3HOWH

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howH00
4LF6L 1S3OA 2ZM6L 5HGQA 4JI5Q 2ZJRA 2R7ZG 2OTJA 3KDFA 4JI0Q 5FJ8G 1PFSA 4C3IH 3BJUA 1PYBA 2AMCB 5M3MH 5GAGC 3F1ZA 4X6AH 1HZCA 3AFQA 3PUXA 5GAEC 1RIPA 1XPRA 2VZAA 4GKKL 3I7FA 4JI0L 1SLJA 1XTDA 4YY3Q 2Z6KA 1JMCA 4IJLA 1E7ZA 1JB7A 1TXYA 5DLQE 3PUWA 4R4OA 4R1JA 2AHOB 2PQAB 3CMEA 1QZHA 1JJCB 1OXXK 4R4QA 2UUCL 4HJ8A 1P16A 3STBC 1FVIA 1O7IA 3S1RH 4GKKQ 2Q2TA 5LMNL 1EIYB 2CQOA 3CC4A 5IYBG 4A3FH 4DR1Q 1Q82C 1V43A 1TWCH 4X66L 1VQBA 3UE1A 4AYBE 3PUVA 1Y1VH 2JQOA 3CCRA 4DV6Q 2PI2E 4MTNA 4A75A 3S1MH 1HNWL 5IP9H 1I94Q 3TQYA 2KHJA 2VY3A 3SGIA 3PGZA 5M5WH 1VQEA 1N8RC 1HNXL 1IBKL 4X65Q 4BY1H 3GTOH 4L5SA 2KENA 4GKJQ 3RN5A 1N32Q 4IJHA 2BA0A 3KF6A 3HKSA 3RZDH 1IL2A 2Y0SG 1LYLA 2KBNA 1HR0W 2NVTH 1N34Q 2ZTCA 4Y52H 2BA1A 4A3CG 2A8VA 2K50A 4TQUS 1E3PA 4LFCL 3L0OA 1TWAH 1Y1VG 3PV0A 4A3LH 4WJ4A 1HZAA 1Q8KA 4GN5A 2RHSB 2WAQG 4EQ5A 4OONA 4JG2A 1SE8A 1X3FA 4P75A 3PF4A 4TVAB 1N34L 4POFA 4BXXG 2IHEA 1NE3A 4LF5L 1X54A 1SR3A 4XIGS 1EWIA 3ULPA 4A3BG 4DR6L 3W5OA 2BH2A 1B7YB 3M3YH 4A3CH 1OXSC 2EQSA 2ZJPA 2F4VQ 1EYGA 1BBWA 1GM5A 2QGQA 3I4NH 4NXMQ 2K4KA 1L2FA 2JK8A 1EOVA 1PV4A 2YU9H 2ES2A 2OTLA 1VQCA 1Q7YC 1FGUA 1UE5A 1E1TA 1SROA 4LFAQ 4DAYB 2Z6KC 4DKAC 1ASZA 1LUZA 2PMZE 2CFMA 1KRSA 1OXUA 4JI5L 3ULJA 1SFOH 1NMFA 3PUZA 3TREA 2F4VL 5M3FG 2K5NA 4JI4L 2VNUD 2UXCQ 4JYAL 3ICEA 4DR2L 2WAQE 4KHPQ 3PO2H 1UE6A 3B6YA 2R7ZH 2AWOA 4LF8L 3JC66 1Z9FA 1K0RA 2JA8G 5JJIA 2DGYA 5C0XG 2IHFA 3F2DA 4PZ6A 2K52A 5FLMG 1VQGA 1VQ9A 3UDFA 4YCWA 3EN2A 2PNHA 3K7AH 1UWVA 2E8GA 3PSIA 3TS0A 2Y0SE 1VQAA 4LWCA 1X9NA 1MKHA 4JYAQ 2RF4A 1XMOQ 4DR2Q 1VQFA 1PH7A 2OQKA 1EUJA 4IPCA 3CC2A 4DR7Q 3CCJA 1S40A 