMUA 2PPBA 3RZOK 4BY7C 4A3DK 4A3EC 2R93C 2JA6C 2JA8K 1Y1WC 2WAQL 3HOVC 5M5WK 2E2HC 2A6HA 3HOWK 2WAQD 4BXXK 3S2DK 1TWCK 3GTPK 4Q5SA 3S1NC 4Y52C 4LK1A 3WODA 1TWFK 5FLMC 1Y1WK 2Y0SD 1YNJA 2JA6K 2O5JA 4A3JC 4LK0A 5IYDK 5C44C 2E2IC 2NVXK 4Q4ZA 3S14K 3S2DC 1Y1VC 4QJVB 5FJ8K 4A3IK 3PO2C 4BBSK 3FKIC 4QIWL 3M3YK 2JA7K 3DXJA 5C4XC 2A69A 5C3EC 1R9TC 1XPPA 5IP9C 5IYBK 1IW7A 4OIQA 1I3QC 1BDFA 3S16C 4A3CK 2VUMC 2JA7C 5M3FK 1I6HK 3S1QK 4A3FK 2A6EA 2PMZL 4Y7NK 4A93C 3S14C 5C4JK 2R92K 3HOUK 3S1RK 3FKIK 2YU9C 2WB1L 2JA5K 1TWCC 3GTPC 3H3VD 5C44K 2E2IK 4YFXA 3HOXK 1YNNA 2NVXC 3H3VL 4G7OA 5IYDC 4JK1A 1TWFC 2R93K 3GTQK 3GTKK 3HOYK 4LJZA 4KN7A 2JA8C 4MQ9A 2BE5A 4YFKA 3S1MK 3H0GC 3S15C 3PO3K 4A3BK 4XLNA 1SFOK 3GTGC 4OIRA 5TMCA 4NOIA 4BBRC 2NVTK 1TWAK 3M4OC 4A3CC 3S17K 3CQZK 3K7AK 3GTGK 3S1QC 2CW0A 4A3KC 5M5YK 1K83K 3S17C 1TWAC 1I3QK 3GTJK 1HQMA 2R7ZC 1ZYRA 1R9TK 4A3IC 3PO2K 5D4DA 4XLPA 3GTQC 2Y0SL 3M3YC 2B63K 3HKZL 4OIOA 4LLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSZ A;  4G7H A;  4AYB L;  3I4N K;  1TWH K;  2PA8 D;  2NVQ C;  4AYB D;  4A3G C;  3RZD C;  3GTK C;  3HOY C;  4X6A K;  4X6A C;  3S1R C;  2YU9 K;  5FLM K;  2R92 C;  3HOX C;  3HOU C;  3I4M K;  2A68 A;  3S1N K;  3RZD K;  2NVY K;  2JA5 C;  2NVQ K;  3EQL A;  4YFN A;  4OIN A;  4A3G K;  1I6H C;  2R7Z K;  2B63 C;  4XSX A;  1I50 K;  3HOZ C;  3S2H K;  4A3L K;  3I4M C;  4A93 K;  3S16 K;  5IP9 K;  1WCM C;  2E2J C;  5C3E K;  4OIP A;  4C3H K;  2PMZ D;  1I6V A;  1K83 C;  3S2H C;  4A3L C;  5IYC K;  3GTL K;  3GTO C;  1WCM K;  2E2J K;  1SFO C;  4MEX A;  4BBS C;  4A3M K;  1TWG C;  2NVY C;  3M4O K;  4BBR K;  3S15 K;  3S1M C;  4A3J K;  4BY1 C;  4C2M K;  1Y1V K;  5M3M K;  3PO3 C;  1TWH C;  3H0G K;  3HOV K;  4BXX C;  2WB1 D;  4A3E K;  4Y52 K;  4QJV A;  4ZH4 A;  4MEY A;  3I4N C;  2E2H K;  3GTM C;  3HOW C;  2PA8 L;  4A3D C;  3RZO C;  4A3K K;  1TWG K;  4BY7 K;  4C3J K;  4YG2 A;  4QIW D;  4A3F C;  4BY1 K;  5IYC C;  3GTJ C;  3CQZ C;  3K7A C;  4C3I K;  5C4J C;  5IP7 C;  2O5I A;  3GTO K;  4KN4 A;  4GZY A;  4A3M C;  2NVT C;  5TMF A;  4Y7N C;  3GTL C;  4A3B C;  5C4X K;  5M5X K;  2VUM K;  5IP7 K;  1I50 C;  4G7Z A;  3HOZ K;  5IYB C;  1SMY A;  3GTM K;  3HKZ D;  4KMU A;  2PPB A;  3RZO K;  4BY7 C;  4A3D K;  4A3E C;  2R93 C;  2JA6 C;  2JA8 K;  1Y1W C;  2WAQ L;  3HOV C;  5M5W K;  2E2H C;  