3HOVK

Complete rna polymerase ii elongation complex ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hovK00
5IYBK 4MQ9A 4C3IK 2JA6K 4A3BK 4A93K 1TWAC 1K83K 2CW0A 2JA5K 3S2DC 4XLNA 1TWAK 4A3JC 3PO2K 2NVXC 3HOWK 3K7AK 3S2DK 2NVQC 4A3JK 4G7HA 5IYCC 2NVQK 5IP7C 1Y1VC 3S1NK 2E2IC 1TWHC 3HOXC 4KN4A 1Y1VK 1YNNA 5IP7K 1TWHK 2JA8C 4YFNA 5M5XK 2JA8K 4BBSC 3HOUK 4Y52C 1WCMK 4Q4ZA 3GTPC 2B63K 2YU9C 4A3LK 4A3IC 5IP9K 4JK1A 4A3KC 3FKIK 4KN7A 3WODA 2YU9K 3S15K 5FLMC 4A3IK 3S16C 1BDFA 2A6HA 4Y7NC 4G7ZA 2PMZD 5FLMK 4C3JK 2VUMC 2PMZL 4LLGA 4OIOA 4BY7K 4A3MC 3M3YC 4BXXC 4QIWD 2R93C 4A3MK 2NVTK 4QIWL 4QJVA 2JA6C 4A3BC 5C3EK 4AYBD 3M4OC 1K83C 2JA5C 4AYBL 5D4DA 3HOVK 3M4OK 3PO2C 3PO3K 1TWGK 2A6EA 3K7AC 3HOWC 1XPPA 3S1NC 4C3HK 4YFXA 4NOIA 4C2MK 3HOUC 3S1RK 1WCMC 2WAQD 2B63C 2JA7C 4A3LC 3HKZD 2WAQL 3EQLA 4YG2A 5IP9C 3FKIC 5M5YK 2JA7K 2R7ZK 3HKZL 4YFKA 5FJ8K 3S15C 3S1QC 4A3DK 1ZYRA 3S1QK 4A3CK 1IW7A 3GTGK 3H0GC 4BY7C 1TWCK 3H0GK 4LK1A 4MEXA 1I6VA 2NVTC 4OINA 4QJVB 5C44K 5C3EC 1I50K 4XSXA 3RZDC 4ZH4A 4OIPA 3RZDK 3HOVC 3PO3C 1TWGC 4XLPA 3GTJC 3GTKK 3GTJK 2Y0SD 2A68A 1SFOK 2O5JA 2Y0SL 4MEYA 3I4NK 2PPBA 3HOZK 3GTMK 3S1RC 5C4JK 3DXJA 5C4XK 3S17K 3S2HC 4X6AC 2R7ZC 3S1MC 5TMFA 3S2HK 1TWFK 4KMUA 5TMCA 4BBRK 3GTQK 3RZOC 3S1MK 4A3DC 4X6AK 3RZOK 4A3CC 3GTGC 1R9TC 3GTLC 4A3GK 1TWCC 3GTLK 4LK0A 2PA8D 1Y1WK 1R9TK 3H3VD 4OIRA 4G7OA 2R92K 3H3VL 2PA8L 1I6HC 1I6HK 5C44C 1I50C 4GZYA 4BY1C 2E2HC 4OIQA 3GTOC 3GTKC 2E2JC 4BY1K 2WB1D 5IYDC 2E2HK 2NVXK 3GTOK 2E2JK 2WB1L 5IYCK 5IYDK 1YNJA 1SFOC 3I4NC 1HQMA 2E2IK 3I4MC 3HOZC 4LJZA 3HOXK 3GTMC 4A3FC 3I4MK 5C4JC 4A3FK 4BBSK 4Y52K 2A69A 1I3QC 3GTPK 3S14C 3S17C 5C4XC 4XSZA 1I3QK 2BE5A 3HOYC 3S14K 1TWFC 4A3KK 4BBRC 2O5IA 4A3EC 3GTQC 3HOYK 3S16K 4Y7NK 4A3EK 3CQZC 5M3FK 4Q5SA 4A3GC 5M3MK 2VUMK 3CQZK 2NVYC 1Y1WC 2R92C 2NVYK 3M3YK 5M5WK 5IYBC 4BXXK 2R93K 1SMYA 4A93C
chains in the Genus database with same CATH superfamily
