3HOWH

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howH00
4GKJL 1FVIA 2JA6H 2NVXH 4JI7Q 4JI0Q 1EUJA 1KRTA 4OWWB 2NN6I 1Z9FA 2ZTEA 2NZOA 4BY7G 2LXJA 2R92H 2HQLA 2BA0A 1XMOL 4GLXA 2E2HH 3S1NH 1K0RA 4GNXA 3CAMA 3G48A 1QUQB 3CCUA 5J3BA 4IO9A 4JOIA 1N32L 2K5HA 2N3SA 4APVA 4HJ5A 3CQZH 4BY1G 4IFDI 4LW1A 3S1QH 3IRBA 4AIMA 3PO3H 4X66L 3S2DH 4R4OA 1UE6A 5BR8L 1PH1A 5AJ3Q 2UXCL 1XJVA 1JT8A 3HOWG 2Y0SG 4A3CG 3PSIA 1NJIC 3H3VH 3KF8B 1MKHA 1YVCA 1BBWA 2JQOA 1KIXA 5FJ8G 2IX1A 4OO1G 1DGSA 4IOAA 2ZM6L 2JE6I 2QGQA 4GLVB 1HR0Q 4KI0A 1FGUA 1X3GA 3CC7A 1XPUA 3HOXH 1HNWL 4RG1A 4YY3Q 4JI3L 2K75A 2N49A 2E5LL 1KL9A 1Q8KA 4JI2L 3M4PA 1NMGA 3CP0A 2E2IH 1C0AA 1OXVA 4DR1L 4LF5L 1S72A 1SRUA 1OXUA 1RL2A 4A3IG 3PIOA 2K14A 4A75A 2R7ZG 3RR5A 3WWVA 4A3MG 1I5FA 3S15H 5IYCG 1VQPA 3GTKH 1PH9A 3OTOL 2JA8H 2PMZE 3VDYA 4KHPQ 5GROA 2ATWA 1VQ6A 4JI6L 1N36Q 2C35B 2UU9L 1LM0A 4X64Q 3JAMc 1KC8C 2QEXA 4YWKA 3W1GA 1SN8A 1M1KC 1SMXA 3J81j 2VL6A 3PUVA 1VQ5A 4DV7Q 1L2FA 1XMQL 3L7ZC 2K4KA 4JV5L 2EIFA 2N8NA 1Y14B 3B6YA 3SGIA 1FL0A 1C9OA 2UUCQ 1VQGA 1JMCA 2Q2IA 5IP7H 1M90C 3K7UC 1X55A 2OQKA 4AYBG 1R9TH 2AHOB 3TS0A 4IPDA 2CKZB 2RHSB 4R4TA 1XNRL 3KJOA 5LMNW 1VQJA 1VQCA 4OX9L 2IT1A 3F1ZA 1YHAA 1Q81C 2VQFL 5IYCH 4LFAQ 2ES2A 5JJKA 1QZGA 2E2JH 4LNQA 5HGQA 2R93H 2MO0A 2PNHA 2WB1E 4X62L 1VQLA 4AQYL 4A3LH 1KQSA 3CMEA 4NXNL 1ASZA 4DR6L 1Z47A 2D62A 3GTJH 4BA2I 4BBRH 4LF9Q 3PUYA 2JEAI 2NVQH 4DR2Q 3E9HA 4A3DG 4LFBQ 4B3RQ 3A5UA 2VQEQ 1CUKA 3NENA 3K8AA 2ID0A 3PO3G 4EX5A 3S14H 1VS0A 2RHQB 3ULLA 5M3MG 2PI2A 1K8GA 1VQMA 3T1YL 1J5EQ 4L5RC 1VQHA 1OXSC 1J5EL 1E1OA 3KDFA 1UE1A 2NVTH 1HZBA 1IBML 1ASYA 4K0KQ 3CXCA 4KHZA 4GKKL 4QGUA 3K7AH 1G51A 2JA9A 4GOPB 2CCZA 4LF9L 2KENA 3HOVG 4LF4Q 2EQSA 2D0OA 3BJUA 2CWAA 4JI8L 4NXNQ 1W2BA 4JI5Q 1YI2A 4QIWE 1E22A 1EQRA 1LYLA 4XIGS 4JBKA 5GAGC 2PI2E 1WI5A 2K5VA 3EN2A 2RF4A 1Y1WH 1P16A 1BKBA 2UUAQ 3PIPA 1L1OB 3ERSX 3FHWA 1HZCA 1YEZA 2IHFA 1S40A 1HR0W 3M4QA 2F3IA 4GLAC 1BBUA 3MXNB 2VW9A 3KF6B 1X56A 4A4IA 2I5LX 1QVFA 3U4VA 5LMUL 4OXPA 3TRZA 3HFZB 3ULJA 4LFCQ 5M5WH 1V43A 5HY6A 4EQ5A 2Z6KC 2HHHL 3HOXG 2UUBL 3I7FA 1I50H 4X65Q 4DV7L 1I94L 1T9HA 1X65A 1VQKA 2UXBL 1K3RA 1PH7A 4JI4L 2VUMG 3W5OA 3J81c 4PG3A 4MNOA 4JI6Q 3E0EA 3FP9A 1IBLL 1VQBA 1JE5A 4ME3A 1TWGH 4DR3Q 4UY8C 4P73A 3KOJA 1IZ6A 2IHEA 5IY0A 4HIOA 1VQ4A 3STBD 4QJFA 4DV2L 4DR5Q 1PHJA 3M7NA 5GAEC 3JC66 1CKOA 1GVPA 3HOYG 4JCVE 3J7A5 5FLMG 1B70B 4DV2Q 4JI3Q 4IPGA 2A19A 4HJAA 4UP8A 5DLQE 3S1RH 4GN3B 3DM3A 3CCVA 1YHQA 1PH8A 2BH2A 3H3VI 1HNWQ 5IP9H 2HHHQ 5C0XJ 2YV5A 2ZM6Q 3U4ZA 2JJQA 2N78A 2YU9H 1WOCA 3S16H 3HOZH 1VQDA 2UXBQ 2ASBA 2ZJQA 5GQOA 5AJ3L 4X65L 1Q86C 1X3FA 4A3FH 1I94Q 2NN6G 2UUBQ 2UXCQ 1MJCA 3E9IA 1VQOA 5JJLA 2I5HA 4A3GG 4LFCL 4MTNA 1A8VA 2Y0SE 3M85A 2IX0A 2JA5G 5M5XH 3KFUA 3I4OA 2HT1A 4DR4L 4HIKA 2KHJA 3ER0A 4PZ7A 3UE1A 3J80i 3RN5A 1OTCA 4UP7A 3I56A 3L2PA 4ALPA 3HOYH 1UWVA 2VS1A 3RNUA 4DR7L 4LF4L 4NXML 1AE3A 2UUAL 3NELA 2ZTDA 3KDFB 1K9MC 4YCWA 4JBMA 4GKKQ 4BY1H 3EIVA 4IFDG 2UXDL 2CQOA 4R4IA 4LUVA 5C3EG 4HIDA 3H15A 5M3FG 2B29A 4OO1I 3RLFA 5FLXc 2F52A 2WAQG 2WP8J 3U50C 4J15A 5C44H 4L5QA 3T1YQ 1PH5A 4A3CH 3UDXA 4LF6Q 3M3YH 1TWCH 1VQ9A 1IBMQ 4K0KL 2LXKA 3AEVA 1EWIA 1EIFA 2K52A 4TQUS 1YJ9A 3GTLH 4DUZL 3K80C 4A3GH 4B3RL 5H1SE 4LUZA 2VUMH 4DR6Q 1TXYA 2KCTA 3TQYA 3LGJA 5C4XG 1NY4A 2YYZA 2ZTCA 4AQYQ 3PUZA 4NB3A 3I55A 2UXDQ 4DR2L 1WYDA 2R7FA 2VQFQ 1LTLA 3GTQH 5GADC 2GVAA 3I4NG 4NXMQ 4OX9Q 2PQAB 1RIPA 3TS2A 4LUOA 4BBSG 1V9PA 4DR7Q 2XGTA 4BXXG 5IT9c 5FLMH 5C3EH 4BXXH 4GS3A 1WFQA 3FKIG 3A0JA 4DV3Q 3RZDH 2VY3A 4DK3C 1D7QA 4AH6A 5C0XI 2K5NA 4A76A 4DR4Q 4PZ8A 5IWAQ 4P75A 1XNRQ 4JYAQ 5FJ8H 1O7IA 2GVBA 3S2HH 3AFPA 1KAWA 4A3JG 2WAQE 4A3KH 1XMQQ 4GOPA 1GM5A 1JJCB 1VQ8A 5IP7G 2UUCL 3BZCA 1N33Q 4X64L 4HJ8A 1H95A 1PH4A 1PH6A 2FXQA 1NBWA 5C4JH 2AKWB 2Q2HA 4DV0L 2MO1A 2JA5H 3CCEA 2YTVA 1AH9A 4JV5Q 4UP9A 3BU2A 3UDGA 4GN5A 2JEBI 4A3IH 3GTOH 3ULPA 3RLNA 1SFOH 3ZJYC 4QL5A 4A3MH 3J7ZC 3CCRA 1J6QA 3H0GG 4DV5L 3UDIA 3H0GH 1SLJA 3GTGH 3I2ZA 4JI2Q 3OTOQ 4DR5L 2E5LQ 1YITA 4A93H 4A3DH 5IP9G 4WJ4A 1C7YA 5JEAG 4DR3L 2R6GA 4R4QA 2AWOA 2Q2UA 1IBLQ 3OYYA 4DR1Q 4LF5Q 3D0FA 4DPGA 3PO2H 3CD6A 1HJPA 1CSQA 3PO2G 1PH2A 4A3JH 4JI4Q 2OTJA 1D8LA 1BVSA 4OONA 2R7DA 1U5KA 3GDEA 1PA6A 2EXDA 4JBWA 5IYDH 1EIYB 2K50A 3EBEA 3GTPH 2B3GA 1QZHA 4C3JH 1OXXK 4MZ9A 2YTYA 3TREA 5LMUQ 1WJJA 3W1BA 1N32Q 2A1AA 4DKAC 2B63G 2XTIA 4C2MH 3PUWA 3HOVH 1IYJB 5BR8Q 1CKMA 3G4SA 4YHHL 1XNQQ 1GKHA 1GD7A 3G71A 3F8TA 5IE8A 4PMWA 1WCMG 4JI7L 3RLOA 1Y1VH 4P74A 2HIXA 1L1OA 3UDFA 4GKJQ 1V1QA 2CWPA 2F4VL 4JI5L 1XMOQ 2BH8A 1QUQA 4JI8Q 5M3MH 3HOWH 4YWMA 5LMNL 4JBJA 3KF6A 1YNXA 4A3BH 1CKNB 4IFDJ 3HOUG 1EYGA 2PQAA 2CFMA 1HZ9A 1Q82C 1B7YB 4P72A 4DV6L 1PYSB 2I5MX 5ELNA 1N34L 3I4MG 4GNXC 4B3TL 3I4MH 3GO5A 1VQIA 1OXTA 1X6OA 3JAMi 4HJ7A 1VQEA 3U58A 1HNZQ 3PCOB 3PGZA 2VZAA 4PZ6A 4HIMA 2H5XA 4JG2A 1PVOA 3CW2C 5IYBG 1VQFA 1GO3E 2WFWA 2VQEL 1A62A 1YJWA 1XPRA 4L5SA 1FJGQ 1VCIA 4LFBL 5K36G 2DGYA 1Q1BA 3S24A 1TWAH 4JI1Q 1E7ZA 1HNXL 3PF5A 1FJGL 3DLLA 2GN5A 2DUDA 2I0QA 3T1HQ 3CCLA 4A3LG 1YHBA 3M9BA 4X62Q 2OCEA 4DUYQ 2QA4A 4LF7L 2Z6KA 1G291 4FDBA 2A8VA 2NVYH 4R1JA 4LFAL 4A93G 1HNZL 1B8AA 2KBNA 3FKIH 5JEAJ 4GOPC 3OW2A 4DAYB 1IBKL 1YIJA 3HKSA 4B3TQ 1I6HH 3J81i 1CKNA 4A3EG 1EQQA 1K83H 1N34Q 3A74A 3J80c 3HOZG 1SROA 1PYBA 4KLKA 1L0WA 1N8RC 1N9WA 3CCJA 4DV1Q 1NE3A 2AMCB 1L1OC 1SR3A 1PH3A 4WJ3M 1NMFA 2MFIA 2F4VQ 3A5ZB 3CF5A 3RN2A 4Y7NH 5GAHC 1EOVA 2R92G 1SE8A 3G6EA 2UU9Q 1N36L 1QVCA 3AYHB 1UEBA 1CSPA 4YHHQ 1XNQL 1E1TA 3CMAA 4KHPL 3GD7A 3ICEA 4BBRG 1Y1WG 4R4CA 1PFSA 4H02A 1X3EA 3L0OA 3CCMA 4IPCA 4RMFA 1HH2P 2KCMA 1UE7A 3PUXA 1MJEA 1YZ6A 3CCQA 5M3FH 4DV4L 3F2CA 1A0IA 3S17H 4YCUA 2OWOA 1YBYA 4B3SL 2JA7H 4LF8L 4O0AA 4YY3L 4A3BG 3HOUH 4Y52H 4JOIC 4OWTB 4B3SQ 5IYDG 3NBHB 4OWXB 2E8GA 1HR0L 4BA1I 4A3FG 1QVGA 2KHIA 1KXLA 1VQAA 3CCSA 3TEHB 1IL2A 2B63H 4X6AH 4POGA 1G6PA 3D31A 2RCNA 5E7NA 4LF8Q 1K8AC 4X66Q 3AFQA 4DV4Q 4C3HH 4DV5Q 3RZOH 1LUZA 2R7ZH 2VNUD 1K73C 1JJGA 1X9NA 1A63A 1Y1VG 1WCMH 2ZJRA 2BA1A 1VQNA 2OQ0A 5C0XG 4BBSH 1Q1EA 1KD1C 2JA8G 4DV0Q 1TWFH 1E3PA 3F2DA 2AWNA 4DV1L 4O2DA 2LSSA 3CC2A 4LWCA 1N33L 1W3SA 2D0PA 1KRSA 3PV0A 2MNAA 3S1MH 1U0LA 5C44G 2WB1G 3KLWA 4JI0L 3GTMH 4A3EH 3HKZG 1EFWA 1Q7YC 1MIUA 2NZHA 4A3KG 4JYAL 1NTGA 5IWAL 4GN4B 2Q2TA 1XPOA 5JJIA 1JJ2A 4DV3L 5IYBH 3CPWA 2ZJPA 5C4XH 3NEMA 3MEFA 4UPAA 4AYBE 4C3IH 2YTXA 3HKZE 3T1HL 4B3MQ 2JA6G 4QQBX 1HNXQ 4JI1L 4DAMA 2MQHA 5M5YH 4HJ9A 5EAYA 1IBKQ 3AQQA 2Z0SA 1Q12A 3CPFA 1HZAA 4XTCS 1XTDA 1PV4A 3I4NH 4BY7H 2R93G 1P8LA 4L5TA 4QY7A 2ALYB 1IXRA 4YCVA 3STBC 4DUYL 4LF7Q 4IJHA 3PF4A 3CC4A 2V1CC 1Q46A 4IPHA 1VQ7A 1YJNA 2OTLA 3K0XA 4POFA 3UE0A 3M4OH 4DUZQ 2IY5B 3BZKA 3K81C 1X54A 4IOCA 4B3ML 5ELOA 4DV6Q 1E24A 2JK8A 4YWLA 4DK6C 3KYHC 4JC0A 4DNIA 4LF6L 1TWHH 2JA7G 4TVAB 1AE2A 4IJLA 4P71A 1I3QH 5LMNQ 2L15A 1KHIA 1UE5A 1S3OA 4GNXB 3Q8DA 4NPSA 1JB7A 3F2BA 3KJPA 2HIVA
chains in the Genus database with same CATH superfamily
2JA6H 2NVXH 4JI0Q 1AZPA 2NZOA 2R7ZB 2NB0A 2E2HH 4RGMA 2BDOA 1EYCA 3QOJA 1K8MA 1QUQB 4XYQA 3CCUA 5CR3A 2FFKB 4HJ5A 1RF2D 1B50A 2KA7A 4IFDI 3S1QH 3IRBA 3PO3H 1GUWA 1HXYD 5AJ3Q 4RHRA 1QB5D 3HOWG 3PSIA 2PW5A 4NP5A 2IX1A 2JE6I 4XXEA 5E1FA 3QJYA 2K75A 4KV6A 1H9RA 3RZOB 4JI2L 5ELCA 4LF5L 2EYPA 1S72A 1OXUA 1GHJA 1PFBA 1BF4A 1I5FA 4O1NA 1TR5A 3HOWB 3VDYA 2ATWA 1EEFD 2C35B 2UU9L 1LM0A 4X64Q 2QEXA 1SMXA 3J81j 2K33A 1VMCA 1XMQL 4JV5L 3X3NA 2N8NA 3B6YA 3SGIA 3T51B 1SJHD 2DNEA 3TP5A 5C3WA 1JMCA 2Q2IA 4XYOA 5IP7H 4AYBG 1Y69U 1B1ZA 4IPDA 2RHSB 2KCNA 1TS4A 2ICIA 3OMGA 2IT1A 2VQFL 4LFAQ 4N9TA 4K5WA 4J1MA 1QZGA 4LNQA 1H9SB 5JPNC 1DONA 4ABNA 3GTPB 2DY8A 1D6EC 2Z6BA 2JEAI 3I90A 1EY6A 4A3DG 1ILQA 2V4DA 2G9HD 3A5UA 1ET9A 2RHQB 2Z1CA 3K6OA 1K8GA 3M4OB 3C1FA 3FKIB 2CW0C 1OXSC 3R93A 1E1OA 1UE1A 3Q0AA 1A6XA 4C3JG 1ASYA 4FP5D 4KHZA 1M4VA 3K7AH 2B2WC 4GOPB 2CCZA 2QDBA 1S5DD 3HOVG 5F2DA 2FMCA 2HQEA 3BJUA 4CDEC 2F0PA 4G57A 5E4WC 1E22A 1EQRA 1LYLA 4JBKA 4K8JA 4Y7NB 3ND8A 1HZCA 5TSSA 1BBUA 1S5CD 3MXNB 1HUNA 5IGEA 4HMIA 4A4IA 2F0GA 2Q8IB 2BDNA 1LTRD 2K1BA 2NYZD 5J1ZA 5LMUL 1LACA 2IL8A 4OXPA 3ULJA 5IGDA 5CBEE 3HOXG 2UUBL 3I7FA 2O4XA 3C1EA 1TWHB 2VUMG 2RQXA 3J81c 1PTOB 3FP9A 2C9OA 1TWGH 2ENBA 4CKEA 1IZ6A 4HIOA 3STBD 4DV2L 3R2TA 1PHJA 1LT3D 5GAEC 3JC66 1CKOA 3HOYG 5FLMG 1B70B 2KEDA 4WJ3M 3DM3A 3CCVA 3HEJA 3DWAA 2HHHQ 5LL6X 2N78A 1KNAA 3S16H 1STGA 3K5NA 5GQOA 1SNMA 3VR6A 5AJ3L 1I94Q 4EQNA 1G8ZD 1SE4A 2NN6G 2RKSA 2A6HC 5K5PA 3E9IA 1EL0A 2I5HA 4A3GG 4LFCL 3M85A 2RBMA 1R9TB 2K03A 2SNSA 4HIKA 2KHJA 3ER0A 4IUQA 3RN5A 5DM73 3I56A 3Q24A 2EYOA 3RNUA 2F0TA 4PMBA 3NTIA 1LTTD 2CQOA 4RH6A 1GHKA 3IL8A 1QJOA 1PTOC 2B29A 2WAQG 2WP8J 4HSVA 2K05A 3U50C 3T1YQ 1D1KA 1EY0A 5EKLA 4LF6Q 3M3YH 1IBMQ 2K52A 1YJ9A 3SDZA 3K80C 1C4QA 1O7ZA 5D65A 4LUZA 3RUZA 4DR6Q 3LGJA 4KN4C 1D1IA 1NY4A 4AQYQ 3DUZA 3I55A 4DR2L 2R7FA 4L8JA 2XWBB 1LTLA 3GTQH 4OX9Q 4LUOA 1V9PA 2K32A 2Z4HA 4BXXH 1TY2A 1RTNA 3FKIG 3MFGA 4UDUC 3W2DA 5C0XI 4P75A 1XNRQ 2EE1A 2KEEA 2KVMA 5D3IB 3S2HH 1KAWA 4DXFA 2RCFA 2UUCL 2ZXPA 5JVH3 1N33Q 1SDFA 4FXKC 5CV5A 4XQJA 1PH4A 1OO9B 2FXQA 1EIHA 2Q2HA 2JA5H 4LMQD 4UP9A 3GTOH 2L4NA 4A3IH 1SNCA 4QL5A 1J6QA 3H0GG 1K28A 5IGGA 1LO5D 1V1PB 2PCFB 5D3DA 2EVBA 3I2ZA 1HPCA 5IOCA 1KLGD 5IP9G 5LHY1 1U4LA 1C7YA 5FK9C 1L0XB 3U9SA 