3CPFA 2UXDL 2JEAI 3E0EA 4DV2L 1R9TH 2OWOA 3HOZG 3FKIH 3NELA 1UE7A 2B63G 4JOIA 1A62A 1G6PA 2D0PA 3HOZH 3AFPA 4L5QA 2KCTA 1Q1BA 4JI6Q 2YV5A 1PA6A 2C35B 2E2HH 1XNRL 1D7QA 4P71A 4DR1L 4DV0Q 3PO3H 4DR5L 4POGA 5FLMH 1K3RA 1HZ9A 3HOVG 2UXBQ 1N36Q 4JI3Q 2JA5G 5BR8Q 1JE5A 4O0AA 1I94L 1IBMQ 4DUZQ 1SRUA 1VQLA 1HNXQ 4IFDI 3M9BA 1UE1A 3KLWA 3LGJA 1PH9A 4B3SL 3J7ZC 1PH1A 1PH3A 5M5XH 3KDFB 1VQ8A 1X65A 1IYJB 1X56A 1PH2A 3BZCA 4B3ML 4B3TQ 5IY0A 2JJQA 4A3LG 4LF9L 1VQOA 4A3IH 1KQSA 1IBML 1PVOA 4NPSA 4YCUA 2JEBI 3CCUA 3NBHB 2K5HA 2N49A 5IP7G 3F2CA 1Y1WH 3HOYH 1RL2A 2FXQA 2MQHA 3HKZE 3H3VI 3FHWA 4A3BH 2UU9Q 1PHJA 4OWTB 4RG1A 5LMNW 3F8TA 1WFQA 3S1QH 3S2HH 3Q8DA 1SMXA 2LSSA 3PF5A 1X55A 2JE6I 5C44H 4YCVA 1JT8A 1CKNB 2NVYH 3CAMA 3D0FA 4DK3C 1YITA 4J15A 1VQPA 1PH4A 1X3EA 1HNZL 1J6QA 1WJJA 2AWNA 4DAMA 1L0WA 4DV3L 2CCZA 4R4CA 1P8LA 3ULLA 3PIPA 1PH5A 2UU9L 2JA6G 3EBEA 1Y14B 4NXNQ 3BU2A 1V9PA 3D31A 2D62A 2WP8J 1PYSB 1XPOA 4LF4L 4JI1L 1YJ9A 3J81i 3PUYA 1U5KA 2ZTDA 4OWXB 2UXCL 2R6GA 4QIWE 4YWMA 3J81c 2EIFA 2R92H 1UEBA 2N8NA 4KHPL 3KF8B 1Q86C 1KRTA 2E5LL 4YWKA 3RNUA 4A3MH 1L1OA 3K0XA 1J5EL 4DV5Q 2MNAA 4L5RC 5C44G 3M4QA 3A5UA 2ZM6Q 4IO9A 2JA6H 4JI2Q 3M4PA 1B8AA 4B3RQ 3KFUA 4LUVA 4HIOA 1VQ6A 2I0QA 4BA1I 5GADC 1QUQB 1YJNA 1XMOL 2HHHL 4OO1I 3JAMc 3RLNA 5K36G 5AJ3Q 1HR0Q 1JJGA 1NBWA 1OXVA 4GNXA 4DV2Q 1DGSA 1QVGA 4DV5L 4LF6Q 5IP7H 2A1AA 4C3HH 1WOCA 3I4NG 2I5LX 4JBJA 2VQEQ 4LFBQ 4IFDG 5IE8A 4JI2L 2WFWA 1YBYA 2I5HA 3FKIG 4GLAC 1ASYA 3RLFA 1CKOA 2Z0SA 4IPDA 3CPWA 2JA5H 3M7NA 1G291 3HOVH 2F52A 2PQAA 2NVXH 4JI3L 4L5TA 5BR8L 2ZJQA 1V1QA 2RCNA 2ZTEA 1HH2P 4IPGA 3CW2C 3GTMH 5GAHC 1VQ7A 4OX9L 1K9MC 5C3EH 4UPAA 3RN2A 2OCEA 3MEFA 4GOPA 2YTXA 