4C3IK 3GEHA 3ERED 2JA5K 3S2DC 4XLNA 3PO2K 3HOWK 2JH3A 3BP3A 3S0XA 5IP7K 1TWHK 3GTKA 1VGXA 3AQPA 2JA8K 4BBSC 4WJ4A 1WCMK 3T01A 3GTPC 3N0CA 2B63K 4KN7A 5FLMC 1BDFA 4G7ZA 4GTCA 2VUMC 2EBBA 4OIOA 2P5MA 4GTEA 3GTQA 4QIWL 4C3IC 5IOSA 4BLBA 2JA5C 1O26A 1WQGA 3HOVK 3PO2C 1DD5A 3HOWC 4KB2A 1WQFA 3GEIA 4KC6A 4C2MC 3A8IA 4C3HK 3IPJA 3BUEA 1WCMC 2B63C 2WAQL 4A3LK 2R7ZK 3HKZL 1O2AA 4GTLA 4YFKA 4PAAA 3GTPA 1VJEA 3OEPA 1I6VA 4QJVB 2VUMA 4P5BA 4OIPA 3AD7C 5L46A 1BS2A 3VA7A 1VH2A 3RZDK 4P9SA 3HOVC 2W7VA 2P8TA 3GTJK 2Y0SL 3A8JA 4MEYA 4C3HC 3I4NK 2PPBA 2JA5A 3GTMK 3N0BA 2R7ZC 1TWFK 1TWHA 2ZFZA 3GIRA 3JSTA 3Q3QA 4BBRK 4BKWA 3RZOC 1WCMA 1IBAA 3FOEA 2B63A 3GTLK 4G7OA 1Y1WK 1YCLA 4ILDA 1WIHA 1I6HC 1YX2A 3BP8C 1F93A 1ZVUA 2E2HC 4OIQA 3GTOC 2D6FC 4BY1K 4GFQA 2NVXK 2WB1L 5IYDK 3I4NC 3GTMC 4A3FC 1J98A 4KM8A 4Y52K 2A69A 4M1XA 5EGHA 3TFHA 3S14K 1TWFC 4BBRC 5JFEA 4A3EC 3HOYK 4KATA 4Y7NK 5M3MK 4G0VA 3CQZK 1Y1WC 2R7ZA 2R93K 5IYBC 4LR2A 1WORA 1X31C 1K83K 2CW0A 3LPXA 4A3JC 2NVXC 3K7AK 3S2DK 4GTFA 2NVQC 1BJTA 1Y1VC 3S1NK 3FOFA 4KN4A 2E2HA 3GTJA 4Y52C 3HOUK 4GT9A 2YU9C 3FHZA 2GAGC 5IP9K 4A3IC 1IE0A 3V4GA 3GTMA 1WSRA 1WSVA 4Y7NC 3A8KA 5FLMK 4C3JK 2PMZL 4LLGA 2R93C 1TWFA 4QIWD 1EK8A 4QJVA 1IQ0A 3TTGA 4XCHA 1K83C 3GTLA 4AYBL 1B4BA 1Y1WA 3K7AC 1XPPA 1DCHA 3S1NC 2RH6A 3LAPA 4YFXA 4NOIA 4C2MK 2NVXA 3HOUC 2WAQD 2JA7C 4KMHA 3HKZD 3EQLA 5IP9C 3S1QC 4GTBA 1ZYRA 1F7UA 4C3JC 1IS1A 1IW7A 3H0GC 2YU9A 4MEXA 1V5VA 5CHPA 1I50K 3CQZA 1USOA 4PABA 5IOTA 4XLPA 2R93A 1GE9A 2Y0SD 1K83A 3HOZK 3HXAA 5C4JK 5C4XK 4X6AC 5JVOA 5TMCA 3RZOK 1ISEA 1WOPA 1R9TC 4LK0A 4WJ3M 2R92K 1UV7A 3H3VL 1I6HK 1F7VA 1I50C 4GZYA 3TFJA 2E2JC 2WB1D 2E2HK 3GTOK 5IYCK 1HQMA 3I4MC 3HOZC 4LJZA 1F9NA 3HOXK 1USMA 5C4JC 4A3FK 1I3QC 4LOWA 5C4XC 4G0WA 1IL2A 4A3KK 4GTAA 3MMLB 4A3EK 4KAWX 1B4AA 2NVYC 3T02A 2R92C 4A93C 5IYBK 2JA6K 1INNA 3CAGA 1TWAC 1DCPA 3OPFA 4A3JK 5IYCC 1I50A 2NVQK 1O2BA 3HOXC 1Y1VK 1KQ4A 5E68A 4Q4ZA 1J6VA 1DCOA 4A3KC 3FKIK 2YU9K 1EI6A 2FQTA 4A3IK 2A6HA 1WQHA 2PMZD 1XZPB 3T00A 1L0WA 3AQOA 4A3MC 3NUHA 4KM9A 3AH5A 2JA6C 4AYBD 3M4OC 1XZQB 3L4JA 2NVYA 3PO3K 1TWGK 2A6EA 2R92A 3GTOA 3QX3A 1RU0A 4KARA 2JA7K 4YG2A 2V6TA 3FKIC 2GSOA 5FJ8K 4G0UA 4A3DK 3S1QK 4A3CK 3GTGK 1TWCK 3H0GK 1O24A 4LK1A 3SZYA 5C44K 1HI9A 4ZH4A 1BGWA 3PO3C 1TWGC 3G4CA 3AD9C 2JA6A 1SFOK 5CJ9A 1J6XA 1EQRA 3GDZA 4AH6A 3S17K 4J3NA 3S2HC 4KASA 3S1MC 1Y1VA 4A3DC 4KMUA 4X6AK 1JOEA 4A3CC 3GTGC 4DDQA 1TWCC 1R9TK 3H3VD 3FKIA 4OIRA 1XXBA 1XXAA 2PA8L 2KWAA 5C44C 1O2FB 2E2JK 5TJ3A 1SFOC 2E2IK 1TWGA 3I4MK 2XCQA 1PJ7A 1XXCA 3S17C 