3HOWH

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 16
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howH00
2KHJA 1Y1VG 2BA0A 4A3IG 2VQEQ 4NXNL 1SR3A 4BA2I 1TWFH 3GTGH 1VQFA 5GQOA 1IBLL 2OTJA 5LMNQ 2ZM6Q 3PIPA 1G51A 5H1SE 5FLMH 4BBSG 4O2DA 3ULPA 5M5XH 2UXDQ 3EBEA 1DGSA 5AJ3Q 3KF8B 1MJCA 3OTOQ 4C3IH 1CKNA 3I56A 2RF4A 5C4JH 4NXNQ 3EN2A 1CKOA 3KDFA 1IBML 2BH8A 4MTNA 4P71A 1LTLA 3H15A 2B63G 2PI2A 1KC8C 1MJEA 2NZHA 1IBLQ 2BH2A 1XNRL 3CD6A 2Z6KC 4DUYL 3CPWA 2WB1E 3TS0A 1X54A 1PFSA 2N78A 1Q86C 1Q82C 3UE0A 3JAMc 3STBD 1VQDA 3A74A 4LWCA 1VQMA 1YNXA 4IPHA 1HZCA 2JA5G 5LMNW 1IBMQ 1X55A 1N33L 3IRBA 1XNRQ 4GLXA 4DUYQ 3OW2A 3AQQA 4GN5A 3ZJYC 4IFDJ 1C0AA 5C0XJ 4IPGA 2OQ0A 1JT8A 1JJCB 1N9WA 1SROA 4UPAA 1XMQQ 1I5FA 2PNHA 2ZJQA 1AH9A 2NVYH 4LF7L 3TREA 3VDYA 2R7ZG 1E1TA 3U58A 4LF6L 3KLWA 1GD7A 1N33Q 4OXPA 2WAQG 4DR5L 3UE1A 5IP7G 1PHJA 4PZ6A 5JJKA 4UY8C 4PMWA 2F4VL 2Z6KA 3F2CA 2R7ZH 3S1RH 4OWTB 4OWWB 1FL0A 1QUQB 3BZCA 2ZJRA 1GM5A 1HNZL 2ZTEA 1UEBA 4LF7Q 3S1QH 3HOZH 4LF6Q 5IP7H 2WFWA 3NENA 4TVAB 3CCUA 1VQBA 1BKBA 2F52A 4MZ9A 3PO3H 4JC0A 4X64L 4DR5Q 3JC66 1UWVA 2F4VQ 2KCMA 4PZ7A 5JJLA 5IYBH 3CAMA 4L5QA 4IPCA 4ALPA 5J3BA 3E9IA 4APVA 5JEAG 3GTLH 3FKIG 4FDBA 1XJVA 4JI5L 4A93G 3M9BA 4DV7L 1HNZQ 2EIFA 1VQ8A 1NBWA 2IT1A 2EXDA 3I4OA 4IOAA 2Z0SA 2R7DA 2RHQB 4A3FH 4C2MH 3ER0A 4X64Q 3J7ZC 2UXBL 1HJPA 2K50A 2YTXA 3A5ZB 4LF5L 4A3JG 1PH8A 1U5KA 4JI5Q 2UXCL 2NN6G 3CCVA 4DV7Q 4A3KH 3CMEA 1VQOA 3ICEA 4DR7L 1YHQA 2AWOA 1BVSA 4IO9A 4B3SL 2D0OA 4JYAL 1J5EL 4IFDI 2CWAA 1GVPA 5C0XI 4JI2L 3FHWA 2JA9A 1VQHA 4KHZA 1CSPA 4KLKA 3K80C 3CCEA 1L2FA 3HOVG 1UE1A 4EX5A 3M85A 2UXBQ 1QVGA 1PA6A 3HOYG 1KQSA 2AHOB 4DK3C 4LF5Q 1W3SA 3G48A 5M3MG 3WWVA 2UXCQ 2E8GA 2JA6H 1C9OA 1G6PA 3F1ZA 1A0IA 3F2DA 4DR7Q 1S72A 1K73C 4B3SQ 1XNQL 3PUVA 1J5EQ 1Z47A 4JOIC 1CUKA 3NEMA 4JI2Q 2VNUD 5GADC 1HZAA 3HOYH 2LXJA 5M3MH 3H3VH 1N8RC 4X6AH 1QZHA 2K5NA 3GDEA 1MKHA 1YJNA 1VQKA 4GNXC 4DKAC 3GTKH 3A5UA 1M1KC 2L15A 1I94L 1KAWA 1D7QA 1XNQQ 1JJGA 1VS0A 1YIJA 2VUMG 2MFIA 4BY1G 4A3DG 2NVQH 2R93G 1B70B 1V1QA 4QL5A 4L5SA 2NVXH 4A3BH 1Q1BA 4DUZL 3GTJH 1OXVA 4YCVA 3F8TA 5FLXc 4BY1H 4A3DH 1I94Q 4IJLA 3S15H 4NB3A 4LF8L 2IX0A 1TWHH 3E0EA 5K36G 4XIGS 2PI2E 3HOWG 2OCEA 1RIPA 1SFOH 4DV2L 1KHIA 4JOIA 2AKWB 5FLMG 4DUZQ 1KXLA 1HNXL 4RG1A 2R6GA 3I4MG 1T9HA 2GVAA 2MO1A 3CC7A 3HOWH 4GNXA 4LF8Q 1YI2A 2K4KA 4R4QA 4DV5L 4A75A 3I4MH 1SMXA 4DV2Q 4YWLA 4LUOA 1E1OA 3CF5A 4KHPL 3FP9A 1X6OA 1YHBA 1VQ9A 1PH2A 1GKHA 2K5HA 2VW9A 5IYCG 3RNUA 4B3ML 1XTDA 3KJPA 1FJGL 1YVCA 1AE3A 4HJAA 1PYSB 1CKNB 2HQLA 2Q2HA 1Q46A 3KOJA 4DV5Q 3CW2C 3CQZH 4QIWE 1Q81C 1EOVA 3KDFB 3S1MH 3S24A 1WYDA 4KHPQ 2VS1A 1NMFA 2N3SA 3RLOA 5IYCH 2D62A 2MQHA 1OXTA 1YITA 1RL2A 1E7ZA 4A3CH 2UUCL 3GTMH 4YHHL 4DV0L 4B3MQ 1QVFA 1NTGA 4DV1L 1PYBA 2R7FA 3UDGA 1FJGQ 5IYDH 3T1YL 2YTYA 3HOXG 1OXUA 2YYZA 4TQUS 3UDFA 1VQJA 1A63A 1MIUA 1YJWA 3J81i 1JMCA 4JI6L 2K75A 2I5LX 1N34L 1EIYB 3PIOA 3BU2A 2HHHL 1VQGA 4BBRG 5IE8A 4P72A 5HGQA 4OO1G 2UUCQ 3HOXH 1LM0A 1K9MC 4YHHQ 2MNAA 5M3FH 4DV0Q 3HOZG 4DV1Q 3U4ZA 4HIMA 3T1YQ 4XTCS 2EQSA 4OWXB 3PO3G 1QZGA 4BBRH 4JI6Q 4JG2A 4GLAC 3W1BA 5IYBG 4DV6L 1N34Q 5DLQE 4AIMA 1KIXA 1JE5A 2BA1A 2D0PA 2HHHQ 2C35B 4LNQA 4GOPA 3ULLA 2YTVA 2WAQE 2DUDA 3PF4A 1B8AA 3CCSA 1ASYA 4JBMA 4A3FG 2E2IH 3GO5A 1UE7A 1I50H 1Q1EA 3I2ZA 1KD1C 1KL9A 4DV6Q 3AEVA 2V1CC 3W1GA 2CWPA 4B3TL 4BA1I 3I55A 5BR8L 3CCJA 2JE6I 4A3KG 2GVBA 4DR2L 1QVCA 1E24A 2F3IA 4JV5L 2I5MX 4R1JA 1L1OA 1SN8A 3KF6A 4UP7A 3MEFA 5IP9H 2CCZA 3K8AA 1PH5A 2OQKA 1EUJA 3SGIA 1TWAH 1CKMA 3KJOA 2Y0SG 3CC2A 4B3TQ 5BR8Q 3RN2A 1X3GA 5LMUL 3M4PA 3G6EA 2JA6G 4YY3L 4DR2Q 1WJJA 1Q7YC 3M4OH 3D0FA 4HJ8A 4JV5Q 2QEXA 1SLJA 1UE6A 1UE5A 3MXNB 3G71A 2B3GA 5HY6A 4WJ4A 1H95A 2HT1A 2ZTDA 3TQYA 3GTPH 3J80c 3M3YH 3ULJA 4R4CA 3KYHC 1X65A 2JEAI 4A3GG 5LMUQ 3F2BA 4JYAQ 3J81j 2HIVA 4YY3Q 1X9NA 1VQIA 1NMGA 3A0JA 5JEAJ 3J7A5 4A3LH 4AYBG 4A3MH 3PGZA 1I3QH 4BXXG 4LF4L 3RN5A 4GKJL 1FGUA 1EWIA 4GLVB 4A3GH 4A3BG 4WJ3M 4QGUA 3K81C 3HKZG 4DR6L 3TS2A 4QJFA 4DR1L 4UP8A 3GTOH 4X62L 1VQNA 5C4XH 3S2HH 4LFCL 4LFBL 1EYGA 4JBWA 2CQOA 3PCOB 4BXXH 1PVOA 3M4QA 1WFQA 1O7IA 4H02A 2IHEA 4LF4Q 2ZTCA 1Z9FA 4GKJQ 4R4IA 2KHIA 4DR3L 2OWOA 4DR6Q 4DR1Q 3RLNA 4X62Q 2KENA 3I7FA 4LFCQ 2MO0A 4LFBQ 4HIDA 5IWAL 4GKKL 1P16A 2K52A 2RCNA 1EIFA 2YV5A 3CC4A 3HFZB 2UUBL 3PV0A 4OO1I 1HNWL 4NXML 2ZJPA 1IXRA 2RHSB 3E9HA 4HIKA 2JK8A 1K8GA 4Y52H 4BY7H 2H5XA 4DR3Q 1IBKL 2KBNA 2OTLA 5ELOA 1EQRA 1XPOA 4K0KL 5GAGC 4YCWA 1OXXK 1JB7A 5IWAQ 4AH6A 1OTCA 4GKKQ 3GTQH 2IY5B 1IYJB 1M90C 2UUBQ 4GNXB 1HNXQ 3CCRA 1HNWQ 2PQAA 5LMNL 1B7YB 4NXMQ 5IY0A 5GAHC 1CSQA 1VQCA 1PH9A 4LUZA 1PV4A 1IBKQ 1TXYA 3RZDH 4R4TA 2JA7H 1NJIC 4IFDG 5C0XG 4K0KQ 1EQQA 4A3CG 2XTIA 2PQAB 4LFAL 4NPSA 5IYDG 2N8NA 2Q2TA 1X3FA 4ME3A 4GOPC 3U4VA 1K83H 2I5HA 3JAMi 1YZ6A 5ELNA 4JCVE 1YBYA 2VY3A 3UDXA 4AQYL 2WB1G 5GROA 1Y1VH 4A3IH 3S17H 1WI5A 1P8LA 4LUVA 3RR5A 1D8LA 4Y7NH 4LFAQ 3PUZA 4JI0L 2NN6I 5M3FG 1KRTA 1W2BA 3PUXA 4JBJA 4PG3A 4L5TA 5C3EG 1PH6A 1PH3A 3AFQA 4BBSH 1WOCA 1BBWA 3BJUA 4KI0A 3DLLA 2N49A 1YEZA 1OXSC 2AMCB 2E2HH 4AQYQ 3L7ZC 1L1OC 3OYYA 1R9TH 2Q2IA 5C3EH 1XMQL 2YU9H 4POGA 1LYLA 4J15A 2B63H 3H3VI 2AWNA 4JI0Q 2IHFA 2VQFL 4QQBX 2A19A 1Q8KA 3KFUA 4X65L 3S1NH 1I6HH 3BZKA 2ATWA 4P74A 1C7YA 3PF5A 4GN3B 4DV3L 3J81c 4A4IA 1A8VA 4IPDA 2QGQA 4MNOA 1Y1WG 2JA5H 4L5RC 2CFMA 1K8AC 1VQEA 2PMZE 1LUZA 1XPRA 2VQFQ 4GOPB 2Q2UA 3CCMA 1Y14B 1EFWA 3PUWA 1QUQA 4X65Q 3CCQA 1XPUA 1BBUA 3K0XA 5IT9c 3CMAA 1V9PA 3TEHB 1FVIA 4DAYB 5IP9G 1Y1WH 3Q8DA 2ID0A 4DV4L 3S2DH 4O0AA 2WP8J 4DV3Q 1XMOL 2ASBA 4JI1L 3S16H 1HR0L 1YJ9A 3RLFA 4IJHA 1S40A 1S3OA 3HOUG 4BY7G 1SE8A 5EAYA 3PSIA 4UP9A 3G4SA 2JJQA 1VQLA 1PH4A 4JI7L 4JI8L 1PH1A 4YWKA 2E5LL 1N36L 2B29A 3HOUH 2ALYB 4LW1A 1E3PA 1U0LA 3EIVA 2QA4A 1L1OB 3KF6B 4DV4Q 2VL6A 4P73A 4JI1Q 1XMOQ 1HR0Q 3RZOH 1NE3A 4YCUA 1IZ6A 1TWGH 1KRSA 4HIOA 1PH7A 3CP0A 3NELA 3D31A 2GN5A 4A3LG 4JI7Q 2Y0SE 4JI8Q 4A3MG 2I0QA 2E5LQ 1N36Q 1HH2P 1L0WA 4RMFA 1GO3E 2A1AA 3AFPA 1VQAA 5FJ8G 3FKIH 3J80i 1N32L 4A93H 2DGYA 4HJ9A 3PO2G 3TRZA 1Q12A 1VQ5A 1A62A 2HIXA 1NY4A 4LF9L 1WCMG 4JI4L 3S14H 4GN4B 5C4XG 3K7UC 4DK6C 3LGJA 2R92G 3DM3A 1IL2A 1X3EA 5FJ8H 4GS3A 3W5OA 4B3RL 1V43A 3K7AH 4A3EG 3PO2H 1K0RA 3ERSX 1HR0W 4A3JH 1N32Q 3HKSA 1WCMH 2NZOA 4OX9L 1HZBA 2UUAL 5M5WH 1JJ2A 2R92H 3T1HL 1TWCH 2ES2A 4AYBE 1SRUA 4LF9Q 4JI4Q 4R4OA 2NVTH 2K5VA 5E7NA 2JEBI 4A3EH 2CKZB 2JQOA 1J6QA 1AE2A 5M5YH 4JI3L 2UU9L 3HOVH 3HKZE 3GD7A 3CXCA 1VQ7A 4HJ5A 4B3RQ 3U50C 2IX1A 1HZ9A 1K3RA 2FXQA 3H0GG 2VZAA 4OX9Q 2UUAQ 4DR4L 3T1HQ 5C44G 4IOCA 1VQ4A 3STBC 4C3JH 5GAEC 4JBKA 4C3HH 3NBHB 3B6YA 1YHAA 4X66L 3M7NA 3CCLA 3CPFA 2UU9Q 3L0OA 4JI3Q 3H0GH 4P75A 1ASZA 4DNIA 5C44H 4DPGA 3L2PA 4QY7A 4DR4Q 2VQEL 2LSSA 3UDIA 1VQPA 5JJIA 2JA7G 4OONA 2JA8G 1VQ6A 2VUMH 3I4NG 2R93H 2K14A 2KCTA 3PUYA 4PZ8A 4EQ5A 4X66Q 2ZM6L 4A76A 1G291 2E2JH 4DAMA 3AYHB 2A8VA 4HJ7A 2LXKA 4POFA 1VCIA 2UXDL 5AJ3L 1E22A 2XGTA 2JA8H 4YWMA 3OTOL 3I4NH 1X56A
chains in the Genus database with same CATH superfamily
1Y1VG 4DA2A 4NXNL 2VQEQ 1SR3A 1R4PB 5IGFA 4BA2I 1QWYA 1TWFH 4DAPA 1IBLL 1TWHB 2ZM6Q 3PIPA 2O4XA 5D3DA 2UXDQ 3SK8A 1DGSA 5A2QL 2PPBC 2MP1A 3BDCA 1CKNA 2BCOA 5C4JH 2LS01 3EN2A 3MZ5A 3VA7A 1JR0D 1IBML 1JWUD 2BH8A 4P71A 3H15A 1KC8C 1MJEA 2NZHA 4QMGA 1XNRL 3CD6A 2Z6KC 3CPWA 2F0UA 4V190 3TS0A 5C3XA 3JAMc 1M4VA 2ZXPA 5I9OA 3NTIA 3DUZA 2KA7A 1U9RA 1VQMA 1YNXA 4IPHA 3MFYA 5CC4A 1X55A 3G6JB 3MXGA 5C5MA 2CVRA 4GLXA 1IW7C 3AQQA 3WOEA 4IPGA 1JJCB 3Q0AA 1N9WA 2KOLA 1AH9A 5FLXE 4LF7L 3VDYA 4KD4A 4X3KA 1N33Q 4OXPA 1Y1VB 5LL6S 2J0TD 1HXYD 2A68C 4PMWA 4DK1A 1FGBD 3KLSA 1FL0A 1KNEA 4OO1H 4H0LC 1HNZL 3J80L 4LF6Q 2WFWA 3NENA 1CHQD 3CCUA 1VQBA 2E2HB 3KLRA 3D8GA 1R4QB 5C3EB 4UAIA 1CT1D 2KCMA 4PZ7A 5JJLA 3CAMA 4L5QA 2B2WC 5J3BA 3E9IA 3EFXD 3FKIG 1NNXA 1CQVA 4DV7L 2EXDA 5KGUA 3ER0A 3J7ZC 2UXBL 3FPUB 1I4QA 3QB3A 5CV5A 1NAPA 5BN4A 4A3JG 3BVMA 1U5KA 4A3KH 3CCVA 3CMEA 4DR7L 1STAA 1Y1WB 3BG3A 2D0OA 3KBGA 3EVQA 1SNMA 2CWAA 5C0XI 1GXDC 4KLKA 2I46A 1L2FA 4EX5A 2GA4B 1RODA 1ESFA 1KQSA 4LF5Q 3G48A 3CRKC 1BQQT 1E2ZA 3F1ZA 1A0IA 5NUCA 2ZXOA 1JC7A 3HOUB 1QCBD 3RZOB 4JOIC 1CUKA 4JI2Q 3TP6A 5GADC 3HOYH 3P20A 1N8RC 1QZHA 4HTHA 3GDEA 1XXGA 1Y8OB 1LT3D 3GTKH 3SHLA 4C1NI 1KAWA 1H9MA 4CHTB 4OGQC 2BE5C 1VS0A 1WD0A 2VUMG 1B70B 3ONAB 1H9SA 3QG1A 4L5SA 1SYBA 1IKLA 5D14A 3DM1A 1GHKA 4YCVA 3F8TA 1LLRD 3V05A 2FINB 3K7AB 1I94Q 5K36G 2B2UA 4A3JB 1G2TA 4XIGS 2PI2E 3MFGA 4RAUC 4JK1C 1TQOA 4RKLA 1RIPA 3FMCA 1EWCA 4K6LA 4K8JA 1B4OA 1HNXL 3X3NA 1T9HA 2GVAA 3HOWH 2Q8RE 3IKJA 3RD4A 4OHJA 4DV5L 4A75A 1SMXA 5KNDA 1QNUA 1EY8A 2Z6BA 3CF5A 3FP9A 4K14A 5T1GA 1CM9A 4WORA 3H0GB 2CW0D 4WJWA 1GUOA 1SXTA 1YVCA 1PYSB 1CKNB 2HQLA 3KOJA 1Q46A 4QIWE 3CQZH 1Q81C 1CHPD 1FNWA 2JN4A 2VS1A 1S5FD 2D62A 2PCFB 4IFDH 1OXTA 4RGNA 5FK9C 3GTMH 3Q6SA 1SE3A 3TDQA 4DV0L 4B3MQ 4DV1L 1FJGQ 2JA7B 3I4NB 3SE0A 3CKIB 1A63A 1VQJA 1SYGA 2F0FA 2AQ3B 3J81i 4CKEA 1N34L 3BU2A 5HGTA 3KBXA 4YHHQ 3HOZG 3S17B 3U4ZA 2A6HC 4I65A 4DN4M 3PO3G 3QOJA 1EY0A 1F2YA 4JG2A 5IYBG 1K3BC 2BA1A 1ILPA 2C35B 4GOPA 3ULLA 3SK4A 1SNCA 1R9TB 3CCSA 4JBMA 5I9PA 1SMYD 1KD1C 3S1NB 1A2UA 3W1GA 2DJFC 2DNEA 1IL8A 2KHSA 1K28A 4QCLA 1QVCA 1E24A 2JA5B 2F3IA 4R1JA 3C46A 3FPPA 3K8AA 3OSOA 4ZUJA 4F8MA 4IUUA 1CKMA 1LV9A 4B3TQ 3DWAA 1SNDA 2C9OA 