1TS5A 3PO2G 1CSQA 1QG7A 1PH2A 1D8LA 3HG9A 4OONA 2R7DA 5IYDH 3EBEA 1SJED 2B2TA 1CTMA 4C3JH 2NN6H 1DYQA 1OXXK 4MZ9A 3H0GB 3NE5B 3TREA 5LMUQ 4H0LC 1N32Q 1I4XA 2GA4B 4DNRB 4IQZA 3PUWA 1LABA 1CI3M 5BR8Q 4F7XA 1QNKA 2JA5B 2BE5C 1XNQQ 2EZVA 3H91A 3G71A 4M1UB 5IE8A 1SYDA 4O42A 1SYFA 4CKBA 1F2MA 4ZKBB 2BH8A 1EYAA 3HKZB 3HOWH 2VB2X 3GTQB 3NQIA 2WAQB 3P7JA 4DAYA 2I5MX 4B3TL 3DEOA 3GO5A 1OXTA 3U58A 1PMRA 1CQVA 3PCOB 1ZEQX 4PZ6A 2H5XA 3BYYB 3CW2C 2LKVA 3AU7A 2WFWA 1WTOA 5KYIA 4KD4A 1Y8OB 1TWAH 2EYJA 3HP3A 4A3MB 1E7ZA 1HNXL 1FJGL 2I0QA 3QR8A 1HRJA 3D8GA 2OCEA 2QA4A 1A2UA 4PV1C 4LFAL 2RSNA 3T16A 1B8AA 4DAYB 4HEDA 1YIJA 4DNTB 3EQLC 3HKSA 2XSCA 3HOZG 1BOSA 4C1NK 1PYBA 4KLKA 2PQEA 4UAIA 4DV1Q 1Q8IA 2NVXB 1E2WA 1PH3A 3HRZC 2WIIB 1PRTF 3T4AC 4DA2A 5GAHC 2R92G 2JA6B 2UU9Q 3J80L 1UEBA 4YHHQ 3E5SA 1D2BA 2F0LA 2WV6D 1UE7A 1DXMA 4RCNA 1K83B 5JVG3 4CDCC 3PIP3 1TWCB 2OWOA 4HSPA 2IWHA 1YBYA 4B3SL 2JA7H 4JK1C 4R8NA 3BYTB 2LFNA 3K7AB 4B3SQ 3A55A 2M2LA 4OWXB 2CW0D 1CM9A 2KHIA 2SDFA 3TBIB 2NVTB 3DM1A 1KXLA 3TEHB 1DOLA 1IL2A 5DM63 4X6AH 1E0BA 2PZTA 2WINB 4G7ZC 4POGA 2BOSA 1G6PA 3GTJB 5EPKA 3FRPB 5JOBA 4DV5Q 2R7ZH 4N8X1 1JJGA 2OQ0A 4BBSH 4DV0Q 4DV1L 1W3SA 4IN3A 4JI0L 2WB1G 5CMDA 1R4QB 1STYA 5IWAL 1JJ2A 5DEHA 2X69A 2ZJPA 3FPUB 2E74C 3NEMA 4UPAA 5EKKA 4AYBE 4OIJA 3NWTA 3HOVB 1HNXQ 3VR2A 1J9OA 5M5YH 5EAYA 3C46A 3GTKB 4KY7A 3CPFA 1PV4A 4ZCKA 4BY7H 3S15B 2R93G 4U68A 1CZWA 2ALYB 4DUYL 1CA5A 1X3PA 3NPPA 4K8IA 4YIJA 3CC4A 4IPHA 1YJNA 2OTLA 4DXGA 3M4OH 3BZKA 5JEAH 2PW7A 4IOCA 4DNIA 4JC0A 3I8ZA 2CHBD 4TVAB 1JC7A 4IJLA 4A93B 4P71A 1U4MA 3I4MB 1II3A 1KHIA 1S3OA 3Q8DA 1LTSD 3F2BA 1R4PB 2K28A 4EQOA 2M9VA 1A3UA 2Z8LA 4IUNA 2NN6I 4IURA 2LXJA 3PO3B 1EWHA 2BA0A 4GLXA 3VA5A 5ISRA 2MHVA 5KEEA 3TMEA 4GNXA 2PMZB 2D5DA 2MPMA 4IO9A 3EVQA 1N32L 2N3SA 3CQZH 1WTWA 1BCPC 3BG3A 4LW1A 2WACA 4AIMA 5A2QL 1Y8PB 3BDOA 1JT8A 1XJVA 4A3CG 2G5DA 5EQ0A 3KF8B 1MGSA 1BBWA 1KIXA 4RAUC 4OO1G 2ZM6L 1EZ8A 1HCZA 1SE2A 1X3GA 5IGCA 5AFWA 5ELDA 1HNWL 4YY3Q 1YNNC 4JI3L 2N49A 3VR3A 3K5LA 1Q8KA 3M4PA 1NMGA 1ENFA 4FF4A 1ESFA 3NXWA 1SRUA 3J7YW 4A75A 1DD2A 3S15H 4A3MG 4BY7B 3CU7A 5IYCG 1VQPA 2BE5D 2F0FA 1IKMA 2JA8H 4FF1A 5GROA 3S1QB 4JI6L 3JAMc 1KC8C 2F0DA 4KY5A 2Y0SB 4BY1B 3M7GA 4IUPA 4YWKA 3W1GA 2VL6A 3GTOB 3EA6A 1L2FA 4DV7Q 2PNRC 2K5QA 3K58A 2QCPX 1C9OA 1LT4D 2NUCA 2XNAC 1X55A 3NUCA 4R4TA 2TMPA 1V8QA 1VQJA 4OX9L 3VYSA 5NUCA 5IYCH 2E2JH 2NZ1D 2MO0A 2HDMA 4AQYL 4BBSB 1ASZA 1NAPA 2D62A 3MWYW 1SNPA 4Z9CB 4BA2I 4LF9Q 3K5OA 4DR6L 2NVQB 2NVQH 5E3FA 4LFBQ 1TY0A 3P20A 3PO3G 3KUPA 2ZXRA 3S14H 1VS0A 2PI2A 3T1YL 1J5EL 4A3IB 2NVTH 4K0KQ 1JCKB 1WTPA 1EZ6A 4K14A 1KABA 3MAQA 1TKWB 3L3OC 2CWAA 4JI8L 1SYGA 1W2BA 2IPKD 3C3LA 1KLUD 3N52A 1WI5A 4MN3A 4LAAA 2K5VA 3MFYA 3GV6A 2UUAQ 3MXNA 3PIPA 1S40A 4GLAC 1K3BC 3ITPA 4A3FB 3VYUA 1WD1A 4ZUIA 2A74C 4KN7C 3X3MA 1STAA 1JWSD 1KDAA 3HFZB 5M5WH 2IW3A 2HHHL 1EU3A 5I9OA 5J39A 4BS9A 2UXBL 5T1GA 4MNOA 1GUGA 2F4IA 3E0EA 2Q8TA 1IBLL 1VQBA 2K01A 4UY8C 4P73A 3KOJA 2HUGA 1B53A 1VMPA 3M7NA 1FNWA 1GVPA 4JCVE 3J7A5 4RWSC 4FXDA 2A19A 4UP8A 5DLQE 2O5IC 4J6HA 5IP9H 5C0XJ 3SK4A 3U4ZA 1EY8A 3BZDB 3HOZH 4PNYA 1GOZA 1VQDA 4BBRB 1FD7D 4F8MA 2F0NA 2XN9C 4EVOA 4X65L 4A3FH 1JORA 4KTAA 2JA5G 2DJFC 5M5XH 3KFUA 1EQTA 2MP1A 2A69C 4PZ7A 3UE1A 1OTCA 4UP7A 1HUMA 5C4JB 3K59A 3L2PA 3Q23A 4WRDA 4KKTA 5FO9B 4NXML 2F0SA 3R3OA 1PRTD 3I72A 4IFDG 1S5FD 1JOQA 4J8QA 1XXGA 4A3GB 2F03A 2QDLA 5M3FG 5EPJA 2F0UA 5FLXc 2IJ0A 2F52A 5C44H 4J15A 1LLRD 5ELBA 1VQ9A 1RHPA 3MZ5A 1V1OA 3GTLH 1ZYRC 4DUZL 2VB3X 4IALA 2NTSA 1TXYA 1CFMA 5C4XG 2CVRA 3PUZA 4NB3A 5COYA 1EIGA 2UXDQ 2VQFQ 4V190 5GADC 3M4YA 4Q5VA 4BBSG 4DR7Q 4BXXG 5C3EH 1MSHA 4BWGB 2H1EA 3A0JA 3RZDH 4DR4Q 3OSOA 4DAVA 4ZLTF 1W6JA 1T5EA 5KNDA 2F0KA 4JYAQ 3PIO3 4A3JG 1XMQQ 1GM5A 1JJCB 3BZCA 1ICWA 1GJXA 4X64L 4HJ8A 1BCPB 1SMYD 2PZWA 4HMJA 2MO1A 3CCEA 2YTVA 1SNDA 3UDGA 3RLNA 2B2VA 2F0JA 3CCRA 4RFBA 3UDIA 2RDGA 4K5XA 3KLRA 5FKAC 4KHVA 3SHLA 4JI2Q 3UI2A 4R8IA 3OTOQ 5KNBA 4DR5L 3U9OA 1YITA 2PO4A 4DR3L 1BNZA 2AWOA 2ZXOA 3MVVA 2KCCA 4DR1Q 3D0FA 3CD6A 1HJPA 3IFDA 4JI4Q 2A6EC 1NUCA 1BVSA 3GDEA 3I73A 4QB4A 4JBWA 3D4RA 4K2KA 3GTPH 2B3GA 3C2PA 2PYKA 1LTGD 1D5ZC 2KJXA 2B63G 2XTIA 4C2MH 3FPPA 3TZDA 1IYJB 5M3FB 3CQZB 1GKHA 4ZYSA 3K5MA 1F9QA 1GD7A 3F8TA 3FDTA 3TDQA 1O7LA 1LTBD 1L1OA 2SOBA 2F4VL 1XMOQ 1QUQA 4AYBB 5M3MH 4YWMA 1MD2D 3KF6A 1YNXA 5I6WA 2B2VC 2KQ3A 1EYGA 1HZ9A 2JN4A 1PYSB 5ELNA 1N34L 3I4MH 2CH4W 1AZQA 3PGZA 2DY7A 5IYBG 3V2TA 1EFID 3GTGB 2VQEL 4L5SA 1Q1BA 4FVMA 1XTCD 4JI1Q 2L12A 3DXJC 3PF5A 1G2TA 3DLLA 2AQ1B 3T1HQ 3M9BA 5IGBA 2IX3A 4FDBA 2NVYH 2RSOA 4R1JA 1HNZL 3KF8A 4TKOB 4MHEA 3OW2A 1IBKL 1CKNA 4XT3B 4CKCA 3A74A 1PRTC 3KLSA 2AQ3B 2JYOA 5CV8A 1NE3A 5M9OA 1SR3A 1NMFA 2MGSA 5I4DA 1PXUA 2A69D 1UNSA 1DOMA 4RCOA 4Y7NH 1ONLA 1SE8A 5C3EB 1CSPA 4KHPL 2FHTA 3GD7A 4BBRG 3L0OA 4EQPA 3CCMA 4RMFA 4L6TB 1KDBA 3PUXA 3CCQA 4DV4L 4LF8L 4O0AA 2D2CC 3HOUH 3A54A 3H94A 1HR0L 2KECA 4A3FG 2G9DA 1VQAA 3CCSA 2KOLA 1ML0D 1B3QA 3EJIA 2WKCA 2RCNA 4LF8Q 1K8AC 1BQQT 4DV4Q 1GXDC 1ZXTA 4C3HH 1LUZA 2E2JB 1ENCA 1A63A 3MXPA 1VQNA 3SK8A 1KD1C 1IYVA 2F1MA 1Y1VB 2LSSA 2EPBA 4LWCA 1YNJD 1KRSA 1U0LA 2EYMA 2L9HA 5IODA 2NZHA 2Q2TA 2K7VA 5BN5A 4OHJA 5JJIA 2B8FA 3IKJA 3I70A 3QOLA 4DV3L 1KAAA 1IKLA 3HOZB 2X6GA 3CRKC 5C4XH 1I4QA 4NKLA 4ME5A 4C3IH 3HKZE 3VYTA 2JA6G 1TS2A 2R92B 4JVZA 1IBKQ 1EY4A 1PZKD 2MUYA 1Q12A 2B2UC 3L9AX 4XTCS 1XTDA 1JQYD 2B2TC 4QY7A 5T1IA 1FGBD 2QILA 4IJHA 5A35A 3PF4A 2V1CC 2K5WA 1LTID 2ZT9C 1X54A 2K04A 4B3ML 1U4RA 2JK8A 2JA7G 1STHA 1AE2A 5LMNQ 1UE5A 2F0OA 4GNXB 4NPSA 3KJPA 1PDQA 4GKJL 1QE6A 4DK0A 1SMYC 1KRTA 5M5YB 3ONAB 1Z9FA 4QUFA 2OT2A 4BY7G 1Q3LA 2R92H 4Q0FA 1XMOL 5CV6A 1RCVD 1K0RA 2O5JC 1EY9A 1H9MA 3CAMA 3G48A 4C2MB 4JOIA 4APVA 1K0SA 2E2DC 1S5ED 3S2DH 4X66L 1JWUD 4R4OA 1RKNA 2UXCL 3PMFA 2Y0SG 3CKIB 5IGFA 3DEPA 3NTHA 3VA7A 1DGSA 2D9UA 1QWYA 3S14B 4IOAA 2HD3A 4GLVB 4KI0A 1FGUA 3CC7A 4FNFA 1XPUA 3HOXH 3JAML 4RG1A 2E5LL 1KL9A 1MBYA 3URYA 2E2IH 3HZXA 1C0AA 1OXVA 4DR1L 1FNVA 2E2IB 1PTOF 1RL2A 4A3IG 2K14A 1STNA 3SK6A 3GTKH 1PH9A 4OIKA 3OTOL 4ZK9B 2PMZE 3EFXD 5C0XH 1N36Q 3EROA 2EY2A 1SN8A 1JICA 3L7ZC 1Y14B 1O80A 1U9RA 3DMUA 4QUCA 3TN2A 1HA5A 5FLXE 4DU9A 1M90C 4ZKCB 2CKZB 1TWFB 1YNND 1SBBB 5I6YA 3KJOA 1VQCA 1F77A 1FR3A 1Q81C 2ES2A 4CJ0B 5KYLA 1DJRD 2WB1E 2EYHA 4X62L 3CMEA 4NXNL 1IW7C 1RD9D 1Z47A 3GTJH 2PPBC 3PUYA 1GUNA 4B3RQ 3NENA 3K8AA 4K6DA 1NNXA 4EX5A 5M3MG 2A6HD 2L11A 1VQHA 1MHWC 2JXMB 1HZBA 1UUPA 3NWSA 4QGUA 1EQVA 2KENA 2DNCA 2CH4A 2D0OA 4NXNQ 3J7AV 4JI5Q 1PRTB 4QIWE 4XIGS 1HQMC 5GAGC 2PI2E 4TSSA 3EN2A 5I9PA 1P16A 3P75A 1YEZA 2IHFA 5L37A 5C5MA 3M4QA 1JR0D 1SXTA 4KJNA 1FNUA 1PYWD 2I5LX 1QVFA 2QKIC 3GP7A 1ZKOA 1CQFA 5HY6A 4EQ5A 2Z6KC 2A68D 4X65Q 1I50H 1STEA 1T9HA 1X65A 1EWCA 1VQKA 2VUMB 3I91A 4KK7A 3W5OA 2YU9B 3SVMA 1I6HB 4ME3A 4C3HG 1TWAB 5IY0A 3DWPA 1VQ4A 1E2ZA 3MTSA 4IPGA 5CV4A 3HS0C 1PH8A 4FYDA 4DAPA 4CDDC 5CC4A 2YV5A 3HGBA 2JJQA 1BR9A 4HTHA 2L1BA 1PFNA 2UXBQ 3E0JA 3HOXB 4ODGA 2UXCQ 2A68C 3T56B 3VR5A 3HOYB 4B9XA 5EKIA 3T13A 2EYLA 4MTNA 1A8VA 2Y0SE 3OWFA 2IX0A 5G3LF 1HA6A 2A73B 4QIWB 4A3BB 1C48A 3J80i 2EY6A 2L5TA 4ALPA 1UWVA 1X3QA 2VS1A 4LF4L 1AE3A 2UUAL 1Y1WB 3S1RB 2QEJC 1QILA 3KDFB 2XRSD 4IUTA 2EJGC 4YCWA 2NVYB 5DNFA 4BY1H 4GKKQ 4LUVA 5C3EG 1O78A 1SNOA 4HIDA 1BUVT 3RLFA 3NBIA 2N55A 2RVLA 4L5QA 3UDXA 4G7HC 1TWCH 4K0KL 3T53B 4P2CB 4A3GH 4TQUS 1SYCA 2KHSA 4M8AA 1UAPA 2KCTA 2A5HA 3TQYA 5ELEA 1VF5C 3PO2B 2YYZA 2ZTCA 3H6MA 1EEID 4CBVA 3D3RA 2GVAA 2PQAB 5EBDA 1EY7A 1SYEA 3OWEB 5FLMH 5HGTA 1S5BD 4GS3A 1WFQA 1BCPD 3RMHA 2VY3A 4DV3Q 4G7OC 2K5NA 1L0YB 5M3MB 4PZ8A 4ILWA 3S2HB 3LNNA 5FJ8H 5A2QE 4R9WA 2GVBA 3AFPA 2WAQE 4K6LA 4I7ZC 1VQ8A 5IP7G 1GUTA 4U673 2B63B 2FINB 1NBWA 3OW7A 5C4JH 2AKWB 3BU2A 4GN5A 2JEBI 3ULPA 4X3SA 3ZJYC 3I4LA 4CHTB 1ET6A 3GTGH 4A93H 4FF3A 5JEAG 2R6GA 4R4QA 2Q2UA 3OYYA 1JWMD 4A3JH 1NCVA 3G7LA 1G2SA 1LTAD 1U5KA 1IYUA 2EXDA 3NK9A 1EIYB 2K50A 4S3SA 2AUKA 2Z4IA 1H9KA 1Q90A 2OXPA 1WJJA 3W1BA 2F0MA 4DKAC 2OEOA 2B2YC 2XIWA 2AUJD 3A8KE 3ZYYX 1B44D 5EBCA 1CKMA 2L55A 2O2LD 1F9RA 3G4SA 4H7BA 1AFPA 4PMWA 1WCMG 4JI7L 1VDZA 3RLOA 1Y1VH 2HIXA 3UDFA 1V1QA 2CWPA 4WJWA 4JI5L 2FJ2A 4GZYC 5EJWA 3V96A 4JBJA 1F2YA 4A3BH 3A7LA 3RZDB 3HOUG 2DJGC 2CFMA 2PQAA 1Q82C 1A15A 4P72A 4DV6L 5IT9E 3WOFA 4OO1H 1BDOA 1I3QB 5CGKA 1X6OA 1VQEA 2KUMA 1HNZQ 2SNMA 4HIMA 2F0IA 3IAYA 3R2IA 1VQFA 4LJZC 1PLFA 4ZAIA 5I2XA 2QF7A 3ND9A 1XPRA 2DGYA 3S24A 4H44C 4RGTA 2GN5A 4C1NI 2E75C 2BCOA 5HURA 3CCLA 4X62Q 4DUYQ 4RKBA 3I4NB 3R8BA 3TP8A 2KBNA 3TP6A 2OF1A 2B2YA 2JA7B 1H9SA 3SE0A 2Q8RE 1QCBD 1U4PA 2EDGA 1EQQA 1N34Q 3S1NB 3OMCA 1AP0A 4JPBW 1N8RC 1N9WA 1IHZA 4MTKA 1JB3A 3CCJA 4A3KB 1BCPF 4TRDA 2AMCB 4RHSA 4E6IA 1L1OC 3NP8A 1Z7TA 3D6WA 4LK1C 1F9PA 2F4VQ 4OL7A 1SAPA 3BDLA 2HCCA 4WORA 1N36L 3WOEA 2F0HA 3AYHB 3CMAA 3QO2A 1PFSA 1QNUA 4H02A 4KKSA 2HCIA 5CYUA 2KCMA 4ID6A 3F2CA 1A0IA 3S17H 1DOKA 1ZYRD 4JOIC 4OWTB 5IYDG 4BA1I 1QVGA 3E3XA 2EY1A 5E7NA 3TSSA 2EYFA 1I50B 4X66Q 4N8FA 4B08A 3RZOH 4A3EB 4DF7A 1K73C 4XT1B 1B4OA 1WCMH 5EPLA 5E4XA 4XQQA 5C0XG 1Q1EA 1E3PA 4EGVA 3F2DA 1EOTA 4KD3A 2D0PA 3MHBA 2MNAA 3S1MH 5C44G 3KLWA 3GTMH 4A3EH 3HKZG 1EFWA 4JYAL 1NTGA 2XRQD 4GN4B 3K0YA 1WTRA 1XPOA 3H3VC 1TU2B 4QCLA 1BBXC 5JJZA 4B3MQ 2JSOA 5JPMC 2YTXA 2M00A 4X3KA 5K36H 