3HOWH

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 16
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howH00
1L2FA 2JEBI 2B29A 2JEAI 2R93H 3HOXG 4UP9A 3CD6A 4QQBX 1VQ4A 4DR3Q 3OTOL 2HIXA 4GNXB 1XNQQ 4IFDG 1W2BA 4Y52H 2R7FA 4AYBE 1WOCA 1HNXL 3KJPA 1QUQA 4GLVB 1NMGA 2DUDA 3I4OA 4JI0L 3W5OA 3S2DH 2K50A 1E7ZA 4DAMA 2F52A 5IE8A 4EX5A 1PH3A 4BY1H 2DGYA 2Y0SG 1WJJA 3KLWA 3KOJA 1C0AA 1G51A 4DUZQ 1VCIA 1VQFA 4DR3L 1YZ6A 1YVCA 2PNHA 4LWCA 5K36G 1SFOH 4OXPA 1NBWA 1T9HA 3RN2A 3A74A 1Z9FA 2PI2A 4HJAA 4GNXA 4LF8Q 1P16A 4KHPL 3M7NA 2K75A 1Z47A 3F1ZA 2ATWA 1V43A 4UP7A 5JJLA 3EBEA 2LSSA 3CCEA 4DV6Q 1PVOA 2N3SA 2N78A 3M4OH 3HKZE 1PFSA 5IP7H 5IYCG 4BBSG 2JQOA 1Q1EA 4DUZL 2NVYH 5JJKA 3D0FA 5JJIA 1Q86C 1VQDA 3RLFA 3HOXH 3S2HH 4POFA 1K9MC 3ER0A 1HNZQ 2VUMG 2RHQB 2KCMA 3CCRA 1Q8KA 3M4PA 5J3BA 4LF8L 3PF4A 3J7ZC 4A93G 5GROA 4KHZA 4K0KQ 4LFCQ 4DV6L 2KHIA 5EAYA 1K73C 4OO1G 2IHFA 2MQHA 2WB1E 3BJUA 3TEHB 2MO1A 4IJLA 4DKAC 2E8GA 1WI5A 3RLNA 1Y1VG 3G71A 3CCSA 1HNZL 4C2MH 4B3TQ 4B3MQ 1KRSA 3NEMA 1XMQQ 4WJ3M 1EOVA 4A3IG 3D31A 4YWMA 5LMUQ 4L5TA 1M90C 4LFCL 1UEBA 4L5QA 4P73A 4YCVA 4K0KL 3HOWG 5LMNW 1YJ9A 4OWXB 1N36Q 2YV5A 4GKKQ 4GKJQ 2CCZA 1KAWA 2JA9A 1IBKQ 2XTIA 3GTOH 1FJGQ 3E9HA 5IYCH 1QVGA 4BBSH 5IYDG 1XPRA 1B7YB 3K81C 2JJQA 3S15H 3S14H 4A3BG 4B3ML 4B3TL 1CKMA 1VQGA 1YITA 2Q2TA 1MJCA 4JI7Q 1XMQL 2CKZB 2VUMH 1UE1A 1JE5A 2WAQE 4P71A 3J80i 1IXRA 4LFAQ 4ALPA 1K3RA 4A93H 3EIVA 3W1GA 1N36L 1M1KC 2D0PA 2QA4A 4GKKL 2Q2IA 1GM5A 2ZTCA 4GKJL 5C4XG 4JYAQ 1IBKL 1FJGL 4C3HH 3PF5A 2PI2E 5M5XH 3H3VI 2IY5B 2JA7G 4IPGA 3PCOB 3KDFB 4DV1Q 1Y1VH 2JE6I 2I5HA 4LFAL 1HJPA 1OXXK 4JI4L 1VQPA 4A3IH 1BBWA 2UUAQ 1WFQA 2RHSB 4LW1A 3HOZG 4A4IA 3HOWH 4A3LG 1N32Q 2OWOA 4JBJA 3L7ZC 1CSPA 3PGZA 1Q46A 5IYDH 2PQAB 4A3BH 3SGIA 1YHQA 3KF8B 2Z0SA 1L1OB 4A3DG 3HOVG 1OXTA 3KDFA 4BA1I 1KXLA 1X3FA 2UUAL 2LXJA 3GTGH 2WP8J 2NN6I 3NENA 3W1BA 3DLLA 1XPUA 3KF6A 3I4MG 5M5YH 1I94Q 1JMCA 1LUZA 4BXXG 1BBUA 2OQ0A 4TQUS 1QZHA 1N32L 4H02A 5C4XH 3K8AA 3CCLA 1KQSA 2OCEA 1JT8A 3OTOQ 2JA7H 2VS1A 1OXVA 1SMXA 3FP9A 1YJNA 1HH2P 5C0XG 1AE2A 1DGSA 3CMAA 1FL0A 3K7UC 3GTMH 5BR8L 4JI0Q 2AHOB 4HIDA 2V1CC 1ASZA 2VY3A 5E7NA 5C4JH 4GOPB 1X3EA 1R9TH 1I94L 1AE3A 1VS0A 1MJEA 2HQLA 3HOZH 3BZKA 1X6OA 2R7ZG 5ELNA 1S72A 2OTLA 1EFWA 4NXMQ 4LFBQ 3JAMc 4LUVA 4A3LH 4DV5Q 3U4ZA 4A3CG 4PMWA 4AQYQ 3S17H 4OX9L 1IZ6A 1U0LA 2JA6G 1EQRA 1HZBA 1ASYA 4HIMA 4A3DH 3K80C 3CW2C 3HOVH 2AWOA 3UDXA 4KHPQ 3F8TA 1QZGA 2GVBA 5IY0A 3E9IA 4YWKA 4LF6Q 3ICEA 5LMNQ 3Q8DA 3UE0A 3I4MH 4NB3A 4NXML 4LFBL 3TRZA 4GOPA 3UDFA 3OW2A 1WYDA 1VQKA 2VQEQ 1IBLQ 4DV5L 1IL2A 2UXBQ 4AQYL 2ZJQA 2VZAA 3CMEA 1S40A 4R4QA 1Q7YC 4HJ5A 4OONA 1LTLA 2B63G 2YTXA 2EQSA 3M4QA 3CC4A 3CCQA 2EXDA 4LF6L 4IJHA 1I6HH 1IBMQ 5LMNL 4HJ8A 1VQBA 1YHAA 1YNXA 2UXBL 3F2BA 4IPCA 2VQEL 1IBLL 2R92G 4UP8A 4A3KG 2R7ZH 2E2JH 4PZ7A 3ULPA 3CXCA 4FDBA 2BH2A 1BKBA 1WCMG 3G6EA 1YI2A 3EN2A 4LNQA 2JA5G 4C3IH 2UU9Q 2IT1A 3PSIA 5JEAG 4HJ9A 4YY3Q 1N8RC 1XMOQ 2HT1A 2JA6H 3PO2G 4BA2I 2R6GA 2IX1A 4A3MG 1IBML 4X66Q 1VQLA 3J81c 1VQJA 4DK3C 5HGQA 1LYLA 5C44G 4DV0Q 1X56A 1VQMA 4GLXA 2D0OA 2BA1A 1EIYB 4WJ4A 4KI0A 4PZ8A 4YCWA 3CC7A 3AQQA 2IX0A 2MFIA 3G48A 2UU9L 2NVTH 5FLXc 1YHBA 3M3YH 4HIOA 2RCNA 4YY3L 1A0IA 1XMOL 2Q2UA 2HIVA 3AFPA 4XIGS 1PH9A 4RG1A 4GLAC 4X66L 2B63H 5FLMG 4IPDA 4R4OA 4JOIA 1CKNB 3PUVA 4DV0L 4A76A 5GAGC 2K52A 4YHHQ 1VQ9A 2NVXH 1KHIA 3S1RH 1H95A 1A63A 4POGA 2ZM6Q 2XGTA 1KRTA 2R92H 4A3KH 3M85A 2A1AA 2R7DA 2NZOA 4R4CA 4X65Q 4UY8C 1UE6A 2Z6KA 1WCMH 4DUYQ 4LF5Q 1YIJA 2JA5H 3GTKH 4XTCS 1N34Q 4JI4Q 3S1QH 4JV5Q 3B6YA 2UXCQ 4QIWE 4IO9A 3PO2H 4YHHL 4A3MH 1PHJA 4AYBG 1FGUA 5GQOA 1PH4A 2CQOA 4GNXC 3LGJA 5C44H 2ZM6L 1CKNA 4P72A 1SRUA 2F4VQ 4BBRG 2H5XA 1EWIA 4X65L 1E3PA 1HZ9A 3CCJA 5AJ3Q 4DR4Q 2KBNA 4NPSA 4DUYL 4LF5L 4DPGA 3KF6B 1N34L 1EIFA 3CF5A 4JV5L 3RR5A 2UXCL 2VNUD 4DR2Q 2I0QA 3K0XA 5FLMH 2Y0SE 1LM0A 4BY7G 1PYSB 3GTPH 1VQHA 2CWAA 3ULJA 1QVFA 4LF4Q 5C3EG 2F4VL 4DR6Q 1RL2A 4OWWB 1TWAH 2JA8G 3KJOA 1GD7A 5GADC 1I5FA 5AJ3L 4DR4L 4O0AA 1BVSA 4APVA 1SE8A 2KHJA 4DR2L 1TWHH 4GN3B 5BR8Q 3I55A 2A8VA 1CUKA 3J81j 2OTJA 3IRBA 5IP9G 2VL6A 4A3EG 4LF9Q 2QEXA 1UWVA 3RZOH 1A62A 1V1QA 5M5WH 1HNWQ 2ZTEA 1EQQA 4LF4L 4DR6L 1K0RA 2R93G 2WB1G 3J80c 1PH7A 5GAEC 4IFDI 3S24A 4BBRH 3GO5A 1X65A 4OX9Q 2UUBQ 1VQOA 3AYHB 1HR0W 1D7QA 1X9NA 4LF9L 4LUZA 4X62Q 1PH6A 1HNWL 2UXDQ 3KYHC 3CPFA 3E0EA 3CP0A 3RNUA 5M3FG 1JJ2A 4BY7H 1PA6A 1C9OA 2UUCQ 1CSQA 1PH1A 1Q1BA 3BZCA 4KLKA 4AH6A 2E2IH 2BH8A 5C3EH 3KFUA 3GD7A 2I5MX 2JA8H 4IFDJ 1GVPA 3CQZH 1AH9A 4C3JH 3DM3A 3MXNB 2UUBL 4A3FG 1GO3E 1I50H 1J5EQ 3I4NG 1VQ8A 3U58A 5H1SE 1NTGA 4JBWA 4X62L 3RN5A 2UXDL 1VQIA 1D8LA 4A75A 2N8NA 3CCVA 4A3JG 5IP9H 4R1JA 4A3EH 4DK6C 2NN6G 3TS0A 3CC2A 1SN8A 1L0WA 2UUCL 2K5VA 2KCTA 1VQ7A 2I5LX 3BU2A 1Y14B 2LXKA 2QGQA 3CAMA 3STBD 5FJ8G 3S1MH 3J81i 3UDIA 3L0OA 1VQAA 1J5EL 3HOYG 3H3VH 2K14A 1KIXA 3HOUG 5GAHC 3JC66 1N33L 1VQEA 2BA0A 3A5UA 4OO1I 1K8AC 3T1YQ 4B3RQ 4QGUA 1KL9A 1K83H 1X55A 3PV0A 4QY7A 4DR5Q 1NE3A 2E5LQ 4IPHA 3CPWA 5M3FH 2YU9H 1UE5A 4UPAA 2OQKA 3TQYA 1X3GA 1XPOA 5M3MG 1P8LA 4A3CH 1QVCA 1IYJB 2ID0A 1TXYA 1XNQL 5JEAJ 3TREA 1U5KA 2Q2HA 4P74A 2E2HH 3AEVA 1PYBA 4A3FH 5DLQE 2YTYA 3I56A 2ZJRA 4PG3A 5ELOA 3T1YL 3I4NH 4IOAA 4B3RL 4DR5L 4LF7Q 1YBYA 5IYBG 2E5LL 1A8VA 4A3JH 4DAYB 4DV7Q 2EIFA 2PMZE 3L2PA 1L1OC 3OYYA 5IT9c 1W3SA 5IWAQ 4DV3Q 3F2DA 1UE7A 4Y7NH 3FKIG 5FJ8H 4J15A 1SLJA 2MNAA 1K8GA 1HZCA 1E24A 5HY6A 1Q81C 1OTCA 2VW9A 1NMFA 1MIUA 2FXQA 2GVAA 1TWCH 3NELA 4QL5A 3PUYA 4DNIA 3PIPA 1C7YA 1KC8C 2K5HA 2HHHQ 3U4VA 1S3OA 4JI5Q 3HOUH 4LF7L 4R4IA 3AFQA 1TWGH 4DV7L 1FVIA 2ZJPA 4JI8Q 5IWAL 4DV3L 1PV4A 2JK8A 1E1TA 1NY4A 4L5RC 3PUZA 1CKOA 4O2DA 1PH2A 5M3MH 4DV4Q 3H15A 2C35B 4HIKA 1GKHA 2L15A 4JI2Q 4GOPC 1NJIC 1G291 3CCMA 4PZ6A 4JI5L 3VDYA 2CFMA 2HHHL 4B3SQ 2K5NA 3S1NH 1HR0Q 4AIMA 4L5SA 4JG2A 3T1HQ 1V9PA 3HOYH 4NXNQ 2MO0A 2RF4A 1G6PA 4JI8L 5IYBH 3PUXA 3UDGA 3PO3G 3J7A5 1PH8A 3G4SA 4BXXH 4DV4L 2ZTDA 2N49A 4JI2L 3M9BA 1YEZA 2K4KA 3FKIH 3GTJH 4B3SL 1HR0L 2IHEA 1SR3A 2A19A 5LMUL 4LUOA 3ERSX 1HZAA 3T1HL 4YCUA 1Y1WG 1KD1C 4MZ9A 4NXNL 2NVQH 3H0GG 3HFZB 1I3QH 3I7FA 1B8AA 2NZHA 4DR7Q 4QJFA 3HKZG 3STBC 4JCVE 5C0XI 3RZDH 4DV2Q 1RIPA 4JC0A 4JI7L 1E1OA 1OXUA 3GTQH 3JAMi 3GDEA 4JI1Q 4EQ5A 1Q12A 4A3GG 3ULLA 4OWTB 2D62A 3U50C 3ZJYC 1X54A 2GN5A 2B3GA 3K7AH 4GN4B 1E22A 3RLOA 4GS3A 1VQ5A 4JYAL 4DR7L 3PUWA 2WFWA 4YWLA 4JOIC 1YJWA 2ES2A 4JBMA 3PO3H 2KENA 3A5ZB 4DV2L 4IOCA 1JJGA 5C0XJ 2YTVA 4DV1L 4JI6Q 3NBHB 1XTDA 4ME3A 2VQFQ 1VQNA 3GTLH 2YYZA 1OXSC 1XNRQ 4DR1Q 4GN5A 4JI1L 4X6AH 2F3IA 1O7IA 1VQCA 1EYGA 2Z6KC 3A0JA 4BY1G 1Y1WH 2CWPA 4X64Q 4HJ7A 4R4TA 4P75A 4JBKA 3HKSA 3H0GH 3WWVA 4JI3Q 3FHWA 3CCUA 2ALYB 1XJVA 1MKHA 1JJCB 3S16H 1B70B 4MTNA 3F2CA 1JB7A 4JI6L 1QUQB 1Q82C 2VQFL 4TVAB 3PIOA 1PH5A 2AWNA 4DR1L 1XNRL 1N9WA 1J6QA 1N33Q 2AKWB 4RMFA 3TS2A 4MNOA 2WAQG 1HNXQ 1EUJA 2PQAA 4A3GH 3I2ZA 4X64L 1SROA 3MEFA 1TWFH 1L1OA 1VQ6A 5IP7G 4JI3L 2ASBA 3UE1A 2AMCB
chains in the Genus database with same CATH superfamily
2JEBI 2B29A 3KBGA 3NPPA 3CD6A 4QQBX 1W2BA 2R7FA 4QMGA 1HNXL 1QUQA 1NMGA 2L0CA 4KHVA 4JI0L 3W5OA 1ET9A 4DAMA 1FGBD 4LJZC 3Q6SA 1DM0B 1S5BD 1PH3A 1FD7D 4EQPA 1C0AA 3CKIB 1VCIA 3PQIA 5NUCA 5T1GA 3H94A 3SVMA 4OXPA 1NBWA 1EY7A 1Z9FA 1Q8IA 4XQQA 3D3RA 1GOZA 3E5SA 4IUQA 3VR3A 3F1ZA 3EBEA 1PVOA 2N3SA 2N78A 3HKZE 1ET6A 1HUMA 4K5VA 3FKIB 5JJKA 3D0FA 2VUMG 5DM73 2VUMB 2RHQB 1DONA 1Q8KA 4LF8L 5J3BA 3PF4A 1AN8A 3MAQA 4ZAIA 2KHIA 2IHFA 2MQHA 1HCZA 4C3HG 2MO1A 2E8GA 4DF7A 1BO0A 3DEOA 1Y1VG 3G71A 3X3MA 4C2MH 4B3MQ 3GTQB 1FR3A 5EPJA 5C3XA 1VF7A 4WJ3M 4IN3A 2A69D 1M90C 3D4WA 4LFCL 3HOWG 3DHQA 4U673 2YV5A 4GKKQ 4DXFA 4GKJQ 2JA9A 2XTIA 3GTOH 1GUGA 5IYDG 1XPRA 3K81C 2F0OA 4A3BG 2GA4B 3OW7A 1WTVA 4GZYC 3MFGA 2VUMH 1JE5A 3JAML 2BOSA 2X6GA 3EIVA 1B3QA 1M1KC 2Q2IA 3W2DA 3HKZB 4HMJA 5ELBA 4C3HH 4H44C 2IY5B 2F0HA 2KQ3A 1KAAA 3KDFB 1H9SB 1Y1VH 3TZUA 2JE6I 3A7AB 4A3GB 1HJPA 4DN4M 1BBWA 2VB3X 3HOWH 1LT3D 2EPBA 1N32Q 2SNSA 3PGZA 4KJOA 4F87A 5IYDH 4A3BH 4DK1A 4HMIA 2K28A 2Z0SA 1OXTA 5ISRA 2WP8J 4ZUIA 5IODA 3I4MG 4ZKCB 3I4MB 1LUZA 2L11A 4H02A 2OCEA 1M8AA 2VS1A 3SEBA 1DGSA 3OIPA 2SOBA 4DAPA 3GTMH 4JI0Q 2FFKB 3KF8A 5FLXL 1X3EA 4FNFA 5FO9B 1VS0A 1SEBD 2HQLA 3RD4A 3BZKA 1CT1D 2OTLA 1SNPA 4LFBQ 2XSCA 1EY0A 5CBAE 4DV5Q 1EZ6A 4CBVA 1HZBA 3CW2C 3BVGA 2GVBA 5CV9A 3VA7A 3Q8DA 1E2ZA 3I4MH 3H91A 2XVSA 3VR5A 3FPUB 4B9XA 1R4PB 1LTAD 2ZXRA 1Q7YC 3D4RA 4RGOS 1ENFA 4OONA 1D1IA 2YTXA 1C4QA 3QG1A 2KJXA 3J7YW 3CCQA 4IJHA 1I6HH 3MXNA 5LMNL 1F2LA 1IBMQ 1YHAA 3S1RB 1SNMA 1NSNS 1E0BA 1XXGA 2UXBL 1IBLL 3BDOA 4KKTA 3ULPA 1WCMG 4DU9A 1WCMB 3EN2A 1YI2A 1JOQA 4IFDH 1RODA 5CC4A 1KLGD 5L37A 5JEAG 4HJ9A 1N8RC 4A93B 4BA2I 1O7YA 4X66Q 2KEEA 1VQJA 4TRDA 2F0KA 2K7VA 1LLRD 1JWSD 3AQQA 2IX0A 2CH4W 4ID6A 3M3YH 2RCNA 4YY3L 1XMOL 4IUUA 4RG1A 4GLAC 4DV0L 1VQ9A 1JR0D 4IUTA 2F0LA 3S1RH 1H95A 1KRTA 4HEDA 4R4CA 1UE6A 1WCMH 4FO2A 4LF5Q 1YIJA 3GTKH 4XTCS 1IHZA 1Y8NB 5JEAH 3B6YA 2NWGA 4JV5Q 1PLFA 3NXWA 2XNAC 4YHHL 4RWSC 1FGUA 1MBYA 4GNXC 3Q0AA 1EWIA 1JWUD 2L4NA 1PTOH 4DPGA 5ELCA 1ESRA 3CF5A 5C4JB 4DR2Q 2F4IA 2EY6A 3TDQA 2Y0SE 1LM0A 1VQHA 1DJRD 3ULJA 2AUJD 4RHRA 4O1NA 4DR6Q 2D5DA 4KY7A 3S17B 2PMZB 5GADC 2BDNA 1BVSA 4A3DB 5JPNC 2EJGC 3TN2A 2KHJA 1J9OA 1EY5A 2XRQD 5IP9G 2K32A 1DCZA 