1I3QK 2BE5A 3S16K 2CFAB 5M3FK 1XZPA 4Q5SA 3G4AA 2JA7A 2NVYK 5EGEA 3M3YK 4BXXK 1SMYA 4MQ9A 4A3BK 3GTGA 4A93K 5HL8A 1TWCA 1XZQA 3H0GA 1TWAK 4O2DA 4G7HA 5IP7C 5IORA 2GAHC 2E2IC 1TWHC 2V6UA 1YNNA 2JA8C 4YFNA 5M5XK 4KMAA 1ZBSA 1SFOA 1O29A 4JK1A 3S15K 2V6SA 3WODA 3S16C 1O25A 2ZUFA 4BY7K 1VRQC 3TFIA 3OREA 3M3YC 4BXXC 4A3MK 2NVTK 4A3BC 5C3EK 1ZXOA 1R9TA 5D4DA 4LQYA 3M4OK 2FQOA 1C0AA 1O28A 3S1RK 4A3LC 5M5YK 4GTDA 2RGRA 3S15C 1EH1A 2E2IA 4BLAA 1JVIA 4WILA 1WOOA 4KMDA 4BY7C 1VLOA 1I3QA 4FM9A 4KB4A 2NVTC 4OINA 5C3EC 4XSXA 3RZDC 2PHCB 4C45A 1ZQ1C 3GTJC 3GTKK 2A68A 2XCOA 2O5JA 3GSIA 4RMFA 5IOQA 1PJ6A 1TWAA 1O27A 3S1RC 3DXJA 3GEEA 1J6WA 5TMFA 3LAJA 3S2HK 2ZUEA 3GTQK 3S1MK 3L4KA 3GTLC 2CFAA 4A3GK 1PJ5A 2PA8D 2GSUA 1WOSA 3AD8C 4BY1C 1G51A 3ADAC 3GTKC 5IYDC 1YNJA 4KDDA 4BBSK 2Y3PA 1JQWA 3GTPK 3S14C 2GSNA 3SZZA 4XSZA 1EFWA 3HOYC 2O5IA 3GTQC 1AB4A 2XCRB 4FZBA 3CQZC 4P5AA 4A3GC 2VUMK 3N3YA 5M5WK
chains in the Genus database with same CATH topology
5IYBK 4MQ9A 4C3IK 2JA6K 4A3BK 4A93K 1TWAC 1K83K 2CW0A 2JA5K 3S2DC 4XLNA 1TWAK 4A3JC 3PO2K 2NVXC 3HOWK 3K7AK 3S2DK 2NVQC 4A3JK 4G7HA 5IYCC 2NVQK 5IP7C 1Y1VC 3S1NK 2E2IC 1TWHC 3HOXC 4KN4A 1Y1VK 1YNNA 5IP7K 1TWHK 2JA8C 4YFNA 5M5XK 2JA8K 4BBSC 3HOUK 4Y52C 1WCMK 4Q4ZA 3GTPC 2B63K 2YU9C 4A3LK 4A3IC 5IP9K 4JK1A 4A3KC 3FKIK 4KN7A 3WODA 2YU9K 3S15K 5FLMC 4A3IK 3S16C 1BDFA 2A6HA 4Y7NC 4G7ZA 2PMZD 5FLMK 4C3JK 2VUMC 2PMZL 4LLGA 4OIOA 4BY7K 4A3MC 3M3YC 4BXXC 4QIWD 2R93C 4A3MK 2NVTK 4QIWL 4QJVA 2JA6C 4A3BC 5C3EK 4AYBD 3M4OC 1K83C 2JA5C 4AYBL 5D4DA 3HOVK 3M4OK 3PO2C 3PO3K 1TWGK 2A6EA 3K7AC 3HOWC 1XPPA 3S1NC 4C3HK 4YFXA 4NOIA 4C2MK 3HOUC 3S1RK 1WCMC 2WAQD 2B63C 2JA7C 4A3LC 3HKZD 2WAQL 3EQLA 4YG2A 5IP9C 3FKIC 5M5YK 2JA7K 2R7ZK 3HKZL 4YFKA 5FJ8K 3S15C 3S1QC 4A3DK 1ZYRA 3S1QK 4A3CK 1IW7A 3GTGK 3H0GC 4BY7C 1TWCK 3H0GK 4LK1A 4MEXA 1I6VA 2NVTC 4OINA 4QJVB 5C44K 5C3EC 1I50K 4XSXA 3RZDC 4ZH4A 4OIPA 3RZDK 3HOVC 3PO3C 1TWGC 4XLPA 3GTJC 3GTKK 3GTJK 2Y0SD 2A68A 1SFOK 2O5JA 2Y0SL 4MEYA 3I4NK 2PPBA 3HOZK 3GTMK 3S1RC 5C4JK 3DXJA 5C4XK 3S17K 3S2HC 4X6AC 2R7ZC 3S1MC 5TMFA 3S2HK 1TWFK 4KMUA 5TMCA 4BBRK 3GTQK 3RZOC 3S1MK 4A3DC 4X6AK 3RZOK 4A3CC 3GTGC 1R9TC 3GTLC 4A3GK 1TWCC 3GTLK 4LK0A 2PA8D 1Y1WK 1R9TK 3H3VD 4OIRA 