3T4AC 5LMUL 3G6EA 5ELFA 3S1RB 3S9WA 2QEXA 2MJ8A 3MWYW 1SLJA 1UE6A 4WJ4A 4Q5VA 2B2UC 2ZTDA 3TQYA 5I6YA 3J80c 1TIID 1ENAA 5DM73 3F2BA 3H3VC 1HQMC 3A0JA 4A3MH 4GLVB 1KDCA 1U4RA 3I70A 1DZ1A 5C4XH 4LFCL 3CU7A 4JBWA 1PVOA 4K2KA 3M4QA 1GJXA 1I4PA 2IHEA 3NBIA 1SAPA 3SR1A 2HUGA 1EIHA 1P16A 1SEBD 2K6AA 2XWJB 2K52A 5LHY1 1W6KA 2YV5A 2UUBL 3A8IE 5M5YB 4HIKA 1G2SA 2H5XA 4DR3Q 2KBNA 1HHVA 4KJOA 5JAVA 1X32A 5IWAQ 1OTCA 1CA6A 2B2VC 1HNXQ 1HNWQ 2PQAA 5LMNL 1UUPA 4RCNA 4BWGB 2WACA 3KK7A 3MTSA 1PV4A 1IBKQ 2EJMA 1F9QA 2QF7A 4K5XA 1NJIC 5C0XG 1LT4D 5FO7B 2XRSD 1X3FA 1LTRD 4ME3A 4GOPC 2EZVA 4A3DB 3K58A 4B9XA 1I4RA 2WV6D 2KEDA 4ABNA 1YBYA 4AQYL 1Y1VH 2L11A 4LUVA 3H6MA 4B9WA 1X3QA 3BYTB 2EPBA 2EY1A 4LFAQ 2V4DA 3PUZA 1W2BA 1EU4A 1PH3A 4PG3A 4L5TA 2DNCA 1TWFB 3AFQA 4HEDA 5EJWA 2B2YA 2F0SA 3KUPA 1OXSC 2AMCB 5AFWA 2E2HH 3L7ZC 4EQPA 3I4MB 5C3EH 2F0WA 4RWSC 1XMQL 4POGA 2R61A 4K5VA 2IHFA 2Z4IA 4Q0FA 1Q8KA 3J7AF 1EYCA 3H91A 4J1MA 3BZKA 2ATWA 4P74A 4ZKCB 1CZGA 3PF5A 2SEBD 2CH4A 1A15A 3J81c 1KLUD 2QGQA 4MNOA 2D9UA 4GOPB 5CV7A 4X65Q 3K0XA 4DAYB 3S2DH 1Y1WH 3Q8DA 2ID0A 4DV3Q 1YJ9A 1QB5D 4U68A 1EY7A 4BY7G 1M8AA 1SE8A 5EAYA 4UP9A 1VQLA 2L0CA 3M4YA 2AUKA 3VR4A 4JI7L 1EZ8A 3CHBD 4YWKA 2ALYB 3TBIB 3EIVA 4DV4Q 3A7AB 2VL6A 3RZOH 1HR0Q 2M9VA 3A56A 4BBRB 1KRSA 5ELBA 4P2CB 4OELB 1PFBA 1TS2A 3VYTA 4NP5A 1N36Q 1VQAA 5FJ8G 3FKIH 1WTHA 2E76C 2DGYA 3JAME 1CTMA 1RJTA 4IUVA 2HCIA 3Q22A 1EZ6A 2OEOA 1RKNA 4B3RL 5JPMC 3O13A 3K7AH 1MGSA 2AUJD 3ERSX 3HEJA 4A3JH 3OW7A 1HR0W 1N32Q 4OX9L 1ZEQX 1FNUA 5KYLA 4LF9Q 1V1OA 4A3KB 5IT9E 1HPCA 2H1EA 3HZXA 4JI3L 1MD2D 3K5LA 3NBHA 3U50C 1IKMA 4KY5A 3LWEA 1K3RA 2G9DA 2FXQA 4OL7A 1BF4A 3PMFA 2UUAQ 4KD3A 3DEPA 5GAEC 2FMCA 3M7NA 3CCLA 3L0OA 1D1IA 3H0GH 1YNJD 3L2PA 4V0BA 1I3QB 2VQEL 2LSSA 3UDIA 3DWQA 1VQ6A 2VUMH 4EQ5A 4PZ8A 1GUWA 1EIGA 2ZM6L 3GTOB 4A76A 1CQFA 1IYUA 4N9PA 3AYHB 4UDUC 2DN8A 1H9JA 2LXKA 1UNSA 1VCIA 4POFA 2UXDL 1DJRD 3I4NH 1X56A 3HKZB 5K36H 4C3IG 5GQOA 3PIP3 2OTJA 5LMNQ 5KIXA 1D5ZC 4BBSG 3ULPA 4M8AA 4PV1C 1SE2A 4L63B 5ELDA 4FF3A 1BNZA 3OTOQ 3I56A 3EQLC 3K59A 1LTLA 2B63G 2PI2A 2BH2A 5D3IB 1PZKD 1PFSA 4EQNA 3DMUA 2N78A 1Q86C 1Q82C 3GTQB 3UE0A 2HCCA 3STBD 1VQDA 1UEAB 4MIUA 5LMNW 1F9SA 1N33L 4PMBA 2K04A 3ZJYC 4IFDJ 2ENBA 5EKLA 1SROA 2F3VA 1XMQQ 2ZJQA 2R7ZG 5IOCA 5M9OA 3U58A 1WTOA 4LF6L 2RDGA 1RDPD 3GTMB 2KQ3A 2G9HD 3UE1A 5JJKA 3EROA 2DY8A 2Z6KA 3F2CA 2EY5A 3S1RH 4OWTB 3BZCA 2ZJRA 1GM5A 2XRQD 2K03A 3HOZH 3NHHA 3T13A 4U673 5IP7H 1LABA 1A2TA 1BKBA 2F52A 5C5LA 5CMDA 3PO3H 1LTID 4DR5Q 1UWVA 2A69C 5IYBH 4IPCA 4DNTB 4ALPA 4APVA 4DK0A 5JEAG 1XJVA 4A93G 1BXTA 2EIFA 1VQ8A 1NBWA 4IURA 5I6WA 4C2MH 3CRLC 4QF4A 3C1EA 3I90A 2K50A 2YTXA 3NQTA 2EDGA 4LF5L 2K7VA 4JI5Q 1J8IA 3MXNA 1IW7D 3S16B 1G6ZA 1Q8IA 1GVPA 4JI2L 1YNNC 3CCEA 1CSPA 2NBFA 3HOVG 3M85A 2NN6H 2AHOB 4DK3C 5IGDA 5M3MG 3WWVA 1C9OA 2B2WA 1G6PA 1SE4A 1O7YA 3DHQA 3F2DA 1STBA 1K73C 4B3SQ 4C3JG 1J5EQ 3FVQA 2A68D 4RHSA 3I8ZA 1TWGB 1A3VA 3H3VH 5A2QE 5FOBB 3HS0C 4GNXC 1KAAA 1I94L 1XNQQ 4RGTA 1JQYD 4BY1G 1PRTF 2R93G 5TSSA 2F4IA 3U9OA 1C4QA 2B8GA 1RHPA 1Q1BA 1OXVA 4FP5D 2L55A 1B1ZA 1KDBA 4Z9CB 4A3DH 2X69A 5M5WB 2F0KA 1TWCB 4C1NK 1KHIA 4JOIA 2AKWB 1AEXA 1KXLA 3OWEB 4RG1A 2R6GA 3N52A 4HSVA 3R93A 3E6ZX 2K4KA 3OIPA 3I4MH 4DV2Q 4KN7C 4C3JB 3D6WA 4LUOA 3J80E 2M2LA 4IUNA 3R8BA 5IYCG 1CZWA 1BBXC 3KJPA 4B3ML 1FJGL 3EJIA 4HJAA 4CGYB 1F9PA 1ICFB 1EOVA 5E1FA 3S24A 2Z1CA 4KHPQ 3PQIA 3RLOA 1T5EA 2MQHA 2XIWA 2F0HA 1E7ZA 4YHHL 1PYBA 2JA8B 3HOXG 2RQXA 2VB3X 1EOTA 3PIOA 5EKIA 2QCPX 4X3UA 1EEID 2UUCQ 5M5XB 2WKCA 4HIMA 3T1YQ 2O5IC 1B9NA 1PZJD 2EQSA 3UI2A 4N9TA 4BBRH 3VYRA 4AIMA 5C4HA 2D0PA 2HHHQ 4QIWB 2K5QA 2DUDA 2QDBA 1ASYA 1I4GA 2DJGC 1MBYA 1HTLD 1BCPC 4A3FG 3GO5A 3I2ZA 4IQZA 5EGTA 1KL9A 4DV6Q 1K8MA 4IUPA 2CWPA 4B3TL 4BA1I 3I55A 1JOQA 3CCJA 2JE6I 2GVBA 2NYZD 4BS9A 1AW7A 3J7YW 4UP7A 3QR8A 1PH5A 2OQKA 3BZDB 2K1BA 1EUJA 4N8X1 3S2DB 3RN2A 4BY7H 1Q7YC 4DR2Q 1MI2A 1V1PB 3D0FA 3MXNB 2B3GA 2HT1A 2A73B 3M3YH 3K5OA 4S3SA 3OWFA 2Z4HA 1L0YB 3KYHC 4OIJA 4R4CA 4A3GG 2HIVA 4H13C 3GP7A 1NMGA 1ILQA 5L37A 3MAQA 1I3QH 3W3AA 4QB4A 4BXXG 1FGUA 1EWIA 3VYSA 2LFNA 2Q8TA 1STEA 2PZTA 4RFBA 3GTOH 2F0PA 3FKIB 1VQNA 3S2HH 2FJ2A 4KY6A 1EYGA 3PCOB 2PZUA 2ZTCA 4GKJQ 4R4IA 5J22A 1DCZA 4DR3L 3NUCA 4DR6Q 4DR1Q 3RLNA 2PZWA 2XWBB 4ZCKA 5IWAL 1FR3A 1EIFA 4OO1I 1HNWL 3E5SA 3E9HA 4DF7A 1K8GA 1U4MA 2F0QA 1IBKL 2ZT9C 3LNNA 5ELOA 1XPOA 1D6EC 4AH6A 4GKKQ 3GTQH 2IY5B 2RDHA 1FD7D 1HFGA 3CCRA 4G7OC 4NXMQ 2IJ0A 1PH9A 2NVQB 1QJOA 3J81L 1TXYA 4R4TA 1BUVT 4K0KQ 1JORA 1EQQA 1HCZA 4LFAL 4XDXA 2N8NA 2Q2TA 2VUMB 4E6IA 3U4VA 5KNCA 4QUCA 3S15B 4EVOA 4ZYSA 1EU3A 4DXGA 3DEOA 2WB1G 5GROA 4PNYA 1D8LA 4XYOA 5M3FG 1KRTA 3PUXA 2RSNA 5JVH3 3I73A 1XTCD 4BBSH 1WOCA 1BBWA 4HR7B 2B2VA 2BOSA 3A8JE 2KJXA 1A3TA 2Q2IA 1ICWA 3DXJC 2YU9H 2B63H 3K0YA 1EQVA 2L1BA 4QQBX 2A19A 3KFUA 4X65L 4CDEC 1E2VA 1KTKA 4GN3B 3HGBA 1UAPA 4DV3L 1A8VA 3S1MB 4DAYA 4L5RC 4R8NA 2CFMA 3NPPA 5J39A 2MUYA 1XPRA 2VQFQ 2Q2UA 3KLSX 4NKLA 4EQOA 3CCMA 1EL0A 1JICA 1QUQA 5KEEA 3CMAA 1V9PA 3MA2B 4DV4L 3S16H 4I7ZC 1HR0L 4HCEA 1S3OA 1SSOA 4GZYC 3PSIA 2JJQA 1PH4A 1GUGA 1N36L 2B29A 5M3FB 4LW1A 1E3PA 1U0LA 2QA4A 1XMOQ 3QIAA 4ZLTF 2EYHA 4P73A 1JB3A 1RF2D 1TWGH 1F77A 1TR5A 2F0EA 1PH7A 4CBVA 1SYEA 3CP0A 3NELA 3HOZB 3D31A 5CBEE 4F87A 2GN5A 3OIQA 1AZQA 4JI8Q 1PXUA 1KDAA 5JEAH 4RMFA 1GO3E 1TVXA 2A1AA 3AFPA 1WD1A 3PO3B 1N32L 1O80A 4A93H 3PO2G 2E2IB 1A62A 3L9AX 1I50B 1NY4A 4LF9L 1WCMG 2IL8A 2F0TA 3K7UC 4DK6C 3LGJA 1QILA 2R92G 4CKCA 3W5OA 1V43A 4A3EG 4C2MB 4FF4A 2EYFA 2UUAL 2EYLA 5M5WH 4R9WA 1S5BD 1TWCH 3ITPA 1PMRA 2K5VA 2CW0C 2KCNA 3U9SA 3HOVH 3GD7A 4C3HG 4RHRA 1STYA 3WDNA 1HZ9A 1WTXA 3NTKA 3A8KE 3T1HQ 4FNFA 5C44G 4IOCA 2L4NA 4C3JH 4JBKA 3GTPB 2HQEA 3MC0B 1BOSA 1ASZA 5BN3A 4DNIA 3MVVA 4DR4Q 4OONA 2R93H 3PUYA 4X66Q 3ND8A 5I4DA 1G291 1PRTD 5T1IA 4HJ7A 4DXFA 2JA8H 4PQXA 4YWMA 3OTOL 3D4RA 2KHJA 4A3IG 4ODGA 1VQFA 1L0XB 5DM63 4RGMA 1QNKA 1IYVA 4O2DA 2EY2A 1DOMA 5M5XH 2TSSA 3KF8B 1MJCA 2WIIB 5CV6A 5IGBA 1PFMA 4MTNA 3FEWX 3RUZA 1HTPA 1S5DD 2WB1E 1X54A 1J9OA 3TP5A 3F2UA 5HURA 1HZCA 2SOBA 3RZDB 4O42A 2AQ1B 4DUYQ 1W6JA 3OW2A 2IWHA 2FMMA 2JYOA 1C0AA 4QUFA 3V96A 5C0XJ 2OQ0A 1JT8A 1NCVA 1NUCA 4UPAA 2NB0A 1I5FA 5G3LF 2PNHA 2F03A 4I7AA 1VMPA 4KJNA 3KLWA 1GD7A 1T5XD 1Y69U 3BYYB 4DR5L 4PZ6A 4G7ZC 4H7BA 4KV6A 3VYUA 4OWWB 3TZDA 1QUQB 1EQTA 5JVG3 2ZTEA 4FXKC 4X3TA 2EJFC 1ESRA 4XQJA 1ML0D 4TVAB 1TT2A 1ZXTA 1B3AA 4MZ9A 3NQIA 3JC66 1DOKA 2F4VQ 5IIFA 4XYQA 3R3OA 5EPKA 4KMUC 4JI5L 3M9BA 2N88A 2F0NA 4LK1C 2IT1A 3Q23A 3I4OA 1STNA 4IOAA 4A3FH 5CBAE 4X64Q 4NDXA 2JXMB 1B50A 2K28A 5ELCA 3K57A 1HJPA 3QWNA 3A5ZB 4LJZC 1VQOA 2AWOA 5KRUA 4IO9A 4B3SL 1J5EL 2JA9A 1VQHA 4KHZA 3SVMA 3SXHA 1QVGA 3HOYG 1W3SA 2JP1A 2UXCQ 2E8GA 2F0LA 1XNQL 3P1HA 4BY7B 3PUVA 1RD9D 2F1MA 2F0GA 1QG7A 1HZAA 4X6AH 4DGZA 2K5NA 3TN2A 1MKHA 3D3RA 2SNSA 4FXDA 1YJNA 1VQKA 1PTOC 4DKAC 4DAVA 3A5UA 2H4OA 3M3YB 2WINB 5DAUA 1YIJA 2NVQH 2A69D 1V1QA 4F7XA 3TSSA 5BN5A 4CDDC 1TS3A 1IHZA 1WTPA 4IJLA 3S15H 2ICIA 2IX0A 3E0EA 5EBDA 3HOWG 3S2HB 3C2PA 3D6CA 2OCEA 1SFOH 3T16A 4DV2L 2NVTB 5FLMG 4DUZQ 2OT2A 2MHVA 4ID6A 3CC7A 1JOOA 1NSNS 4GNXA 1YI2A 4LF8Q 1YNND 3K5MA 4R4QA 2EE1A 2XN9C 2EXZA 3TP8A 4X3SA 4YWLA 4KHPL 1PTOB 1X6OA 1MHWC 1VQ9A 1PLFA 1PH2A 2K5HA 1EWHA 1SYDA 3RNUA 1XTDA 1ZKOA 3MXUA 4A3BB 5KNBA 1O7LA 5I2XA 3S1MH 2QEJC 1WYDA 2A5HA 1YITA 2E2JB 1F2ZA 2UUCL 3SK6A 1NTGA 2R7FA 2K32A 2K5WA 1CI3M 3UDGA 3T1YL 1HQRD 5FO8B 2YYZA 4TQUS 4XQNA 3UDFA 1MIUA 1HFNA 1YJWA 3GTGB 2I5LX 1EIYB 2B39A 1O78A 2HHHL 3ZYYX 1VQGA 5IE8A 3IAYA 2MNAA 5M3FH 4G4KA 4C3IB 1EEFD 4OWXB 1ZYRD 3FRPB 1QZGA 4JI6Q 4DV6L 4BBSB 5DLQE 1Z6HA 2N55A 4LNQA 5EPLA 5EPJA 1SDFA 2ZXRA 3PF4A 1RCVD 2YU9B 2BDNA 2B63B 1AP0A 4ZKBB 2E2IH 1UE7A 1I50H 4ME5A 1TKWB 1SBBB 2O5JC 4DR2L 3T56B 2A6EC 2FFKB 2NVYB 1JOKA 3MEFA 4RKBA 2CCZA 1V1PA 5K5PA 5CR3A 3SGIA 2KECA 1TWAH 3MEHA 3KJOA 3CC2A 5BR8Q 2JA6G 3M4PA 1V8QA 5CGKA 3HG9A 3M4OH 1YNJC 2R7ZB 4HJ8A 4JV5Q 1O7ZA 3G71A 1UE5A 5HY6A 4CJ0B 1H95A 3T53B 4FXGC 4EGVA 3GTPH 3OMCA 1ENFA 2KVMA 1Z7TA 2PMZB 1WTVA 1XX8A 4JYAQ 1EYDA 3J81j 4YY3Q 3NSWA 1X9NA 5JEAJ 2Z9HA 4AYBG 5JOBA 4R8IA 4GKJL 2K05A 3QOLA 4XXEA 4A3BG 3FDTA 4WJ3M 3K81C 4DR6L 3TS2A 4QJFA 4DR1L 4A93B 3BVGA 2PNRC 2Q8IB 2CQOA 4IUQA 1HA5A 1WFQA 3N6RA 3T51B 4LF4Q 4HSPA 1TS5A 3QO2A 2OWOA 1I6VC 2R3ZA 3NWSA 4X62Q 2KENA 3I7FA 4LFBQ 4FO2A 5FO9B 4GKKL 3VR6A 2JSOA 3PV0A 4HCSA 3TZUA 3VR2A 2ZJPA 1IXRA 4NXML 2JK8A 3HOVB 4ZUIA 2OTLA 5M3MB 4K6DA 4UHVA 2MGSA 4KKSA 4K0KL 4YCWA 1OXXK 2M00A 4GNXB 3I91A 5IY0A 2RKSA 1CSQA 1STGA 2E74C 4LUZA 3E0JA 3RZDH 1HRJA 1XWEA 4A3CG 3GTJB 2XTIA 4KN4C 5IYDG 4BY1B 2R93B 4FVMA 1K83H 2I5HA 2RVLA 2PW7A 1I4HA 5C0XH 1SNPA 3SK5A 2BE5D 3UDXA 4A3IH 1WI5A 3RR5A 1CA5A 2NN6I 1PH6A 5EKKA 5C3EG 4JBJA 1STHA 3D4WA 3NK9A 4KI0A 3DLLA 2N49A 1YEZA 2IW3A 4O1NA 2J4XA 1PDQA 3A54A 3H3VI 1LYLA 4TSSA 2AWNA 2PYKA 4JI0Q 4L8JA 2VQFL 4K2LA 3NE5B 1X3PA 1C7YA 2VXWA 3K5NA 1GOZA 1Y1WG 1K8AC 1VQEA 2PMZE 4KTAA 1WTRA 5I2YA 1EFWA 1XPUA 3CCQA 2IPKD 1BBUA 5IT9c 3L3OC 5IP9G 5F2DA 4O0AA 2WP8J 1XMOL 2ASBA 4IJHA 3HOUG 3URYA 5G3LD 1Q3LA 4NW2A 4CKBA 3G4SA 1WVLA 4JI8L 3HOXB 3SEBA 5CV4A 4JI1Q 4YCUA 1IZ6A 4HIOA 4XT3B 3BS1A 2HD3A 4A3LG 2E5LQ 1HH2P 1L0WA 4IZ8A 3J80i 3GQBA 2A6HD 1Q12A 2MPMA 1BCPB 3R2IA 5FLXL 3S14H 3DM3A 1X3EA 5FJ8H 