4IUUA 1PZJD 2MQHA 4HJ9A 4ZRZA 2Z0SA 1HZAA 4N9PA 1P8LA 1KNEA 4L5TA 4YCVA 1TIID 4HN7A 4G4KA 3FMCA 1VQ7A 4POFA 3FVQA 4DUZQ 4RKLA 1YNJC 5ELOA 4DV6Q 1E24A 4DK6C 1I4HA 5FLXL 1TWHH 2EOTA 3G6JB 3OHXC 1I3QH 2L15A 3QG1A 5CBAE 1JB7A 4DPGA 5FOBB 1FVIA 4I7AA 4KMUC 1ESRA 4JI7Q 1ILPA 2DN8A 3DWQA 3SEBA 1NR4A 1EUJA 3AB9A 4OELB 4OWWB 1WTXA 2ZTEA 2MJ8A 3S2DB 2HQLA 1J8IA 3J81E 1SE3A 3ERQA 3S1NH 4F88A 3MC0B 2PZUA 5J3BA 2K5HA 5BN4A 2TSSA 4BY1G 3SK5A 3D6CA 1UE6A 5BR8L 1PH1A 1I6VC 1XWEA 3S9WA 1PZID 1TQOA 1NJIC 3H3VH 1MKHA 1YVCA 2JQOA 3OIPA 5FJ8G 3FEWX 1TT2A 2QGQA 3A8JE 1HR0Q 5KNCA 4JW0A 5EGTA 4C56C 1SSOA 3NSWA 3CP0A 2EY5A 1STBA 5BN3A 3PIOA 1SNQA 2LMCB 3RR5A 1PFMA 3WWVA 2R7ZG 1CK1A 2F3VA 4F87A 3MA2B 1EY5A 4KHPQ 3NBHA 4I65A 1VQ6A 1AW7A 1A3VA 3SR1A 1M1KC 3QIAA 1VQ5A 3PUVA 1V1PA 2R61A 2K4KA 2EIFA 5I2YA 3WDNA 4IUVA 1FYCA 3KBXA 1FL0A 2ICEC 1KDCA 4OGQC 2UUCQ 1RODA 1VQGA 3K7UC 2OQKA 4ULLA 1R9TH 2AHOB 3TS0A 2JP1A 1XNRL 4C3IG 5LMNW 3QWNA 2I46A 1WCMB 3S1MB 3F1ZA 1YHAA 2F0WA 5JJKA 1DM0B 3BVZA 5KGUA 5HGQA 2R93H 2PNHA 2EJMA 3TP7A 1VQLA 4A3LH 1KQSA 1HHVA 4BBRH 1LT6D 4A3JB 4IFDH 4DR2Q 3E9HA 1M8AA 4C3HB 2VQEQ 1CUKA 1T5XD 2ID0A 1G6ZA 3ULLA 4OEMB 1VQMA 4CJ2C 1LV9A 5FO8B 1J5EQ 4L5RC 5D14A 1HTPA 3KDFA 1IBML 3GV3A 4IZ8A 3CXCA 4GKKL 1HFGA 1G51A 2JA9A 4LF9L 4DFAA 4LF4Q 2EQSA 4MIUA 2RA4A 5J22A 1YI2A 2LS01 4RA8A 1BXTA 1ICFB 2RF4A 1Y1WH 1GUSA 1BKBA 2WB1B 3TZUA 1A2TA 1L1OB 3ERSX 3FHWA 1HR0W 2F3IA 3Q22A 1B3AA 1QOHA 2Z9HA 2VW9A 3KF6B 3LWUA 1X56A 4H13C 1IL8A 3JAME 3U4VA 3TRZA 4LFCQ 4WFN3 1V43A 1F9SA 1I4RA 1I94L 1JE4A 4DV7L 2B8GA 1CA6A 2F0VA 1K3RA 3KBGA 1PH7A 4JI4L 2J0TD 1Y8NB 4PG3A 4JI6Q 1EYDA 3IFTA 1JE5A 5CV7A 4DR3Q 2WKDA 2IHEA 4QJFA 4DR5Q 2QW7A 5LL6S 4KY6A 4DV2Q 4JI3Q 1GUOA 3HOUB 4HJAA 3S1RH 2BH2A 4GN3B 1HNWQ 3RD4A 1YHQA 3H3VI 3J81L 2ZM6Q 2XVSA 4PMCA 2YU9H 1WOCA 2ASBA 2ZJQA 1Q86C 1X3FA 2UUBQ 4UHVA 1MJCA 5C4ZA 1VQOA 1WTQA 5JJLA 5KRUA 4NW2A 3GTMB 5ELFA 5IT9L 3I4OA 2HT1A 4CDFC 4DR4L 5M5XB 4HR7B 2LY7A 1E2VA 4QF4A 3HOYH 4ZQ3A 4DR7L 3NELA 2F0QA 1I4PA 2ZTDA 4JBMA 3OOCA 1K9MC 2UXDL 3EIVA 4R4IA 3NQTA 3BVMA 4XQNA 3H15A 4L63B 1XYIA 4OO1I 1DCZA 3NTKA 4ZUJA 4DK1A 5C4HA 4A3CH 1PH5A 4DN4M 5CV9A 2LXKA 4C3IB 1G91A 3AEVA 1EWIA 1EIFA 4B3RL 5H1SE 3D4WA 3OIQA 2VUMH 1S4ZA 5C6AA 3AMUA 3LWEA 1WYDA 1HTLD 3I4NG 4NXMQ 1RIPA 3TS2A 2XGTA 3DHQA 5IT9c 2NWGA 1WVLA 4DK3C 1D7QA 4AH6A 1HQRD 4A76A 2C5CA 2VXWA 2RDFA 5IWAQ 4XDXA 1O7IA 3P1HA 4FO2A 4A3KH 1RDPD 3F2UA 4GOPA 1CHPD 4NDXA 1H95A 1PH6A 3Q6SA 2E2HB 4DV0L 1AH9A 2I07B 1MI2A 4JV5Q 1RJTA 1SFOH 1NSNS 4A3MH 2NBFA 3J7ZC 4DV5L 3H0GH 1SLJA 3S17B 1XX8A 5IIFA 3BS1A 2E5LQ 4V0BA 4A3DH 4WJ4A 3LX0A 1IBLQ 1CZGA 1TVXA 4LF5Q 1UEAB 3PO2H 2OTJA 1PA6A 2B2UA 4NMZA 3E6ZX 3GTLB 1QZHA 2R3ZA 3GQBA 2SEBD 2K6AA 4CGYB 2YTYA 1WD0A 4RGNA 2A1AA 2CQAA 2FMMA 1AEXA 4KKUA 1TWGB 5C5LA 3HOVH 4YHHL 1BO0A 2X6LA 2P5ZX 2B39A 1K8OA 3MEHA 2J4XA 2J7ZA 4P74A 4GKJQ 4FF2A 4FXGC 4JI8Q 5LMNL 1H9JA 1F2ZA 1CKNB 2AQ2B 3NHHA 1RTOA 4IFDJ 1B7YB 1AN8A 3CHBD 1D5MC 1SEBD 3I4MG 2JA8B 4GNXC 1VQIA 4PQXA 1KTKA 3JAMi 3N6RA 4HJ7A 2VZAA 1PVOA 4JG2A 3K57A 1GO3E 3M3YB 1A62A 1WTHA 1EU4A 1YJWA 1FJGQ 1VCIA 4LFBL 5K36G 5C44B 4DGZA 1IW7D 4B9WA 1W6KA 3A8IE 2DUDA 4A3LG 1YHBA 2E76C 4LF7L 2Z6KA 1G291 4X3UA 2A8VA 4RGOS 4A93G 1SFOB 3FKIH 5JEAJ 4GOPC 4X3TA 5JAVA 1B9NA 3I3CA 5CORA 4B3TQ 1I6HH 3J81i 4A3EG 1K83H 3J80c 3A56A 1NR2A 1SROA 3QB3A 1L0WA 2F0EA 1MSGA 1HFNA 2A6ED 5KIXA 5M5WB 2MFIA 2R93B 3A5ZB 3CF5A 3MXGA 3RN2A 1ENAA 2L0CA 1EOVA 3G6EA 2RDHA 1QVCA 1A3TA 2NTTA 4K5VA 1XNQL 1E1TA 3ICEA 2B2WA 1Y1WG 4R4CA 1X3EA 1VF7A 4IPCA 1HH2P 1MJEA 1YZ6A 5M3FH 4YCUA 4A3BG 4Y52H 4YY3L 1LT5D 3NBHB 3KK7A 2E8GA 4HCEA 3W3AA 1PTOH 1X32A 1DZ1A 2EJFC 5C4XB 2B63H 4HAEA 1SYBA 3D31A 3BDCA 2HDLA 3AFQA 3OPOA 2K5DA 3V05A 1B2TA 1B9MA 2VNUD 3J7AF 4CJ1B 1X9NA 1Y1VG 3PQIA 2ZJRA 2BA1A 3A7AB 2JA8G 1TWFH 2F3WA 1CHQD 3CRLC 5DAUA 2AWNA 4O2DA 3CC2A 1N33L 3VR4A 3PV0A 3BVGA 3SXHA 3O13A 1Z6HA 2H4OA 3S16B 1WTVA 1Q7YC 1MIUA 4A3KG 5FO7B 3D4DA 2N88A 1O7YA 5IYBH 3CPWA 5C3XA 3VYRA 3MEFA 3T1HL 1CT1D 4C3JB 3MXUA 4QQBX 4JI1L 4DAMA 1C8CA 3AQQA 1JOKA 3I4NH 3KLSX 4LF7Q 5G3LD 1IXRA 3STBC 3J80E 1Q46A 4A3DB 3K0XA 1I4GA 1PTOD 3UE0A 4QMGA 2IY5B 2XWJB 4KJOA 3K81C 3H09A 4YWLA 4HCSA 2EXZA 3KYHC 4LF6L 1F2LA 1JOOA 4K2LA 1D5XC 1TS3A 2HIVA
chains in the Genus database with same CATH topology
4GKJL 1FVIA 2JA6H 2NVXH 4JI7Q 4JI0Q 1EUJA 1KRTA 4OWWB 2NN6I 1Z9FA 2ZTEA 2NZOA 4BY7G 2LXJA 2R92H 2HQLA 2BA0A 1XMOL 4GLXA 2E2HH 3S1NH 1K0RA 4GNXA 3CAMA 3G48A 1QUQB 3CCUA 5J3BA 4IO9A 4JOIA 1N32L 2K5HA 2N3SA 4APVA 4HJ5A 3CQZH 4BY1G 4IFDI 4LW1A 3S1QH 3IRBA 4AIMA 3PO3H 4X66L 3S2DH 4R4OA 1UE6A 5BR8L 1PH1A 5AJ3Q 2UXCL 1XJVA 1JT8A 3HOWG 2Y0SG 4A3CG 3PSIA 1NJIC 3H3VH 3KF8B 1MKHA 1YVCA 1BBWA 2JQOA 1KIXA 5FJ8G 2IX1A 4OO1G 1DGSA 4IOAA 2ZM6L 2JE6I 2QGQA 4GLVB 1HR0Q 4KI0A 1FGUA 1X3GA 3CC7A 1XPUA 3HOXH 1HNWL 4RG1A 4YY3Q 4JI3L 2K75A 2N49A 2E5LL 1KL9A 1Q8KA 4JI2L 3M4PA 1NMGA 3CP0A 2E2IH 1C0AA 1OXVA 4DR1L 4LF5L 1S72A 1SRUA 1OXUA 1RL2A 4A3IG 3PIOA 2K14A 4A75A 2R7ZG 3RR5A 3WWVA 4A3MG 1I5FA 3S15H 5IYCG 1VQPA 3GTKH 1PH9A 3OTOL 2JA8H 2PMZE 3VDYA 4KHPQ 5GROA 2ATWA 1VQ6A 4JI6L 1N36Q 2C35B 2UU9L 1LM0A 4X64Q 3JAMc 1KC8C 2QEXA 4YWKA 3W1GA 1SN8A 1M1KC 1SMXA 3J81j 2VL6A 3PUVA 1VQ5A 4DV7Q 1L2FA 1XMQL 3L7ZC 2K4KA 4JV5L 2EIFA 2N8NA 1Y14B 3B6YA 3SGIA 1FL0A 1C9OA 2UUCQ 1VQGA 1JMCA 2Q2IA 5IP7H 1M90C 3K7UC 1X55A 2OQKA 4AYBG 1R9TH 2AHOB 3TS0A 4IPDA 2CKZB 2RHSB 4R4TA 1XNRL 3KJOA 5LMNW 1VQJA 1VQCA 4OX9L 2IT1A 3F1ZA 1YHAA 1Q81C 2VQFL 5IYCH 4LFAQ 2ES2A 5JJKA 1QZGA 2E2JH 4LNQA 5HGQA 2R93H 2MO0A 2PNHA 2WB1E 4X62L 1VQLA 4AQYL 4A3LH 1KQSA 3CMEA 4NXNL 1ASZA 4DR6L 1Z47A 2D62A 3GTJH 4BA2I 4BBRH 4LF9Q 3PUYA 2JEAI 2NVQH 4DR2Q 3E9HA 4A3DG 4LFBQ 4B3RQ 3A5UA 2VQEQ 1CUKA 3NENA 3K8AA 2ID0A 3PO3G 4EX5A 3S14H 1VS0A 2RHQB 3ULLA 5M3MG 2PI2A 1K8GA 1VQMA 3T1YL 1J5EQ 4L5RC 1VQHA 1OXSC 1J5EL 1E1OA 3KDFA 1UE1A 2NVTH 1HZBA 1IBML 1ASYA 4K0KQ 3CXCA 4KHZA 4GKKL 4QGUA 3K7AH 1G51A 2JA9A 4GOPB 2CCZA 4LF9L 2KENA 3HOVG 4LF4Q 2EQSA 2D0OA 3BJUA 2CWAA 4JI8L 4NXNQ 1W2BA 4JI5Q 1YI2A 4QIWE 1E22A 1EQRA 1LYLA 4XIGS 4JBKA 5GAGC 2PI2E 1WI5A 2K5VA 3EN2A 2RF4A 1Y1WH 1P16A 1BKBA 2UUAQ 3PIPA 1L1OB 3ERSX 3FHWA 1HZCA 1YEZA 2IHFA 1S40A 1HR0W 3M4QA 2F3IA 4GLAC 1BBUA 3MXNB 2VW9A 3KF6B 1X56A 4A4IA 2I5LX 1QVFA 3U4VA 5LMUL 4OXPA 3TRZA 3HFZB 3ULJA 4LFCQ 5M5WH 1V43A 5HY6A 4EQ5A 2Z6KC 2HHHL 3HOXG 2UUBL 3I7FA 1I50H 4X65Q 4DV7L 1I94L 1T9HA 1X65A 1VQKA 2UXBL 1K3RA 1PH7A 4JI4L 2VUMG 3W5OA 3J81c 4PG3A 4MNOA 4JI6Q 3E0EA 3FP9A 1IBLL 1VQBA 1JE5A 4ME3A 1TWGH 4DR3Q 4UY8C 4P73A 3KOJA 1IZ6A 2IHEA 5IY0A 4HIOA 1VQ4A 3STBD 4QJFA 4DV2L 4DR5Q 1PHJA 3M7NA 5GAEC 3JC66 1CKOA 1GVPA 3HOYG 4JCVE 3J7A5 5FLMG 1B70B 4DV2Q 4JI3Q 4IPGA 2A19A 4HJAA 4UP8A 5DLQE 3S1RH 4GN3B 3DM3A 3CCVA 1YHQA 1PH8A 2BH2A 3H3VI 1HNWQ 5IP9H 2HHHQ 5C0XJ 2YV5A 2ZM6Q 3U4ZA 2JJQA 2N78A 2YU9H 1WOCA 3S16H 3HOZH 1VQDA 2UXBQ 2ASBA 2ZJQA 5GQOA 5AJ3L 4X65L 1Q86C 1X3FA 4A3FH 1I94Q 2NN6G 2UUBQ 2UXCQ 1MJCA 3E9IA 1VQOA 5JJLA 2I5HA 4A3GG 4LFCL 4MTNA 1A8VA 2Y0SE 3M85A 2IX0A 2JA5G 5M5XH 3KFUA 3I4OA 2HT1A 4DR4L 4HIKA 2KHJA 3ER0A 4PZ7A 3UE1A 3J80i 3RN5A 1OTCA 4UP7A 3I56A 3L2PA 4ALPA 3HOYH 1UWVA 2VS1A 3RNUA 4DR7L 4LF4L 4NXML 1AE3A 2UUAL 3NELA 2ZTDA 3KDFB 1K9MC 4YCWA 4JBMA 4GKKQ 4BY1H 3EIVA 4IFDG 2UXDL 2CQOA 4R4IA 4LUVA 5C3EG 4HIDA 3H15A 5M3FG 2B29A 4OO1I 3RLFA 5FLXc 2F52A 2WAQG 2WP8J 3U50C 4J15A 5C44H 4L5QA 3T1YQ 1PH5A 4A3CH 3UDXA 4LF6Q 3M3YH 1TWCH 1VQ9A 1IBMQ 4K0KL 2LXKA 3AEVA 1EWIA 1EIFA 2K52A 4TQUS 1YJ9A 3GTLH 4DUZL 3K80C 4A3GH 4B3RL 5H1SE 4LUZA 2VUMH 4DR6Q 1TXYA 2KCTA 3TQYA 3LGJA 5C4XG 1NY4A 2YYZA 2ZTCA 4AQYQ 3PUZA 4NB3A 3I55A 2UXDQ 4DR2L 1WYDA 2R7FA 2VQFQ 1LTLA 3GTQH 5GADC 2GVAA 3I4NG 4NXMQ 4OX9Q 2PQAB 1RIPA 3TS2A 4LUOA 4BBSG 1V9PA 4DR7Q 2XGTA 4BXXG 5IT9c 5FLMH 5C3EH 4BXXH 4GS3A 1WFQA 3FKIG 3A0JA 4DV3Q 3RZDH 2VY3A 4DK3C 1D7QA 4AH6A 5C0XI 2K5NA 4A76A 4DR4Q 4PZ8A 5IWAQ 4P75A 1XNRQ 4JYAQ 5FJ8H 1O7IA 2GVBA 3S2HH 3AFPA 1KAWA 4A3JG 2WAQE 4A3KH 1XMQQ 4GOPA 1GM5A 1JJCB 1VQ8A 5IP7G 2UUCL 3BZCA 1N33Q 4X64L 4HJ8A 1H95A 1PH4A 1PH6A 2FXQA 1NBWA 5C4JH 2AKWB 2Q2HA 4DV0L 2MO1A 2JA5H 3CCEA 2YTVA 1AH9A 4JV5Q 4UP9A 3BU2A 3UDGA 4GN5A 2JEBI 4A3IH 3GTOH 3ULPA 3RLNA 1SFOH 3ZJYC 4QL5A 4A3MH 3J7ZC 3CCRA 1J6QA 3H0GG 4DV5L 3UDIA 3H0GH 1SLJA 3GTGH 3I2ZA 4JI2Q 3OTOQ 4DR5L 2E5LQ 1YITA 4A93H 4A3DH 5IP9G 4WJ4A 1C7YA 5JEAG 4DR3L 2R6GA 4R4QA 2AWOA 2Q2UA 1IBLQ 3OYYA 4DR1Q 4LF5Q 3D0FA 4DPGA 3PO2H 3CD6A 1HJPA 1CSQA 3PO2G 1PH2A 4A3JH 4JI4Q 2OTJA 1D8LA 1BVSA 4OONA 2R7DA 1U5KA 3GDEA 1PA6A 2EXDA 4JBWA 5IYDH 1EIYB 2K50A 3EBEA 3GTPH 2B3GA 1QZHA 4C3JH 1OXXK 4MZ9A 2YTYA 3TREA 5LMUQ 1WJJA 3W1BA 1N32Q 2A1AA 4DKAC 2B63G 2XTIA 4C2MH 3PUWA 3HOVH 1IYJB 5BR8Q 1CKMA 3G4SA 4YHHL 1XNQQ 1GKHA 1GD7A 3G71A 3F8TA 5IE8A 4PMWA 1WCMG 4JI7L 3RLOA 1Y1VH 4P74A 2HIXA 1L1OA 3UDFA 4GKJQ 1V1QA 2CWPA 2F4VL 4JI5L 1XMOQ 2BH8A 1QUQA 4JI8Q 5M3MH 3HOWH 4YWMA 5LMNL 4JBJA 3KF6A 1YNXA 4A3BH 1CKNB 4IFDJ 3HOUG 1EYGA 2PQAA 2CFMA 1HZ9A 1Q82C 1B7YB 4P72A 4DV6L 1PYSB 2I5MX 5ELNA 1N34L 3I4MG 4GNXC 4B3TL 3I4MH 3GO5A 1VQIA 1OXTA 1X6OA 3JAMi 4HJ7A 1VQEA 3U58A 1HNZQ 3PCOB 3PGZA 2VZAA 4PZ6A 4HIMA 2H5XA 4JG2A 1PVOA 3CW2C 5IYBG 1VQFA 1GO3E 2WFWA 2VQEL 1A62A 1YJWA 1XPRA 4L5SA 1FJGQ 1VCIA 4LFBL 5K36G 2DGYA 1Q1BA 3S24A 1TWAH 4JI1Q 1E7ZA 1HNXL 3PF5A 1FJGL 