1HNWQ 2Z4HA 3OWFA 3RMHA 2R93G 1B53A 4X3UA 2K05A 1VQOA 3K57A 1X9NA 1AW7A 2I07B 2UXDQ 3ND8A 1LTTD 3CP0A 1B9NA 3P1HA 2R7ZB 2E2JB 1PA6A 1C9OA 2BH8A 1YNJD 1S5ED 4TKOB 1GVPA 1WD0A 1GO3E 4XT3B 4X62L 1H9JA 1D8LA 1TY2A 2N8NA 4A3JG 2EE1A 4A3JB 5IP9H 3KK7A 3NE5B 2K5VA 2KCTA 3BU2A 4K6DA 2QGQA 3STBD 5FJ8G 2NVTB 5KNDA 1CHQD 5BN4A 3H3VH 1TWCB 1KIXA 2B63B 5FLXE 1N33L 1IW7C 2NVXB 4CGYB 3EFXD 4HAEA 1M4VA 1H9MA 2AQ3B 3NP8A 2SDFA 4QGUA 1KL9A 4IPHA 4QB4A 4A3KB 3K0YA 2OQKA 3TQYA 4K6LA 3WOFA 2P5ZX 1RD9D 3GV3A 2JA5B 3E6ZX 3S1QB 5JPMC 4G57A 1U5KA 2B39A 2Q2HA 4PMCA 2F3WA 4P74A 1PYBA 4OELB 4A3MB 2ZJRA 2BE5D 2F0WA 5C44B 2V4DA 3OHXC 3LWEA 4A3JH 4DAYB 4DV7Q 2EIFA 1L1OC 3OYYA 1CTMA 3F2DA 5FJ8H 1SLJA 2J4XA 1K3BC 5I9OA 1MIUA 4DNIA 1C7YA 1TWCH 4QL5A 2HHHQ 4LF7L 2F1MA 3AFQA 4O42A 3VR2A 1G6ZA 1MI2A 1TWAB 3O13A 2L5TA 1K0SA 2JK8A 2TMPA 1NY4A 1L0YB 3VA5A 4JVZA 5BN3A 2J7ZA 1CKOA 1PH2A 2RDFA 3I72A 5BN5A 4DV4Q 4GOPC 1NNXA 2L15A 4JI2Q 5CYUA 4F7XA 1NR2A 4PZ6A 4JI5L 2K5NA 4AIMA 4L5SA 2H4OA 2EDGA 4JI8L 2K33A 3UDGA 4BBRB 4WJWA 5HGTA 3G4SA 3LX0A 2A5HA 2N49A 2EY2A 4HCEA 4B3SL 1BCPD 5CV6A 4EQOA 2K1BA 5LMUL 1HZAA 1KD1C 3DMUA 3L3OC 4HSVA 4BY7B 3H0GG 4G7HC 3H0GB 2E2IB 2F0EA 1C8CA 1EU3A 4C3JB 4JCVE 3C2PA 3MHBA 1QNKA 1E1OA 3P75A 3SDZA 4RHSA 3GDEA 1AZPA 4S3SA 1TWFB 1D2BA 3K7AH 2RKSA 4GS3A 1VQ5A 2EYPA 4DR7L 3PUWA 2ES2A 2WB1B 4DV2L 1JJGA 5EQ0A 1K8MA 5E3FA 4CDCC 3HZXA 4ME3A 2VQFQ 5G3LF 4X6AH 2YYZA 1OXSC 1JE4A 1XNRQ 4JI1L 2F3IA 1D1KA 1H9SA 3OPOA 1GJXA 1UAPA 2CWPA 4HJ7A 4R4TA 4P75A 4XYOA 2CHBD 3H0GH 4JI3Q 4M1UB 2ALYB 2N55A 2FINB 5KYLA 3S16H 1LTSD 4NMZA 1JB7A 3PIOA 4A3FB 1PFBA 1N33Q 3IFTA 3NBHA 3TS2A 2O5IC 1TWFH 4CKBA 5CGKA 3K58A 5IP7G 4XQJA 4KN4C 3UE1A 5HY6A 1L2FA 2JEAI 4V0BA 1VQ4A 4DR3Q 3OTOL 4Y52H 1KNAA 4XQNA 3A8JE 4AYBE 4K8JA 2DUDA 1TWGB 2MGSA 1BQQT 1E7ZA 2VXWA 2EYMA 2EXZA 3LWUA 4EX5A 1QILA 3VYTA 2CW0C 3KLWA 1WJJA 3KOJA 5EKKA 1G51A 1GXDC 2F0UA 5CMDA 2A6EC 5D65A 1YVCA 3Q22A 3TP6A 5K36G 4IUPA 4XYQA 5EKIA 3S1NB 4TSSA 4GNXA 2RDGA 4KHPL 2K01A 2ATWA 1Z47A 1WTXA 1V43A 4UP7A 1XTCD 1JORA 1PZJD 1D5XC 5IP7H 4Q5VA 1QG7A 4H7BA 1ZEQX 3MA2B 3ER0A 4FXGC 3CCRA 3MWYW 5GROA 1XYIA 4N8X1 4K0KQ 5EAYA 1I3QB 3I91A 5D3DA 4R9WA 2B2TC 3OOCA 3MC0B 1TU2B 3A7LA 1WI5A 4DK0A 2L12A 3K5LA 2KVMA 4DA2A 4B3TQ 1I4RA 1KRSA 1LABA 2QDLA 5K36H 3NEMA 1XMQQ 4A3IG 5LMUQ 4YWMA 1JWMD 2B2WC 1CA6A 1UEBA 2KHSA 1YJ9A 4OWXB 4UDUC 1HFNA 2ENBA 3H6MA 3VR6A 3SK4A 1KAWA 1FJGQ 1B9MA 4B3ML 3GTLB 2DY7A 2Q2TA 3WOEA 3NWSA 3R2TA 3J80i 4LFAQ 3W1GA 2D0PA 4GKKL 1SNDA 4GKJL 1LTRD 1SSOA 2PI2E 5M5XH 4IPGA 2I5HA 4QCLA 3OMGA 1VQPA 4A3IH 1R9TB 1FNVA 1WFQA 4HCSA 4Q0FA 1CI3M 3HP3A 4A3LG 2O2LD 3L7ZC 1MHWC 1CSPA 2NB0A 1Q46A 2B2YC 3BYYB 3SGIA 5KNCA 2MPMA 2EOTA 5A2QE 4I7AA 2A6HD 1ML0D 2NN6I 3W1BA 1ENAA 5KGUA 3GV6A 1I94Q 1WTHA 4BXXG 4TQUS 2F03A 1N32L 1SE4A 4U68A 1ILPA 1JT8A 3OTOQ 1OXVA 1SMXA 4ODGA 1CA5A 3K7UC 4ABNA 3U9OA 5BR8L 1STGA 4JBKA 1R9TH 1CK1A 2EJFC 1STEA 1S72A 1EFWA 1GUOA 2RVLA 3I70A 1JCKB 4A3LH 2NTSA 2Q8IB 3U4ZA 4C3IG 4A3CG 1F2MA 2K6AA 1L0XB 1EQRA 1ASYA 3K80C 1DOMA 2A69C 4KHPQ 3DXJC 3F8TA 3I90A 5LL6X 4YWKA 4X3KA 3MVVA 4LFBL 1Y69U 4BXXH 4GOPA 3UDFA 3OW2A 3N52A 4DV5L 4C2MB 2ZJQA 2VZAA 3QJYA 4R4QA 2Z4IA 1EY6A 1RJTA 3RUZA 2EXDA 1LO5D 4K8IA 3GTOB 1YNND 1S5DD 3AB9A 4IPCA 4UP8A 1TKWB 2F0JA 2EJMA 1ICWA 1BKBA 4LNQA 2UU9Q 4C3IH 3CHBD 3F2UA 1VF5C 3EQLC 3T4AC 1VDZA 2HT1A 4N9PA 2IX1A 1IBML 1VQLA 3J81c 2JYOA 3T13A 1FNWA 4RH6A 4C3HB 1CQFA 3QR8A 2D0OA 2CVRA 1Y1VB 2F0NA 2G9HD 5E4WC 4KI0A 2MFIA 5T1IA 5IGGA 1RHPA 4HIOA 2HIVA 3AFPA 4XIGS 4X66L 1RTOA 1V8QA 5FLMG 3HOWB 2JSOA 4A76A 2K52A 3GTPB 1A63A 1QJOA 1S4ZA 4A3BB 3C1FA 1TR5A 2NZOA 4X65Q 1TVXA 4ZRZA 1B1ZA 3ZYYX 2FMMA 1N34Q 4RGTA 1WTOA 3Q24A 2UXCQ 4QIWE 2PZTA 3DWQA 2F0QA 3LGJA 1CKNA 1EWCA 2F4VQ 3P7JA 5AJ3Q 2KBNA 4LF5L 3GTMB 1EIFA 4JV5L 3RR5A 2XN9C 2I0QA 2K04A 1T5EA 3K0XA 5FLMH 4R8IA 3GTPH 1D6EC 2CWAA 1TIID 3I8ZA 5C3EG 5C3EB 4HR7B 1GD7A 1I5FA 4H13C 4F8MA 1V1OA 1SE8A 1I4HA 4DR2L 5BR8Q 1CUKA 3J81j 4LF9Q 4A3EG 4A3EB 3EROA 1V1QA 5EBDA 3A8KE 3X3NA 4DR6L 3EVQA 3J80c 1PH7A 4KD3A 4KD4A 4ZQ3A 4IFDI 2DJGC 2EYOA 5ELFA 1IKMA 5IT9L 2UUBQ 1I6HB 3AYHB 1HR0W 1D7QA 1PH6A 1HNWL 4QIWB 3KYHC 5J1ZA 3NTIA 1SE3A 3D6WA 3NK9A 1CSQA 2UUCQ 4AH6A 5C3EH 2OXPA 2I5MX 4IFDJ 3CQZH 3DM3A 1ESFA 3PIP3 3I4NG 1VQ8A 5C5LA 3U58A 1NTGA 2B2TA 4JBWA 2UXDL 2WV6D 2F3VA 3CCVA 1SBBB 1DD2A 4R1JA 4A3EH 3CC2A 4RFBA 2J0TD 5JOBA 3CAMA 1TY0A 3S1MH 4N9TA 1TT2A 3M3YB 4MIUA 3UDIA 2B2WA 3HOYG 3HOUG 2IL8A 4XDXA 3HOUB 3BDCA 2NYZD 2AUKA 1MSHA 4OO1I 2EYJA 4WFN3 3T1YQ 4RKLA 3BDLA 2E5LQ 1CHPD 2YU9H 1UE5A 1XPOA 1EZ8A 1EL0A 1P8LA 1XX8A 3MXUA 1IYJB 2OT2A 3GTKB 1XNQL 4ULLA 2MJ8A 5JEAJ 2E2HH 3AEVA 5DLQE 4PG3A 4WRDA 3I4NH 1A6XA 1EYDA 2PMZE 3LNNA 5LHY1 5IWAQ 4DV3Q 1PRTB 4Y7NH 4KY5A 4LK1C 1PTOB 2WACA 1K8GA 4FVMA 5F2DA 1OTCA 2VW9A 3HOYH 1EU4A 3PUYA 4K2KA 3HOUH 1KC8C 4JK1C 1V1PA 1DYQA 4R4IA 4YIJA 4DV7L 1QE6A 2HDMA 2B2YA 2IWHA 5JAVA 2WKCA 3H15A 3K5MA 1GKHA 1LACA 1NJIC 1G291 1F77A 3VDYA 2HHHL 1FNUA 4JG2A 3T1HQ 1STBA 4NXNQ 2RF4A 1G6PA 3PO3G 1SJED 4DV4L 5KYIA 1YNJC 4JI2L 3M9BA 2K4KA 5JJZA 1BOSA 3GTJH 1JC7A 2M2LA 2IHEA 1O78A 1SR3A 2A19A 2F0MA 2E2DC 2F0IA 2HUGA 3ERSX 1Y1WG 4YCUA 1Y1WB 1C48A 1BCPB 1STHA 3I7FA 3STBC 5ELDA 2DN8A 5C0XI 3JAME 3WDNA 4JC0A 4CKEA 4CJ2C 3JAMi 4G4KA 1Q12A 4EQNA 1PZKD 1ZYRD 2KCNA 1E22A 4MN3A 4KKSA 4JYAL 4YWLA 2WFWA 1YJWA 2R93B 4JBMA 1PXUA 3GP7A 2AQ2B 3PO3H 1A3VA 3A5ZB 1X3QA 5C0XJ 3DWPA 3W3AA 3MTSA 1LT4D 1NCVA 1O7IA 1VQCA 3A55A 1ZKOA 2Z6KC 2BE5C 3A0JA 3TMEA 4IUNA 4BY1G 1Y1WH 4BY1B 1H9RA 4X64Q 2SNMA 5A35A 3SK5A 3WWVA 2Z8LA 1DOKA 2KCCA 3CCUA 1JJCB 1EWHA 4K14A 4MTNA 3F2CA 3NTHA 1QUQB 1Q82C 1NAPA 2EYFA 2VQFL 1XNRL 3G6JB 3T51B 4RMFA 5JVH3 2BDOA 2WAQG 1HFGA 4QUFA 1SROA 5EGTA 3MEFA 1II3A 1HRJA 4JI3L 2ASBA 2AMCB 2RSNA 4FP5D 5CV5A 2R93H 3AMUA 1XNQQ 1WOCA 3KJPA 4GLVB 3I4OA 3S2DH 2K50A 3TSSA 4BY1H 4UHVA 2Y0SG 1RKNA 2E74C 3BS1A 1F9QA 3BG3A 4DUZQ 1VQFA 4DR3L 3NWTA 2PNHA 4LWCA 3OMCA 1SFOH 2DNCA 1RTNA 2OEOA 3RN2A 3A74A 1BBXC 1BCPC 2PI2A 5FK9C 4HJAA 1P16A 2KOLA 1PRTD 2K75A 5JJLA 2LS01 1PTOD 4DV6Q 2LSSA 3T53B 3M4OH 2JQOA 1Q1EA 5JJIA 2MP1A 1VQDA 2Q8RE 3RLFA 2JP1A 3S2HH 4POFA 1HNZQ 1D5MC 3M4PA 1LTID 4FF4A 4KHZA 3FPPA 1K73C 2QW7A 3QO2A 2WB1E 3BJUA 3TEHB 1KTKA 3H3VC 4ME5A 2F0TA 4DKAC 4LMQD 3M4YA 1SNOA 2HDLA 1F9SA 5KRUA 2G5DA 4KV6A 1DXMA 1EY9A 5CV7A 1J8IA 4L5TA 4K0KL 3K7AB 4P73A 3U9SA 4CJ1B 4MHEA 5LMNW 4DXGA 4XXEA 1N36Q 4PNYA 2HCCA 1EYAA 2CCZA 1IBKQ 4ZYSA 1QVGA 1B7YB 3S14H 4B3TL 1CKMA 2TSSA 4P2CB 1VQGA 3I4LA 1MJCA 1XMQL 3KBXA 4NP5A 4IZ8A 1BR9A 4OIJA 1IXRA 4ALPA 3Q23A 2LFNA 3FDTA 2QA4A 3S16B 2ZTCA 5C4XG 4JYAQ 1FJGL 3PF5A 3D4DA 2AQ1B 2VB2X 2JA7G 3J7AV 5I9PA 5J39A 3FVQA 4LFAL 1MSGA 4OL7A 1TQOA 1OXXK 5EJWA 5C3WA 2D9UA 4ZK9B 2UUAQ 3HOZG 1SMYD 3HOZB 1Y8OB 1FYCA 3EA6A 4IQZA 2OWOA 1X32A 2PQAB 3KF8B 1HQRD 3CU7A 3KDFA 1DZ1A 3HS0C 2LXJA 3DLLA 5M5YH 1JMCA 1QZHA 2B2VC 2M00A 5C4XH 1QNUA 2QDBA 3P20A 2JA7H 1ZXTA 3K5NA 2IJ0A 2QEJC 1YJNA 1BNZA 2R3ZA 4FF1A 1AE2A 1WTRA 1FL0A 2AHOB 2I46A 2V1CC 5M9OA 2VY3A 5E7NA 1ASZA 2FJ2A 1I94L 5C4ZA 3HOZH 1MJEA 5KEEA 1X6OA 5ELNA 4NXMQ 4CDFC 3JAMc 2FMCA 1SNQA 4AQYQ 1IZ6A 1U0LA 1EIGA 5EBCA 4HIMA 2AWOA 1SXTA 3MXGA 3E9IA 2K5WA 1WTPA 4LF6Q 3ICEA 3UE0A 4NB3A 3TRZA 2PCFB 4K5XA 2VQEQ 1TS4A 2LMCB 2R61A 1EFID 5FO7B 3K59A 3CMEA 4RA8A 2QCPX 3C1EA 4HJ5A 1WD1A 4CHTB 2EQSA 1PDQA 3M4QA 1BDOA 3BYTB 4HJ8A 2O4XA 1VQBA 1B3AA 3KLRA 4Z9CB 1NR4A 3F2BA 2R92G 1S5FD 2F0VA 2WKDA 3VYSA 1HA5A 4PZ7A 3N6RA 3TP7A 3IFDA 4KK7A 1IYVA 4I7ZC 3G6EA 3NQIA 3PO2G 1GUSA 2R6GA 3ERQA 3PO2B 1QWYA 4DK3C 5HGQA 2QKIC 2NUCA 1X56A 1ONLA 5M5XB 1HTLD 1EIYB 5IGCA 1GUWA 4YCWA 2UU9L 3G48A 5FLXc 2A68C 5IIFA 4A3IB 2Q2UA 4KTAA 2DY8A 1PH9A 4R4OA 1Q90A 3T16A 3PUVA 5GAGC 3AU7A 2C9OA 1CFMA 3A8IE 2ZM6Q 2XGTA 2R92H 3M85A 1STYA 1GUTA 2Z6KA 4DUYQ 2OF1A 1QOHA 3PO2H 4PQXA 4IO9A 3RZOB 4ZLTF 1PHJA 4AYBG 5GQOA 1PH4A 2CQOA 2O5JC 2B8FA 3IL8A 3K6OA 4P72A 2CW0D 1SRUA 1TS5A 4HTHA 2H5XA 3SR1A 4X65L 3J7AF 1E3PA 2PZWA 2A6ED 3CCJA 4DR4Q 4NPSA 2Q8TA 1BUVT 3KF6B 4K2LA 5G3LD 1N34L 4ILWA 2UXCL 1B2TA 5DEHA 1K28A 4V190 5CV8A 1QVFA 4LF4Q 2F4VL 1RL2A 4OWWB 3QIAA 2JA8G 3KJOA 1F9PA 5AJ3L 1EY8A 1JB3A 4APVA 1TWHH 3I55A 2A8VA 3RZOH 5ELEA 1UWVA 2QEXA 5M5WH 1U4RA 1YNNC 1EQVA 1EQQA 1K0RA 3OWEB 3OSOA 3S24A 1HTPA 2LKVA 4LAAA 1X65A 5JVG3 1R4QB 3T56B 1E2VA 4LF9L 4DNTB 2RQXA 3RNUA 1K83B 3I3CA 1SYBA 1JJ2A 5COYA 1PH1A 1Q1BA 3BZCA 1D5ZC 4C3IB 3GD7A 2JA8H 1AH9A 2UUBL 5FOBB 1J5EQ 1A2TA 1I50H 3HEJA 4RKBA 2B8GA 2Z9HA 5H1SE 2F0DA 1VQIA 1O7ZA 4QF4A 1UEAB 2NN6G 1SN8A 2UUCL 5CBEE 1SYDA 2I5LX 5IGFA 5I2XA 2K14A 3JC66 1AZQA 4B3RQ 1U4PA 1G8ZD 4PV1C 1K83H 4QY7A 3PV0A 4DR5Q 1NE3A 3D6CA 4UPAA 4A3CH 1QVCA 2ID0A 1TXYA 2G9DA 5EKLA 2A73B 2YTYA 3I56A 3T1YL 5ELOA 1HPCA 5IYBG 2E5LL 1A8VA 2F0FA 4R8NA 3L2PA 5E1FA 2NN6H 1W3SA 1PZID 2MUYA 1I6VC 1UE7A 1UUPA 3FKIG 1EEID 1F2YA 1HZCA 1HA6A 1E24A 1QCBD 4BS9A 3PIPA 2PNRC 2K5HA 1S3OA 2K03A 4DNRB 1SAPA 5C5MA 2ZJPA 2D2CC 5IWAL 4DV3L 5IOCA 1PV4A 2NTTA 4FF2A 2K5DA 4O2DA 4DAYA 1GHJA 4HIKA 2XIWA 2PO4A 3DM1A 3FEWX 1HR0Q 3SE0A 4C1NK 2B2VA 1V9PA 2MO0A 5IYBH 3PUXA 3J7A5 4OIKA 5EPLA 3ONAB 3FKIH 2L55A 5KNBA 3T1HL 4MZ9A 4NXNL 4OEMB 4IUVA 2PW5A 1ENCA 3PMFA 1SYEA 3HFZB 1B8AA 2NZHA 1NUCA 3VR4A 3HKZG 3CQZB 1LTBD 4JI7L 1OXUA 3GTQH 4L63B 4A3GG 4J8QA 1B4OA 3TZDA 2D62A 3ZJYC 2GN5A 1W6KA 