3HOVK

Complete rna polymerase ii elongation complex ii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hovK00
4LK1A 2A69A 3S2DK 5C4XC 4LJZA 5C44C 2O5IA 2JA6C 4A3CK 2R7ZC 4QJVA 2A6EA 1TWCK 2E2HC 3GTPK 1TWGK 1K83K 3K7AC 5IP9K 3S14C 4LLGA 5C3EK 3S1MC 2NVXC 4BXXK 2R92C 2CW0A 3S1NC 4A3JK 3H0GK 5M5WK 4A3DC 1I3QC 4BY7C 1TWFK 4KMUA 3S1RC 2YU9K 4NOIA 3GTLC 3PO2K 3RZDK 2JA8K 2WAQD 1I50K 1ZYRA 1WCMC 3HKZL 5IP7K 3CQZC 1YNNA 3GTMC 2E2JC 3FKIK 4YFKA 3PO3C 2NVQC 4G7ZA 3S2HK 4X6AC 3DXJA 4OINA 4OIRA 5C4XK 5IYBC 5FJ8K 5M5YK 2JA6K 4MEXA 4A3GK 3RZOC 3GTKK 4A3BK 2R93K 3S17C 4C3HK 2NVXK 3HOYK 2PPBA 3S16K 4XLNA 4QIWL 5FLMK 4A3IC 2JA7K 3HOWK 4Y52K 4BBSC 3S15C 4BY7K 4C3IK 4A3FK 5IYDC 3S1RK 4YFNA 3GTQC 3HOVC 1IW7A 2B63C 2E2IK 1XPPA 3I4MC 5M5XK 1Y1WC 2VUMK 4A3LK 4LK0A 2WB1L 4KN4A 4BY1K 4BBRK 3CQZK 1I6HK 3GTMK 4QJVB 2NVYC 3PO3K 5C4JC 2NVQK 3HOZC 2O5JA 4X6AK 4A3MC 1TWHK 4QIWD 4ZH4A 3H3VL 1R9TK 2JA5C 1SFOC 4A3KK 5TMFA 4Y7NC 3S1MK 3RZOK 2A6HA 1Y1VC 3GTJC 3S17K 5C44K 2R7ZK 4OIQA 2WB1D 2E2HK 3GTOC 3S14K 3K7AK 3HOXC 4A3CC 2PMZL 1TWCC 3S15K 3HKZD 2R92K 3S1NK 1TWGC 4JK1A 4KN7A 5C3EC 3GTQK 3H3VD 4A93C 4AYBL 5IYCC 1I3QK 3I4MK 4BXXC 4A3DK 1Y1WK 5D4DA 3GTLK 4XSZA 2NVTC 3HOUC 4GZYA 3HOZK 4MEYA 1WCMK 2YU9C 3S1QC 3WODA 3RZDC 3PO2C 1I50C 2PMZD 4OIOA 5M3MK 2E2JK 1SFOK 2JA5K 3GTGC 1TWAC 2Y0SL 3I4NC 2A68A 4AYBD 3S2HC 5IYBK 4YG2A 4A3EC 3GTOK 2WAQL 3HOXK 3M3YC 4A3GC 2PA8L 3GTKC 3M4OC 4A3BC 3S2DC 2R93C 4A3IK 4A93K 5IYCK 3HOYC 4BBSK 3S16C 3GTPC 2Y0SD 1K83C 5IP9C 4Y52C 5FLMC 4G7HA 2JA7C 4C3JK 3HOWC 3HOVK 5IYDK 3EQLA 4XSXA 4XLPA 4A3JC 4A3FC 2B63K 1HQMA 3H0GC 2NVTK 1SMYA 3HOUK 2BE5A 4MQ9A 4YFXA 4Q4ZA 3S1QK 2E2IC 1TWFC 2VUMC 3GTGK 4A3LC 2NVYK 5C4JK 1I6HC 2PA8D 4BBRC 4OIPA 1TWAK 4A3MK 4BY1C 1I6VA 2JA8C 3I4NK 5IP7C 4Q5SA 5TMCA 1TWHC 1BDFA 4Y7NK 4A3EK 1R9TC 3FKIC 1YNJA 4G7OA 4A3KC 1Y1VK 3M3YK 3GTJK 4C2MK 5M3FK 3M4OK
chains in the Genus database with same CATH superfamily
