3HOWH

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 16
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howH00
3NEMA 5GAEC 1NBWA 3TS2A 5GQOA 4DR3Q 1VQIA 3M4OH 1HR0Q 4H02A 2IX1A 1YJWA 3S17H 2GVAA 4B3TQ 4DV2Q 3I55A 1RL2A 3HOZG 4LFBL 5JJLA 4JI2Q 2JA9A 1J6QA 5IYCG 4DV6Q 1SRUA 3CCUA 1XPOA 4GNXB 4BBRG 3D0FA 1X3FA 4IFDJ 2VQFL 2NZHA 4X65L 1SE8A 1DGSA 2A1AA 5JEAG 3F8TA 4A3JG 2D0OA 2K5NA 1PH8A 2OWOA 4DAYB 2F52A 4K0KL 2PI2E 2NVXH 1N32Q 3BZCA 5M5WH 1EFWA 1MIUA 1YNXA 5BR8L 1XNRQ 5J3BA 3I7FA 5FJ8G 2F4VQ 1TXYA 2OQKA 4P71A 1Q82C 1L1OA 1P16A 3CQZH 3J80i 1EWIA 1Y1WH 5JJKA 2E2IH 1QZHA 3RZOH 2PI2A 2UUBQ 2ZTEA 2JQOA 4O2DA 4A3KH 1D7QA 4JI3L 1Z47A 1ASYA 1KRSA 1Y1VG 2ZTDA 1YJ9A 1I3QH 3E9HA 4GN5A 1ASZA 1XNQQ 1PH2A 2JA6G 1V43A 2JA5G 3HOWG 3PO3H 1B8AA 2YYZA 1J5EQ 3KF6A 1HNXL 2AHOB 1X54A 1Q8KA 2K5VA 2IHEA 3PUXA 5C44H 3GTJH 3G6EA 1KQSA 4DR7L 3F1ZA 2XGTA 4JI5L 3STBC 1VQMA 5IYBG 1IL2A 3KDFB 2K75A 5M3MG 4DV3Q 4IFDG 1S3OA 3LGJA 4LF6L 5DLQE 2Z0SA 1EYGA 3K7AH 3TQYA 3FP9A 4X64Q 4AQYL 1VQKA 1PH5A 5IYCH 2ID0A 4POGA 1I50H 4BBRH 1YHQA 4DR2Q 2HHHQ 4JI7L 1IXRA 4MNOA 1NY4A 2H5XA 1AE2A 3I2ZA 3TREA 4A3JH 1XMOL 1VQ7A 4C2MH 4L5QA 1KRTA 4DUZL 4Y52H 1UE5A 3KOJA 4LFCL 2AWNA 4BXXG 2MNAA 1PV4A 1FJGL 1IBKQ 1IBLQ 1PVOA 5M5YH 1HNZQ 1U5KA 1SMXA 1VQFA 4IPGA 4DV4Q 4JI4L 3S1MH 1T9HA 2WAQE 1KXLA 2OTJA 4PG3A 1NE3A 4NXNQ 4LWCA 4PZ6A 1Y1VH 1XMQL 3CXCA 5FLMG 4DV5Q 4FDBA 2JEBI 4WJ4A 3HKZG 2PNHA 2V1CC 4R1JA 4YHHL 3D31A 4JI6L 2JA6H 3HOWH 1I6HH 1BBUA 2JA5H 3CCSA 4B3ML 3CCLA 5IWAQ 3JC66 3CC2A 3T1HQ 1PH6A 2UU9Q 4PZ8A 2KCTA 4WJ3M 4GKKQ 3GD7A 4LUOA 4GLXA 4JI1Q 3W1GA 2Q2TA 3U4VA 2VY3A 4JI8L 4LNQA 3CPFA 4R4CA 2B3GA 3H3VI 5M3MH 1E22A 3RR5A 2Q2UA 3GTMH 2NZOA 4LFAL 1JMCA 3I4NG 4JBMA 4R4OA 4LF4L 3L7ZC 3UDFA 1CKOA 3KDFA 2YTXA 4GLVB 1KHIA 4DR5L 3BJUA 3U50C 4A3DH 4JYAQ 2DUDA 3ULJA 1LM0A 2MQHA 2N49A 4X62L 3RLOA 1BBWA 4NPSA 2KENA 1Q1EA 4KLKA 1I94Q 4OX9Q 1LTLA 4JC0A 2HQLA 4POFA 5ELOA 2UUCQ 3CP0A 2NN6I 1JB7A 1L1OB 2ZTCA 4LF8L 1SN8A 4BXXH 3M4QA 2ES2A 5IP9G 2ASBA 2RF4A 1TWFH 1WOCA 2UUBL 1GVPA 4YCWA 2CKZB 1H95A 3KFUA 4JV5Q 3PUWA 1FVIA 2CWAA 1VQJA 1JJGA 2EXDA 2CCZA 5FLMH 3PUYA 3U58A 3OYYA 4HIKA 1R9TH 3AFQA 4OWTB 1OTCA 1KIXA 1IBMQ 3PUZA 3W5OA 4EQ5A 3J81j 4HIDA 3RN2A 1MJEA 1VQ9A 2NVYH 5ELNA 1IYJB 1VQOA 4P72A 4IO9A 3S2DH 4DV0L 2KHJA 2R7ZG 3CMEA 2E5LQ 3EBEA 1GO3E 2A19A 4JOIC 4DKAC 4YY3L 3W1BA 2R92G 2VUMG 4C3IH 4IJLA 4MZ9A 4X64L 3RN5A 1N34Q 2UUAL 3EN2A 1E3PA 5E7NA 2NVQH 1K8AC 2OQ0A 1D8LA 1MJCA 1YZ6A 2WAQG 1EQQA 1PH7A 4LF7L 3H0GG 1B70B 1VQNA 1M1KC 3B6YA 3UDGA 1CUKA 3FKIG 1HZ9A 1W3SA 2B63G 3I56A 4LF5Q 1I5FA 4NXML 1V1QA 2GN5A 3TS0A 2YU9H 1WI5A 1VQLA 3S24A 3CC7A 4IOCA 3SGIA 1N33L 1CKNA 4PZ7A 5M3FG 1XPRA 1X56A 5C0XJ 1B7YB 1PH1A 1E24A 1HNZL 1CSPA 3NELA 4IPHA 4JCVE 4R4IA 3MEFA 3KYHC 4DUYL 1TWHH 4JOIA 1UEBA 3M9BA 3CCMA 4B3RQ 1NTGA 4LUZA 4BY1G 3OTOL 3H15A 4A3BG 2LXKA 2RHSB 2LXJA 4X66Q 2VQEL 1YITA 4DR1L 2I0QA 4BBSG 3RLNA 4DR6Q 2UXCL 2CQOA 1K83H 1HZAA 3T1YL 2NN6G 2BA0A 2AMCB 4A3MG 2QEXA 1SFOH 4GKKL 3PV0A 2BH2A 2UXDL 2ZM6L 1AH9A 3UDXA 1X9NA 1JJ2A 1HNWL 4A3EG 3RLFA 5C3EG 3J81c 2R7ZH 4JBWA 2JEAI 2JA7H 4OWXB 3PIOA 4ME3A 2I5MX 3G71A 2R7FA 1KD1C 1UWVA 1S40A 1E1OA 3A5UA 2IT1A 3J7A5 3S1RH 3HOZH 2JJQA 2R6GA 5HGQA 3G48A 4UPAA 2RCNA 3H0GH 4AYBE 3VDYA 2EIFA 1AE3A 4A76A 3FKIH 3CPWA 1X6OA 2B63H 1XTDA 3U4ZA 2KBNA 3M3YH 1YBYA 1EIYB 4B3SQ 3HFZB 1VQ4A 2K52A 4MTNA 4NB3A 2VL6A 4P74A 3H3VH 3M7NA 5HY6A 3PF5A 4KHPQ 2NVTH 3A0JA 1A0IA 4R4TA 2MFIA 3PO2G 4DK3C 1CKMA 1YVCA 4LUVA 5FJ8H 4JI0Q 4KHZA 5LMUQ 2UXBL 4DV7L 3FHWA 3M4PA 3CCJA 1TWAH 5C4JH 4HJ5A 4QL5A 4BY1H 4A3BH 4LF9L 4GKJL 1UE1A 4LFBQ 1LYLA 1QUQB 1WFQA 3K80C 4UP8A 1A8VA 4DAMA 3G4SA 3CCEA 5LMNL 3PUVA 1P8LA 5IT9c 3UDIA 4DV1L 3JAMc 2A8VA 2K5HA 2QGQA 2VNUD 4A3MH 4JBJA 1YHAA 4YCVA 2VQFQ 1K0RA 1N36L 5M5XH 3AFPA 4DR4Q 4RG1A 5AJ3L 4YCUA 4DR6L 1WJJA 4A3EH 5C3EH 1S72A 4JG2A 4DR3L 1Q1BA 1N34L 1K73C 1HR0L 1X3GA 5BR8Q 5IYBH 4A93G 3IRBA 3AYHB 3BZKA 4B3TL 4DV2L 3MXNB 3WWVA 2EQSA 2OTLA 4JI2L 4GOPB 4DV6L 2C35B 2K14A 1OXVA 4QIWE 3F2CA 2K4KA 3AEVA 2N8NA 3S1QH 4UP9A 2GVBA 5K36G 4JI3Q 1Q12A 4XTCS 2E8GA 3GTOH 3PSIA 1CKNB 5GADC 3M85A 4HJ8A 3TEHB 1N32L 1XJVA 2KCMA 3GO5A 2Y0SE 3PIPA 1XNRL 2L15A 1FL0A 1HNXQ 2F4VL 1YJNA 3PO2H 4DPGA 1G6PA 3L2PA 1O7IA 4DR7Q 1QVFA 1Q81C 5C4XG 5JJIA 5H1SE 4OXPA 3J81i 2KHIA 4JI5Q 3HOUG 4GOPC 2OCEA 4O0AA 3CC4A 2PMZE 1EIFA 4LF6Q 1VCIA 4AQYQ 1GD7A 1XNQL 2JK8A 4YWKA 1C7YA 3DLLA 1VQPA 1J5EL 1QVGA 1EQRA 1EOVA 4OONA 4JI7Q 1QUQA 1NMFA 1VQEA 5LMNW 4QJFA 5C0XI 3I4OA 3PF4A 1JJCB 3PGZA 4QGUA 1XMOQ 2ZJQA 3GTGH 1N9WA 4UP7A 2AWOA 1FGUA 2K50A 4DUZQ 5IY0A 4A93H 4DV3L 4LFCQ 3S2HH 1E1TA 5IYDG 2Q2HA 2BA1A 1FJGQ 1BVSA 3KLWA 4L5RC 3I4NH 1OXTA 4KI0A 1C0AA 4JI4Q 2JA8G 4JBKA 1PFSA 2XTIA 4DR2L 2HHHL 4GOPA 1G291 3CD6A 1HJPA 1XMQQ 4R4QA 2ZJPA 3AQQA 1BKBA 4YHHQ 1IZ6A 1HZCA 2IHFA 2VS1A 1TWGH 4B3MQ 1MKHA 1PYSB 3JAMi 3RNUA 1IBKL 2VW9A 1IBLL 3ULPA 5FLXc 5IP9H 2LSSA 1A62A 1X55A 2PQAA 5C4XH 4DV4L 2FXQA 1GM5A 2D0PA 3HOUH 4JI8Q 5IP7G 4NXNL 1PH4A 4HJAA 4LW1A 3PCOB 1VQCA 1K9MC 4A3GG 4LFAQ 4DV5L 4A4IA 3STBD 4HIOA 1UE6A 3OW2A 4LF4Q 1G51A 4A75A 3HKZE 3A5ZB 5IWAL 2Z6KC 4DR5Q 1YIJA 1PH9A 3T1HL 2UU9L 4EX5A 4A3CG 1RIPA 4A3IG 3CMAA 2HIVA 2YTYA 4X62Q 4TVAB 4L5TA 2Y0SG 5GAGC 3DM3A 4JI1L 1KAWA 2ALYB 3CCQA 1OXUA 4LF8Q 3K81C 1VQ8A 1LUZA 2I5HA 2WB1E 2R92H 2VUMH 1YI2A 5IYDH 1SR3A 4L5SA 1L2FA 4BY7G 1PA6A 4HJ7A 2D62A 3E9IA 4C3JH 4UY8C 4ALPA 3GTQH 2JA8H 4JYAL 3E0EA 4GNXC 3UE1A 5C0XG 3HOYG 1HZBA 2E2HH 1C9OA 2IX0A 1I94L 4HIMA 4OX9L 1M90C 4XIGS 1WCMG 2UUCL 3GDEA 4OO1I 1Z9FA 3KJPA 5IE8A 4Y7NH 2Z6KA 5M3FH 2AKWB 2N78A 4GLAC 4TQUS 4DNIA 2CFMA 4DV0Q 1JE5A 4QY7A 1VQAA 2HIXA 3RZDH 5IP7H 4YY3Q 4JV5L 2VZAA 2DGYA 1A63A 4AIMA 4A3GH 1UE7A 4YWMA 2QA4A 4C3HH 3KF8B 2UUAQ 1XPUA 1VQ6A 5EAYA 3CCRA 3K0XA 4LF7Q 4BBSH 4RMFA 1IBML 1HH2P 4A3DG 1Y14B 4A3CH 1X3EA 1VQDA 2YTVA 4GNXA 4A3IH 2IY5B 4NXMQ 2I5LX 4X65Q 3HKSA 2B29A 2E5LL 1PYBA 1SROA 4GN3B 1N33Q 3ICEA 1OXSC 2F3IA 3ULLA 4X6AH 1VQ5A 4J15A 1VQBA 5GAHC 2WFWA 1L0WA 4BY7H 2R93G 1NMGA 3EIVA 5GROA 1YEZA 4DUYQ 1YHBA 3KJOA 4K0KQ 2CWPA 4BA1I 4LF5L 3OTOQ 3HOYH 4IPCA 4IPDA 3HOXG 3S14H 2VQEQ 3HOVG 1CSQA 4BA2I 4DR1Q 2UXCQ 3I4MG 4A3FG 2MO1A 1WCMH 2ZJRA 3ER0A 2JE6I 3T1YQ 1QZGA 2HT1A 4YWLA 3NENA 3L0OA 2RHQB 4A3LG 4IJHA 4PMWA 3Q8DA 2PQAB 2UXDQ 2YV5A 1WYDA 2BH8A 2R7DA 4APVA 1EUJA 3J80c 2ZM6Q 1HNWQ 1W2BA 1TWCH 1JT8A 1Q86C 2WB1G 2E2JH 1N8RC 4B3RL 1Q7YC 4OWWB 3CF5A 2ATWA 4X66L 1E7ZA 3NBHB 4IOAA 2WP8J 4AYBG 4OO1G 1OXXK 4GS3A 1GKHA 3UE0A 3CW2C 3ERSX 1QVCA 2Q2IA 1V9PA 1X65A 3S15H 3CAMA 3F2DA 3K8AA 1K3RA 3GTPH 1Q46A 3S1NH 1SLJA 4GN4B 5JEAJ 1NJIC 3CCVA 1VQGA 3A74A 1Y1WG 4HJ9A 1K8GA 3GTKH 4DV7Q 1PH3A 4QQBX 2UXBQ 4AH6A 2R93H 1HR0W 4A3KG 1PHJA 4IFDI 4LF9Q 2N3SA 3HOXH 3KF6B 4B3SL 3GTLH 3HOVH 4DR4L 4GKJQ 3ZJYC 3I4MH 1U0LA 1KL9A 4P73A 5LMNQ 4A3FH 3PO3G 3S16H 4KHPL 3F2BA 4DV1Q 4JI6Q 1KC8C 3TRZA 1VS0A 4A3LH 4P75A 5C44G 1N36Q 4JI0L 1L1OC 4DK6C 2MO0A 3K7UC 5LMUL 3BU2A 5AJ3Q 3J7ZC 2JA7G 1VQHA
chains in the Genus database with same CATH superfamily
1NBWA 1VQIA 1EZ6A 3NUCA 3VA7A 4BS9A 1IKLA 1RL2A 4JI2Q 4DV6Q 3TP6A 1TU2B 1PTOF 1W6JA 1SDFA 4X65L 1SEBD 2PNRC 3FEWX 4DAYB 3A7LA 4XXEA 3NHHA 3L3OC 1DOLA 1N32Q 3PIP3 2KJXA 1IYVA 5CYUA 3CHBD 5J39A 2F0UA 2F4VQ 5IGGA 1I4HA 3CQZH 4ZYSA 4C1NI 2E2IH 3RZOH 2PI2A 3H91A 1JORA 1CK1A 4A3KH 1XTCD 3HS0C 2RSNA 2ZXRA 1I3QH 3E9HA 4IUNA 1FNWA 2JA5G 3K0YA 1B8AA 4HAEA 1D5ZC 2YYZA 2AHOB 3DEPA 1S5DD 1CT1D 2FHTA 2IHEA 5C44H 4ZUJA 3GTJH 1KQSA 2EYJA 3F1ZA 4Y7NB 2M00A 4EQOA 3NK9A 1MBYA 1IL2A 4IFDG 4DV3Q 4LF6L 4FF4A 5DLQE 1B53A 1K8MA 1EL0A 3FP9A 1EEFD 2IJ0A 4X64Q 5IYCH 2KQ3A 1I50H 1ZYRC 4BBRH 4A3GB 5T1IA 1STGA 1IXRA 5A2QL 1NY4A 3I2ZA 5CV5A 4A3JH 2HDLA 1SYGA 4DUZL 3KOJA 4ZKBB 2AWNA 2MNAA 1FJGL 1H9MA 2Y0SB 4DN4M 5M5YH 4HSVA 1VQFA 4JI4L 3S1MH 4HN7A 2OTJA 3MC0B 4NXNQ 2R61A 3S1MB 4BY7B 4ULLA 5EBDA 4WJ4A 2F0LA 3D31A 2X6GA 3HOYB 3CC2A 1PTOH 4R9WA 4ZLTF 2UU9Q 3G7LA 2RCFA 2KCTA 1K8OA 4LUOA 1PTOB 5T1GA 1C8CA 3W1GA 2Q2TA 2VY3A 1IKMA 3CPFA 4R4CA 4ZK9B 4ILWA 4C3IG 4X3TA 3HEJA 2NB0A 4DXGA 4LFAL 4CDCC 5CMDA 4LF4L 4R4OA 2E2JB 1CQVA 4GLVB 4U673 1KHIA 2ZT9C 4A3DH 1A15A 1EIGA 1TIID 3J7AV 4X62L 3VR5A 1BBWA 4LJZC 2KENA 1Q1EA 2B2WA 2CW0C 4OX9Q 5ELOA 2NN6I 3LWEA 1JB7A 1H9RA 3M4QA 1XYIA 1DYQA 1TWFH 1H95A 1UNSA 2SDFA 1HCZA 2XIWA 2EXDA 2QCPX 4IURA 3G6JB 4HIKA 1R9TH 3AFQA 4OWTB 1OTCA 3J81j 4HIDA 3RN2A 5ELNA 3S16B 4A3FB 4IO9A 2BOSA 1Z7TA 2R7ZG 4N8FA 3EBEA 3E0JA 1GO3E 4DKAC 3WOFA 3MTSA 2VUMG 1G8ZD 1JOKA 2RA4A 4IJLA 5FO9B 4C3JG 2G9DA 1MJCA 1EQQA 1PH7A 1B70B 3R3OA 4MTKA 1VQNA 4RGOS 1CUKA 3FKIG 4AYBB 1V1QA 2GN5A 2YU9H 1VQLA 3A55A 3S24A 4IOCA 1N33L 2KEDA 1CA5A 5M3FG 4CJ1B 5C0XJ 1DOKA 2EYOA 1B7YB 1HNZL 4G7OC 1CSPA 4JCVE 3D3RA 1FD7D 5M5WB 1PRTF 1TWHH 3M9BA 4K0KL 1NTGA 1CZWA 1YITA 4DR1L 2UXCL 1K83H 2B2UC 3D6CA 2NN6G 2BA0A 2QF7A 2AMCB 4Q0FA 1RJTA 1XX8A 2BH2A 2QKIC 2ZM6L 3PO3B 1ML0D 2DJFC 3NWSA 3J81c 1GUSA 2Z4HA 2JA7H 4OWXB 4ME3A 4PMCA 2EY6A 2EYFA 4OELB 4XQNA 1E1OA 3A5UA 2JA7B 3GV6A 5A35A 2B2YC 1WD0A 4AYBE 1JC7A 1XWEA 2EIFA 3K7AB 4J6HA 1XTDA 5JPNC 1YBYA 3BVMA 1ESFA 4H0LC 4MTNA 2B2UA 4HR7B 2VL6A 3H3VH 4S3SA 4R4TA 5COYA 4DK3C 1CKMA 4ZAIA 4JI0Q 4C56C 4V0BA 5LMUQ 1B3QA 1T5EA 3M4PA 4RHSA 4A3BH 4GKJL 4MIUA 1LABA 2B2YA 3NTKA 1A8VA 3CCEA 1P8LA 4DV1L 3UDIA 2VNUD 2AUKA 1EZ8A 