2A6H A;  3HOW K;  2WAQ D;  4BXX K;  3S2D K;  1TWC K;  3GTP K;  4Q5S A;  3S1N C;  4Y52 C;  4LK1 A;  3WOD A;  1TWF K;  5FLM C;  1Y1W K;  2Y0S D;  1YNJ A;  2JA6 K;  2O5J A;  4A3J C;  4LK0 A;  5IYD K;  5C44 C;  2E2I C;  2NVX K;  4Q4Z A;  3S14 K;  3S2D C;  1Y1V C;  4QJV B;  5FJ8 K;  4A3I K;  3PO2 C;  4BBS K;  3FKI C;  4QIW L;  3M3Y K;  2JA7 K;  3DXJ A;  5C4X C;  2A69 A;  5C3E C;  1R9T C;  1XPP A;  5IP9 C;  5IYB K;  1IW7 A;  4OIQ A;  1I3Q C;  1BDF A;  3S16 C;  4A3C K;  2VUM C;  2JA7 C;  5M3F K;  1I6H K;  3S1Q K;  4A3F K;  2A6E A;  2PMZ L;  4Y7N K;  4A93 C;  3S14 C;  5C4J K;  2R92 K;  3HOU K;  3S1R K;  3FKI K;  2YU9 C;  2WB1 L;  2JA5 K;  1TWC C;  3GTP C;  3H3V D;  5C44 K;  2E2I K;  4YFX A;  3HOX K;  1YNN A;  2NVX C;  3H3V L;  4G7O A;  5IYD C;  4JK1 A;  1TWF C;  2R93 K;  3GTQ K;  3GTK K;  3HOY K;  4LJZ A;  4KN7 A;  2JA8 C;  4MQ9 A;  2BE5 A;  4YFK A;  3S1M K;  3H0G C;  3S15 C;  3PO3 K;  4A3B K;  4XLN A;  1SFO K;  3GTG C;  4OIR A;  5TMC A;  4NOI A;  4BBR C;  2NVT K;  1TWA K;  3M4O C;  4A3C C;  3S17 K;  3CQZ K;  3K7A K;  3GTG K;  3S1Q C;  2CW0 A;  4A3K C;  5M5Y K;  1K83 K;  3S17 C;  1TWA C;  1I3Q K;  3GTJ K;  1HQM A;  2R7Z C;  1ZYR A;  1R9T K;  4A3I C;  3PO2 K;  5D4D A;  4XLP A;  3GTQ C;  2Y0S L;  3M3Y C;  2B63 K;  3HKZ L;  4OIO A;  4LLG A; 
#chains in the Genus database with same CATH topology
 1WIH A;  1JVI A;  2PA8 D;  5EGH A;  4AYB D;  4A3G C;  4GTB A;  1ZXO A;  1VH2 A;  2YU9 K;  3I4M K;  5FLM K;  1IBA A;  3SZY A;  2NVY K;  4KAS A;  2NVQ K;  2FQT A;  1C0A A;  3GTQ A;  4XSX A;  3HOZ C;  3Q3Q A;  2E2J C;  5C3E K;  2GSU A;  4OIP A;  3GTO C;  1XXB A;  2E2J K;  4WIL A;  4A3M K;  1O24 A;  3S1M C;  4KDD A;  4A3J K;  3G4A A;  1J98 A;  1EFW A;  5M3M K;  1F93 A;  3GTJ A;  2JH3 A;  1IL2 A;  4A3E K;  1TWG A;  3HOW C;  2GSO A;  1EI6 A;  2RH6 A;  1TWG K;  1J6X A;  4A3F C;  3GEE A;  3GTO K;  3GTJ C;  1VRQ C;  3K7A C;  1X31 C;  4KN4 A;  3V4G A;  4A3M C;  3GTL C;  4KB4 A;  4A3B C;  4G7Z A;  3HOZ K;  1BS2 A;  2E2I A;  4KMU A;  3RZO K;  3LAP A;  4A3E C;  3TFH A;  2R93 C;  2WAQ L;  3HOV C;  5M5W K;  4GTF A;  3HOW K;  4BXX K;  4Q5S A;  4GTD A;  4Y52 C;  4LK1 A;  3WOD A;  5FLM C;  2Y0S D;  5IYD K;  4A3J C;  5C44 C;  2E2I C;  3S14 K;  3S2D C;  5FJ8 K;  3PO2 C;  2R93 A;  3M3Y K;  2JA7 K;  3GSI A;  1G51 A;  3T01 A;  4WJ3 