1INNA 4LJZA 3T00A 3OPFA 2JA6C 2A6EA 1TWGK 1K83K 3FOEA 1TWAA 4BXXK 1XZQA 4A3DC 2PHCB 5IOTA 5EGHA 4KMUA 1IS1A 1J98A 3RZDK 2WAQD 3G4CA 5IP7K 1XXCA 3GTMC 2E2JC 3GTPA 4YFKA 1XZQB 4G7ZA 4X6AC 3DXJA 5C4XK 5IYBC 5M5YK 1O2BA 1BS2A 2E2IA 3LPXA 3S17C 4P5AA 5IOSA 3V4GA 3HOWK 5FLMK 4Y52K 3MMLB 1R9TA 2D6FC 4YFNA 3GTQC 2B63C 4KMDA 5M5XK 2VUMK 1PJ7A 4BBRK 3CQZK 2XCQA 1O27A 4QJVB 3PO3K 3GTKA 2R93A 4DDQA 1TWHK 4ZH4A 3Q3QA 2JA5C 1WOPA 4P5BA 3RZOK 2A6HA 3BP8C 5IORA 1EI6A 1Y1VC 2FQOA 3GSIA 2WB1D 1O2AA 3AD8C 2E2HK 3GTOC 3T02A 4A3CC 3HOXC 1J6XA 3S15K 1O26A 3TFIA 4JK1A 1IBAA 1I3QK 4C3JC 1VRQC 4GTCA 2NVTC 3HOZK 3TFHA 5TJ3A 3AQPA 4G0VA 1TWAC 1JVIA 2A68A 3S2HC 4GTEA 4XCHA 1IE0A 1Y1WA 1O29A 4C45A 3GDZA 2PA8L 2XCOA 1L0WA 4A3BC 3S2DC 4KMAA 5IYCK 3HOYC 3GTPC 2Y0SD 4KATA 4KB4A 5IYDK 4C3IC 4KM8A 3HOUK 4KARA 3GTJA 4Q4ZA 4GT9A 2E2IC 4A3LC 1AB4A 3BP3A 1I6VA 1BDFA 1VGXA 1R9TC 1YNJA 3M3YK 2ZUFA 5M3FK 2B63A 5L46A 1TWCK 3GTGA 4GTDA 5IP9K 5C3EK 1B4BA 2CW0A 3S1NC 3BUEA 1YCLA 3H0GK 4GTLA 4GTFA 1ISEA 1TWFK 1Y1VA 2YU9K 3GTLC 1WCMC 3HKZL 3S0XA 1JQWA 3FKIK 1J6VA 4OINA 3GEIA 5FJ8K 2JA6K 4MEXA 4A3GK 4C3HK 1USOA 3S16K 4A3IC 2JA7K 4ILDA 1DCPA 1WQHA 4RMFA 1DCOA 3HOVC 4BLBA 5E68A 1IW7A 1X31C 1Y1WC 3CAGA 4KN4A 3QX3A 1I6HK 1B4AA 3GTMK 4KAWX 2NVYC 3L4JA 4X6AK 4A3MC 2NVXA 5IOQA 1O28A 4Y7NC 1DD5A 3GEEA 3TFJA 3GTJC 3S17K 5C44K 2R7ZK 3S14K 3K7AK 1GE9A 1UV7A 3L4KA 2R92K 1TWGC 4BKWA 3GTQK 4A93C 2CFAA 4BXXC 4KASA 1XZPA 4WILA 3IPJA 5D4DA 3S1QC 3RZDC 3A8JA 3HXAA 3GTGC 2JA5K 2GSUA 3AD7C 2CFAB 3T01A 3G4AA 4P9SA 4BLAA 4A3EC 3GTOK 2WAQL 4KDDA 3HOXK 3FOFA 4C2MC 3GTLA 3LAPA 1WCMA 3FHZA 1KQ4A 4FZBA 4BBSK 1VLOA 3TTGA 4Y52C 5FLMC 1SFOA 3HOWC 4G7HA 4C3JK 3EQLA 4XSXA 1PJ5A 4XLPA 4A3JC 2NVTK 1HQMA 2ZFZA 2XCRB 4LQYA 2VUMC 1EFWA 3A8IA 5C4JK 2PA8D 4BBRC 1TWAK 2JA8C 1PJ6A 5TMCA 1TWHC 2FQTA 4LK1A 2A69A 3S2DK 2O5IA 2NVYA 2E2HC 1WSVA 3GTPK 4LLGA 2NVXC 1I3QC 4BY7C 1BGWA 3S1RC 1WQGA 3N3YA 3PO2K 1I50K 1ZYRA 1YNNA 3JSTA 1TWGA 1K83A 2NVQC 2JA7A 3AH5A 1ZXOA 3GTKK 4M1XA 2R93K 2PPBA 2RGRA 2GSNA 1V5VA 4QIWL 2EBBA 4XLNA 4A3FK 5IYDC 3I4MC 3OREA 4LK0A 5JVOA 4BY1K 3A8KA 2R92A 1O25A 3H3VL 1SFOC 4A3KK 5TMFA 1EK8A 3S1MK 1G51A 4KMHA 2VUMA 1IQ0A 3CQZA 2PMZL 3N0CA 1TWCC 3AD9C 4KN7A 5C3EC 4A3DK 1TWHA 4AYBL 1WOOA 1Y1WK 1F7VA 1EQRA 3ERED 4XSZA 4FM9A 4GZYA 3NUHA 4MEYA 1O24A 2YU9C 1ZVUA 2E2HA 4O2DA 4OIOA 2E2JK 1WSRA 4GTBA 3I4NC 1O2FB 5IYBK 3ADAC 1I3QA 4LR2A 4YG2A 4G0WA 4A3GC 3M4OC 2RH6A 2P5MA 4C3HC 4A93K 1BJTA 3S16C 1HI9A 4WJ3M 1K83C 3N0BA 2JA7C 1WIHA 1J6WA 2V6UA 5HL8A 2B63K 4MQ9A 4YFXA 3S1QK 3GEHA 3GTGK 