2OT2A 4JBJA 1LTAD 4A3MH 4YCVA 2VQFQ 1JWMD 2JA5B 5AJ3L 4YCUA 5BN4A 4A3EH 3W2DA 3NP8A 1X32A 2RDFA 1EIHA 1X3GA 1BNZA 4IFDH 3C1EA 1HFGA 2OTLA 4GOPB 2PZTA 2V4DA 1EY5A 3F2CA 1EU3A 2N8NA 4KJNA 3HZXA 4JI3Q 4XTCS 2F0QA 1CKNB 3TEHB 5IOCA 1XJVA 1HTPA 3PO2H 4DR7Q 2XWBB 4OXPA 2K1BA 2B2VA 2SOBA 3CC4A 1E2ZA 1V1OA 1EU4A 2JK8A 3NTHA 1EQRA 2BDOA 5AFWA 3I4OA 1JJCB 3PGZA 2ZJQA 2F0FA 3KUPA 1FGUA 1H9SA 1H9KA 2NVYB 3NSWA 3S2HH 4EQPA 1S5FD 4R8NA 5IYDG 1II3A 4DNTB 1DD2A 4C3IB 1STBA 3MXNA 2XTIA 2NVQB 1LT4D 3CD6A 1XMQQ 1PZKD 5C5MA 3V05A 1SYEA 4CHTB 3E3XA 1SNDA 2VS1A 1TWGH 4B3MQ 3JAMi 4H44C 1O7LA 1TKWB 3D4RA 1WTXA 1LTBD 2LSSA 3FVQA 5C4XH 5FKAC 4DV4L 2QDLA 1GM5A 2D0PA 3VYTA 3HOUH 4OIJA 4LW1A 5EGTA 4HJAA 1GJXA 1UE6A 1G51A 3A5ZB 1T5XD 5IWAL 1H9JA 1PH9A 4A3CG 1LTID 1RIPA 3CMAA 5CBAE 2HIVA 2FMCA 2GA4B 4TVAB 4L5TA 1GOZA 3QB3A 4JI1L 1KAWA 2F0PA 5F2DA 1E0BA 4K2KA 1CFMA 3K81C 1EEID 2I5HA 2WB1E 3I72A 2VUMH 2R7ZB 1PA6A 1L0XB 4C3JH 4UY8C 2K28A 4ALPA 2PCFB 2VUMB 4JYAL 2F0EA 2MPMA 4C3JB 2E2HH 1OO9B 3CRLC 4HMJA 3TDQA 1I94L 3FKIB 1PMRA 2UUCL 3GDEA 2E2HB 5IE8A 5M3FH 2F0HA 5CORA 5FOBB 1TS4A 1WD1A 4DNIA 5M3FB 4DV0Q 1TVXA 1NR4A 1VQAA 2HIXA 3RZDH 4OL7A 4AIMA 1CI3M 4YWMA 4C3HH 4IQZA 3NXWA 5KGUA 4LF7Q 3MXPA 1QILA 1IBML 1HH2P 3FRPB 3VA5A 3KLRA 2YTVA 2NTSA 1BUVT 2I5LX 2X6LA 3HKSA 4JPBW 3SVMA 2FMMA 2E5LL 1PYBA 4GN3B 3Q22A 3ICEA 4XQJA 5M5XB 2K01A 3OMCA 1AP0A 4JK1C 1D6EC 3ZYYX 1L0WA 5KYLA 1I4RA 3SK5A 2F3VA 1YEZA 2KOLA 3NWTA 5IGBA 1AW7A 3TZUA 3HOVG 1CSQA 1SJED 1WTWA 3I4MG 1UEAB 1WCMH 3ER0A 2HT1A 2RHQB 4PMWA 3Q8DA 2PQAB 2UXDQ 1EFID 3E5SA 4MN3A 1HNWQ 1AN8A 4B3RL 2ATWA 4FF3A 3EFXD 3OHXC 5CV6A 1EYAA 2JSOA 1ET9A 3ERSX 4IALA 2QEJC 1U4PA 2Q2IA 1TY0A 2O5IC 2K5QA 1X65A 4KN7C 3S15H 5J1ZA 3F2DA 3K8AA 4F87A 5CV4A 1VDZA 1Q46A 4NDXA 1NUCA 2L12A 4GN4B 5JEAJ 2D2CC 3BS1A 1VQGA 1G91A 4FNFA 2UXBQ 4RHRA 2R93H 4AH6A 3IFTA 4A3KG 2L4NA 2WKDA 3BYTB 5ELCA 4LF9Q 4B3SL 3OMGA 2WV6D 1U0LA 3F2BA 1KC8C 1EY4A 5C44G 4NW2A 2MO0A 1I6VC 4XT1B 4FF1A 4DR6Q 3NEMA 5GAEC 2IX1A 4Z9CB 4B3TQ 4LFBL 2A6HD 1J6QA 5E4WC 5IYCG 3CCUA 4RCNA 1XPOA 4GNXB 4BBRG 2SEBD 3OIQA 3D0FA 3DWQA 3NBHA 5EJWA 4NP5A 5FO7B 4A3JG 2OWOA 2K5NA 1QNUA 1PH8A 2F52A 3Q6SA 1LTSD 1ENAA 5BR8L 5J3BA 5ELDA 1TXYA 4P71A 1Q82C 1P16A 3J80i 4B9WA 5E3FA 2UUBQ 2ZTEA 3FPUB 2KHSA 2L5TA 1PFBA 2PQEA 4OEMB 3H94A 1ASZA 1XNQQ 2H4OA 4FXGC 1JOQA 1JB3A 1J5EQ 3KF6A 4KY6A 1KAAA 1X54A 3BDOA 1F9QA 1QWYA 4JI5L 3TSSA 1WVLA 3VR3A 2K5WA 3KDFB 1S3OA 3LGJA 3V96A 4AQYL 3KLSA 2EY1A 4G7HC 1YHQA 5E4XA 2IW3A 4JI7L 4MNOA 1Q3LA 2H5XA 4C2MH 4L5QA 1ENFA 4LFCL 4DXFA 1D2BA 4P2CB 1SMXA 4UHVA 4IPGA 3WOEA 1T9HA 1KXLA 2PO4A 4PZ6A 1Y1VH 1B9NA 4FDBA 2JEBI 1KNAA 2LKVA 5NUCA 4JI6L 2JA6H 2EY2A 3HOWH 3QG1A 3ONAB 1JICA 1K3BC 1PH6A 4CKEA 4WJ3M 1HA6A 5CR3A 4ME5A 3PMFA 4GLXA 3K5OA 3T51B 3H3VI 3RR5A 1IL8A 1EYDA 2YTXA 2A69D 2L11A 4DR5L 3U50C 3Q0AA 2MQHA 3DWPA 1LTLA 4JC0A 4POFA 3UI2A 5CV9A 3CP0A 4KKTA 4LF8L 1L1OB 1KLGD 2ZTCA 1Y69U 2ES2A 2ASBA 4KMUC 3KK7A 4O1NA 1GVPA 4YCWA 3GTPB 3NPPA 5I2YA 3T53B 1JJGA 3GTKB 2Z6BA 5FLMH 3PUYA 1SYDA 1HXYD 2HQEA 1A3VA 2Z9HA 3HOVB 1VQ9A 3T16A 3I4MB 2EVBA 4P72A 3EVQA 3K57A 2KHJA 2F0KA 2A19A 4JOIC 4YY3L 2R92G 4X64L 1B3AA 2Q8RE 3I70A 1N34Q 1CA6A 1E3PA 1KABA 1K8AC 2OQ0A 2WAQG 1HZ9A 3EJIA 3I56A 5JPMC 4K5XA 1CKNA 3N6RA 1X56A 1PH1A 5D3DA 3A54A 3NELA 3M7GA 1RHPA 1GUNA 4K14A 1HUMA 4OIKA 1M4VA 4DUYL 4H7BA 1UEBA 4JOIA 3CCMA 3CQZB 3H15A 4A3BG 3MEHA 2E2IB 2LXJA 2I07B 4X66Q 4BBSG 3RZOB 3J81L 3RLNA 2CQOA 3ITPA 4A3KB 3EQLC 3T1YL 4A3MG 1QOHA 1SFOH 1I3QB 1QE6A 1AH9A 1A2UA 3OIPA 1LT6D 4A3EG 3RLFA 1STNA 2A6HC 4KY5A 3VR6A 2IL8A 1S5BD 5C44B 1BCPB 2I5MX 3GTJB 2R7FA 1S40A 4RA8A 2IT1A 3J7A5 3S1RH 2RKSA 3DWAA 4UPAA 3MVVA 3R8BA 3VDYA 1X6OA 3M3YH 1AFPA 3HFZB 1I50B 4BBRB 5JOBA 4K8JA 2BE5D 2XNAC 3GV3A 1SNCA 3PF5A 2NVTH 4A3JB 1EY6A 2NBFA 3K5MA 3PO2G 4LK1C 4F88A 2C9OA 4DV7L 3FHWA 1TWAH 1S5CD 5I4DA 5C4JH 4HJ5A 4FXDA 5M5YB 4BY1H 5G3LD 1F9SA 1TWAB 3OSOA 2A74C 1ET6A 5FLXE 4DAMA 4EVOA 5IIFA 1RD9D 3G4SA 5IT9c 5LMNL 3JAMc 2QGQA 5JVG3 2WIIB 3RD4A 5J22A 4HEDA 4RG1A 4JG2A 1Z6HA 3FMCA 4DR3L 1Q1BA 3CKIB 1K73C 4E6IA 1HR0L 3D4WA 5DM63 4DV2L 1LV9A 2NUCA 3WWVA 1JR0D 2CHBD 4KK7A 2C35B 2K4KA 2PZUA 3AEVA 3S1QH 3J81E 2GVBA 4JVZA 1Q12A 5K5PA 1SAPA 3PSIA 4OGQC 3R2TA 5GADC 5CC4A 3M85A 5JVH3 1D5XC 4A3DB 4PQXA 1MI2A 3GO5A 2Y0SE 4G4KA 1XNRL 2L15A 1FL0A 3F2UA 3OW7A 4QUCA 1G6PA 3L2PA 1O7IA 5DAUA 3OWEB 1Q81C 1QVFA 2K7VA 5C4XG 1TY2A 3HOUG 1SE2A 3X3NA 2OCEA 4O0AA 1TWFB 1HTLD 1EIFA 4LF6Q 1ESRA 3U9OA 1ONLA 1CZGA 1EOVA 4OONA 1QUQA 3QJYA 3TP8A 1VQEA 5LMNW 1R9TB 4QJFA 2QILA 4QGUA 1N9WA 2AWOA 3K58A 2K50A 4DUZQ 3M4YA 2A69C 4A93H 1RTOA 1FJGQ 1BVSA 1O78A 2DY7A 4JI4Q 4G7ZC 2A73B 4KV6A 4JBKA 4DR2L 2ICIA 1HA5A 3DMUA 2HHHL 2LMCB 1V1PB 2A6ED 3BDLA 3NE5B 1HJPA 1TQOA 3C1FA 2FFKB 2MJ8A 1IZ6A 1A6XA 1TS5A 1LTRD 3RNUA 1S4ZA 2Z8LA 2YU9B 2RBMA 1IBKL 2VW9A 1IBLL 1IW7D 3AB9A 3T56B 5FLXc 1A62A 5C4HA 2PQAA 1SNOA 5KEEA 1PH4A 3PCOB 4LFAQ 4C3HG 4DV5L 1EY0A 3STBD 4X3SA 4LF4Q 3OW2A 1TWHB 2Z6KC 1D1IA 3T1HL 1DOMA 3MFYA 1K83B 1VF5C 4X62Q 3CCQA 1EQTA 1SBBB 1VQ8A 2R92H 1HRJA 4HJ7A 1BXTA 3E9IA 2JA8H 2K32A 1KDBA 1BCPD 4GNXC 4J8QA 2EDGA 2WAQB 1HZBA 1JWUD 4GZYC 1VMPA 1PZJD 1F2ZA 1WCMG 2Z6KA 1U9RA 2KUMA 5EPJA 2CFMA 4K2LA 5IP7H 3P20A 2L55A 3KBXA 4JV5L 4PV1C 1A63A 2QA4A 2Q8TA 2WACA 3KF8B 2BDNA 2EJGC 4BBSH 3K0XA 1F9RA 4HSPA 3ND9A 4A3BB 1EYCA 4ZCKA 4BBSB 4GNXA 4A3IH 4A3MB 5KNBA 1N33Q 1HQRD 1AEXA 4KD3A 3ULLA 4X6AH 1KDCA 1VQ5A 1IHZA 4A3EB 4B9XA 2R93G 1NMGA 1PTOD 3W3AA 2BE5C 4K0KQ 4LF5L 5C0XH 4IPCA 3S14H 2TSSA 2DJGC 4DR1Q 2UXCQ 1DZ1A 2MO1A 1PRTB 4YWLA 3QWNA 4J1MA 2E75C 3J80c 2ZM6Q 4APVA 1SYBA 1W2BA 1TWCH 1Q86C 1BR9A 3PO2B 1WTVA 3CF5A 1E7ZA 2WP8J 5ELFA 4I7ZC 1YNJD 4CDDC 3CRKC 1RCVD 1OXXK 4GS3A 3K5NA 4JW0A 1ZEQX 1QVCA 3MXUA 2MHVA 1WTOA 4G57A 4NMZA 3S1NH 2PW5A 2HUGA 1KTKA 2RDGA 1PH3A 3LX0A 2R3ZA 4QQBX 3VYSA 3S2HB 1B2TA 1EY8A 2FINB 2B2TC 3VYRA 2QW7A 3I4LA 4GKJQ 3HOXH 1HFNA 1LO5D 3X3MA 4QUFA 4KHPL 1PZID 5EPLA 4DV1Q 1A3UA 4KTAA 4XDXA 5EKLA 1L1OC 4DK6C 3K7UC 1TWGB 3BU2A 5AJ3Q 3J7ZC 1VQHA 4HMIA 5C5LA 3TS2A 3VYUA 3M4OH 3VR2A 2HCIA 3C46A 1YJWA 3S17H 3HOZG 2AQ3B 5C4XB 1GUWA 3BVGA 3HOUB 3CU7A 2K05A 1SXTA 2B2TA 2NZHA 5JEAG 4DR4L 3R93A 4L8JA 2PI2E 2NVXH 2J7ZA 3QR8A 4K5WA 2CVRA 2OQKA 2A6EC 1L1OA 1EWCA 2F3WA 1EWIA 1Y1WH 1GUOA 1KDAA 2A68D 4O2DA 1D7QA 1Y1VG 2HDMA 1YJ9A 1IW7C 2JA6G 1PH2A 2F0OA 2XRQD 3HOWG 2JYOA 1LACA 1HNXL 2IPKD 1Q8KA 1ILQA 2K5VA 2VB2X 3STBC 1VQMA 5FK9C 5IYBG 2EOTA 1K0SA 3AMUA 2K75A 2CQAA 5D3IB 2EYHA 2Z0SA 3TQYA 3RZDB 3MXGA 1MHWC 4X3KA 2F0WA 4C3HB 3J7YW 3V2TA 1VQ7A 1XMOL 4FO2A 1WTQA 1F2YA 1KRTA 4Y52H 1UE5A 1EQVA 4YIJA 4DAYA 1PV4A 1BCPC 1U5KA 4CDEC 4DV4Q 4PG3A 1NE3A 1A3TA 3CXCA 5FLMG 4R1JA 4YHHL 4DAVA 2N55A 5HURA 3C2PA 1BBUA 3N52A 3CCSA 1MD2D 5IWAQ 2D9UA 1WCMB 4QB4A 4GKKQ 2EJFC 3GD7A 2RDHA 4JI1Q 1PRTD 4JI8L 5C3WA 4LNQA 4TSSA 5M3MH 3GTMH 2XWJB 2AQ1B 1JMCA 3I4NG 4JBMA 5CGKA 1SNPA 3A8KE 3BJUA 4O42A 5D65A 4JYAQ 3LNNA 2DUDA 3ULJA 1B44D 2N49A 1MSGA 1I94Q 1PFMA 4LAAA 2UUCQ 2MP1A 1PTOC 1SN8A 4BXXH 1VMCA 4IN3A 3S15B 1DCZA 2NTTA 2HCCA 4HTHA 2UUBL 1I4PA 3KFUA 1GHJA 3PUWA 1FVIA 2CWAA 2R93B 2CCZA 2EYLA 1PXUA 2F0NA 3HG9A 5C4ZA 2EPBA 3L9AX 1KIXA 1IBMQ 3PUZA 2OXPA 3W5OA 4EQ5A 1MJEA 1VQOA 1IYJB 3S2DH 3CMEA 2E5LQ 1YNJC 1BF4A 3S2DB 3W1BA 4F7XA 1EWHA 2UUAL 5LL6S 1D8LA 3MA2B 1LTGD 3B6YA 4C1NK 4DA2A 4NXML 4RAUC 5KYIA 3KBGA 4PZ7A 1B4OA 1DJRD 4IPHA 4BWGB 1L0YB 1A2TA 3BYYB 4R4IA 3MEFA 3KYHC 4PNYA 2A5HA 4B3RQ 3NQIA 4BY1G 3OTOL 2PPBC 2RHSB 4LMQD 1JWSD 2VQEL 1Q90A 2I0QA 2KA7A 4PMBA 1HZAA 3FPPA 3SK6A 1DONA 2QEXA 5M9OA 3A7AB 3PV0A 3QO2A 5I9OA 3UDXA 4IZ8A 1KLUD 2Z1CA 1KD1C 1UWVA 1ILPA 3HOZH 2JJQA 4K6LA 4KKUA 5HGQA 2RCNA 3H0GH 4IUQA 2KCNA 3HOZB 1O80A 2B63H 3U4ZA 2KBNA 1EIYB 4DFAA 4B3SQ 5JEAH 2K52A 4F8MA 5HGTA 1GXDC 1I4XA 2AUJD 4RFBA 5JJZA 4P74A 2XN9C 4TRDA 5HY6A 3M7NA 2A68C 1A0IA 4C2MB 2DY8A 4RWSC 1YVCA 4KHZA 1LT3D 3JAML 2E74C 3AU7A 5I6WA 4DK1A 5CV8A 2EYPA 4LFBQ 3K80C 1BOSA 2K5HA 1Y1VB 3R2IA 1K0RA 1H9SB 1N36L 1NR2A 2EY5A 3AFPA 2JA6B 3HOWB 5ISRA 1S72A 5C3EH 3LWUA 3SR1A 4A93G 1N34L 5IYBH 5BR8Q 3IRBA 3AYHB 3BZKA 3MXNB 1STEA 4JI2L 4DV6L 2K14A 1F77A 2F0TA 4UP9A 1F2MA 4CKBA 2B8GA 5K36G 2E8GA 2L0CA 3GTOH 1XXGA 3I3CA 4HJ8A 4L63B 1N32L 4KN4C 3GTOB 1BQQT 3PIPA 4RGMA 2F4VL 1YJNA 1U4RA 5JJIA 1G6ZA 2M9VA 4JI5Q 2JP1A 4M1UB 4GOPC 2F0SA 1VCIA 4AQYQ 4KHVA 4YWKA 1C7YA 2JA7G 3MWYW 1PRTC 4JI7Q 1NMFA 2K03A 5C0XI 2JN4A 2QDBA 3GTGH 3IFDA 5LHY1 4UP7A 5C3XA 5IY0A 4DV3L 4LFCQ 5IT9E 3JAME 4WORA 4EGVA 4FF2A 3J7AF 1PYWD 1R4QB 2NWGA 3SE0A 4L5RC 3I4NH 2F0GA 1OXTA 4KI0A 5KNCA 1QG7A 2JA8G 1PFSA 1CM9A 4GOPA 1G291 5FLXL 2C5CA 3K6OA 2Q8IB 1STAA 2ZJPA 1QCBD 2E76C 4FYDA 1HZCA 2IHFA 2IX3A 3A56A 1PYSB 1X3PA 1Y8NB 3ULPA 3HRZC 2FXQA 5IP7G 4NXNL 1K9MC 4A4IA 3FDTA 3K5LA 4HIOA 4ZKCB 4A75A 4DR5Q 2UU9L 4EX5A 4A3IG 2Z4IA 2YTYA 4EQNA 5GAGC 3DM3A 2ALYB 1SFOB 1OXUA 1WTHA 2KEEA 4LF8Q 1F2LA 1LUZA 1YI2A 1SR3A 4L5SA 3QOJA 1L2FA 1S5ED 3QIAA 2D62A 1Y8OB 3E0EA 3S1RB 4WRDA 3UE1A 5C0XG 3IKJA 4V190 1C9OA 1TS3A 1J8IA 4IUTA 4OX9L 1M90C 4XIGS 3KJPA 4Y7NH 3M3YB 2AKWB 3D4DA 4RGTA 4GLAC 4TQUS 5BN5A 1JE5A 4QY7A 3GQBA 2NVTB 4YY3Q 2VZAA 5IGFA 4KKSA 1WTPA 1FYCA 4A3GH 1UE7A 4IUUA 1Y8PB 5C4JB 4BY1B 4RMFA 1STYA 2PZWA 4CGYB 4KD4A 2IY5B 4X65Q 4UDUC 3Q24A 4QMGA 1ICFB 1SROA 4WJWA 2K6AA 3RUZA 1VQBA 3BVZA 