3DLLA 2GN5A 2DUDA 2I0QA 3T1HQ 3CCLA 4A3LG 1YHBA 3M9BA 4X62Q 2OCEA 4DUYQ 2QA4A 4LF7L 2Z6KA 1G291 4FDBA 2A8VA 2NVYH 4R1JA 4LFAL 4A93G 1HNZL 1B8AA 2KBNA 3FKIH 5JEAJ 4GOPC 3OW2A 4DAYB 1IBKL 1YIJA 3HKSA 4B3TQ 1I6HH 3J81i 1CKNA 4A3EG 1EQQA 1K83H 1N34Q 3A74A 3J80c 3HOZG 1SROA 1PYBA 4KLKA 1L0WA 1N8RC 1N9WA 3CCJA 4DV1Q 1NE3A 2AMCB 1L1OC 1SR3A 1PH3A 4WJ3M 1NMFA 2MFIA 2F4VQ 3A5ZB 3CF5A 3RN2A 4Y7NH 5GAHC 1EOVA 2R92G 1SE8A 3G6EA 2UU9Q 1N36L 1QVCA 3AYHB 1UEBA 1CSPA 4YHHQ 1XNQL 1E1TA 3CMAA 4KHPL 3GD7A 3ICEA 4BBRG 1Y1WG 4R4CA 1PFSA 4H02A 1X3EA 3L0OA 3CCMA 4IPCA 4RMFA 1HH2P 2KCMA 1UE7A 3PUXA 1MJEA 1YZ6A 3CCQA 5M3FH 4DV4L 3F2CA 1A0IA 3S17H 4YCUA 2OWOA 1YBYA 4B3SL 2JA7H 4LF8L 4O0AA 4YY3L 4A3BG 3HOUH 4Y52H 4JOIC 4OWTB 4B3SQ 5IYDG 3NBHB 4OWXB 2E8GA 1HR0L 4BA1I 4A3FG 1QVGA 2KHIA 1KXLA 1VQAA 3CCSA 3TEHB 1IL2A 2B63H 4X6AH 4POGA 1G6PA 3D31A 2RCNA 5E7NA 4LF8Q 1K8AC 4X66Q 3AFQA 4DV4Q 4C3HH 4DV5Q 3RZOH 1LUZA 2R7ZH 2VNUD 1K73C 1JJGA 1X9NA 1A63A 1Y1VG 1WCMH 2ZJRA 2BA1A 1VQNA 2OQ0A 5C0XG 4BBSH 1Q1EA 1KD1C 2JA8G 4DV0Q 1TWFH 1E3PA 3F2DA 2AWNA 4DV1L 4O2DA 2LSSA 3CC2A 4LWCA 1N33L 1W3SA 2D0PA 1KRSA 3PV0A 2MNAA 3S1MH 1U0LA 5C44G 2WB1G 3KLWA 4JI0L 3GTMH 4A3EH 3HKZG 1EFWA 1Q7YC 1MIUA 2NZHA 4A3KG 4JYAL 1NTGA 5IWAL 4GN4B 2Q2TA 1XPOA 5JJIA 1JJ2A 4DV3L 5IYBH 3CPWA 2ZJPA 5C4XH 3NEMA 3MEFA 4UPAA 4AYBE 4C3IH 2YTXA 3HKZE 3T1HL 4B3MQ 2JA6G 4QQBX 1HNXQ 4JI1L 4DAMA 2MQHA 5M5YH 4HJ9A 5EAYA 1IBKQ 3AQQA 2Z0SA 1Q12A 3CPFA 1HZAA 4XTCS 1XTDA 1PV4A 3I4NH 4BY7H 2R93G 1P8LA 4L5TA 4QY7A 2ALYB 1IXRA 4YCVA 3STBC 4DUYL 4LF7Q 4IJHA 3PF4A 3CC4A 2V1CC 1Q46A 4IPHA 1VQ7A 1YJNA 2OTLA 3K0XA 4POFA 3UE0A 3M4OH 4DUZQ 2IY5B 3BZKA 3K81C 1X54A 4IOCA 4B3ML 5ELOA 4DV6Q 1E24A 2JK8A 4YWLA 4DK6C 3KYHC 4JC0A 4DNIA 4LF6L 1TWHH 2JA7G 4TVAB 1AE2A 4IJLA 4P71A 1I3QH 5LMNQ 2L15A 1KHIA 1UE5A 1S3OA 4GNXB 3Q8DA 4NPSA 1JB7A 3F2BA 3KJPA 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ L;  1FVI A;  2JA6 H;  2NVX H;  4JI7 Q;  4JI0 Q;  1EUJ A;  1KRT A;  4OWW B;  2NN6 I;  1Z9F A;  2ZTE A;  2NZO A;  4BY7 G;  2LXJ A;  2R92 H;  2HQL A;  2BA0 A;  1XMO L;  4GLX A;  2E2H H;  3S1N H;  1K0R A;  4GNX A;  3CAM A;  3G48 A;  1QUQ B;  3CCU A;  5J3B A;  4IO9 A;  4JOI A;  1N32 L;  2K5H A;  2N3S A;  4APV A;  4HJ5 A;  3CQZ H;  4BY1 G;  4IFD I;  4LW1 A;  3S1Q H;  3IRB A;  4AIM A;  3PO3 H;  4X66 L;  3S2D H;  4R4O A;  1UE6 A;  5BR8 L;  1PH1 A;  5AJ3 Q;  2UXC L;  1XJV A;  1JT8 A;  3HOW G;  2Y0S G;  4A3C G;  3PSI A;  1NJI C;  3H3V H;  3KF8 B;  1MKH A;  1YVC A;  1BBW A;  2JQO A;  1KIX A;  5FJ8 G;  2IX1 A;  4OO1 G;  1DGS A;  4IOA A;  2ZM6 L;  2JE6 I;  2QGQ A;  4GLV B;  1HR0 Q;  4KI0 A;  1FGU A;  1X3G A;  3CC7 A;  1XPU A;  3HOX H;  1HNW L;  4RG1 A;  4YY3 Q;  4JI3 L;  2K75 A;  2N49 A;  2E5L L;  1KL9 A;  1Q8K A;  4JI2 L;  3M4P A;  1NMG A;  3CP0 A;  2E2I H;  1C0A A;  1OXV A;  4DR1 L;  4LF5 L;  1S72 A;  1SRU A;  1OXU A;  1RL2 A;  4A3I G;  3PIO A;  2K14 A;  4A75 A;  2R7Z G;  3RR5 A;  3WWV A;  4A3M G;  1I5F A;  3S15 H;  5IYC G;  1VQP A;  3GTK H;  1PH9 A;  3OTO L;  2JA8 H;  2PMZ E;  3VDY A;  4KHP Q;  5GRO A;  2ATW A;  1VQ6 A;  4JI6 L;  1N36 Q;  2C35 B;  2UU9 L;  1LM0 A;  4X64 Q;  3JAM c;  1KC8 C;  2QEX A;  4YWK A;  3W1G A;  1SN8 A;  1M1K C;  1SMX A;  3J81 j;  2VL6 A;  3PUV A;  1VQ5 A;  4DV7 Q;  1L2F A;  1XMQ L;  3L7Z C;  2K4K A;  4JV5 L;  2EIF A;  2N8N A;  1Y14 B;  3B6Y A;  3SGI A;  1FL0 A;  1C9O A;  2UUC Q;  1VQG A;  1JMC A;  2Q2I A;  5IP7 H;  1M90 C;  3K7U C;  1X55 A;  2OQK A;  4AYB G;  1R9T H;  2AHO B;  3TS0 A;  4IPD A;  2CKZ B;  2RHS B;  4R4T A;  1XNR L;  3KJO A;  5LMN W;  1VQJ A;  1VQC A;  4OX9 L;  2IT1 A;  3F1Z A;  1YHA A;  1Q81 C;  2VQF L;  5IYC H;  4LFA Q;  2ES2 A;  5JJK A;  1QZG A;  2E2J H;  4LNQ A;  5HGQ A;  2R93 H;  2MO0 A;  2PNH A;  2WB1 E;  4X62 L;  1VQL A;  4AQY L;  4A3L H;  1KQS A;  3CME A;  4NXN L;  1ASZ A;  4DR6 L;  1Z47 A;  2D62 A;  3GTJ H;  4BA2 I;  4BBR H;  4LF9 Q;  3PUY A;  2JEA I;  2NVQ H;  4DR2 Q;  3E9H A;  4A3D G;  4LFB Q;  4B3R Q;  3A5U A;  2VQE Q;  1CUK A;  3NEN A;  3K8A A;  2ID0 A;  3PO3 G;  4EX5 A;  3S14 H;  1VS0 A;  2RHQ B;  3ULL A;  5M3M G;  2PI2 A;  1K8G A;  1VQM A;  3T1Y L;  1J5E Q;  4L5R C;  1VQH A;  1OXS C;  1J5E L;  1E1O A;  3KDF A;  1UE1 A;  2NVT H;  1HZB A;  1IBM L;  1ASY A;  4K0K Q;  3CXC A;  4KHZ A;  4GKK L;  4QGU A;  3K7A H;  1G51 A;  2JA9 A;  4GOP B;  2CCZ A;  4LF9 L;  2KEN A;  3HOV G;  4LF4 Q;  2EQS A;  2D0O A;  3BJU A;  2CWA A;  4JI8 L;  4NXN Q;  1W2B A;  4JI5 Q;  1YI2 A;  4QIW E;  1E22 A;  1EQR A;  1LYL A;  4XIG S;  4JBK A;  5GAG C;  2PI2 E;  1WI5 A;  2K5V A;  3EN2 A;  2RF4 A;  1Y1W H;  1P16 A;  1BKB A;  2UUA Q;  3PIP A;  1L1O B;  3ERS X;  3FHW A;  1HZC A;  1YEZ A;  2IHF A;  1S40 A;  1HR0 W;  3M4Q A;  2F3I A;  4GLA C;  1BBU A;  3MXN B;  2VW9 A;  3KF6 B;  1X56 A;  4A4I A;  2I5L X;  1QVF A;  3U4V A;  5LMU L;  4OXP A;  3TRZ A;  3HFZ B;  3ULJ A;  4LFC Q;  5M5W H;  1V43 A;  5HY6 A;  4EQ5 A;  2Z6K C;  2HHH L;  3HOX G;  2UUB L;  3I7F A;  1I50 H;  4X65 Q;  4DV7 L;  1I94 L;  1T9H A;  1X65 A;  1VQK A;  2UXB L;  1K3R A;  1PH7 A;  4JI4 L;  2VUM G;  3W5O A;  3J81 c;  4PG3 A;  4MNO A;  4JI6 Q;  3E0E A;  3FP9 A;  1IBL L;  1VQB A;  1JE5 A;  4ME3 A;  1TWG H;  4DR3 Q;  4UY8 C;  4P73 A;  3KOJ A;  1IZ6 A;  2IHE A;  5IY0 A;  4HIO A;  1VQ4 A;  3STB D;  4QJF A;  4DV2 L;  4DR5 Q;  1PHJ A;  3M7N A;  5GAE C;  3JC6 6;  1CKO A;  1GVP A;  3HOY G;  4JCV E;  3J7A 5;  5FLM G;  1B70 B;  4DV2 Q;  4JI3 Q;  4IPG A;  2A19 A;  4HJA A;  4UP8 A;  5DLQ E;  3S1R H;  4GN3 B;  3DM3 A;  3CCV A;  1YHQ A;  1PH8 A;  2BH2 A;  3H3V I;  1HNW Q;  5IP9 H;  2HHH Q;  5C0X J;  2YV5 A;  2ZM6 Q;  3U4Z A;  2JJQ A;  2N78 A;  2YU9 H;  1WOC A;  3S16 H;  3HOZ H;  1VQD A;  2UXB Q;  2ASB A;  2ZJQ A;  5GQO A;  5AJ3 L;  4X65 L;  1Q86 C;  1X3F A;  4A3F H;  1I94 Q;  2NN6 G;  2UUB Q;  2UXC Q;  1MJC A;  3E9I A;  1VQO A;  5JJL A;  2I5H A;  4A3G G;  4LFC L;  4MTN A;  1A8V A;  2Y0S E;  3M85 A;  2IX0 A;  2JA5 G;  5M5X H;  3KFU A;  3I4O A;  2HT1 A;  4DR4 L;  4HIK A;  2KHJ A;  3ER0 A;  4PZ7 A;  3UE1 A;  3J80 i;  3RN5 A;  1OTC A;  4UP7 A;  3I56 A;  3L2P A;  4ALP A;  3HOY H;  1UWV A;  2VS1 A;  3RNU A;  4DR7 L;  4LF4 L;  4NXM L;  1AE3 A;  2UUA L;  3NEL A;  2ZTD A;  3KDF B;  1K9M C;  4YCW A;  4JBM A;  4GKK Q;  4BY1 H;  3EIV A;  4IFD G;  2UXD L;  2CQO A;  4R4I A;  4LUV A;  5C3E G;  4HID A;  3H15 A;  5M3F G;  2B29 A;  4OO1 I;  3RLF A;  5FLX c;  2F52 A;  2WAQ G;  2WP8 J;  3U50 C;  4J15 A;  5C44 H;  4L5Q A;  3T1Y Q;  1PH5 A;  4A3C H;  3UDX A;  4LF6 Q;  3M3Y H;  1TWC H;  1VQ9 A;  1IBM Q;  4K0K L;  2LXK A;  3AEV A;  1EWI A;  1EIF A;  2K52 A;  4TQU S;  1YJ9 A;  3GTL H;  4DUZ L;  3K80 C;  4A3G H;  4B3R L;  5H1S E;  4LUZ A;  2VUM H;  4DR6 Q;  1TXY A;  2KCT A;  3TQY A;  3LGJ A;  5C4X G;  1NY4 A;  2YYZ A;  2ZTC A;  4AQY Q;  3PUZ A;  4NB3 A;  3I55 A;  2UXD Q;  4DR2 L;  1WYD A;  2R7F A;  2VQF Q;  1LTL A;  3GTQ H;  5GAD C;  2GVA A;  3I4N G;  4NXM Q;  4OX9 Q;  2PQA B;  1RIP A;  3TS2 A;  4LUO A;  4BBS G;  1V9P A;  4DR7 Q;  2XGT A;  4BXX G;  5IT9 c;  5FLM H;  5C3E H;  4BXX H;  4GS3 A;  1WFQ A;  3FKI G;  3A0J A;  4DV3 Q;  3RZD H;  2VY3 A;  4DK3 C;  1D7Q A;  4AH6 A;  5C0X I;  2K5N A;  4A76 A;  4DR4 Q;  4PZ8 A;  5IWA Q;  4P75 A;  1XNR Q;  4JYA Q;  5FJ8 H;  1O7I A;  2GVB A;  3S2H H;  3AFP A;  1KAW A;  4A3J G;  2WAQ E;  4A3K H;  1XMQ Q;  4GOP A;  1GM5 A;  1JJC B;  1VQ8 A;  5IP7 G;  2UUC L;  3BZC A;  1N33 Q;  4X64 L;  4HJ8 A;  1H95 A;  1PH4 A;  1PH6 A;  2FXQ A;  1NBW A;  5C4J H;  2AKW B;  2Q2H A;  4DV0 L;  2MO1 A;  2JA5 H;  3CCE A;  2YTV A;  1AH9 A;  4JV5 Q;  4UP9 A;  3BU2 A;  3UDG A;  4GN5 A;  2JEB I;  4A3I H;  3GTO H;  3ULP A;  3RLN A;  1SFO H;  3ZJY C;  4QL5 A;  4A3M H;  3J7Z C;  3CCR A;  1J6Q A;  3H0G G;  4DV5 L;  3UDI A;  3H0G H;  1SLJ A;  3GTG H;  3I2Z A;  4JI2 Q;  3OTO Q;  4DR5 L;  2E5L Q;  1YIT A;  4A93 H;  4A3D H;  5IP9 G;  4WJ4 A;  1C7Y A;  5JEA G;  4DR3 L;  2R6G A;  4R4Q A;  2AWO A;  2Q2U A;  1IBL Q;  3OYY A;  4DR1 Q;  4LF5 Q;  3D0F A;  4DPG A;  3PO2 H;  3CD6 A;  1HJP A;  1CSQ A;  3PO2 G;  1PH2 A;  4A3J H;  4JI4 Q;  2OTJ A;  1D8L A;  1BVS A;  4OON A;  2R7D A;  1U5K A;  3GDE A;  1PA6 A;  2EXD A;  4JBW A;  5IYD H;  1EIY B;  2K50 A;  3EBE A;  3GTP H;  2B3G A;  1QZH A;  4C3J H;  1OXX K;  4MZ9 A;  2YTY A;  3TRE A;  5LMU Q;  1WJJ A;  3W1B A;  1N32 Q;  2A1A A;  4DKA C;  2B63 G;  2XTI A;  4C2M H;  3PUW A;  3HOV H;  1IYJ B;  5BR8 Q;  1CKM A;  3G4S A;  4YHH L;  1XNQ Q;  1GKH A;  1GD7 A;  3G71 A;  3F8T A;  5IE8 A;  4PMW A;  1WCM G;  4JI7 L;  3RLO A;  1Y1V H;  4P74 A;  2HIX A;  1L1O A;  3UDF A;  4GKJ Q;  1V1Q A;  2CWP A;  2F4V L;  4JI5 L;  1XMO Q;  2BH8 A;  1QUQ A;  4JI8 Q;  5M3M H;  3HOW H;  4YWM A;  5LMN L;  4JBJ A;  3KF6 A;  1YNX A;  4A3B H;  1CKN B;  4IFD J;  3HOU G;  1EYG A;  2PQA A;  2CFM A;  1HZ9 A;  1Q82 C;  1B7Y B;  4P72 A;  4DV6 L;  1PYS B;  2I5M X;  5ELN A;  1N34 L;  3I4M G;  4GNX C;  4B3T L;  3I4M H;  3GO5 A;  1VQI A;  1OXT A;  1X6O A;  3JAM i;  4HJ7 A;  1VQE A;  3U58 A;  1HNZ Q;  3PCO B;  3PGZ A;  2VZA A;  4PZ6 A;  4HIM A;  2H5X A;  4JG2 A;  1PVO A;  3CW2 C;  5IYB G;  1VQF A;  1GO3 E;  2WFW A;  2VQE L;  1A62 A;  1YJW A;  1XPR A;  4L5S A;  1FJG Q;  1VCI A;  4LFB L;  5K36 G;  2DGY