4G7OA 2R92K 3H3VL 2PA8L 1I6HC 1I6HK 5C44C 1I50C 4GZYA 4BY1C 2E2HC 4OIQA 3GTOC 3GTKC 2E2JC 4BY1K 2WB1D 5IYDC 2E2HK 2NVXK 3GTOK 2E2JK 2WB1L 5IYCK 5IYDK 1YNJA 1SFOC 3I4NC 1HQMA 2E2IK 3I4MC 3HOZC 4LJZA 3HOXK 3GTMC 4A3FC 3I4MK 5C4JC 4A3FK 4BBSK 4Y52K 2A69A 1I3QC 3GTPK 3S14C 3S17C 5C4XC 4XSZA 1I3QK 2BE5A 3HOYC 3S14K 1TWFC 4A3KK 4BBRC 2O5IA 4A3EC 3GTQC 3HOYK 3S16K 4Y7NK 4A3EK 3CQZC 5M3FK 4Q5SA 4A3GC 5M3MK 2VUMK 3CQZK 2NVYC 1Y1WC 2R92C 2NVYK 3M3YK 5M5WK 5IYBC 4BXXK 2R93K 1SMYA 4A93C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB K;  4MQ9 A;  4C3I K;  2JA6 K;  4A3B K;  4A93 K;  1TWA C;  1K83 K;  2CW0 A;  2JA5 K;  3S2D C;  4XLN A;  1TWA K;  4A3J C;  3PO2 K;  2NVX C;  3HOW K;  3K7A K;  3S2D K;  2NVQ C;  4A3J K;  4G7H A;  5IYC C;  2NVQ K;  5IP7 C;  1Y1V C;  3S1N K;  2E2I C;  1TWH C;  3HOX C;  4KN4 A;  1Y1V K;  1YNN A;  5IP7 K;  1TWH K;  2JA8 C;  4YFN A;  5M5X K;  2JA8 K;  4BBS C;  3HOU K;  4Y52 C;  1WCM K;  4Q4Z A;  3GTP C;  2B63 K;  2YU9 C;  4A3L K;  4A3I C;  5IP9 K;  4JK1 A;  4A3K C;  3FKI K;  4KN7 A;  3WOD A;  2YU9 K;  3S15 K;  5FLM C;  4A3I K;  3S16 C;  1BDF A;  2A6H A;  4Y7N C;  4G7Z A;  2PMZ D;  5FLM K;  4C3J K;  2VUM C;  2PMZ L;  4LLG A;  4OIO A;  4BY7 K;  4A3M C;  3M3Y C;  4BXX C;  4QIW D;  2R93 C;  4A3M K;  2NVT K;  4QIW L;  4QJV A;  2JA6 C;  4A3B C;  5C3E K;  4AYB D;  3M4O C;  1K83 C;  2JA5 C;  4AYB L;  5D4D A;  3HOV K;  3M4O K;  3PO2 C;  3PO3 K;  1TWG K;  2A6E A;  3K7A C;  3HOW C;  1XPP A;  3S1N C;  4C3H K;  4YFX A;  4NOI A;  4C2M K;  3HOU C;  3S1R K;  1WCM C;  2WAQ D;  2B63 C;  2JA7 C;  4A3L C;  3HKZ D;  2WAQ L;  3EQL A;  4YG2 A;  5IP9 C;  3FKI C;  5M5Y K;  2JA7 K;  2R7Z K;  3HKZ L;  4YFK A;  5FJ8 K;  3S15 C;  3S1Q C;  4A3D K;  1ZYR A;  3S1Q K;  4A3C K;  1IW7 A;  3GTG K;  3H0G C;  4BY7 C;  1TWC K;  3H0G K;  4LK1 A;  4MEX A;  1I6V A;  2NVT C;  4OIN A;  4QJV B;  5C44 K;  5C3E C;  1I50 K;  4XSX A;  3RZD C;  4ZH4 A;  4OIP A;  3RZD K;  3HOV C;  3PO3 C;  1TWG C;  4XLP A;  3GTJ C;  3GTK K;  3GTJ K;  2Y0S D;  2A68 A;  1SFO K;  2O5J A;  2Y0S L;  4MEY A;  3I4N K;  2PPB A;  3HOZ K;  3GTM K;  3S1R C;  5C4J K;  3DXJ A;  5C4X K;  3S17 K;  3S2H C;  4X6A C;  2R7Z C;  3S1M C;  5TMF A;  3S2H K;  1TWF K;  4KMU A;  5TMC