1G91A 3EA6A 4A3FB 3J81E 1LTGD 2NZOA 2OXPA 5IGGA 2I07B 3T1HL 4AYBE 1AZPA 1S5CD 4JI4Q 4R4OA 2NVTH 2K33A 2JEBI 2JQOA 1J6QA 1AE2A 1A3UA 1BO0A 3CXCA 1VQ7A 2IX1A 2EY6A 3TP7A 3H0GG 4OEMB 4DR4L 2F3WA 1H9RA 4M1UB 3B6YA 1JE4A 2D5DA 4X66L 1PTOH 3CPFA 2UU9Q 4HMIA 4ZAIA 3G7LA 4P75A 4JPBW 5KYIA 4QY7A 1XYIA 1NR4A 2EVBA 4HAEA 5JPNC 2NTTA 2JA7G 3VR5A 4A3GB 3I4NG 2KCTA 3A55A 5DEHA 2E2JH 3DWPA 4KKTA 3H94A 4RCOA 1HUMA 2X6GA 2BA0A 1MSHA 1S5ED 4L6TB 3GTGH 2EYPA 3KF8A 1EY5A 1G51A 1GUSA 5CORA 5H1SE 5FLMH 1LT5D 1S4ZA 3EBEA 3MXPA 5AJ3Q 1SFOB 3W2DA 4C3IH 1SYCA 2RF4A 4NXNQ 1CKOA 1BR9A 3KDFA 2LY7A 3OPOA 1IBLQ 5CV9A 4DUYL 2OF1A 4TKOB 3A74A 5LL6X 3P7JA 4LWCA 2JA5G 1IBMQ 2L12A 4DNRB 3IRBA 1XNRQ 4GN5A 1TY2A 2PO4A 4K5WA 4LMQD 2NVYH 3TREA 1E1TA 2A74C 1B9MA 1LTAD 5IGEA 4MN3A 5J1ZA 2WAQG 5EBCA 2F0OA 5IP7G 4Y7NB 1PHJA 2F0DA 3WOFA 4UY8C 2F4VL 1TS4A 2R7ZH 3A7LA 4PMCA 5C6AA 4LF7Q 2NWGA 1UEBA 2WB1B 3S1QH 1LTBD 4JC0A 4X64L 5IGCA 4CDCC 1CFMA 3SDZA 3GTLH 4FDBA 1I6HB 1HNZQ 4OIKA 2Z0SA 2R7DA 2RHQB 1GHJA 1EY6A 4J8QA 5COYA 1BCPF 2XNAC 1PH8A 2UXCL 2KCCA 1FYCA 5CV8A 2NN6G 4DV7Q 3ICEA 1TU2B 2D2CC 1YHQA 1BVSA 4IFDI 4CJ1B 3FHWA 3K80C 2CH4W 1UE1A 2UXBQ 1PA6A 3D4DA 2WAQB 1KABA 2ICEC 2SDFA 2JA6H 1TWAB 1BDOA 4DR7Q 1S72A 2XSCA 1Z47A 3M4OB 3NEMA 1PZID 2VNUD 1G8ZD 2LXJA 5M3MH 2QDLA 3I4LA 1ET9A 2IX3A 4KY7A 5ISRA 1M1KC 2L15A 2DY7A 1D7QA 1F2LA 3HP3A 2PW5A 1JJGA 2MFIA 4A3DG 1JWMD 4ZRZA 4QL5A 1B3QA 2NVXH 3NXWA 1EYAA 4A3BH 4DUZL 2RCFA 3GTJH 1LACA 5FLXc 3BVZA 4BY1H 1GUTA 3PO2B 1H9SB 4NB3A 4LF8L 1TWHH 2F0VA 1WCMB 2R92B 5C3WA 1PYWD 1VF7A 4A3EB 3I4MG 5DNFA 1H9KA 1E2WA 1KLGD 2MO1A 4ILWA 3IL8A 1SJED 4N8FA 3OOCA 4H44C 3NP8A 1I4XA 4C3HB 1E1OA 1SMYC 1YHBA 1GKHA 4FYDA 2VW9A 5C44B 1AE3A 1NR2A 2Q2HA 4DV5Q 3CW2C 4WFN3 3KDFB 3LWUA 1PTOD 1NMFA 2N3SA 5IYCH 1AFPA 1RL2A 4A3CH 1QVFA 5IYDH 1ENCA 4FF1A 2YTYA 1OXUA 4HMJA 3I3CA 1II3A 4ZK9B 1JMCA 4JI6L 2K75A 1PFNA 1K83B 3VA5A 1KNAA 4BBRG 4P72A 4IN3A 5HGQA 4OO1G 3HOXH 1C48A 1LM0A 4A3IB 1K9MC 5CYUA 4DV0Q 3C3LA 4WRDA 4DV1Q 2KUMA 2B2TA 4XTCS 1DXMA 2PQEA 5C4JB 4DFAA 2RBMA 4XT1B 1K8OA 3W1BA 2EYMA 4GLAC 1N34Q 1KIXA 1JE5A 1RTNA 1WTWA 1LTTD 1K0SA 2YTVA 2WAQE 1B8AA 5FKAC 1JWSD 1Q1EA 2EJGC 1E0BA 2V1CC 3AEVA 3OHXC 5EQ0A 1U4LA 5BR8L 1SNOA 4A3KG 1CK1A 3K6OA 1DM0B 1DD2A 4JV5L 2I5MX 1D1KA 1L1OA 1SN8A 2LMCB 3KF6A 1Q90A 2K01A 5IP9H 1SYFA 2RSOA 2Y0SG 4G57A 3AMUA 1X3GA 3HOUH 4JYAL 4YY3L 1WJJA 3RMHA 4KKUA 4ULLA 3ULJA 3C1FA 1X65A 1PRTC 1C8CA 3H09A 5LMUQ 2JEAI 3X3MA 1VQIA 2AQ2B 5C4ZA 4LAAA 3J7A5 3NWTA 4A3LH 2VB2X 3PGZA 4LF4L 3RN5A 3HRZC 1ONLA 2HDLA 5ELEA 4A3GH 4QGUA 3HKZG 4K8IA 4RGOS 4UP8A 1D2BA 4X62L 4LFBL 4BXXH 4JW0A 3S14B 1LTSD 1QOHA 1O7IA 1B53A 1EY4A 4H02A 1Z9FA 2BDOA 1A6XA 2KHIA 1HA6A 5A35A 1FNVA 4LFCQ 2MO0A 2Y0SB 2A6ED 4HIDA 3MHBA 3TMEA 2F0JA 2RCNA 1B2TA 3CC4A 3HFZB 2L9HA 2LKVA 4Y52H 1DONA 2RHSB 4MTKA 1TY0A 2EOTA 3HOYB 1PRTB 2CQAA 2RDFA 2XVSA 1EQRA 3JAML 1SJHD 3E3XA 5GAGC 2HDMA 1JB7A 1WTQA 3GTKB 1IYJB 2B2YC 3M7GA 1M90C 1LT6D 2UUBQ 4FF2A 2NTSA 1B7YB 3AU7A 2J7ZA 5GAHC 1VQCA 2Z8LA 2B2TC 2JA7H 4IFDG 2PQAB 2L5TA 4NPSA 1HUNA 2E2DC 5E4WC 3GV6A 5IT9L 3JAMi 1YZ6A 3ND9A 3V2TA 2EYJA 4JCVE 5E3FA 2VY3A 5ELNA 3S17H 1P8LA 4NMZA 4Y7NH 2EYOA 1MSGA 4MHEA 2CHBD 4JI0L 3OMGA 5IODA 3HOWB 3PIO3 3ERQA 1SNQA 3BJUA 2NZ1D 1ET6A 3IFDA 4AQYQ 1DYQA 1L1OC 3OYYA 4XQQA 1R9TH 4J15A 1DOLA 1OO9B 2K5DA 5D65A 3S1NH 1I6HH 2X6LA 1D5XC 1VMCA 3AB9A 4RA8A 2QW7A 1VDZA 1JCKB 5JJZA 3CQZB 4A4IA 4IPDA 4KHVA 2JA5H 2C5CA 1LUZA 3LX0A 1Y14B 3PUWA 3I72A 3TEHB 1FVIA 4IALA 4IUTA 2KEEA 3BDLA 3R2TA 2F0IA 2G5DA 2RA4A 4JI1L 4ZQ3A 3RLFA 1S40A 4F88A 2WKDA 1EY9A 3GV3A 1Y8NB 2P5ZX 1PH1A 2E5LL 1L1OB 3KF6B 1QE6A 1NE3A 4DU9A 3S1QB 3BDOA 1U4PA 2E75C 3J7AV 4JI7Q 2Y0SE 2SNMA 4A3MG 2I0QA 4HJ9A 4RH6A 3TRZA 1VQ5A 3GTLB 2HIXA 2TMPA 4JI4L 4GN4B 5C4XG 1IL2A 1RTOA 4GS3A 3Q24A 4TRDA 3PO2H 1K0RA 3HKSA 1WCMH 1HZBA 4C56C 1JJ2A 2R92H 4J6HA 1BCPD 3P75A 1SRUA 2ES2A 5E7NA 4A3EH 2O2LD 2CKZB 5M5YH 2F0MA 4B08A 2UU9L 3HKZE 4G7HC 4B3RQ 4HJ5A 1AN8A 4KK7A 4HN7A 1F9RA 3VR3A 1B44D 2VZAA 4OX9Q 1VQ4A 2FHTA 3STBC 2QILA 2JA6B 4C3HH 1EFID 1LO5D 3NBHB 1YHAA 2QKIC 2B8FA 4JI3Q 1F2MA 1GUNA 5C44H 4DPGA 4A3MB 3IFTA 1VQPA 5JJIA 4CDFC 2JA8G 1PTOF 3NTHA 2K14A 4JVZA 4CJ2C 1Y8PB 5E4XA 2NUCA 1VF5C 3QJYA 5C4XB 4AYBB 4DAMA 4YIJA 1D5MC 2A8VA 2NVXB 5AJ3L 1E22A 2XGTA 1ZYRC
chains in the Genus database with same CATH topology
2KHJA 1Y1VG 2BA0A 4A3IG 2VQEQ 4NXNL 1SR3A 4BA2I 1TWFH 3GTGH 1VQFA 5GQOA 1IBLL 2OTJA 5LMNQ 2ZM6Q 3PIPA 1G51A 5H1SE 5FLMH 4BBSG 4O2DA 3ULPA 5M5XH 2UXDQ 3EBEA 1DGSA 5AJ3Q 3KF8B 1MJCA 3OTOQ 4C3IH 1CKNA 3I56A 2RF4A 5C4JH 4NXNQ 3EN2A 1CKOA 3KDFA 1IBML 2BH8A 4MTNA 4P71A 1LTLA 3H15A 2B63G 2PI2A 1KC8C 1MJEA 2NZHA 1IBLQ 2BH2A 1XNRL 3CD6A 2Z6KC 4DUYL 3CPWA 2WB1E 3TS0A 1X54A 1PFSA 2N78A 1Q86C 1Q82C 3UE0A 3JAMc 3STBD 1VQDA 3A74A 4LWCA 1VQMA 1YNXA 4IPHA 1HZCA 2JA5G 5LMNW 1IBMQ 1X55A 1N33L 3IRBA 1XNRQ 4GLXA 4DUYQ 3OW2A 3AQQA 4GN5A 3ZJYC 4IFDJ 1C0AA 5C0XJ 4IPGA 2OQ0A 1JT8A 1JJCB 1N9WA 1SROA 4UPAA 1XMQQ 1I5FA 2PNHA 2ZJQA 1AH9A 2NVYH 4LF7L 3TREA 3VDYA 2R7ZG 1E1TA 3U58A 4LF6L 3KLWA 1GD7A 1N33Q 4OXPA 2WAQG 4DR5L 3UE1A 5IP7G 1PHJA 4PZ6A 5JJKA 4UY8C 4PMWA 2F4VL 2Z6KA 3F2CA 2R7ZH 3S1RH 4OWTB 4OWWB 1FL0A 1QUQB 3BZCA 2ZJRA 1GM5A 1HNZL 2ZTEA 1UEBA 4LF7Q 3S1QH 3HOZH 4LF6Q 5IP7H 2WFWA 3NENA 4TVAB 3CCUA 1VQBA 1BKBA 2F52A 4MZ9A 3PO3H 4JC0A 4X64L 4DR5Q 3JC66 1UWVA 2F4VQ 2KCMA 4PZ7A 5JJLA 5IYBH 3CAMA 4L5QA 4IPCA 4ALPA 5J3BA 3E9IA 4APVA 5JEAG 3GTLH 3FKIG 4FDBA 1XJVA 4JI5L 4A93G 3M9BA 4DV7L 1HNZQ 2EIFA 1VQ8A 1NBWA 2IT1A 2EXDA 3I4OA 4IOAA 2Z0SA 2R7DA 2RHQB 4A3FH 4C2MH 3ER0A 4X64Q 3J7ZC 2UXBL 1HJPA 2K50A 2YTXA 3A5ZB 4LF5L 4A3JG 1PH8A 1U5KA 4JI5Q 2UXCL 2NN6G 3CCVA 4DV7Q 4A3KH 3CMEA 1VQOA 3ICEA 4DR7L 1YHQA 2AWOA 1BVSA 4IO9A 4B3SL 2D0OA 4JYAL 1J5EL 4IFDI 2CWAA 1GVPA 5C0XI 4JI2L 3FHWA 2JA9A 1VQHA 4KHZA 1CSPA 4KLKA 3K80C 3CCEA 1L2FA 3HOVG 1UE1A 4EX5A 3M85A 2UXBQ 1QVGA 1PA6A 3HOYG 1KQSA 2AHOB 4DK3C 4LF5Q 1W3SA 3G48A 5M3MG 3WWVA 2UXCQ 2E8GA 2JA6H 1C9OA 1G6PA 3F1ZA 1A0IA 3F2DA 4DR7Q 1S72A 1K73C 4B3SQ 1XNQL 3PUVA 1J5EQ 1Z47A 4JOIC 1CUKA 3NEMA 4JI2Q 2VNUD 5GADC 1HZAA 3HOYH 2LXJA 5M3MH 3H3VH 1N8RC 4X6AH 1QZHA 2K5NA 3GDEA 1MKHA 1YJNA 1VQKA 4GNXC 4DKAC 3GTKH 3A5UA 1M1KC 2L15A 1I94L 1KAWA 1D7QA 1XNQQ 1JJGA 1VS0A 1YIJA 2VUMG 2MFIA 4BY1G 4A3DG 2NVQH 2R93G 1B70B 1V1QA 4QL5A 4L5SA 2NVXH 4A3BH 1Q1BA 4DUZL 3GTJH 1OXVA 4YCVA 3F8TA 5FLXc 4BY1H 4A3DH 1I94Q 4IJLA 3S15H 4NB3A 4LF8L 2IX0A 1TWHH 3E0EA 5K36G 4XIGS 2PI2E 3HOWG 2OCEA 1RIPA 1SFOH 4DV2L 1KHIA 4JOIA 2AKWB 5FLMG 4DUZQ 1KXLA 1HNXL 4RG1A 2R6GA 3I4MG 1T9HA 2GVAA 2MO1A 3CC7A 3HOWH 4GNXA 4LF8Q 1YI2A 2K4KA 4R4QA 4DV5L 4A75A 3I4MH 1SMXA 4DV2Q 4YWLA 4LUOA 1E1OA 3CF5A 4KHPL 3FP9A 1X6OA 1YHBA 1VQ9A 1PH2A 1GKHA 2K5HA 2VW9A 5IYCG 3RNUA 4B3ML 1XTDA 3KJPA 1FJGL 1YVCA 1AE3A 4HJAA 1PYSB 1CKNB 2HQLA 2Q2HA 1Q46A 3KOJA 4DV5Q 3CW2C 3CQZH 4QIWE 1Q81C 1EOVA 3KDFB 3S1MH 3S24A 1WYDA 4KHPQ 2VS1A 1NMFA 2N3SA 3RLOA 5IYCH 2D62A 2MQHA 1OXTA 1YITA 1RL2A 1E7ZA 4A3CH 2UUCL 3GTMH 4YHHL 4DV0L 4B3MQ 1QVFA 1NTGA 4DV1L 1PYBA 2R7FA 3UDGA 1FJGQ 5IYDH 3T1YL 2YTYA 3HOXG 1OXUA 2YYZA 4TQUS 3UDFA 1VQJA 1A63A 1MIUA 1YJWA 3J81i 1JMCA 4JI6L 2K75A 2I5LX 1N34L 1EIYB 3PIOA 3BU2A 2HHHL 1VQGA 4BBRG 5IE8A 4P72A 5HGQA 4OO1G 2UUCQ 3HOXH 1LM0A 1K9MC 4YHHQ 2MNAA 5M3FH 4DV0Q 3HOZG 4DV1Q 3U4ZA 4HIMA 3T1YQ 4XTCS 2EQSA 4OWXB 3PO3G 1QZGA 4BBRH 4JI6Q 4JG2A 4GLAC 3W1BA 5IYBG 4DV6L 1N34Q 5DLQE 4AIMA 1KIXA 1JE5A 2BA1A 2D0PA 2HHHQ 2C35B 4LNQA 4GOPA 3ULLA 2YTVA 2WAQE 2DUDA 3PF4A 1B8AA 3CCSA 1ASYA 4JBMA 4A3FG 2E2IH 3GO5A 1UE7A 1I50H 1Q1EA 3I2ZA 1KD1C 1KL9A 4DV6Q 3AEVA 2V1CC 3W1GA 2CWPA 4B3TL 4BA1I 3I55A 5BR8L 3CCJA 2JE6I 4A3KG 2GVBA 4DR2L 1QVCA 1E24A 2F3IA 4JV5L 2I5MX 4R1JA 1L1OA 1SN8A 3KF6A 4UP7A 3MEFA 5IP9H 2CCZA 3K8AA 1PH5A 2OQKA 1EUJA 3SGIA 1TWAH 1CKMA 3KJOA 2Y0SG 3CC2A 4B3TQ 5BR8Q 3RN2A 1X3GA 5LMUL 3M4PA 3G6EA 2JA6G 4YY3L 4DR2Q 1WJJA 1Q7YC 3M4OH 3D0FA 4HJ8A 4JV5Q 2QEXA 1SLJA 1UE6A 1UE5A 3MXNB 3G71A 2B3GA 5HY6A 4WJ4A 1H95A 2HT1A 2ZTDA 3TQYA 3GTPH 3J80c 3M3YH 3ULJA 4R4CA 3KYHC 1X65A 2JEAI 4A3GG 5LMUQ 3F2BA 4JYAQ 3J81j 2HIVA 4YY3Q 1X9NA 1VQIA 1NMGA 3A0JA 5JEAJ 3J7A5 4A3LH 4AYBG 4A3MH 3PGZA 1I3QH 4BXXG 4LF4L 3RN5A 4GKJL 1FGUA 1EWIA 4GLVB 4A3GH 4A3BG 4WJ3M 4QGUA 3K81C 3HKZG 4DR6L 3TS2A 4QJFA 4DR1L 4UP8A 3GTOH 4X62L 1VQNA 5C4XH 3S2HH 4LFCL 4LFBL 1EYGA 4JBWA 2CQOA 3PCOB 4BXXH 1PVOA 3M4QA 1WFQA 1O7IA 4H02A 2IHEA 4LF4Q 2ZTCA 1Z9FA 4GKJQ 4R4IA 2KHIA 4DR3L 2OWOA 4DR6Q 4DR1Q 3RLNA 4X62Q 2KENA 3I7FA 4LFCQ 2MO0A 4LFBQ 4HIDA 5IWAL 4GKKL 1P16A 2K52A 2RCNA 1EIFA 2YV5A 3CC4A 3HFZB 2UUBL 3PV0A 4OO1I 1HNWL 4NXML 2ZJPA 1IXRA 2RHSB 3E9HA 4HIKA 2JK8A 1K8GA 4Y52H 4BY7H 2H5XA 4DR3Q 1IBKL 2KBNA 2OTLA 5ELOA 1EQRA 1XPOA 4K0KL 5GAGC 4YCWA 1OXXK 1JB7A 5IWAQ 4AH6A 1OTCA 4GKKQ 3GTQH 2IY5B 1IYJB 1M90C 2UUBQ 4GNXB 1HNXQ 3CCRA 1HNWQ 2PQAA 5LMNL 1B7YB 4NXMQ 5IY0A 5GAHC 1CSQA 1VQCA 1PH9A 4LUZA 1PV4A 1IBKQ 1TXYA 3RZDH 4R4TA 2JA7H 1NJIC 4IFDG 5C0XG 4K0KQ 1EQQA 4A3CG 2XTIA 2PQAB 4LFAL 4NPSA 5IYDG 2N8NA 2Q2TA 1X3FA 4ME3A 4GOPC 3U4VA 1K83H 2I5HA 3JAMi 1YZ6A 5ELNA 4JCVE 1YBYA 2VY3A 3UDXA 4AQYL 2WB1G 5GROA 1Y1VH 4A3IH 3S17H 1WI5A 1P8LA 4LUVA 3RR5A 1D8LA 4Y7NH 4LFAQ 3PUZA 4JI0L 2NN6I 5M3FG 1KRTA 1W2BA 3PUXA 4JBJA 4PG3A 4L5TA 5C3EG 1PH6A 1PH3A 3AFQA 4BBSH 1WOCA 1BBWA 3BJUA 4KI0A 