5FLXc 4P73A 3PCOB 2HT1A 4A3DG 4A3FG 1KXLA 3AYHB 1EQRA 4P72A 4X62Q 3G6EA 3GDEA 3G71A 1VQ4A 3L7ZC 1N33L 1GKHA 1N9WA 3E9HA 4HIDA 4DR4L 4A3KH 4DR6Q 5M3MG 4DV6L 2PI2A 2RHQB 3T1YL 3H3VH 4BY7G 4AQYL 2UUAQ 4OX9Q 1XJVA 4LUOA 4LW1A 2MFIA 4EX5A 5IP9G 4BBRG 1VQMA 4GS3A 3U4VA 1NMGA 1VCIA 1FJGL 4A3GG 1QZGA 4A3DH 2UUBQ 1C0AA 4GOPB 4LFAL 2ALYB 2MO1A 4HIMA 3W1GA 1GVPA 1L1OB 1E1OA 4OXPA 5C4XH 5C4JH 1JJ2A 3A0JA 4GOPC 1EQQA 2WB1E 2VQFL 4XTCS 1TWFH 5M3FH 2IT1A 1VQHA 4RMFA 3T1HL 4PG3A 1I5FA 2E2IH 1E24A 4BXXH 1FL0A 3GTPH 5IYDH 3IRBA 4LF8Q 1VS0A 4YWLA 1A8VA 4DV3Q 1KC8C 5C0XI 5JEAJ 1BKBA 4UP7A 1I3QH 2ASBA 2GVBA 3A74A 3CF5A 3DM3A 4A3JG 4LF4Q 4JI1Q 2K14A 3S16H 4A3GH 3J7A5 3CMAA 4NXML 1BVSA 4KHZA 2B3GA 3MXNB 4Y7NH 3CXCA 4A3MG 3M4OH 3GTQH 1CKNA 3DLLA 2UXDQ 4HJ7A 3HFZB 1J5EQ 1Y1WG 3HOYG 2CWPA 4ME3A 3KJPA 2K5VA 4X64Q 5IWAL 3OTOQ 1KL9A 4YHHL 1EFWA 2Q2UA 3J81j 2B63H 3S2DH 5E7NA 4AH6A 4B3RL 4JI6L 4JI4Q 4JBKA 1XNQQ 2BH8A 3GTGH 2XTIA 3EIVA 2MO0A 3ER0A 2JA9A 3KJOA 3UE0A 5GQOA 1MJCA 5AJ3L 4JBWA 3CCVA 2I5MX 4DV1L 1CUKA 1YJWA 1G51A 2UUCQ 4KLKA 2NZOA 4GN4B 2QEXA 2R93H 3K8AA 3HOWH 4PZ7A 3HKZG 5IWAQ 3OTOL 3CC7A 4LF7L 1K83H 2K75A 2Q2IA 2JA8H 4DK6C 5HY6A 3J80i 5LMNQ 3KF6B 1A63A 2JA7G 3KYHC 4UY8C 1XMQQ 1N36L 1MJEA 4C3JH 4DV1Q 2NVQH 2N78A 3I2ZA 5ELOA 4HJ5A 3CCMA 4LF9Q 4DV7Q 4LF7Q 2IX0A 3RZOH 1XPUA 1X3GA 5IYDG 3J80c 4GKJL 1N32L 1QVCA 4JC0A 1XMQL 1L1OC 4GNXC 1HZBA 2CWAA 3ZJYC 4DR4Q 4DR5Q 3VDYA 3CCQA 3W1BA 5EAYA 2UXBL 4LFCQ 4KI0A 2QA4A 4HJ9A 4DV7L 4R4IA 2UUAL 2JA7H 4IFDJ 2VW9A 2GN5A 4O2DA 3GTLH 2YTVA 3STBD 1GO3E 2GVAA 5ELNA 1YNXA 1OXTA 3ERSX 1VQIA 4B3MQ 2Q2HA 1W2BA 5C4XG 1Q12A 4P74A 2N3SA 1HJPA 1IBKQ 1HNWQ 5LMUL 3S17H 2IY5B 3RLOA 1I6HH 1I50H 