A;  4BBR K;  3GTQ K;  3RZO C;  3S1M K;  4A3D C;  4X6A K;  3RZO K;  4A3C C;  3GTG C;  1R9T C;  3GTL C;  4A3G K;  1TWC C;  3GTL K;  4LK0 A;  2PA8 D;  1Y1W K;  1R9T K;  3H3V D;  4OIR A;  4G7O A;  2R92 K;  3H3V L;  2PA8 L;  1I6H C;  1I6H K;  5C44 C;  1I50 C;  4GZY A;  4BY1 C;  2E2H C;  4OIQ A;  3GTO C;  3GTK C;  2E2J C;  4BY1 K;  2WB1 D;  5IYD C;  2E2H K;  2NVX K;  3GTO K;  2E2J K;  2WB1 L;  5IYC K;  5IYD K;  1YNJ A;  1SFO C;  3I4N C;  1HQM A;  2E2I K;  3I4M C;  3HOZ C;  4LJZ A;  3HOX K;  3GTM C;  4A3F C;  3I4M K;  5C4J C;  4A3F K;  4BBS K;  4Y52 K;  2A69 A;  1I3Q C;  3GTP K;  3S14 C;  3S17 C;  5C4X C;  4XSZ A;  1I3Q K;  2BE5 A;  3HOY C;  3S14 K;  1TWF C;  4A3K K;  4BBR C;  2O5I A;  4A3E C;  3GTQ C;  3HOY K;  3S16 K;  4Y7N K;  4A3E K;  3CQZ C;  5M3F K;  4Q5S A;  4A3G C;  5M3M K;  2VUM K;  3CQZ K;  2NVY C;  1Y1W C;  2R92 C;  2NVY K;  3M3Y K;  5M5W K;  5IYB C;  4BXX K;  2R93 K;  1SMY A;  4A93 C; 
#chains in the Genus database with same CATH topology
 4C3I K;  3GEH A;  3ERE D;  2JA5 K;  3S2D C;  4XLN A;  3PO2 K;  3HOW K;  2JH3 A;  3BP3 A;  3S0X A;  5IP7 K;  1TWH K;  3GTK A;  1VGX A;  3AQP A;  2JA8 K;  4BBS C;  4WJ4 A;  1WCM K;  3T01 A;  3GTP C;  3N0C A;  2B63 K;  4KN7 A;  5FLM C;  1BDF A;  4G7Z A;  4GTC A;  2VUM C;  2EBB A;  4OIO A;  2P5M A;  4GTE A;  3GTQ A;  4QIW L;  4C3I C;  5IOS A;  4BLB A;  2JA5 C;  1O26 A;  1WQG A;  3HOV K;  3PO2 C;  1DD5 A;  3HOW C;  4KB2 A;  1WQF A;  3GEI A;  4KC6 A;  4C2M C;  3A8I A;  4C3H K;  3IPJ A;  3BUE A;  1WCM C;  2B63 C;  2WAQ L;  4A3L K;  2R7Z K;  3HKZ L;  1O2A A;  4GTL A;  4YFK A;  4PAA A;  3GTP A;  1VJE A;  3OEP A;  1I6V A;  4QJV B;  2VUM A;  4P5B A;  4OIP A;  3AD7 C;  5L46 A;  1BS2 A;  3VA7 A;  1VH2 A;  3RZD K;  4P9S A;  3HOV C;  2W7V A;  2P8T A;  3GTJ K;  2Y0S L;  3A8J A;  4MEY A;  4C3H C;  3I4N K;  2PPB A;  2JA5 A;  3GTM K;  3N0B A;  2R7Z C;  1TWF K;  1TWH A;  2ZFZ A;  3GIR A;  3JST A;  3Q3Q A;  4BBR K;  4BKW A;  3RZO C;  1WCM A;  1IBA A;  3FOE A;  2B63 A;  3GTL K;  4G7O A;  1Y1W K;  1YCL A;  4ILD A;  1WIH A;  1I6H C;  1YX2 A;  3BP8 C;  1F93 A;  1ZVU A;  2E2H C;  4OIQ A;  3GTO C;  2D6F C;  4BY1 K;  4GFQ A;  2NVX K;  2WB1 L;  5IYD K;  3I4N C;  3GTM C;  4A3F C;  1J98 A;  4KM8 A;  