A;  1Q1B A;  3S24 A;  1TWA H;  4JI1 Q;  1E7Z A;  1HNX L;  3PF5 A;  1FJG L;  3DLL A;  2GN5 A;  2DUD A;  2I0Q A;  3T1H Q;  3CCL A;  4A3L G;  1YHB A;  3M9B A;  4X62 Q;  2OCE A;  4DUY Q;  2QA4 A;  4LF7 L;  2Z6K A;  1G29 1;  4FDB A;  2A8V A;  2NVY H;  4R1J A;  4LFA L;  4A93 G;  1HNZ L;  1B8A A;  2KBN A;  3FKI H;  5JEA J;  4GOP C;  3OW2 A;  4DAY B;  1IBK L;  1YIJ A;  3HKS A;  4B3T Q;  1I6H H;  3J81 i;  1CKN A;  4A3E G;  1EQQ A;  1K83 H;  1N34 Q;  3A74 A;  3J80 c;  3HOZ G;  1SRO A;  1PYB A;  4KLK A;  1L0W A;  1N8R C;  1N9W A;  3CCJ A;  4DV1 Q;  1NE3 A;  2AMC B;  1L1O C;  1SR3 A;  1PH3 A;  4WJ3 M;  1NMF A;  2MFI A;  2F4V Q;  3A5Z B;  3CF5 A;  3RN2 A;  4Y7N H;  5GAH C;  1EOV A;  2R92 G;  1SE8 A;  3G6E A;  2UU9 Q;  1N36 L;  1QVC A;  3AYH B;  1UEB A;  1CSP A;  4YHH Q;  1XNQ L;  1E1T A;  3CMA A;  4KHP L;  3GD7 A;  3ICE A;  4BBR G;  1Y1W G;  4R4C A;  1PFS A;  4H02 A;  1X3E A;  3L0O A;  3CCM A;  4IPC A;  4RMF A;  1HH2 P;  2KCM A;  1UE7 A;  3PUX A;  1MJE A;  1YZ6 A;  3CCQ A;  5M3F H;  4DV4 L;  3F2C A;  1A0I A;  3S17 H;  4YCU A;  2OWO A;  1YBY A;  4B3S L;  2JA7 H;  4LF8 L;  4O0A A;  4YY3 L;  4A3B G;  3HOU H;  4Y52 H;  4JOI C;  4OWT B;  4B3S Q;  5IYD G;  3NBH B;  4OWX B;  2E8G A;  1HR0 L;  4BA1 I;  4A3F G;  1QVG A;  2KHI A;  1KXL A;  1VQA A;  3CCS A;  3TEH B;  1IL2 A;  2B63 H;  4X6A H;  4POG A;  1G6P A;  3D31 A;  2RCN A;  5E7N A;  4LF8 Q;  1K8A C;  4X66 Q;  3AFQ A;  4DV4 Q;  4C3H H;  4DV5 Q;  3RZO H;  1LUZ A;  2R7Z H;  2VNU D;  1K73 C;  1JJG A;  1X9N A;  1A63 A;  1Y1V G;  1WCM H;  2ZJR A;  2BA1 A;  1VQN A;  2OQ0 A;  5C0X G;  4BBS H;  1Q1E A;  1KD1 C;  2JA8 G;  4DV0 Q;  1TWF H;  1E3P A;  3F2D A;  2AWN A;  4DV1 L;  4O2D A;  2LSS A;  3CC2 A;  4LWC A;  1N33 L;  1W3S A;  2D0P A;  1KRS A;  3PV0 A;  2MNA A;  3S1M H;  1U0L A;  5C44 G;  2WB1 G;  3KLW A;  4JI0 L;  3GTM H;  4A3E H;  3HKZ G;  1EFW A;  1Q7Y C;  1MIU A;  2NZH A;  4A3K G;  4JYA L;  1NTG A;  5IWA L;  4GN4 B;  2Q2T A;  1XPO A;  5JJI A;  1JJ2 A;  4DV3 L;  5IYB H;  3CPW A;  2ZJP A;  5C4X H;  3NEM A;  3MEF A;  4UPA A;  4AYB E;  4C3I H;  2YTX A;  3HKZ E;  3T1H L;  4B3M Q;  2JA6 G;  4QQB X;  1HNX Q;  4JI1 L;  4DAM A;  2MQH A;  5M5Y H;  4HJ9 A;  5EAY A;  1IBK Q;  3AQQ A;  2Z0S A;  1Q12 A;  3CPF A;  1HZA A;  4XTC S;  1XTD A;  1PV4 A;  3I4N H;  4BY7 H;  2R93 G;  1P8L A;  4L5T A;  4QY7 A;  2ALY B;  1IXR A;  4YCV A;  3STB C;  4DUY L;  4LF7 Q;  4IJH A;  3PF4 A;  3CC4 A;  2V1C C;  1Q46 A;  4IPH A;  1VQ7 A;  1YJN A;  2OTL A;  3K0X A;  4POF A;  3UE0 A;  3M4O H;  4DUZ Q;  2IY5 B;  3BZK A;  3K81 C;  1X54 A;  4IOC A;  4B3M L;  5ELO A;  4DV6 Q;  1E24 A;  2JK8 A;  4YWL A;  4DK6 C;  3KYH C;  4JC0 A;  4DNI A;  4LF6 L;  1TWH H;  2JA7 G;  4TVA B;  1AE2 A;  4IJL A;  4P71 A;  1I3Q H;  5LMN Q;  2L15 A;  1KHI A;  1UE5 A;  1S3O A;  4GNX B;  3Q8D A;  4NPS A;  1JB7 A;  3F2B A;  3KJP A;  2HIV A; 
#chains in the Genus database with same CATH topology
 2JA6 H;  2NVX H;  4JI0 Q;  1AZP A;  2NZO A;  2R7Z B;  2NB0 A;  2E2H H;  4RGM A;  2BDO A;  1EYC A;  3QOJ A;  1K8M A;  1QUQ B;  4XYQ A;  3CCU A;  5CR3 A;  2FFK B;  4HJ5 A;  1RF2 D;  1B50 A;  2KA7 A;  4IFD I;  3S1Q H;  3IRB A;  3PO3 H;  1GUW A;  1HXY D;  5AJ3 Q;  4RHR A;  1QB5 D;  3HOW G;  3PSI A;  2PW5 A;  4NP5 A;  2IX1 A;  2JE6 I;  4XXE A;  5E1F A;  3QJY A;  2K75 A;  4KV6 A;  1H9R A;  3RZO B;  4JI2 L;  5ELC A;  4LF5 L;  2EYP A;  1S72 A;  1OXU A;  1GHJ A;  1PFB A;  1BF4 A;  1I5F A;  4O1N A;  1TR5 A;  3HOW B;  3VDY A;  2ATW A;  1EEF D;  2C35 B;  2UU9 L;  1LM0 A;  4X64 Q;  2QEX A;  1SMX A;  3J81 j;  2K33 A;  1VMC A;  1XMQ L;  4JV5 L;  3X3N A;  2N8N A;  3B6Y A;  3SGI A;  3T51 B;  1SJH D;  2DNE A;  3TP5 A;  5C3W A;  1JMC A;  2Q2I A;  4XYO A;  5IP7 H;  4AYB G;  1Y69 U;  1B1Z A;  4IPD A;  2RHS B;  2KCN A;  1TS4 A;  2ICI A;  3OMG A;  2IT1 A;  2VQF L;  4LFA Q;  4N9T A;  4K5W A;  4J1M A;  1QZG A;  4LNQ A;  1H9S B;  5JPN C;  1DON A;  4ABN A;  3GTP B;  2DY8 A;  1D6E C;  2Z6B A;  2JEA I;  3I90 A;  1EY6 A;  4A3D G;  1ILQ A;  2V4D A;  2G9H D;  3A5U A;  1ET9 A;  2RHQ B;  2Z1C A;  3K6O A;  1K8G A;  3M4O B;  3C1F A;  3FKI B;  2CW0 C;  1OXS C;  3R93 A;  1E1O A;  1UE1 A;  3Q0A A;  1A6X A;  4C3J G;  1ASY A;  4FP5 D;  4KHZ A;  1M4V A;  3K7A H;  2B2W C;  4GOP B;  2CCZ A;  2QDB A;  1S5D D;  3HOV G;  5F2D A;  2FMC A;  2HQE A;  3BJU A;  4CDE C;  2F0P A;  4G57 A;  5E4W C;  1E22 A;  1EQR A;  1LYL A;  4JBK A;  4K8J A;  4Y7N B;  3ND8 A;  1HZC A;  5TSS A;  1BBU A;  1S5C D;  3MXN B;  1HUN A;  5IGE A;  4HMI A;  4A4I A;  2F0G A;  2Q8I B;  2BDN A;  1LTR D;  2K1B A;  2NYZ D;  5J1Z A;  5LMU L;  1LAC A;  2IL8 A;  4OXP A;  3ULJ A;  5IGD A;  5CBE E;  3HOX G;  2UUB L;  3I7F A;  2O4X A;  3C1E A;  1TWH B;  2VUM G;  2RQX A;  3J81 c;  1PTO B;  3FP9 A;  2C9O A;  1TWG H;  2ENB A;  4CKE A;  1IZ6 A;  4HIO A;  3STB D;  4DV2 L;  3R2T A;  1PHJ A;  1LT3 D;  5GAE C;  3JC6 6;  1CKO A;  3HOY G;  5FLM G;  1B70 B;  2KED A;  4WJ3 M;  3DM3 A;  3CCV A;  3HEJ A;  3DWA A;  2HHH Q;  5LL6 X;  2N78 A;  1KNA A;  3S16 H;  1STG A;  3K5N A;  5GQO A;  1SNM A;  3VR6 A;  5AJ3 L;  1I94 Q;  4EQN A;  1G8Z D;  1SE4 A;  2NN6 G;  2RKS A;  2A6H C;  5K5P A;  3E9I A;  1EL0 A;  2I5H A;  4A3G G;  4LFC L;  3M85 A;  2RBM A;  1R9T B;  2K03 A;  2SNS A;  4HIK A;  2KHJ A;  3ER0 A;  4IUQ A;  3RN5 A;  5DM7 3;  3I56 A;  3Q24 A;  2EYO A;  3RNU A;  2F0T A;  4PMB A;  3NTI A;  1LTT D;  2CQO A;  4RH6 A;  1GHK A;  3IL8 A;  1QJO A;  1PTO C;  2B29 A;  2WAQ G;  2WP8 J;  4HSV A;  2K05 A;  3U50 C;  3T1Y Q;  1D1K A;  1EY0 A;  5EKL A;  4LF6 Q;  3M3Y H;  1IBM Q;  2K52 A;  1YJ9 A;  3SDZ A;  3K80 C;  1C4Q A;  1O7Z A;  5D65 A;  4LUZ A;  3RUZ A;  4DR6 Q;  3LGJ A;  4KN4 C;  1D1I A;  1NY4 A;  4AQY Q;  3DUZ A;  3I55 A;  4DR2 L;  2R7F A;  4L8J A;  2XWB B;  1LTL A;  3GTQ H;  4OX9 Q;  4LUO A;  1V9P A;  2K32 A;  2Z4H A;  4BXX H;  1TY2 A;  1RTN A;  3FKI G;  3MFG A;  4UDU C;  3W2D A;  5C0X I;  4P75 A;  1XNR Q;  2EE1 A;  2KEE A;  2KVM A;  5D3I B;  3S2H H;  1KAW A;  4DXF A;  2RCF A;  2UUC L;  2ZXP A;  5JVH 3;  1N33 Q;  1SDF A;  4FXK C;  5CV5 A;  4XQJ A;  1PH4 A;  1OO9 B;  2FXQ A;  1EIH A;  2Q2H A;  2JA5 H;  4LMQ D;  4UP9 A;  3GTO H;  2L4N A;  4A3I H;  1SNC A;  4QL5 A;  1J6Q A;  3H0G G;  1K28 A;  5IGG A;  1LO5 D;  1V1P B;  2PCF B;  5D3D A;  2EVB A;  3I2Z A;  1HPC A;  5IOC A;  1KLG D;  5IP9 G;  5LHY 1;  1U4L A;  1C7Y A;  5FK9 C;  1L0X B;  3U9S A;  1TS5 A;  3PO2 G;  1CSQ A;  1QG7 A;  1PH2 A;  1D8L A;  3HG9 A;  4OON A;  2R7D A;  5IYD H;  3EBE A;  1SJE D;  2B2T A;  1CTM A;  4C3J H;  2NN6 H;  1DYQ A;  1OXX K;  4MZ9 A;  3H0G B;  3NE5 B;  3TRE A;  5LMU Q;  4H0L C;  1N32 Q;  1I4X A;  2GA4 B;  4DNR B;  4IQZ A;  3PUW A;  1LAB A;  1CI3 M;  5BR8 Q;  4F7X A;  1QNK A;  2JA5 B;  2BE5 C;  1XNQ Q;  2EZV A;  3H91 A;  3G71 A;  4M1U B;  5IE8 A;  1SYD A;  4O42 A;  1SYF A;  4CKB A;  1F2M A;  4ZKB B;  2BH8 A;  1EYA A;  3HKZ B;  3HOW H;  2VB2 X;  3GTQ B;  3NQI A;  2WAQ B;  3P7J A;  4DAY A;  2I5M X;  4B3T L;  3DEO A;  3GO5 A;  1OXT A;  3U58 A;  1PMR A;  1CQV A;  3PCO B;  1ZEQ X;  4PZ6 A;  2H5X A;  3BYY B;  3CW2 C;  2LKV A;  3AU7 A;  2WFW A;  1WTO A;  5KYI A;  4KD4 A;  1Y8O B;  1TWA H;  2EYJ A;  3HP3 A;  4A3M B;  1E7Z A;  1HNX L;  1FJG L;  2I0Q A;  3QR8 A;  1HRJ A;  3D8G A;  2OCE A;  2QA4 A;  1A2U A;  4PV1 C;  4LFA L;  2RSN A;  3T16 A;  1B8A A;  4DAY B;  4HED A;  1YIJ A;  4DNT B;  3EQL C;  3HKS A;  2XSC A;  3HOZ G;  1BOS A;  4C1N K;  1PYB A;  4KLK A;  2PQE A;  4UAI A;  4DV1 Q;  1Q8I A;  2NVX B;  1E2W A;  1PH3 A;  3HRZ C;  2WII B;  1PRT F;  3T4A C;  4DA2 A;  5GAH C;  2R92 G;  2JA6 B;  2UU9 Q;  3J80 L;  1UEB A;  4YHH Q;  3E5S A;  1D2B A;  2F0L A;  2WV6 D;  1UE7 A;  1DXM A;  4RCN A;  1K83 B;  5JVG 3;  4CDC C;  3PIP 3;  1TWC B;  2OWO A;  4HSP A;  2IWH A;  1YBY A;  4B3S L;  2JA7 H;  4JK1 C;  4R8N A;  3BYT B;  2LFN A;  3K7A B;  4B3S Q;  3A55 A;  2M2L A;  4OWX B;  2CW0 D;  1CM9 A;  2KHI A;  2SDF A;  3TBI B;  2NVT B;  3DM1 A;  1KXL A;  3TEH B;  1DOL A;  1IL2 A;  5DM6 3;  4X6A H;  1E0B A;  2PZT A;  2WIN B;  4G7Z C;  4POG A;  2BOS A;  1G6P A;  3GTJ B;  5EPK A;  3FRP B;  5JOB A;  4DV5 Q;  2R7Z H;  4N8X 1;  1JJG A;  2OQ0 A;  4BBS H;  4DV0 Q;  4DV1 L;  1W3S A;  4IN3 A;  4JI0 L;  2WB1 G;  5CMD A;  1R4Q B;  1STY A;  5IWA L;  1JJ2 A;  5DEH A;  2X69 A;  2ZJP A;  3FPU B;  2E74 C;  3NEM A;  4UPA A;  5EKK A;  4AYB E;  4OIJ A;  3NWT A;  3HOV B;  1HNX Q;  3VR2 A;  1J9O A;  5M5Y H;  5EAY A;  3C46 A;  3GTK B;  4KY7 A;  3CPF A;  1PV4 A;  4ZCK A;  4BY7 H;  3S15 B;  2R93 G;  4U68 A;  1CZW A;  2ALY B;  4DUY L;  1CA5 A;  1X3P A;  3NPP A;  4K8I A;  4YIJ A;  3CC4 A;  4IPH A;  1YJN A;  2OTL A;  4DXG A;  3M4O H;  3BZK A;  5JEA H;  2PW7 A;  4IOC A;  4DNI A;  4JC0 A;  3I8Z A;  2CHB D;  4TVA B;  1JC7 A;  4IJL A;  4A93 B;  4P71 A;  1U4M A;  3I4M B;  1II3 A;  1KHI A;  1S3O A;  3Q8D A;  1LTS D;  3F2B A;  1R4P B;  2K28 A;  4EQO A;  2M9V A;  1A3U A;  2Z8L A;  4IUN A;  2NN6 I;  4IUR A;  2LXJ A;  3PO3 B;  1EWH A;  2BA0 A;  4GLX A;  3VA5 A;  5ISR A;  2MHV A;  5KEE A;  3TME A;  4GNX A;  2PMZ B;  2D5D A;  2MPM A;  4IO9 A;  3EVQ A;  1N32 L;  2N3S A;  3CQZ H;  1WTW A;  1BCP C;  3BG3 A;  4LW1 A;  2WAC A;  4AIM A;  5A2Q L;  1Y8P B;  3BDO A;  1JT8 A;  1XJV A;  