1C0AA 1I6HC 1EH1A 4OIPA 1WOSA 2GAGC 4PABA 2ZUEA 5IP7C 4Q5SA 1ZBSA 4A3EK 1XZPB 1ZQ1C 2Y3PA 1Y1VK 4C2MK 5C4XC 2V6SA 5C44C 4A3CK 2R7ZC 4QJVA 1I50A 3S14C 2GAHC 3K7AC 3SZZA 2R92C 4A3JK 5M5WK 3LAJA 3GIRA 1DCHA 4NOIA 2JA8K 3CQZC 1TWCA 4GFQA 3PO3C 1F93A 3AQOA 3S2HK 4OIRA 3H0GA 1TWFA 3RZOC 4A3BK 5JFEA 2YU9A 2NVXK 3HOYK 4BBSC 3S15C 3FKIA 4BY7K 4C3IK 4KM9A 3S1RK 4WJ4A 2E2IK 1XPPA 4J3NA 4AH6A 1WQFA 4A3LK 2JA6A 2WB1L 2O5JA 5C4JC 2NVQK 3HOZC 5EGEA 4QIWD 1R9TK 1XXBA 3VA7A 4OIQA 2JH3A 4KB2A 3GTMA 4G0UA 3HKZD 3S1NK 1VH2A 1USMA 2V6TA 3H3VD 5IYCC 2KWAA 3I4MK 1RU0A 1JOEA 1VJEA 3GTLK 3SZYA 3HOUC 4GTAA 1WCMK 3WODA 3PO2C 1YX2A 2R7ZA 1I50C 2PMZD 4PAAA 5M3MK 1SFOK 2Y0SL 1XXAA 4AYBD 3GTQA 3M3YC 1F9NA 3GTKC 2R93C 4A3IK 1F7UA 5CJ9A 5CHPA 2GSOA 2JA5A 5IP9C 2P8TA 3HOVK 3OEPA 2W7VA 4A3FC 3H0GC 1SMYA 1IL2A 2BE5A 1TWFC 3GTOA 1WORA 2NVYK 4BY1C 4A3MK 3I4NK 4LOWA 4KC6A 4Y7NK 4G7OA 3FKIC 4A3KC 3GTJK 3S1MC 3M4OK
chains in the Genus database with same CATH topology
4LK1A 2A69A 3S2DK 5C4XC 4LJZA 5C44C 2O5IA 2JA6C 4A3CK 2R7ZC 4QJVA 2A6EA 1TWCK 2E2HC 3GTPK 1TWGK 1K83K 3K7AC 5IP9K 3S14C 4LLGA 5C3EK 3S1MC 2NVXC 4BXXK 2R92C 2CW0A 3S1NC 4A3JK 3H0GK 5M5WK 4A3DC 1I3QC 4BY7C 1TWFK 4KMUA 3S1RC 2YU9K 4NOIA 3GTLC 3PO2K 3RZDK 2JA8K 2WAQD 1I50K 1ZYRA 1WCMC 3HKZL 5IP7K 3CQZC 1YNNA 3GTMC 2E2JC 3FKIK 4YFKA 3PO3C 2NVQC 4G7ZA 3S2HK 4X6AC 3DXJA 4OINA 4OIRA 5C4XK 5IYBC 5FJ8K 5M5YK 2JA6K 4MEXA 4A3GK 3RZOC 3GTKK 4A3BK 2R93K 3S17C 4C3HK 2NVXK 3HOYK 2PPBA 3S16K 4XLNA 4QIWL 5FLMK 4A3IC 2JA7K 3HOWK 4Y52K 4BBSC 3S15C 4BY7K 4C3IK 4A3FK 5IYDC 3S1RK 4YFNA 3GTQC 3HOVC 1IW7A 2B63C 2E2IK 1XPPA 3I4MC 5M5XK 1Y1WC 2VUMK 4A3LK 4LK0A 2WB1L 4KN4A 4BY1K 4BBRK 3CQZK 1I6HK 3GTMK 4QJVB 2NVYC 3PO3K 5C4JC 2NVQK 3HOZC 2O5JA 4X6AK 4A3MC 1TWHK 4QIWD 4ZH4A 3H3VL 1R9TK 2JA5C 1SFOC 4A3KK 5TMFA 4Y7NC 3S1MK 3RZOK 2A6HA 1Y1VC 3GTJC 3S17K 5C44K 2R7ZK 4OIQA 2WB1D 2E2HK 3GTOC 3S14K 3K7AK 3HOXC 4A3CC 2PMZL 1TWCC 3S15K 3HKZD 2R92K 3S1NK 1TWGC 4JK1A 4KN7A 5C3EC 3GTQK 3H3VD 4A93C 4AYBL 5IYCC 1I3QK 3I4MK 4BXXC 4A3DK 1Y1WK 5D4DA 3GTLK 4XSZA 2NVTC 3HOUC 4GZYA 3HOZK 4MEYA 1WCMK 2YU9C 3S1QC 3WODA 3RZDC 3PO2C 1I50C 2PMZD 4OIOA 5M3MK 2E2JK 1SFOK 2JA5K 3GTGC 1TWAC 2Y0SL 3I4NC 2A68A 4AYBD 3S2HC 5IYBK 4YG2A 4A3EC 