5GAHC 2WFWA 4BY7H 3EIVA 5GROA 2ICEC 4DUYQ 2CWPA 3J80L 3HOYH 2B2WC 3HOXG 3WDNA 1NNXA 3S1QB 2DNEA 1R4PB 3T1YQ 1O7YA 2JE6I 1QZGA 3H6MA 3L0OA 4IJHA 2YV5A 1EUJA 1D5MC 2JXMB 1JT8A 2WB1G 2E2JH 5EKKA 5IODA 3DXJC 4OWWB 4CDFC 4XYOA 3NBHB 4IOAA 4U68A 4CBVA 3CW2C 3SK8A 3BG3A 4KJOA 1U4MA 5TSSA 3CAMA 1K3RA 1UUPA 4UAIA 1RDPD 2O2LD 1NJIC 1IYUA 1Y1WG 1K8GA 4A93B 4DV7Q 2WINB 1HR0W 2VB3X 1RKNA 1PHJA 2SNSA 5K36H 3GTLH 2N3SA 3KLSX 3KF6B 3ZJYC 5A2QE 5LMNQ 3S16H 4A3FH 1RODA 3GTLB 2CH4W 3TP5A 1RF2D 4A3LH 1EY7A 4RGNA 4JI0L 3O13A 5LMUL 1B9MA 4QF4A 3P1HA 5GQOA 4DR3Q 2G9HD 1KNEA 4H02A 1HR0Q 1E2WA 2GVAA 4DV2Q 3I55A 2PYKA 5JJLA 4K8IA 2JA9A 1SRUA 3J80E 4OO1H 1X3FA 4NKLA 4ABNA 2VQFL 4IFDJ 1G2SA 1SE8A 1DGSA 2A1AA 3F8TA 2D0OA 1CHPD 3BZCA 5M5WH 1EFWA 1MIUA 5LL6X 1YNXA 1XNRQ 1M8AA 1ENCA 3I7FA 1SMYD 5FJ8G 1ZXTA 5JJKA 1EOTA 1QZHA 2KECA 2R92B 2JQOA 4JI3L 1Z47A 1ASYA 1KRSA 2ZTDA 1SE4A 2JA8B 4GN5A 4BA2I 1V43A 3PO3H 1DXMA 2XSCA 1QJOA 4RKBA 1I4QA 2G5DA 3PUXA 3G6EA 1HUNA 3RMHA 4DR7L 2XGTA 4RH6A 4H13C 1GUTA 5M3MG 1EYGA 3K7AH 1VQKA 1PH5A 1K28A 2ID0A 5FO8B 5I6YA 4POGA 3T13A 4DR2Q 2HHHQ 2F0MA 4ODGA 1AE2A 3TREA 5KRUA 3D8GA 2EE1A 4A3IB 4BXXG 5IGEA 4WFN3 1IBKQ 1IBLQ 3ND8A 1PVOA 1HNZQ 1SYCA 2WAQE 4LWCA 1XMQL 1SSOA 4DV5Q 3HKZG 2PNHA 2V1CC 2XRSD 5CV7A 2LY7A 3K59A 1I6HH 2JA5H 4B3ML 3CCLA 3S14B 4FVMA 3JC66 4CJ0B 2F1MA 3T1HQ 5ELEA 3TP7A 3QOLA 4PZ8A 1I6HB 3HGBA 4XT3B 2RVLA 2B2VC 3U4VA 2B3GA 1E22A 2L9HA 2Q2UA 2NZOA 1TWCB 4M8AA 2IWHA 1JE4A 3L7ZC 3UDFA 1CKOA 1ICWA 3KDFA 1LM0A 1LT5D 3I90A 4NPSA 3RLOA 2B39A 4KLKA 2H1EA 2HQLA 4X3UA 2OEOA 3OWFA 4DU9A 2ENBA 2EJMA 5IP9G 2RF4A 1YNND 1WOCA 2CKZB 3S1NB 3MFGA 4JV5Q 1HQMC 1VQJA 1MGSA 3U58A 3OYYA 4RKLA 3BDCA 3SDZA 3HOXB 1FNVA 2NVYH 1BDOA 1FGBD 4DV0L 2F0IA 2NYZD 3OPOA 1WTRA 4C3IH 4MZ9A 5I2XA 3RN5A 4IUPA 3EN2A 2NVQH 5E7NA 1YZ6A 2WB1B 5EQ0A 3TZDA 4LF7L 3M4OB 3H0GG 1M1KC 3S17B 3UDGA 2J4XA 1W3SA 1JQYD 2LFNA 4ZQ3A 2B63G 3SHLA 4XQQA 1I5FA 1E2VA 4LF5Q 3TS0A 1WI5A 3CC7A 3SGIA 1UAPA 4N9PA 2MUYA 1XPRA 2DN8A 1E24A 1F9PA 2SNMA 2NVXB 2F0VA 4DF7A 2PW7A 4LUZA 1G2TA 2LXKA 1Y1WB 1GHKA 4GKKL 2UXDL 2MGSA 3TBIB 1X9NA 3A8IE 3NTIA 1JJ2A 5C3EG 1HNWL 2R7ZH 4JBWA 2JEAI 3PIOA 4ID6A 1C4QA 3G71A 4K5VA 2R6GA 3G48A 1W6KA 1AE3A 3MHBA 2LS01 2F4IA 3FKIH 4A76A 2K33A 3CPWA 2HD3A 2F0DA 4QIWB 3OOCA 1SMYC 1VQ4A 3DHQA 2N88A 4K6DA 4NB3A 3SXHA 5DM73 4KHPQ 3A0JA 2MFIA 4N9TA 4DNRB 5FJ8H 4LUVA 1QNKA 4I65A 2UXBL 3MZ5A 3GP7A 1BBXC 3CCJA 4CKCA 4QL5A 4QCLA 4LF9L 1UE1A 2D5DA 1LYLA 3I91A 1QUQB 1WFQA 4UP8A 4DK0A 1I4GA 2K04A 1SNQA 2PMZB 3PUVA 2A8VA 1CHQD 2NN6H 1YHAA 3NBIA 2XVSA 5M5XH 1GUGA 4DR4Q 1PFNA 4DR6L 1WJJA 2I46A 1NCVA 1PDQA 4FXKC 1C48A 3EROA 5E1FA 5DEHA 4B3TL 5EPKA 2EQSA 2EYMA 1OXVA 4QIWE 5M3MB 3GTMB 4HCEA 4I7AA 4TKOB 2VXWA 2KCMA 3SK4A 4CJ2C 1HNXQ 1LTTD 5KIXA 1ZKOA 1HHVA 4DPGA 3PIO3 4DAPA 5H1SE 3J81i 2KHIA 4IUVA 1TT2A 2PMZE 3IAYA 1GD7A 1XNQL 4HCSA 3DLLA 1VQPA 5KNDA 1J5EL 1LLRD 3I8ZA 3TN2A 3A8JE 2WKCA 4RCOA 5L37A 1QVGA 3C3LA 3HKZB 5IGCA 3ERQA 3PF4A 1CQFA 1XMOQ 5ELBA 2ZXPA 3SEBA 4R8IA 1DM0B 1E1TA 2Q2HA 2BA1A 2B8FA 3EA6A 3KLWA 5DNFA 1C0AA 1SNMA 2TMPA 5G3LF 1D1KA 4R4QA 3AQQA 1BKBA 4YHHQ 1X3QA 1YNNC 1MKHA 2ZXOA 3S9WA 1VF7A 5IP9H 1CTMA 1X55A 4JI8Q 5I9PA 1VQCA 4A3GG 1B50A 2DNCA 2RQXA 5IGDA 1SYFA 2RSOA 3HKZE 4DGZA 1O7ZA 1YIJA 4B08A 1EY9A 1SJHD 1ZYRD 2Y0SG 2CH4A 3E6ZX 2KCCA 5EBCA 4KY7A 1MSHA 4ZRZA 5IYDH 1J9OA 4BY7G 3GTQH 3HP3A 3NQTA 1FR3A 1JOOA 2O4XA 3HOYG 3GTQB 3H0GB 2IX0A 4HIMA 1NSNS 3P7JA 1V1PA 4OO1I 1Z9FA 2B63B 1TS2A 2N78A 3U9SA 4XYQA 1NAPA 5IT9L 1PLFA 2DGYA 2UUAQ 1VQ6A 1XPUA 5EAYA 3T4AC 3CCRA 3Q23A 2K5DA 2E2DC 1AZPA 4A3DG 1Y14B 4A3CH 2O5JC 1X3EA 1VQDA 4NXMQ 4MHEA 2B29A 4FP5D 1OXSC 2F3IA 1STHA 2NZ1D 3H3VC 3TMEA 5C3EB 2CW0D 5EKIA 4J15A 3MAQA 1YHBA 3KJOA 4BA1I 5JAVA 3OTOQ 4IPDA 1BO0A 3PQIA 2VQEQ 1SE3A 5BN3A 2L1BA 4A3FG 2EXZA 2ZJRA 2OF1A 2KVMA 3NENA 4A3LG 2X69A 2EZVA 1WYDA 2BH8A 2R7DA 4ZUIA 1N8RC 1Q7YC 2BCOA 3H09A 4X66L 1RTNA 4L6TB 5C6AA 4AYBG 3URYA 4OO1G 3D6WA 2J0TD 1GKHA 3KF8A 5D14A 3UE0A 2M2LA 1BCPF 3DUZA 1TR5A 2P5ZX 1V9PA 1QB5D 2F0JA 3IL8A 3GTPH 3GTGB 4Q5VA 1SLJA 1Q8IA 3DM1A 3CCVA 3A74A 4HJ9A 3GTKH 1U4LA 4N8X1 4IFDI 3I4NB 3I73A 4OHJA 3HOVH 3I4MH 4P73A 1KL9A 1AZQA 3PO3G 1HPCA 2AQ2B 4JI6Q 1FNUA 2FJ2A 3TRZA 1VS0A 3DEOA 4P75A 5CBEE 1N36Q 1JCKB 3VR4A 3BZDB 1B1ZA 3P75A 1V8QA 2F03A
chains in the Genus database with same CATH topology
3NEMA 5GAEC 1NBWA 3TS2A 5GQOA 4DR3Q 1VQIA 3M4OH 1HR0Q 4H02A 2IX1A 1YJWA 3S17H 2GVAA 4B3TQ 4DV2Q 3I55A 1RL2A 3HOZG 4LFBL 5JJLA 4JI2Q 2JA9A 1J6QA 5IYCG 4DV6Q 1SRUA 3CCUA 1XPOA 4GNXB 4BBRG 3D0FA 1X3FA 4IFDJ 2VQFL 2NZHA 4X65L 1SE8A 1DGSA 2A1AA 5JEAG 3F8TA 4A3JG 2D0OA 2K5NA 1PH8A 2OWOA 4DAYB 2F52A 4K0KL 2PI2E 2NVXH 1N32Q 3BZCA 5M5WH 1EFWA 1MIUA 1YNXA 5BR8L 1XNRQ 5J3BA 3I7FA 5FJ8G 2F4VQ 1TXYA 2OQKA 4P71A 1Q82C 1L1OA 1P16A 3CQZH 3J80i 1EWIA 1Y1WH 5JJKA 2E2IH 1QZHA 3RZOH 2PI2A 2UUBQ 2ZTEA 2JQOA 4O2DA 4A3KH 1D7QA 4JI3L 1Z47A 1ASYA 1KRSA 1Y1VG 2ZTDA 1YJ9A 1I3QH 3E9HA 4GN5A 1ASZA 1XNQQ 1PH2A 2JA6G 1V43A 2JA5G 3HOWG 3PO3H 1B8AA 2YYZA 1J5EQ 3KF6A 1HNXL 2AHOB 1X54A 1Q8KA 2K5VA 2IHEA 3PUXA 5C44H 3GTJH 3G6EA 1KQSA 4DR7L 3F1ZA 2XGTA 4JI5L 3STBC 1VQMA 5IYBG 1IL2A 3KDFB 2K75A 5M3MG 4DV3Q 4IFDG 1S3OA 3LGJA 4LF6L 5DLQE 2Z0SA 1EYGA 3K7AH 3TQYA 3FP9A 4X64Q 4AQYL 1VQKA 1PH5A 5IYCH 2ID0A 4POGA 1I50H 4BBRH 1YHQA 4DR2Q 2HHHQ 4JI7L 1IXRA 4MNOA 1NY4A 2H5XA 1AE2A 3I2ZA 3TREA 4A3JH 1XMOL 1VQ7A 4C2MH 4L5QA 1KRTA 4DUZL 4Y52H 1UE5A 3KOJA 4LFCL 2AWNA 4BXXG 2MNAA 1PV4A 1FJGL 1IBKQ 1IBLQ 1PVOA 5M5YH 1HNZQ 1U5KA 1SMXA 1VQFA 4IPGA 4DV4Q 4JI4L 3S1MH 1T9HA 2WAQE 1KXLA 2OTJA 4PG3A 1NE3A 4NXNQ 4LWCA 4PZ6A 1Y1VH 1XMQL 3CXCA 5FLMG 4DV5Q 4FDBA 2JEBI 4WJ4A 3HKZG 2PNHA 2V1CC 4R1JA 4YHHL 3D31A 4JI6L 2JA6H 3HOWH 1I6HH 1BBUA 2JA5H 3CCSA 4B3ML 3CCLA 5IWAQ 3JC66 3CC2A 3T1HQ 1PH6A 2UU9Q 4PZ8A 2KCTA 4WJ3M 4GKKQ 3GD7A 4LUOA 4GLXA 4JI1Q 3W1GA 2Q2TA 3U4VA 2VY3A 4JI8L 4LNQA 3CPFA 4R4CA 2B3GA 3H3VI 5M3MH 1E22A 3RR5A 2Q2UA 3GTMH 2NZOA 4LFAL 1JMCA 3I4NG 4JBMA 4R4OA 4LF4L 3L7ZC 3UDFA 1CKOA 3KDFA 2YTXA 4GLVB 1KHIA 4DR5L 3BJUA 3U50C 4A3DH 4JYAQ 2DUDA 3ULJA 1LM0A 2MQHA 2N49A 4X62L 3RLOA 1BBWA 4NPSA 2KENA 1Q1EA 4KLKA 1I94Q 4OX9Q 1LTLA 4JC0A 2HQLA 4POFA 5ELOA 2UUCQ 3CP0A 2NN6I 1JB7A 1L1OB 2ZTCA 4LF8L 1SN8A 4BXXH 3M4QA 2ES2A 5IP9G 2ASBA 2RF4A 1TWFH 1WOCA 2UUBL 1GVPA 4YCWA 2CKZB 1H95A 3KFUA 4JV5Q 3PUWA 1FVIA 2CWAA 1VQJA 1JJGA 2EXDA 2CCZA 5FLMH 3PUYA 3U58A 3OYYA 4HIKA 1R9TH 3AFQA 4OWTB 1OTCA 1KIXA 1IBMQ 3PUZA 3W5OA 4EQ5A 3J81j 4HIDA 3RN2A 1MJEA 1VQ9A 2NVYH 5ELNA 1IYJB 1VQOA 4P72A 4IO9A 3S2DH 4DV0L 2KHJA 2R7ZG 3CMEA 2E5LQ 3EBEA 1GO3E 2A19A 4JOIC 4DKAC 4YY3L 3W1BA 2R92G 2VUMG 4C3IH 4IJLA 4MZ9A 4X64L 3RN5A 1N34Q 2UUAL 3EN2A 1E3PA 5E7NA 2NVQH 1K8AC 2OQ0A 1D8LA 1MJCA 1YZ6A 2WAQG 1EQQA 1PH7A 4LF7L 3H0GG 1B70B 1VQNA 1M1KC 3B6YA 3UDGA 1CUKA 3FKIG 1HZ9A 1W3SA 2B63G 3I56A 4LF5Q 1I5FA 4NXML 1V1QA 2GN5A 3TS0A 2YU9H 1WI5A 1VQLA 3S24A 3CC7A 4IOCA 3SGIA 1N33L 1CKNA 4PZ7A 5M3FG 1XPRA 1X56A 5C0XJ 1B7YB 1PH1A 1E24A 1HNZL 1CSPA 3NELA 4IPHA 4JCVE 4R4IA 3MEFA 3KYHC 4DUYL 1TWHH 4JOIA 1UEBA 3M9BA 3CCMA 4B3RQ 1NTGA 4LUZA 4BY1G 3OTOL 3H15A 4A3BG 2LXKA 2RHSB 2LXJA 4X66Q 2VQEL 1YITA 4DR1L 2I0QA 4BBSG 3RLNA 4DR6Q 2UXCL 2CQOA 1K83H 1HZAA 3T1YL 2NN6G 2BA0A 2AMCB 4A3MG 2QEXA 1SFOH 4GKKL 3PV0A 2BH2A 2UXDL 2ZM6L 1AH9A 3UDXA 1X9NA 1JJ2A 1HNWL 4A3EG 3RLFA 5C3EG 3J81c 2R7ZH 4JBWA 2JEAI 2JA7H 4OWXB 3PIOA 4ME3A 2I5MX 3G71A 2R7FA 1KD1C 1UWVA 1S40A 1E1OA 3A5UA 2IT1A 3J7A5 3S1RH 3HOZH 2JJQA 2R6GA 5HGQA 3G48A 4UPAA 2RCNA 3H0GH 4AYBE 3VDYA 2EIFA 1AE3A 4A76A 3FKIH 3CPWA 1X6OA 2B63H 1XTDA 3U4ZA 2KBNA 3M3YH 1YBYA 1EIYB 4B3SQ 3HFZB 1VQ4A 2K52A 4MTNA 4NB3A 2VL6A 4P74A 3H3VH 3M7NA 5HY6A 3PF5A 4KHPQ 2NVTH 3A0JA 1A0IA 4R4TA 2MFIA 3PO2G 4DK3C 1CKMA 1YVCA 4LUVA 5FJ8H 4JI0Q 4KHZA 5LMUQ 2UXBL 4DV7L 3FHWA 3M4PA 3CCJA 1TWAH 5C4JH 4HJ5A 4QL5A 4BY1H 4A3BH 4LF9L 4GKJL 1UE1A 4LFBQ 1LYLA 1QUQB 1WFQA 3K80C 4UP8A 1A8VA 4DAMA 3G4SA 3CCEA 5LMNL 3PUVA 1P8LA 5IT9c 3UDIA 4DV1L 3JAMc 2A8VA 2K5HA 2QGQA 2VNUD 4A3MH 4JBJA 1YHAA 4YCVA 2VQFQ 1K0RA 1N36L 5M5XH 3AFPA 4DR4Q 4RG1A 5AJ3L 4YCUA 4DR6L 1WJJA 4A3EH 5C3EH 1S72A 4JG2A 4DR3L 1Q1BA 1N34L 1K73C 1HR0L 1X3GA 5BR8Q 5IYBH 4A93G 3IRBA 3AYHB 3BZKA 4B3TL 4DV2L 3MXNB 3WWVA 2EQSA 2OTLA 4JI2L 4GOPB 4DV6L 2C35B 2K14A 1OXVA 4QIWE 3F2CA 2K4KA 3AEVA 2N8NA 3S1QH 4UP9A 2GVBA 5K36G 4JI3Q 1Q12A 4XTCS 2E8GA 3GTOH 3PSIA 1CKNB 5GADC 3M85A 4HJ8A 3TEHB 1N32L 1XJVA 2KCMA 3GO5A 2Y0SE 3PIPA 1XNRL 2L15A 1FL0A 1HNXQ 2F4VL 1YJNA 3PO2H 4DPGA 1G6PA 3L2PA 1O7IA 4DR7Q 1QVFA 1Q81C 5C4XG 5JJIA 5H1SE 4OXPA 3J81i 2KHIA 4JI5Q 3HOUG 4GOPC 2OCEA 4O0AA 3CC4A 2PMZE 1EIFA 4LF6Q 1VCIA 4AQYQ 1GD7A 1XNQL 2JK8A 4YWKA 1C7YA 3DLLA 1VQPA 1J5EL 1QVGA 1EQRA 1EOVA 4OONA 4JI7Q 1QUQA 1NMFA 1VQEA 5LMNW 4QJFA 5C0XI 3I4OA 3PF4A 1JJCB 3PGZA 4QGUA 1XMOQ 2ZJQA 3GTGH 1N9WA 4UP7A 2AWOA 1FGUA 2K50A 4DUZQ 5IY0A 4A93H 4DV3L 4LFCQ 3S2HH 1E1TA 5IYDG 2Q2HA 2BA1A 1FJGQ 1BVSA 3KLWA 4L5RC 3I4NH 1OXTA 4KI0A 1C0AA 4JI4Q 2JA8G 4JBKA 1PFSA 2XTIA 4DR2L 2HHHL 4GOPA 1G291 3CD6A 1HJPA 1XMQQ 4R4QA 2ZJPA 3AQQA 1BKBA 4YHHQ 1IZ6A 1HZCA 2IHFA 2VS1A 1TWGH 4B3MQ 1MKHA 1PYSB 3JAMi 3RNUA 1IBKL 2VW9A 1IBLL 3ULPA 5FLXc 5IP9H 2LSSA 1A62A 1X55A 2PQAA 5C4XH 4DV4L 2FXQA 1GM5A 2D0PA 3HOUH 4JI8Q 5IP7G 4NXNL 1PH4A 4HJAA 4LW1A 3PCOB 1VQCA 1K9MC 4A3GG 4LFAQ 