3DLLA 2N49A 1YEZA 1OXSC 2AMCB 2E2HH 4AQYQ 3L7ZC 1L1OC 3OYYA 1R9TH 2Q2IA 5C3EH 1XMQL 2YU9H 4POGA 1LYLA 4J15A 2B63H 3H3VI 2AWNA 4JI0Q 2IHFA 2VQFL 4QQBX 2A19A 1Q8KA 3KFUA 4X65L 3S1NH 1I6HH 3BZKA 2ATWA 4P74A 1C7YA 3PF5A 4GN3B 4DV3L 3J81c 4A4IA 1A8VA 4IPDA 2QGQA 4MNOA 1Y1WG 2JA5H 4L5RC 2CFMA 1K8AC 1VQEA 2PMZE 1LUZA 1XPRA 2VQFQ 4GOPB 2Q2UA 3CCMA 1Y14B 1EFWA 3PUWA 1QUQA 4X65Q 3CCQA 1XPUA 1BBUA 3K0XA 5IT9c 3CMAA 1V9PA 3TEHB 1FVIA 4DAYB 5IP9G 1Y1WH 3Q8DA 2ID0A 4DV4L 3S2DH 4O0AA 2WP8J 4DV3Q 1XMOL 2ASBA 4JI1L 3S16H 1HR0L 1YJ9A 3RLFA 4IJHA 1S40A 1S3OA 3HOUG 4BY7G 1SE8A 5EAYA 3PSIA 4UP9A 3G4SA 2JJQA 1VQLA 1PH4A 4JI7L 4JI8L 1PH1A 4YWKA 2E5LL 1N36L 2B29A 3HOUH 2ALYB 4LW1A 1E3PA 1U0LA 3EIVA 2QA4A 1L1OB 3KF6B 4DV4Q 2VL6A 4P73A 4JI1Q 1XMOQ 1HR0Q 3RZOH 1NE3A 4YCUA 1IZ6A 1TWGH 1KRSA 4HIOA 1PH7A 3CP0A 3NELA 3D31A 2GN5A 4A3LG 4JI7Q 2Y0SE 4JI8Q 4A3MG 2I0QA 2E5LQ 1N36Q 1HH2P 1L0WA 4RMFA 1GO3E 2A1AA 3AFPA 1VQAA 5FJ8G 3FKIH 3J80i 1N32L 4A93H 2DGYA 4HJ9A 3PO2G 3TRZA 1Q12A 1VQ5A 1A62A 2HIXA 1NY4A 4LF9L 1WCMG 4JI4L 3S14H 4GN4B 5C4XG 3K7UC 4DK6C 3LGJA 2R92G 3DM3A 1IL2A 1X3EA 5FJ8H 4GS3A 3W5OA 4B3RL 1V43A 3K7AH 4A3EG 3PO2H 1K0RA 3ERSX 1HR0W 4A3JH 1N32Q 3HKSA 1WCMH 2NZOA 4OX9L 1HZBA 2UUAL 5M5WH 1JJ2A 2R92H 3T1HL 1TWCH 2ES2A 4AYBE 1SRUA 4LF9Q 4JI4Q 4R4OA 2NVTH 2K5VA 5E7NA 2JEBI 4A3EH 2CKZB 2JQOA 1J6QA 1AE2A 5M5YH 4JI3L 2UU9L 3HOVH 3HKZE 3GD7A 3CXCA 1VQ7A 4HJ5A 4B3RQ 3U50C 2IX1A 1HZ9A 1K3RA 2FXQA 3H0GG 2VZAA 4OX9Q 2UUAQ 4DR4L 3T1HQ 5C44G 4IOCA 1VQ4A 3STBC 4C3JH 5GAEC 4JBKA 4C3HH 3NBHB 3B6YA 1YHAA 4X66L 3M7NA 3CCLA 3CPFA 2UU9Q 3L0OA 4JI3Q 3H0GH 4P75A 1ASZA 4DNIA 5C44H 4DPGA 3L2PA 4QY7A 4DR4Q 2VQEL 2LSSA 3UDIA 1VQPA 5JJIA 2JA7G 4OONA 2JA8G 1VQ6A 2VUMH 3I4NG 2R93H 2K14A 2KCTA 3PUYA 4PZ8A 4EQ5A 4X66Q 2ZM6L 4A76A 1G291 2E2JH 4DAMA 3AYHB 2A8VA 4HJ7A 2LXKA 4POFA 1VCIA 2UXDL 5AJ3L 1E22A 2XGTA 2JA8H 4YWMA 3OTOL 3I4NH 1X56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHJ A;  1Y1V G;  2BA0 A;  4A3I G;  2VQE Q;  4NXN L;  1SR3 A;  4BA2 I;  1TWF H;  3GTG H;  1VQF A;  5GQO A;  1IBL L;  2OTJ A;  5LMN Q;  2ZM6 Q;  3PIP A;  1G51 A;  5H1S E;  5FLM H;  4BBS G;  4O2D A;  3ULP A;  5M5X H;  2UXD Q;  3EBE A;  1DGS A;  5AJ3 Q;  3KF8 B;  1MJC A;  3OTO Q;  4C3I H;  1CKN A;  3I56 A;  2RF4 A;  5C4J H;  4NXN Q;  3EN2 A;  1CKO A;  3KDF A;  1IBM L;  2BH8 A;  4MTN A;  4P71 A;  1LTL A;  3H15 A;  2B63 G;  2PI2 A;  1KC8 C;  1MJE A;  2NZH A;  1IBL Q;  2BH2 A;  1XNR L;  3CD6 A;  2Z6K C;  4DUY L;  3CPW A;  2WB1 E;  3TS0 A;  1X54 A;  1PFS A;  2N78 A;  1Q86 C;  1Q82 C;  3UE0 A;  3JAM c;  3STB D;  1VQD A;  3A74 A;  4LWC A;  1VQM A;  1YNX A;  4IPH A;  1HZC A;  2JA5 G;  5LMN W;  1IBM Q;  1X55 A;  1N33 L;  3IRB A;  1XNR Q;  4GLX A;  4DUY Q;  3OW2 A;  3AQQ A;  4GN5 A;  3ZJY C;  4IFD J;  1C0A A;  5C0X J;  4IPG A;  2OQ0 A;  1JT8 A;  1JJC B;  1N9W A;  1SRO A;  4UPA A;  1XMQ Q;  1I5F A;  2PNH A;  2ZJQ A;  1AH9 A;  2NVY H;  4LF7 L;  3TRE A;  3VDY A;  2R7Z G;  1E1T A;  3U58 A;  4LF6 L;  3KLW A;  1GD7 A;  1N33 Q;  4OXP A;  2WAQ G;  4DR5 L;  3UE1 A;  5IP7 G;  1PHJ A;  4PZ6 A;  5JJK A;  4UY8 C;  4PMW A;  2F4V L;  2Z6K A;  3F2C A;  2R7Z H;  3S1R H;  4OWT B;  4OWW B;  1FL0 A;  1QUQ B;  3BZC A;  2ZJR A;  1GM5 A;  1HNZ L;  2ZTE A;  1UEB A;  4LF7 Q;  3S1Q H;  3HOZ H;  4LF6 Q;  5IP7 H;  2WFW A;  3NEN A;  4TVA B;  3CCU A;  1VQB A;  1BKB A;  2F52 A;  4MZ9 A;  3PO3 H;  4JC0 A;  4X64 L;  4DR5 Q;  3JC6 6;  1UWV A;  2F4V Q;  2KCM A;  4PZ7 A;  5JJL A;  5IYB H;  3CAM A;  4L5Q A;  4IPC A;  4ALP A;  5J3B A;  3E9I A;  4APV A;  5JEA G;  3GTL H;  3FKI G;  4FDB A;  1XJV A;  4JI5 L;  4A93 G;  3M9B A;  4DV7 L;  1HNZ Q;  2EIF A;  1VQ8 A;  1NBW A;  2IT1 A;  2EXD A;  3I4O A;  4IOA A;  2Z0S A;  2R7D A;  2RHQ B;  4A3F H;  4C2M H;  3ER0 A;  4X64 Q;  3J7Z C;  2UXB L;  1HJP A;  2K50 A;  2YTX A;  3A5Z B;  4LF5 L;  4A3J G;  1PH8 A;  1U5K A;  4JI5 Q;  2UXC L;  2NN6 G;  3CCV A;  4DV7 Q;  4A3K H;  3CME A;  1VQO A;  3ICE A;  4DR7 L;  1YHQ A;  2AWO A;  1BVS A;  4IO9 A;  4B3S L;  2D0O A;  4JYA L;  1J5E L;  4IFD I;  2CWA A;  1GVP A;  5C0X I;  4JI2 L;  3FHW A;  2JA9 A;  1VQH A;  4KHZ A;  1CSP A;  4KLK A;  3K80 C;  3CCE A;  1L2F A;  3HOV G;  1UE1 A;  4EX5 A;  3M85 A;  2UXB Q;  1QVG A;  1PA6 A;  3HOY G;  1KQS A;  2AHO B;  4DK3 C;  4LF5 Q;  1W3S A;  3G48 A;  5M3M G;  3WWV A;  2UXC Q;  2E8G A;  2JA6 H;  1C9O A;  1G6P A;  3F1Z A;  1A0I A;  3F2D A;  4DR7 Q;  1S72 A;  1K73 C;  4B3S Q;  1XNQ L;  3PUV A;  1J5E Q;  1Z47 A;  4JOI C;  1CUK A;  3NEM A;  4JI2 Q;  2VNU D;  5GAD C;  1HZA A;  3HOY H;  2LXJ A;  5M3M H;  3H3V H;  1N8R C;  4X6A H;  1QZH A;  2K5N A;  3GDE A;  1MKH A;  1YJN A;  1VQK A;  4GNX C;  4DKA C;  3GTK H;  3A5U A;  1M1K C;  2L15 A;  1I94 L;  1KAW A;  1D7Q A;  1XNQ Q;  1JJG A;  1VS0 A;  1YIJ A;  2VUM G;  2MFI A;  4BY1 G;  4A3D G;  2NVQ H;  2R93 G;  1B70 B;  1V1Q A;  4QL5 A;  4L5S A;  2NVX H;  4A3B H;  1Q1B A;  4DUZ L;  3GTJ H;  1OXV A;  4YCV A;  3F8T A;  5FLX c;  4BY1 H;  4A3D H;  1I94 Q;  4IJL A;  3S15 H;  4NB3 A;  4LF8 L;  2IX0 A;  1TWH H;  3E0E A;  5K36 G;  4XIG S;  2PI2 E;  3HOW G;  2OCE A;  1RIP A;  1SFO H;  4DV2 L;  1KHI A;  4JOI A;  2AKW B;  5FLM G;  4DUZ Q;  1KXL A;  1HNX L;  4RG1 A;  2R6G A;  3I4M G;  1T9H A;  2GVA A;  2MO1 A;  3CC7 A;  3HOW H;  4GNX A;  4LF8 Q;  1YI2 A;  2K4K A;  4R4Q A;  4DV5 L;  4A75 A;  3I4M H;  1SMX A;  4DV2 Q;  4YWL A;  4LUO A;  1E1O A;  3CF5 A;  4KHP L;  3FP9 A;  1X6O A;  1YHB A;  1VQ9 A;  1PH2 A;  1GKH A;  2K5H A;  2VW9 A;  5IYC G;  3RNU A;  4B3M L;  1XTD A;  3KJP A;  1FJG L;  1YVC A;  1AE3 A;  4HJA A;  1PYS B;  1CKN B;  2HQL A;  2Q2H A;  1Q46 A;  3KOJ A;  4DV5 Q;  3CW2 C;  3CQZ H;  4QIW E;  1Q81 C;  1EOV A;  3KDF B;  3S1M H;  3S24 A;  1WYD A;  4KHP Q;  2VS1 A;  1NMF A;  2N3S A;  3RLO A;  5IYC H;  2D62 A;  2MQH A;  1OXT A;  1YIT A;  1RL2 A;  1E7Z A;  4A3C H;  2UUC L;  3GTM H;  4YHH L;  4DV0 L;  4B3M Q;  1QVF A;  1NTG A;  4DV1 L;  1PYB A;  2R7F A;  3UDG A;  1FJG Q;  5IYD H;  3T1Y L;  2YTY A;  3HOX G;  1OXU A;  2YYZ A;  4TQU S;  3UDF A;  1VQJ A;  1A63 A;  1MIU A;  1YJW A;  3J81 i;  1JMC A;  4JI6 L;  2K75 A;  2I5L X;  1N34 L;  1EIY B;  3PIO A;  3BU2 A;  2HHH L;  1VQG A;  4BBR G;  5IE8 A;  4P72 A;  5HGQ A;  4OO1 G;  2UUC Q;  3HOX H;  1LM0 A;  1K9M C;  4YHH Q;  2MNA A;  5M3F H;  4DV0 Q;  3HOZ G;  4DV1 Q;  3U4Z A;  4HIM A;  3T1Y Q;  4XTC S;  2EQS A;  4OWX B;  3PO3 G;  1QZG A;  4BBR H;  4JI6 Q;  4JG2 A;  4GLA C;  3W1B A;  5IYB G;  4DV6 L;  1N34 Q;  5DLQ E;  4AIM A;  1KIX A;  1JE5 A;  2BA1 A;  2D0P A;  2HHH Q;  2C35 B;  4LNQ A;  4GOP A;  3ULL A;  2YTV A;  2WAQ E;  2DUD A;  3PF4 A;  1B8A A;  3CCS A;  1ASY A;  4JBM A;  4A3F G;  2E2I H;  3GO5 A;  1UE7 A;  1I50 H;  1Q1E A;  3I2Z A;  1KD1 C;  1KL9 A;  4DV6 Q;  3AEV A;  2V1C C;  3W1G A;  2CWP A;  4B3T L;  4BA1 I;  3I55 A;  5BR8 L;  3CCJ A;  2JE6 I;  4A3K G;  2GVB A;  4DR2 L;  1QVC A;  1E24 A;  2F3I A;  4JV5 L;  2I5M X;  4R1J A;  1L1O A;  1SN8 A;  3KF6 A;  4UP7 A;  3MEF A;  5IP9 H;  2CCZ A;  3K8A A;  1PH5 A;  2OQK A;  1EUJ A;  3SGI A;  1TWA H;  1CKM A;  3KJO A;  2Y0S G;  3CC2 A;  4B3T Q;  5BR8 Q;  3RN2 A;  1X3G A;  5LMU L;  3M4P A;  3G6E A;  2JA6 G;  4YY3 L;  4DR2 Q;  1WJJ A;  1Q7Y C;  3M4O H;  3D0F A;  4HJ8 A;  4JV5 Q;  2QEX A;  1SLJ A;  1UE6 A;  1UE5 A;  3MXN B;  3G71 A;  2B3G A;  5HY6 A;  4WJ4 A;  1H95 A;  2HT1 A;  2ZTD A;  3TQY A;  3GTP H;  3J80 c;  3M3Y H;  3ULJ A;  4R4C A;  3KYH C;  1X65 A;  2JEA I;  4A3G G;  5LMU Q;  3F2B A;  4JYA Q;  3J81 j;  2HIV A;  4YY3 Q;  1X9N A;  1VQI A;  1NMG A;  3A0J A;  5JEA J;  3J7A 5;  4A3L H;  4AYB G;  4A3M H;  3PGZ A;  1I3Q H;  4BXX G;  4LF4 L;  3RN5 A;  4GKJ L;  1FGU A;  1EWI A;  4GLV B;  4A3G H;  4A3B G;  4WJ3 M;  4QGU A;  3K81 C;  3HKZ G;  4DR6 L;  3TS2 A;  4QJF A;  4DR1 L;  4UP8 A;  3GTO H;  4X62 L;  1VQN A;  5C4X H;  3S2H H;  4LFC L;  4LFB L;  1EYG A;  4JBW A;  2CQO A;  3PCO B;  4BXX H;  1PVO A;  3M4Q A;  1WFQ A;  1O7I A;  4H02 A;  2IHE A;  4LF4 Q;  2ZTC A;  1Z9F A;  4GKJ Q;  4R4I A;  2KHI A;  4DR3 L;  2OWO A;  4DR6 Q;  4DR1 Q;  3RLN A;  4X62 Q;  2KEN A;  3I7F A;  4LFC Q;  2MO0 A;  4LFB Q;  4HID A;  5IWA L;  4GKK L;  1P16 A;  2K52 A;  2RCN A;  1EIF A;  2YV5 A;  3CC4 A;  3HFZ B;  2UUB L;  3PV0 A;  4OO1 I;  1HNW L;  4NXM L;  2ZJP A;  1IXR A;  2RHS B;  3E9H A;  4HIK A;  2JK8 A;  1K8G A;  4Y52 H;  4BY7 H;  2H5X A;  4DR3 Q;  1IBK L;  2KBN A;  2OTL A;  5ELO A;  1EQR A;  1XPO A;  4K0K L;  5GAG C;  4YCW A;  1OXX K;  1JB7 A;  5IWA Q;  4AH6 A;  1OTC A;  4GKK Q;  3GTQ H;  2IY5 B;  1IYJ B;  1M90 C;  2UUB Q;  4GNX B;  1HNX Q;  3CCR A;  1HNW Q;  2PQA A;  5LMN L;  1B7Y B;  4NXM Q;  5IY0 A;  5GAH C;  1CSQ A;  1VQC A;  1PH9 A;  4LUZ A;  1PV4 A;  1IBK Q;  1TXY A;  3RZD H;  4R4T A;  2JA7 H;  1NJI C;  4IFD G;  5C0X G;  4K0K Q;  1EQQ A;  4A3C G;  2XTI A;  2PQA B;  4LFA L;  4NPS A;  5IYD G;  2N8N A;  2Q2T A;  1X3F A;  4ME3 A;  4GOP C;  3U4V A;  1K83 H;  2I5H A;  3JAM i;  1YZ6 A;  5ELN A;  4JCV E;  1YBY A;  2VY3 A;  3UDX A;  4AQY L;  2WB1 G;  5GRO A;  1Y1V H;  4A3I H;  3S17 H;  1WI5 A;  1P8L A;  4LUV A;  3RR5 A;  1D8L A;  4Y7N H;  4LFA Q;  3PUZ A;  4JI0 L;  2NN6 I;  5M3F G;  1KRT A;  1W2B A;  3PUX A;  4JBJ A;  4PG3 A;  4L5T A;  5C3E G;  1PH6 A;  1PH3 