M;  2YU9 A;  3MML B;  2GSN A;  4OIQ A;  3S16 C;  1BDF A;  4KM9 A;  2VUM C;  1UV7 A;  4C3I C;  3T02 A;  4Y7N K;  1INN A;  2V6T A;  2V6U A;  2R92 K;  3S1R K;  2WB1 L;  4FM9 A;  2P8T A;  1TWC C;  2ZFZ A;  2VUM A;  5C44 K;  2E2I K;  3H3V L;  3GTK K;  4LJZ A;  5CHP A;  3A8I A;  1PJ7 A;  3PO3 K;  1IE0 A;  5IOQ A;  3ORE A;  1TWA K;  4LQY A;  1IS1 A;  1VJE A;  3GTJ K;  1WQF A;  5EGE A;  2R7Z C;  4A3I C;  4C3J C;  3OEP A;  1WSV A;  1DD5 A;  3I4M C;  4C3H K;  1JQW A;  4XSZ A;  4G7H A;  2NVQ C;  4KAT A;  4C3H C;  2R7Z A;  3S1N K;  2R92 C;  3HOX C;  2JA5 C;  4KC6 A;  4KMH A;  1I6H C;  1F7V A;  2B63 C;  5TJ3 A;  4LOW A;  1ZBS A;  4A93 K;  3AD8 C;  2R92 A;  1I6V A;  3S2H C;  4A3L C;  4MEX A;  1USO A;  1WCM A;  3PO3 C;  3H0G K;  5IOS A;  3L4J A;  2WB1 D;  1SFO A;  3VA7 A;  4QJV A;  4ZH4 A;  4GTC A;  4MEY A;  2E2H K;  4XCH A;  2XCO A;  3RZO C;  1B4B A;  2RGR A;  4BY1 K;  4C3I K;  4RMF A;  5C4J C;  3LPX A;  3L4K A;  5TMF A;  4Y7N C;  3GTM A;  4KB2 A;  3T00 A;  5M5X K;  1XZP B;  3GIR A;  5IYB C;  3GTM K;  2PPB A;  4A3D K;  4GFQ A;  4KMD A;  1Y1W C;  1I6H K;  2E2H C;  2A6H A;  2WAQ D;  3S2D K;  3GTP K;  1PJ6 A;  4C2M C;  1TWF K;  1Y1W K;  2JA7 A;  4O2D A;  4BBS K;  2JA6 A;  4PAA A;  1Y1W A;  4QIW L;  2E2H A;  2A69 A;  1DCP A;  5C3E C;  1F9N A;  2CFA B;  5IP9 C;  5IYB K;  1IW7 A;  4A3F K;  4A93 C;  1L0W A;  5C4J K;  3FKI K;  1EK8 A;  3HOX K;  1YNN A;  4P5B A;  4G7O A;  4JK1 A;  3GTQ K;  3HOY K;  4KN7 A;  3TFI A;  4GT9 A;  3S1M K;  3H0G C;  1DCO A;  3HXA A;  3GEI A;  1SFO K;  3GTG C;  4OIR A;  3NUH A;  4NOI A;  5TMC A;  1IQ0 A;  3M4O C;  4A3C C;  3S17 K;  3N0C A;  3CQZ K;  1GE9 A;  3GTG K;  3S1Q C;  3H0G A;  5M5Y K;  3S17 C;  1O2B A;  2KWA A;  1I3Q K;  1WOS A;  5D4D A;  3GTQ C;  2Y0S L;  4J3N A;  3GDZ A;  1HI9 A;  1O26 A;  3S1N C;  1TWH K;  3ADA C;  4G0V A;  1XZQ B;  3RZD C;  2GAH C;  3GTK C;  4X6A C;  2PHC B;  3S1R C;  3BP8 C;  3RZD K;  4OIN A;  4YFN A;  3GTO A;  3FOE A;  1I50 K;  3S2H K;  3AQP A;  4A3L K;  3GTK A;  3S16 K;  5IP9 K;  3FOF A;  4GTL A;  2PMZ D;  5CJ9 A;  1K83 C;  5IYC K;  3AD9 C;  1TWG C;  4GTA A;  3S15 K;  1J6V A;  1BGW A;  4C2M K;  1K83 A;  4FZB A;  1O2A A;  2GAG C;  3I4N C;  1XZP A;  5IOR A;  1WQH A;  4P9S A;  1JOE A;  5JFE A;  3SZZ A;  4YG2 A;  5IYC C;  1O25 A;  2NVT C;  1YX2 A;  2VUM K;  5IP7 