4DV5L 4A4IA 3STBD 4HIOA 1UE6A 3OW2A 4LF4Q 1G51A 4A75A 3HKZE 3A5ZB 5IWAL 2Z6KC 4DR5Q 1YIJA 1PH9A 3T1HL 2UU9L 4EX5A 4A3CG 1RIPA 4A3IG 3CMAA 2HIVA 2YTYA 4X62Q 4TVAB 4L5TA 2Y0SG 5GAGC 3DM3A 4JI1L 1KAWA 2ALYB 3CCQA 1OXUA 4LF8Q 3K81C 1VQ8A 1LUZA 2I5HA 2WB1E 2R92H 2VUMH 1YI2A 5IYDH 1SR3A 4L5SA 1L2FA 4BY7G 1PA6A 4HJ7A 2D62A 3E9IA 4C3JH 4UY8C 4ALPA 3GTQH 2JA8H 4JYAL 3E0EA 4GNXC 3UE1A 5C0XG 3HOYG 1HZBA 2E2HH 1C9OA 2IX0A 1I94L 4HIMA 4OX9L 1M90C 4XIGS 1WCMG 2UUCL 3GDEA 4OO1I 1Z9FA 3KJPA 5IE8A 4Y7NH 2Z6KA 5M3FH 2AKWB 2N78A 4GLAC 4TQUS 4DNIA 2CFMA 4DV0Q 1JE5A 4QY7A 1VQAA 2HIXA 3RZDH 5IP7H 4YY3Q 4JV5L 2VZAA 2DGYA 1A63A 4AIMA 4A3GH 1UE7A 4YWMA 2QA4A 4C3HH 3KF8B 2UUAQ 1XPUA 1VQ6A 5EAYA 3CCRA 3K0XA 4LF7Q 4BBSH 4RMFA 1IBML 1HH2P 4A3DG 1Y14B 4A3CH 1X3EA 1VQDA 2YTVA 4GNXA 4A3IH 2IY5B 4NXMQ 2I5LX 4X65Q 3HKSA 2B29A 2E5LL 1PYBA 1SROA 4GN3B 1N33Q 3ICEA 1OXSC 2F3IA 3ULLA 4X6AH 1VQ5A 4J15A 1VQBA 5GAHC 2WFWA 1L0WA 4BY7H 2R93G 1NMGA 3EIVA 5GROA 1YEZA 4DUYQ 1YHBA 3KJOA 4K0KQ 2CWPA 4BA1I 4LF5L 3OTOQ 3HOYH 4IPCA 4IPDA 3HOXG 3S14H 2VQEQ 3HOVG 1CSQA 4BA2I 4DR1Q 2UXCQ 3I4MG 4A3FG 2MO1A 1WCMH 2ZJRA 3ER0A 2JE6I 3T1YQ 1QZGA 2HT1A 4YWLA 3NENA 3L0OA 2RHQB 4A3LG 4IJHA 4PMWA 3Q8DA 2PQAB 2UXDQ 2YV5A 1WYDA 2BH8A 2R7DA 4APVA 1EUJA 3J80c 2ZM6Q 1HNWQ 1W2BA 1TWCH 1JT8A 1Q86C 2WB1G 2E2JH 1N8RC 4B3RL 1Q7YC 4OWWB 3CF5A 2ATWA 4X66L 1E7ZA 3NBHB 4IOAA 2WP8J 4AYBG 4OO1G 1OXXK 4GS3A 1GKHA 3UE0A 3CW2C 3ERSX 1QVCA 2Q2IA 1V9PA 1X65A 3S15H 3CAMA 3F2DA 3K8AA 1K3RA 3GTPH 1Q46A 3S1NH 1SLJA 4GN4B 5JEAJ 1NJIC 3CCVA 1VQGA 3A74A 1Y1WG 4HJ9A 1K8GA 3GTKH 4DV7Q 1PH3A 4QQBX 2UXBQ 4AH6A 2R93H 1HR0W 4A3KG 1PHJA 4IFDI 4LF9Q 2N3SA 3HOXH 3KF6B 4B3SL 3GTLH 3HOVH 4DR4L 4GKJQ 3ZJYC 3I4MH 1U0LA 1KL9A 4P73A 5LMNQ 4A3FH 3PO3G 3S16H 4KHPL 3F2BA 4DV1Q 4JI6Q 1KC8C 3TRZA 1VS0A 4A3LH 4P75A 5C44G 1N36Q 4JI0L 1L1OC 4DK6C 2MO0A 3K7UC 5LMUL 3BU2A 5AJ3Q 3J7ZC 2JA7G 1VQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEM A;  5GAE C;  1NBW A;  3TS2 A;  5GQO A;  4DR3 Q;  1VQI A;  3M4O H;  1HR0 Q;  4H02 A;  2IX1 A;  1YJW A;  3S17 H;  2GVA A;  4B3T Q;  4DV2 Q;  3I55 A;  1RL2 A;  3HOZ G;  4LFB L;  5JJL A;  4JI2 Q;  2JA9 A;  1J6Q A;  5IYC G;  4DV6 Q;  1SRU A;  3CCU A;  1XPO A;  4GNX B;  4BBR G;  3D0F A;  1X3F A;  4IFD J;  2VQF L;  2NZH A;  4X65 L;  1SE8 A;  1DGS A;  2A1A A;  5JEA G;  3F8T A;  4A3J G;  2D0O A;  2K5N A;  1PH8 A;  2OWO A;  4DAY B;  2F52 A;  4K0K L;  2PI2 E;  2NVX H;  1N32 Q;  3BZC A;  5M5W H;  1EFW A;  1MIU A;  1YNX A;  5BR8 L;  1XNR Q;  5J3B A;  3I7F A;  5FJ8 G;  2F4V Q;  1TXY A;  2OQK A;  4P71 A;  1Q82 C;  1L1O A;  1P16 A;  3CQZ H;  3J80 i;  1EWI A;  1Y1W H;  5JJK A;  2E2I H;  1QZH A;  3RZO H;  2PI2 A;  2UUB Q;  2ZTE A;  2JQO A;  4O2D A;  4A3K H;  1D7Q A;  4JI3 L;  1Z47 A;  1ASY A;  1KRS A;  1Y1V G;  2ZTD A;  1YJ9 A;  1I3Q H;  3E9H A;  4GN5 A;  1ASZ A;  1XNQ Q;  1PH2 A;  2JA6 G;  1V43 A;  2JA5 G;  3HOW G;  3PO3 H;  1B8A A;  2YYZ A;  1J5E Q;  3KF6 A;  1HNX L;  2AHO B;  1X54 A;  1Q8K A;  2K5V A;  2IHE A;  3PUX A;  5C44 H;  3GTJ H;  3G6E A;  1KQS A;  4DR7 L;  3F1Z A;  2XGT A;  4JI5 L;  3STB C;  1VQM A;  5IYB G;  1IL2 A;  3KDF B;  2K75 A;  5M3M G;  4DV3 Q;  4IFD G;  1S3O A;  3LGJ A;  4LF6 L;  5DLQ E;  2Z0S A;  1EYG A;  3K7A H;  3TQY A;  3FP9 A;  4X64 Q;  4AQY L;  1VQK A;  1PH5 A;  5IYC H;  2ID0 A;  4POG A;  1I50 H;  4BBR H;  1YHQ A;  4DR2 Q;  2HHH Q;  4JI7 L;  1IXR A;  4MNO A;  1NY4 A;  2H5X A;  1AE2 A;  3I2Z A;  3TRE A;  4A3J H;  1XMO L;  1VQ7 A;  4C2M H;  4L5Q A;  1KRT A;  4DUZ L;  4Y52 H;  1UE5 A;  3KOJ A;  4LFC L;  2AWN A;  4BXX G;  2MNA A;  1PV4 A;  1FJG L;  1IBK Q;  1IBL Q;  1PVO A;  5M5Y H;  1HNZ Q;  1U5K A;  1SMX A;  1VQF A;  4IPG A;  4DV4 Q;  4JI4 L;  3S1M H;  1T9H A;  2WAQ E;  1KXL A;  2OTJ A;  4PG3 A;  1NE3 A;  4NXN Q;  4LWC A;  4PZ6 A;  1Y1V H;  1XMQ L;  3CXC A;  5FLM G;  4DV5 Q;  4FDB A;  2JEB I;  4WJ4 A;  3HKZ G;  2PNH A;  2V1C C;  4R1J A;  4YHH L;  3D31 A;  4JI6 L;  2JA6 H;  3HOW H;  1I6H H;  1BBU A;  2JA5 H;  3CCS A;  4B3M L;  3CCL A;  5IWA Q;  3JC6 6;  3CC2 A;  3T1H Q;  1PH6 A;  2UU9 Q;  4PZ8 A;  2KCT A;  4WJ3 M;  4GKK Q;  3GD7 A;  4LUO A;  4GLX A;  4JI1 Q;  3W1G A;  2Q2T A;  3U4V A;  2VY3 A;  4JI8 L;  4LNQ A;  3CPF A;  4R4C A;  2B3G A;  3H3V I;  5M3M H;  1E22 A;  3RR5 A;  2Q2U A;  3GTM H;  2NZO A;  4LFA L;  1JMC A;  3I4N G;  4JBM A;  4R4O A;  4LF4 L;  3L7Z C;  3UDF A;  1CKO A;  3KDF A;  2YTX A;  4GLV B;  1KHI A;  4DR5 L;  3BJU A;  3U50 C;  4A3D H;  4JYA Q;  2DUD A;  3ULJ A;  1LM0 A;  2MQH A;  2N49 A;  4X62 L;  3RLO A;  1BBW A;  4NPS A;  2KEN A;  1Q1E A;  4KLK A;  1I94 Q;  4OX9 Q;  1LTL A;  4JC0 A;  2HQL A;  4POF A;  5ELO A;  2UUC Q;  3CP0 A;  2NN6 I;  1JB7 A;  1L1O B;  2ZTC A;  4LF8 L;  1SN8 A;  4BXX H;  3M4Q A;  2ES2 A;  5IP9 G;  2ASB A;  2RF4 A;  1TWF H;  1WOC A;  2UUB L;  1GVP A;  4YCW A;  2CKZ B;  1H95 A;  3KFU A;  4JV5 Q;  3PUW A;  1FVI A;  2CWA A;  1VQJ A;  1JJG A;  2EXD A;  2CCZ A;  5FLM H;  3PUY A;  3U58 A;  3OYY A;  4HIK A;  1R9T H;  3AFQ A;  4OWT B;  1OTC A;  1KIX A;  1IBM Q;  3PUZ A;  3W5O A;  4EQ5 A;  3J81 j;  4HID A;  3RN2 A;  1MJE A;  1VQ9 A;  2NVY H;  5ELN A;  1IYJ B;  1VQO A;  4P72 A;  4IO9 A;  3S2D H;  4DV0 L;  2KHJ A;  2R7Z G;  3CME A;  2E5L Q;  3EBE A;  1GO3 E;  2A19 A;  4JOI C;  4DKA C;  4YY3 L;  3W1B A;  2R92 G;  2VUM G;  4C3I H;  4IJL A;  4MZ9 A;  4X64 L;  3RN5 A;  1N34 Q;  2UUA L;  3EN2 A;  1E3P A;  5E7N A;  2NVQ H;  1K8A C;  2OQ0 A;  1D8L A;  1MJC A;  1YZ6 A;  2WAQ G;  1EQQ A;  1PH7 A;  4LF7 L;  3H0G G;  1B70 B;  1VQN A;  1M1K C;  3B6Y A;  3UDG A;  1CUK A;  3FKI G;  1HZ9 A;  1W3S A;  2B63 G;  3I56 A;  4LF5 Q;  1I5F A;  4NXM L;  1V1Q A;  2GN5 A;  3TS0 A;  2YU9 H;  1WI5 A;  1VQL A;  3S24 A;  3CC7 A;  4IOC A;  3SGI A;  1N33 L;  1CKN A;  4PZ7 A;  5M3F G;  1XPR A;  1X56 A;  5C0X J;  1B7Y B;  1PH1 A;  1E24 A;  1HNZ L;  1CSP A;  3NEL A;  4IPH A;  4JCV E;  4R4I A;  3MEF A;  3KYH C;  4DUY L;  1TWH H;  4JOI A;  1UEB A;  3M9B A;  3CCM A;  4B3R Q;  1NTG A;  4LUZ A;  4BY1 G;  3OTO L;  3H15 A;  4A3B G;  2LXK A;  2RHS B;  2LXJ A;  4X66 Q;  2VQE L;  1YIT A;  4DR1 L;  2I0Q A;  4BBS G;  3RLN A;  4DR6 Q;  2UXC L;  2CQO A;  1K83 H;  1HZA A;  3T1Y L;  2NN6 G;  2BA0 A;  2AMC B;  4A3M G;  2QEX A;  1SFO H;  4GKK L;  3PV0 A;  2BH2 A;  2UXD L;  2ZM6 L;  1AH9 A;  3UDX A;  1X9N A;  1JJ2 A;  1HNW L;  4A3E G;  3RLF A;  5C3E G;  3J81 c;  2R7Z H;  4JBW A;  2JEA I;  2JA7 H;  4OWX B;  3PIO A;  4ME3 A;  2I5M X;  3G71 A;  2R7F A;  1KD1 C;  1UWV A;  1S40 A;  1E1O A;  3A5U A;  2IT1 A;  3J7A 5;  3S1R H;  3HOZ H;  2JJQ A;  2R6G A;  5HGQ A;  3G48 A;  4UPA A;  2RCN A;  3H0G H;  4AYB E;  3VDY A;  2EIF A;  1AE3 A;  4A76 A;  3FKI H;  3CPW A;  1X6O A;  2B63 H;  1XTD A;  3U4Z A;  2KBN A;  3M3Y H;  1YBY A;  1EIY B;  4B3S Q;  3HFZ B;  1VQ4 A;  2K52 A;  4MTN A;  4NB3 A;  2VL6 A;  4P74 A;  3H3V H;  3M7N A;  5HY6 A;  3PF5 A;  4KHP Q;  2NVT H;  3A0J A;  1A0I A;  4R4T A;  2MFI A;  3PO2 G;  4DK3 C;  1CKM A;  1YVC A;  4LUV A;  5FJ8 H;  4JI0 Q;  4KHZ A;  5LMU Q;  2UXB L;  4DV7 L;  3FHW A;  3M4P A;  3CCJ A;  1TWA H;  5C4J H;  4HJ5 A;  4QL5 A;  4BY1 H;  4A3B H;  4LF9 L;  4GKJ L;  1UE1 A;  4LFB Q;  1LYL A;  1QUQ B;  1WFQ A;  3K80 C;  4UP8 A;  1A8V A;  4DAM A;  3G4S A;  3CCE A;  5LMN L;  3PUV A;  1P8L A;  5IT9 c;  3UDI A;  4DV1 L;  3JAM c;  2A8V A;  2K5H A;  2QGQ A;  2VNU D;  4A3M H;  4JBJ A;  1YHA A;  4YCV A;  2VQF Q;  1K0R A;  1N36 L;  5M5X H;  3AFP A;  4DR4 Q;  4RG1 A;  5AJ3 L;  4YCU A;  4DR6 L;  1WJJ A;  4A3E H;  5C3E H;  1S72 A;  4JG2 A;  4DR3 L;  1Q1B A;  1N34 L;  1K73 C;  1HR0 L;  1X3G A;  5BR8 Q;  5IYB H;  4A93 G;  3IRB A;  3AYH B;  3BZK A;  4B3T L;  4DV2 L;  3MXN B;  3WWV A;  2EQS A;  2OTL A;  4JI2 L;  4GOP B;  4DV6 L;  2C35 B;  2K14 A;  1OXV A;  4QIW E;  3F2C A;  2K4K A;  3AEV A;  2N8N A;  3S1Q H;  4UP9 A;  2GVB A;  5K36 G;  4JI3 Q;  1Q12 A;  4XTC S;  2E8G A;  3GTO H;  3PSI A;  1CKN B;  5GAD C;  3M85 A;  4HJ8 A;  3TEH B;  1N32 L;  1XJV A;  2KCM A;  3GO5 A;  2Y0S E;  3PIP A;  1XNR L;  2L15 A;  1FL0 A;  1HNX Q;  2F4V L;  1YJN A;  3PO2 H;  4DPG A;  1G6P A;  3L2P A;  1O7I A;  4DR7 Q;  1QVF A;  1Q81 C;  5C4X G;  5JJI A;  5H1S E;  4OXP A;  3J81 i;  2KHI A;  4JI5 Q;  3HOU G;  4GOP C;  2OCE A;  4O0A A;  3CC4 A;  2PMZ E;  1EIF A;  4LF6 Q;  1VCI A;  4AQY Q;  1GD7 A;  1XNQ L;  2JK8 A;  4YWK A;  1C7Y A;  3DLL A;  1VQP A;  1J5E L;  1QVG A;  1EQR A;  1EOV A;  4OON A;  4JI7 Q;  1QUQ A;  1NMF A;  1VQE A;  5LMN W;  4QJF A;  5C0X I;  3I4O A;  3PF4 A;  1JJC B;  3PGZ A;  4QGU A;  1XMO Q;  2ZJQ A;  3GTG H;  1N9W A;  4UP7 A;  2AWO A;  1FGU A;  2K50 A;  4DUZ Q;  5IY0 A;  4A93 H;  4DV3 L;  4LFC Q;  3S2H H;  1E1T A;  5IYD G;  2Q2H A;  2BA1 A;  1FJG Q;  1BVS A;  3KLW A;  4L5R C;  3I4N H;  1OXT A;  4KI0 A;  1C0A A;  4JI4 Q;  2JA8 G;  4JBK A;  1PFS A;  2XTI A;  4DR2 L;  2HHH L;  4GOP A;  1G29 1;  3CD6 A;  1HJP A;  1XMQ Q;  4R4Q A;  2ZJP A;  3AQQ A;  1BKB A;  4YHH Q;  1IZ6 A;  1HZC A;  2IHF A;  2VS1 A;  1TWG H;  4B3M Q;  1MKH A;  1PYS B;  3JAM i;  3RNU A;  1IBK L;  2VW9 A;  1IBL L;  3ULP A;  5FLX c;  5IP9 H;  2LSS A;  1A62 A;  1X55 A;  2PQA A;  5C4X H;  4DV4 L;  2FXQ A;  1GM5 A;  2D0P A;  3HOU H;  4JI8 Q;  5IP7 G;  4NXN L;  1PH4 A;  4HJA A;  4LW1 A;  3PCO B;  1VQC A;  1K9M C;  4A3G G;  4LFA Q;  4DV5 L;  4A4I A;  3STB D;  4HIO A;  1UE6 A;  3OW2 A;  4LF4 Q;  1G51 A;  4A75 A;  3HKZ E;  3A5Z B;  5IWA L;  2Z6K C;  4DR5 Q;  1YIJ A;  1PH9 A;  3T1H L;  2UU9 L;  4EX5 A;  4A3C G;  1RIP A;  4A3I G;  3CMA A;  2HIV A;  2YTY A;  4X62 Q;  4TVA B;  4L5T A;  2Y0S G;  5GAG C;  3DM3 A;  4JI1 L;  1KAW A;  2ALY B;  3CCQ A;  1OXU A;  4LF8 Q;  3K81 C;  1VQ8 A;  1LUZ A;  2I5H A;  2WB1 E;  2R92 H;  2VUM H;  1YI2 A;  5IYD H;  1SR3 A;  4L5S A;  1L2F A;  4BY7 G;  1PA6 A;  4HJ7 A;  2D62 A;  3E9I A;  4C3J H;  4UY8 C;  4ALP A;  3GTQ H;  2JA8 H;  4JYA L;  3E0E A;  4GNX C;  3UE1 A;  5C0X G;  3HOY G;  1HZB A;  2E2H H;  1C9O A;  2IX0 A;  1I94 L;  4HIM A;  4OX9 L;  1M90 C;  4XIG S;  1WCM G;  2UUC L;  3GDE A;  4OO1 I;  1Z9F A;  3KJP A;  5IE8 A;  4Y7N H;  2Z6K A;  5M3F H;  2AKW B;  2N78 A;  4GLA C;  4TQU S;  4DNI A;  2CFM A;  4DV0 Q;  1JE5 A;  4QY7 A;  1VQA A;  2HIX A;  3RZD H;  5IP7 H;  4YY3 Q;  4JV5 L;  2VZA A;  2DGY A;  1A63 A;  4AIM A;  4A3G H;  1UE7 A;  4YWM A;  2QA4 A;  4C3H H;  3KF8 B;  2UUA Q;  1XPU A;  1VQ6 A;  5EAY A;  3CCR A;  3K0X A;  4LF7 Q;  4BBS H;  4RMF A;  1IBM L;  1HH2 P;  4A3D G;  1Y14 B;  4A3C H;  1X3E A;  1VQD A;  2YTV A;  4GNX A;  4A3I H;  2IY5 B;  4NXM Q;  2I5L X;  4X65 Q;  3HKS A;  2B29 A;  2E5L L;  1PYB A;  1SRO A;  4GN3 B;  1N33 Q;  3ICE A;  1OXS C;  2F3I A;  3ULL A;  4X6A H;  1VQ5 A;  4J15 A;  1VQB A;  5GAH C;  2WFW A;  1L0W A;  4BY7 H;  2R93 G;  1NMG A;  3EIV A;  5GRO A;  1YEZ A;  4DUY Q;  1YHB A;  3KJO A;  4K0K Q;  2CWP A;  4BA1 I;  4LF5 L;  3OTO Q;  3HOY H;  4IPC A;  4IPD A;  3HOX G;  3S14 H;  2VQE Q;  3HOV G;  1CSQ A;  4BA2 I;  4DR1 Q;  2UXC Q;  3I4M G;  4A3F G;  2MO1 A;  1WCM H;  2ZJR A;  3ER0 A;  2JE6 I;  3T1Y Q;  1QZG A;  2HT1 A;  4YWL A;  3NEN A;  3L0O A;  2RHQ B;  4A3L G;  4IJH A;  4PMW A;  3Q8D A;  2PQA B;  2UXD Q;  2YV5 A;  1WYD A;  2BH8 A;  2R7D A;  4APV A;  1EUJ A;  3J80 c;  2ZM6 Q;  1HNW Q;  1W2B A;  1TWC H;  1JT8 A;  1Q86 C;  2WB1 G;  2E2J H;  1N8R C;  4B3R L;  1Q7Y C;  4OWW B;  3CF5 A;  2ATW A;  4X66 L;  1E7Z A;  3NBH B;  4IOA A;  2WP8 J;  4AYB G;  4OO1 G;  1OXX K;  4GS3 A;  1GKH A;  3UE0 A;  3CW2 C;  3ERS X;  1QVC A;  2Q2I A;  1V9P A;  1X65 A;  3S15 H;  3CAM A;  3F2D A;  3K8A A;  1K3R A;  3GTP H;  1Q46 A;  3S1N H;  1SLJ A;  4GN4 B;  5JEA J;  1NJI C;  3CCV A;  1VQG A;  3A74 A;  1Y1W G;  4HJ9 A;  1K8G A;  3GTK H;  4DV7 Q;  1PH3 A;  4QQB X;  2UXB Q;  4AH6 A;  2R93 H;  1HR0 W;  4A3K G;  1PHJ A;  4IFD I;  4LF9 Q;  2N3S A;  3HOX H;  3KF6 B;  4B3S L;  3GTL H;  3HOV H;  4DR4 L;  4GKJ Q;  3ZJY C;  3I4M H;  1U0L A;  1KL9 A;  4P73 A;  5LMN Q;  4A3F H;  3PO3 G;  3S16 H;  4KHP L;  3F2B A;  4DV1 Q;  4JI6 Q;  1KC8 C;  3TRZ A;  1VS0 A;  4A3L H;  4P75 A;  5C44 G;  1N36 Q;  4JI0 L;  1L1O C;  4DK6 C;  2MO0 A;  3K7U C;  5LMU L;  3BU2 A;  5AJ3 Q;  3J7Z C;  2JA7 G;  1VQH A; 
#chains in the Genus database with same CATH topology
 1NBW A;  1VQI A;  1EZ6 A;  3NUC A;  3VA7 A;  4BS9 A;  1IKL A;  1RL2 A;  4JI2 Q;  4DV6 Q;  3TP6 A;  1TU2 B;  1PTO F;  1W6J A;  1SDF A;  4X65 L;  1SEB D;  2PNR C;  3FEW X;  4DAY B;  3A7L A;  4XXE A;  3NHH A;  3L3O C;  1DOL A;  1N32 Q;  3PIP 3;  2KJX A;  1IYV A;  5CYU A;  3CHB D;  5J39 A;  2F0U A;  2F4V Q;  5IGG A;  1I4H A;  3CQZ H;  4ZYS A;  4C1N I;  2E2I H;  3RZO H;  2PI2 A;  3H91 A;  1JOR A;  1CK1 A;  4A3K H;  1XTC D;  3HS0 C;  2RSN A;  2ZXR A;  1I3Q H;  3E9H A;  4IUN A;  1FNW A;  2JA5 G;  3K0Y A;  1B8A A;  4HAE A;  1D5Z C;  2YYZ A;  2AHO B;  3DEP A;  1S5D D;  1CT1 D;  2FHT A;  2IHE A;  5C44 H;  4ZUJ A;  3GTJ H;  1KQS A;  2EYJ A;  3F1Z A;  4Y7N B;  2M00 A;  4EQO A;  3NK9 A;  1MBY A;  1IL2 A;  4IFD G;  4DV3 Q;  4LF6 L;  4FF4 A;  5DLQ E;  1B53 A;  1K8M A;  1EL0 A;  3FP9 A;  1EEF D;  2IJ0 A;  4X64 Q;  5IYC H;  2KQ3 A;  1I50 H;  1ZYR C;  4BBR H;  4A3G B;  5T1I A;  1STG A;  1IXR A;  5A2Q L;  1NY4 A;  3I2Z A;  5CV5 A;  4A3J H;  2HDL A;  1SYG A;  4DUZ L;  3KOJ A;  4ZKB B;  2AWN A;  2MNA A;  1FJG L;  1H9M A;  2Y0S B;  4DN4 M;  5M5Y H;  4HSV A;  1VQF A;  4JI4 L;  3S1M H;  4HN7 A;  2OTJ A;  3MC0 B;  4NXN Q;  2R61 A;  3S1M B;  4BY7 B;  4ULL A;  5EBD A;  4WJ4 A;  2F0L A;  3D31 A;  2X6G A;  3HOY B;  3CC2 A;  1PTO H;  4R9W A;  4ZLT F;  2UU9 Q;  3G7L A;  2RCF A;  2KCT A;  1K8O A;  4LUO A;  1PTO B;  5T1G A;  1C8C A;  3W1G A;  2Q2T A;  2VY3 A;  1IKM A;  3CPF A;  4R4C A;  4ZK9 B;  4ILW A;  4C3I G;  4X3T A;  3HEJ A;  2NB0 A;  4DXG A;  4LFA L;  4CDC C;  5CMD A;  4LF4 L;  4R4O A;  2E2J B;  1CQV A;  4GLV B;  4U67 3;  1KHI A;  2ZT9 C;  4A3D H;  1A15 A;  1EIG A;  1TII D;  3J7A V;  4X62 L;  3VR5 A;  1BBW A;  4LJZ C;  2KEN A;  1Q1E A;  2B2W A;  2CW0 C;  4OX9 Q;  5ELO A;  2NN6 I;  3LWE A;  1JB7 A;  1H9R A;  3M4Q A;  1XYI A;  1DYQ A;  1TWF H;  1H95 A;  1UNS A;  2SDF A;  1HCZ A;  2XIW A;  2EXD A;  2QCP X;  4IUR A;  3G6J B;  4HIK A;  1R9T H;  3AFQ A;  4OWT B;  1OTC A;  3J81 j;  4HID A;  3RN2 A;  5ELN A;  3S16 B;  4A3F B;  4IO9 A;  2BOS A;  1Z7T A;  2R7Z G;  4N8F A;  3EBE A;  3E0J A;  1GO3 E;  4DKA C;  3WOF A;  3MTS A;  2VUM G;  1G8Z D;  1JOK A;  2RA4 A;  4IJL A;  5FO9 B;  4C3J G;  2G9D A;  1MJC A;  1EQQ A;  1PH7 A;  1B70 B;  3R3O A;  4MTK A;  1VQN A;  4RGO S;  1CUK A;  3FKI G;  4AYB B;  1V1Q A;  2GN5 A;  2YU9 H;  1VQL A;  3A55 A;  3S24 A;  4IOC A;  1N33 L;  2KED A;  1CA5 A;  5M3F G;  4CJ1 B;  5C0X J;  1DOK A;  2EYO A;  1B7Y B;  1HNZ L;  4G7O C;  1CSP A;  4JCV E;  3D3R A;  1FD7 D;  5M5W B;  1PRT F;  1TWH H;  3M9B A;  4K0K L;  1NTG A;  1CZW A;  1YIT A;  4DR1 L;  2UXC L;  1K83 H;  2B2U C;  3D6C A;  2NN6 G;  2BA0 A;  2QF7 A;  2AMC B;  4Q0F A;  1RJT A;  1XX8 A;  2BH2 A;  2QKI C;  2ZM6 L;  3PO3 B;  1ML0 D;  2DJF C;  3NWS A;  3J81 c;  1GUS A;  2Z4H A;  2JA7 H;  4OWX B;  4ME3 A;  4PMC A;  2EY6 A;  2EYF A;  4OEL B;  4XQN A;  1E1O A;  3A5U A;  2JA7 B;  3GV6 A;  5A35 A;  2B2Y C;  1WD0 A;  4AYB E;  1JC7 A;  1XWE A;  2EIF A;  3K7A B;  4J6H A;  1XTD A;  5JPN C;  1YBY A;  3BVM A;  1ESF A;  4H0L C;  4MTN A;  2B2U A;  4HR7 B;  2VL6 A;  3H3V H;  4S3S A;  4R4T A;  5COY A;  4DK3 C;  1CKM A;  4ZAI A;  4JI0 Q;  4C56 C;  4V0B A;  5LMU Q;  1B3Q A;  1T5E A;  3M4P A;  4RHS A;  4A3B H;  4GKJ L;  4MIU A;  1LAB A;  2B2Y A;  3NTK A;  1A8V A;  3CCE A;  1P8L A;  4DV1 L;  3UDI A;  2VNU D;  2AUK A;  1EZ8 A;  2OT2 A;  4JBJ A;  1LTA D;  4A3M H;  4YCV A;  2VQF Q;  1JWM D;  2JA5 B;  5AJ3 L;  4YCU A;  5BN4 A;  4A3E H;  3W2D A;  3NP8 A;  1X32 A;  2RDF A;  1EIH A;  1X3G A;  1BNZ A;  4IFD H;  3C1E A;  1HFG A;  2OTL A;  4GOP B;  2PZT A;  2V4D A;  1EY5 A;  3F2C A;  1EU3 A;  2N8N A;  4KJN A;  3HZX A;  4JI3 Q;  4XTC S;  2F0Q A;  1CKN B;  3TEH B;  5IOC A;  1XJV A;  1HTP A;  3PO2 H;  4DR7 Q;  2XWB B;  4OXP A;  2K1B A;  2B2V A;  2SOB A;  3CC4 A;  1E2Z A;  1V1O A;  1EU4 A;  2JK8 A;  3NTH A;  1EQR A;  2BDO A;  5AFW A;  3I4O A;  1JJC B;  3PGZ A;  2ZJQ A;  2F0F A;  3KUP A;  1FGU A;  1H9S A;  1H9K A;  2NVY B;  3NSW A;  3S2H H;  4EQP A;  1S5F D;  4R8N A;  5IYD G;  1II3 A;  4DNT B;  1DD2 A;  4C3I B;  1STB A;  3MXN A;  2XTI A;  2NVQ B;  1LT4 D;  3CD6 A;  1XMQ Q;  1PZK D;  5C5M A;  3V05 A;  1SYE A;  4CHT B;  3E3X A;  1SND A;  2VS1 A;  1TWG H;  4B3M Q;  3JAM i;  4H44 C;  1O7L A;  1TKW B;  3D4R A;  1WTX A;  1LTB D;  2LSS A;  3FVQ A;  5C4X H;  5FKA C;  4DV4 L;  2QDL A;  1GM5 A;  2D0P A;  3VYT A;  3HOU H;  4OIJ A;  4LW1 A;  5EGT A;  4HJA A;  1GJX A;  1UE6 A;  1G51 A;  3A5Z B;  1T5X D;  5IWA L;  1H9J A;  1PH9 A;  4A3C G;  1LTI D;  1RIP A;  3CMA A;  5CBA E;  2HIV A;  2FMC A;  2GA4 B;  4TVA B;  4L5T A;  1GOZ A;  3QB3 A;  4JI1 L;  1KAW A;  2F0P A;  5F2D A;  1E0B A;  4K2K A;  1CFM A;  3K81 C;  1EEI D;  2I5H A;  2WB1 E;  3I72 A;  2VUM H;  2R7Z B;  1PA6 A;  1L0X B;  4C3J H;  4UY8 C;  2K28 A;  4ALP A;  2PCF B;  2VUM B;  4JYA L;  2F0E A;  2MPM A;  4C3J B;  2E2H H;  1OO9 B;  3CRL C;  4HMJ A;  3TDQ A;  1I94 L;  3FKI B;  1PMR A;  2UUC L;  3GDE A;  2E2H B;  5IE8 A;  5M3F H;  2F0H A;  5COR A;  5FOB B;  1TS4 A;  1WD1 A;  4DNI A;  5M3F B;  4DV0 Q;  1TVX A;  1NR4 A;  1VQA A;  2HIX A;  3RZD H;  4OL7 A;  4AIM A;  1CI3 M;  4YWM A;  4C3H H;  4IQZ A;  3NXW A;  5KGU A;  4LF7 Q;  3MXP A;  1QIL A;  1IBM L;  1HH2 P;  3FRP B;  3VA5 A;  3KLR A;  2YTV A;  2NTS A;  1BUV T;  2I5L X;  2X6L A;  3HKS A;  4JPB W;  3SVM A;  2FMM A;  2E5L L;  1PYB A;  4GN3 B;  3Q22 A;  3ICE A;  4XQJ A;  5M5X B;  2K01 A;  3OMC A;  1AP0 A;  4JK1 C;  1D6E C;  3ZYY X;  1L0W A;  5KYL A;  1I4R A;  3SK5 A;  2F3V A;  1YEZ A;  2KOL A;  3NWT A;  5IGB A;  1AW7 A;  3TZU A;  3HOV G;  1CSQ A;  1SJE D;  1WTW A;  3I4M G;  1UEA B;  1WCM H;  3ER0 A;  2HT1 A;  2RHQ B;  4PMW A;  3Q8D A;  2PQA B;  2UXD Q;  1EFI D;  3E5S A;  4MN3 A;  1HNW Q;  1AN8 A;  4B3R L;  2ATW A;  4FF3 A;  3EFX D;  3OHX C;  5CV6 A;  1EYA A;  2JSO A;  1ET9 A;  3ERS X;  4IAL A;  2QEJ C;  1U4P A;  2Q2I A;  1TY0 A;  2O5I C;  2K5Q A;  1X65 A;  4KN7 C;  3S15 H;  5J1Z A;  3F2D A;  3K8A A;  4F87 A;  5CV4 A;  1VDZ A;  1Q46 A;  4NDX A;  1NUC A;  2L12 A;  4GN4 B;  5JEA J;  2D2C C;  3BS1 A;  1VQG A;  1G91 A;  4FNF A;  2UXB Q;  4RHR A;  2R93 H;  4AH6 A;  3IFT A;  4A3K G;  2L4N A;  2WKD A;  3BYT B;  5ELC A;  4LF9 Q;  4B3S L;  3OMG A;  2WV6 D;  1U0L