A;  3AFQ A;  4BBS H;  1WOC A;  1BBW A;  3BJU A;  4KI0 A;  3DLL A;  2N49 A;  1YEZ A;  1OXS C;  2AMC B;  2E2H H;  4AQY Q;  3L7Z C;  1L1O C;  3OYY A;  1R9T H;  2Q2I A;  5C3E H;  1XMQ L;  2YU9 H;  4POG A;  1LYL A;  4J15 A;  2B63 H;  3H3V I;  2AWN A;  4JI0 Q;  2IHF A;  2VQF L;  4QQB X;  2A19 A;  1Q8K A;  3KFU A;  4X65 L;  3S1N H;  1I6H H;  3BZK A;  2ATW A;  4P74 A;  1C7Y A;  3PF5 A;  4GN3 B;  4DV3 L;  3J81 c;  4A4I A;  1A8V A;  4IPD A;  2QGQ A;  4MNO A;  1Y1W G;  2JA5 H;  4L5R C;  2CFM A;  1K8A C;  1VQE A;  2PMZ E;  1LUZ A;  1XPR A;  2VQF Q;  4GOP B;  2Q2U A;  3CCM A;  1Y14 B;  1EFW A;  3PUW A;  1QUQ A;  4X65 Q;  3CCQ A;  1XPU A;  1BBU A;  3K0X A;  5IT9 c;  3CMA A;  1V9P A;  3TEH B;  1FVI A;  4DAY B;  5IP9 G;  1Y1W H;  3Q8D A;  2ID0 A;  4DV4 L;  3S2D H;  4O0A A;  2WP8 J;  4DV3 Q;  1XMO L;  2ASB A;  4JI1 L;  3S16 H;  1HR0 L;  1YJ9 A;  3RLF A;  4IJH A;  1S40 A;  1S3O A;  3HOU G;  4BY7 G;  1SE8 A;  5EAY A;  3PSI A;  4UP9 A;  3G4S A;  2JJQ A;  1VQL A;  1PH4 A;  4JI7 L;  4JI8 L;  1PH1 A;  4YWK A;  2E5L L;  1N36 L;  2B29 A;  3HOU H;  2ALY B;  4LW1 A;  1E3P A;  1U0L A;  3EIV A;  2QA4 A;  1L1O B;  3KF6 B;  4DV4 Q;  2VL6 A;  4P73 A;  4JI1 Q;  1XMO Q;  1HR0 Q;  3RZO H;  1NE3 A;  4YCU A;  1IZ6 A;  1TWG H;  1KRS A;  4HIO A;  1PH7 A;  3CP0 A;  3NEL A;  3D31 A;  2GN5 A;  4A3L G;  4JI7 Q;  2Y0S E;  4JI8 Q;  4A3M G;  2I0Q A;  2E5L Q;  1N36 Q;  1HH2 P;  1L0W A;  4RMF A;  1GO3 E;  2A1A A;  3AFP A;  1VQA A;  5FJ8 G;  3FKI H;  3J80 i;  1N32 L;  4A93 H;  2DGY A;  4HJ9 A;  3PO2 G;  3TRZ A;  1Q12 A;  1VQ5 A;  1A62 A;  2HIX A;  1NY4 A;  4LF9 L;  1WCM G;  4JI4 L;  3S14 H;  4GN4 B;  5C4X G;  3K7U C;  4DK6 C;  3LGJ A;  2R92 G;  3DM3 A;  1IL2 A;  1X3E A;  5FJ8 H;  4GS3 A;  3W5O A;  4B3R L;  1V43 A;  3K7A H;  4A3E G;  3PO2 H;  1K0R A;  3ERS X;  1HR0 W;  4A3J H;  1N32 Q;  3HKS A;  1WCM H;  2NZO A;  4OX9 L;  1HZB A;  2UUA L;  5M5W H;  1JJ2 A;  2R92 H;  3T1H L;  1TWC H;  2ES2 A;  4AYB E;  1SRU A;  4LF9 Q;  4JI4 Q;  4R4O A;  2NVT H;  2K5V A;  5E7N A;  2JEB I;  4A3E H;  2CKZ B;  2JQO A;  1J6Q A;  1AE2 A;  5M5Y H;  4JI3 L;  2UU9 L;  3HOV H;  3HKZ E;  3GD7 A;  3CXC A;  1VQ7 A;  4HJ5 A;  4B3R Q;  3U50 C;  2IX1 A;  1HZ9 A;  1K3R A;  2FXQ A;  3H0G G;  2VZA A;  4OX9 Q;  2UUA Q;  4DR4 L;  3T1H Q;  5C44 G;  4IOC A;  1VQ4 A;  3STB C;  4C3J H;  5GAE C;  4JBK A;  4C3H H;  3NBH B;  3B6Y A;  1YHA A;  4X66 L;  3M7N A;  3CCL A;  3CPF A;  2UU9 Q;  3L0O A;  4JI3 Q;  3H0G H;  4P75 A;  1ASZ A;  4DNI A;  5C44 H;  4DPG A;  3L2P A;  4QY7 A;  4DR4 Q;  2VQE L;  2LSS A;  3UDI A;  1VQP A;  5JJI A;  2JA7 G;  4OON A;  2JA8 G;  1VQ6 A;  2VUM H;  3I4N G;  2R93 H;  2K14 A;  2KCT A;  3PUY A;  4PZ8 A;  4EQ5 A;  4X66 Q;  2ZM6 L;  4A76 A;  1G29 1;  2E2J H;  4DAM A;  3AYH B;  2A8V A;  4HJ7 A;  2LXK A;  4POF A;  1VCI A;  2UXD L;  5AJ3 L;  1E22 A;  2XGT A;  2JA8 H;  4YWM A;  3OTO L;  3I4N H;  1X56 A; 
#chains in the Genus database with same CATH topology
 1Y1V G;  4DA2 A;  4NXN L;  2VQE Q;  1SR3 A;  1R4P B;  5IGF A;  4BA2 I;  1QWY A;  1TWF H;  4DAP A;  1IBL L;  1TWH B;  2ZM6 Q;  3PIP A;  2O4X A;  5D3D A;  2UXD Q;  3SK8 A;  1DGS A;  5A2Q L;  2PPB C;  2MP1 A;  3BDC A;  1CKN A;  2BCO A;  5C4J H;  2LS0 1;  3EN2 A;  3MZ5 A;  3VA7 A;  1JR0 D;  1IBM L;  1JWU D;  2BH8 A;  4P71 A;  3H15 A;  1KC8 C;  1MJE A;  2NZH A;  4QMG A;  1XNR L;  3CD6 A;  2Z6K C;  3CPW A;  2F0U A;  4V19 0;  3TS0 A;  5C3X A;  3JAM c;  1M4V A;  2ZXP A;  5I9O A;  3NTI A;  3DUZ A;  2KA7 A;  1U9R A;  1VQM A;  1YNX A;  4IPH A;  3MFY A;  5CC4 A;  1X55 A;  3G6J B;  3MXG A;  5C5M A;  2CVR A;  4GLX A;  1IW7 C;  3AQQ A;  3WOE A;  4IPG A;  1JJC B;  3Q0A A;  1N9W A;  2KOL A;  1AH9 A;  5FLX E;  4LF7 L;  3VDY A;  4KD4 A;  4X3K A;  1N33 Q;  4OXP A;  1Y1V B;  5LL6 S;  2J0T D;  1HXY D;  2A68 C;  4PMW A;  4DK1 A;  1FGB D;  3KLS A;  1FL0 A;  1KNE A;  4OO1 H;  4H0L C;  1HNZ L;  3J80 L;  4LF6 Q;  2WFW A;  3NEN A;  1CHQ D;  3CCU A;  1VQB A;  2E2H B;  3KLR A;  3D8G A;  1R4Q B;  5C3E B;  4UAI A;  1CT1 D;  2KCM A;  4PZ7 A;  5JJL A;  3CAM A;  4L5Q A;  2B2W C;  5J3B A;  3E9I A;  3EFX D;  3FKI G;  1NNX A;  1CQV A;  4DV7 L;  2EXD A;  5KGU A;  3ER0 A;  3J7Z C;  2UXB L;  3FPU B;  1I4Q A;  3QB3 A;  5CV5 A;  1NAP A;  5BN4 A;  4A3J G;  3BVM A;  1U5K A;  4A3K H;  3CCV A;  3CME A;  4DR7 L;  1STA A;  1Y1W B;  3BG3 A;  2D0O A;  3KBG A;  3EVQ A;  1SNM A;  2CWA A;  5C0X I;  1GXD C;  4KLK A;  2I46 A;  1L2F A;  4EX5 A;  2GA4 B;  1ROD A;  1ESF A;  1KQS A;  4LF5 Q;  3G48 A;  3CRK C;  1BQQ T;  1E2Z A;  3F1Z A;  1A0I A;  5NUC A;  2ZXO A;  1JC7 A;  3HOU B;  1QCB D;  3RZO B;  4JOI C;  1CUK A;  4JI2 Q;  3TP6 A;  5GAD C;  3HOY H;  3P20 A;  1N8R C;  1QZH A;  4HTH A;  3GDE A;  1XXG A;  1Y8O B;  1LT3 D;  3GTK H;  3SHL A;  4C1N I;  1KAW A;  1H9M A;  4CHT B;  4OGQ C;  2BE5 C;  1VS0 A;  1WD0 A;  2VUM G;  1B70 B;  3ONA B;  1H9S A;  3QG1 A;  4L5S A;  1SYB A;  1IKL A;  5D14 A;  3DM1 A;  1GHK A;  4YCV A;  3F8T A;  1LLR D;  3V05 A;  2FIN B;  3K7A B;  1I94 Q;  5K36 G;  2B2U A;  4A3J B;  1G2T A;  4XIG S;  2PI2 E;  3MFG A;  4RAU C;  4JK1 C;  1TQO A;  4RKL A;  1RIP A;  3FMC A;  1EWC A;  4K6L A;  4K8J A;  1B4O A;  1HNX L;  3X3N A;  1T9H A;  2GVA A;  3HOW H;  2Q8R E;  3IKJ A;  3RD4 A;  4OHJ A;  4DV5 L;  4A75 A;  1SMX A;  5KND A;  1QNU A;  1EY8 A;  2Z6B A;  3CF5 A;  3FP9 A;  4K14 A;  5T1G A;  1CM9 A;  4WOR A;  3H0G B;  2CW0 D;  4WJW A;  1GUO A;  1SXT A;  1YVC A;  1PYS B;  1CKN B;  2HQL A;  3KOJ A;  1Q46 A;  4QIW E;  3CQZ H;  1Q81 C;  1CHP D;  1FNW A;  2JN4 A;  2VS1 A;  1S5F D;  2D62 A;  2PCF B;  4IFD H;  1OXT A;  4RGN A;  5FK9 C;  3GTM H;  3Q6S A;  1SE3 A;  3TDQ A;  4DV0 L;  4B3M Q;  4DV1 L;  1FJG Q;  2JA7 B;  3I4N B;  3SE0 A;  3CKI B;  1A63 A;  1VQJ A;  1SYG A;  2F0F A;  2AQ3 B;  3J81 i;  4CKE A;  1N34 L;  3BU2 A;  5HGT A;  3KBX A;  4YHH Q;  3HOZ G;  3S17 B;  3U4Z A;  2A6H C;  4I65 A;  4DN4 M;  3PO3 G;  3QOJ A;  1EY0 A;  1F2Y A;  4JG2 A;  5IYB G;  1K3B C;  2BA1 A;  1ILP A;  2C35 B;  4GOP A;  3ULL A;  3SK4 A;  1SNC A;  1R9T B;  3CCS A;  4JBM A;  5I9P A;  1SMY D;  1KD1 C;  3S1N B;  1A2U A;  3W1G A;  2DJF C;  2DNE A;  1IL8 A;  2KHS A;  1K28 A;  4QCL A;  1QVC A;  1E24 A;  2JA5 B;  2F3I A;  4R1J A;  3C46 A;  3FPP A;  3K8A A;  3OSO A;  4ZUJ A;  4F8M A;  4IUU A;  1CKM A;  1LV9 A;  4B3T Q;  3DWA A;  1SND A;  2C9O A;  3T4A C;  5LMU L;  3G6E A;  5ELF A;  3S1R B;  3S9W A;  2QEX A;  2MJ8 A;  3MWY W;  1SLJ A;  1UE6 A;  4WJ4 A;  4Q5V A;  2B2U C;  2ZTD A;  3TQY A;  5I6Y A;  3J80 c;  1TII D;  1ENA A;  5DM7 3;  3F2B A;  3H3V C;  1HQM C;  3A0J A;  4A3M H;  4GLV B;  1KDC A;  1U4R A;  3I70 A;  1DZ1 A;  5C4X H;  4LFC L;  3CU7 A;  4JBW A;  1PVO A;  4K2K A;  3M4Q A;  1GJX A;  1I4P A;  2IHE A;  3NBI A;  1SAP A;  3SR1 A;  2HUG A;  1EIH A;  1P16 A;  1SEB D;  2K6A A;  2XWJ B;  2K52 A;  5LHY 1;  1W6K A;  2YV5 A;  2UUB L;  3A8I E;  5M5Y B;  4HIK A;  1G2S A;  2H5X A;  4DR3 Q;  2KBN A;  1HHV A;  4KJO A;  5JAV A;  1X32 A;  5IWA Q;  1OTC A;  1CA6 A;  2B2V C;  1HNX Q;  1HNW Q;  2PQA A;  5LMN L;  1UUP A;  4RCN A;  4BWG B;  2WAC A;  3KK7 A;  3MTS A;  1PV4 A;  1IBK Q;  2EJM A;  1F9Q A;  2QF7 A;  4K5X A;  1NJI C;  5C0X G;  1LT4 D;  5FO7 B;  2XRS D;  1X3F A;  1LTR D;  4ME3 A;  4GOP C;  2EZV A;  4A3D B;  3K58 A;  4B9X A;  1I4R A;  2WV6 D;  2KED A;  4ABN A;  1YBY A;  4AQY L;  1Y1V H;  2L11 A;  4LUV A;  3H6M A;  4B9W A;  1X3Q A;  3BYT B;  2EPB A;  2EY1 A;  4LFA Q;  2V4D A;  3PUZ A;  1W2B A;  1EU4 A;  1PH3 A;  4PG3 A;  4L5T A;  2DNC A;  1TWF B;  3AFQ A;  4HED A;  5EJW A;  2B2Y A;  2F0S A;  3KUP A;  1OXS C;  2AMC B;  5AFW A;  2E2H H;  3L7Z C;  4EQP A;  3I4M B;  5C3E H;  2F0W A;  4RWS C;  1XMQ L;  4POG A;  2R61 A;  4K5V A;  2IHF A;  2Z4I A;  4Q0F A;  1Q8K A;  3J7A F;  1EYC A;  3H91 A;  4J1M A;  3BZK A;  2ATW A;  4P74 A;  4ZKC B;  1CZG A;  3PF5 A;  2SEB D;  2CH4 A;  1A15 A;  3J81 c;  1KLU D;  2QGQ A;  4MNO A;  2D9U A;  4GOP B;  5CV7 A;  4X65 Q;  3K0X A;  4DAY B;  3S2D H;  1Y1W H;  3Q8D A;  2ID0 A;  4DV3 Q;  1YJ9 A;  1QB5 D;  4U68 A;  1EY7 A;  4BY7 G;  1M8A A;  1SE8 A;  5EAY A;  4UP9 A;  1VQL A;  2L0C A;  3M4Y A;  2AUK A;  3VR4 A;  4JI7 L;  1EZ8 A;  3CHB D;  4YWK A;  2ALY B;  3TBI B;  3EIV A;  4DV4 Q;  3A7A B;  2VL6 A;  3RZO H;  1HR0 Q;  2M9V A;  3A56 A;  4BBR B;  1KRS A;  5ELB A;  4P2C B;  4OEL B;  1PFB A;  1TS2 A;  3VYT A;  4NP5 A;  1N36 Q;  1VQA A;  5FJ8 G;  3FKI H;  1WTH A;  2E76 C;  2DGY A;  3JAM E;  1CTM A;  1RJT A;  4IUV A;  2HCI A;  3Q22 A;  1EZ6 A;  2OEO A;  1RKN A;  4B3R L;  5JPM C;  3O13 A;  3K7A H;  1MGS A;  2AUJ D;  3ERS X;  3HEJ A;  4A3J H;  3OW7 A;  1HR0 W;  1N32 Q;  4OX9 L;  1ZEQ X;  1FNU A;  5KYL A;  4LF9 Q;  1V1O A;  4A3K B;  5IT9 E;  1HPC A;  2H1E A;  3HZX A;  4JI3 L;  1MD2 D;  3K5L A;  3NBH A;  3U50 C;  1IKM A;  4KY5 A;  3LWE A;  1K3R A;  2G9D A;  2FXQ A;  4OL7 A;  1BF4 A;  3PMF A;  2UUA Q;  4KD3 A;  3DEP A;  5GAE C;  2FMC A;  3M7N A;  3CCL A;  3L0O A;  1D1I A;  3H0G H;  1YNJ D;  3L2P A;  4V0B A;  1I3Q B;  2VQE L;  2LSS A;  3UDI A;  3DWQ A;  1VQ6 A;  2VUM H;  4EQ5 A;  4PZ8 A;  1GUW A;  1EIG A;  2ZM6 L;  3GTO B;  4A76 A;  1CQF A;  1IYU A;  4N9P A;  3AYH B;  4UDU C;  2DN8 A;  1H9J A;  2LXK A;  1UNS A;  1VCI A;  4POF A;  2UXD