4GN4B 3RLOA 1K8OA 3S1MB 5CORA 4JOIC 1Z7TA 4IOCA 4DV1L 2X6LA 4JI6Q 3NBHB 1XTDA 1VQNA 2HQEA 4DR1Q 4FYDA 1MGSA 2NZ1D 2YU9B 2RDHA 2RCFA 1BF4A 1WVLA 1B70B 3DWAA 2QILA 2E2HB 4TVAB 2AWNA 1CM9A 3I4NB 1J6QA 1CQVA 1RDPD 2AKWB 5LL6S 5HURA 1HNXQ 1EUJA 2PQAA 4A3GH 3NBIA 3I2ZA 4X64L 3HGBA 5IGEA 4Y7NB 2NVYB 3HOXG 4UP9A 3HOXB 2HIXA 4GNXB 3HOYB 1LV9A 4IFDG 1B50A 1Y8PB 1TS3A 2F52A 5IE8A 5EPKA 2ICEC 3QWNA 2E75C 2DGYA 3C3LA 1YZ6A 4DGZA 1T9HA 4LF8Q 2A74C 2HCIA 1AFPA 3M7NA 5E4XA 4F88A 3CCEA 2JN4A 3SHLA 4CKCA 4OHJA 1PFSA 5IYCG 4BBSG 4BBSB 2PZUA 4DUZL 3S15B 2C5CA 2NVYH 5DNFA 2L9HA 1Q86C 3UI2A 3HOXH 1I4QA 2QF7A 1Z6HA 3QB3A 3R8BA 1K9MC 3GTJB 4XT1B 2KCMA 1AEXA 5K5PA 3J7ZC 4A93G 2X69A 4LFCQ 4DV6L 4OO1G 1ZYRC 4BWGB 5CR3A 4IJLA 2DJFC 4DAVA 3RLNA 3CCSA 3VYUA 5DM63 1HNZL 1EEFD 3BVZA 1EQTA 2CQAA 1EOVA 3D31A 4L5QA 4YCVA 1ICFB 1PRTF 1PTOF 1JOOA 3PO3B 3E9HA 5IYCH 4BBSH 2JJQA 3S15H 2RBMA 2XWJB 1YITA 4JI7Q 2ZXOA 2CKZB 5I6YA 1UE1A 2WAQE 4P71A 1K3RA 3GTGB 4A93H 4M8AA 1KDBA 1N36L 1A3UA 4FF3A 1GM5A 4OO1H 3KLSX 1IBKL 3IAYA 3A56A 1SYFA 3H3VI 4NW2A 3PCOB 4DV1Q 2EZVA 3MEHA 4JI4L 4N8FA 2RHSB 3IKJA 4LW1A 4A4IA 3R2IA 1F9RA 4JBJA 1YHQA 4A3DG 1L1OB 1SJHD 1CZWA 1BCPF 1I4XA 4RGMA 3HOVG 3HOVB 3S2DB 4BA1I 1KXLA 1X3FA 1HQMC 2UUAL 4IURA 1PRTC 3GTGH 3NENA 1XPUA 1GUNA 1PTOC 3KF6A 4CJ0B 1BBUA 2OQ0A 3J81L 4C56C 3K8AA 3CCLA 1KQSA 1SFOB 1G2SA 1BXTA 4NDXA 3FP9A 1WTWA 3M7GA 1HH2P 1E2WA 5C0XG 4L8JA 3CMAA 2WAQB 3TP5A 4KJNA 4HIDA 3HG9A 4GOPB 5C4JH 3M4OB 1AE3A 2WIIB 2R7ZG 3S2HB 1I4PA 3SXHA 4LUVA 5IT9E 4IALA 4ZKBB 1U9RA 4PMWA 3S17H 4OX9L 4CDEC 2JA6G 2JA6B 1HUNA 4A3DH 3HOVH 3UDXA 1QZGA 3KUPA 5IY0A 5LMNQ 2Y0SB 4NXML 2IW3A 3SK6A 4RCNA 1WYDA 1VQKA 2UXBQ 1IBLQ 1IL2A 2KA7A 1JOKA 4AQYL 1SNCA 1S40A 1LTLA 5C0XH 2B63G 2PQEA 2Z1CA 5I6WA 3CC4A 4LF6L 4J6HA 3V96A 1KABA 1PMRA 2PW7A 1YNXA 2VQEL 2H1EA 3S14B 4JPBW 4A3KG 2R7ZH 2E2JH 3CXCA 3OIQA 3R3OA 4FDBA 3R93A 2BH2A 3C46A 2Z6BA 3MZ5A 2JA5G 2IT1A 4J1MA 3PSIA 4UAIA 2B2UC 4YY3Q 1XMOQ 2JA6H 1TS2A 4A3MG 2LY7A 3ITPA 3V2TA 3DEPA 4C1NI 1A15A 1LYLA 1SMYC 5C44G 4DV0Q 1G91A 1VQMA 4GLXA 4DFAA 2BA1A 4WJ4A 4PZ8A 3CC7A 2NVTH 1EY4A 1YHBA 1A0IA 3CRLC 1RCVD 3J80L 4FXDA 1EYCA 2KECA 2B63H 1KNEA 4IPDA 3ND9A 3KLSA 4JOIA 1CKNB 2RA4A 1ILQA 4YHHQ 2NVXH 1KHIA 1CZGA 5TSSA 4POGA 4A3KH 2A1AA 2R7DA 4UY8C 2JA5H 3K5OA 2ZXPA 3S1QH 4JI4Q 1IW7D 3BVMA 4G7ZC 5M5YB 4A3MH 1PFNA 5C4XB 1W6JA 1MD2D 5C44H 2ZM6L 2L1BA 3TBIB 2JA7B 1LTGD 4BBRG 1XWEA 1HZ9A 5IGBA 1H9KA 4DUYL 2ZT9C 1A2UA 5FKAC 1STAA 2VNUD 5D14A 1STNA 3QOJA 2EY5A 3L9AX 5A2QL 4ZUJA 1PYSB 5C6AA 4BY7G 1SYCA 1WTQA 3GQBA 1TWAH 4HSPA 2KUMA 4C3JG 1HXYD 3NSWA 4DR4L 4O0AA 4PMBA 4GN3B 2OTJA 5I2YA 1F2ZA 3IRBA 2VL6A 1LT6D 3SK8A 1A62A 1KDCA 1AP0A 2N88A 3NQTA 2ZTEA 4KY6A 4LF4L 2PYKA 2IPKD 2WB1G 5FO8B 5GAEC 3DUZA 4BBRH 3TP8A 3GO5A 4OX9Q 4RCOA 5D3IB 4ZCKA 4LUZA 5KIXA 5J22A 4X62Q 3V05A 4JW0A 3CPFA 3E0EA 5M3FG 5M3FB 1UNSA 1A3TA 4BY7H 2XRSD 4KLKA 2E2IH 4QUCA 3URYA 3KFUA 3FRPB 1VMCA 4C3JH 3MXNB 4K5WA 4A3FG 1HHVA 3H09A 3RN5A 3D8GA 4A75A 4B9WA 4B08A 3NUCA 4DK6C 3J81E 5C4HA 3TS0A 1L0WA 1VQ7A 2DNEA 5AFWA 1Y14B 2LXKA 3J81i 1SDFA 1X3PA 2M9VA 5DAUA 4NKLA 3L0OA 1VMPA 1VQAA 1EOTA 1J5EL 1Q3LA 3MXPA 1IYUA 5GAHC 1VQEA 2BA0A 3A5UA 1LT5D 1K8AC 3BZDB 1S5CD 1X55A 4G7OC 2R92B 5M3FH 3CPWA 4X3SA 3A54A 1KDAA 1X3GA 5M3MG 5M3MB 1U4LA 1O80A 1V1PB 3TREA 4A3FH 1PYWD 2MHVA 3MFYA 2E76C 4B3RL 4IOAA 4EGVA 4DR5L 4LF7Q 1YBYA 1EIHA 5IT9c 4MTKA 1IL8A 3VYRA 4J15A 2ICIA 2MNAA 2IX3A 2K5QA 1Q81C 2JXMB 1NMFA 2GVAA 2FXQA 3NELA 1O7LA 4JI5Q 4HN7A 2A6HC 4KMUC 3U4VA 2NVQB 2F0SA 1TWGH 3E3XA 1FVIA 1SE2A 2F0PA 4JI8Q 1OO9B 1E1TA 4L5RC 3RZDB 3PUZA 5M3MH 2C35B 1TWHB 3CCMA 2CFMA 2EY1A 4B3SQ 3S1NH 5M5WB 4AYBB 1JICA 1IKLA 4L6TB 5I4DA 1PH8A 1PFMA 2ZTDA 1YEZA 2FHTA 3PIO3 3J80E 1RF2D 1HR0L 1B44D 1I4GA 4LUOA 3EJIA 2NVQH 2RSOA 3G7LA 4FXKC 2WINB 4KN7C 1I3QH 4CDDC 4WORA 3CRKC 4H0LC 4DR7Q 4QJFA 1JQYD 2JA8B 3FMCA 3NTKA 3HRZC 2BCOA 1T5XD 3RZDH 4DV2Q 1GHKA 1I50B 1RIPA 4RGNA 4E6IA 2NBFA 4JI1Q 4EQ5A 3ULLA 3I73A 4OWTB 3U50C 1X54A 1DOLA 2B3GA 3E0JA 2SEBD 4KKUA 2PPBC 2KEDA 3S9WA 2KENA 2YTVA 3QOLA 2F0GA 2A68D 3GTLH 4GN5A 2EYHA 5CV4A 2CH4A 1EYGA 4X3TA 4RAUC 3HKSA 3FHWA 2XWBB 1SYGA 1XJVA 1MKHA 1KLUD 1G2TA 3NHHA 4JI6L 2B2UA 4EVOA 1PH5A 4DR1L 1N9WA 2HD3A 2EVBA 4I65A 4OGQC 4MNOA 5IGDA 1L1OA 1VQ6A 2EYLA 1U4MA 1QB5D
chains in the Genus database with same CATH topology
1L2FA 2JEBI 2B29A 2JEAI 2R93H 3HOXG 4UP9A 3CD6A 4QQBX 1VQ4A 4DR3Q 3OTOL 2HIXA 4GNXB 1XNQQ 4IFDG 1W2BA 4Y52H 2R7FA 4AYBE 1WOCA 1HNXL 3KJPA 1QUQA 4GLVB 1NMGA 2DUDA 3I4OA 4JI0L 3W5OA 3S2DH 2K50A 1E7ZA 4DAMA 2F52A 5IE8A 4EX5A 1PH3A 4BY1H 2DGYA 2Y0SG 1WJJA 3KLWA 3KOJA 1C0AA 1G51A 4DUZQ 1VCIA 1VQFA 4DR3L 1YZ6A 1YVCA 2PNHA 4LWCA 5K36G 1SFOH 4OXPA 1NBWA 1T9HA 3RN2A 3A74A 1Z9FA 2PI2A 4HJAA 4GNXA 4LF8Q 1P16A 4KHPL 3M7NA 2K75A 1Z47A 3F1ZA 2ATWA 1V43A 4UP7A 5JJLA 3EBEA 2LSSA 3CCEA 4DV6Q 1PVOA 2N3SA 2N78A 3M4OH 3HKZE 1PFSA 5IP7H 5IYCG 4BBSG 2JQOA 1Q1EA 4DUZL 2NVYH 5JJKA 3D0FA 5JJIA 1Q86C 1VQDA 3RLFA 3HOXH 3S2HH 4POFA 1K9MC 3ER0A 1HNZQ 2VUMG 2RHQB 2KCMA 3CCRA 1Q8KA 3M4PA 5J3BA 4LF8L 3PF4A 3J7ZC 4A93G 5GROA 4KHZA 4K0KQ 4LFCQ 4DV6L 2KHIA 5EAYA 1K73C 4OO1G 2IHFA 2MQHA 2WB1E 3BJUA 3TEHB 2MO1A 4IJLA 4DKAC 2E8GA 1WI5A 3RLNA 1Y1VG 3G71A 3CCSA 1HNZL 4C2MH 4B3TQ 4B3MQ 1KRSA 3NEMA 1XMQQ 4WJ3M 1EOVA 4A3IG 3D31A 4YWMA 5LMUQ 4L5TA 1M90C 4LFCL 1UEBA 4L5QA 4P73A 4YCVA 4K0KL 3HOWG 5LMNW 1YJ9A 4OWXB 1N36Q 2YV5A 4GKKQ 4GKJQ 2CCZA 1KAWA 2JA9A 1IBKQ 2XTIA 3GTOH 1FJGQ 3E9HA 5IYCH 1QVGA 4BBSH 5IYDG 1XPRA 1B7YB 3K81C 2JJQA 3S15H 3S14H 4A3BG 4B3ML 4B3TL 1CKMA 1VQGA 1YITA 2Q2TA 1MJCA 4JI7Q 1XMQL 2CKZB 2VUMH 1UE1A 1JE5A 2WAQE 4P71A 3J80i 1IXRA 4LFAQ 4ALPA 1K3RA 4A93H 3EIVA 3W1GA 1N36L 1M1KC 2D0PA 2QA4A 4GKKL 2Q2IA 1GM5A 2ZTCA 4GKJL 5C4XG 4JYAQ 1IBKL 1FJGL 4C3HH 3PF5A 2PI2E 5M5XH 3H3VI 2IY5B 2JA7G 4IPGA 3PCOB 3KDFB 4DV1Q 1Y1VH 2JE6I 2I5HA 4LFAL 1HJPA 1OXXK 4JI4L 1VQPA 4A3IH 1BBWA 2UUAQ 1WFQA 2RHSB 4LW1A 3HOZG 4A4IA 3HOWH 4A3LG 1N32Q 2OWOA 4JBJA 3L7ZC 1CSPA 3PGZA 1Q46A 5IYDH 2PQAB 4A3BH 3SGIA 1YHQA 3KF8B 2Z0SA 1L1OB 4A3DG 3HOVG 1OXTA 3KDFA 4BA1I 1KXLA 1X3FA 2UUAL 2LXJA 3GTGH 2WP8J 2NN6I 3NENA 3W1BA 3DLLA 1XPUA 3KF6A 3I4MG 5M5YH 1I94Q 1JMCA 1LUZA 4BXXG 1BBUA 2OQ0A 4TQUS 1QZHA 1N32L 4H02A 5C4XH 3K8AA 3CCLA 1KQSA 2OCEA 1JT8A 3OTOQ 2JA7H 2VS1A 1OXVA 1SMXA 3FP9A 1YJNA 1HH2P 5C0XG 1AE2A 1DGSA 3CMAA 1FL0A 3K7UC 3GTMH 5BR8L 4JI0Q 2AHOB 4HIDA 2V1CC 1ASZA 2VY3A 5E7NA 5C4JH 4GOPB 1X3EA 1R9TH 1I94L 1AE3A 1VS0A 1MJEA 2HQLA 3HOZH 3BZKA 1X6OA 2R7ZG 5ELNA 1S72A 2OTLA 1EFWA 4NXMQ 4LFBQ 3JAMc 4LUVA 4A3LH 4DV5Q 3U4ZA 4A3CG 4PMWA 4AQYQ 3S17H 4OX9L 1IZ6A 1U0LA 2JA6G 1EQRA 1HZBA 1ASYA 4HIMA 4A3DH 3K80C 3CW2C 3HOVH 2AWOA 3UDXA 4KHPQ 3F8TA 1QZGA 2GVBA 5IY0A 3E9IA 4YWKA 4LF6Q 3ICEA 5LMNQ 3Q8DA 3UE0A 3I4MH 4NB3A 4NXML 4LFBL 3TRZA 4GOPA 3UDFA 3OW2A 1WYDA 1VQKA 2VQEQ 1IBLQ 4DV5L 1IL2A 2UXBQ 4AQYL 2ZJQA 2VZAA 3CMEA 1S40A 4R4QA 1Q7YC 4HJ5A 4OONA 1LTLA 2B63G 2YTXA 2EQSA 3M4QA 3CC4A 3CCQA 2EXDA 4LF6L 4IJHA 1I6HH 1IBMQ 5LMNL 4HJ8A 1VQBA 1YHAA 1YNXA 2UXBL 3F2BA 4IPCA 2VQEL 1IBLL 2R92G 4UP8A 4A3KG 2R7ZH 2E2JH 4PZ7A 3ULPA 3CXCA 4FDBA 2BH2A 1BKBA 1WCMG 3G6EA 1YI2A 3EN2A 4LNQA 2JA5G 4C3IH 2UU9Q 2IT1A 3PSIA 5JEAG 4HJ9A 4YY3Q 1N8RC 1XMOQ 2HT1A 2JA6H 3PO2G 4BA2I 2R6GA 2IX1A 4A3MG 1IBML 4X66Q 1VQLA 3J81c 1VQJA 4DK3C 5HGQA 1LYLA 5C44G 4DV0Q 1X56A 1VQMA 4GLXA 2D0OA 2BA1A 1EIYB 4WJ4A 4KI0A 4PZ8A 4YCWA 3CC7A 3AQQA 2IX0A 2MFIA 3G48A 2UU9L 2NVTH 5FLXc 1YHBA 3M3YH 4HIOA 2RCNA 4YY3L 1A0IA 1XMOL 2Q2UA 2HIVA 3AFPA 4XIGS 1PH9A 4RG1A 4GLAC 4X66L 2B63H 5FLMG 4IPDA 4R4OA 4JOIA 1CKNB 3PUVA 4DV0L 4A76A 5GAGC 2K52A 4YHHQ 1VQ9A 2NVXH 1KHIA 3S1RH 1H95A 1A63A 4POGA 2ZM6Q 2XGTA 1KRTA 2R92H 4A3KH 3M85A 2A1AA 2R7DA 2NZOA 4R4CA 4X65Q 4UY8C 1UE6A 2Z6KA 1WCMH 4DUYQ 4LF5Q 1YIJA 2JA5H 3GTKH 4XTCS 1N34Q 4JI4Q 3S1QH 4JV5Q 3B6YA 2UXCQ 4QIWE 4IO9A 3PO2H 4YHHL 4A3MH 1PHJA 4AYBG 1FGUA 5GQOA 1PH4A 2CQOA 4GNXC 3LGJA 5C44H 2ZM6L 1CKNA 4P72A 1SRUA 2F4VQ 4BBRG 2H5XA 1EWIA 4X65L 1E3PA 1HZ9A 3CCJA 5AJ3Q 4DR4Q 2KBNA 4NPSA 4DUYL 4LF5L 4DPGA 3KF6B 1N34L 1EIFA 3CF5A 4JV5L 3RR5A 2UXCL 2VNUD 4DR2Q 2I0QA 3K0XA 5FLMH 2Y0SE 1LM0A 4BY7G 1PYSB 3GTPH 1VQHA 2CWAA 3ULJA 1QVFA 4LF4Q 5C3EG 2F4VL 4DR6Q 1RL2A 4OWWB 1TWAH 2JA8G 3KJOA 1GD7A 5GADC 1I5FA 5AJ3L 4DR4L 4O0AA 1BVSA 4APVA 1SE8A 2KHJA 4DR2L 1TWHH 4GN3B 5BR8Q 3I55A 2A8VA 1CUKA 3J81j 2OTJA 3IRBA 5IP9G 2VL6A 4A3EG 4LF9Q 2QEXA 1UWVA 3RZOH 1A62A 1V1QA 5M5WH 1HNWQ 2ZTEA 1EQQA 4LF4L 4DR6L 1K0RA 2R93G 2WB1G 3J80c 1PH7A 5GAEC 4IFDI 3S24A 4BBRH 3GO5A 1X65A 4OX9Q 2UUBQ 1VQOA 3AYHB 1HR0W 1D7QA 1X9NA 4LF9L 4LUZA 4X62Q 1PH6A 1HNWL 2UXDQ 3KYHC 3CPFA 3E0EA 3CP0A 3RNUA 5M3FG 1JJ2A 4BY7H 1PA6A 1C9OA 2UUCQ 1CSQA 1PH1A 1Q1BA 3BZCA 4KLKA 4AH6A 2E2IH 2BH8A 5C3EH 3KFUA 3GD7A 2I5MX 2JA8H 4IFDJ 1GVPA 3CQZH 1AH9A 4C3JH 3DM3A 3MXNB 2UUBL 4A3FG 1GO3E 1I50H 1J5EQ 3I4NG 1VQ8A 3U58A 5H1SE 1NTGA 4JBWA 4X62L 3RN5A 2UXDL 1VQIA 1D8LA 4A75A 2N8NA 3CCVA 4A3JG 5IP9H 4R1JA 4A3EH 4DK6C 2NN6G 3TS0A 3CC2A 1SN8A 1L0WA 2UUCL 2K5VA 2KCTA 1VQ7A 2I5LX 3BU2A 1Y14B 2LXKA 2QGQA 3CAMA 3STBD 5FJ8G 3S1MH 3J81i 3UDIA 3L0OA 1VQAA 1J5EL 3HOYG 3H3VH 2K14A 1KIXA 3HOUG 5GAHC 3JC66 1N33L 1VQEA 2BA0A 3A5UA 4OO1I 1K8AC 3T1YQ 4B3RQ 4QGUA 1KL9A 1K83H 1X55A 3PV0A 4QY7A 4DR5Q 1NE3A 2E5LQ 4IPHA 3CPWA 5M3FH 2YU9H 