3GTOK 2WAQL 3HOXK 3M3YC 4A3GC 2PA8L 3GTKC 3M4OC 4A3BC 3S2DC 2R93C 4A3IK 4A93K 5IYCK 3HOYC 4BBSK 3S16C 3GTPC 2Y0SD 1K83C 5IP9C 4Y52C 5FLMC 4G7HA 2JA7C 4C3JK 3HOWC 3HOVK 5IYDK 3EQLA 4XSXA 4XLPA 4A3JC 4A3FC 2B63K 1HQMA 3H0GC 2NVTK 1SMYA 3HOUK 2BE5A 4MQ9A 4YFXA 4Q4ZA 3S1QK 2E2IC 1TWFC 2VUMC 3GTGK 4A3LC 2NVYK 5C4JK 1I6HC 2PA8D 4BBRC 4OIPA 1TWAK 4A3MK 4BY1C 1I6VA 2JA8C 3I4NK 5IP7C 4Q5SA 5TMCA 1TWHC 1BDFA 4Y7NK 4A3EK 1R9TC 3FKIC 1YNJA 4G7OA 4A3KC 1Y1VK 3M3YK 3GTJK 4C2MK 5M3FK 3M4OK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK1 A;  2A69 A;  3S2D K;  5C4X C;  4LJZ A;  5C44 C;  2O5I A;  2JA6 C;  4A3C K;  2R7Z C;  4QJV A;  2A6E A;  1TWC K;  2E2H C;  3GTP K;  1TWG K;  1K83 K;  3K7A C;  5IP9 K;  3S14 C;  4LLG A;  5C3E K;  3S1M C;  2NVX C;  4BXX K;  2R92 C;  2CW0 A;  3S1N C;  4A3J K;  3H0G K;  5M5W K;  4A3D C;  1I3Q C;  4BY7 C;  1TWF K;  4KMU A;  3S1R C;  2YU9 K;  4NOI A;  3GTL C;  3PO2 K;  3RZD K;  2JA8 K;  2WAQ D;  1I50 K;  1ZYR A;  1WCM C;  3HKZ L;  5IP7 K;  3CQZ C;  1YNN A;  3GTM C;  2E2J C;  3FKI K;  4YFK A;  3PO3 C;  2NVQ C;  4G7Z A;  3S2H K;  4X6A C;  3DXJ A;  4OIN A;  4OIR A;  5C4X K;  5IYB C;  5FJ8 K;  5M5Y K;  2JA6 K;  4MEX A;  4A3G K;  3RZO C;  3GTK K;  4A3B K;  2R93 K;  3S17 C;  4C3H K;  2NVX K;  3HOY K;  2PPB A;  3S16 K;  4XLN A;  4QIW L;  5FLM K;  4A3I C;  2JA7 K;  3HOW K;  4Y52 K;  4BBS C;  3S15 C;  4BY7 K;  4C3I K;  4A3F K;  5IYD C;  3S1R K;  4YFN A;  3GTQ C;  3HOV C;  1IW7 A;  2B63 C;  2E2I K;  1XPP A;  3I4M C;  5M5X K;  1Y1W C;  2VUM K;  4A3L K;  4LK0 A;  2WB1 L;  4KN4 A;  4BY1 K;  4BBR K;  3CQZ K;  1I6H K;  3GTM K;  4QJV B;  2NVY C;  3PO3 K;  5C4J C;  2NVQ K;  3HOZ C;  2O5J A;  4X6A K;  4A3M C;  1TWH K;  4QIW D;  4ZH4 A;  3H3V L;  1R9T K;  2JA5 C;  1SFO C;  4A3K K;  5TMF A;  4Y7N C;  3S1M K;  3RZO K;  2A6H A;  1Y1V C;  3GTJ C;  3S17 K;  5C44 K;  2R7Z K;  4OIQ A;  2WB1 D;  2E2H K;  3GTO C;  3S14 K;  3K7A K;  3HOX C;  4A3C C;  2PMZ L;  1TWC C;  3S15 K;  3HKZ D;  2R92 K;  3S1N K;  1TWG C;  4JK1 A;  4KN7 A;  5C3E C;  3GTQ K;  3H3V D;  4A93 C;  4AYB L;  5IYC C;  1I3Q K;  3I4M K;  4BXX C;  4A3D K;  1Y1W K;  5D4D A;  3GTL K;  4XSZ A;  2NVT C;  3HOU C;  4GZY A;  3HOZ K;  4MEY A;  1WCM K;  2YU9 C;  3S1Q