L;  1DJR D;  3I4N H;  1X56 A;  3HKZ B;  5K36 H;  4C3I G;  5GQO A;  3PIP 3;  2OTJ A;  5LMN Q;  5KIX A;  1D5Z C;  4BBS G;  3ULP A;  4M8A A;  4PV1 C;  1SE2 A;  4L63 B;  5ELD A;  4FF3 A;  1BNZ A;  3OTO Q;  3I56 A;  3EQL C;  3K59 A;  1LTL A;  2B63 G;  2PI2 A;  2BH2 A;  5D3I B;  1PZK D;  1PFS A;  4EQN A;  3DMU A;  2N78 A;  1Q86 C;  1Q82 C;  3GTQ B;  3UE0 A;  2HCC A;  3STB D;  1VQD A;  1UEA B;  4MIU A;  5LMN W;  1F9S A;  1N33 L;  4PMB A;  2K04 A;  3ZJY C;  4IFD J;  2ENB A;  5EKL A;  1SRO A;  2F3V A;  1XMQ Q;  2ZJQ A;  2R7Z G;  5IOC A;  5M9O A;  3U58 A;  1WTO A;  4LF6 L;  2RDG A;  1RDP D;  3GTM B;  2KQ3 A;  2G9H D;  3UE1 A;  5JJK A;  3ERO A;  2DY8 A;  2Z6K A;  3F2C A;  2EY5 A;  3S1R H;  4OWT B;  3BZC A;  2ZJR A;  1GM5 A;  2XRQ D;  2K03 A;  3HOZ H;  3NHH A;  3T13 A;  4U67 3;  5IP7 H;  1LAB A;  1A2T A;  1BKB A;  2F52 A;  5C5L A;  5CMD A;  3PO3 H;  1LTI D;  4DR5 Q;  1UWV A;  2A69 C;  5IYB H;  4IPC A;  4DNT B;  4ALP A;  4APV A;  4DK0 A;  5JEA G;  1XJV A;  4A93 G;  1BXT A;  2EIF A;  1VQ8 A;  1NBW A;  4IUR A;  5I6W A;  4C2M H;  3CRL C;  4QF4 A;  3C1E A;  3I90 A;  2K50 A;  2YTX A;  3NQT A;  2EDG A;  4LF5 L;  2K7V A;  4JI5 Q;  1J8I A;  3MXN A;  1IW7 D;  3S16 B;  1G6Z A;  1Q8I A;  1GVP A;  4JI2 L;  1YNN C;  3CCE A;  1CSP A;  2NBF A;  3HOV G;  3M85 A;  2NN6 H;  2AHO B;  4DK3 C;  5IGD A;  5M3M G;  3WWV A;  1C9O A;  2B2W A;  1G6P A;  1SE4 A;  1O7Y A;  3DHQ A;  3F2D A;  1STB A;  1K73 C;  4B3S Q;  4C3J G;  1J5E Q;  3FVQ A;  2A68 D;  4RHS A;  3I8Z A;  1TWG B;  1A3V A;  3H3V H;  5A2Q E;  5FOB B;  3HS0 C;  4GNX C;  1KAA A;  1I94 L;  1XNQ Q;  4RGT A;  1JQY D;  4BY1 G;  1PRT F;  2R93 G;  5TSS A;  2F4I A;  3U9O A;  1C4Q A;  2B8G A;  1RHP A;  1Q1B A;  1OXV A;  4FP5 D;  2L55 A;  1B1Z A;  1KDB A;  4Z9C B;  4A3D H;  2X69 A;  5M5W B;  2F0K A;  1TWC B;  4C1N K;  1KHI A;  4JOI A;  2AKW B;  1AEX A;  1KXL A;  3OWE B;  4RG1 A;  2R6G A;  3N52 A;  4HSV A;  3R93 A;  3E6Z X;  2K4K A;  3OIP A;  3I4M H;  4DV2 Q;  4KN7 C;  4C3J B;  3D6W A;  4LUO A;  3J80 E;  2M2L A;  4IUN A;  3R8B A;  5IYC G;  1CZW A;  1BBX C;  3KJP A;  4B3M L;  1FJG L;  3EJI A;  4HJA A;  4CGY B;  1F9P A;  1ICF B;  1EOV A;  5E1F A;  3S24 A;  2Z1C A;  4KHP Q;  3PQI A;  3RLO A;  1T5E A;  2MQH A;  2XIW A;  2F0H A;  1E7Z A;  4YHH L;  1PYB A;  2JA8 B;  3HOX G;  2RQX A;  2VB3 X;  1EOT A;  3PIO A;  5EKI A;  2QCP X;  4X3U A;  1EEI D;  2UUC Q;  5M5X B;  2WKC A;  4HIM A;  3T1Y Q;  2O5I C;  1B9N A;  1PZJ D;  2EQS A;  3UI2 A;  4N9T A;  4BBR H;  3VYR A;  4AIM A;  5C4H A;  2D0P A;  2HHH Q;  4QIW B;  2K5Q A;  2DUD A;  2QDB A;  1ASY A;  1I4G A;  2DJG C;  1MBY A;  1HTL D;  1BCP C;  4A3F G;  3GO5 A;  3I2Z A;  4IQZ A;  5EGT A;  1KL9 A;  4DV6 Q;  1K8M A;  4IUP A;  2CWP A;  4B3T L;  4BA1 I;  3I55 A;  1JOQ A;  3CCJ A;  2JE6 I;  2GVB A;  2NYZ D;  4BS9 A;  1AW7 A;  3J7Y W;  4UP7 A;  3QR8 A;  1PH5 A;  2OQK A;  3BZD B;  2K1B A;  1EUJ A;  4N8X 1;  3S2D B;  3RN2 A;  4BY7 H;  1Q7Y C;  4DR2 Q;  1MI2 A;  1V1P B;  3D0F A;  3MXN B;  2B3G A;  2HT1 A;  2A73 B;  3M3Y H;  3K5O A;  4S3S A;  3OWF A;  2Z4H A;  1L0Y B;  3KYH C;  4OIJ A;  4R4C A;  4A3G G;  2HIV A;  4H13 C;  3GP7 A;  1NMG A;  1ILQ A;  5L37 A;  3MAQ A;  1I3Q H;  3W3A A;  4QB4 A;  4BXX G;  1FGU A;  1EWI A;  3VYS A;  2LFN A;  2Q8T A;  1STE A;  2PZT A;  4RFB A;  3GTO H;  2F0P A;  3FKI B;  1VQN A;  3S2H H;  2FJ2 A;  4KY6 A;  1EYG A;  3PCO B;  2PZU A;  2ZTC A;  4GKJ Q;  4R4I A;  5J22 A;  1DCZ A;  4DR3 L;  3NUC A;  4DR6 Q;  4DR1 Q;  3RLN A;  2PZW A;  2XWB B;  4ZCK A;  5IWA L;  1FR3 A;  1EIF A;  4OO1 I;  1HNW L;  3E5S A;  3E9H A;  4DF7 A;  1K8G A;  1U4M A;  2F0Q A;  1IBK L;  2ZT9 C;  3LNN A;  5ELO A;  1XPO A;  1D6E C;  4AH6 A;  4GKK Q;  3GTQ H;  2IY5 B;  2RDH A;  1FD7 D;  1HFG A;  3CCR A;  4G7O C;  4NXM Q;  2IJ0 A;  1PH9 A;  2NVQ B;  1QJO A;  3J81 L;  1TXY A;  4R4T A;  1BUV T;  4K0K Q;  1JOR A;  1EQQ A;  1HCZ A;  4LFA L;  4XDX A;  2N8N A;  2Q2T A;  2VUM B;  4E6I A;  3U4V A;  5KNC A;  4QUC A;  3S15 B;  4EVO A;  4ZYS A;  1EU3 A;  4DXG A;  3DEO A;  2WB1 G;  5GRO A;  4PNY A;  1D8L A;  4XYO A;  5M3F G;  1KRT A;  3PUX A;  2RSN A;  5JVH 3;  3I73 A;  1XTC D;  4BBS H;  1WOC A;  1BBW A;  4HR7 B;  2B2V A;  2BOS A;  3A8J E;  2KJX A;  1A3T A;  2Q2I A;  1ICW A;  3DXJ C;  2YU9 H;  2B63 H;  3K0Y A;  1EQV A;  2L1B A;  4QQB X;  2A19 A;  3KFU A;  4X65 L;  4CDE C;  1E2V A;  1KTK A;  4GN3 B;  3HGB A;  1UAP A;  4DV3 L;  1A8V A;  3S1M B;  4DAY A;  4L5R C;  4R8N A;  2CFM A;  3NPP A;  5J39 A;  2MUY A;  1XPR A;  2VQF Q;  2Q2U A;  3KLS X;  4NKL A;  4EQO A;  3CCM A;  1EL0 A;  1JIC A;  1QUQ A;  5KEE A;  3CMA A;  1V9P A;  3MA2 B;  4DV4 L;  3S16 H;  4I7Z C;  1HR0 L;  4HCE A;  1S3O A;  1SSO A;  4GZY C;  3PSI A;  2JJQ A;  1PH4 A;  1GUG A;  1N36 L;  2B29 A;  5M3F B;  4LW1 A;  1E3P A;  1U0L A;  2QA4 A;  1XMO Q;  3QIA A;  4ZLT F;  2EYH A;  4P73 A;  1JB3 A;  1RF2 D;  1TWG H;  1F77 A;  1TR5 A;  2F0E A;  1PH7 A;  4CBV A;  1SYE A;  3CP0 A;  3NEL A;  3HOZ B;  3D31 A;  5CBE E;  4F87 A;  2GN5 A;  3OIQ A;  1AZQ A;  4JI8 Q;  1PXU A;  1KDA A;  5JEA H;  4RMF A;  1GO3 E;  1TVX A;  2A1A A;  3AFP A;  1WD1 A;  3PO3 B;  1N32 L;  1O80 A;  4A93 H;  3PO2 G;  2E2I B;  1A62 A;  3L9A X;  1I50 B;  1NY4 A;  4LF9 L;  1WCM G;  2IL8 A;  2F0T A;  3K7U C;  4DK6 C;  3LGJ A;  1QIL A;  2R92 G;  4CKC A;  3W5O A;  1V43 A;  4A3E G;  4C2M B;  4FF4 A;  2EYF A;  2UUA L;  2EYL A;  5M5W H;  4R9W A;  1S5B D;  1TWC H;  3ITP A;  1PMR A;  2K5V A;  2CW0 C;  2KCN A;  3U9S A;  3HOV H;  3GD7 A;  4C3H G;  4RHR A;  1STY A;  3WDN A;  1HZ9 A;  1WTX A;  3NTK A;  3A8K E;  3T1H Q;  4FNF A;  5C44 G;  4IOC A;  2L4N A;  4C3J H;  4JBK A;  3GTP B;  2HQE A;  3MC0 B;  1BOS A;  1ASZ A;  5BN3 A;  4DNI A;  3MVV A;  4DR4 Q;  4OON A;  2R93 H;  3PUY A;  4X66 Q;  3ND8 A;  5I4D A;  1G29 1;  1PRT D;  5T1I A;  4HJ7 A;  4DXF A;  2JA8 H;  4PQX A;  4YWM A;  3OTO L;  3D4R A;  2KHJ A;  4A3I G;  4ODG A;  1VQF A;  1L0X B;  5DM6 3;  4RGM A;  1QNK A;  1IYV A;  4O2D A;  2EY2 A;  1DOM A;  5M5X H;  2TSS A;  3KF8 B;  1MJC A;  2WII B;  5CV6 A;  5IGB A;  1PFM A;  4MTN A;  3FEW X;  3RUZ A;  1HTP A;  1S5D D;  2WB1 E;  1X54 A;  1J9O A;  3TP5 A;  3F2U A;  5HUR A;  1HZC A;  2SOB A;  3RZD B;  4O42 A;  2AQ1 B;  4DUY Q;  1W6J A;  3OW2 A;  2IWH A;  2FMM A;  2JYO A;  1C0A A;  4QUF A;  3V96 A;  5C0X J;  2OQ0 A;  1JT8 A;  1NCV A;  1NUC A;  4UPA A;  2NB0 A;  1I5F A;  5G3L F;  2PNH A;  2F03 A;  4I7A A;  1VMP A;  4KJN A;  3KLW A;  1GD7 A;  1T5X D;  1Y69 U;  3BYY B;  4DR5 L;  4PZ6 A;  4G7Z C;  4H7B A;  4KV6 A;  3VYU A;  4OWW B;  3TZD A;  1QUQ B;  1EQT A;  5JVG 3;  2ZTE A;  4FXK C;  4X3T A;  2EJF C;  1ESR A;  4XQJ A;  1ML0 D;  4TVA B;  1TT2 A;  1ZXT A;  1B3A A;  4MZ9 A;  3NQI A;  3JC6 6;  1DOK A;  2F4V Q;  5IIF A;  4XYQ A;  3R3O A;  5EPK A;  4KMU C;  4JI5 L;  3M9B A;  2N88 A;  2F0N A;  4LK1 C;  2IT1 A;  3Q23 A;  3I4O A;  1STN A;  4IOA A;  4A3F H;  5CBA E;  4X64 Q;  4NDX A;  2JXM B;  1B50 A;  2K28 A;  5ELC A;  3K57 A;  1HJP A;  3QWN A;  3A5Z B;  4LJZ C;  1VQO A;  2AWO A;  5KRU A;  4IO9 A;  4B3S L;  1J5E L;  2JA9 A;  1VQH A;  4KHZ A;  3SVM A;  3SXH A;  1QVG A;  3HOY G;  1W3S A;  2JP1 A;  2UXC Q;  2E8G A;  2F0L A;  1XNQ L;  3P1H A;  4BY7 B;  3PUV A;  1RD9 D;  2F1M A;  2F0G A;  1QG7 A;  1HZA A;  4X6A H;  4DGZ A;  2K5N A;  3TN2 A;  1MKH A;  3D3R A;  2SNS A;  4FXD A;  1YJN A;  1VQK A;  1PTO C;  4DKA C;  4DAV A;  3A5U A;  2H4O A;  3M3Y B;  2WIN B;  5DAU A;  1YIJ A;  2NVQ H;  2A69 D;  1V1Q A;  4F7X A;  3TSS A;  5BN5 A;  4CDD C;  1TS3 A;  1IHZ A;  1WTP A;  4IJL A;  3S15 H;  2ICI A;  2IX0 A;  3E0E A;  5EBD A;  3HOW G;  3S2H B;  3C2P A;  3D6C A;  2OCE A;  1SFO H;  3T16 A;  4DV2 L;  2NVT B;  5FLM G;  4DUZ Q;  2OT2 A;  2MHV A;  4ID6 A;  3CC7 A;  1JOO A;  1NSN S;  4GNX A;  1YI2 A;  4LF8 Q;  1YNN D;  3K5M A;  4R4Q A;  2EE1 A;  2XN9 C;  2EXZ A;  3TP8 A;  4X3S A;  4YWL A;  4KHP L;  1PTO B;  1X6O A;  1MHW C;  1VQ9 A;  1PLF A;  1PH2 A;  2K5H A;  1EWH A;  1SYD A;  3RNU A;  1XTD A;  1ZKO A;  3MXU A;  4A3B B;  5KNB A;  1O7L A;  5I2X A;  3S1M H;  2QEJ C;  1WYD A;  2A5H A;  1YIT A;  2E2J B;  1F2Z A;  2UUC L;  3SK6 A;  1NTG A;  2R7F A;  2K32 A;  2K5W A;  1CI3 M;  3UDG A;  3T1Y L;  1HQR D;  5FO8 B;  2YYZ A;  4TQU S;  4XQN A;  3UDF A;  1MIU A;  1HFN A;  1YJW A;  3GTG B;  2I5L X;  1EIY B;  2B39 A;  1O78 A;  2HHH L;  3ZYY X;  1VQG A;  5IE8 A;  3IAY A;  2MNA A;  5M3F H;  4G4K A;  4C3I B;  1EEF D;  4OWX B;  1ZYR D;  3FRP B;  1QZG A;  4JI6 Q;  4DV6 L;  4BBS B;  5DLQ E;  1Z6H A;  2N55 A;  4LNQ A;  5EPL A;  5EPJ A;  1SDF A;  2ZXR A;  3PF4 A;  1RCV D;  2YU9 B;  2BDN A;  2B63 B;  1AP0 A;  4ZKB B;  2E2I H;  1UE7 A;  1I50 H;  4ME5 A;  1TKW B;  1SBB B;  2O5J C;  4DR2 L;  3T56 B;  2A6E C;  2FFK B;  2NVY B;  1JOK A;  3MEF A;  4RKB A;  2CCZ A;  1V1P A;  5K5P A;  5CR3 A;  3SGI A;  2KEC A;  1TWA H;  3MEH A;  3KJO A;  3CC2 A;  5BR8 Q;  2JA6 G;  3M4P A;  1V8Q A;  5CGK A;  3HG9 A;  3M4O H;  1YNJ C;  2R7Z B;  4HJ8 A;  4JV5 Q;  1O7Z A;  3G71 A;  1UE5 A;  5HY6 A;  4CJ0 B;  1H95 A;  3T53 B;  4FXG C;  4EGV A;  3GTP H;  3OMC A;  1ENF A;  2KVM A;  1Z7T A;  2PMZ B;  1WTV A;  1XX8 A;  4JYA Q;  1EYD A;  3J81 j;  4YY3 Q;  3NSW A;  1X9N A;  5JEA J;  2Z9H A;  4AYB G;  5JOB A;  