1LM0A 3JAMi 5FJ8H 2R7DA 2NN6G 2VQFQ 3K7UC 4X65L 1IXRA 1PH6A 1GD7A 4JV5Q 1B70B 3I4MH 2KCMA 5C0XJ 4UP9A 1YIJA 2CKZB 3S14H 2DUDA 2E2JH 4BBSH 1WYDA 3K80C 4GN3B 1NY4A 1Q1EA 4QJFA 4JI8L 4IOCA 4A3KG 4JCVE 3CCLA 4GNXB 1X6OA 5JJKA 2KHIA 3OW2A 4LUZA 4OWWB 5IT9c 2YTYA 3GO5A 4QL5A 1S72A 2XGTA 1HR0L 3S24A 2WB1G 1YHAA 3CD6A 3CCEA 3HOXH 3I4MG 4H02A 4JI8Q 3NEMA 4BBRH 4X64L 2ID0A 4YHHQ 1YVCA 2VQEL 1NJIC 3I55A 5IYBH 1VQKA 2VUMH 4UP8A 4C2MH 4DUZL 4QQBX 2E5LQ 5JJLA 3U4ZA 4DR7L 1CKMA 4MNOA 1WI5A 3H0GH 1M1KC 3G4SA 1CSPA 4PZ8A 4QY7A 3I4OA 1NTGA 4R4TA 4WJ3M 4BY1G 2H5XA 1VQ5A 4QGUA 2NZHA 4GLXA 2IX1A 5M5YH 3OYYA 4YY3L 4DR3Q 1VQNA 3PO2G 1QVFA 3FP9A 1VQJA 4X62L 4BY7H 2HHHQ 4A93H 1SN8A 1AE2A 1YHQA 5GROA 1C7YA 1T9HA 4HJAA 2YYZA 1TWGH 3GTKH 5JEAG 4NB3A 3CP0A 1WCMG 3H15A 1A0IA 3PIOA 4AQYQ 2LXKA 4LFBL 2VUMG 4BA2I 4APVA 4A3EG 1YEZA 3BZKA 4DV4Q 4JI7Q 1CSQA 4DR3L 3M85A 3K81C 4ALPA 3G48A 3HOUG 1M90C 2UUBL 4IOAA 1Z47A 1AE3A 1PH8A 4B3TL 3KOJA 4X66Q 3HOXG 1K73C 4DUYL 3S15H 4PMWA 1Q46A 3TS2A 4IPHA 3RR5A 4K0KL 2EXDA 4AYBG 2HIVA 3S1NH 1E22A 3TEHB 3F2BA 3U58A 3WWVA 1K8AC 3NENA 1IZ6A 1WCMH 3AQQA 1K8GA 4DV4L 3AEVA 3GD7A 4MZ9A 4JI7L 2NN6I 2HIXA 3GTJH 4HIKA 1IBLL 4JBMA 2OQ0A 5IYCG 2V1CC 1KD1C 1LTLA 1XNRQ 1VQDA 1N33Q 1YI2A 4DV0L 2A19A 1D8LA 2VS1A 4DNIA 4FDBA 3CQZH 4DUYQ 5LMUQ 4K0KQ 2L15A 3T1YQ 1H95A 4GLVB 1KHIA 4JOIC 4AIMA 4B3SQ 3PO3G 3UDXA 4A3JH 3HOUH 1QUQA 1KIXA 1U0LA 1IBLQ 3H0GG 1BBUA 4JV5L 1FJGQ 4BBSG 3E9IA 4DPGA 3CCSA 1HNZQ 4A93G 1KAWA 4A3IG 4LF5Q 2AKWB 5H1SE 1TWHH 3L2PA 3I56A 1OTCA 1YZ6A 2D0OA 1AH9A 4NXNL 3UDIA 2R92G 3TRZA 2ATWA 1EIFA 4LNQA 1C9OA 2VL6A 5IYCH 2B29A 1XNQL 2R93G 5C3EG 3A5ZB 3T1HQ 3UDGA 2HQLA 1Q81C 4OO1G 4A76A 2F3IA 4A4IA 4A3EH 2LXJA 3U50C 1YHBA 2R7FA 1W3SA 5J3BA 1MIUA 3HOWG