1UE5A 4UPAA 2OQKA 3TQYA 1X3GA 1XPOA 5M3MG 1P8LA 4A3CH 1QVCA 1IYJB 2ID0A 1TXYA 1XNQL 5JEAJ 3TREA 1U5KA 2Q2HA 4P74A 2E2HH 3AEVA 1PYBA 4A3FH 5DLQE 2YTYA 3I56A 2ZJRA 4PG3A 5ELOA 3T1YL 3I4NH 4IOAA 4B3RL 4DR5L 4LF7Q 1YBYA 5IYBG 2E5LL 1A8VA 4A3JH 4DAYB 4DV7Q 2EIFA 2PMZE 3L2PA 1L1OC 3OYYA 5IT9c 1W3SA 5IWAQ 4DV3Q 3F2DA 1UE7A 4Y7NH 3FKIG 5FJ8H 4J15A 1SLJA 2MNAA 1K8GA 1HZCA 1E24A 5HY6A 1Q81C 1OTCA 2VW9A 1NMFA 1MIUA 2FXQA 2GVAA 1TWCH 3NELA 4QL5A 3PUYA 4DNIA 3PIPA 1C7YA 1KC8C 2K5HA 2HHHQ 3U4VA 1S3OA 4JI5Q 3HOUH 4LF7L 4R4IA 3AFQA 1TWGH 4DV7L 1FVIA 2ZJPA 4JI8Q 5IWAL 4DV3L 1PV4A 2JK8A 1E1TA 1NY4A 4L5RC 3PUZA 1CKOA 4O2DA 1PH2A 5M3MH 4DV4Q 3H15A 2C35B 4HIKA 1GKHA 2L15A 4JI2Q 4GOPC 1NJIC 1G291 3CCMA 4PZ6A 4JI5L 3VDYA 2CFMA 2HHHL 4B3SQ 2K5NA 3S1NH 1HR0Q 4AIMA 4L5SA 4JG2A 3T1HQ 1V9PA 3HOYH 4NXNQ 2MO0A 2RF4A 1G6PA 4JI8L 5IYBH 3PUXA 3UDGA 3PO3G 3J7A5 1PH8A 3G4SA 4BXXH 4DV4L 2ZTDA 2N49A 4JI2L 3M9BA 1YEZA 2K4KA 3FKIH 3GTJH 4B3SL 1HR0L 2IHEA 1SR3A 2A19A 5LMUL 4LUOA 3ERSX 1HZAA 3T1HL 4YCUA 1Y1WG 1KD1C 4MZ9A 4NXNL 2NVQH 3H0GG 3HFZB 1I3QH 3I7FA 1B8AA 2NZHA 4DR7Q 4QJFA 3HKZG 3STBC 4JCVE 5C0XI 3RZDH 4DV2Q 1RIPA 4JC0A 4JI7L 1E1OA 1OXUA 3GTQH 3JAMi 3GDEA 4JI1Q 4EQ5A 1Q12A 4A3GG 3ULLA 4OWTB 2D62A 3U50C 3ZJYC 1X54A 2GN5A 2B3GA 3K7AH 4GN4B 1E22A 3RLOA 4GS3A 1VQ5A 4JYAL 4DR7L 3PUWA 2WFWA 4YWLA 4JOIC 1YJWA 2ES2A 4JBMA 3PO3H 2KENA 3A5ZB 4DV2L 4IOCA 1JJGA 5C0XJ 2YTVA 4DV1L 4JI6Q 3NBHB 1XTDA 4ME3A 2VQFQ 1VQNA 3GTLH 2YYZA 1OXSC 1XNRQ 4DR1Q 4GN5A 4JI1L 4X6AH 2F3IA 1O7IA 1VQCA 1EYGA 2Z6KC 3A0JA 4BY1G 1Y1WH 2CWPA 4X64Q 4HJ7A 4R4TA 4P75A 4JBKA 3HKSA 3H0GH 3WWVA 4JI3Q 3FHWA 3CCUA 2ALYB 1XJVA 1MKHA 1JJCB 3S16H 1B70B 4MTNA 3F2CA 1JB7A 4JI6L 1QUQB 1Q82C 2VQFL 4TVAB 3PIOA 1PH5A 2AWNA 4DR1L 1XNRL 1N9WA 1J6QA 1N33Q 2AKWB 4RMFA 3TS2A 4MNOA 2WAQG 1HNXQ 1EUJA 2PQAA 4A3GH 3I2ZA 4X64L 1SROA 3MEFA 1TWFH 1L1OA 1VQ6A 5IP7G 4JI3L 2ASBA 3UE1A 2AMCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  2JEB I;  2B29 A;  2JEA I;  2R93 H;  3HOX G;  4UP9 A;  3CD6 A;  4QQB X;  1VQ4 A;  4DR3 Q;  3OTO L;  2HIX A;  4GNX B;  1XNQ Q;  4IFD G;  1W2B A;  4Y52 H;  2R7F A;  4AYB E;  1WOC A;  1HNX L;  3KJP A;  1QUQ A;  4GLV B;  1NMG A;  2DUD A;  3I4O A;  4JI0 L;  3W5O A;  3S2D H;  2K50 A;  1E7Z A;  4DAM A;  2F52 A;  5IE8 A;  4EX5 A;  1PH3 A;  4BY1 H;  2DGY A;  2Y0S G;  1WJJ A;  3KLW A;  3KOJ A;  1C0A A;  1G51 A;  4DUZ Q;  1VCI A;  1VQF A;  4DR3 L;  1YZ6 A;  1YVC A;  2PNH A;  4LWC A;  5K36 G;  1SFO H;  4OXP A;  1NBW A;  1T9H A;  3RN2 A;  3A74 A;  1Z9F A;  2PI2 A;  4HJA A;  4GNX A;  4LF8 Q;  1P16 A;  4KHP L;  3M7N A;  2K75 A;  1Z47 A;  3F1Z A;  2ATW A;  1V43 A;  4UP7 A;  5JJL A;  3EBE A;  2LSS A;  3CCE A;  4DV6 Q;  1PVO A;  2N3S A;  2N78 A;  3M4O H;  3HKZ E;  1PFS A;  5IP7 H;  5IYC G;  4BBS G;  2JQO A;  1Q1E A;  4DUZ L;  2NVY H;  5JJK A;  3D0F A;  5JJI A;  1Q86 C;  1VQD A;  3RLF A;  3HOX H;  3S2H H;  4POF A;  1K9M C;  3ER0 A;  1HNZ Q;  2VUM G;  2RHQ B;  2KCM A;  3CCR A;  1Q8K A;  3M4P A;  5J3B A;  4LF8 L;  3PF4 A;  3J7Z C;  4A93 G;  5GRO A;  4KHZ A;  4K0K Q;  4LFC Q;  4DV6 L;  2KHI A;  5EAY A;  1K73 C;  4OO1 G;  2IHF A;  2MQH A;  2WB1 E;  3BJU A;  3TEH B;  2MO1 A;  4IJL A;  4DKA C;  2E8G A;  1WI5 A;  3RLN A;  1Y1V G;  3G71 A;  3CCS A;  1HNZ L;  4C2M H;  4B3T Q;  4B3M Q;  1KRS A;  3NEM A;  1XMQ Q;  4WJ3 M;  1EOV A;  4A3I G;  3D31 A;  4YWM A;  5LMU Q;  4L5T A;  1M90 C;  4LFC L;  1UEB A;  4L5Q A;  4P73 A;  4YCV A;  4K0K L;  3HOW G;  5LMN W;  1YJ9 A;  4OWX B;  1N36 Q;  2YV5 A;  4GKK Q;  4GKJ Q;  2CCZ A;  1KAW A;  2JA9 A;  1IBK Q;  2XTI A;  3GTO H;  1FJG Q;  3E9H A;  5IYC H;  1QVG A;  4BBS H;  5IYD G;  1XPR A;  1B7Y B;  3K81 C;  2JJQ A;  3S15 H;  3S14 H;  4A3B G;  4B3M L;  4B3T L;  1CKM A;  1VQG A;  1YIT A;  2Q2T A;  1MJC A;  4JI7 Q;  1XMQ L;  2CKZ B;  2VUM H;  1UE1 A;  1JE5 A;  2WAQ E;  4P71 A;  3J80 i;  1IXR A;  4LFA Q;  4ALP A;  1K3R A;  4A93 H;  3EIV A;  3W1G A;  1N36 L;  1M1K C;  2D0P A;  2QA4 A;  4GKK L;  2Q2I A;  1GM5 A;  2ZTC A;  4GKJ L;  5C4X G;  4JYA Q;  1IBK L;  1FJG L;  4C3H H;  3PF5 A;  2PI2 E;  5M5X H;  3H3V I;  2IY5 B;  2JA7 G;  4IPG A;  3PCO B;  3KDF B;  4DV1 Q;  1Y1V H;  2JE6 I;  2I5H A;  4LFA L;  1HJP A;  1OXX K;  4JI4 L;  1VQP A;  4A3I H;  1BBW A;  2UUA Q;  1WFQ A;  2RHS B;  4LW1 A;  3HOZ G;  4A4I A;  3HOW H;  4A3L G;  1N32 Q;  2OWO A;  4JBJ A;  3L7Z C;  1CSP A;  3PGZ A;  1Q46 A;  5IYD H;  2PQA B;  4A3B H;  3SGI A;  1YHQ A;  3KF8 B;  2Z0S A;  1L1O B;  4A3D G;  3HOV G;  1OXT A;  3KDF A;  4BA1 I;  1KXL A;  1X3F A;  2UUA L;  2LXJ A;  3GTG H;  2WP8 J;  2NN6 I;  3NEN A;  3W1B A;  3DLL A;  1XPU A;  3KF6 A;  3I4M G;  5M5Y H;  1I94 Q;  1JMC A;  1LUZ A;  4BXX G;  1BBU A;  2OQ0 A;  4TQU S;  1QZH A;  1N32 L;  4H02 A;  5C4X H;  3K8A A;  3CCL A;  1KQS A;  2OCE A;  1JT8 A;  3OTO Q;  2JA7 H;  2VS1 A;  1OXV A;  1SMX A;  3FP9 A;  1YJN A;  1HH2 P;  5C0X G;  1AE2 A;  1DGS A;  3CMA A;  1FL0 A;  3K7U C;  3GTM H;  5BR8 L;  4JI0 Q;  2AHO B;  4HID A;  2V1C C;  1ASZ A;  2VY3 A;  5E7N A;  5C4J H;  4GOP B;  1X3E A;  1R9T H;  1I94 L;  1AE3 A;  1VS0 A;  1MJE A;  2HQL A;  3HOZ H;  3BZK A;  1X6O A;  2R7Z G;  5ELN A;  1S72 A;  2OTL A;  1EFW A;  4NXM Q;  4LFB Q;  3JAM c;  4LUV A;  4A3L H;  4DV5 Q;  3U4Z A;  4A3C G;  4PMW A;  4AQY Q;  3S17 H;  4OX9 L;  1IZ6 A;  1U0L A;  2JA6 G;  1EQR A;  1HZB A;  1ASY A;  4HIM A;  4A3D H;  3K80 C;  3CW2 C;  3HOV H;  2AWO A;  3UDX A;  4KHP Q;  3F8T A;  1QZG A;  2GVB A;  5IY0 A;  3E9I A;  4YWK A;  4LF6 Q;  3ICE A;  5LMN Q;  3Q8D A;  3UE0 A;  3I4M H;  4NB3 A;  4NXM L;  4LFB L;  3TRZ A;  4GOP A;  3UDF A;  3OW2 A;  1WYD A;  1VQK A;  2VQE Q;  1IBL Q;  4DV5 L;  1IL2 A;  2UXB Q;  4AQY L;  2ZJQ A;  2VZA A;  3CME A;  1S40 A;  4R4Q A;  1Q7Y C;  4HJ5 A;  4OON A;  1LTL A;  2B63 G;  2YTX A;  2EQS A;  3M4Q A;  3CC4 A;  3CCQ A;  2EXD A;  4LF6 L;  4IJH A;  1I6H H;  1IBM Q;  5LMN L;  4HJ8 A;  1VQB A;  1YHA A;  1YNX A;  2UXB L;  3F2B A;  4IPC A;  2VQE L;  1IBL L;  2R92 G;  4UP8 A;  4A3K G;  2R7Z H;  2E2J H;  4PZ7 A;  3ULP A;  3CXC A;  4FDB A;  2BH2 A;  1BKB A;  1WCM G;  3G6E A;  1YI2 A;  3EN2 A;  4LNQ A;  2JA5 G;  4C3I H;  2UU9 Q;  2IT1 A;  3PSI A;  5JEA G;  4HJ9 A;  4YY3 Q;  1N8R C;  1XMO Q;  2HT1 A;  2JA6 H;  3PO2 G;  4BA2 I;  2R6G A;  2IX1 A;  4A3M G;  1IBM L;  4X66 Q;  1VQL A;  3J81 c;  1VQJ A;  4DK3 C;  5HGQ A;  1LYL A;  5C44 G;  4DV0 Q;  1X56 A;  1VQM A;  4GLX A;  2D0O A;  2BA1 A;  1EIY B;  4WJ4 A;  4KI0 A;  4PZ8 A;  4YCW A;  3CC7 A;  3AQQ A;  2IX0 A;  2MFI A;  3G48 A;  2UU9 L;  2NVT H;  5FLX c;  1YHB A;  3M3Y H;  4HIO A;  2RCN A;  4YY3 L;  1A0I A;  1XMO L;  2Q2U A;  2HIV A;  3AFP A;  4XIG S;  1PH9 A;  4RG1 A;  4GLA C;  4X66 L;  2B63 H;  5FLM G;  4IPD A;  4R4O A;  4JOI A;  1CKN B;  3PUV A;  4DV0 L;  4A76 A;  5GAG C;  2K52 A;  4YHH Q;  1VQ9 A;  2NVX H;  1KHI A;  3S1R H;  1H95 A;  1A63 A;  4POG A;  2ZM6 Q;  2XGT A;  1KRT A;  2R92 H;  4A3K H;  3M85 A;  2A1A A;  2R7D A;  2NZO A;  4R4C A;  4X65 Q;  4UY8 C;  1UE6 A;  2Z6K A;  1WCM H;  4DUY Q;  4LF5 Q;  1YIJ A;  2JA5 H;  3GTK H;  4XTC S;  1N34 Q;  4JI4 Q;  3S1Q H;  4JV5 Q;  3B6Y A;  2UXC Q;  4QIW E;  4IO9 A;  3PO2 H;  4YHH L;  4A3M H;  1PHJ A;  4AYB G;  1FGU A;  5GQO A;  1PH4 A;  2CQO A;  4GNX C;  3LGJ A;  5C44 H;  2ZM6 L;  1CKN A;  4P72 A;  1SRU A;  2F4V Q;  4BBR G;  2H5X A;  1EWI A;  4X65 L;  1E3P A;  1HZ9 A;  3CCJ A;  5AJ3 Q;  4DR4 Q;  2KBN A;  4NPS A;  4DUY L;  4LF5 L;  4DPG A;  3KF6 B;  1N34 L;  1EIF A;  3CF5 A;  4JV5 L;  3RR5 A;  2UXC L;  2VNU D;  4DR2 Q;  2I0Q A;  3K0X A;  5FLM H;  2Y0S E;  1LM0 A;  4BY7 G;  1PYS B;  3GTP H;  1VQH A;  2CWA A;  3ULJ A;  1QVF A;  4LF4 Q;  5C3E G;  2F4V L;  4DR6 Q;  1RL2 A;  4OWW B;  1TWA H;  2JA8 G;  3KJO A;  1GD7 A;  5GAD C;  1I5F A;  5AJ3 L;  4DR4 L;  4O0A A;  1BVS A;  4APV A;  1SE8 A;  2KHJ A;  4DR2 L;  1TWH H;  4GN3 B;  5BR8 Q;  3I55 A;  2A8V A;  1CUK A;  3J81 j;  2OTJ A;  3IRB A;  5IP9 G;  2VL6 A;  4A3E G;  4LF9 Q;  2QEX A;  1UWV A;  3RZO H;  1A62 A;  1V1Q A;  5M5W H;  1HNW Q;  2ZTE A;  1EQQ A;  4LF4 L;  4DR6 L;  1K0R A;  2R93 G;  2WB1 G;  3J80 c;  1PH7 A;  5GAE C;  4IFD I;  3S24 A;  4BBR H;  3GO5 A;  1X65 A;  4OX9 Q;  2UUB Q;  1VQO A;  3AYH B;  1HR0 W;  1D7Q A;  1X9N A;  4LF9 L;  4LUZ A;  4X62 Q;  1PH6 A;  1HNW L;  2UXD Q;  3KYH C;  3CPF A;  3E0E A;  3CP0 A;  3RNU A;  5M3F G;  1JJ2 A;  4BY7 H;  1PA6 A;  1C9O A;  2UUC Q;  1CSQ A;  1PH1 A;  1Q1B A;  3BZC A;  4KLK A;  4AH6 A;  2E2I H;  2BH8 A;  5C3E H;  3KFU A;  3GD7 A;  2I5M X;  2JA8 H;  4IFD J;  1GVP A;  3CQZ H;  1AH9 A;  4C3J H;  3DM3 A;  3MXN B;  2UUB L;  4A3F G;  1GO3 E;  1I50 H;  1J5E Q;  3I4N G;  1VQ8 A;  3U58 A;  5H1S E;  1NTG A;  4JBW A;  4X62 L;  3RN5 A;  2UXD L;  1VQI A;  1D8L A;  4A75 A;  2N8N A;  3CCV A;  4A3J G;  5IP9 H;  4R1J A;  4A3E H;  4DK6 C;  2NN6 G;  3TS0 A;  3CC2 A;  1SN8 A;  1L0W A;  2UUC L;  2K5V A;  2KCT A;  1VQ7 A;  2I5L X;  3BU2 A;  1Y14 B;  2LXK A;  2QGQ A;  3CAM A;  3STB D;  5FJ8 G;  3S1M H;  3J81 i;  3UDI A;  3L0O A;  1VQA A;  1J5E L;  3HOY G;  3H3V H;  2K14 A;  1KIX A;  3HOU G;  5GAH C;  3JC6 6;  1N33 L;  1VQE A;  2BA0 A;  3A5U A;  4OO1 I;  1K8A C;  3T1Y Q;  4B3R Q;  4QGU A;  1KL9 A;  1K83 H;  1X55 A;  3PV0 A;  4QY7 A;  4DR5 Q;  1NE3 