4Y52 K;  2A69 A;  4M1X A;  5EGH A;  3TFH A;  3S14 K;  1TWF C;  4BBR C;  5JFE A;  4A3E C;  3HOY K;  4KAT A;  4Y7N K;  5M3M K;  4G0V A;  3CQZ K;  1Y1W C;  2R7Z A;  2R93 K;  5IYB C;  4LR2 A;  1WOR A;  1X31 C;  1K83 K;  2CW0 A;  3LPX A;  4A3J C;  2NVX C;  3K7A K;  3S2D K;  4GTF A;  2NVQ C;  1BJT A;  1Y1V C;  3S1N K;  3FOF A;  4KN4 A;  2E2H A;  3GTJ A;  4Y52 C;  3HOU K;  4GT9 A;  2YU9 C;  3FHZ A;  2GAG C;  5IP9 K;  4A3I C;  1IE0 A;  3V4G A;  3GTM A;  1WSR A;  1WSV A;  4Y7N C;  3A8K A;  5FLM K;  4C3J K;  2PMZ L;  4LLG A;  2R93 C;  1TWF A;  4QIW D;  1EK8 A;  4QJV A;  1IQ0 A;  3TTG A;  4XCH A;  1K83 C;  3GTL A;  4AYB L;  1B4B A;  1Y1W A;  3K7A C;  1XPP A;  1DCH A;  3S1N C;  2RH6 A;  3LAP A;  4YFX A;  4NOI A;  4C2M K;  2NVX A;  3HOU C;  2WAQ D;  2JA7 C;  4KMH A;  3HKZ D;  3EQL A;  5IP9 C;  3S1Q C;  4GTB A;  1ZYR A;  1F7U A;  4C3J C;  1IS1 A;  1IW7 A;  3H0G C;  2YU9 A;  4MEX A;  1V5V A;  5CHP A;  1I50 K;  3CQZ A;  1USO A;  4PAB A;  5IOT A;  4XLP A;  2R93 A;  1GE9 A;  2Y0S D;  1K83 A;  3HOZ K;  3HXA A;  5C4J K;  5C4X K;  4X6A C;  5JVO A;  5TMC A;  3RZO K;  1ISE A;  1WOP A;  1R9T C;  4LK0 A;  4WJ3 M;  2R92 K;  1UV7 A;  3H3V L;  1I6H K;  1F7V A;  1I50 C;  4GZY A;  3TFJ A;  2E2J C;  2WB1 D;  2E2H K;  3GTO K;  5IYC K;  1HQM A;  3I4M C;  3HOZ C;  4LJZ A;  1F9N A;  3HOX K;  1USM A;  5C4J C;  4A3F K;  1I3Q C;  4LOW A;  5C4X C;  4G0W A;  1IL2 A;  4A3K K;  4GTA A;  3MML B;  4A3E K;  4KAW X;  1B4A A;  2NVY C;  3T02 A;  2R92 C;  4A93 C;  5IYB K;  2JA6 K;  1INN A;  3CAG A;  1TWA C;  1DCP A;  3OPF A;  4A3J K;  5IYC C;  1I50 A;  2NVQ K;  1O2B A;  3HOX C;  1Y1V K;  1KQ4 A;  5E68 A;  4Q4Z A;  1J6V A;  1DCO A;  4A3K C;  3FKI K;  2YU9 K;  1EI6 A;  2FQT A;  4A3I K;  2A6H A;  1WQH A;  2PMZ D;  1XZP B;  3T00 A;  1L0W A;  3AQO A;  4A3M C;  3NUH A;  4KM9 A;  3AH5 A;  2JA6 C;  4AYB D;  3M4O C;  1XZQ B;  3L4J A;  2NVY A;  3PO3 K;  1TWG K;  2A6E A;  2R92 A;  3GTO A;  3QX3 A;  1RU0 A;  4KAR A;  2JA7 K;  4YG2 A;  2V6T A;  3FKI C;  2GSO A;  5FJ8 K;  4G0U A;  4A3D K;  3S1Q K;  4A3C K;  3GTG K;  1TWC K;  3H0G K;  1O24 A;  4LK1 A;  3SZY A;  5C44 K;  1HI9 A;  4ZH4 A;  1BGW A;  3PO3 C;  1TWG C;  3G4C A;  3AD9 C;  2JA6 A;  1SFO K;  5CJ9 A;  1J6X A;  