C;  3WOD A;  3RZD C;  3PO2 C;  1I50 C;  2PMZ D;  4OIO A;  5M3M K;  2E2J K;  1SFO K;  2JA5 K;  3GTG C;  1TWA C;  2Y0S L;  3I4N C;  2A68 A;  4AYB D;  3S2H C;  5IYB K;  4YG2 A;  4A3E C;  3GTO K;  2WAQ L;  3HOX K;  3M3Y C;  4A3G C;  2PA8 L;  3GTK C;  3M4O C;  4A3B C;  3S2D C;  2R93 C;  4A3I K;  4A93 K;  5IYC K;  3HOY C;  4BBS K;  3S16 C;  3GTP C;  2Y0S D;  1K83 C;  5IP9 C;  4Y52 C;  5FLM C;  4G7H A;  2JA7 C;  4C3J K;  3HOW C;  3HOV K;  5IYD K;  3EQL A;  4XSX A;  4XLP A;  4A3J C;  4A3F C;  2B63 K;  1HQM A;  3H0G C;  2NVT K;  1SMY A;  3HOU K;  2BE5 A;  4MQ9 A;  4YFX A;  4Q4Z A;  3S1Q K;  2E2I C;  1TWF C;  2VUM C;  3GTG K;  4A3L C;  2NVY K;  5C4J K;  1I6H C;  2PA8 D;  4BBR C;  4OIP A;  1TWA K;  4A3M K;  4BY1 C;  1I6V A;  2JA8 C;  3I4N K;  5IP7 C;  4Q5S A;  5TMC A;  1TWH C;  1BDF A;  4Y7N K;  4A3E K;  1R9T C;  3FKI C;  1YNJ A;  4G7O A;  4A3K C;  1Y1V K;  3M3Y K;  3GTJ K;  4C2M K;  5M3F K;  3M4O K; 
#chains in the Genus database with same CATH topology
 1INN A;  4LJZ A;  3T00 A;  3OPF A;  2JA6 C;  2A6E A;  1TWG K;  1K83 K;  3FOE A;  1TWA A;  4BXX K;  1XZQ A;  4A3D C;  2PHC B;  5IOT A;  5EGH A;  4KMU A;  1IS1 A;  1J98 A;  3RZD K;  2WAQ D;  3G4C A;  5IP7 K;  1XXC A;  3GTM C;  2E2J C;  3GTP A;  4YFK A;  1XZQ B;  4G7Z A;  4X6A C;  3DXJ A;  5C4X K;  5IYB C;  5M5Y K;  1O2B A;  1BS2 A;  2E2I A;  3LPX A;  3S17 C;  4P5A A;  5IOS A;  3V4G A;  3HOW K;  5FLM K;  4Y52 K;  3MML B;  1R9T A;  2D6F C;  4YFN A;  3GTQ C;  2B63 C;  4KMD A;  5M5X K;  2VUM K;  1PJ7 A;  4BBR K;  3CQZ K;  2XCQ A;  1O27 A;  4QJV B;  3PO3 K;  3GTK A;  2R93 A;  4DDQ A;  1TWH K;  4ZH4 A;  3Q3Q A;  2JA5 C;  1WOP A;  4P5B A;  3RZO K;  2A6H A;  3BP8 C;  5IOR A;  1EI6 A;  1Y1V C;  2FQO A;  3GSI A;  2WB1 D;  1O2A A;  3AD8 C;  2E2H K;  3GTO C;  3T02 A;  4A3C C;  3HOX C;  1J6X A;  3S15 K;  1O26 A;  3TFI A;  4JK1 A;  1IBA A;  1I3Q K;  4C3J C;  1VRQ C;  4GTC A;  2NVT C;  3HOZ K;  3TFH A;  5TJ3 A;  3AQP A;  4G0V A;  1TWA C;  1JVI A;  2A68 A;  3S2H C;  4GTE A;  4XCH A;  1IE0 A;  1Y1W A;  1O29 A;  4C45 A;  3GDZ A;  2PA8 L;  2XCO A;  1L0W A;  4A3B C;  3S2D C;  4KMA A;  5IYC K;  3HOY C;  3GTP C;  2Y0S D;  4KAT A;  4KB4 A;  5IYD K;  4C3I C;  4KM8 A;  3HOU K;  4KAR A;  3GTJ A;  