A;  2E5L Q;  4IPH A;  3CPW A;  5M3F H;  2YU9 H;  1UE5 A;  4UPA A;  2OQK A;  3TQY A;  1X3G A;  1XPO A;  5M3M G;  1P8L A;  4A3C H;  1QVC A;  1IYJ B;  2ID0 A;  1TXY A;  1XNQ L;  5JEA J;  3TRE A;  1U5K A;  2Q2H A;  4P74 A;  2E2H H;  3AEV A;  1PYB A;  4A3F H;  5DLQ E;  2YTY A;  3I56 A;  2ZJR A;  4PG3 A;  5ELO A;  3T1Y L;  3I4N H;  4IOA A;  4B3R L;  4DR5 L;  4LF7 Q;  1YBY A;  5IYB G;  2E5L L;  1A8V A;  4A3J H;  4DAY B;  4DV7 Q;  2EIF A;  2PMZ E;  3L2P A;  1L1O C;  3OYY A;  5IT9 c;  1W3S A;  5IWA Q;  4DV3 Q;  3F2D A;  1UE7 A;  4Y7N H;  3FKI G;  5FJ8 H;  4J15 A;  1SLJ A;  2MNA A;  1K8G A;  1HZC A;  1E24 A;  5HY6 A;  1Q81 C;  1OTC A;  2VW9 A;  1NMF A;  1MIU A;  2FXQ A;  2GVA A;  1TWC H;  3NEL A;  4QL5 A;  3PUY A;  4DNI A;  3PIP A;  1C7Y A;  1KC8 C;  2K5H A;  2HHH Q;  3U4V A;  1S3O A;  4JI5 Q;  3HOU H;  4LF7 L;  4R4I A;  3AFQ A;  1TWG H;  4DV7 L;  1FVI A;  2ZJP A;  4JI8 Q;  5IWA L;  4DV3 L;  1PV4 A;  2JK8 A;  1E1T A;  1NY4 A;  4L5R C;  3PUZ A;  1CKO A;  4O2D A;  1PH2 A;  5M3M H;  4DV4 Q;  3H15 A;  2C35 B;  4HIK A;  1GKH A;  2L15 A;  4JI2 Q;  4GOP C;  1NJI C;  1G29 1;  3CCM A;  4PZ6 A;  4JI5 L;  3VDY A;  2CFM A;  2HHH L;  4B3S Q;  2K5N A;  3S1N H;  1HR0 Q;  4AIM A;  4L5S A;  4JG2 A;  3T1H Q;  1V9P A;  3HOY H;  4NXN Q;  2MO0 A;  2RF4 A;  1G6P A;  4JI8 L;  5IYB H;  3PUX A;  3UDG A;  3PO3 G;  3J7A 5;  1PH8 A;  3G4S A;  4BXX H;  4DV4 L;  2ZTD A;  2N49 A;  4JI2 L;  3M9B A;  1YEZ A;  2K4K A;  3FKI H;  3GTJ H;  4B3S L;  1HR0 L;  2IHE A;  1SR3 A;  2A19 A;  5LMU L;  4LUO A;  3ERS X;  1HZA A;  3T1H L;  4YCU A;  1Y1W G;  1KD1 C;  4MZ9 A;  4NXN L;  2NVQ H;  3H0G G;  3HFZ B;  1I3Q H;  3I7F A;  1B8A A;  2NZH A;  4DR7 Q;  4QJF A;  3HKZ G;  3STB C;  4JCV E;  5C0X I;  3RZD H;  4DV2 Q;  1RIP A;  4JC0 A;  4JI7 L;  1E1O A;  1OXU A;  3GTQ H;  3JAM i;  3GDE A;  4JI1 Q;  4EQ5 A;  1Q12 A;  4A3G G;  3ULL A;  4OWT B;  2D62 A;  3U50 C;  3ZJY C;  1X54 A;  2GN5 A;  2B3G A;  3K7A H;  4GN4 B;  1E22 A;  3RLO A;  4GS3 A;  1VQ5 A;  4JYA L;  4DR7 L;  3PUW A;  2WFW A;  4YWL A;  4JOI C;  1YJW A;  2ES2 A;  4JBM A;  3PO3 H;  2KEN A;  3A5Z B;  4DV2 L;  4IOC A;  1JJG A;  5C0X J;  2YTV A;  4DV1 L;  4JI6 Q;  3NBH B;  1XTD A;  4ME3 A;  2VQF Q;  1VQN A;  3GTL H;  2YYZ A;  1OXS C;  1XNR Q;  4DR1 Q;  4GN5 A;  4JI1 L;  4X6A H;  2F3I A;  1O7I A;  1VQC A;  1EYG A;  2Z6K C;  3A0J A;  4BY1 G;  1Y1W H;  2CWP A;  4X64 Q;  4HJ7 A;  4R4T A;  4P75 A;  4JBK A;  3HKS A;  3H0G H;  3WWV A;  4JI3 Q;  3FHW A;  3CCU A;  2ALY B;  1XJV A;  1MKH A;  1JJC B;  3S16 H;  1B70 B;  4MTN A;  3F2C A;  1JB7 A;  4JI6 L;  1QUQ B;  1Q82 C;  2VQF L;  4TVA B;  3PIO A;  1PH5 A;  2AWN A;  4DR1 L;  1XNR L;  1N9W A;  1J6Q A;  1N33 Q;  2AKW B;  4RMF A;  3TS2 A;  4MNO A;  2WAQ G;  1HNX Q;  1EUJ A;  2PQA A;  4A3G H;  3I2Z A;  4X64 L;  1SRO A;  3MEF A;  1TWF H;  1L1O A;  1VQ6 A;  5IP7 G;  4JI3 L;  2ASB A;  3UE1 A;  2AMC B; 
#chains in the Genus database with same CATH topology
 2JEB I;  2B29 A;  3KBG A;  3NPP A;  3CD6 A;  4QQB X;  1W2B A;  2R7F A;  4QMG A;  1HNX L;  1QUQ A;  1NMG A;  2L0C A;  4KHV A;  4JI0 L;  3W5O A;  1ET9 A;  4DAM A;  1FGB D;  4LJZ C;  3Q6S A;  1DM0 B;  1S5B D;  1PH3 A;  1FD7 D;  4EQP A;  1C0A A;  3CKI B;  1VCI A;  3PQI A;  5NUC A;  5T1G A;  3H94 A;  3SVM A;  4OXP A;  1NBW A;  1EY7 A;  1Z9F A;  1Q8I A;  4XQQ A;  3D3R A;  1GOZ A;  3E5S A;  4IUQ A;  3VR3 A;  3F1Z A;  3EBE A;  1PVO A;  2N3S A;  2N78 A;  3HKZ E;  1ET6 A;  1HUM A;  4K5V A;  3FKI B;  5JJK A;  3D0F A;  2VUM G;  5DM7 3;  2VUM B;  2RHQ B;  1DON A;  1Q8K A;  4LF8 L;  5J3B A;  3PF4 A;  1AN8 A;  3MAQ A;  4ZAI A;  2KHI A;  2IHF A;  2MQH A;  1HCZ A;  4C3H G;  2MO1 A;  2E8G A;  4DF7 A;  1BO0 A;  3DEO A;  1Y1V G;  3G71 A;  3X3M A;  4C2M H;  4B3M Q;  3GTQ B;  1FR3 A;  5EPJ A;  5C3X A;  1VF7 A;  4WJ3 M;  4IN3 A;  2A69 D;  1M90 C;  3D4W A;  4LFC L;  3HOW G;  3DHQ A;  4U67 3;  2YV5 A;  4GKK Q;  4DXF A;  4GKJ Q;  2JA9 A;  2XTI A;  3GTO H;  1GUG A;  5IYD G;  1XPR A;  3K81 C;  2F0O A;  4A3B G;  2GA4 B;  3OW7 A;  1WTV A;  4GZY C;  3MFG A;  2VUM H;  1JE5 A;  3JAM L;  2BOS A;  2X6G A;  3EIV A;  1B3Q A;  1M1K C;  2Q2I A;  3W2D A;  3HKZ B;  4HMJ A;  5ELB A;  4C3H H;  4H44 C;  2IY5 B;  2F0H A;  2KQ3 A;  1KAA A;  3KDF B;  1H9S B;  1Y1V H;  3TZU A;  2JE6 I;  3A7A B;  4A3G B;  1HJP A;  4DN4 M;  1BBW A;  2VB3 X;  3HOW H;  1LT3 D;  2EPB A;  1N32 Q;  2SNS A;  3PGZ A;  4KJO A;  4F87 A;  5IYD H;  4A3B H;  4DK1 A;  4HMI A;  2K28 A;  2Z0S A;  1OXT A;  5ISR A;  2WP8 J;  4ZUI A;  5IOD A;  3I4M G;  4ZKC B;  3I4M B;  1LUZ A;  2L11 A;  4H02 A;  2OCE A;  1M8A A;  2VS1 A;  3SEB A;  1DGS A;  3OIP A;  2SOB A;  4DAP A;  3GTM H;  4JI0 Q;  2FFK B;  3KF8 A;  5FLX L;  1X3E A;  4FNF A;  5FO9 B;  1VS0 A;  1SEB D;  2HQL A;  3RD4 A;  3BZK A;  1CT1 D;  2OTL A;  1SNP A;  4LFB Q;  2XSC A;  1EY0 A;  5CBA E;  4DV5 Q;  1EZ6 A;  4CBV A;  1HZB A;  3CW2 C;  3BVG A;  2GVB A;  5CV9 A;  3VA7 A;  3Q8D A;  1E2Z A;  3I4M H;  3H91 A;  2XVS A;  3VR5 A;  3FPU B;  4B9X A;  1R4P B;  1LTA D;  2ZXR A;  1Q7Y C;  3D4R A;  4RGO S;  1ENF A;  4OON A;  1D1I A;  2YTX A;  1C4Q A;  3QG1 A;  2KJX A;  3J7Y W;  3CCQ A;  4IJH A;  1I6H H;  3MXN A;  5LMN L;  1F2L A;  1IBM Q;  1YHA A;  3S1R B;  1SNM A;  1NSN S;  1E0B A;  1XXG A;  2UXB L;  1IBL L;  3BDO A;  4KKT A;  3ULP A;  1WCM G;  4DU9 A;  1WCM B;  3EN2 A;  1YI2 A;  1JOQ A;  4IFD H;  1ROD A;  5CC4 A;  1KLG D;  5L37 A;  5JEA G;  4HJ9 A;  1N8R C;  4A93 B;  4BA2 I;  1O7Y A;  4X66 Q;  2KEE A;  1VQJ A;  4TRD A;  2F0K A;  2K7V A;  1LLR D;  1JWS D;  3AQQ A;  2IX0 A;  2CH4 W;  4ID6 A;  3M3Y H;  2RCN A;  4YY3 L;  1XMO L;  4IUU A;  4RG1 A;  4GLA C;  4DV0 L;  1VQ9 A;  1JR0 D;  4IUT A;  2F0L A;  3S1R H;  1H95 A;  1KRT A;  4HED A;  4R4C A;  1UE6 A;  1WCM H;  4FO2 A;  4LF5 Q;  1YIJ A;  3GTK H;  4XTC S;  1IHZ A;  1Y8N B;  5JEA H;  3B6Y A;  2NWG A;  4JV5 Q;  1PLF A;  3NXW A;  2XNA C;  4YHH L;  4RWS C;  1FGU A;  1MBY A;  4GNX C;  3Q0A A;  1EWI A;  1JWU D;  2L4N A;  1PTO H;  4DPG A;  5ELC A;  1ESR A;  3CF5 A;  5C4J B;  4DR2 Q;  2F4I A;  2EY6 A;  3TDQ A;  2Y0S E;  1LM0 A;  1VQH A;  1DJR D;  3ULJ A;  2AUJ D;  4RHR A;  4O1N A;  4DR6 Q;  2D5D A;  4KY7 A;  3S17 B;  2PMZ B;  5GAD C;  2BDN A;  1BVS A;  4A3D B;  5JPN C;  2EJG C;  3TN2 A;  2KHJ A;  1J9O A;  1EY5 A;  2XRQ D;  5IP9 G;  2K32 A;  1DCZ A;  1HNW Q;  2Z4H A;  3OWF A;  3RMH A;  2R93 G;  1B53 A;  4X3U A;  2K05 A;  1VQO A;  3K57 A;  1X9N A;  1AW7 A;  2I07 B;  2UXD Q;  3ND8 A;  1LTT D;  3CP0 A;  1B9N A;  3P1H A;  2R7Z B;  2E2J B;  1PA6 A;  1C9O A;  2BH8 A;  1YNJ D;  1S5E D;  4TKO B;  1GVP A;  1WD0 A;  1GO3 E;  4XT3 B;  4X62 L;  1H9J A;  1D8L A;  1TY2 A;  2N8N A;  4A3J G;  2EE1 A;  4A3J B;  5IP9 H;  3KK7 A;  3NE5 B;  2K5V A;  2KCT A;  3BU2 A;  4K6D A;  2QGQ A;  3STB D;  5FJ8 G;  2NVT B;  5KND A;  1CHQ D;  5BN4 A;  3H3V H;  1TWC B;  1KIX A;  2B63 B;  5FLX E;  1N33 L;  1IW7 C;  2NVX B;  4CGY B;  3EFX D;  4HAE A;  1M4V A;  1H9M A;  2AQ3 B;  3NP8 A;  2SDF A;  4QGU A;  1KL9 A;  4IPH A;  4QB4 A;  4A3K B;  3K0Y A;  2OQK A;  3TQY A;  4K6L A;  3WOF A;  2P5Z X;  1RD9 D;  3GV3 A;  2JA5 B;  3E6Z X;  3S1Q B;  5JPM C;  4G57 A;  1U5K A;  2B39 A;  2Q2H A;  4PMC A;  2F3W A;  4P74 A;  1PYB A;  4OEL B;  4A3M B;  2ZJR A;  2BE5 D;  2F0W A;  5C44 B;  2V4D A;  3OHX C;  3LWE A;  4A3J H;  4DAY B;  4DV7 Q;  2EIF A;  1L1O C;  3OYY A;  1CTM A;  3F2D A;  5FJ8 H;  1SLJ A;  2J4X A;  1K3B C;  5I9O A;  1MIU A;  4DNI A;  1C7Y A;  1TWC H;  4QL5 A;  2HHH Q;  4LF7 L;  2F1M A;  3AFQ A;  4O42 A;  3VR2 A;  1G6Z A;  1MI2 A;  1TWA B;  3O13 A;  2L5T A;  1K0S A;  2JK8 A;  2TMP A;  1NY4 A;  1L0Y B;  3VA5 A;  4JVZ A;  5BN3 A;  2J7Z A;  1CKO A;  1PH2 A;  2RDF A;  3I72 A;  5BN5 A;  4DV4 Q;  4GOP C;  1NNX A;  2L15 A;  4JI2 Q;  5CYU A;  4F7X A;  1NR2 A;  4PZ6 A;  4JI5 L;  2K5N A;  4AIM A;  4L5S A;  2H4O A;  2EDG A;  4JI8 L;  2K33 A;  3UDG A;  4BBR B;  4WJW A;  5HGT A;  3G4S A;  3LX0 A;  2A5H A;  2N49 A;  2EY2 A;  4HCE A;  4B3S L;  1BCP D;  5CV6 A;  4EQO A;  2K1B A;  5LMU L;  1HZA A;  1KD1 C;  3DMU A;  3L3O C;  4HSV A;  4BY7 B;  3H0G G;  4G7H C;  3H0G B;  2E2I B;  2F0E A;  1C8C A;  1EU3 A;  4C3J B;  4JCV E;  3C2P A;  3MHB A;  1QNK A;  1E1O A;  3P75 A;  3SDZ A;  4RHS A;  3GDE A;  1AZP A;  4S3S A;  1TWF B;  1D2B A;  3K7A H;  2RKS A;  4GS3 A;  1VQ5 A;  2EYP A;  4DR7 L;  3PUW A;  2ES2 A;  2WB1 B;  4DV2 L;  1JJG A;  5EQ0 A;  1K8M A;  5E3F A;  4CDC C;  3HZX A;  4ME3 A;  2VQF Q;  5G3L F;  4X6A H;  2YYZ A;  1OXS C;  1JE4 A;  1XNR Q;  4JI1 L;  2F3I A;  1D1K A;  1H9S A;  3OPO A;  1GJX A;  1UAP A;  2CWP A;  4HJ7 A;  4R4T A;  4P75 A;  4XYO A;  2CHB D;  3H0G H;  4JI3 Q;  4M1U B;  2ALY B;  2N55 A;  2FIN B;  5KYL A;  3S16 H;  1LTS D;  4NMZ A;  1JB7 A;  3PIO A;  4A3F B;  1PFB A;  1N33 Q;  3IFT A;  3NBH A;  3TS2 A;  2O5I C;  1TWF H;  4CKB A;  5CGK A;  3K58 A;  5IP7 G;  4XQJ A;  4KN4 C;  3UE1 A;  5HY6 A;  1L2F A;  2JEA I;  4V0B A;  1VQ4 A;  4DR3 Q;  3OTO L;  4Y52 H;  1KNA A;  4XQN A;  3A8J E;  4AYB E;  4K8J A;  2DUD A;  1TWG B;  2MGS A;  1BQQ T;  1E7Z A;  2VXW A;  2EYM A;  2EXZ A;  3LWU A;  4EX5 A;  1QIL A;  3VYT A;  2CW0 C;  3KLW A;  1WJJ A;  3KOJ A;  5EKK A;  1G51 A;  1GXD C;  2F0U A;  5CMD A;  2A6E C;  5D65 A;  