1EQR A;  3GDZ A;  4AH6 A;  3S17 K;  4J3N A;  3S2H C;  4KAS A;  3S1M C;  1Y1V A;  4A3D C;  4KMU A;  4X6A K;  1JOE A;  4A3C C;  3GTG C;  4DDQ A;  1TWC C;  1R9T K;  3H3V D;  3FKI A;  4OIR A;  1XXB A;  1XXA A;  2PA8 L;  2KWA A;  5C44 C;  1O2F B;  2E2J K;  5TJ3 A;  1SFO C;  2E2I K;  1TWG A;  3I4M K;  2XCQ A;  1PJ7 A;  1XXC A;  3S17 C;  1I3Q K;  2BE5 A;  3S16 K;  2CFA B;  5M3F K;  1XZP A;  4Q5S A;  3G4A A;  2JA7 A;  2NVY K;  5EGE A;  3M3Y K;  4BXX K;  1SMY A;  4MQ9 A;  4A3B K;  3GTG A;  4A93 K;  5HL8 A;  1TWC A;  1XZQ A;  3H0G A;  1TWA K;  4O2D A;  4G7H A;  5IP7 C;  5IOR A;  2GAH C;  2E2I C;  1TWH C;  2V6U A;  1YNN A;  2JA8 C;  4YFN A;  5M5X K;  4KMA A;  1ZBS A;  1SFO A;  1O29 A;  4JK1 A;  3S15 K;  2V6S A;  3WOD A;  3S16 C;  1O25 A;  2ZUF A;  4BY7 K;  1VRQ C;  3TFI A;  3ORE A;  3M3Y C;  4BXX C;  4A3M K;  2NVT K;  4A3B C;  5C3E K;  1ZXO A;  1R9T A;  5D4D A;  4LQY A;  3M4O K;  2FQO A;  1C0A A;  1O28 A;  3S1R K;  4A3L C;  5M5Y K;  4GTD A;  2RGR A;  3S15 C;  1EH1 A;  2E2I A;  4BLA A;  1JVI A;  4WIL A;  1WOO A;  4KMD A;  4BY7 C;  1VLO A;  1I3Q A;  4FM9 A;  4KB4 A;  2NVT C;  4OIN A;  5C3E C;  4XSX A;  3RZD C;  2PHC B;  4C45 A;  1ZQ1 C;  3GTJ C;  3GTK K;  2A68 A;  2XCO A;  2O5J A;  3GSI A;  4RMF A;  5IOQ A;  1PJ6 A;  1TWA A;  1O27 A;  3S1R C;  3DXJ A;  3GEE A;  1J6W A;  5TMF A;  3LAJ A;  3S2H K;  2ZUE A;  3GTQ K;  3S1M K;  3L4K A;  3GTL C;  2CFA A;  4A3G K;  1PJ5 A;  2PA8 D;  2GSU A;  1WOS A;  3AD8 C;  4BY1 C;  1G51 A;  3ADA C;  3GTK C;  5IYD C;  1YNJ A;  4KDD A;  4BBS K;  2Y3P A;  1JQW A;  3GTP K;  3S14 C;  2GSN A;  3SZZ A;  4XSZ A;  1EFW A;  3HOY C;  2O5I A;  3GTQ C;  1AB4 A;  2XCR B;  4FZB A;  3CQZ C;  4P5A A;  4A3G C;  2VUM K;  3N3Y A;  5M5W K; 
#chains in the Genus database with same CATH homology
 5IYB K;  4MQ9 A;  4C3I K;  2JA6 K;  4A3B K;  4A93 K;  1TWA C;  1K83 K;  2CW0 A;  2JA5 K;  3S2D C;  4XLN A;  1TWA K;  4A3J C;  3PO2 K;  2NVX C;  3HOW K;  3K7A K;  3S2D K;  2NVQ C;  4A3J K;  4G7H A;  5IYC C;  2NVQ K;  5IP7 C;  1Y1V C;  3S1N K;  2E2I C;  1TWH C;  3HOX C;  4KN4 A;  1Y1V K;  1YNN A;  5IP7 K;  1TWH K;  2JA8 C;  4YFN A;  5M5X K;  2JA8 K;  4BBS C;  3HOU K;  4Y52 C;  1WCM K;  4Q4Z A;  3GTP C;  2B63 K;  2YU9 C;  4A3L