4R8I A;  4GKJ L;  2K05 A;  3QOL A;  4XXE A;  4A3B G;  3FDT A;  4WJ3 M;  3K81 C;  4DR6 L;  3TS2 A;  4QJF A;  4DR1 L;  4A93 B;  3BVG A;  2PNR C;  2Q8I B;  2CQO A;  4IUQ A;  1HA5 A;  1WFQ A;  3N6R A;  3T51 B;  4LF4 Q;  4HSP A;  1TS5 A;  3QO2 A;  2OWO A;  1I6V C;  2R3Z A;  3NWS A;  4X62 Q;  2KEN A;  3I7F A;  4LFB Q;  4FO2 A;  5FO9 B;  4GKK L;  3VR6 A;  2JSO A;  3PV0 A;  4HCS A;  3TZU A;  3VR2 A;  2ZJP A;  1IXR A;  4NXM L;  2JK8 A;  3HOV B;  4ZUI A;  2OTL A;  5M3M B;  4K6D A;  4UHV A;  2MGS A;  4KKS A;  4K0K L;  4YCW A;  1OXX K;  2M00 A;  4GNX B;  3I91 A;  5IY0 A;  2RKS A;  1CSQ A;  1STG A;  2E74 C;  4LUZ A;  3E0J A;  3RZD H;  1HRJ A;  1XWE A;  4A3C G;  3GTJ B;  2XTI A;  4KN4 C;  5IYD G;  4BY1 B;  2R93 B;  4FVM A;  1K83 H;  2I5H A;  2RVL A;  2PW7 A;  1I4H A;  5C0X H;  1SNP A;  3SK5 A;  2BE5 D;  3UDX A;  4A3I H;  1WI5 A;  3RR5 A;  1CA5 A;  2NN6 I;  1PH6 A;  5EKK A;  5C3E G;  4JBJ A;  1STH A;  3D4W A;  3NK9 A;  4KI0 A;  3DLL A;  2N49 A;  1YEZ A;  2IW3 A;  4O1N A;  2J4X A;  1PDQ A;  3A54 A;  3H3V I;  1LYL A;  4TSS A;  2AWN A;  2PYK A;  4JI0 Q;  4L8J A;  2VQF L;  4K2L A;  3NE5 B;  1X3P A;  1C7Y A;  2VXW A;  3K5N A;  1GOZ A;  1Y1W G;  1K8A C;  1VQE A;  2PMZ E;  4KTA A;  1WTR A;  5I2Y A;  1EFW A;  1XPU A;  3CCQ A;  2IPK D;  1BBU A;  5IT9 c;  3L3O C;  5IP9 G;  5F2D A;  4O0A A;  2WP8 J;  1XMO L;  2ASB A;  4IJH A;  3HOU G;  3URY A;  5G3L D;  1Q3L A;  4NW2 A;  4CKB A;  3G4S A;  1WVL A;  4JI8 L;  3HOX B;  3SEB A;  5CV4 A;  4JI1 Q;  4YCU A;  1IZ6 A;  4HIO A;  4XT3 B;  3BS1 A;  2HD3 A;  4A3L G;  2E5L Q;  1HH2 P;  1L0W A;  4IZ8 A;  3J80 i;  3GQB A;  2A6H D;  1Q12 A;  2MPM A;  1BCP B;  3R2I A;  5FLX L;  3S14 H;  3DM3 A;  1X3E A;  5FJ8 H;  1G91 A;  3EA6 A;  4A3F B;  3J81 E;  1LTG D;  2NZO A;  2OXP A;  5IGG A;  2I07 B;  3T1H L;  4AYB E;  1AZP A;  1S5C D;  4JI4 Q;  4R4O A;  2NVT H;  2K33 A;  2JEB I;  2JQO A;  1J6Q A;  1AE2 A;  1A3U A;  1BO0 A;  3CXC A;  1VQ7 A;  2IX1 A;  2EY6 A;  3TP7 A;  3H0G G;  4OEM B;  4DR4 L;  2F3W A;  1H9R A;  4M1U B;  3B6Y A;  1JE4 A;  2D5D A;  4X66 L;  1PTO H;  3CPF A;  2UU9 Q;  4HMI A;  4ZAI A;  3G7L A;  4P75 A;  4JPB W;  5KYI A;  4QY7 A;  1XYI A;  1NR4 A;  2EVB A;  4HAE A;  5JPN C;  2NTT A;  2JA7 G;  3VR5 A;  4A3G B;  3I4N G;  2KCT A;  3A55 A;  5DEH A;  2E2J H;  3DWP A;  4KKT A;  3H94 A;  4RCO A;  1HUM A;  2X6G A;  2BA0 A;  1MSH A;  1S5E D;  4L6T B;  3GTG H;  2EYP A;  3KF8 A;  1EY5 A;  1G51 A;  1GUS A;  5COR A;  5H1S E;  5FLM H;  1LT5 D;  1S4Z A;  3EBE A;  3MXP A;  5AJ3 Q;  1SFO B;  3W2D A;  4C3I H;  1SYC A;  2RF4 A;  4NXN Q;  1CKO A;  1BR9 A;  3KDF A;  2LY7 A;  3OPO A;  1IBL Q;  5CV9 A;  4DUY L;  2OF1 A;  4TKO B;  3A74 A;  5LL6 X;  3P7J A;  4LWC A;  2JA5 G;  1IBM Q;  2L12 A;  4DNR B;  3IRB A;  1XNR Q;  4GN5 A;  1TY2 A;  2PO4 A;  4K5W A;  4LMQ D;  2NVY H;  3TRE A;  1E1T A;  2A74 C;  1B9M A;  1LTA D;  5IGE A;  4MN3 A;  5J1Z A;  2WAQ G;  5EBC A;  2F0O A;  5IP7 G;  4Y7N B;  1PHJ A;  2F0D A;  3WOF A;  4UY8 C;  2F4V L;  1TS4 A;  2R7Z H;  3A7L A;  4PMC A;  5C6A A;  4LF7 Q;  2NWG A;  1UEB A;  2WB1 B;  3S1Q H;  1LTB D;  4JC0 A;  4X64 L;  5IGC A;  4CDC C;  1CFM A;  3SDZ A;  3GTL H;  4FDB A;  1I6H B;  1HNZ Q;  4OIK A;  2Z0S A;  2R7D A;  2RHQ B;  1GHJ A;  1EY6 A;  4J8Q A;  5COY A;  1BCP F;  2XNA C;  1PH8 A;  2UXC L;  2KCC A;  1FYC A;  5CV8 A;  2NN6 G;  4DV7 Q;  3ICE A;  1TU2 B;  2D2C C;  1YHQ A;  1BVS A;  4IFD I;  4CJ1 B;  3FHW A;  3K80 C;  2CH4 W;  1UE1 A;  2UXB Q;  1PA6 A;  3D4D A;  2WAQ B;  1KAB A;  2ICE C;  2SDF A;  2JA6 H;  1TWA B;  1BDO A;  4DR7 Q;  1S72 A;  2XSC A;  1Z47 A;  3M4O B;  3NEM A;  1PZI D;  2VNU D;  1G8Z D;  2LXJ A;  5M3M H;  2QDL A;  3I4L A;  1ET9 A;  2IX3 A;  4KY7 A;  5ISR A;  1M1K C;  2L15 A;  2DY7 A;  1D7Q A;  1F2L A;  3HP3 A;  2PW5 A;  1JJG A;  2MFI A;  4A3D G;  1JWM D;  4ZRZ A;  4QL5 A;  1B3Q A;  2NVX H;  3NXW A;  1EYA A;  4A3B H;  4DUZ L;  2RCF A;  3GTJ H;  1LAC A;  5FLX c;  3BVZ A;  4BY1 H;  1GUT A;  3PO2 B;  1H9S B;  4NB3 A;  4LF8 L;  1TWH H;  2F0V A;  1WCM B;  2R92 B;  5C3W A;  1PYW D;  1VF7 A;  4A3E B;  3I4M G;  5DNF A;  1H9K A;  1E2W A;  1KLG D;  2MO1 A;  4ILW A;  3IL8 A;  1SJE D;  4N8F A;  3OOC A;  4H44 C;  3NP8 A;  1I4X A;  4C3H B;  1E1O A;  1SMY C;  1YHB A;  1GKH A;  4FYD A;  2VW9 A;  5C44 B;  1AE3 A;  1NR2 A;  2Q2H A;  4DV5 Q;  3CW2 C;  4WFN 3;  3KDF B;  3LWU A;  1PTO D;  1NMF A;  2N3S A;  5IYC H;  1AFP A;  1RL2 A;  4A3C H;  1QVF A;  5IYD H;  1ENC A;  4FF1 A;  2YTY A;  1OXU A;  4HMJ A;  3I3C A;  1II3 A;  4ZK9 B;  1JMC A;  4JI6 L;  2K75 A;  1PFN A;  1K83 B;  3VA5 A;  1KNA A;  4BBR G;  4P72 A;  4IN3 A;  5HGQ A;  4OO1 G;  3HOX H;  1C48 A;  1LM0 A;  4A3I B;  1K9M C;  5CYU A;  4DV0 Q;  3C3L A;  4WRD A;  4DV1 Q;  2KUM A;  2B2T A;  4XTC S;  1DXM A;  2PQE A;  5C4J B;  4DFA A;  2RBM A;  4XT1 B;  1K8O A;  3W1B A;  2EYM A;  4GLA C;  1N34 Q;  1KIX A;  1JE5 A;  1RTN A;  1WTW A;  1LTT D;  1K0S A;  2YTV A;  2WAQ E;  1B8A A;  5FKA C;  1JWS D;  1Q1E A;  2EJG C;  1E0B A;  2V1C C;  3AEV A;  3OHX C;  5EQ0 A;  1U4L A;  5BR8 L;  1SNO A;  4A3K G;  1CK1 A;  3K6O A;  1DM0 B;  1DD2 A;  4JV5 L;  2I5M X;  1D1K A;  1L1O A;  1SN8 A;  2LMC B;  3KF6 A;  1Q90 A;  2K01 A;  5IP9 H;  1SYF A;  2RSO A;  2Y0S G;  4G57 A;  3AMU A;  1X3G A;  3HOU H;  4JYA L;  4YY3 L;  1WJJ A;  3RMH A;  4KKU A;  4ULL A;  3ULJ A;  3C1F A;  1X65 A;  1PRT C;  1C8C A;  3H09 A;  5LMU Q;  2JEA I;  3X3M A;  1VQI A;  2AQ2 B;  5C4Z A;  4LAA A;  3J7A 5;  3NWT A;  4A3L H;  2VB2 X;  3PGZ A;  4LF4 L;  3RN5 A;  3HRZ C;  1ONL A;  2HDL A;  5ELE A;  4A3G H;  4QGU A;  3HKZ G;  4K8I A;  4RGO S;  4UP8 A;  1D2B A;  4X62 L;  4LFB L;  4BXX H;  4JW0 A;  3S14 B;  1LTS D;  1QOH A;  1O7I A;  1B53 A;  1EY4 A;  4H02 A;  1Z9F A;  2BDO A;  1A6X A;  2KHI A;  1HA6 A;  5A35 A;  1FNV A;  4LFC Q;  2MO0 A;  2Y0S B;  2A6E D;  4HID A;  3MHB A;  3TME A;  2F0J A;  2RCN A;  1B2T A;  3CC4 A;  3HFZ B;  2L9H A;  2LKV A;  4Y52 H;  1DON A;  2RHS B;  4MTK A;  1TY0 A;  2EOT A;  3HOY B;  1PRT B;  2CQA A;  2RDF A;  2XVS A;  1EQR A;  3JAM L;  1SJH D;  3E3X A;  5GAG C;  2HDM A;  1JB7 A;  1WTQ A;  3GTK B;  1IYJ B;  2B2Y C;  3M7G A;  1M90 C;  1LT6 D;  2UUB Q;  4FF2 A;  2NTS A;  1B7Y B;  3AU7 A;  2J7Z A;  5GAH C;  1VQC A;  2Z8L A;  2B2T C;  2JA7 H;  4IFD G;  2PQA B;  2L5T A;  4NPS A;  1HUN A;  2E2D C;  5E4W C;  3GV6 A;  5IT9 L;  3JAM i;  1YZ6 A;  3ND9 A;  3V2T A;  2EYJ A;  4JCV E;  5E3F A;  2VY3 A;  5ELN A;  3S17 H;  1P8L A;  4NMZ A;  4Y7N H;  2EYO A;  1MSG A;  4MHE A;  2CHB D;  4JI0 L;  3OMG A;  5IOD A;  3HOW B;  3PIO 3;  3ERQ A;  1SNQ A;  3BJU A;  2NZ1 D;  1ET6 A;  3IFD A;  4AQY Q;  1DYQ A;  1L1O C;  3OYY A;  4XQQ A;  1R9T H;  4J15 A;  1DOL A;  1OO9 B;  2K5D A;  5D65 A;  3S1N H;  1I6H H;  2X6L A;  1D5X C;  1VMC A;  3AB9 A;  4RA8 A;  2QW7 A;  1VDZ A;  1JCK B;  5JJZ A;  3CQZ B;  4A4I A;  4IPD A;  4KHV A;  2JA5 H;  2C5C A;  1LUZ A;  3LX0 A;  1Y14 B;  3PUW A;  3I72 A;  3TEH B;  1FVI A;  4IAL A;  4IUT A;  2KEE A;  3BDL A;  3R2T A;  2F0I A;  2G5D A;  2RA4 A;  4JI1 L;  4ZQ3 A;  3RLF A;  1S40 A;  4F88 A;  2WKD A;  1EY9 A;  3GV3 A;  1Y8N B;  2P5Z X;  1PH1 A;  2E5L L;  1L1O B;  3KF6 B;  1QE6 A;  1NE3 A;  4DU9 A;  3S1Q B;  3BDO A;  1U4P A;  2E75 C;  3J7A V;  4JI7 Q;  2Y0S E;  2SNM A;  4A3M G;  2I0Q A;  4HJ9 A;  4RH6 A;  3TRZ A;  1VQ5 A;  3GTL B;  2HIX A;  2TMP A;  4JI4 L;  4GN4 B;  5C4X G;  1IL2 A;  1RTO A;  4GS3 A;  3Q24 A;  4TRD A;  3PO2 H;  1K0R A;  3HKS A;  1WCM H;  1HZB A;  4C56 C;  1JJ2 A;  2R92 H;  4J6H A;  1BCP D;  3P75 A;  1SRU A;  2ES2 A;  5E7N A;  4A3E H;  2O2L D;  2CKZ B;  5M5Y H;  2F0M A;  4B08 A;  2UU9 L;  3HKZ E;  4G7H C;  4B3R Q;  4HJ5 A;  1AN8 A;  4KK7 A;  4HN7 A;  1F9R A;  3VR3 A;  1B44 D;  2VZA A;  4OX9 Q;  1VQ4 A;  2FHT A;  3STB C;  2QIL A;  2JA6 B;  4C3H H;  1EFI D;  1LO5 D;  3NBH B;  1YHA A;  2QKI C;  2B8F A;  4JI3 Q;  1F2M A;  1GUN A;  5C44 H;  4DPG A;  4A3M B;  3IFT A;  1VQP A;  5JJI A;  4CDF C;  2JA8 G;  1PTO F;  3NTH A;  2K14 A;  4JVZ A;  4CJ2 C;  1Y8P B;  5E4X A;  2NUC A;  1VF5 C;  3QJY A;  5C4X B;  4AYB B;  4DAM A;  4YIJ A;  1D5M C;  2A8V A;  2NVX B;  5AJ3 L;  1E22 A;  2XGT A;  1ZYR C; 
#chains in the Genus database with same CATH homology