1YVC A;  3Q22 A;  3TP6 A;  5K36 G;  4IUP A;  4XYQ A;  5EKI A;  3S1N B;  4TSS A;  4GNX A;  2RDG A;  4KHP L;  2K01 A;  2ATW A;  1Z47 A;  1WTX A;  1V43 A;  4UP7 A;  1XTC D;  1JOR A;  1PZJ D;  1D5X C;  5IP7 H;  4Q5V A;  1QG7 A;  4H7B A;  1ZEQ X;  3MA2 B;  3ER0 A;  4FXG C;  3CCR A;  3MWY W;  5GRO A;  1XYI A;  4N8X 1;  4K0K Q;  5EAY A;  1I3Q B;  3I91 A;  5D3D A;  4R9W A;  2B2T C;  3OOC A;  3MC0 B;  1TU2 B;  3A7L A;  1WI5 A;  4DK0 A;  2L12 A;  3K5L A;  2KVM A;  4DA2 A;  4B3T Q;  1I4R A;  1KRS A;  1LAB A;  2QDL A;  5K36 H;  3NEM A;  1XMQ Q;  4A3I G;  5LMU Q;  4YWM A;  1JWM D;  2B2W C;  1CA6 A;  1UEB A;  2KHS A;  1YJ9 A;  4OWX B;  4UDU C;  1HFN A;  2ENB A;  3H6M A;  3VR6 A;  3SK4 A;  1KAW A;  1FJG Q;  1B9M A;  4B3M L;  3GTL B;  2DY7 A;  2Q2T A;  3WOE A;  3NWS A;  3R2T A;  3J80 i;  4LFA Q;  3W1G A;  2D0P A;  4GKK L;  1SND A;  4GKJ L;  1LTR D;  1SSO A;  2PI2 E;  5M5X H;  4IPG A;  2I5H A;  4QCL A;  3OMG A;  1VQP A;  4A3I H;  1R9T B;  1FNV A;  1WFQ A;  4HCS A;  4Q0F A;  1CI3 M;  3HP3 A;  4A3L G;  2O2L D;  3L7Z C;  1MHW C;  1CSP A;  2NB0 A;  1Q46 A;  2B2Y C;  3BYY B;  3SGI A;  5KNC A;  2MPM A;  2EOT A;  5A2Q E;  4I7A A;  2A6H D;  1ML0 D;  2NN6 I;  3W1B A;  1ENA A;  5KGU A;  3GV6 A;  1I94 Q;  1WTH A;  4BXX G;  4TQU S;  2F03 A;  1N32 L;  1SE4 A;  4U68 A;  1ILP A;  1JT8 A;  3OTO Q;  1OXV A;  1SMX A;  4ODG A;  1CA5 A;  3K7U C;  4ABN A;  3U9O A;  5BR8 L;  1STG A;  4JBK A;  1R9T H;  1CK1 A;  2EJF C;  1STE A;  1S72 A;  1EFW A;  1GUO A;  2RVL A;  3I70 A;  1JCK B;  4A3L H;  2NTS A;  2Q8I B;  3U4Z A;  4C3I G;  4A3C G;  1F2M A;  2K6A A;  1L0X B;  1EQR A;  1ASY A;  3K80 C;  1DOM A;  2A69 C;  4KHP Q;  3DXJ C;  3F8T A;  3I90 A;  5LL6 X;  4YWK A;  4X3K A;  3MVV A;  4LFB L;  1Y69 U;  4BXX H;  4GOP A;  3UDF A;  3OW2 A;  3N52 A;  4DV5 L;  4C2M B;  2ZJQ A;  2VZA A;  3QJY A;  4R4Q A;  2Z4I A;  1EY6 A;  1RJT A;  3RUZ A;  2EXD A;  1LO5 D;  4K8I A;  3GTO B;  1YNN D;  1S5D D;  3AB9 A;  4IPC A;  4UP8 A;  1TKW B;  2F0J A;  2EJM A;  1ICW A;  1BKB A;  4LNQ A;  2UU9 Q;  4C3I H;  3CHB D;  3F2U A;  1VF5 C;  3EQL C;  3T4A C;  1VDZ A;  2HT1 A;  4N9P A;  2IX1 A;  1IBM L;  1VQL A;  3J81 c;  2JYO A;  3T13 A;  1FNW A;  4RH6 A;  4C3H B;  1CQF A;  3QR8 A;  2D0O A;  2CVR A;  1Y1V B;  2F0N A;  2G9H D;  5E4W C;  4KI0 A;  2MFI A;  5T1I A;  5IGG A;  1RHP A;  4HIO A;  2HIV A;  3AFP A;  4XIG S;  4X66 L;  1RTO A;  1V8Q A;  5FLM G;  3HOW B;  2JSO A;  4A76 A;  2K52 A;  3GTP B;  1A63 A;  1QJO A;  1S4Z A;  4A3B B;  3C1F A;  1TR5 A;  2NZO A;  4X65 Q;  1TVX A;  4ZRZ A;  1B1Z A;  3ZYY X;  2FMM A;  1N34 Q;  4RGT A;  1WTO A;  3Q24 A;  2UXC Q;  4QIW E;  2PZT A;  3DWQ A;  2F0Q A;  3LGJ A;  1CKN A;  1EWC A;  2F4V Q;  3P7J A;  5AJ3 Q;  2KBN A;  4LF5 L;  3GTM B;  1EIF A;  4JV5 L;  3RR5 A;  2XN9 C;  2I0Q A;  2K04 A;  1T5E A;  3K0X A;  5FLM H;  4R8I A;  3GTP H;  1D6E C;  2CWA A;  1TII D;  3I8Z A;  5C3E G;  5C3E B;  4HR7 B;  1GD7 A;  1I5F A;  4H13 C;  4F8M A;  1V1O A;  1SE8 A;  1I4H A;  4DR2 L;  5BR8 Q;  1CUK A;  3J81 j;  4LF9 Q;  4A3E G;  4A3E B;  3ERO A;  1V1Q A;  5EBD A;  3A8K E;  3X3N A;  4DR6 L;  3EVQ A;  3J80 c;  1PH7 A;  4KD3 A;  4KD4 A;  4ZQ3 A;  4IFD I;  2DJG C;  2EYO A;  5ELF A;  1IKM A;  5IT9 L;  2UUB Q;  1I6H B;  3AYH B;  1HR0 W;  1D7Q A;  1PH6 A;  1HNW L;  4QIW B;  3KYH C;  5J1Z A;  3NTI A;  1SE3 A;  3D6W A;  3NK9 A;  1CSQ A;  2UUC Q;  4AH6 A;  5C3E H;  2OXP A;  2I5M X;  4IFD J;  3CQZ H;  3DM3 A;  1ESF A;  3PIP 3;  3I4N G;  1VQ8 A;  5C5L A;  3U58 A;  1NTG A;  2B2T A;  4JBW A;  2UXD L;  2WV6 D;  2F3V A;  3CCV A;  1SBB B;  1DD2 A;  4R1J A;  4A3E H;  3CC2 A;  4RFB A;  2J0T D;  5JOB A;  3CAM A;  1TY0 A;  3S1M H;  4N9T A;  1TT2 A;  3M3Y B;  4MIU A;  3UDI A;  2B2W A;  3HOY G;  3HOU G;  2IL8 A;  4XDX A;  3HOU B;  3BDC A;  2NYZ D;  2AUK A;  1MSH A;  4OO1 I;  2EYJ A;  4WFN 3;  3T1Y Q;  4RKL A;  3BDL A;  2E5L Q;  1CHP D;  2YU9 H;  1UE5 A;  1XPO A;  1EZ8 A;  1EL0 A;  1P8L A;  1XX8 A;  3MXU A;  1IYJ B;  2OT2 A;  3GTK B;  1XNQ L;  4ULL A;  2MJ8 A;  5JEA J;  2E2H H;  3AEV A;  5DLQ E;  4PG3 A;  4WRD A;  3I4N H;  1A6X A;  1EYD A;  2PMZ E;  3LNN A;  5LHY 1;  5IWA Q;  4DV3 Q;  1PRT B;  4Y7N H;  4KY5 A;  4LK1 C;  1PTO B;  2WAC A;  1K8G A;  4FVM A;  5F2D A;  1OTC A;  2VW9 A;  3HOY H;  1EU4 A;  3PUY A;  4K2K A;  3HOU H;  1KC8 C;  4JK1 C;  1V1P A;  1DYQ A;  4R4I A;  4YIJ A;  4DV7 L;  1QE6 A;  2HDM A;  2B2Y A;  2IWH A;  5JAV A;  2WKC A;  3H15 A;  3K5M A;  1GKH A;  1LAC A;  1NJI C;  1G29 1;  1F77 A;  3VDY A;  2HHH L;  1FNU A;  4JG2 A;  3T1H Q;  1STB A;  4NXN Q;  2RF4 A;  1G6P A;  3PO3 G;  1SJE D;  4DV4 L;  5KYI A;  1YNJ C;  4JI2 L;  3M9B A;  2K4K A;  5JJZ A;  1BOS A;  3GTJ H;  1JC7 A;  2M2L A;  2IHE A;  1O78 A;  1SR3 A;  2A19 A;  2F0M A;  2E2D C;  2F0I A;  2HUG A;  3ERS X;  1Y1W G;  4YCU A;  1Y1W B;  1C48 A;  1BCP B;  1STH A;  3I7F A;  3STB C;  5ELD A;  2DN8 A;  5C0X I;  3JAM E;  3WDN A;  4JC0 A;  4CKE A;  4CJ2 C;  3JAM i;  4G4K A;  1Q12 A;  4EQN A;  1PZK D;  1ZYR D;  2KCN A;  1E22 A;  4MN3 A;  4KKS A;  4JYA L;  4YWL A;  2WFW A;  1YJW A;  2R93 B;  4JBM A;  1PXU A;  3GP7 A;  2AQ2 B;  3PO3 H;  1A3V A;  3A5Z B;  1X3Q A;  5C0X J;  3DWP A;  3W3A A;  3MTS A;  1LT4 D;  1NCV A;  1O7I A;  1VQC A;  3A55 A;  1ZKO A;  2Z6K C;  2BE5 C;  3A0J A;  3TME A;  4IUN A;  4BY1 G;  1Y1W H;  4BY1 B;  1H9R A;  4X64 Q;  2SNM A;  5A35 A;  3SK5 A;  3WWV A;  2Z8L A;  1DOK A;  2KCC A;  3CCU A;  1JJC B;  1EWH A;  4K14 A;  4MTN A;  3F2C A;  3NTH A;  1QUQ B;  1Q82 C;  1NAP A;  2EYF A;  2VQF L;  1XNR L;  3G6J B;  3T51 B;  4RMF A;  5JVH 3;  2BDO A;  2WAQ G;  1HFG A;  4QUF A;  1SRO A;  5EGT A;  3MEF A;  1II3 A;  1HRJ A;  4JI3 L;  2ASB A;  2AMC B;  2RSN A;  4FP5 D;  5CV5 A;  2R93 H;  3AMU A;  1XNQ Q;  1WOC A;  3KJP A;  4GLV B;  3I4O A;  3S2D H;  2K50 A;  3TSS A;  4BY1 H;  4UHV A;  2Y0S G;  1RKN A;  2E74 C;  3BS1 A;  1F9Q A;  3BG3 A;  4DUZ Q;  1VQF A;  4DR3 L;  3NWT A;  2PNH A;  4LWC A;  3OMC A;  1SFO H;  2DNC A;  1RTN A;  2OEO A;  3RN2 A;  3A74 A;  1BBX C;  1BCP C;  2PI2 A;  5FK9 C;  4HJA A;  1P16 A;  2KOL A;  1PRT D;  2K75 A;  5JJL A;  2LS0 1;  1PTO D;  4DV6 Q;  2LSS A;  3T53 B;  3M4O H;  2JQO A;  1Q1E A;  5JJI A;  2MP1 A;  1VQD A;  2Q8R E;  3RLF A;  2JP1 A;  3S2H H;  4POF A;  1HNZ Q;  1D5M C;  3M4P A;  1LTI D;  4FF4 A;  4KHZ A;  3FPP A;  1K73 C;  2QW7 A;  3QO2 A;  2WB1 E;  3BJU A;  3TEH B;  1KTK A;  3H3V C;  4ME5 A;  2F0T A;  4DKA C;  4LMQ D;  3M4Y A;  1SNO A;  2HDL A;  1F9S A;  5KRU A;  2G5D A;  4KV6 A;  1DXM A;  1EY9 A;  5CV7 A;  1J8I A;  4L5T A;  4K0K L;  3K7A B;  4P73 A;  3U9S A;  4CJ1 B;  4MHE A;  5LMN W;  4DXG A;  4XXE A;  1N36 Q;  4PNY A;  2HCC A;  1EYA A;  2CCZ A;  1IBK Q;  4ZYS A;  1QVG A;  1B7Y B;  3S14 H;  4B3T L;  1CKM A;  2TSS A;  4P2C B;  1VQG A;  3I4L A;  1MJC A;  1XMQ L;  3KBX A;  4NP5 A;  4IZ8 A;  1BR9 A;  4OIJ A;  1IXR A;  4ALP A;  3Q23 A;  2LFN A;  3FDT A;  2QA4 A;  3S16 B;  2ZTC A;  5C4X G;  4JYA Q;  1FJG L;  3PF5 A;  3D4D A;  2AQ1 B;  2VB2 X;  2JA7 G;  3J7A V;  5I9P A;  5J39 A;  3FVQ A;  4LFA L;  1MSG A;  4OL7 A;  1TQO A;  1OXX K;  5EJW A;  5C3W A;  2D9U A;  4ZK9 B;  2UUA Q;  3HOZ G;  1SMY D;  3HOZ B;  1Y8O B;  1FYC A;  3EA6 A;  4IQZ A;  2OWO A;  1X32 A;  2PQA B;  3KF8 B;  1HQR D;  3CU7 A;  3KDF A;  1DZ1 A;  3HS0 C;  2LXJ A;  3DLL A;  5M5Y H;  1JMC A;  1QZH A;  2B2V C;  2M00 A;  5C4X H;  1QNU A;  2QDB A;  3P20 A;  2JA7 H;  1ZXT A;  3K5N A;  2IJ0 A;  2QEJ C;  1YJN A;  1BNZ A;  2R3Z A;  4FF1 A;  1AE2 A;  1WTR A;  1FL0 A;  2AHO B;  2I46 A;  2V1C C;  5M9O A;  2VY3 A;  5E7N A;  1ASZ A;  2FJ2 A;  1I94 L;  5C4Z A;  3HOZ H;  1MJE A;  5KEE A;  1X6O A;  5ELN A;  4NXM Q;  4CDF C;  3JAM c;  2FMC A;  1SNQ A;  4AQY Q;  1IZ6 A;  1U0L A;  1EIG A;  5EBC A;  4HIM A;  2AWO A;  1SXT A;  3MXG A;  3E9I A;  2K5W A;  1WTP A;  4LF6 Q;  3ICE A;  3UE0 A;  4NB3 A;  3TRZ A;  2PCF B;  4K5X A;  2VQE Q;  1TS4 A;  2LMC B;  2R61 A;  1EFI D;  5FO7 B;  3K59 A;  3CME A;  4RA8 A;  2QCP X;  3C1E A;  4HJ5 A;  1WD1 A;  4CHT B;  2EQS A;  1PDQ A;  3M4Q A;  1BDO A;  3BYT B;  4HJ8 A;  2O4X A;  1VQB A;  1B3A A;  3KLR A;  4Z9C B;  1NR4 A;  3F2B A;  2R92 G;  1S5F D;  2F0V A;  2WKD A;  3VYS A;  1HA5 A;  4PZ7 A;  3N6R A;  3TP7 A;  3IFD A;  4KK7 A;  1IYV A;  4I7Z C;  3G6E A;  3NQI A;  3PO2 G;  1GUS A;  2R6G A;  3ERQ A;  3PO2 B;  1QWY A;  4DK3 C;  5HGQ A;  2QKI C;  2NUC A;  1X56 A;  1ONL A;  5M5X B;  1HTL D;  1EIY B;  5IGC A;  1GUW A;  4YCW A;  2UU9 L;  3G48 A;  5FLX c;  2A68 C;  5IIF A;  4A3I B;  2Q2U A;  4KTA A;  2DY8 A;  1PH9 A;  4R4O A;  1Q90 A;  3T16 A;  3PUV A;  5GAG C;  3AU7 A;  2C9O A;  1CFM A;  3A8I E;  2ZM6 Q;  2XGT A;  2R92 H;  3M85 A;  1STY A;  1GUT A;  2Z6K A;  4DUY Q;  2OF1 A;  1QOH A;  3PO2 H;  4PQX A;  4IO9 A;  3RZO B;  4ZLT F;  1PHJ A;  4AYB G;  5GQO A;  1PH4 A;  2CQO A;  2O5J C;  2B8F A;  3IL8 A;  3K6O A;  4P72 A;  2CW0 D;  1SRU A;  1TS5 A;  4HTH A;  2H5X A;  3SR1 A;  4X65 L;  3J7A F;  1E3P A;  2PZW A;  2A6E D;  3CCJ A;  4DR4 Q;  4NPS A;  2Q8T A;  1BUV T;  3KF6 B;  4K2L A;  5G3L D;  1N34 L;  4ILW A;  2UXC L;  1B2T A;  5DEH A;  1K28 A;  4V19 0;  5CV8 A;  1QVF A;  4LF4 Q;  2F4V L;  1RL2 A;  4OWW B;  3QIA A;  2JA8 G;  3KJO A;  1F9P A;  5AJ3 L;  1EY8 A;  