K;  4A3I C;  5IP9 K;  4JK1 A;  4A3K C;  3FKI K;  4KN7 A;  3WOD A;  2YU9 K;  3S15 K;  5FLM C;  4A3I K;  3S16 C;  1BDF A;  2A6H A;  4Y7N C;  4G7Z A;  2PMZ D;  5FLM K;  4C3J K;  2VUM C;  2PMZ L;  4LLG A;  4OIO A;  4BY7 K;  4A3M C;  3M3Y C;  4BXX C;  4QIW D;  2R93 C;  4A3M K;  2NVT K;  4QIW L;  4QJV A;  2JA6 C;  4A3B C;  5C3E K;  4AYB D;  3M4O C;  1K83 C;  2JA5 C;  4AYB L;  5D4D A;  3HOV K;  3M4O K;  3PO2 C;  3PO3 K;  1TWG K;  2A6E A;  3K7A C;  3HOW C;  1XPP A;  3S1N C;  4C3H K;  4YFX A;  4NOI A;  4C2M K;  3HOU C;  3S1R K;  1WCM C;  2WAQ D;  2B63 C;  2JA7 C;  4A3L C;  3HKZ D;  2WAQ L;  3EQL A;  4YG2 A;  5IP9 C;  3FKI C;  5M5Y K;  2JA7 K;  2R7Z K;  3HKZ L;  4YFK A;  5FJ8 K;  3S15 C;  3S1Q C;  4A3D K;  1ZYR A;  3S1Q K;  4A3C K;  1IW7 A;  3GTG K;  3H0G C;  4BY7 C;  1TWC K;  3H0G K;  4LK1 A;  4MEX A;  1I6V A;  2NVT C;  4OIN A;  4QJV B;  5C44 K;  5C3E C;  1I50 K;  4XSX A;  3RZD C;  4ZH4 A;  4OIP A;  3RZD K;  3HOV C;  3PO3 C;  1TWG C;  4XLP A;  3GTJ C;  3GTK K;  3GTJ K;  2Y0S D;  2A68 A;  1SFO K;  2O5J A;  2Y0S L;  4MEY A;  3I4N K;  2PPB A;  3HOZ K;  3GTM K;  3S1R C;  5C4J K;  3DXJ A;  5C4X K;  3S17 K;  3S2H C;  4X6A C;  2R7Z C;  3S1M C;  5TMF A;  3S2H K;  1TWF K;  4KMU A;  5TMC A;  4BBR K;  3GTQ K;  3RZO C;  3S1M K;  4A3D C;  4X6A K;  3RZO K;  4A3C C;  3GTG C;  1R9T C;  3GTL C;  4A3G K;  1TWC C;  3GTL K;  4LK0 A;  2PA8 D;  1Y1W K;  1R9T K;  3H3V D;  4OIR A;  4G7O A;  2R92 K;  3H3V L;  2PA8 L;  1I6H C;  1I6H K;  5C44 C;  1I50 C;  4GZY A;  4BY1 C;  2E2H C;  4OIQ A;  3GTO C;  3GTK C;  2E2J C;  4BY1 K;  2WB1 D;  5IYD C;  2E2H K;  2NVX K;  3GTO K;  2E2J K;  2WB1 L;  5IYC K;  5IYD K;  1YNJ A;  1SFO C;  3I4N C;  1HQM A;  2E2I K;  3I4M C;  3HOZ C;  4LJZ A;  3HOX K;  3GTM C;  4A3F C;  3I4M K;  5C4J C;  4A3F K;  4BBS K;  4Y52 K;  2A69 A;  1I3Q C;  3GTP K;  3S14 C;  3S17 C;  5C4X C;  4XSZ A;  1I3Q K;  2BE5 A;  3HOY C;  3S14 K;  1TWF C;  4A3K K;  4BBR C;  2O5I A;  4A3E C;  3GTQ C;  3HOY K;  3S16 K;  4Y7N K;  4A3E K;  3CQZ C;  5M3F K;  4Q5S A;  4A3G C;  5M3M K;  2VUM K;  3CQZ K;  2NVY C;  1Y1W C;  2R92 C;  2NVY K;  3M3Y K;  5M5W K;  5IYB C;  4BXX K;  2R93 K;  1SMY A;  4A93 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...