 2KHJ A;  1Y1V G;  2BA0 A;  4A3I G;  2VQE Q;  4NXN L;  1SR3 A;  4BA2 I;  1TWF H;  3GTG H;  1VQF A;  5GQO A;  1IBL L;  2OTJ A;  5LMN Q;  2ZM6 Q;  3PIP A;  1G51 A;  5H1S E;  5FLM H;  4BBS G;  4O2D A;  3ULP A;  5M5X H;  2UXD Q;  3EBE A;  1DGS A;  5AJ3 Q;  3KF8 B;  1MJC A;  3OTO Q;  4C3I H;  1CKN A;  3I56 A;  2RF4 A;  5C4J H;  4NXN Q;  3EN2 A;  1CKO A;  3KDF A;  1IBM L;  2BH8 A;  4MTN A;  4P71 A;  1LTL A;  3H15 A;  2B63 G;  2PI2 A;  1KC8 C;  1MJE A;  2NZH A;  1IBL Q;  2BH2 A;  1XNR L;  3CD6 A;  2Z6K C;  4DUY L;  3CPW A;  2WB1 E;  3TS0 A;  1X54 A;  1PFS A;  2N78 A;  1Q86 C;  1Q82 C;  3UE0 A;  3JAM c;  3STB D;  1VQD A;  3A74 A;  4LWC A;  1VQM A;  1YNX A;  4IPH A;  1HZC A;  2JA5 G;  5LMN W;  1IBM Q;  1X55 A;  1N33 L;  3IRB A;  1XNR Q;  4GLX A;  4DUY Q;  3OW2 A;  3AQQ A;  4GN5 A;  3ZJY C;  4IFD J;  1C0A A;  5C0X J;  4IPG A;  2OQ0 A;  1JT8 A;  1JJC B;  1N9W A;  1SRO A;  4UPA A;  1XMQ Q;  1I5F A;  2PNH A;  2ZJQ A;  1AH9 A;  2NVY H;  4LF7 L;  3TRE A;  3VDY A;  2R7Z G;  1E1T A;  3U58 A;  4LF6 L;  3KLW A;  1GD7 A;  1N33 Q;  4OXP A;  2WAQ G;  4DR5 L;  3UE1 A;  5IP7 G;  1PHJ A;  4PZ6 A;  5JJK A;  4UY8 C;  4PMW A;  2F4V L;  2Z6K A;  3F2C A;  2R7Z H;  3S1R H;  4OWT B;  4OWW B;  1FL0 A;  1QUQ B;  3BZC A;  2ZJR A;  1GM5 A;  1HNZ L;  2ZTE A;  1UEB A;  4LF7 Q;  3S1Q H;  3HOZ H;  4LF6 Q;  5IP7 H;  2WFW A;  3NEN A;  4TVA B;  3CCU A;  1VQB A;  1BKB A;  2F52 A;  4MZ9 A;  3PO3 H;  4JC0 A;  4X64 L;  4DR5 Q;  3JC6 6;  1UWV A;  2F4V Q;  2KCM A;  4PZ7 A;  5JJL A;  5IYB H;  3CAM A;  4L5Q A;  4IPC A;  4ALP A;  5J3B A;  3E9I A;  4APV A;  5JEA G;  3GTL H;  3FKI G;  4FDB A;  1XJV A;  4JI5 L;  4A93 G;  3M9B A;  4DV7 L;  1HNZ Q;  2EIF A;  1VQ8 A;  1NBW A;  2IT1 A;  2EXD A;  3I4O A;  4IOA A;  2Z0S A;  2R7D A;  2RHQ B;  4A3F H;  4C2M H;  3ER0 A;  4X64 Q;  3J7Z C;  2UXB L;  1HJP A;  2K50 A;  2YTX A;  3A5Z B;  4LF5 L;  4A3J G;  1PH8 A;  1U5K A;  4JI5 Q;  2UXC L;  2NN6 G;  3CCV A;  4DV7 Q;  4A3K H;  3CME A;  1VQO A;  3ICE A;  4DR7 L;  1YHQ A;  2AWO A;  1BVS A;  4IO9 A;  4B3S L;  2D0O A;  4JYA L;  1J5E L;  4IFD I;  2CWA A;  1GVP A;  5C0X I;  4JI2 L;  3FHW A;  2JA9 A;  1VQH A;  4KHZ A;  1CSP A;  4KLK A;  3K80 C;  3CCE A;  1L2F A;  3HOV G;  1UE1 A;  4EX5 A;  3M85 A;  2UXB Q;  1QVG A;  1PA6 A;  3HOY G;  1KQS A;  2AHO B;  4DK3 C;  4LF5 Q;  1W3S A;  3G48 A;  5M3M G;  3WWV A;  2UXC Q;  2E8G A;  2JA6 H;  1C9O A;  1G6P A;  3F1Z A;  1A0I A;  3F2D A;  4DR7 Q;  1S72 A;  1K73 C;  4B3S Q;  1XNQ L;  3PUV A;  1J5E Q;  1Z47 A;  4JOI C;  1CUK A;  3NEM A;  4JI2 Q;  2VNU D;  5GAD C;  1HZA A;  3HOY H;  2LXJ A;  5M3M H;  3H3V H;  1N8R C;  4X6A H;  1QZH A;  2K5N A;  3GDE A;  1MKH A;  1YJN A;  1VQK A;  4GNX C;  4DKA C;  3GTK H;  3A5U A;  1M1K C;  2L15 A;  1I94 L;  1KAW A;  1D7Q A;  1XNQ Q;  1JJG A;  1VS0 A;  1YIJ A;  2VUM G;  2MFI A;  4BY1 G;  4A3D G;  2NVQ H;  2R93 G;  1B70 B;  1V1Q A;  4QL5 A;  4L5S A;  2NVX H;  4A3B H;  1Q1B A;  4DUZ L;  3GTJ H;  1OXV A;  4YCV A;  3F8T A;  5FLX c;  4BY1 H;  4A3D H;  1I94 Q;  4IJL A;  3S15 H;  4NB3 A;  4LF8 L;  2IX0 A;  1TWH H;  3E0E A;  5K36 G;  4XIG S;  2PI2 E;  3HOW G;  2OCE A;  1RIP A;  1SFO H;  4DV2 L;  1KHI A;  4JOI A;  2AKW B;  5FLM G;  4DUZ Q;  1KXL A;  1HNX L;  4RG1 A;  2R6G A;  3I4M G;  1T9H A;  2GVA A;  2MO1 A;  3CC7 A;  3HOW H;  4GNX A;  4LF8 Q;  1YI2 A;  2K4K A;  4R4Q A;  4DV5 L;  4A75 A;  3I4M H;  1SMX A;  4DV2 Q;  4YWL A;  4LUO A;  1E1O A;  3CF5 A;  4KHP L;  3FP9 A;  1X6O A;  1YHB A;  1VQ9 A;  1PH2 A;  1GKH A;  2K5H A;  2VW9 A;  5IYC G;  3RNU A;  4B3M L;  1XTD A;  3KJP A;  1FJG L;  1YVC A;  1AE3 A;  4HJA A;  1PYS B;  1CKN B;  2HQL A;  2Q2H A;  1Q46 A;  3KOJ A;  4DV5 Q;  3CW2 C;  3CQZ H;  4QIW E;  1Q81 C;  1EOV A;  3KDF B;  3S1M H;  3S24 A;  1WYD A;  4KHP Q;  2VS1 A;  1NMF A;  2N3S A;  3RLO A;  5IYC H;  2D62 A;  2MQH A;  1OXT A;  1YIT A;  1RL2 A;  1E7Z A;  4A3C H;  2UUC L;  3GTM H;  4YHH L;  4DV0 L;  4B3M Q;  1QVF A;  1NTG A;  4DV1 L;  1PYB A;  2R7F A;  3UDG A;  1FJG Q;  5IYD H;  3T1Y L;  2YTY A;  3HOX G;  1OXU A;  2YYZ A;  4TQU S;  3UDF A;  1VQJ A;  1A63 A;  1MIU A;  1YJW A;  3J81 i;  1JMC A;  4JI6 L;  2K75 A;  2I5L X;  1N34 L;  1EIY B;  3PIO A;  3BU2 A;  2HHH L;  1VQG A;  4BBR G;  5IE8 A;  4P72 A;  5HGQ A;  4OO1 G;  2UUC Q;  3HOX H;  1LM0 A;  1K9M C;  4YHH Q;  2MNA A;  5M3F H;  4DV0 Q;  3HOZ G;  4DV1 Q;  3U4Z A;  4HIM A;  3T1Y Q;  4XTC S;  2EQS A;  4OWX B;  3PO3 G;  1QZG A;  4BBR H;  4JI6 Q;  4JG2 A;  4GLA C;  3W1B A;  5IYB G;  4DV6 L;  1N34 Q;  5DLQ E;  4AIM A;  1KIX A;  1JE5 A;  2BA1 A;  2D0P A;  2HHH Q;  2C35 B;  4LNQ A;  4GOP A;  3ULL A;  2YTV A;  2WAQ E;  2DUD A;  3PF4 A;  1B8A A;  3CCS A;  1ASY A;  4JBM A;  4A3F G;  2E2I H;  3GO5 A;  1UE7 A;  1I50 H;  1Q1E A;  3I2Z A;  1KD1 C;  1KL9 A;  4DV6 Q;  3AEV A;  2V1C C;  3W1G A;  2CWP A;  4B3T L;  4BA1 I;  3I55 A;  5BR8 L;  3CCJ A;  2JE6 I;  4A3K G;  2GVB A;  4DR2 L;  1QVC A;  1E24 A;  2F3I A;  4JV5 L;  2I5M X;  4R1J A;  1L1O A;  1SN8 A;  3KF6 A;  4UP7 A;  3MEF A;  5IP9 H;  2CCZ A;  3K8A A;  1PH5 A;  2OQK A;  1EUJ A;  3SGI A;  1TWA H;  1CKM A;  3KJO A;  2Y0S G;  3CC2 A;  4B3T Q;  5BR8 Q;  3RN2 A;  1X3G A;  5LMU L;  3M4P A;  3G6E A;  2JA6 G;  4YY3 L;  4DR2 Q;  1WJJ A;  1Q7Y C;  3M4O H;  3D0F A;  4HJ8 A;  4JV5 Q;  2QEX A;  1SLJ A;  1UE6 A;  1UE5 A;  3MXN B;  3G71 A;  2B3G A;  5HY6 A;  4WJ4 A;  1H95 A;  2HT1 A;  2ZTD A;  3TQY A;  3GTP H;  3J80 c;  3M3Y H;  3ULJ A;  4R4C A;  3KYH C;  1X65 A;  2JEA I;  4A3G G;  5LMU Q;  3F2B A;  4JYA Q;  3J81 j;  2HIV A;  4YY3 Q;  1X9N A;  1VQI A;  1NMG A;  3A0J A;  5JEA J;  3J7A 5;  4A3L H;  4AYB G;  4A3M H;  3PGZ A;  1I3Q H;  4BXX G;  4LF4 L;  3RN5 A;  4GKJ L;  1FGU A;  1EWI A;  4GLV B;  4A3G H;  4A3B G;  4WJ3 M;  4QGU A;  3K81 C;  3HKZ G;  4DR6 L;  3TS2 A;  4QJF A;  4DR1 L;  4UP8 A;  3GTO H;  4X62 L;  1VQN A;  5C4X H;  3S2H H;  4LFC L;  4LFB L;  1EYG A;  4JBW A;  2CQO A;  3PCO B;  4BXX H;  1PVO A;  3M4Q A;  1WFQ A;  1O7I A;  4H02 A;  2IHE A;  4LF4 Q;  2ZTC A;  1Z9F A;  4GKJ Q;  4R4I A;  2KHI A;  4DR3 L;  2OWO A;  4DR6 Q;  4DR1 Q;  3RLN A;  4X62 Q;  2KEN A;  3I7F A;  4LFC Q;  2MO0 A;  4LFB Q;  4HID A;  5IWA L;  4GKK L;  1P16 A;  2K52 A;  2RCN A;  1EIF A;  2YV5 A;  3CC4 A;  3HFZ B;  2UUB L;  3PV0 A;  4OO1 I;  1HNW L;  4NXM L;  2ZJP A;  1IXR A;  2RHS B;  3E9H A;  4HIK A;  2JK8 A;  1K8G A;  4Y52 H;  4BY7 H;  2H5X A;  4DR3 Q;  1IBK L;  2KBN A;  2OTL A;  5ELO A;  1EQR A;  1XPO A;  4K0K L;  5GAG C;  4YCW A;  1OXX K;  1JB7 A;  5IWA Q;  4AH6 A;  1OTC A;  4GKK Q;  3GTQ H;  2IY5 B;  1IYJ B;  1M90 C;  2UUB Q;  4GNX B;  1HNX Q;  3CCR A;  1HNW Q;  2PQA A;  5LMN L;  1B7Y B;  4NXM Q;  5IY0 A;  5GAH C;  1CSQ A;  1VQC A;  1PH9 A;  4LUZ A;  1PV4 A;  1IBK Q;  1TXY A;  3RZD H;  4R4T A;  2JA7 H;  1NJI C;  4IFD G;  5C0X G;  4K0K Q;  1EQQ A;  4A3C G;  2XTI A;  2PQA B;  4LFA L;  4NPS A;  5IYD G;  2N8N A;  2Q2T A;  1X3F A;  4ME3 A;  4GOP C;  3U4V A;  1K83 H;  2I5H A;  3JAM i;  1YZ6 A;  5ELN A;  4JCV E;  1YBY A;  2VY3 A;  3UDX A;  4AQY L;  2WB1 G;  5GRO A;  1Y1V H;  4A3I H;  3S17 H;  1WI5 A;  1P8L A;  4LUV A;  3RR5 A;  1D8L A;  4Y7N H;  4LFA Q;  3PUZ A;  4JI0 L;  2NN6 I;  5M3F G;  1KRT A;  1W2B A;  3PUX A;  4JBJ A;  4PG3 A;  4L5T A;  5C3E G;  1PH6 A;  1PH3 A;  3AFQ A;  4BBS H;  1WOC A;  1BBW A;  3BJU A;  4KI0 A;  3DLL A;  2N49 A;  1YEZ A;  1OXS C;  2AMC B;  2E2H H;  4AQY Q;  3L7Z C;  1L1O C;  3OYY A;  1R9T H;  2Q2I A;  5C3E H;  1XMQ L;  2YU9 H;  4POG A;  1LYL A;  4J15 A;  2B63 H;  3H3V I;  2AWN A;  4JI0 Q;  2IHF A;  2VQF L;  4QQB X;  2A19 A;  1Q8K A;  3KFU A;  4X65 L;  3S1N H;  1I6H H;  3BZK A;  2ATW A;  4P74 A;  1C7Y A;  3PF5 A;  4GN3 B;  4DV3 L;  3J81 c;  4A4I A;  1A8V A;  4IPD A;  2QGQ A;  4MNO A;  1Y1W G;  2JA5 H;  4L5R C;  2CFM A;  1K8A C;  1VQE A;  2PMZ E;  1LUZ A;  1XPR A;  2VQF Q;  4GOP B;  2Q2U A;  3CCM A;  1Y14 B;  1EFW A;  3PUW A;  1QUQ A;  4X65 Q;  3CCQ A;  1XPU A;  1BBU A;  3K0X A;  5IT9 c;  3CMA A;  1V9P A;  3TEH B;  1FVI A;  4DAY B;  5IP9 G;  1Y1W H;  3Q8D A;  2ID0 A;  4DV4 L;  3S2D H;  4O0A A;  2WP8 J;  4DV3 Q;  1XMO L;  2ASB A;  4JI1 L;  3S16 H;  1HR0 L;  1YJ9 A;  3RLF A;  4IJH A;  1S40 A;  1S3O A;  3HOU G;  4BY7 G;  1SE8 A;  5EAY A;  3PSI A;  4UP9 A;  3G4S A;  2JJQ A;  1VQL A;  1PH4 A;  4JI7 L;  4JI8 L;  1PH1 A;  4YWK A;  2E5L L;  1N36 L;  2B29 A;  3HOU H;  2ALY B;  4LW1 A;  1E3P A;  1U0L A;  3EIV A;  2QA4 A;  1L1O B;  3KF6 B;  4DV4 Q;  2VL6 A;  4P73 A;  4JI1 Q;  1XMO Q;  1HR0 Q;  3RZO H;  1NE3 A;  4YCU A;  1IZ6 A;  1TWG H;  1KRS A;  4HIO A;  1PH7 A;  3CP0 A;  3NEL A;  3D31 A;  2GN5 A;  4A3L G;  4JI7 Q;  2Y0S E;  4JI8 Q;  4A3M G;  2I0Q A;  2E5L Q;  1N36 Q;  1HH2 P;  1L0W A;  4RMF A;  1GO3 E;  2A1A A;  3AFP A;  1VQA A;  5FJ8 G;  3FKI H;  3J80 i;  1N32 L;  4A93 H;  2DGY A;  4HJ9 A;  3PO2 G;  3TRZ A;  1Q12 A;  1VQ5 A;  1A62 A;  2HIX A;  1NY4 A;  4LF9 L;  1WCM G;  4JI4 L;  3S14 H;  4GN4 B;  5C4X G;  3K7U C;  4DK6 C;  3LGJ A;  2R92 G;  3DM3 A;  1IL2 A;  1X3E A;  5FJ8 H;  4GS3 A;  3W5O A;  4B3R L;  1V43 A;  3K7A H;  4A3E G;  3PO2 H;  1K0R A;  3ERS X;  1HR0 W;  4A3J H;  1N32 Q;  3HKS A;  1WCM H;  2NZO A;  4OX9 L;  1HZB A;  2UUA L;  5M5W H;  1JJ2 A;  2R92 H;  3T1H L;  1TWC H;  2ES2 A;  4AYB E;  1SRU A;  4LF9 Q;  4JI4 Q;  4R4O A;  2NVT H;  2K5V A;  5E7N A;  2JEB I;  4A3E H;  2CKZ B;  2JQO A;  1J6Q A;  1AE2 A;  5M5Y H;  4JI3 L;  2UU9 L;  3HOV H;  3HKZ E;  3GD7 A;  3CXC A;  1VQ7 A;  4HJ5 A;  4B3R Q;  3U50 C;  2IX1 A;  1HZ9 A;  1K3R A;  2FXQ A;  3H0G G;  2VZA A;  4OX9 Q;  2UUA Q;  4DR4 L;  3T1H Q;  5C44 G;  4IOC A;  1VQ4 A;  3STB C;  4C3J H;  5GAE C;  4JBK A;  4C3H H;  3NBH B;  3B6Y A;  1YHA A;  4X66 L;  3M7N A;  3CCL A;  3CPF A;  2UU9 Q;  3L0O A;  4JI3 Q;  3H0G H;  4P75 A;  1ASZ A;  4DNI A;  5C44 H;  4DPG A;  3L2P A;  4QY7 A;  4DR4 Q;  2VQE L;  2LSS A;  3UDI A;  1VQP A;  5JJI A;  2JA7 G;  4OON A;  2JA8 G;  1VQ6 A;  2VUM H;  3I4N G;  2R93 H;  2K14 A;  2KCT A;  3PUY A;  4PZ8 A;  4EQ5 A;  4X66 Q;  2ZM6 L;  4A76 A;  1G29 1;  2E2J H;  4DAM A;  3AYH B;  2A8V A;  4HJ7 A;  2LXK A;  4POF A;  1VCI A;  2UXD L;  5AJ3 L;  1E22 A;  2XGT A;  2JA8 H;  4YWM A;  3OTO L;  3I4N H;  1X56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...