1JB3 A;  4APV A;  1TWH H;  3I55 A;  2A8V A;  3RZO H;  5ELE A;  1UWV A;  2QEX A;  5M5W H;  1U4R A;  1YNN C;  1EQV A;  1EQQ A;  1K0R A;  3OWE B;  3OSO A;  3S24 A;  1HTP A;  2LKV A;  4LAA A;  1X65 A;  5JVG 3;  1R4Q B;  3T56 B;  1E2V A;  4LF9 L;  4DNT B;  2RQX A;  3RNU A;  1K83 B;  3I3C A;  1SYB A;  1JJ2 A;  5COY A;  1PH1 A;  1Q1B A;  3BZC A;  1D5Z C;  4C3I B;  3GD7 A;  2JA8 H;  1AH9 A;  2UUB L;  5FOB B;  1J5E Q;  1A2T A;  1I50 H;  3HEJ A;  4RKB A;  2B8G A;  2Z9H A;  5H1S E;  2F0D A;  1VQI A;  1O7Z A;  4QF4 A;  1UEA B;  2NN6 G;  1SN8 A;  2UUC L;  5CBE E;  1SYD A;  2I5L X;  5IGF A;  5I2X A;  2K14 A;  3JC6 6;  1AZQ A;  4B3R Q;  1U4P A;  1G8Z D;  4PV1 C;  1K83 H;  4QY7 A;  3PV0 A;  4DR5 Q;  1NE3 A;  3D6C A;  4UPA A;  4A3C H;  1QVC A;  2ID0 A;  1TXY A;  2G9D A;  5EKL A;  2A73 B;  2YTY A;  3I56 A;  3T1Y L;  5ELO A;  1HPC A;  5IYB G;  2E5L L;  1A8V A;  2F0F A;  4R8N A;  3L2P A;  5E1F A;  2NN6 H;  1W3S A;  1PZI D;  2MUY A;  1I6V C;  1UE7 A;  1UUP A;  3FKI G;  1EEI D;  1F2Y A;  1HZC A;  1HA6 A;  1E24 A;  1QCB D;  4BS9 A;  3PIP A;  2PNR C;  2K5H A;  1S3O A;  2K03 A;  4DNR B;  1SAP A;  5C5M A;  2ZJP A;  2D2C C;  5IWA L;  4DV3 L;  5IOC A;  1PV4 A;  2NTT A;  4FF2 A;  2K5D A;  4O2D A;  4DAY A;  1GHJ A;  4HIK A;  2XIW A;  2PO4 A;  3DM1 A;  3FEW X;  1HR0 Q;  3SE0 A;  4C1N K;  2B2V A;  1V9P A;  2MO0 A;  5IYB H;  3PUX A;  3J7A 5;  4OIK A;  5EPL A;  3ONA B;  3FKI H;  2L55 A;  5KNB A;  3T1H L;  4MZ9 A;  4NXN L;  4OEM B;  4IUV A;  2PW5 A;  1ENC A;  3PMF A;  1SYE A;  3HFZ B;  1B8A A;  2NZH A;  1NUC A;  3VR4 A;  3HKZ G;  3CQZ B;  1LTB D;  4JI7 L;  1OXU A;  3GTQ H;  4L63 B;  4A3G G;  4J8Q A;  1B4O A;  3TZD A;  2D62 A;  3ZJY C;  2GN5 A;  1W6K A;  4GN4 B;  3RLO A;  1K8O A;  3S1M B;  5COR A;  4JOI C;  1Z7T A;  4IOC A;  4DV1 L;  2X6L A;  4JI6 Q;  3NBH B;  1XTD A;  1VQN A;  2HQE A;  4DR1 Q;  4FYD A;  1MGS A;  2NZ1 D;  2YU9 B;  2RDH A;  2RCF A;  1BF4 A;  1WVL A;  1B70 B;  3DWA A;  2QIL A;  2E2H B;  4TVA B;  2AWN A;  1CM9 A;  3I4N B;  1J6Q A;  1CQV A;  1RDP D;  2AKW B;  5LL6 S;  5HUR A;  1HNX Q;  1EUJ A;  2PQA A;  4A3G H;  3NBI A;  3I2Z A;  4X64 L;  3HGB A;  5IGE A;  4Y7N B;  2NVY B;  3HOX G;  4UP9 A;  3HOX B;  2HIX A;  4GNX B;  3HOY B;  1LV9 A;  4IFD G;  1B50 A;  1Y8P B;  1TS3 A;  2F52 A;  5IE8 A;  5EPK A;  2ICE C;  3QWN A;  2E75 C;  2DGY A;  3C3L A;  1YZ6 A;  4DGZ A;  1T9H A;  4LF8 Q;  2A74 C;  2HCI A;  1AFP A;  3M7N A;  5E4X A;  4F88 A;  3CCE A;  2JN4 A;  3SHL A;  4CKC A;  4OHJ A;  1PFS A;  5IYC G;  4BBS G;  4BBS B;  2PZU A;  4DUZ L;  3S15 B;  2C5C A;  2NVY H;  5DNF A;  2L9H A;  1Q86 C;  3UI2 A;  3HOX H;  1I4Q A;  2QF7 A;  1Z6H A;  3QB3 A;  3R8B A;  1K9M C;  3GTJ B;  4XT1 B;  2KCM A;  1AEX A;  5K5P A;  3J7Z C;  4A93 G;  2X69 A;  4LFC Q;  4DV6 L;  4OO1 G;  1ZYR C;  4BWG B;  5CR3 A;  4IJL A;  2DJF C;  4DAV A;  3RLN A;  3CCS A;  3VYU A;  5DM6 3;  1HNZ L;  1EEF D;  3BVZ A;  1EQT A;  2CQA A;  1EOV A;  3D31 A;  4L5Q A;  4YCV A;  1ICF B;  1PRT F;  1PTO F;  1JOO A;  3PO3 B;  3E9H A;  5IYC H;  4BBS H;  2JJQ A;  3S15 H;  2RBM A;  2XWJ B;  1YIT A;  4JI7 Q;  2ZXO A;  2CKZ B;  5I6Y A;  1UE1 A;  2WAQ E;  4P71 A;  1K3R A;  3GTG B;  4A93 H;  4M8A A;  1KDB A;  1N36 L;  1A3U A;  4FF3 A;  1GM5 A;  4OO1 H;  3KLS X;  1IBK L;  3IAY A;  3A56 A;  1SYF A;  3H3V I;  4NW2 A;  3PCO B;  4DV1 Q;  2EZV A;  3MEH A;  4JI4 L;  4N8F A;  2RHS B;  3IKJ A;  4LW1 A;  4A4I A;  3R2I A;  1F9R A;  4JBJ A;  1YHQ A;  4A3D G;  1L1O B;  1SJH D;  1CZW A;  1BCP F;  1I4X A;  4RGM A;  3HOV G;  3HOV B;  3S2D B;  4BA1 I;  1KXL A;  1X3F A;  1HQM C;  2UUA L;  4IUR A;  1PRT C;  3GTG H;  3NEN A;  1XPU A;  1GUN A;  1PTO C;  3KF6 A;  4CJ0 B;  1BBU A;  2OQ0 A;  3J81 L;  4C56 C;  3K8A A;  3CCL A;  1KQS A;  1SFO B;  1G2S A;  1BXT A;  4NDX A;  3FP9 A;  1WTW A;  3M7G A;  1HH2 P;  1E2W A;  5C0X G;  4L8J A;  3CMA A;  2WAQ B;  3TP5 A;  4KJN A;  4HID A;  3HG9 A;  4GOP B;  5C4J H;  3M4O B;  1AE3 A;  2WII B;  2R7Z G;  3S2H B;  1I4P A;  3SXH A;  4LUV A;  5IT9 E;  4IAL A;  4ZKB B;  1U9R A;  4PMW A;  3S17 H;  4OX9 L;  4CDE C;  2JA6 G;  2JA6 B;  1HUN A;  4A3D H;  3HOV H;  3UDX A;  1QZG A;  3KUP A;  5IY0 A;  5LMN Q;  2Y0S B;  4NXM L;  2IW3 A;  3SK6 A;  4RCN A;  1WYD A;  1VQK A;  2UXB Q;  1IBL Q;  1IL2 A;  2KA7 A;  1JOK A;  4AQY L;  1SNC A;  1S40 A;  1LTL A;  5C0X H;  2B63 G;  2PQE A;  2Z1C A;  5I6W A;  3CC4 A;  4LF6 L;  4J6H A;  3V96 A;  1KAB A;  1PMR A;  2PW7 A;  1YNX A;  2VQE L;  2H1E A;  3S14 B;  4JPB W;  4A3K G;  2R7Z H;  2E2J H;  3CXC A;  3OIQ A;  3R3O A;  4FDB A;  3R93 A;  2BH2 A;  3C46 A;  2Z6B A;  3MZ5 A;  2JA5 G;  2IT1 A;  4J1M A;  3PSI A;  4UAI A;  2B2U C;  4YY3 Q;  1XMO Q;  2JA6 H;  1TS2 A;  4A3M G;  2LY7 A;  3ITP A;  3V2T A;  3DEP A;  4C1N I;  1A15 A;  1LYL A;  1SMY C;  5C44 G;  4DV0 Q;  1G91 A;  1VQM A;  4GLX A;  4DFA A;  2BA1 A;  4WJ4 A;  4PZ8 A;  3CC7 A;  2NVT H;  1EY4 A;  1YHB A;  1A0I A;  3CRL C;  1RCV D;  3J80 L;  4FXD A;  1EYC A;  2KEC A;  2B63 H;  1KNE A;  4IPD A;  3ND9 A;  3KLS A;  4JOI A;  1CKN B;  2RA4 A;  1ILQ A;  4YHH Q;  2NVX H;  1KHI A;  1CZG A;  5TSS A;  4POG A;  4A3K H;  2A1A A;  2R7D A;  4UY8 C;  2JA5 H;  3K5O A;  2ZXP A;  3S1Q H;  4JI4 Q;  1IW7 D;  3BVM A;  4G7Z C;  5M5Y B;  4A3M H;  1PFN A;  5C4X B;  1W6J A;  1MD2 D;  5C44 H;  2ZM6 L;  2L1B A;  3TBI B;  2JA7 B;  1LTG D;  4BBR G;  1XWE A;  1HZ9 A;  5IGB A;  1H9K A;  4DUY L;  2ZT9 C;  1A2U A;  5FKA C;  1STA A;  2VNU D;  5D14 A;  1STN A;  3QOJ A;  2EY5 A;  3L9A X;  5A2Q L;  4ZUJ A;  1PYS B;  5C6A A;  4BY7 G;  1SYC A;  1WTQ A;  3GQB A;  1TWA H;  4HSP A;  2KUM A;  4C3J G;  1HXY D;  3NSW A;  4DR4 L;  4O0A A;  4PMB A;  4GN3 B;  2OTJ A;  5I2Y A;  1F2Z A;  3IRB A;  2VL6 A;  1LT6 D;  3SK8 A;  1A62 A;  1KDC A;  1AP0 A;  2N88 A;  3NQT A;  2ZTE A;  4KY6 A;  4LF4 L;  2PYK A;  2IPK D;  2WB1 G;  5FO8 B;  5GAE C;  3DUZ A;  4BBR H;  3TP8 A;  3GO5 A;  4OX9 Q;  4RCO A;  5D3I B;  4ZCK A;  4LUZ A;  5KIX A;  5J22 A;  4X62 Q;  3V05 A;  4JW0 A;  3CPF A;  3E0E A;  5M3F G;  5M3F B;  1UNS A;  1A3T A;  4BY7 H;  2XRS D;  4KLK A;  2E2I H;  4QUC A;  3URY A;  3KFU A;  3FRP B;  1VMC A;  4C3J H;  3MXN B;  4K5W A;  4A3F G;  1HHV A;  3H09 A;  3RN5 A;  3D8G A;  4A75 A;  4B9W A;  4B08 A;  3NUC A;  4DK6 C;  3J81 E;  5C4H A;  3TS0 A;  1L0W A;  1VQ7 A;  2DNE A;  5AFW A;  1Y14 B;  2LXK A;  3J81 i;  1SDF A;  1X3P A;  2M9V A;  5DAU A;  4NKL A;  3L0O A;  1VMP A;  1VQA A;  1EOT A;  1J5E L;  1Q3L A;  3MXP A;  1IYU A;  5GAH C;  1VQE A;  2BA0 A;  3A5U A;  1LT5 D;  1K8A C;  3BZD B;  1S5C D;  1X55 A;  4G7O C;  2R92 B;  5M3F H;  3CPW A;  4X3S A;  3A54 A;  1KDA A;  1X3G A;  5M3M G;  5M3M B;  1U4L A;  1O80 A;  1V1P B;  3TRE A;  4A3F H;  1PYW D;  2MHV A;  3MFY A;  2E76 C;  4B3R L;  4IOA A;  4EGV A;  4DR5 L;  4LF7 Q;  1YBY A;  1EIH A;  5IT9 c;  4MTK A;  1IL8 A;  3VYR A;  4J15 A;  2ICI A;  2MNA A;  2IX3 A;  2K5Q A;  1Q81 C;  2JXM B;  1NMF A;  2GVA A;  2FXQ A;  3NEL A;  1O7L A;  4JI5 Q;  4HN7 A;  2A6H C;  4KMU C;  3U4V A;  2NVQ B;  2F0S A;  1TWG H;  3E3X A;  1FVI A;  1SE2 A;  2F0P A;  4JI8 Q;  1OO9 B;  1E1T A;  4L5R C;  3RZD B;  3PUZ A;  5M3M H;  2C35 B;  1TWH B;  3CCM A;  2CFM A;  2EY1 A;  4B3S Q;  3S1N H;  5M5W B;  4AYB B;  1JIC A;  1IKL A;  4L6T B;  5I4D A;  1PH8 A;  1PFM A;  2ZTD A;  1YEZ A;  2FHT A;  3PIO 3;  3J80 E;  1RF2 D;  1HR0 L;  1B44 D;  1I4G A;  4LUO A;  3EJI A;  2NVQ H;  2RSO A;  3G7L A;  4FXK C;  2WIN B;  4KN7 C;  1I3Q H;  4CDD C;  4WOR A;  3CRK C;  4H0L C;  4DR7 Q;  4QJF A;  1JQY D;  2JA8 B;  3FMC A;  3NTK A;  3HRZ C;  2BCO A;  1T5X D;  3RZD H;  4DV2 Q;  1GHK A;  1I50 B;  1RIP A;  4RGN A;  4E6I A;  2NBF A;  4JI1 Q;  4EQ5 A;  3ULL A;  3I73 A;  4OWT B;  3U50 C;  1X54 A;  1DOL A;  2B3G A;  3E0J A;  2SEB D;  4KKU A;  2PPB C;  2KED A;  3S9W A;  2KEN A;  2YTV A;  3QOL A;  2F0G A;  2A68 D;  3GTL H;  4GN5 A;  2EYH A;  5CV4 A;  2CH4 A;  1EYG A;  4X3T A;  4RAU C;  3HKS A;  3FHW A;  2XWB B;  1SYG A;  1XJV A;  1MKH A;  1KLU D;  1G2T A;  3NHH A;  4JI6 L;  2B2U A;  4EVO A;  1PH5 A;  4DR1 L;  1N9W A;  2HD3 A;  2EVB A;  4I65 A;  4OGQ C;  4MNO A;  5IGD A;  1L1O A;  1VQ6 A;  2EYL A;  1U4M A;  1QB5 D; 
#chains in the Genus database with same CATH homology