4Q4Z A;  4GT9 A;  2E2I C;  4A3L C;  1AB4 A;  3BP3 A;  1I6V A;  1BDF A;  1VGX A;  1R9T C;  1YNJ A;  3M3Y K;  2ZUF A;  5M3F K;  2B63 A;  5L46 A;  1TWC K;  3GTG A;  4GTD A;  5IP9 K;  5C3E K;  1B4B A;  2CW0 A;  3S1N C;  3BUE A;  1YCL A;  3H0G K;  4GTL A;  4GTF A;  1ISE A;  1TWF K;  1Y1V A;  2YU9 K;  3GTL C;  1WCM C;  3HKZ L;  3S0X A;  1JQW A;  3FKI K;  1J6V A;  4OIN A;  3GEI A;  5FJ8 K;  2JA6 K;  4MEX A;  4A3G K;  4C3H K;  1USO A;  3S16 K;  4A3I C;  2JA7 K;  4ILD A;  1DCP A;  1WQH A;  4RMF A;  1DCO A;  3HOV C;  4BLB A;  5E68 A;  1IW7 A;  1X31 C;  1Y1W C;  3CAG A;  4KN4 A;  3QX3 A;  1I6H K;  1B4A A;  3GTM K;  4KAW X;  2NVY C;  3L4J A;  4X6A K;  4A3M C;  2NVX A;  5IOQ A;  1O28 A;  4Y7N C;  1DD5 A;  3GEE A;  3TFJ A;  3GTJ C;  3S17 K;  5C44 K;  2R7Z K;  3S14 K;  3K7A K;  1GE9 A;  1UV7 A;  3L4K A;  2R92 K;  1TWG C;  4BKW A;  3GTQ K;  4A93 C;  2CFA A;  4BXX C;  4KAS A;  1XZP A;  4WIL A;  3IPJ A;  5D4D A;  3S1Q C;  3RZD C;  3A8J A;  3HXA A;  3GTG C;  2JA5 K;  2GSU A;  3AD7 C;  2CFA B;  3T01 A;  3G4A A;  4P9S A;  4BLA A;  4A3E C;  3GTO K;  2WAQ L;  4KDD A;  3HOX K;  3FOF A;  4C2M C;  3GTL A;  3LAP A;  1WCM A;  3FHZ A;  1KQ4 A;  4FZB A;  4BBS K;  1VLO A;  3TTG A;  4Y52 C;  5FLM C;  1SFO A;  3HOW C;  4G7H A;  4C3J K;  3EQL A;  4XSX A;  1PJ5 A;  4XLP A;  4A3J C;  2NVT K;  1HQM A;  2ZFZ A;  2XCR B;  4LQY A;  2VUM C;  1EFW A;  3A8I A;  5C4J K;  2PA8 D;  4BBR C;  1TWA K;  2JA8 C;  1PJ6 A;  5TMC A;  1TWH C;  2FQT A;  4LK1 A;  2A69 A;  3S2D K;  2O5I A;  2NVY A;  2E2H C;  1WSV A;  3GTP K;  4LLG A;  2NVX C;  1I3Q C;  4BY7 C;  1BGW A;  3S1R C;  1WQG A;  3N3Y A;  3PO2 K;  1I50 K;  1ZYR A;  1YNN A;  3JST A;  1TWG A;  1K83 A;  2NVQ C;  2JA7 A;  3AH5 A;  1ZXO A;  3GTK K;  4M1X A;  2R93 K;  2PPB A;  2RGR A;  2GSN A;  1V5V A;  4QIW L;  2EBB A;  4XLN A;  4A3F K;  5IYD C;  3I4M C;  3ORE A;  4LK0 A;  5JVO A;  4BY1 K;  3A8K A;  2R92 A;  1O25 A;  3H3V L;  1SFO C;  4A3K K;  5TMF A;  1EK8 A;  3S1M K;  1G51 A;  4KMH A;  2VUM A;  1IQ0 A;  3CQZ A;  2PMZ L;  3N0C A;  1TWC C;  3AD9 C;  4KN7 A;  5C3E C;  4A3D K;  1TWH A;  4AYB L;  1WOO A;  1Y1W K;  1F7V A;  1EQR A;  3ERE D;  4XSZ A;  4FM9 A;  4GZY A;  3NUH A;  4MEY A;  1O24 A;  2YU9 C;  1ZVU A;  