A;  3F2B A;  1KC8 C;  1EY4 A;  5C44 G;  4NW2 A;  2MO0 A;  1I6V C;  4XT1 B;  4FF1 A;  4DR6 Q;  3NEM A;  5GAE C;  2IX1 A;  4Z9C B;  4B3T Q;  4LFB L;  2A6H D;  1J6Q A;  5E4W C;  5IYC G;  3CCU A;  4RCN A;  1XPO A;  4GNX B;  4BBR G;  2SEB D;  3OIQ A;  3D0F A;  3DWQ A;  3NBH A;  5EJW A;  4NP5 A;  5FO7 B;  4A3J G;  2OWO A;  2K5N A;  1QNU A;  1PH8 A;  2F52 A;  3Q6S A;  1LTS D;  1ENA A;  5BR8 L;  5J3B A;  5ELD A;  1TXY A;  4P71 A;  1Q82 C;  1P16 A;  3J80 i;  4B9W A;  5E3F A;  2UUB Q;  2ZTE A;  3FPU B;  2KHS A;  2L5T A;  1PFB A;  2PQE A;  4OEM B;  3H94 A;  1ASZ A;  1XNQ Q;  2H4O A;  4FXG C;  1JOQ A;  1JB3 A;  1J5E Q;  3KF6 A;  4KY6 A;  1KAA A;  1X54 A;  3BDO A;  1F9Q A;  1QWY A;  4JI5 L;  3TSS A;  1WVL A;  3VR3 A;  2K5W A;  3KDF B;  1S3O A;  3LGJ A;  3V96 A;  4AQY L;  3KLS A;  2EY1 A;  4G7H C;  1YHQ A;  5E4X A;  2IW3 A;  4JI7 L;  4MNO A;  1Q3L A;  2H5X A;  4C2M H;  4L5Q A;  1ENF A;  4LFC L;  4DXF A;  1D2B A;  4P2C B;  1SMX A;  4UHV A;  4IPG A;  3WOE A;  1T9H A;  1KXL A;  2PO4 A;  4PZ6 A;  1Y1V H;  1B9N A;  4FDB A;  2JEB I;  1KNA A;  2LKV A;  5NUC A;  4JI6 L;  2JA6 H;  2EY2 A;  3HOW H;  3QG1 A;  3ONA B;  1JIC A;  1K3B C;  1PH6 A;  4CKE A;  4WJ3 M;  1HA6 A;  5CR3 A;  4ME5 A;  3PMF A;  4GLX A;  3K5O A;  3T51 B;  3H3V I;  3RR5 A;  1IL8 A;  1EYD A;  2YTX A;  2A69 D;  2L11 A;  4DR5 L;  3U50 C;  3Q0A A;  2MQH A;  3DWP A;  1LTL A;  4JC0 A;  4POF A;  3UI2 A;  5CV9 A;  3CP0 A;  4KKT A;  4LF8 L;  1L1O B;  1KLG D;  2ZTC A;  1Y69 U;  2ES2 A;  2ASB A;  4KMU C;  3KK7 A;  4O1N A;  1GVP A;  4YCW A;  3GTP B;  3NPP A;  5I2Y A;  3T53 B;  1JJG A;  3GTK B;  2Z6B A;  5FLM H;  3PUY A;  1SYD A;  1HXY D;  2HQE A;  1A3V A;  2Z9H A;  3HOV B;  1VQ9 A;  3T16 A;  3I4M B;  2EVB A;  4P72 A;  3EVQ A;  3K57 A;  2KHJ A;  2F0K A;  2A19 A;  4JOI C;  4YY3 L;  2R92 G;  4X64 L;  1B3A A;  2Q8R E;  3I70 A;  1N34 Q;  1CA6 A;  1E3P A;  1KAB A;  1K8A C;  2OQ0 A;  2WAQ G;  1HZ9 A;  3EJI A;  3I56 A;  5JPM C;  4K5X A;  1CKN A;  3N6R A;  1X56 A;  1PH1 A;  5D3D A;  3A54 A;  3NEL A;  3M7G A;  1RHP A;  1GUN A;  4K14 A;  1HUM A;  4OIK A;  1M4V A;  4DUY L;  4H7B A;  1UEB A;  4JOI A;  3CCM A;  3CQZ B;  3H15 A;  4A3B G;  3MEH A;  2E2I B;  2LXJ A;  2I07 B;  4X66 Q;  4BBS G;  3RZO B;  3J81 L;  3RLN A;  2CQO A;  3ITP A;  4A3K B;  3EQL C;  3T1Y L;  4A3M G;  1QOH A;  1SFO H;  1I3Q B;  1QE6 A;  1AH9 A;  1A2U A;  3OIP A;  1LT6 D;  4A3E G;  3RLF A;  1STN A;  2A6H C;  4KY5 A;  3VR6 A;  2IL8 A;  1S5B D;  5C44 B;  1BCP B;  2I5M X;  3GTJ B;  2R7F A;  1S40 A;  4RA8 A;  2IT1 A;  3J7A 5;  3S1R H;  2RKS A;  3DWA A;  4UPA A;  3MVV A;  3R8B A;  3VDY A;  1X6O A;  3M3Y H;  1AFP A;  3HFZ B;  1I50 B;  4BBR B;  5JOB A;  4K8J A;  2BE5 D;  2XNA C;  3GV3 A;  1SNC A;  3PF5 A;  2NVT H;  4A3J B;  1EY6 A;  2NBF A;  3K5M A;  3PO2 G;  4LK1 C;  4F88 A;  2C9O A;  4DV7 L;  3FHW A;  1TWA H;  1S5C D;  5I4D A;  5C4J H;  4HJ5 A;  4FXD A;  5M5Y B;  4BY1 H;  5G3L D;  1F9S A;  1TWA B;  3OSO A;  2A74 C;  1ET6 A;  5FLX E;  4DAM A;  4EVO A;  5IIF A;  1RD9 D;  3G4S A;  5IT9 c;  5LMN L;  3JAM c;  2QGQ A;  5JVG 3;  2WII B;  3RD4 A;  5J22 A;  4HED A;  4RG1 A;  4JG2 A;  1Z6H A;  3FMC A;  4DR3 L;  1Q1B A;  3CKI B;  1K73 C;  4E6I A;  1HR0 L;  3D4W A;  5DM6 3;  4DV2 L;  1LV9 A;  2NUC A;  3WWV A;  1JR0 D;  2CHB D;  4KK7 A;  2C35 B;  2K4K A;  2PZU A;  3AEV A;  3S1Q H;  3J81 E;  2GVB A;  4JVZ A;  1Q12 A;  5K5P A;  1SAP A;  3PSI A;  4OGQ C;  3R2T A;  5GAD C;  5CC4 A;  3M85 A;  5JVH 3;  1D5X C;  4A3D B;  4PQX A;  1MI2 A;  3GO5 A;  2Y0S E;  4G4K A;  1XNR L;  2L15 A;  1FL0 A;  3F2U A;  3OW7 A;  4QUC A;  1G6P A;  3L2P A;  1O7I A;  5DAU A;  3OWE B;  1Q81 C;  1QVF A;  2K7V A;  5C4X G;  1TY2 A;  3HOU G;  1SE2 A;  3X3N A;  2OCE A;  4O0A A;  1TWF B;  1HTL D;  1EIF A;  4LF6 Q;  1ESR A;  3U9O A;  1ONL A;  1CZG A;  1EOV A;  4OON A;  1QUQ A;  3QJY A;  3TP8 A;  1VQE A;  5LMN W;  1R9T B;  4QJF A;  2QIL A;  4QGU A;  1N9W A;  2AWO A;  3K58 A;  2K50 A;  4DUZ Q;  3M4Y A;  2A69 C;  4A93 H;  1RTO A;  1FJG Q;  1BVS A;  1O78 A;  2DY7 A;  4JI4 Q;  4G7Z C;  2A73 B;  4KV6 A;  4JBK A;  4DR2 L;  2ICI A;  1HA5 A;  3DMU A;  2HHH L;  2LMC B;  1V1P B;  2A6E D;  3BDL A;  3NE5 B;  1HJP A;  1TQO A;  3C1F A;  2FFK B;  2MJ8 A;  1IZ6 A;  1A6X A;  1TS5 A;  1LTR D;  3RNU A;  1S4Z A;  2Z8L A;  2YU9 B;  2RBM A;  1IBK L;  2VW9 A;  1IBL L;  1IW7 D;  3AB9 A;  3T56 B;  5FLX c;  1A62 A;  5C4H A;  2PQA A;  1SNO A;  5KEE A;  1PH4 A;  3PCO B;  4LFA Q;  4C3H G;  4DV5 L;  1EY0 A;  3STB D;  4X3S A;  4LF4 Q;  3OW2 A;  1TWH B;  2Z6K C;  1D1I A;  3T1H L;  1DOM A;  3MFY A;  1K83 B;  1VF5 C;  4X62 Q;  3CCQ A;  1EQT A;  1SBB B;  1VQ8 A;  2R92 H;  1HRJ A;  4HJ7 A;  1BXT A;  3E9I A;  2JA8 H;  2K32 A;  1KDB A;  1BCP D;  4GNX C;  4J8Q A;  2EDG A;  2WAQ B;  1HZB A;  1JWU D;  4GZY C;  1VMP A;  1PZJ D;  1F2Z A;  1WCM G;  2Z6K A;  1U9R A;  2KUM A;  5EPJ A;  2CFM A;  4K2L A;  5IP7 H;  3P20 A;  2L55 A;  3KBX A;  4JV5 L;  4PV1 C;  1A63 A;  2QA4 A;  2Q8T A;  2WAC A;  3KF8 B;  2BDN A;  2EJG C;  4BBS H;  3K0X A;  1F9R A;  4HSP A;  3ND9 A;  4A3B B;  1EYC A;  4ZCK A;  4BBS B;  4GNX A;  4A3I H;  4A3M B;  5KNB A;  1N33 Q;  1HQR D;  1AEX A;  4KD3 A;  3ULL A;  4X6A H;  1KDC A;  1VQ5 A;  1IHZ A;  4A3E B;  4B9X A;  2R93 G;  1NMG A;  1PTO D;  3W3A A;  2BE5 C;  4K0K Q;  4LF5 L;  5C0X H;  4IPC A;  3S14 H;  2TSS A;  2DJG C;  4DR1 Q;  2UXC Q;  1DZ1 A;  2MO1 A;  1PRT B;  4YWL A;  3QWN A;  4J1M A;  2E75 C;  3J80 c;  2ZM6 Q;  4APV A;  1SYB A;  1W2B A;  1TWC H;  1Q86 C;  1BR9 A;  3PO2 B;  1WTV A;  3CF5 A;  1E7Z A;  2WP8 J;  5ELF A;  4I7Z C;  1YNJ D;  4CDD C;  3CRK C;  1RCV D;  1OXX K;  4GS3 A;  3K5N A;  4JW0 A;  1ZEQ X;  1QVC A;  3MXU A;  2MHV A;  1WTO A;  4G57 A;  4NMZ A;  3S1N H;  2PW5 A;  2HUG A;  1KTK A;  2RDG A;  1PH3 A;  3LX0 A;  2R3Z A;  4QQB X;  3VYS A;  3S2H B;  1B2T A;  1EY8 A;  2FIN B;  2B2T C;  3VYR A;  2QW7 A;  3I4L A;  4GKJ Q;  3HOX H;  1HFN A;  1LO5 D;  3X3M A;  4QUF A;  4KHP L;  1PZI D;  5EPL A;  4DV1 Q;  1A3U A;  4KTA A;  4XDX A;  5EKL A;  1L1O C;  4DK6 C;  3K7U C;  1TWG B;  3BU2 A;  5AJ3 Q;  3J7Z C;  1VQH A;  4HMI A;  5C5L A;  3TS2 A;  3VYU A;  3M4O H;  3VR2 A;  2HCI A;  3C46 A;  1YJW A;  3S17 H;  3HOZ G;  2AQ3 B;  5C4X B;  1GUW A;  3BVG A;  3HOU B;  3CU7 A;  2K05 A;  1SXT A;  2B2T A;  2NZH A;  5JEA G;  4DR4 L;  3R93 A;  4L8J A;  2PI2 E;  2NVX H;  2J7Z A;  3QR8 A;  4K5W A;  2CVR A;  2OQK A;  2A6E C;  1L1O A;  1EWC A;  2F3W A;  1EWI A;  1Y1W H;  1GUO A;  1KDA A;  2A68 D;  4O2D A;  1D7Q A;  1Y1V G;  2HDM A;  1YJ9 A;  1IW7 C;  2JA6 G;  1PH2 A;  2F0O A;  2XRQ D;  3HOW G;  2JYO A;  1LAC A;  1HNX L;  2IPK D;  1Q8K A;  1ILQ A;  2K5V A;  2VB2 X;  3STB C;  1VQM A;  5FK9 C;  5IYB G;  2EOT A;  1K0S A;  3AMU A;  2K75 A;  2CQA A;  5D3I B;  2EYH A;  2Z0S A;  3TQY A;  3RZD B;  3MXG A;  1MHW C;  4X3K A;  2F0W A;  4C3H B;  3J7Y W;  3V2T A;  1VQ7 A;  1XMO L;  4FO2 A;  1WTQ A;  1F2Y A;  1KRT A;  4Y52 H;  1UE5 A;  1EQV A;  4YIJ A;  4DAY A;  1PV4 A;  1BCP C;  1U5K A;  4CDE C;  4DV4 Q;  4PG3 A;  1NE3 A;  1A3T A;  3CXC A;  5FLM G;  4R1J A;  4YHH L;  4DAV A;  2N55 A;  5HUR A;  3C2P A;  1BBU A;  3N52 A;  3CCS A;  1MD2 D;  5IWA Q;  2D9U A;  1WCM B;  4QB4 A;  4GKK Q;  2EJF C;  3GD7 A;  2RDH A;  4JI1 Q;  1PRT D;  4JI8 L;  5C3W A;  4LNQ A;  4TSS A;  5M3M H;  3GTM H;  2XWJ B;  2AQ1 B;  1JMC A;  3I4N G;  4JBM A;  5CGK A;  1SNP A;  3A8K E;  3BJU A;  4O42 A;  5D65 A;  4JYA Q;  3LNN A;  2DUD A;  3ULJ A;  1B44 D;  2N49 A;  1MSG A;  1I94 Q;  1PFM A;  4LAA A;  2UUC Q;  2MP1 A;  1PTO C;  1SN8 A;  4BXX H;  1VMC A;  4IN3 A;  3S15 B;  1DCZ A;  2NTT A;  2HCC A;  4HTH A;  2UUB L;  1I4P A;  3KFU A;  1GHJ A;  3PUW A;  1FVI A;  2CWA A;  2R93 B;  2CCZ A;  2EYL A;  1PXU A;  2F0N A;  3HG9 A;  5C4Z A;  2EPB A;  3L9A X;  1KIX A;  1IBM Q;  3PUZ A;  2OXP A;  3W5O A;  4EQ5 A;  1MJE A;  1VQO A;  1IYJ B;  3S2D H;  3CME A;  2E5L Q;  1YNJ C;  1BF4 A;  3S2D B;  3W1B A;  4F7X A;  1EWH A;  2UUA L;  5LL6 S;  1D8L A;  3MA2 B;  1LTG D;  3B6Y A;  4C1N K;  4DA2 A;  4NXM L;  4RAU C;  5KYI A;  3KBG A;  4PZ7 A;  1B4O A;  1DJR D;  4IPH A;  4BWG B;  1L0Y B;  1A2T A;  3BYY B;  4R4I A;  3MEF A;  3KYH C;  4PNY A;  2A5H A;  4B3R Q;  3NQI A;  4BY1 G;  3OTO L;  2PPB C;  2RHS B;  4LMQ D;  1JWS D;  2VQE L;  1Q90 A;  2I0Q A;  2KA7 A;  4PMB A;  1HZA A;  3FPP A;  3SK6 A;  1DON A;  2QEX A;  5M9O A;  3A7A B;  3PV0 A;  3QO2 A;  5I9O A;  3UDX A;  4IZ8 A;  1KLU D;  2Z1C A;  1KD1 C;  1UWV A;  1ILP A;  3HOZ H;  2JJQ A;  4K6L A;  4KKU A;  5HGQ A;  2RCN A;  3H0G H;  4IUQ A;  2KCN A;  3HOZ B;  1O80 A;  2B63 H;  3U4Z A;  2KBN A;  1EIY B;  4DFA A;  4B3S Q;  5JEA H;  2K52 A;  4F8M A;  5HGT A;  1GXD C;  1I4X A;  2AUJ D;  4RFB A;  5JJZ A;  4P74 A;  2XN9 C;  4TRD A;  5HY6 A;  3M7N A;  2A68 C;  1A0I A;  4C2M B;  2DY8 A;  4RWS C;  1YVC A;  4KHZ A;  1LT3 D;  3JAM L;  2E74 C;  3AU7 A;  5I6W A;  4DK1 A;  5CV8 A;  2EYP A;  4LFB Q;  3K80 C;  1BOS A;  2K5H A;  1Y1V B;  3R2I A;  1K0R A;  1H9S B;  1N36 L;  1NR2 A;  2EY5 A;  3AFP A;  2JA6 B;  3HOW B;  5ISR A;  1S72 A;  5C3E H;  3LWU A;  3SR1 A;  4A93 G;  1N34 L;  5IYB H;  5BR8 Q;  3IRB A;  3AYH B;  3BZK A;  3MXN B;  1STE A;  4JI2 L;  4DV6 L;  2K14 A;  1F77 A;  2F0T A;  