 1L2F A;  2JEB I;  2B29 A;  2JEA I;  2R93 H;  3HOX G;  4UP9 A;  3CD6 A;  4QQB X;  1VQ4 A;  4DR3 Q;  3OTO L;  2HIX A;  4GNX B;  1XNQ Q;  4IFD G;  1W2B A;  4Y52 H;  2R7F A;  4AYB E;  1WOC A;  1HNX L;  3KJP A;  1QUQ A;  4GLV B;  1NMG A;  2DUD A;  3I4O A;  4JI0 L;  3W5O A;  3S2D H;  2K50 A;  1E7Z A;  4DAM A;  2F52 A;  5IE8 A;  4EX5 A;  1PH3 A;  4BY1 H;  2DGY A;  2Y0S G;  1WJJ A;  3KLW A;  3KOJ A;  1C0A A;  1G51 A;  4DUZ Q;  1VCI A;  1VQF A;  4DR3 L;  1YZ6 A;  1YVC A;  2PNH A;  4LWC A;  5K36 G;  1SFO H;  4OXP A;  1NBW A;  1T9H A;  3RN2 A;  3A74 A;  1Z9F A;  2PI2 A;  4HJA A;  4GNX A;  4LF8 Q;  1P16 A;  4KHP L;  3M7N A;  2K75 A;  1Z47 A;  3F1Z A;  2ATW A;  1V43 A;  4UP7 A;  5JJL A;  3EBE A;  2LSS A;  3CCE A;  4DV6 Q;  1PVO A;  2N3S A;  2N78 A;  3M4O H;  3HKZ E;  1PFS A;  5IP7 H;  5IYC G;  4BBS G;  2JQO A;  1Q1E A;  4DUZ L;  2NVY H;  5JJK A;  3D0F A;  5JJI A;  1Q86 C;  1VQD A;  3RLF A;  3HOX H;  3S2H H;  4POF A;  1K9M C;  3ER0 A;  1HNZ Q;  2VUM G;  2RHQ B;  2KCM A;  3CCR A;  1Q8K A;  3M4P A;  5J3B A;  4LF8 L;  3PF4 A;  3J7Z C;  4A93 G;  5GRO A;  4KHZ A;  4K0K Q;  4LFC Q;  4DV6 L;  2KHI A;  5EAY A;  1K73 C;  4OO1 G;  2IHF A;  2MQH A;  2WB1 E;  3BJU A;  3TEH B;  2MO1 A;  4IJL A;  4DKA C;  2E8G A;  1WI5 A;  3RLN A;  1Y1V G;  3G71 A;  3CCS A;  1HNZ L;  4C2M H;  4B3T Q;  4B3M Q;  1KRS A;  3NEM A;  1XMQ Q;  4WJ3 M;  1EOV A;  4A3I G;  3D31 A;  4YWM A;  5LMU Q;  4L5T A;  1M90 C;  4LFC L;  1UEB A;  4L5Q A;  4P73 A;  4YCV A;  4K0K L;  3HOW G;  5LMN W;  1YJ9 A;  4OWX B;  1N36 Q;  2YV5 A;  4GKK Q;  4GKJ Q;  2CCZ A;  1KAW A;  2JA9 A;  1IBK Q;  2XTI A;  3GTO H;  1FJG Q;  3E9H A;  5IYC H;  1QVG A;  4BBS H;  5IYD G;  1XPR A;  1B7Y B;  3K81 C;  2JJQ A;  3S15 H;  3S14 H;  4A3B G;  4B3M L;  4B3T L;  1CKM A;  1VQG A;  1YIT A;  2Q2T A;  1MJC A;  4JI7 Q;  1XMQ L;  2CKZ B;  2VUM H;  1UE1 A;  1JE5 A;  2WAQ E;  4P71 A;  3J80 i;  1IXR A;  4LFA Q;  4ALP A;  1K3R A;  4A93 H;  3EIV A;  3W1G A;  1N36 L;  1M1K C;  2D0P A;  2QA4 A;  4GKK L;  2Q2I A;  1GM5 A;  2ZTC A;  4GKJ L;  5C4X G;  4JYA Q;  1IBK L;  1FJG L;  4C3H H;  3PF5 A;  2PI2 E;  5M5X H;  3H3V I;  2IY5 B;  2JA7 G;  4IPG A;  3PCO B;  3KDF B;  4DV1 Q;  1Y1V H;  2JE6 I;  2I5H A;  4LFA L;  1HJP A;  1OXX K;  4JI4 L;  1VQP A;  4A3I H;  1BBW A;  2UUA Q;  1WFQ A;  2RHS B;  4LW1 A;  3HOZ G;  4A4I A;  3HOW H;  4A3L G;  1N32 Q;  2OWO A;  4JBJ A;  3L7Z C;  1CSP A;  3PGZ A;  1Q46 A;  5IYD H;  2PQA B;  4A3B H;  3SGI A;  1YHQ A;  3KF8 B;  2Z0S A;  1L1O B;  4A3D G;  3HOV G;  1OXT A;  3KDF A;  4BA1 I;  1KXL A;  1X3F A;  2UUA L;  2LXJ A;  3GTG H;  2WP8 J;  2NN6 I;  3NEN A;  3W1B A;  3DLL A;  1XPU A;  3KF6 A;  3I4M G;  5M5Y H;  1I94 Q;  1JMC A;  1LUZ A;  4BXX G;  1BBU A;  2OQ0 A;  4TQU S;  1QZH A;  1N32 L;  4H02 A;  5C4X H;  3K8A A;  3CCL A;  1KQS A;  2OCE A;  1JT8 A;  3OTO Q;  2JA7 H;  2VS1 A;  1OXV A;  1SMX A;  3FP9 A;  1YJN A;  1HH2 P;  5C0X G;  1AE2 A;  1DGS A;  3CMA A;  1FL0 A;  3K7U C;  3GTM H;  5BR8 L;  4JI0 Q;  2AHO B;  4HID A;  2V1C C;  1ASZ A;  2VY3 A;  5E7N A;  5C4J H;  4GOP B;  1X3E A;  1R9T H;  1I94 L;  1AE3 A;  1VS0 A;  1MJE A;  2HQL A;  3HOZ H;  3BZK A;  1X6O A;  2R7Z G;  5ELN A;  1S72 A;  2OTL A;  1EFW A;  4NXM Q;  4LFB Q;  3JAM c;  4LUV A;  4A3L H;  4DV5 Q;  3U4Z A;  4A3C G;  4PMW A;  4AQY Q;  3S17 H;  4OX9 L;  1IZ6 A;  1U0L A;  2JA6 G;  1EQR A;  1HZB A;  1ASY A;  4HIM A;  4A3D H;  3K80 C;  3CW2 C;  3HOV H;  2AWO A;  3UDX A;  4KHP Q;  3F8T A;  1QZG A;  2GVB A;  5IY0 A;  3E9I A;  4YWK A;  4LF6 Q;  3ICE A;  5LMN Q;  3Q8D A;  3UE0 A;  3I4M H;  4NB3 A;  4NXM L;  4LFB L;  3TRZ A;  4GOP A;  3UDF A;  3OW2 A;  1WYD A;  1VQK A;  2VQE Q;  1IBL Q;  4DV5 L;  1IL2 A;  2UXB Q;  4AQY L;  2ZJQ A;  2VZA A;  3CME A;  1S40 A;  4R4Q A;  1Q7Y C;  4HJ5 A;  4OON A;  1LTL A;  2B63 G;  2YTX A;  2EQS A;  3M4Q A;  3CC4 A;  3CCQ A;  2EXD A;  4LF6 L;  4IJH A;  1I6H H;  1IBM Q;  5LMN L;  4HJ8 A;  1VQB A;  1YHA A;  1YNX A;  2UXB L;  3F2B A;  4IPC A;  2VQE L;  1IBL L;  2R92 G;  4UP8 A;  4A3K G;  2R7Z H;  2E2J H;  4PZ7 A;  3ULP A;  3CXC A;  4FDB A;  2BH2 A;  1BKB A;  1WCM G;  3G6E A;  1YI2 A;  3EN2 A;  4LNQ A;  2JA5 G;  4C3I H;  2UU9 Q;  2IT1 A;  3PSI A;  5JEA G;  4HJ9 A;  4YY3 Q;  1N8R C;  1XMO Q;  2HT1 A;  2JA6 H;  3PO2 G;  4BA2 I;  2R6G A;  2IX1 A;  4A3M G;  1IBM L;  4X66 Q;  1VQL A;  3J81 c;  1VQJ A;  4DK3 C;  5HGQ A;  1LYL A;  5C44 G;  4DV0 Q;  1X56 A;  1VQM A;  4GLX A;  2D0O A;  2BA1 A;  1EIY B;  4WJ4 A;  4KI0 A;  4PZ8 A;  4YCW A;  3CC7 A;  3AQQ A;  2IX0 A;  2MFI A;  3G48 A;  2UU9 L;  2NVT H;  5FLX c;  1YHB A;  3M3Y H;  4HIO A;  2RCN A;  4YY3 L;  1A0I A;  1XMO L;  2Q2U A;  2HIV A;  3AFP A;  4XIG S;  1PH9 A;  4RG1 A;  4GLA C;  4X66 L;  2B63 H;  5FLM G;  4IPD A;  4R4O A;  4JOI A;  1CKN B;  3PUV A;  4DV0 L;  4A76 A;  5GAG C;  2K52 A;  4YHH Q;  1VQ9 A;  2NVX H;  1KHI A;  3S1R H;  1H95 A;  1A63 A;  4POG A;  2ZM6 Q;  2XGT A;  1KRT A;  2R92 H;  4A3K H;  3M85 A;  2A1A A;  2R7D A;  2NZO A;  4R4C A;  4X65 Q;  4UY8 C;  1UE6 A;  2Z6K A;  1WCM H;  4DUY Q;  4LF5 Q;  1YIJ A;  2JA5 H;  3GTK H;  4XTC S;  1N34 Q;  4JI4 Q;  3S1Q H;  4JV5 Q;  3B6Y A;  2UXC Q;  4QIW E;  4IO9 A;  3PO2 H;  4YHH L;  4A3M H;  1PHJ A;  4AYB G;  1FGU A;  5GQO A;  1PH4 A;  2CQO A;  4GNX C;  3LGJ A;  5C44 H;  2ZM6 L;  1CKN A;  4P72 A;  1SRU A;  2F4V Q;  4BBR G;  2H5X A;  1EWI A;  4X65 L;  1E3P A;  1HZ9 A;  3CCJ A;  5AJ3 Q;  4DR4 Q;  2KBN A;  4NPS A;  4DUY L;  4LF5 L;  4DPG A;  3KF6 B;  1N34 L;  1EIF A;  3CF5 A;  4JV5 L;  3RR5 A;  2UXC L;  2VNU D;  4DR2 Q;  2I0Q A;  3K0X A;  5FLM H;  2Y0S E;  1LM0 A;  4BY7 G;  1PYS B;  3GTP H;  1VQH A;  2CWA A;  3ULJ A;  1QVF A;  4LF4 Q;  5C3E G;  2F4V L;  4DR6 Q;  1RL2 A;  4OWW B;  1TWA H;  2JA8 G;  3KJO A;  1GD7 A;  5GAD C;  1I5F A;  5AJ3 L;  4DR4 L;  4O0A A;  1BVS A;  4APV A;  1SE8 A;  2KHJ A;  4DR2 L;  1TWH H;  4GN3 B;  5BR8 Q;  3I55 A;  2A8V A;  1CUK A;  3J81 j;  2OTJ A;  3IRB A;  5IP9 G;  2VL6 A;  4A3E G;  4LF9 Q;  2QEX A;  1UWV A;  3RZO H;  1A62 A;  1V1Q A;  5M5W H;  1HNW Q;  2ZTE A;  1EQQ A;  4LF4 L;  4DR6 L;  1K0R A;  2R93 G;  2WB1 G;  3J80 c;  1PH7 A;  5GAE C;  4IFD I;  3S24 A;  4BBR H;  3GO5 A;  1X65 A;  4OX9 Q;  2UUB Q;  1VQO A;  3AYH B;  1HR0 W;  1D7Q A;  1X9N A;  4LF9 L;  4LUZ A;  4X62 Q;  1PH6 A;  1HNW L;  2UXD Q;  3KYH C;  3CPF A;  3E0E A;  3CP0 A;  3RNU A;  5M3F G;  1JJ2 A;  4BY7 H;  1PA6 A;  1C9O A;  2UUC Q;  1CSQ A;  1PH1 A;  1Q1B A;  3BZC A;  4KLK A;  4AH6 A;  2E2I H;  2BH8 A;  5C3E H;  3KFU A;  3GD7 A;  2I5M X;  2JA8 H;  4IFD J;  1GVP A;  3CQZ H;  1AH9 A;  4C3J H;  3DM3 A;  3MXN B;  2UUB L;  4A3F G;  1GO3 E;  1I50 H;  1J5E Q;  3I4N G;  1VQ8 A;  3U58 A;  5H1S E;  1NTG A;  4JBW A;  4X62 L;  3RN5 A;  2UXD L;  1VQI A;  1D8L A;  4A75 A;  2N8N A;  3CCV A;  4A3J G;  5IP9 H;  4R1J A;  4A3E H;  4DK6 C;  2NN6 G;  3TS0 A;  3CC2 A;  1SN8 A;  1L0W A;  2UUC L;  2K5V A;  2KCT A;  1VQ7 A;  2I5L X;  3BU2 A;  1Y14 B;  2LXK A;  2QGQ A;  3CAM A;  3STB D;  5FJ8 G;  3S1M H;  3J81 i;  3UDI A;  3L0O A;  1VQA A;  1J5E L;  3HOY G;  3H3V H;  2K14 A;  1KIX A;  3HOU G;  5GAH C;  3JC6 6;  1N33 L;  1VQE A;  2BA0 A;  3A5U A;  4OO1 I;  1K8A C;  3T1Y Q;  4B3R Q;  4QGU A;  1KL9 A;  1K83 H;  1X55 A;  3PV0 A;  4QY7 A;  4DR5 Q;  1NE3 A;  2E5L Q;  4IPH A;  3CPW A;  5M3F H;  2YU9 H;  1UE5 A;  4UPA A;  2OQK A;  3TQY A;  1X3G A;  1XPO A;  5M3M G;  1P8L A;  4A3C H;  1QVC A;  1IYJ B;  2ID0 A;  1TXY A;  1XNQ L;  5JEA J;  3TRE A;  1U5K A;  2Q2H A;  4P74 A;  2E2H H;  3AEV A;  1PYB A;  4A3F H;  5DLQ E;  2YTY A;  3I56 A;  2ZJR A;  4PG3 A;  5ELO A;  3T1Y L;  3I4N H;  4IOA A;  4B3R L;  4DR5 L;  4LF7 Q;  1YBY A;  5IYB G;  2E5L L;  1A8V A;  4A3J H;  4DAY B;  4DV7 Q;  2EIF A;  2PMZ E;  3L2P A;  1L1O C;  3OYY A;  5IT9 c;  1W3S A;  5IWA Q;  4DV3 Q;  3F2D A;  1UE7 A;  4Y7N H;  3FKI G;  5FJ8 H;  4J15 A;  1SLJ A;  2MNA A;  1K8G A;  1HZC A;  1E24 A;  5HY6 A;  1Q81 C;  1OTC A;  2VW9 A;  1NMF A;  1MIU A;  2FXQ A;  2GVA A;  1TWC H;  3NEL A;  4QL5 A;  3PUY A;  4DNI A;  3PIP A;  1C7Y A;  1KC8 C;  2K5H A;  2HHH Q;  3U4V A;  1S3O A;  4JI5 Q;  3HOU H;  4LF7 L;  4R4I A;  3AFQ A;  1TWG H;  4DV7 L;  1FVI A;  2ZJP A;  4JI8 Q;  5IWA L;  4DV3 L;  1PV4 A;  2JK8 A;  1E1T A;  1NY4 A;  4L5R C;  3PUZ A;  1CKO A;  4O2D A;  1PH2 A;  5M3M H;  4DV4 Q;  3H15 A;  2C35 B;  4HIK A;  1GKH A;  2L15 A;  4JI2 Q;  4GOP C;  1NJI C;  1G29 1;  3CCM A;  4PZ6 A;  4JI5 L;  3VDY A;  2CFM A;  2HHH L;  4B3S Q;  2K5N A;  3S1N H;  1HR0 Q;  4AIM A;  4L5S A;  4JG2 A;  3T1H Q;  1V9P A;  3HOY H;  4NXN Q;  2MO0 A;  2RF4 A;  1G6P A;  4JI8 L;  5IYB H;  3PUX A;  3UDG A;  3PO3 G;  3J7A 5;  1PH8 A;  3G4S A;  4BXX H;  4DV4 L;  2ZTD A;  2N49 A;  4JI2 L;  3M9B A;  1YEZ A;  2K4K A;  3FKI H;  3GTJ H;  4B3S L;  1HR0 L;  2IHE A;  1SR3 A;  2A19 A;  5LMU L;  4LUO A;  3ERS X;  1HZA A;  3T1H L;  4YCU A;  1Y1W G;  1KD1 C;  4MZ9 A;  4NXN L;  2NVQ H;  3H0G G;  3HFZ B;  1I3Q H;  3I7F A;  1B8A A;  2NZH A;  4DR7 Q;  4QJF A;  3HKZ G;  3STB C;  4JCV E;  5C0X I;  3RZD H;  4DV2 Q;  1RIP A;  4JC0 A;  4JI7 L;  1E1O A;  1OXU A;  3GTQ H;  3JAM i;  3GDE A;  4JI1 Q;  4EQ5 A;  1Q12 A;  4A3G G;  3ULL A;  4OWT B;  2D62 A;  3U50 C;  3ZJY C;  1X54 A;  2GN5 A;  2B3G A;  3K7A H;  4GN4 B;  1E22 A;  3RLO A;  4GS3 A;  1VQ5 A;  4JYA L;  4DR7 L;  3PUW A;  2WFW A;  4YWL A;  4JOI C;  1YJW A;  2ES2 A;  4JBM A;  3PO3 H;  2KEN A;  3A5Z B;  4DV2 L;  4IOC A;  1JJG A;  5C0X J;  2YTV A;  4DV1 L;  4JI6 Q;  3NBH B;  1XTD A;  4ME3 A;  2VQF Q;  1VQN A;  3GTL H;  2YYZ A;  1OXS C;  1XNR Q;  4DR1 Q;  4GN5 A;  4JI1 L;  4X6A H;  2F3I A;  1O7I A;  1VQC A;  1EYG A;  2Z6K C;  3A0J A;  4BY1 G;  1Y1W H;  2CWP A;  4X64 Q;  4HJ7 A;  4R4T A;  4P75 A;  4JBK A;  3HKS A;  3H0G H;  3WWV A;  4JI3 Q;  3FHW A;  3CCU A;  2ALY B;  1XJV A;  1MKH A;  1JJC B;  3S16 H;  1B70 B;  4MTN A;  3F2C A;  1JB7 A;  4JI6 L;  1QUQ B;  1Q82 C;  2VQF L;  4TVA B;  3PIO A;  1PH5 A;  2AWN A;  4DR1 L;  1XNR L;  1N9W A;  1J6Q A;  1N33 Q;  2AKW B;  4RMF A;  3TS2 A;  4MNO A;  2WAQ G;  1HNX Q;  1EUJ A;  2PQA A;  4A3G H;  3I2Z A;  4X64 L;  1SRO A;  3MEF A;  1TWF H;  1L1O A;  1VQ6 A;  5IP7 G;  4JI3 L;  2ASB A;  3UE1 A;  2AMC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...