4A3C G;  2G5D A;  5EQ0 A;  3KF8 B;  1MGS A;  1BBW A;  1KIX A;  4RAU C;  4OO1 G;  2ZM6 L;  1EZ8 A;  1HCZ A;  1SE2 A;  1X3G A;  5IGC A;  5AFW A;  5ELD A;  1HNW L;  4YY3 Q;  1YNN C;  4JI3 L;  2N49 A;  3VR3 A;  3K5L A;  1Q8K A;  3M4P A;  1NMG A;  1ENF A;  4FF4 A;  1ESF A;  3NXW A;  1SRU A;  3J7Y W;  4A75 A;  1DD2 A;  3S15 H;  4A3M G;  4BY7 B;  3CU7 A;  5IYC G;  1VQP A;  2BE5 D;  2F0F A;  1IKM A;  2JA8 H;  4FF1 A;  5GRO A;  3S1Q B;  4JI6 L;  3JAM c;  1KC8 C;  2F0D A;  4KY5 A;  2Y0S B;  4BY1 B;  3M7G A;  4IUP A;  4YWK A;  3W1G A;  2VL6 A;  3GTO B;  3EA6 A;  1L2F A;  4DV7 Q;  2PNR C;  2K5Q A;  3K58 A;  2QCP X;  1C9O A;  1LT4 D;  2NUC A;  2XNA C;  1X55 A;  3NUC A;  4R4T A;  2TMP A;  1V8Q A;  1VQJ A;  4OX9 L;  3VYS A;  5NUC A;  5IYC H;  2E2J H;  2NZ1 D;  2MO0 A;  2HDM A;  4AQY L;  4BBS B;  1ASZ A;  1NAP A;  2D62 A;  3MWY W;  1SNP A;  4Z9C B;  4BA2 I;  4LF9 Q;  3K5O A;  4DR6 L;  2NVQ B;  2NVQ H;  5E3F A;  4LFB Q;  1TY0 A;  3P20 A;  3PO3 G;  3KUP A;  2ZXR A;  3S14 H;  1VS0 A;  2PI2 A;  3T1Y L;  1J5E L;  4A3I B;  2NVT H;  4K0K Q;  1JCK B;  1WTP A;  1EZ6 A;  4K14 A;  1KAB A;  3MAQ A;  1TKW B;  3L3O C;  2CWA A;  4JI8 L;  1SYG A;  1W2B A;  2IPK D;  3C3L A;  1KLU D;  3N52 A;  1WI5 A;  4MN3 A;  4LAA A;  2K5V A;  3MFY A;  3GV6 A;  2UUA Q;  3MXN A;  3PIP A;  1S40 A;  4GLA C;  1K3B C;  3ITP A;  4A3F B;  3VYU A;  1WD1 A;  4ZUI A;  2A74 C;  4KN7 C;  3X3M A;  1STA A;  1JWS D;  1KDA A;  3HFZ B;  5M5W H;  2IW3 A;  2HHH L;  1EU3 A;  5I9O A;  5J39 A;  4BS9 A;  2UXB L;  5T1G A;  4MNO A;  1GUG A;  2F4I A;  3E0E A;  2Q8T A;  1IBL L;  1VQB A;  2K01 A;  4UY8 C;  4P73 A;  3KOJ A;  2HUG A;  1B53 A;  1VMP A;  3M7N A;  1FNW A;  1GVP A;  4JCV E;  3J7A 5;  4RWS C;  4FXD A;  2A19 A;  4UP8 A;  5DLQ E;  2O5I C;  4J6H A;  5IP9 H;  5C0X J;  3SK4 A;  3U4Z A;  1EY8 A;  3BZD B;  3HOZ H;  4PNY A;  1GOZ A;  1VQD A;  4BBR B;  1FD7 D;  4F8M A;  2F0N A;  2XN9 C;  4EVO A;  4X65 L;  4A3F H;  1JOR A;  4KTA A;  2JA5 G;  2DJF C;  5M5X H;  3KFU A;  1EQT A;  2MP1 A;  2A69 C;  4PZ7 A;  3UE1 A;  1OTC A;  4UP7 A;  1HUM A;  5C4J B;  3K59 A;  3L2P A;  3Q23 A;  4WRD A;  4KKT A;  5FO9 B;  4NXM L;  2F0S A;  3R3O A;  1PRT D;  3I72 A;  4IFD G;  1S5F D;  1JOQ A;  4J8Q A;  1XXG A;  4A3G B;  2F03 A;  2QDL A;  5M3F G;  5EPJ A;  2F0U A;  5FLX c;  2IJ0 A;  2F52 A;  5C44 H;  4J15 A;  1LLR D;  5ELB A;  1VQ9 A;  1RHP A;  3MZ5 A;  1V1O A;  3GTL H;  1ZYR C;  4DUZ L;  2VB3 X;  4IAL A;  2NTS A;  1TXY A;  1CFM A;  5C4X G;  2CVR A;  3PUZ A;  4NB3 A;  5COY A;  1EIG A;  2UXD Q;  2VQF Q;  4V19 0;  5GAD C;  3M4Y A;  4Q5V A;  4BBS G;  4DR7 Q;  4BXX G;  5C3E H;  1MSH A;  4BWG B;  2H1E A;  3A0J A;  3RZD H;  4DR4 Q;  3OSO A;  4DAV A;  4ZLT F;  1W6J A;  1T5E A;  5KND A;  2F0K A;  4JYA Q;  3PIO 3;  4A3J G;  1XMQ Q;  1GM5 A;  1JJC B;  3BZC A;  1ICW A;  1GJX A;  4X64 L;  4HJ8 A;  1BCP B;  1SMY D;  2PZW A;  4HMJ A;  2MO1 A;  3CCE A;  2YTV A;  1SND A;  3UDG A;  3RLN A;  2B2V A;  2F0J A;  3CCR A;  4RFB A;  3UDI A;  2RDG A;  4K5X A;  3KLR A;  5FKA C;  4KHV A;  3SHL A;  4JI2 Q;  3UI2 A;  4R8I A;  3OTO Q;  5KNB A;  4DR5 L;  3U9O A;  1YIT A;  2PO4 A;  4DR3 L;  1BNZ A;  2AWO A;  2ZXO A;  3MVV A;  2KCC A;  4DR1 Q;  3D0F A;  3CD6 A;  1HJP A;  3IFD A;  4JI4 Q;  2A6E C;  1NUC A;  1BVS A;  3GDE A;  3I73 A;  4QB4 A;  4JBW A;  3D4R A;  4K2K A;  3GTP H;  2B3G A;  3C2P A;  2PYK A;  1LTG D;  1D5Z C;  2KJX A;  2B63 G;  2XTI A;  4C2M H;  3FPP A;  3TZD A;  1IYJ B;  5M3F B;  3CQZ B;  1GKH A;  4ZYS A;  3K5M A;  1F9Q A;  1GD7 A;  3F8T A;  3FDT A;  3TDQ A;  1O7L A;  1LTB D;  1L1O A;  2SOB A;  2F4V L;  1XMO Q;  1QUQ A;  4AYB B;  5M3M H;  4YWM A;  1MD2 D;  3KF6 A;  1YNX A;  5I6W A;  2B2V C;  2KQ3 A;  1EYG A;  1HZ9 A;  2JN4 A;  1PYS B;  5ELN A;  1N34 L;  3I4M H;  2CH4 W;  1AZQ A;  3PGZ A;  2DY7 A;  5IYB G;  3V2T A;  1EFI D;  3GTG B;  2VQE L;  4L5S A;  1Q1B A;  4FVM A;  1XTC D;  4JI1 Q;  2L12 A;  3DXJ C;  3PF5 A;  1G2T A;  3DLL A;  2AQ1 B;  3T1H Q;  3M9B A;  5IGB A;  2IX3 A;  4FDB A;  2NVY H;  2RSO A;  4R1J A;  1HNZ L;  3KF8 A;  4TKO B;  4MHE A;  3OW2 A;  1IBK L;  1CKN A;  4XT3 B;  4CKC A;  3A74 A;  1PRT C;  3KLS A;  2AQ3 B;  2JYO A;  5CV8 A;  1NE3 A;  5M9O A;  1SR3 A;  1NMF A;  2MGS A;  5I4D A;  1PXU A;  2A69 D;  1UNS A;  1DOM A;  4RCO A;  4Y7N H;  1ONL A;  1SE8 A;  5C3E B;  1CSP A;  4KHP L;  2FHT A;  3GD7 A;  4BBR G;  3L0O A;  4EQP A;  3CCM A;  4RMF A;  4L6T B;  1KDB A;  3PUX A;  3CCQ A;  4DV4 L;  4LF8 L;  4O0A A;  2D2C C;  3HOU H;  3A54 A;  3H94 A;  1HR0 L;  2KEC A;  4A3F G;  2G9D A;  1VQA A;  3CCS A;  2KOL A;  1ML0 D;  1B3Q A;  3EJI A;  2WKC A;  2RCN A;  4LF8 Q;  1K8A C;  1BQQ T;  4DV4 Q;  1GXD C;  1ZXT A;  4C3H H;  1LUZ A;  2E2J B;  1ENC A;  1A63 A;  3MXP A;  1VQN A;  3SK8 A;  1KD1 C;  1IYV A;  2F1M A;  1Y1V B;  2LSS A;  2EPB A;  4LWC A;  1YNJ D;  1KRS A;  1U0L A;  2EYM A;  2L9H A;  5IOD A;  2NZH A;  2Q2T A;  2K7V A;  5BN5 A;  4OHJ A;  5JJI A;  2B8F A;  3IKJ A;  3I70 A;  3QOL A;  4DV3 L;  1KAA A;  1IKL A;  3HOZ B;  2X6G A;  3CRK C;  5C4X H;  1I4Q A;  4NKL A;  4ME5 A;  4C3I H;  3HKZ E;  3VYT A;  2JA6 G;  1TS2 A;  2R92 B;  4JVZ A;  1IBK Q;  1EY4 A;  1PZK D;  2MUY A;  1Q12 A;  2B2U C;  3L9A X;  4XTC S;  1XTD A;  1JQY D;  2B2T C;  4QY7 A;  5T1I A;  1FGB D;  2QIL A;  4IJH A;  5A35 A;  3PF4 A;  2V1C C;  2K5W A;  1LTI D;  2ZT9 C;  1X54 A;  2K04 A;  4B3M L;  1U4R A;  2JK8 A;  2JA7 G;  1STH A;  1AE2 A;  5LMN Q;  1UE5 A;  2F0O A;  4GNX B;  4NPS A;  3KJP A;  1PDQ A;  4GKJ L;  1QE6 A;  4DK0 A;  1SMY C;  1KRT A;  5M5Y B;  3ONA B;  1Z9F A;  4QUF A;  2OT2 A;  4BY7 G;  1Q3L A;  2R92 H;  4Q0F A;  1XMO L;  5CV6 A;  1RCV D;  1K0R A;  2O5J C;  1EY9 A;  1H9M A;  3CAM A;  3G48 A;  4C2M B;  4JOI A;  4APV A;  1K0S A;  2E2D C;  1S5E D;  3S2D H;  4X66 L;  1JWU D;  4R4O A;  1RKN A;  2UXC L;  3PMF A;  2Y0S G;  3CKI B;  5IGF A;  3DEP A;  3NTH A;  3VA7 A;  1DGS A;  2D9U A;  1QWY A;  3S14 B;  4IOA A;  2HD3 A;  4GLV B;  4KI0 A;  1FGU A;  3CC7 A;  4FNF A;  1XPU A;  3HOX H;  3JAM L;  4RG1 A;  2E5L L;  1KL9 A;  1MBY A;  3URY A;  2E2I H;  3HZX A;  1C0A A;  1OXV A;  4DR1 L;  1FNV A;  2E2I B;  1PTO F;  1RL2 A;  4A3I G;  2K14 A;  1STN A;  3SK6 A;  3GTK H;  1PH9 A;  4OIK A;  3OTO L;  4ZK9 B;  2PMZ E;  3EFX D;  5C0X H;  1N36 Q;  3ERO A;  2EY2 A;  1SN8 A;  1JIC A;  3L7Z C;  1Y14 B;  1O80 A;  1U9R A;  3DMU A;  4QUC A;  3TN2 A;  1HA5 A;  5FLX E;  4DU9 A;  1M90 C;  4ZKC B;  2CKZ B;  1TWF B;  1YNN D;  1SBB B;  5I6Y A;  3KJO A;  1VQC A;  1F77 A;  1FR3 A;  1Q81 C;  2ES2 A;  4CJ0 B;  5KYL A;  1DJR D;  2WB1 E;  2EYH A;  4X62 L;  3CME A;  4NXN L;  1IW7 C;  1RD9 D;  1Z47 A;  3GTJ H;  2PPB C;  3PUY A;  1GUN A;  4B3R Q;  3NEN A;  3K8A A;  4K6D A;  1NNX A;  4EX5 A;  5M3M G;  2A6H D;  2L11 A;  1VQH A;  1MHW C;  2JXM B;  1HZB A;  1UUP A;  3NWS A;  4QGU A;  1EQV A;  2KEN A;  2DNC A;  2CH4 A;  2D0O A;  4NXN Q;  3J7A V;  4JI5 Q;  1PRT B;  4QIW E;  4XIG S;  1HQM C;  5GAG C;  2PI2 E;  4TSS A;  3EN2 A;  5I9P A;  1P16 A;  3P75 A;  1YEZ A;  2IHF A;  5L37 A;  5C5M A;  3M4Q A;  1JR0 D;  1SXT A;  4KJN A;  1FNU A;  1PYW D;  2I5L X;  1QVF A;  2QKI C;  3GP7 A;  1ZKO A;  1CQF A;  5HY6 A;  4EQ5 A;  2Z6K C;  2A68 D;  4X65 Q;  1I50 H;  1STE A;  1T9H A;  1X65 A;  1EWC A;  1VQK A;  2VUM B;  3I91 A;  4KK7 A;  3W5O A;  2YU9 B;  3SVM A;  1I6H B;  4ME3 A;  4C3H G;  1TWA B;  5IY0 A;  3DWP A;  1VQ4 A;  1E2Z A;  3MTS A;  4IPG A;  5CV4 A;  3HS0 C;  1PH8 A;  4FYD A;  4DAP A;  4CDD C;  5CC4 A;  2YV5 A;  3HGB A;  2JJQ A;  1BR9 A;  4HTH A;  2L1B A;  1PFN A;  2UXB Q;  3E0J A;  3HOX B;  4ODG A;  2UXC Q;  2A68 C;  3T56 B;  3VR5 A;  3HOY B;  4B9X A;  5EKI A;  3T13 A;  2EYL A;  4MTN A;  1A8V A;  2Y0S E;  3OWF A;  2IX0 A;  5G3L F;  1HA6 A;  2A73 B;  4QIW B;  4A3B B;  1C48 A;  3J80 i;  2EY6 A;  2L5T A;  4ALP A;  1UWV A;  1X3Q A;  2VS1 A;  4LF4 L;  1AE3 A;  2UUA L;  1Y1W B;  3S1R B;  2QEJ C;  1QIL A;  3KDF B;  2XRS D;  4IUT A;  2EJG C;  4YCW A;  2NVY B;  5DNF A;  4BY1 H;  4GKK Q;  4LUV A;  5C3E G;  1O78 A;  1SNO A;  4HID A;  1BUV T;  3RLF A;  3NBI A;  2N55 A;  2RVL A;  4L5Q A;  3UDX A;  4G7H C;  1TWC H;  4K0K L;  3T53 B;  4P2C B;  4A3G H;  4TQU S;  1SYC A;  2KHS A;  4M8A A;  1UAP A;  2KCT A;  2A5H A;  3TQY A;  5ELE A;  1VF5 C;  3PO2 B;  2YYZ A;  2ZTC A;  3H6M A;  1EEI D;  4CBV A;  3D3R A;  2GVA A;  2PQA B;  5EBD A;  1EY7 A;  1SYE A;  3OWE B;  5FLM H;  5HGT A;  1S5B D;  4GS3 A;  1WFQ A;  1BCP D;  3RMH A;  2VY3 A;  4DV3 Q;  4G7O C;  2K5N A;  1L0Y B;  5M3M B;  4PZ8 A;  4ILW A;  3S2H B;  3LNN A;  5FJ8 H;  5A2Q E;  4R9W A;  2GVB A;  3AFP A;  2WAQ E;  4K6L A;  4I7Z C;  1VQ8 A;  5IP7 G;  1GUT A;  4U67 3;  2B63 B;  2FIN B;  1NBW A;  3OW7 A;  5C4J H;  2AKW B;  3BU2 A;  4GN5 A;  2JEB I;  3ULP A;  4X3S A;  3ZJY C;  3I4L A;  4CHT B;  1ET6 A;  3GTG H;  4A93 H;  4FF3 A;  5JEA G;  2R6G A;  4R4Q A;  2Q2U A;  3OYY A;  1JWM D;  4A3J H;  1NCV A;  3G7L A;  1G2S A;  1LTA D;  1U5K A;  1IYU A;  2EXD A;  3NK9 A;  1EIY B;  2K50 A;  4S3S A;  2AUK A;  2Z4I A;  1H9K A;  1Q90 A;  2OXP A;  1WJJ A;  3W1B A;  2F0M A;  4DKA C;  2OEO A;  2B2Y C;  2XIW A;  2AUJ D;  3A8K E;  3ZYY X;  1B44 D;  5EBC A;  1CKM A;  2L55 A;  2O2L D;  1F9R A;  3G4S A;  4H7B A;  1AFP