4UP9 A;  1F2M A;  4CKB A;  2B8G A;  5K36 G;  2E8G A;  2L0C A;  3GTO H;  1XXG A;  3I3C A;  4HJ8 A;  4L63 B;  1N32 L;  4KN4 C;  3GTO B;  1BQQ T;  3PIP A;  4RGM A;  2F4V L;  1YJN A;  1U4R A;  5JJI A;  1G6Z A;  2M9V A;  4JI5 Q;  2JP1 A;  4M1U B;  4GOP C;  2F0S A;  1VCI A;  4AQY Q;  4KHV A;  4YWK A;  1C7Y A;  2JA7 G;  3MWY W;  1PRT C;  4JI7 Q;  1NMF A;  2K03 A;  5C0X I;  2JN4 A;  2QDB A;  3GTG H;  3IFD A;  5LHY 1;  4UP7 A;  5C3X A;  5IY0 A;  4DV3 L;  4LFC Q;  5IT9 E;  3JAM E;  4WOR A;  4EGV A;  4FF2 A;  3J7A F;  1PYW D;  1R4Q B;  2NWG A;  3SE0 A;  4L5R C;  3I4N H;  2F0G A;  1OXT A;  4KI0 A;  5KNC A;  1QG7 A;  2JA8 G;  1PFS A;  1CM9 A;  4GOP A;  1G29 1;  5FLX L;  2C5C A;  3K6O A;  2Q8I B;  1STA A;  2ZJP A;  1QCB D;  2E76 C;  4FYD A;  1HZC A;  2IHF A;  2IX3 A;  3A56 A;  1PYS B;  1X3P A;  1Y8N B;  3ULP A;  3HRZ C;  2FXQ A;  5IP7 G;  4NXN L;  1K9M C;  4A4I A;  3FDT A;  3K5L A;  4HIO A;  4ZKC B;  4A75 A;  4DR5 Q;  2UU9 L;  4EX5 A;  4A3I G;  2Z4I A;  2YTY A;  4EQN A;  5GAG C;  3DM3 A;  2ALY B;  1SFO B;  1OXU A;  1WTH A;  2KEE A;  4LF8 Q;  1F2L A;  1LUZ A;  1YI2 A;  1SR3 A;  4L5S A;  3QOJ A;  1L2F A;  1S5E D;  3QIA A;  2D62 A;  1Y8O B;  3E0E A;  3S1R B;  4WRD A;  3UE1 A;  5C0X G;  3IKJ A;  4V19 0;  1C9O A;  1TS3 A;  1J8I A;  4IUT A;  4OX9 L;  1M90 C;  4XIG S;  3KJP A;  4Y7N H;  3M3Y B;  2AKW B;  3D4D A;  4RGT A;  4GLA C;  4TQU S;  5BN5 A;  1JE5 A;  4QY7 A;  3GQB A;  2NVT B;  4YY3 Q;  2VZA A;  5IGF A;  4KKS A;  1WTP A;  1FYC A;  4A3G H;  1UE7 A;  4IUU A;  1Y8P B;  5C4J B;  4BY1 B;  4RMF A;  1STY A;  2PZW A;  4CGY B;  4KD4 A;  2IY5 B;  4X65 Q;  4UDU C;  3Q24 A;  4QMG A;  1ICF B;  1SRO A;  4WJW A;  2K6A A;  3RUZ A;  1VQB A;  3BVZ A;  5GAH C;  2WFW A;  4BY7 H;  3EIV A;  5GRO A;  2ICE C;  4DUY Q;  2CWP A;  3J80 L;  3HOY H;  2B2W C;  3HOX G;  3WDN A;  1NNX A;  3S1Q B;  2DNE A;  1R4P B;  3T1Y Q;  1O7Y A;  2JE6 I;  1QZG A;  3H6M A;  3L0O A;  4IJH A;  2YV5 A;  1EUJ A;  1D5M C;  2JXM B;  1JT8 A;  2WB1 G;  2E2J H;  5EKK A;  5IOD A;  3DXJ C;  4OWW B;  4CDF C;  4XYO A;  3NBH B;  4IOA A;  4U68 A;  4CBV A;  3CW2 C;  3SK8 A;  3BG3 A;  4KJO A;  1U4M A;  5TSS A;  3CAM A;  1K3R A;  1UUP A;  4UAI A;  1RDP D;  2O2L D;  1NJI C;  1IYU A;  1Y1W G;  1K8G A;  4A93 B;  4DV7 Q;  2WIN B;  1HR0 W;  2VB3 X;  1RKN A;  1PHJ A;  2SNS A;  5K36 H;  3GTL H;  2N3S A;  3KLS X;  3KF6 B;  3ZJY C;  5A2Q E;  5LMN Q;  3S16 H;  4A3F H;  1ROD A;  3GTL B;  2CH4 W;  3TP5 A;  1RF2 D;  4A3L H;  1EY7 A;  4RGN A;  4JI0 L;  3O13 A;  5LMU L;  1B9M A;  4QF4 A;  3P1H A;  5GQO A;  4DR3 Q;  2G9H D;  1KNE A;  4H02 A;  1HR0 Q;  1E2W A;  2GVA A;  4DV2 Q;  3I55 A;  2PYK A;  5JJL A;  4K8I A;  2JA9 A;  1SRU A;  3J80 E;  4OO1 H;  1X3F A;  4NKL A;  4ABN A;  2VQF L;  4IFD J;  1G2S A;  1SE8 A;  1DGS A;  2A1A A;  3F8T A;  2D0O A;  1CHP D;  3BZC A;  5M5W H;  1EFW A;  1MIU A;  5LL6 X;  1YNX A;  1XNR Q;  1M8A A;  1ENC A;  3I7F A;  1SMY D;  5FJ8 G;  1ZXT A;  5JJK A;  1EOT A;  1QZH A;  2KEC A;  2R92 B;  2JQO A;  4JI3 L;  1Z47 A;  1ASY A;  1KRS A;  2ZTD A;  1SE4 A;  2JA8 B;  4GN5 A;  4BA2 I;  1V43 A;  3PO3 H;  1DXM A;  2XSC A;  1QJO A;  4RKB A;  1I4Q A;  2G5D A;  3PUX A;  3G6E A;  1HUN A;  3RMH A;  4DR7 L;  2XGT A;  4RH6 A;  4H13 C;  1GUT A;  5M3M G;  1EYG A;  3K7A H;  1VQK A;  1PH5 A;  1K28 A;  2ID0 A;  5FO8 B;  5I6Y A;  4POG A;  3T13 A;  4DR2 Q;  2HHH Q;  2F0M A;  4ODG A;  1AE2 A;  3TRE A;  5KRU A;  3D8G A;  2EE1 A;  4A3I B;  4BXX G;  5IGE A;  4WFN 3;  1IBK Q;  1IBL Q;  3ND8 A;  1PVO A;  1HNZ Q;  1SYC A;  2WAQ E;  4LWC A;  1XMQ L;  1SSO A;  4DV5 Q;  3HKZ G;  2PNH A;  2V1C C;  2XRS D;  5CV7 A;  2LY7 A;  3K59 A;  1I6H H;  2JA5 H;  4B3M L;  3CCL A;  3S14 B;  4FVM A;  3JC6 6;  4CJ0 B;  2F1M A;  3T1H Q;  5ELE A;  3TP7 A;  3QOL A;  4PZ8 A;  1I6H B;  3HGB A;  4XT3 B;  2RVL A;  2B2V C;  3U4V A;  2B3G A;  1E22 A;  2L9H A;  2Q2U A;  2NZO A;  1TWC B;  4M8A A;  2IWH A;  1JE4 A;  3L7Z C;  3UDF A;  1CKO A;  1ICW A;  3KDF A;  1LM0 A;  1LT5 D;  3I90 A;  4NPS A;  3RLO A;  2B39 A;  4KLK A;  2H1E A;  2HQL A;  4X3U A;  2OEO A;  3OWF A;  4DU9 A;  2ENB A;  2EJM A;  5IP9 G;  2RF4 A;  1YNN D;  1WOC A;  2CKZ B;  3S1N B;  3MFG A;  4JV5 Q;  1HQM C;  1VQJ A;  1MGS A;  3U58 A;  3OYY A;  4RKL A;  3BDC A;  3SDZ A;  3HOX B;  1FNV A;  2NVY H;  1BDO A;  1FGB D;  4DV0 L;  2F0I A;  2NYZ D;  3OPO A;  1WTR A;  4C3I H;  4MZ9 A;  5I2X A;  3RN5 A;  4IUP A;  3EN2 A;  2NVQ H;  5E7N A;  1YZ6 A;  2WB1 B;  5EQ0 A;  3TZD A;  4LF7 L;  3M4O B;  3H0G G;  1M1K C;  3S17 B;  3UDG A;  2J4X A;  1W3S A;  1JQY D;  2LFN A;  4ZQ3 A;  2B63 G;  3SHL A;  4XQQ A;  1I5F A;  1E2V A;  4LF5 Q;  3TS0 A;  1WI5 A;  3CC7 A;  3SGI A;  1UAP A;  4N9P A;  2MUY A;  1XPR A;  2DN8 A;  1E24 A;  1F9P A;  2SNM A;  2NVX B;  2F0V A;  4DF7 A;  2PW7 A;  4LUZ A;  1G2T A;  2LXK A;  1Y1W B;  1GHK A;  4GKK L;  2UXD L;  2MGS A;  3TBI B;  1X9N A;  3A8I E;  3NTI A;  1JJ2 A;  5C3E G;  1HNW L;  2R7Z H;  4JBW A;  2JEA I;  3PIO A;  4ID6 A;  1C4Q A;  3G71 A;  4K5V A;  2R6G A;  3G48 A;  1W6K A;  1AE3 A;  3MHB A;  2LS0 1;  2F4I A;  3FKI H;  4A76 A;  2K33 A;  3CPW A;  2HD3 A;  2F0D A;  4QIW B;  3OOC A;  1SMY C;  1VQ4 A;  3DHQ A;  2N88 A;  4K6D A;  4NB3 A;  3SXH A;  5DM7 3;  4KHP Q;  3A0J A;  2MFI A;  4N9T A;  4DNR B;  5FJ8 H;  4LUV A;  1QNK A;  4I65 A;  2UXB L;  3MZ5 A;  3GP7 A;  1BBX C;  3CCJ A;  4CKC A;  4QL5 A;  4QCL A;  4LF9 L;  1UE1 A;  2D5D A;  1LYL A;  3I91 A;  1QUQ B;  1WFQ A;  4UP8 A;  4DK0 A;  1I4G A;  2K04 A;  1SNQ A;  2PMZ B;  3PUV A;  2A8V A;  1CHQ D;  2NN6 H;  1YHA A;  3NBI A;  2XVS A;  5M5X H;  1GUG A;  4DR4 Q;  1PFN A;  4DR6 L;  1WJJ A;  2I46 A;  1NCV A;  1PDQ A;  4FXK C;  1C48 A;  3ERO A;  5E1F A;  5DEH A;  4B3T L;  5EPK A;  2EQS A;  2EYM A;  1OXV A;  4QIW E;  5M3M B;  3GTM B;  4HCE A;  4I7A A;  4TKO B;  2VXW A;  2KCM A;  3SK4 A;  4CJ2 C;  1HNX Q;  1LTT D;  5KIX A;  1ZKO A;  1HHV A;  4DPG A;  3PIO 3;  4DAP A;  5H1S E;  3J81 i;  2KHI A;  4IUV A;  1TT2 A;  2PMZ E;  3IAY A;  1GD7 A;  1XNQ L;  4HCS A;  3DLL A;  1VQP A;  5KND A;  1J5E L;  1LLR D;  3I8Z A;  3TN2 A;  3A8J E;  2WKC A;  4RCO A;  5L37 A;  1QVG A;  3C3L A;  3HKZ B;  5IGC A;  3ERQ A;  3PF4 A;  1CQF A;  1XMO Q;  5ELB A;  2ZXP A;  3SEB A;  4R8I A;  1DM0 B;  1E1T A;  2Q2H A;  2BA1 A;  2B8F A;  3EA6 A;  3KLW A;  5DNF A;  1C0A A;  1SNM A;  2TMP A;  5G3L F;  1D1K A;  4R4Q A;  3AQQ A;  1BKB A;  4YHH Q;  1X3Q A;  1YNN C;  1MKH A;  2ZXO A;  3S9W A;  1VF7 A;  5IP9 H;  1CTM A;  1X55 A;  4JI8 Q;  5I9P A;  1VQC A;  4A3G G;  1B50 A;  2DNC A;  2RQX A;  5IGD A;  1SYF A;  2RSO A;  3HKZ E;  4DGZ A;  1O7Z A;  1YIJ A;  4B08 A;  1EY9 A;  1SJH D;  1ZYR D;  2Y0S G;  2CH4 A;  3E6Z X;  2KCC A;  5EBC A;  4KY7 A;  1MSH A;  4ZRZ A;  5IYD H;  1J9O A;  4BY7 G;  3GTQ H;  3HP3 A;  3NQT A;  1FR3 A;  1JOO A;  2O4X A;  3HOY G;  3GTQ B;  3H0G B;  2IX0 A;  4HIM A;  1NSN S;  3P7J A;  1V1P A;  4OO1 I;  1Z9F A;  2B63 B;  1TS2 A;  2N78 A;  3U9S A;  4XYQ A;  1NAP A;  5IT9 L;  1PLF A;  2DGY A;  2UUA Q;  1VQ6 A;  1XPU A;  5EAY A;  3T4A C;  3CCR A;  3Q23 A;  2K5D A;  2E2D C;  1AZP A;  4A3D G;  1Y14 B;  4A3C H;  2O5J C;  1X3E A;  1VQD A;  4NXM Q;  4MHE A;  2B29 A;  4FP5 D;  1OXS C;  2F3I A;  1STH A;  2NZ1 D;  3H3V C;  3TME A;  5C3E B;  2CW0 D;  5EKI A;  4J15 A;  3MAQ A;  1YHB A;  3KJO A;  4BA1 I;  5JAV A;  3OTO Q;  4IPD A;  1BO0 A;  3PQI A;  2VQE Q;  1SE3 A;  5BN3 A;  2L1B A;  4A3F G;  2EXZ A;  2ZJR A;  2OF1 A;  2KVM A;  3NEN A;  4A3L G;  2X69 A;  2EZV A;  1WYD A;  2BH8 A;  2R7D A;  4ZUI A;  1N8R C;  1Q7Y C;  2BCO A;  3H09 A;  4X66 L;  1RTN A;  4L6T B;  5C6A A;  4AYB G;  3URY A;  4OO1 G;  3D6W A;  2J0T D;  1GKH A;  3KF8 A;  5D14 A;  3UE0 A;  2M2L A;  1BCP F;  3DUZ A;  1TR5 A;  2P5Z X;  1V9P A;  1QB5 D;  2F0J A;  3IL8 A;  3GTP H;  3GTG B;  4Q5V A;  1SLJ A;  1Q8I A;  3DM1 A;  3CCV A;  3A74 A;  4HJ9 A;  3GTK H;  1U4L A;  4N8X 1;  4IFD I;  3I4N B;  3I73 A;  4OHJ A;  3HOV H;  3I4M H;  4P73 A;  1KL9 A;  1AZQ A;  3PO3 G;  1HPC A;  2AQ2 B;  4JI6 Q;  1FNU A;  2FJ2 A;  3TRZ A;  1VS0 A;  3DEO A;  4P75 A;  5CBE E;  1N36 Q;  1JCK B;  3VR4 A;  3BZD B;  1B1Z A;  3P75 A;  1V8Q A;  2F03 A; 
#chains in the Genus database with same CATH homology