K;  1I50 C;  4PAB A;  1SMY A;  1XZQ A;  5IOT A;  4BY7 C;  2JA8 K;  1AB4 A;  3GTL A;  1TWC K;  1I50 A;  2O5J A;  2JA6 K;  4LK0 A;  3BP3 A;  4A3I K;  4GTE A;  3FKI C;  1WOP A;  5HL8 A;  1XPP A;  3QX3 A;  1I3Q C;  2A6E A;  3FKI A;  2PMZ L;  2P5M A;  1VGX A;  3HOU K;  4KM8 A;  2YU9 C;  3AD7 C;  1I3Q A;  4G0U A;  5IYD C;  4BLA A;  3ERE D;  1TWF C;  1F7U A;  1XXA A;  4ILD A;  4DDQ A;  4MQ9 A;  2BE5 A;  1O28 A;  1TWC A;  1TWF A;  4BBR C;  1YCL A;  3K7A K;  3OPF A;  3FHZ A;  4P5A A;  3N3Y A;  4A3K C;  1HQM A;  1ZYR A;  2XCQ A;  3PO2 K;  4XLP A;  3M3Y C;  4KMA A;  4LLG A;  4AYB L;  3I4N K;  1O27 A;  1WQG A;  3HOY C;  1ISE A;  3HOU C;  3N0B A;  4LR2 A;  2A68 A;  4A3G K;  3EQL A;  4KAW X;  1BJT A;  4C45 A;  1XXC A;  4BKW A;  2R7Z K;  5JVO A;  1PJ5 A;  2FQO A;  2NVY A;  1VLO A;  1WCM C;  4WJ4 A;  2W7V A;  2JA5 A;  3GTL K;  2XCR B;  1WCM K;  1SFO C;  1ZVU A;  4BBS C;  2B63 A;  2NVY C;  3S0X A;  3M4O K;  4BBR K;  4BY1 C;  1Y1V K;  1O29 A;  1TWH C;  3HOV K;  4BXX C;  3GEH A;  2V6S A;  4Y52 K;  1B4A A;  3GTM C;  2PA8 L;  4A3D C;  4BY7 K;  4A3K K;  4BLB A;  1TWH A;  4C3J K;  1WSR A;  4AH6 A;  4QIW D;  1USM A;  3CQZ C;  4G0W A;  2D6F C;  5IP7 C;  3AH5 A;  2O5I A;  2ZUE A;  4GZY A;  5C4X K;  3HKZ D;  1KQ4 A;  3CQZ A;  4M1X A;  5E68 A;  3LAJ A;  2JA6 C;  3BUE A;  1EQR A;  4X6A K;  3IPJ A;  1R9T A;  3TFJ A;  1V5V A;  1YNJ A;  3JST A;  2NVX K;  4Q4Z A;  2ZUF A;  1Y1V C;  4QJV B;  5L46 A;  2CFA A;  3DXJ A;  2EBB A;  5C4X C;  1WOR A;  1R9T C;  1RU0 A;  4A3C K;  2JA7 C;  5M3F K;  1Y1V A;  1J6W A;  3S1Q K;  3TTG A;  1O2F B;  3S14 C;  2JA5 K;  3GTP C;  3A8J A;  3H3V D;  2NVX C;  4YFX A;  2R93 K;  4KAR A;  2JA8 C;  4YFK A;  3S15 C;  1WOO A;  1TWA A;  3GTP A;  4A3B K;  2NVX A;  4XLN A;  3AQO A;  2NVT K;  3CAG A;  3G4C A;  2CW0 A;  3A8K A;  1ZQ1 C;  1K83 K;  1TWA C;  1DCH A;  3GTG A;  1R9T K;  2Y3P A;  1EH1 A;  2B63 K;  3HKZ L;  4OIO A; 
#chains in the Genus database with same CATH homology
 4XSZ A;  4G7H A;  4AYB L;  3I4N K;  1TWH K;  2PA8 D;  2NVQ C;  4AYB D;  4A3G C;  3RZD C;  3GTK C;  3HOY C;  4X6A K;  4X6A C;  3S1R C;  2YU9 K;  5FLM K;  2R92 C;  3HOX C;  3HOU C;  3I4M K;  2A68 A;  3S1N K;  3RZD K;  2NVY K;  2JA5 C;  2NVQ K;  3EQL A;  4YFN A;  4OIN A;  4A3G K;  1I6H C;  2R7Z K;  2B63 C;  4XSX A;  1I50 K;  3HOZ C;  3S2H