A;  4PMW A;  1WCM G;  4JI7 L;  1VDZ A;  3RLO A;  1Y1V H;  2HIX A;  3UDF A;  1V1Q A;  2CWP A;  4WJW A;  4JI5 L;  2FJ2 A;  4GZY C;  5EJW A;  3V96 A;  4JBJ A;  1F2Y A;  4A3B H;  3A7L A;  3RZD B;  3HOU G;  2DJG C;  2CFM A;  2PQA A;  1Q82 C;  1A15 A;  4P72 A;  4DV6 L;  5IT9 E;  3WOF A;  4OO1 H;  1BDO A;  1I3Q B;  5CGK A;  1X6O A;  1VQE A;  2KUM A;  1HNZ Q;  2SNM A;  4HIM A;  2F0I A;  3IAY A;  3R2I A;  1VQF A;  4LJZ C;  1PLF A;  4ZAI A;  5I2X A;  2QF7 A;  3ND9 A;  1XPR A;  2DGY A;  3S24 A;  4H44 C;  4RGT A;  2GN5 A;  4C1N I;  2E75 C;  2BCO A;  5HUR A;  3CCL A;  4X62 Q;  4DUY Q;  4RKB A;  3I4N B;  3R8B A;  3TP8 A;  2KBN A;  3TP6 A;  2OF1 A;  2B2Y A;  2JA7 B;  1H9S A;  3SE0 A;  2Q8R E;  1QCB D;  1U4P A;  2EDG A;  1EQQ A;  1N34 Q;  3S1N B;  3OMC A;  1AP0 A;  4JPB W;  1N8R C;  1N9W A;  1IHZ A;  4MTK A;  1JB3 A;  3CCJ A;  4A3K B;  1BCP F;  4TRD A;  2AMC B;  4RHS A;  4E6I A;  1L1O C;  3NP8 A;  1Z7T A;  3D6W A;  4LK1 C;  1F9P A;  2F4V Q;  4OL7 A;  1SAP A;  3BDL A;  2HCC A;  4WOR A;  1N36 L;  3WOE A;  2F0H A;  3AYH B;  3CMA A;  3QO2 A;  1PFS A;  1QNU A;  4H02 A;  4KKS A;  2HCI A;  5CYU A;  2KCM A;  4ID6 A;  3F2C A;  1A0I A;  3S17 H;  1DOK A;  1ZYR D;  4JOI C;  4OWT B;  5IYD G;  4BA1 I;  1QVG A;  3E3X A;  2EY1 A;  5E7N A;  3TSS A;  2EYF A;  1I50 B;  4X66 Q;  4N8F A;  4B08 A;  3RZO H;  4A3E B;  4DF7 A;  1K73 C;  4XT1 B;  1B4O A;  1WCM H;  5EPL A;  5E4X A;  4XQQ A;  5C0X G;  1Q1E A;  1E3P A;  4EGV A;  3F2D A;  1EOT A;  4KD3 A;  2D0P A;  3MHB A;  2MNA A;  3S1M H;  5C44 G;  3KLW A;  3GTM H;  4A3E H;  3HKZ G;  1EFW A;  4JYA L;  1NTG A;  2XRQ D;  4GN4 B;  3K0Y A;  1WTR A;  1XPO A;  3H3V C;  1TU2 B;  4QCL A;  1BBX C;  5JJZ A;  4B3M Q;  2JSO A;  5JPM C;  2YTX A;  2M00 A;  4X3K A;  5K36 H;  4IUU A;  1PZJ D;  2MQH A;  4HJ9 A;  4ZRZ A;  2Z0S A;  1HZA A;  4N9P A;  1P8L A;  1KNE A;  4L5T A;  4YCV A;  1TII D;  4HN7 A;  4G4K A;  3FMC A;  1VQ7 A;  4POF A;  3FVQ A;  4DUZ Q;  4RKL A;  1YNJ C;  5ELO A;  4DV6 Q;  1E24 A;  4DK6 C;  1I4H A;  5FLX L;  1TWH H;  2EOT A;  3G6J B;  3OHX C;  1I3Q H;  2L15 A;  3QG1 A;  5CBA E;  1JB7 A;  4DPG A;  5FOB B;  1FVI A;  4I7A A;  4KMU C;  1ESR A;  4JI7 Q;  1ILP A;  2DN8 A;  3DWQ A;  3SEB A;  1NR4 A;  1EUJ A;  3AB9 A;  4OEL B;  4OWW B;  1WTX A;  2ZTE A;  2MJ8 A;  3S2D B;  2HQL A;  1J8I A;  3J81 E;  1SE3 A;  3ERQ A;  3S1N H;  4F88 A;  3MC0 B;  2PZU A;  5J3B A;  2K5H A;  5BN4 A;  2TSS A;  4BY1 G;  3SK5 A;  3D6C A;  1UE6 A;  5BR8 L;  1PH1 A;  1I6V C;  1XWE A;  3S9W A;  1PZI D;  1TQO A;  1NJI C;  3H3V H;  1MKH A;  1YVC A;  2JQO A;  3OIP A;  5FJ8 G;  3FEW X;  1TT2 A;  2QGQ A;  3A8J E;  1HR0 Q;  5KNC A;  4JW0 A;  5EGT A;  4C56 C;  1SSO A;  3NSW A;  3CP0 A;  2EY5 A;  1STB A;  5BN3 A;  3PIO A;  1SNQ A;  2LMC B;  3RR5 A;  1PFM A;  3WWV A;  2R7Z G;  1CK1 A;  2F3V A;  4F87 A;  3MA2 B;  1EY5 A;  4KHP Q;  3NBH A;  4I65 A;  1VQ6 A;  1AW7 A;  1A3V A;  3SR1 A;  1M1K C;  3QIA A;  1VQ5 A;  3PUV A;  1V1P A;  2R61 A;  2K4K A;  2EIF A;  5I2Y A;  3WDN A;  4IUV A;  1FYC A;  3KBX A;  1FL0 A;  2ICE C;  1KDC A;  4OGQ C;  2UUC Q;  1ROD A;  1VQG A;  3K7U C;  2OQK A;  4ULL A;  1R9T H;  2AHO B;  3TS0 A;  2JP1 A;  1XNR L;  4C3I G;  5LMN W;  3QWN A;  2I46 A;  1WCM B;  3S1M B;  3F1Z A;  1YHA A;  2F0W A;  5JJK A;  1DM0 B;  3BVZ A;  5KGU A;  5HGQ A;  2R93 H;  2PNH A;  2EJM A;  3TP7 A;  1VQL A;  4A3L H;  1KQS A;  1HHV A;  4BBR H;  1LT6 D;  4A3J B;  4IFD H;  4DR2 Q;  3E9H A;  1M8A A;  4C3H B;  2VQE Q;  1CUK A;  1T5X D;  2ID0 A;  1G6Z A;  3ULL A;  4OEM B;  1VQM A;  4CJ2 C;  1LV9 A;  5FO8 B;  1J5E Q;  4L5R C;  5D14 A;  1HTP A;  3KDF A;  1IBM L;  3GV3 A;  4IZ8 A;  3CXC A;  4GKK L;  1HFG A;  1G51 A;  2JA9 A;  4LF9 L;  4DFA A;  4LF4 Q;  2EQS A;  4MIU A;  2RA4 A;  5J22 A;  1YI2 A;  2LS0 1;  4RA8 A;  1BXT A;  1ICF B;  2RF4 A;  1Y1W H;  1GUS A;  1BKB A;  2WB1 B;  3TZU A;  1A2T A;  1L1O B;  3ERS X;  3FHW A;  1HR0 W;  2F3I A;  3Q22 A;  1B3A A;  1QOH A;  2Z9H A;  2VW9 A;  3KF6 B;  3LWU A;  1X56 A;  4H13 C;  1IL8 A;  3JAM E;  3U4V A;  3TRZ A;  4LFC Q;  4WFN 3;  1V43 A;  1F9S A;  1I4R A;  1I94 L;  1JE4 A;  4DV7 L;  2B8G A;  1CA6 A;  2F0V A;  1K3R A;  3KBG A;  1PH7 A;  4JI4 L;  2J0T D;  1Y8N B;  4PG3 A;  4JI6 Q;  1EYD A;  3IFT A;  1JE5 A;  5CV7 A;  4DR3 Q;  2WKD A;  2IHE A;  4QJF A;  4DR5 Q;  2QW7 A;  5LL6 S;  4KY6 A;  4DV2 Q;  4JI3 Q;  1GUO A;  3HOU B;  4HJA A;  3S1R H;  2BH2 A;  4GN3 B;  1HNW Q;  3RD4 A;  1YHQ A;  3H3V I;  3J81 L;  2ZM6 Q;  2XVS A;  4PMC A;  2YU9 H;  1WOC A;  2ASB A;  2ZJQ A;  1Q86 C;  1X3F A;  2UUB Q;  4UHV A;  1MJC A;  5C4Z A;  1VQO A;  1WTQ A;  5JJL A;  5KRU A;  4NW2 A;  3GTM B;  5ELF A;  5IT9 L;  3I4O A;  2HT1 A;  4CDF C;  4DR4 L;  5M5X B;  4HR7 B;  2LY7 A;  1E2V A;  4QF4 A;  3HOY H;  4ZQ3 A;  4DR7 L;  3NEL A;  2F0Q A;  1I4P A;  2ZTD A;  4JBM A;  3OOC A;  1K9M C;  2UXD L;  3EIV A;  4R4I A;  3NQT A;  3BVM A;  4XQN A;  3H15 A;  4L63 B;  1XYI A;  4OO1 I;  1DCZ A;  3NTK A;  4ZUJ A;  4DK1 A;  5C4H A;  4A3C H;  1PH5 A;  4DN4 M;  5CV9 A;  2LXK A;  4C3I B;  1G91 A;  3AEV A;  1EWI A;  1EIF A;  4B3R L;  5H1S E;  3D4W A;  3OIQ A;  2VUM H;  1S4Z A;  5C6A A;  3AMU A;  3LWE A;  1WYD A;  1HTL D;  3I4N G;  4NXM Q;  1RIP A;  3TS2 A;  2XGT A;  3DHQ A;  5IT9 c;  2NWG A;  1WVL A;  4DK3 C;  1D7Q A;  4AH6 A;  1HQR D;  4A76 A;  2C5C A;  2VXW A;  2RDF A;  5IWA Q;  4XDX A;  1O7I A;  3P1H A;  4FO2 A;  4A3K H;  1RDP D;  3F2U A;  4GOP A;  1CHP D;  4NDX A;  1H95 A;  1PH6 A;  3Q6S A;  2E2H B;  4DV0 L;  1AH9 A;  2I07 B;  1MI2 A;  4JV5 Q;  1RJT A;  1SFO H;  1NSN S;  4A3M H;  2NBF A;  3J7Z C;  4DV5 L;  3H0G H;  1SLJ A;  3S17 B;  1XX8 A;  5IIF A;  3BS1 A;  2E5L Q;  4V0B A;  4A3D H;  4WJ4 A;  3LX0 A;  1IBL Q;  1CZG A;  1TVX A;  4LF5 Q;  1UEA B;  3PO2 H;  2OTJ A;  1PA6 A;  2B2U A;  4NMZ A;  3E6Z X;  3GTL B;  1QZH A;  2R3Z A;  3GQB A;  2SEB D;  2K6A A;  4CGY B;  2YTY A;  1WD0 A;  4RGN A;  2A1A A;  2CQA A;  2FMM A;  1AEX A;  4KKU A;  1TWG B;  5C5L A;  3HOV H;  4YHH L;  1BO0 A;  2X6L A;  2P5Z X;  2B39 A;  1K8O A;  3MEH A;  2J4X A;  2J7Z A;  4P74 A;  4GKJ Q;  4FF2 A;  4FXG C;  4JI8 Q;  5LMN L;  1H9J A;  1F2Z A;  1CKN B;  2AQ2 B;  3NHH A;  1RTO A;  4IFD J;  1B7Y B;  1AN8 A;  3CHB D;  1D5M C;  1SEB D;  3I4M G;  2JA8 B;  4GNX C;  1VQI A;  4PQX A;  1KTK A;  3JAM i;  3N6R A;  4HJ7 A;  2VZA A;  1PVO A;  4JG2 A;  3K57 A;  1GO3 E;  3M3Y B;  1A62 A;  1WTH A;  1EU4 A;  1YJW A;  1FJG Q;  1VCI A;  4LFB L;  5K36 G;  5C44 B;  4DGZ A;  1IW7 D;  4B9W A;  1W6K A;  3A8I E;  2DUD A;  4A3L G;  1YHB A;  2E76 C;  4LF7 L;  2Z6K A;  1G29 1;  4X3U A;  2A8V A;  4RGO S;  4A93 G;  1SFO B;  3FKI H;  5JEA J;  4GOP C;  4X3T A;  5JAV A;  1B9N A;  3I3C A;  5COR A;  4B3T Q;  1I6H H;  3J81 i;  4A3E G;  1K83 H;  3J80 c;  3A56 A;  1NR2 A;  1SRO A;  3QB3 A;  1L0W A;  2F0E A;  1MSG A;  1HFN A;  2A6E D;  5KIX A;  5M5W B;  2MFI A;  2R93 B;  3A5Z B;  3CF5 A;  3MXG A;  3RN2 A;  1ENA A;  2L0C A;  1EOV A;  3G6E A;  2RDH A;  1QVC A;  1A3T A;  2NTT A;  4K5V A;  1XNQ L;  1E1T A;  3ICE A;  2B2W A;  1Y1W G;  4R4C A;  1X3E A;  1VF7 A;  4IPC A;  1HH2 P;  1MJE A;  1YZ6 A;  5M3F H;  4YCU A;  4A3B G;  4Y52 H;  4YY3 L;  1LT5 D;  3NBH B;  3KK7 A;  2E8G A;  4HCE A;  3W3A A;  1PTO H;  1X32 A;  1DZ1 A;  2EJF C;  5C4X B;  2B63 H;  4HAE A;  1SYB A;  3D31 A;  3BDC A;  2HDL A;  3AFQ A;  3OPO A;  2K5D A;  3V05 A;  1B2T A;  1B9M A;  2VNU D;  3J7A F;  4CJ1 B;  1X9N A;  1Y1V G;  3PQI A;  2ZJR A;  2BA1 A;  3A7A B;  2JA8 G;  1TWF H;  2F3W A;  1CHQ D;  3CRL C;  5DAU A;  2AWN A;  4O2D A;  3CC2 A;  1N33 L;  3VR4 A;  3PV0 A;  3BVG A;  3SXH A;  3O13 A;  1Z6H A;  2H4O A;  3S16 B;  1WTV A;  1Q7Y C;  1MIU A;  4A3K G;  5FO7 B;  3D4D A;  2N88 A;  1O7Y A;  5IYB H;  3CPW A;  5C3X A;  3VYR A;  3MEF A;  3T1H L;  1CT1 D;  4C3J B;  3MXU A;  4QQB X;  4JI1 L;  4DAM A;  1C8C A;  3AQQ A;  1JOK A;  3I4N H;  3KLS X;  4LF7 Q;  5G3L D;  1IXR A;  3STB C;  3J80 E;  1Q46 A;  4A3D B;  3K0X A;  1I4G A;  1PTO D;  3UE0 A;  4QMG A;  2IY5 B;  2XWJ B;  4KJO A;  3K81 C;  3H09 A;  4YWL A;  4HCS A;  2EXZ A;  3KYH C;  4LF6 L;  1F2L A;  1JOO A;  4K2L A;  1D5X C;  1TS3 A;  2HIV A; 
#chains in the Genus database with same CATH homology