 3NEM A;  5GAE C;  1NBW A;  3TS2 A;  5GQO A;  4DR3 Q;  1VQI A;  3M4O H;  1HR0 Q;  4H02 A;  2IX1 A;  1YJW A;  3S17 H;  2GVA A;  4B3T Q;  4DV2 Q;  3I55 A;  1RL2 A;  3HOZ G;  4LFB L;  5JJL A;  4JI2 Q;  2JA9 A;  1J6Q A;  5IYC G;  4DV6 Q;  1SRU A;  3CCU A;  1XPO A;  4GNX B;  4BBR G;  3D0F A;  1X3F A;  4IFD J;  2VQF L;  2NZH A;  4X65 L;  1SE8 A;  1DGS A;  2A1A A;  5JEA G;  3F8T A;  4A3J G;  2D0O A;  2K5N A;  1PH8 A;  2OWO A;  4DAY B;  2F52 A;  4K0K L;  2PI2 E;  2NVX H;  1N32 Q;  3BZC A;  5M5W H;  1EFW A;  1MIU A;  1YNX A;  5BR8 L;  1XNR Q;  5J3B A;  3I7F A;  5FJ8 G;  2F4V Q;  1TXY A;  2OQK A;  4P71 A;  1Q82 C;  1L1O A;  1P16 A;  3CQZ H;  3J80 i;  1EWI A;  1Y1W H;  5JJK A;  2E2I H;  1QZH A;  3RZO H;  2PI2 A;  2UUB Q;  2ZTE A;  2JQO A;  4O2D A;  4A3K H;  1D7Q A;  4JI3 L;  1Z47 A;  1ASY A;  1KRS A;  1Y1V G;  2ZTD A;  1YJ9 A;  1I3Q H;  3E9H A;  4GN5 A;  1ASZ A;  1XNQ Q;  1PH2 A;  2JA6 G;  1V43 A;  2JA5 G;  3HOW G;  3PO3 H;  1B8A A;  2YYZ A;  1J5E Q;  3KF6 A;  1HNX L;  2AHO B;  1X54 A;  1Q8K A;  2K5V A;  2IHE A;  3PUX A;  5C44 H;  3GTJ H;  3G6E A;  1KQS A;  4DR7 L;  3F1Z A;  2XGT A;  4JI5 L;  3STB C;  1VQM A;  5IYB G;  1IL2 A;  3KDF B;  2K75 A;  5M3M G;  4DV3 Q;  4IFD G;  1S3O A;  3LGJ A;  4LF6 L;  5DLQ E;  2Z0S A;  1EYG A;  3K7A H;  3TQY A;  3FP9 A;  4X64 Q;  4AQY L;  1VQK A;  1PH5 A;  5IYC H;  2ID0 A;  4POG A;  1I50 H;  4BBR H;  1YHQ A;  4DR2 Q;  2HHH Q;  4JI7 L;  1IXR A;  4MNO A;  1NY4 A;  2H5X A;  1AE2 A;  3I2Z A;  3TRE A;  4A3J H;  1XMO L;  1VQ7 A;  4C2M H;  4L5Q A;  1KRT A;  4DUZ L;  4Y52 H;  1UE5 A;  3KOJ A;  4LFC L;  2AWN A;  4BXX G;  2MNA A;  1PV4 A;  1FJG L;  1IBK Q;  1IBL Q;  1PVO A;  5M5Y H;  1HNZ Q;  1U5K A;  1SMX A;  1VQF A;  4IPG A;  4DV4 Q;  4JI4 L;  3S1M H;  1T9H A;  2WAQ E;  1KXL A;  2OTJ A;  4PG3 A;  1NE3 A;  4NXN Q;  4LWC A;  4PZ6 A;  1Y1V H;  1XMQ L;  3CXC A;  5FLM G;  4DV5 Q;  4FDB A;  2JEB I;  4WJ4 A;  3HKZ G;  2PNH A;  2V1C C;  4R1J A;  4YHH L;  3D31 A;  4JI6 L;  2JA6 H;  3HOW H;  1I6H H;  1BBU A;  2JA5 H;  3CCS A;  4B3M L;  3CCL A;  5IWA Q;  3JC6 6;  3CC2 A;  3T1H Q;  1PH6 A;  2UU9 Q;  4PZ8 A;  2KCT A;  4WJ3 M;  4GKK Q;  3GD7 A;  4LUO A;  4GLX A;  4JI1 Q;  3W1G A;  2Q2T A;  3U4V A;  2VY3 A;  4JI8 L;  4LNQ A;  3CPF A;  4R4C A;  2B3G A;  3H3V I;  5M3M H;  1E22 A;  3RR5 A;  2Q2U A;  3GTM H;  2NZO A;  4LFA L;  1JMC A;  3I4N G;  4JBM A;  4R4O A;  4LF4 L;  3L7Z C;  3UDF A;  1CKO A;  3KDF A;  2YTX A;  4GLV B;  1KHI A;  4DR5 L;  3BJU A;  3U50 C;  4A3D H;  4JYA Q;  2DUD A;  3ULJ A;  1LM0 A;  2MQH A;  2N49 A;  4X62 L;  3RLO A;  1BBW A;  4NPS A;  2KEN A;  1Q1E A;  4KLK A;  1I94 Q;  4OX9 Q;  1LTL A;  4JC0 A;  2HQL A;  4POF A;  5ELO A;  2UUC Q;  3CP0 A;  2NN6 I;  1JB7 A;  1L1O B;  2ZTC A;  4LF8 L;  1SN8 A;  4BXX H;  3M4Q A;  2ES2 A;  5IP9 G;  2ASB A;  2RF4 A;  1TWF H;  1WOC A;  2UUB L;  1GVP A;  4YCW A;  2CKZ B;  1H95 A;  3KFU A;  4JV5 Q;  3PUW A;  1FVI A;  2CWA A;  1VQJ A;  1JJG A;  2EXD A;  2CCZ A;  5FLM H;  3PUY A;  3U58 A;  3OYY A;  4HIK A;  1R9T H;  3AFQ A;  4OWT B;  1OTC A;  1KIX A;  1IBM Q;  3PUZ A;  3W5O A;  4EQ5 A;  3J81 j;  4HID A;  3RN2 A;  1MJE A;  1VQ9 A;  2NVY H;  5ELN A;  1IYJ B;  1VQO A;  4P72 A;  4IO9 A;  3S2D H;  4DV0 L;  2KHJ A;  2R7Z G;  3CME A;  2E5L Q;  3EBE A;  1GO3 E;  2A19 A;  4JOI C;  4DKA C;  4YY3 L;  3W1B A;  2R92 G;  2VUM G;  4C3I H;  4IJL A;  4MZ9 A;  4X64 L;  3RN5 A;  1N34 Q;  2UUA L;  3EN2 A;  1E3P A;  5E7N A;  2NVQ H;  1K8A C;  2OQ0 A;  1D8L A;  1MJC A;  1YZ6 A;  2WAQ G;  1EQQ A;  1PH7 A;  4LF7 L;  3H0G G;  1B70 B;  1VQN A;  1M1K C;  3B6Y A;  3UDG A;  1CUK A;  3FKI G;  1HZ9 A;  1W3S A;  2B63 G;  3I56 A;  4LF5 Q;  1I5F A;  4NXM L;  1V1Q A;  2GN5 A;  3TS0 A;  2YU9 H;  1WI5 A;  1VQL A;  3S24 A;  3CC7 A;  4IOC A;  3SGI A;  1N33 L;  1CKN A;  4PZ7 A;  5M3F G;  1XPR A;  1X56 A;  5C0X J;  1B7Y B;  1PH1 A;  1E24 A;  1HNZ L;  1CSP A;  3NEL A;  4IPH A;  4JCV E;  4R4I A;  3MEF A;  3KYH C;  4DUY L;  1TWH H;  4JOI A;  1UEB A;  3M9B A;  3CCM A;  4B3R Q;  1NTG A;  4LUZ A;  4BY1 G;  3OTO L;  3H15 A;  4A3B G;  2LXK A;  2RHS B;  2LXJ A;  4X66 Q;  2VQE L;  1YIT A;  4DR1 L;  2I0Q A;  4BBS G;  3RLN A;  4DR6 Q;  2UXC L;  2CQO A;  1K83 H;  1HZA A;  3T1Y L;  2NN6 G;  2BA0 A;  2AMC B;  4A3M G;  2QEX A;  1SFO H;  4GKK L;  3PV0 A;  2BH2 A;  2UXD L;  2ZM6 L;  1AH9 A;  3UDX A;  1X9N A;  1JJ2 A;  1HNW L;  4A3E G;  3RLF A;  5C3E G;  3J81 c;  2R7Z H;  4JBW A;  2JEA I;  2JA7 H;  4OWX B;  3PIO A;  4ME3 A;  2I5M X;  3G71 A;  2R7F A;  1KD1 C;  1UWV A;  1S40 A;  1E1O A;  3A5U A;  2IT1 A;  3J7A 5;  3S1R H;  3HOZ H;  2JJQ A;  2R6G A;  5HGQ A;  3G48 A;  4UPA A;  2RCN A;  3H0G H;  4AYB E;  3VDY A;  2EIF A;  1AE3 A;  4A76 A;  3FKI H;  3CPW A;  1X6O A;  2B63 H;  1XTD A;  3U4Z A;  2KBN A;  3M3Y H;  1YBY A;  1EIY B;  4B3S Q;  3HFZ B;  1VQ4 A;  2K52 A;  4MTN A;  4NB3 A;  2VL6 A;  4P74 A;  3H3V H;  3M7N A;  5HY6 A;  3PF5 A;  4KHP Q;  2NVT H;  3A0J A;  1A0I A;  4R4T A;  2MFI A;  3PO2 G;  4DK3 C;  1CKM A;  1YVC A;  4LUV A;  5FJ8 H;  4JI0 Q;  4KHZ A;  5LMU Q;  2UXB L;  4DV7 L;  3FHW A;  3M4P A;  3CCJ A;  1TWA H;  5C4J H;  4HJ5 A;  4QL5 A;  4BY1 H;  4A3B H;  4LF9 L;  4GKJ L;  1UE1 A;  4LFB Q;  1LYL A;  1QUQ B;  1WFQ A;  3K80 C;  4UP8 A;  1A8V A;  4DAM A;  3G4S A;  3CCE A;  5LMN L;  3PUV A;  1P8L A;  5IT9 c;  3UDI A;  4DV1 L;  3JAM c;  2A8V A;  2K5H A;  2QGQ A;  2VNU D;  4A3M H;  4JBJ A;  1YHA A;  4YCV A;  2VQF Q;  1K0R A;  1N36 L;  5M5X H;  3AFP A;  4DR4 Q;  4RG1 A;  5AJ3 L;  4YCU A;  4DR6 L;  1WJJ A;  4A3E H;  5C3E H;  1S72 A;  4JG2 A;  4DR3 L;  1Q1B A;  1N34 L;  1K73 C;  1HR0 L;  1X3G A;  5BR8 Q;  5IYB H;  4A93 G;  3IRB A;  3AYH B;  3BZK A;  4B3T L;  4DV2 L;  3MXN B;  3WWV A;  2EQS A;  2OTL A;  4JI2 L;  4GOP B;  4DV6 L;  2C35 B;  2K14 A;  1OXV A;  4QIW E;  3F2C A;  2K4K A;  3AEV A;  2N8N A;  3S1Q H;  4UP9 A;  2GVB A;  5K36 G;  4JI3 Q;  1Q12 A;  4XTC S;  2E8G A;  3GTO H;  3PSI A;  1CKN B;  5GAD C;  3M85 A;  4HJ8 A;  3TEH B;  1N32 L;  1XJV A;  2KCM A;  3GO5 A;  2Y0S E;  3PIP A;  1XNR L;  2L15 A;  1FL0 A;  1HNX Q;  2F4V L;  1YJN A;  3PO2 H;  4DPG A;  1G6P A;  3L2P A;  1O7I A;  4DR7 Q;  1QVF A;  1Q81 C;  5C4X G;  5JJI A;  5H1S E;  4OXP A;  3J81 i;  2KHI A;  4JI5 Q;  3HOU G;  4GOP C;  2OCE A;  4O0A A;  3CC4 A;  2PMZ E;  1EIF A;  4LF6 Q;  1VCI A;  4AQY Q;  1GD7 A;  1XNQ L;  2JK8 A;  4YWK A;  1C7Y A;  3DLL A;  1VQP A;  1J5E L;  1QVG A;  1EQR A;  1EOV A;  4OON A;  4JI7 Q;  1QUQ A;  1NMF A;  1VQE A;  5LMN W;  4QJF A;  5C0X I;  3I4O A;  3PF4 A;  1JJC B;  3PGZ A;  4QGU A;  1XMO Q;  2ZJQ A;  3GTG H;  1N9W A;  4UP7 A;  2AWO A;  1FGU A;  2K50 A;  4DUZ Q;  5IY0 A;  4A93 H;  4DV3 L;  4LFC Q;  3S2H H;  1E1T A;  5IYD G;  2Q2H A;  2BA1 A;  1FJG Q;  1BVS A;  3KLW A;  4L5R C;  3I4N H;  1OXT A;  4KI0 A;  1C0A A;  4JI4 Q;  2JA8 G;  4JBK A;  1PFS A;  2XTI A;  4DR2 L;  2HHH L;  4GOP A;  1G29 1;  3CD6 A;  1HJP A;  1XMQ Q;  4R4Q A;  2ZJP A;  3AQQ A;  1BKB A;  4YHH Q;  1IZ6 A;  1HZC A;  2IHF A;  2VS1 A;  1TWG H;  4B3M Q;  1MKH A;  1PYS B;  3JAM i;  3RNU A;  1IBK L;  2VW9 A;  1IBL L;  3ULP A;  5FLX c;  5IP9 H;  2LSS A;  1A62 A;  1X55 A;  2PQA A;  5C4X H;  4DV4 L;  2FXQ A;  1GM5 A;  2D0P A;  3HOU H;  4JI8 Q;  5IP7 G;  4NXN L;  1PH4 A;  4HJA A;  4LW1 A;  3PCO B;  1VQC A;  1K9M C;  4A3G G;  4LFA Q;  4DV5 L;  4A4I A;  3STB D;  4HIO A;  1UE6 A;  3OW2 A;  4LF4 Q;  1G51 A;  4A75 A;  3HKZ E;  3A5Z B;  5IWA L;  2Z6K C;  4DR5 Q;  1YIJ A;  1PH9 A;  3T1H L;  2UU9 L;  4EX5 A;  4A3C G;  1RIP A;  4A3I G;  3CMA A;  2HIV A;  2YTY A;  4X62 Q;  4TVA B;  4L5T A;  2Y0S G;  5GAG C;  3DM3 A;  4JI1 L;  1KAW A;  2ALY B;  3CCQ A;  1OXU A;  4LF8 Q;  3K81 C;  1VQ8 A;  1LUZ A;  2I5H A;  2WB1 E;  2R92 H;  2VUM H;  1YI2 A;  5IYD H;  1SR3 A;  4L5S A;  1L2F A;  4BY7 G;  1PA6 A;  4HJ7 A;  2D62 A;  3E9I A;  4C3J H;  4UY8 C;  4ALP A;  3GTQ H;  2JA8 H;  4JYA L;  3E0E A;  4GNX C;  3UE1 A;  5C0X G;  3HOY G;  1HZB A;  2E2H H;  1C9O A;  2IX0 A;  1I94 L;  4HIM A;  4OX9 L;  1M90 C;  4XIG S;  1WCM G;  2UUC L;  3GDE A;  4OO1 I;  1Z9F A;  3KJP A;  5IE8 A;  4Y7N H;  2Z6K A;  5M3F H;  2AKW B;  2N78 A;  4GLA C;  4TQU S;  4DNI A;  2CFM A;  4DV0 Q;  1JE5 A;  4QY7 A;  1VQA A;  2HIX A;  3RZD H;  5IP7 H;  4YY3 Q;  4JV5 L;  2VZA A;  2DGY A;  1A63 A;  4AIM A;  4A3G H;  1UE7 A;  4YWM A;  2QA4 A;  4C3H H;  3KF8 B;  2UUA Q;  1XPU A;  1VQ6 A;  5EAY A;  3CCR A;  3K0X A;  4LF7 Q;  4BBS H;  4RMF A;  1IBM L;  1HH2 P;  4A3D G;  1Y14 B;  4A3C H;  1X3E A;  1VQD A;  2YTV A;  4GNX A;  4A3I H;  2IY5 B;  4NXM Q;  2I5L X;  4X65 Q;  3HKS A;  2B29 A;  2E5L L;  1PYB A;  1SRO A;  4GN3 B;  1N33 Q;  3ICE A;  1OXS C;  2F3I A;  3ULL A;  4X6A H;  1VQ5 A;  4J15 A;  1VQB A;  5GAH C;  2WFW A;  1L0W A;  4BY7 H;  2R93 G;  1NMG A;  3EIV A;  5GRO A;  1YEZ A;  4DUY Q;  1YHB A;  3KJO A;  4K0K Q;  2CWP A;  4BA1 I;  4LF5 L;  3OTO Q;  3HOY H;  4IPC A;  4IPD A;  3HOX G;  3S14 H;  2VQE Q;  3HOV G;  1CSQ A;  4BA2 I;  4DR1 Q;  2UXC Q;  3I4M G;  4A3F G;  2MO1 A;  1WCM H;  2ZJR A;  3ER0 A;  2JE6 I;  3T1Y Q;  1QZG A;  2HT1 A;  4YWL A;  3NEN A;  3L0O A;  2RHQ B;  4A3L G;  4IJH A;  4PMW A;  3Q8D A;  2PQA B;  2UXD Q;  2YV5 A;  1WYD A;  2BH8 A;  2R7D A;  4APV A;  1EUJ A;  3J80 c;  2ZM6 Q;  1HNW Q;  1W2B A;  1TWC H;  1JT8 A;  1Q86 C;  2WB1 G;  2E2J H;  1N8R C;  4B3R L;  1Q7Y C;  4OWW B;  3CF5 A;  2ATW A;  4X66 L;  1E7Z A;  3NBH B;  4IOA A;  2WP8 J;  4AYB G;  4OO1 G;  1OXX K;  4GS3 A;  1GKH A;  3UE0 A;  3CW2 C;  3ERS X;  1QVC A;  2Q2I A;  1V9P A;  1X65 A;  3S15 H;  3CAM A;  3F2D A;  3K8A A;  1K3R A;  3GTP H;  1Q46 A;  3S1N H;  1SLJ A;  4GN4 B;  5JEA J;  1NJI C;  3CCV A;  1VQG A;  3A74 A;  1Y1W G;  4HJ9 A;  1K8G A;  3GTK H;  4DV7 Q;  1PH3 A;  4QQB X;  2UXB Q;  4AH6 A;  2R93 H;  1HR0 W;  4A3K G;  1PHJ A;  4IFD I;  4LF9 Q;  2N3S A;  3HOX H;  3KF6 B;  4B3S L;  3GTL H;  3HOV H;  4DR4 L;  4GKJ Q;  3ZJY C;  3I4M H;  1U0L A;  1KL9 A;  4P73 A;  5LMN Q;  4A3F H;  3PO3 G;  3S16 H;  4KHP L;  3F2B A;  4DV1 Q;  4JI6 Q;  1KC8 C;  3TRZ A;  1VS0 A;  4A3L H;  4P75 A;  5C44 G;  1N36 Q;  4JI0 L;  1L1O C;  4DK6 C;  2MO0 A;  3K7U C;  5LMU L;  3BU2 A;  5AJ3 Q;  3J7Z C;  2JA7 G;  1VQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...