2E2H A;  4O2D A;  4OIO A;  2E2J K;  1WSR A;  4GTB A;  3I4N C;  1O2F B;  5IYB K;  3ADA C;  1I3Q A;  4LR2 A;  4YG2 A;  4G0W A;  4A3G C;  3M4O C;  2RH6 A;  2P5M A;  4C3H C;  4A93 K;  1BJT A;  3S16 C;  1HI9 A;  4WJ3 M;  1K83 C;  3N0B A;  2JA7 C;  1WIH A;  1J6W A;  2V6U A;  5HL8 A;  2B63 K;  4MQ9 A;  4YFX A;  3S1Q K;  3GEH A;  3GTG K;  1C0A A;  1I6H C;  1EH1 A;  4OIP A;  1WOS A;  2GAG C;  4PAB A;  2ZUE A;  5IP7 C;  4Q5S A;  1ZBS A;  4A3E K;  1XZP B;  1ZQ1 C;  2Y3P A;  1Y1V K;  4C2M K;  5C4X C;  2V6S A;  5C44 C;  4A3C K;  2R7Z C;  4QJV A;  1I50 A;  3S14 C;  2GAH C;  3K7A C;  3SZZ A;  2R92 C;  4A3J K;  5M5W K;  3LAJ A;  3GIR A;  1DCH A;  4NOI A;  2JA8 K;  3CQZ C;  1TWC A;  4GFQ A;  3PO3 C;  1F93 A;  3AQO A;  3S2H K;  4OIR A;  3H0G A;  1TWF A;  3RZO C;  4A3B K;  5JFE A;  2YU9 A;  2NVX K;  3HOY K;  4BBS C;  3S15 C;  3FKI A;  4BY7 K;  4C3I K;  4KM9 A;  3S1R K;  4WJ4 A;  2E2I K;  1XPP A;  4J3N A;  4AH6 A;  1WQF A;  4A3L K;  2JA6 A;  2WB1 L;  2O5J A;  5C4J C;  2NVQ K;  3HOZ C;  5EGE A;  4QIW D;  1R9T K;  1XXB A;  3VA7 A;  4OIQ A;  2JH3 A;  4KB2 A;  3GTM A;  4G0U A;  3HKZ D;  3S1N K;  1VH2 A;  1USM A;  2V6T A;  3H3V D;  5IYC C;  2KWA A;  3I4M K;  1RU0 A;  1JOE A;  1VJE A;  3GTL K;  3SZY A;  3HOU C;  4GTA A;  1WCM K;  3WOD A;  3PO2 C;  1YX2 A;  2R7Z A;  1I50 C;  2PMZ D;  4PAA A;  5M3M K;  1SFO K;  2Y0S L;  1XXA A;  4AYB D;  3GTQ A;  3M3Y C;  1F9N A;  3GTK C;  2R93 C;  4A3I K;  1F7U A;  5CJ9 A;  5CHP A;  2GSO A;  2JA5 A;  5IP9 C;  2P8T A;  3HOV K;  3OEP A;  2W7V A;  4A3F C;  3H0G C;  1SMY A;  1IL2 A;  2BE5 A;  1TWF C;  3GTO A;  1WOR A;  2NVY K;  4BY1 C;  4A3M K;  3I4N K;  4LOW A;  4KC6 A;  4Y7N K;  4G7O A;  3FKI C;  4A3K C;  3GTJ K;  3S1M C;  3M4O K; 
#chains in the Genus database with same CATH homology
 4LK1 A;  2A69 A;  3S2D K;  5C4X C;  4LJZ A;  5C44 C;  2O5I A;  2JA6 C;  4A3C K;  2R7Z C;  4QJV A;  2A6E A;  1TWC K;  2E2H C;  3GTP K;  1TWG K;  1K83 K;  3K7A C;  5IP9 K;  3S14 C;  4LLG A;  5C3E K;  3S1M C;  2NVX C;  4BXX K;  2R92 C;  2CW0 A;  3S1N C;  4A3J K;  3H0G K;  5M5W K;  4A3D C;  1I3Q C;  4BY7 C;  1TWF K;  4KMU A;  3S1R C;  2YU9 K;  4NOI A;  3GTL C;  3PO2 K;  3RZD K;  2JA8 K;  2WAQ D;  1I50 K;  1ZYR A;  1WCM C;  3HKZ L;  5IP7 K;  3CQZ C;  1YNN A;  3GTM C;  2E2J C;  3FKI K;  4YFK A;  3PO3 C;  2NVQ C;  4G7Z A;  3S2H K;  4X6A C;  3DXJ A;  4OIN A;  4OIR A;  5C4X K;  5IYB C;  5FJ8 K;  5M5Y K;  2JA6 K;  4MEX A;  4A3G K;  3RZO C;  3GTK K;  4A3B K;  2R93 K;  3S17 C;  4C3H K;  2NVX K;  3HOY K;  2PPB A;  3S16 K;  4XLN A;  4QIW L;  5FLM K;  4A3I C;  2JA7 K;  3HOW K;  4Y52 K;  4BBS C;  3S15 C;  4BY7 K;  4C3I K;  4A3F K;  5IYD C;  3S1R K;  4YFN A;  3GTQ C;  3HOV C;  1IW7 A;  2B63 C;  2E2I K;  1XPP A;  3I4M C;  5M5X K;  1Y1W C;  2VUM K;  4A3L K;  4LK0 A;  2WB1 L;  4KN4 A;  4BY1 K;  4BBR K;  3CQZ K;  1I6H K;  3GTM K;  4QJV B;  2NVY C;  3PO3 K;  5C4J C;  2NVQ K;  3HOZ C;  2O5J A;  4X6A K;  4A3M C;  1TWH K;  4QIW D;  4ZH4 A;  3H3V L;  1R9T K;  2JA5 C;  1SFO C;  4A3K K;  5TMF A;  4Y7N C;  3S1M K;  3RZO K;  2A6H A;  1Y1V C;  3GTJ C;  3S17 K;  5C44 K;  2R7Z K;  4OIQ A;  2WB1 D;  2E2H K;  3GTO C;  3S14 K;  3K7A K;  3HOX C;  4A3C C;  2PMZ L;  1TWC C;  3S15 K;  3HKZ D;  2R92 K;  3S1N K;  1TWG C;  4JK1 A;  4KN7 A;  5C3E C;  3GTQ K;  3H3V D;  4A93 C;  4AYB L;  5IYC C;  1I3Q K;  3I4M K;  4BXX C;  4A3D K;  1Y1W K;  5D4D A;  3GTL K;  4XSZ A;  2NVT C;  3HOU C;  4GZY A;  3HOZ K;  4MEY A;  1WCM K;  2YU9 C;  3S1Q C;  3WOD A;  3RZD C;  3PO2 C;  1I50 C;  2PMZ D;  4OIO A;  5M3M K;  2E2J K;  1SFO K;  2JA5 K;  3GTG C;  1TWA C;  2Y0S L;  3I4N C;  2A68 A;  4AYB D;  3S2H C;  5IYB K;  4YG2 A;  4A3E C;  3GTO K;  2WAQ L;  3HOX K;  3M3Y C;  4A3G C;  2PA8 L;  3GTK C;  3M4O C;  4A3B C;  3S2D C;  2R93 C;  4A3I K;  4A93 K;  5IYC K;  3HOY C;  4BBS K;  3S16 C;  3GTP C;  2Y0S D;  1K83 C;  5IP9 C;  4Y52 C;  5FLM C;  4G7H A;  2JA7 C;  4C3J K;  3HOW C;  3HOV K;  5IYD K;  3EQL A;  4XSX A;  4XLP A;  4A3J C;  4A3F C;  2B63 K;  1HQM A;  3H0G C;  2NVT K;  1SMY A;  3HOU K;  2BE5 A;  4MQ9 A;  4YFX A;  4Q4Z A;  3S1Q K;  2E2I C;  1TWF C;  2VUM C;  3GTG K;  4A3L C;  2NVY K;  5C4J K;  1I6H C;  2PA8 D;  4BBR C;  4OIP A;  1TWA K;  4A3M K;  4BY1 C;  1I6V A;  2JA8 C;  3I4N K;  5IP7 C;  4Q5S A;  5TMC A;  1TWH C;  1BDF A;  4Y7N K;  4A3E K;  1R9T C;  3FKI C;  1YNJ A;  4G7O A;  4A3K C;  1Y1V K;  3M3Y K;  3GTJ K;  4C2M K;  5M3F K;  3M4O K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...