 4GKJ L;  1FVI A;  2JA6 H;  2NVX H;  4JI7 Q;  4JI0 Q;  1EUJ A;  1KRT A;  4OWW B;  2NN6 I;  1Z9F A;  2ZTE A;  2NZO A;  4BY7 G;  2LXJ A;  2R92 H;  2HQL A;  2BA0 A;  1XMO L;  4GLX A;  2E2H H;  3S1N H;  1K0R A;  4GNX A;  3CAM A;  3G48 A;  1QUQ B;  3CCU A;  5J3B A;  4IO9 A;  4JOI A;  1N32 L;  2K5H A;  2N3S A;  4APV A;  4HJ5 A;  3CQZ H;  4BY1 G;  4IFD I;  4LW1 A;  3S1Q H;  3IRB A;  4AIM A;  3PO3 H;  4X66 L;  3S2D H;  4R4O A;  1UE6 A;  5BR8 L;  1PH1 A;  5AJ3 Q;  2UXC L;  1XJV A;  1JT8 A;  3HOW G;  2Y0S G;  4A3C G;  3PSI A;  1NJI C;  3H3V H;  3KF8 B;  1MKH A;  1YVC A;  1BBW A;  2JQO A;  1KIX A;  5FJ8 G;  2IX1 A;  4OO1 G;  1DGS A;  4IOA A;  2ZM6 L;  2JE6 I;  2QGQ A;  4GLV B;  1HR0 Q;  4KI0 A;  1FGU A;  1X3G A;  3CC7 A;  1XPU A;  3HOX H;  1HNW L;  4RG1 A;  4YY3 Q;  4JI3 L;  2K75 A;  2N49 A;  2E5L L;  1KL9 A;  1Q8K A;  4JI2 L;  3M4P A;  1NMG A;  3CP0 A;  2E2I H;  1C0A A;  1OXV A;  4DR1 L;  4LF5 L;  1S72 A;  1SRU A;  1OXU A;  1RL2 A;  4A3I G;  3PIO A;  2K14 A;  4A75 A;  2R7Z G;  3RR5 A;  3WWV A;  4A3M G;  1I5F A;  3S15 H;  5IYC G;  1VQP A;  3GTK H;  1PH9 A;  3OTO L;  2JA8 H;  2PMZ E;  3VDY A;  4KHP Q;  5GRO A;  2ATW A;  1VQ6 A;  4JI6 L;  1N36 Q;  2C35 B;  2UU9 L;  1LM0 A;  4X64 Q;  3JAM c;  1KC8 C;  2QEX A;  4YWK A;  3W1G A;  1SN8 A;  1M1K C;  1SMX A;  3J81 j;  2VL6 A;  3PUV A;  1VQ5 A;  4DV7 Q;  1L2F A;  1XMQ L;  3L7Z C;  2K4K A;  4JV5 L;  2EIF A;  2N8N A;  1Y14 B;  3B6Y A;  3SGI A;  1FL0 A;  1C9O A;  2UUC Q;  1VQG A;  1JMC A;  2Q2I A;  5IP7 H;  1M90 C;  3K7U C;  1X55 A;  2OQK A;  4AYB G;  1R9T H;  2AHO B;  3TS0 A;  4IPD A;  2CKZ B;  2RHS B;  4R4T A;  1XNR L;  3KJO A;  5LMN W;  1VQJ A;  1VQC A;  4OX9 L;  2IT1 A;  3F1Z A;  1YHA A;  1Q81 C;  2VQF L;  5IYC H;  4LFA Q;  2ES2 A;  5JJK A;  1QZG A;  2E2J H;  4LNQ A;  5HGQ A;  2R93 H;  2MO0 A;  2PNH A;  2WB1 E;  4X62 L;  1VQL A;  4AQY L;  4A3L H;  1KQS A;  3CME A;  4NXN L;  1ASZ A;  4DR6 L;  1Z47 A;  2D62 A;  3GTJ H;  4BA2 I;  4BBR H;  4LF9 Q;  3PUY A;  2JEA I;  2NVQ H;  4DR2 Q;  3E9H A;  4A3D G;  4LFB Q;  4B3R Q;  3A5U A;  2VQE Q;  1CUK A;  3NEN A;  3K8A A;  2ID0 A;  3PO3 G;  4EX5 A;  3S14 H;  1VS0 A;  2RHQ B;  3ULL A;  5M3M G;  2PI2 A;  1K8G A;  1VQM A;  3T1Y L;  1J5E Q;  4L5R C;  1VQH A;  1OXS C;  1J5E L;  1E1O A;  3KDF A;  1UE1 A;  2NVT H;  1HZB A;  1IBM L;  1ASY A;  4K0K Q;  3CXC A;  4KHZ A;  4GKK L;  4QGU A;  3K7A H;  1G51 A;  2JA9 A;  4GOP B;  2CCZ A;  4LF9 L;  2KEN A;  3HOV G;  4LF4 Q;  2EQS A;  2D0O A;  3BJU A;  2CWA A;  4JI8 L;  4NXN Q;  1W2B A;  4JI5 Q;  1YI2 A;  4QIW E;  1E22 A;  1EQR A;  1LYL A;  4XIG S;  4JBK A;  5GAG C;  2PI2 E;  1WI5 A;  2K5V A;  3EN2 A;  2RF4 A;  1Y1W H;  1P16 A;  1BKB A;  2UUA Q;  3PIP A;  1L1O B;  3ERS X;  3FHW A;  1HZC A;  1YEZ A;  2IHF A;  1S40 A;  1HR0 W;  3M4Q A;  2F3I A;  4GLA C;  1BBU A;  3MXN B;  2VW9 A;  3KF6 B;  1X56 A;  4A4I A;  2I5L X;  1QVF A;  3U4V A;  5LMU L;  4OXP A;  3TRZ A;  3HFZ B;  3ULJ A;  4LFC Q;  5M5W H;  1V43 A;  5HY6 A;  4EQ5 A;  2Z6K C;  2HHH L;  3HOX G;  2UUB L;  3I7F A;  1I50 H;  4X65 Q;  4DV7 L;  1I94 L;  1T9H A;  1X65 A;  1VQK A;  2UXB L;  1K3R A;  1PH7 A;  4JI4 L;  2VUM G;  3W5O A;  3J81 c;  4PG3 A;  4MNO A;  4JI6 Q;  3E0E A;  3FP9 A;  1IBL L;  1VQB A;  1JE5 A;  4ME3 A;  1TWG H;  4DR3 Q;  4UY8 C;  4P73 A;  3KOJ A;  1IZ6 A;  2IHE A;  5IY0 A;  4HIO A;  1VQ4 A;  3STB D;  4QJF A;  4DV2 L;  4DR5 Q;  1PHJ A;  3M7N A;  5GAE C;  3JC6 6;  1CKO A;  1GVP A;  3HOY G;  4JCV E;  3J7A 5;  5FLM G;  1B70 B;  4DV2 Q;  4JI3 Q;  4IPG A;  2A19 A;  4HJA A;  4UP8 A;  5DLQ E;  3S1R H;  4GN3 B;  3DM3 A;  3CCV A;  1YHQ A;  1PH8 A;  2BH2 A;  3H3V I;  1HNW Q;  5IP9 H;  2HHH Q;  5C0X J;  2YV5 A;  2ZM6 Q;  3U4Z A;  2JJQ A;  2N78 A;  2YU9 H;  1WOC A;  3S16 H;  3HOZ H;  1VQD A;  2UXB Q;  2ASB A;  2ZJQ A;  5GQO A;  5AJ3 L;  4X65 L;  1Q86 C;  1X3F A;  4A3F H;  1I94 Q;  2NN6 G;  2UUB Q;  2UXC Q;  1MJC A;  3E9I A;  1VQO A;  5JJL A;  2I5H A;  4A3G G;  4LFC L;  4MTN A;  1A8V A;  2Y0S E;  3M85 A;  2IX0 A;  2JA5 G;  5M5X H;  3KFU A;  3I4O A;  2HT1 A;  4DR4 L;  4HIK A;  2KHJ A;  3ER0 A;  4PZ7 A;  3UE1 A;  3J80 i;  3RN5 A;  1OTC A;  4UP7 A;  3I56 A;  3L2P A;  4ALP A;  3HOY H;  1UWV A;  2VS1 A;  3RNU A;  4DR7 L;  4LF4 L;  4NXM L;  1AE3 A;  2UUA L;  3NEL A;  2ZTD A;  3KDF B;  1K9M C;  4YCW A;  4JBM A;  4GKK Q;  4BY1 H;  3EIV A;  4IFD G;  2UXD L;  2CQO A;  4R4I A;  4LUV A;  5C3E G;  4HID A;  3H15 A;  5M3F G;  2B29 A;  4OO1 I;  3RLF A;  5FLX c;  2F52 A;  2WAQ G;  2WP8 J;  3U50 C;  4J15 A;  5C44 H;  4L5Q A;  3T1Y Q;  1PH5 A;  4A3C H;  3UDX A;  4LF6 Q;  3M3Y H;  1TWC H;  1VQ9 A;  1IBM Q;  4K0K L;  2LXK A;  3AEV A;  1EWI A;  1EIF A;  2K52 A;  4TQU S;  1YJ9 A;  3GTL H;  4DUZ L;  3K80 C;  4A3G H;  4B3R L;  5H1S E;  4LUZ A;  2VUM H;  4DR6 Q;  1TXY A;  2KCT A;  3TQY A;  3LGJ A;  5C4X G;  1NY4 A;  2YYZ A;  2ZTC A;  4AQY Q;  3PUZ A;  4NB3 A;  3I55 A;  2UXD Q;  4DR2 L;  1WYD A;  2R7F A;  2VQF Q;  1LTL A;  3GTQ H;  5GAD C;  2GVA A;  3I4N G;  4NXM Q;  4OX9 Q;  2PQA B;  1RIP A;  3TS2 A;  4LUO A;  4BBS G;  1V9P A;  4DR7 Q;  2XGT A;  4BXX G;  5IT9 c;  5FLM H;  5C3E H;  4BXX H;  4GS3 A;  1WFQ A;  3FKI G;  3A0J A;  4DV3 Q;  3RZD H;  2VY3 A;  4DK3 C;  1D7Q A;  4AH6 A;  5C0X I;  2K5N A;  4A76 A;  4DR4 Q;  4PZ8 A;  5IWA Q;  4P75 A;  1XNR Q;  4JYA Q;  5FJ8 H;  1O7I A;  2GVB A;  3S2H H;  3AFP A;  1KAW A;  4A3J G;  2WAQ E;  4A3K H;  1XMQ Q;  4GOP A;  1GM5 A;  1JJC B;  1VQ8 A;  5IP7 G;  2UUC L;  3BZC A;  1N33 Q;  4X64 L;  4HJ8 A;  1H95 A;  1PH4 A;  1PH6 A;  2FXQ A;  1NBW A;  5C4J H;  2AKW B;  2Q2H A;  4DV0 L;  2MO1 A;  2JA5 H;  3CCE A;  2YTV A;  1AH9 A;  4JV5 Q;  4UP9 A;  3BU2 A;  3UDG A;  4GN5 A;  2JEB I;  4A3I H;  3GTO H;  3ULP A;  3RLN A;  1SFO H;  3ZJY C;  4QL5 A;  4A3M H;  3J7Z C;  3CCR A;  1J6Q A;  3H0G G;  4DV5 L;  3UDI A;  3H0G H;  1SLJ A;  3GTG H;  3I2Z A;  4JI2 Q;  3OTO Q;  4DR5 L;  2E5L Q;  1YIT A;  4A93 H;  4A3D H;  5IP9 G;  4WJ4 A;  1C7Y A;  5JEA G;  4DR3 L;  2R6G A;  4R4Q A;  2AWO A;  2Q2U A;  1IBL Q;  3OYY A;  4DR1 Q;  4LF5 Q;  3D0F A;  4DPG A;  3PO2 H;  3CD6 A;  1HJP A;  1CSQ A;  3PO2 G;  1PH2 A;  4A3J H;  4JI4 Q;  2OTJ A;  1D8L A;  1BVS A;  4OON A;  2R7D A;  1U5K A;  3GDE A;  1PA6 A;  2EXD A;  4JBW A;  5IYD H;  1EIY B;  2K50 A;  3EBE A;  3GTP H;  2B3G A;  1QZH A;  4C3J H;  1OXX K;  4MZ9 A;  2YTY A;  3TRE A;  5LMU Q;  1WJJ A;  3W1B A;  1N32 Q;  2A1A A;  4DKA C;  2B63 G;  2XTI A;  4C2M H;  3PUW A;  3HOV H;  1IYJ B;  5BR8 Q;  1CKM A;  3G4S A;  4YHH L;  1XNQ Q;  1GKH A;  1GD7 A;  3G71 A;  3F8T A;  5IE8 A;  4PMW A;  1WCM G;  4JI7 L;  3RLO A;  1Y1V H;  4P74 A;  2HIX A;  1L1O A;  3UDF A;  4GKJ Q;  1V1Q A;  2CWP A;  2F4V L;  4JI5 L;  1XMO Q;  2BH8 A;  1QUQ A;  4JI8 Q;  5M3M H;  3HOW H;  4YWM A;  5LMN L;  4JBJ A;  3KF6 A;  1YNX A;  4A3B H;  1CKN B;  4IFD J;  3HOU G;  1EYG A;  2PQA A;  2CFM A;  1HZ9 A;  1Q82 C;  1B7Y B;  4P72 A;  4DV6 L;  1PYS B;  2I5M X;  5ELN A;  1N34 L;  3I4M G;  4GNX C;  4B3T L;  3I4M H;  3GO5 A;  1VQI A;  1OXT A;  1X6O A;  3JAM i;  4HJ7 A;  1VQE A;  3U58 A;  1HNZ Q;  3PCO B;  3PGZ A;  2VZA A;  4PZ6 A;  4HIM A;  2H5X A;  4JG2 A;  1PVO A;  3CW2 C;  5IYB G;  1VQF A;  1GO3 E;  2WFW A;  2VQE L;  1A62 A;  1YJW A;  1XPR A;  4L5S A;  1FJG Q;  1VCI A;  4LFB L;  5K36 G;  2DGY A;  1Q1B A;  3S24 A;  1TWA H;  4JI1 Q;  1E7Z A;  1HNX L;  3PF5 A;  1FJG L;  3DLL A;  2GN5 A;  2DUD A;  2I0Q A;  3T1H Q;  3CCL A;  4A3L G;  1YHB A;  3M9B A;  4X62 Q;  2OCE A;  4DUY Q;  2QA4 A;  4LF7 L;  2Z6K A;  1G29 1;  4FDB A;  2A8V A;  2NVY H;  4R1J A;  4LFA L;  4A93 G;  1HNZ L;  1B8A A;  2KBN A;  3FKI H;  5JEA J;  4GOP C;  3OW2 A;  4DAY B;  1IBK L;  1YIJ A;  3HKS A;  4B3T Q;  1I6H H;  3J81 i;  1CKN A;  4A3E G;  1EQQ A;  1K83 H;  1N34 Q;  3A74 A;  3J80 c;  3HOZ G;  1SRO A;  1PYB A;  4KLK A;  1L0W A;  1N8R C;  1N9W A;  3CCJ A;  4DV1 Q;  1NE3 A;  2AMC B;  1L1O C;  1SR3 A;  1PH3 A;  4WJ3 M;  1NMF A;  2MFI A;  2F4V Q;  3A5Z B;  3CF5 A;  3RN2 A;  4Y7N H;  5GAH C;  1EOV A;  2R92 G;  1SE8 A;  3G6E A;  2UU9 Q;  1N36 L;  1QVC A;  3AYH B;  1UEB A;  1CSP A;  4YHH Q;  1XNQ L;  1E1T A;  3CMA A;  4KHP L;  3GD7 A;  3ICE A;  4BBR G;  1Y1W G;  4R4C A;  1PFS A;  4H02 A;  1X3E A;  3L0O A;  3CCM A;  4IPC A;  4RMF A;  1HH2 P;  2KCM A;  1UE7 A;  3PUX A;  1MJE A;  1YZ6 A;  3CCQ A;  5M3F H;  4DV4 L;  3F2C A;  1A0I A;  3S17 H;  4YCU A;  2OWO A;  1YBY A;  4B3S L;  2JA7 H;  4LF8 L;  4O0A A;  4YY3 L;  4A3B G;  3HOU H;  4Y52 H;  4JOI C;  4OWT B;  4B3S Q;  5IYD G;  3NBH B;  4OWX B;  2E8G A;  1HR0 L;  4BA1 I;  4A3F G;  1QVG A;  2KHI A;  1KXL A;  1VQA A;  3CCS A;  3TEH B;  1IL2 A;  2B63 H;  4X6A H;  4POG A;  1G6P A;  3D31 A;  2RCN A;  5E7N A;  4LF8 Q;  1K8A C;  4X66 Q;  3AFQ A;  4DV4 Q;  4C3H H;  4DV5 Q;  3RZO H;  1LUZ A;  2R7Z H;  2VNU D;  1K73 C;  1JJG A;  1X9N A;  1A63 A;  1Y1V G;  1WCM H;  2ZJR A;  2BA1 A;  1VQN A;  2OQ0 A;  5C0X G;  4BBS H;  1Q1E A;  1KD1 C;  2JA8 G;  4DV0 Q;  1TWF H;  1E3P A;  3F2D A;  2AWN A;  4DV1 L;  4O2D A;  2LSS A;  3CC2 A;  4LWC A;  1N33 L;  1W3S A;  2D0P A;  1KRS A;  3PV0 A;  2MNA A;  3S1M H;  1U0L A;  5C44 G;  2WB1 G;  3KLW A;  4JI0 L;  3GTM H;  4A3E H;  3HKZ G;  1EFW A;  1Q7Y C;  1MIU A;  2NZH A;  4A3K G;  4JYA L;  1NTG A;  5IWA L;  4GN4 B;  2Q2T A;  1XPO A;  5JJI A;  1JJ2 A;  4DV3 L;  5IYB H;  3CPW A;  2ZJP A;  5C4X H;  3NEM A;  3MEF A;  4UPA A;  4AYB E;  4C3I H;  2YTX A;  3HKZ E;  3T1H L;  4B3M Q;  2JA6 G;  4QQB X;  1HNX Q;  4JI1 L;  4DAM A;  2MQH A;  5M5Y H;  4HJ9 A;  5EAY A;  1IBK Q;  3AQQ A;  2Z0S A;  1Q12 A;  3CPF A;  1HZA A;  4XTC S;  1XTD A;  1PV4 A;  3I4N H;  4BY7 H;  2R93 G;  1P8L A;  4L5T A;  4QY7 A;  2ALY B;  1IXR A;  4YCV A;  3STB C;  4DUY L;  4LF7 Q;  4IJH A;  3PF4 A;  3CC4 A;  2V1C C;  1Q46 A;  4IPH A;  1VQ7 A;  1YJN A;  2OTL A;  3K0X A;  4POF A;  3UE0 A;  3M4O H;  4DUZ Q;  2IY5 B;  3BZK A;  3K81 C;  1X54 A;  4IOC A;  4B3M L;  5ELO A;  4DV6 Q;  1E24 A;  2JK8 A;  4YWL A;  4DK6 C;  3KYH C;  4JC0 A;  4DNI A;  4LF6 L;  1TWH H;  2JA7 G;  4TVA B;  1AE2 A;  4IJL A;  4P71 A;  1I3Q H;  5LMN Q;  2L15 A;  1KHI A;  1UE5 A;  1S3O A;  4GNX B;  3Q8D A;  4NPS A;  1JB7 A;  3F2B A;  3KJP A;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...