K;  4A3L K;  3I4M C;  4A93 K;  3S16 K;  5IP9 K;  1WCM C;  2E2J C;  5C3E K;  4OIP A;  4C3H K;  2PMZ D;  1I6V A;  1K83 C;  3S2H C;  4A3L C;  5IYC K;  3GTL K;  3GTO C;  1WCM K;  2E2J K;  1SFO C;  4MEX A;  4BBS C;  4A3M K;  1TWG C;  2NVY C;  3M4O K;  4BBR K;  3S15 K;  3S1M C;  4A3J K;  4BY1 C;  4C2M K;  1Y1V K;  5M3M K;  3PO3 C;  1TWH C;  3H0G K;  3HOV K;  4BXX C;  2WB1 D;  4A3E K;  4Y52 K;  4QJV A;  4ZH4 A;  4MEY A;  3I4N C;  2E2H K;  3GTM C;  3HOW C;  2PA8 L;  4A3D C;  3RZO C;  4A3K K;  1TWG K;  4BY7 K;  4C3J K;  4YG2 A;  4QIW D;  4A3F C;  4BY1 K;  5IYC C;  3GTJ C;  3CQZ C;  3K7A C;  4C3I K;  5C4J C;  5IP7 C;  2O5I A;  3GTO K;  4KN4 A;  4GZY A;  4A3M C;  2NVT C;  5TMF A;  4Y7N C;  3GTL C;  4A3B C;  5C4X K;  5M5X K;  2VUM K;  5IP7 K;  1I50 C;  4G7Z A;  3HOZ K;  5IYB C;  1SMY A;  3GTM K;  3HKZ D;  4KMU A;  2PPB A;  3RZO K;  4BY7 C;  4A3D K;  4A3E C;  2R93 C;  2JA6 C;  2JA8 K;  1Y1W C;  2WAQ L;  3HOV C;  5M5W K;  2E2H C;  2A6H A;  3HOW K;  2WAQ D;  4BXX K;  3S2D K;  1TWC K;  3GTP K;  4Q5S A;  3S1N C;  4Y52 C;  4LK1 A;  3WOD A;  1TWF K;  5FLM C;  1Y1W K;  2Y0S D;  1YNJ A;  2JA6 K;  2O5J A;  4A3J C;  4LK0 A;  5IYD K;  5C44 C;  2E2I C;  2NVX K;  4Q4Z A;  3S14 K;  3S2D C;  1Y1V C;  4QJV B;  5FJ8 K;  4A3I K;  3PO2 C;  4BBS K;  3FKI C;  4QIW L;  3M3Y K;  2JA7 K;  3DXJ A;  5C4X C;  2A69 A;  5C3E C;  1R9T C;  1XPP A;  5IP9 C;  5IYB K;  1IW7 A;  4OIQ A;  1I3Q C;  1BDF A;  3S16 C;  4A3C K;  2VUM C;  2JA7 C;  5M3F K;  1I6H K;  3S1Q K;  4A3F K;  2A6E A;  2PMZ L;  4Y7N K;  4A93 C;  3S14 C;  5C4J K;  2R92 K;  3HOU K;  3S1R K;  3FKI K;  2YU9 C;  2WB1 L;  2JA5 K;  1TWC C;  3GTP C;  3H3V D;  5C44 K;  2E2I K;  4YFX A;  3HOX K;  1YNN A;  2NVX C;  3H3V L;  4G7O A;  5IYD C;  4JK1 A;  1TWF C;  2R93 K;  3GTQ K;  3GTK K;  3HOY K;  4LJZ A;  4KN7 A;  2JA8 C;  4MQ9 A;  2BE5 A;  4YFK A;  3S1M K;  3H0G C;  3S15 C;  3PO3 K;  4A3B K;  4XLN A;  1SFO K;  3GTG C;  4OIR A;  5TMC A;  4NOI A;  4BBR C;  2NVT K;  1TWA K;  3M4O C;  4A3C C;  3S17 K;  3CQZ K;  3K7A K;  3GTG K;  3S1Q C;  2CW0 A;  4A3K C;  5M5Y K;  1K83 K;  3S17 C;  1TWA C;  1I3Q K;  3GTJ K;  1HQM A;  2R7Z C;  1ZYR A;  1R9T K;  4A3I C;  3PO2 K;  5D4D A;  4XLP A;  3GTQ C;  2Y0S L;  3M3Y C;  2B63 K;  3HKZ L;  4OIO A;  4LLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...