chains in the Genus database with same CATH superfamily
2D5DA 2ZM6L 1WTHA 3URYA 4S3SA 3BJUA 1RHPA 5GAGC 3BYTB 2HCIA 3AFQA 3PUXA 3J81L 3A8IE 4CHTB 1SLJA 1AZQA 3OMCA 4OO1H 3A8JE 4DAVA 3M7GA 2SNSA 3PMFA 4KD3A 1TWCB 3ZYYX 2AHOB 1GUWA 1QZHA 1R4QB 2SEBD 1AEXA 4Y7NB 1O7IA 1WTOA 2Q2TA 5LMNL 2VB3X 3CRKC 4A3FH 4DR1Q 2G9DA 3PUVA 4A75A 4BS9A 2PI2E 1I94Q 2B2TA 2VY3A 1HNXL 4XDXA 1EY7A 1IKMA 4EGVA 1BF4A 3DWAA 3KF6A 5FO7B 1KABA 1LYLA 1N34Q 1QCBD 1S5DD 3OPOA 2K50A 2M2LA 1Y8OB 3EFXD 1TWAH 3PV0A 5KNCA 1PZJD 3GTQB 4G7ZC 2NTSA 1IHZA 3VA5A 4WFN3 2ZT9C 4POFA 2IHEA 2JP1A 3ULPA 4XIGS 1TWAB 2BH2A 3M3YH 2F0KA 1OXSC 2EQSA 1S5FD 1AFPA 2EE1A 3P75A 2QGQA 1LTRD 5FO8B 5JOBA 4N9PA 1GXDC 2K4KA 1K28A 4O1NA 2YU9H 1Q7YC 1UE5A 1E1TA 2JA5B 3KLSA 1ML0D 1LUZA 2PMZE 1KRSA 2F4VL 3PQIA 1PZID 4KHPQ 2F0QA 3FPPA 1HHVA 2JXMB 3RZOB 2R7ZH 2F0OA 5EPKA 4EQOA 4LF8L 3JC66 2H1EA 1NR4A 2F0IA 4RWSC 2PNHA 3K7AH 1UWVA 3PSIA 4C3HB 5I4DA 1VQAA 2A74C 1A2TA 2FJ2A 4JYAQ 2OQKA 1EUJA 2R7ZB 3CC2A 2XN9C 2UXDL 2OWOA 2L9HA 1G6PA 1TU2B 1E2VA 3AFPA 1Q1BA 5FOBB 1O80A 5M3FB 2E2HH 4FF4A 4DR1L 4DR5L 3D6WA 5FLMH 4J8QA 4HMJA 3D4RA 2JA5G 4ZAIA 1I94L 1B9NA 3EVQA 1UE1A 3LGJA 5M5XH 1H9SB 1NNXA 3C1EA 3QOLA 4HSVA 3BZCA 1RTNA 5EKKA 4K8JA 2M9VA 1JB3A 4RA8A 2EY1A 1KQSA 2K28A 1PVOA 2KQ3A 2RDFA 4NPSA 2JEBI 2MUYA 1PTOB 2N49A 3F2CA 4L8JA 3H6MA 4BBRB 1EQTA 1RL2A 3KBGA 2QF7A 1XWEA 3PIO3 2UU9Q 5EPJA 2Q8IB 1HTPA 4RG1A 5LMNW 3ONAB 5FLXL 2XNAC 1X55A 3KF8A 1JT8A 4MN3A 1B50A 3V96A 4J15A 1VQPA 2QILA 2E76C 1X3EA 1MD2D 1J6QA 1WJJA 3BDLA 4DAMA 4HSPA 2CCZA 4R4CA 1P8LA 2FMCA 1U9RA 5ELBA 2JA6G 3BU2A 1ILQA 2OF1A 3VR3A 4JI1L 4YWMA 2KEEA 4QIWE 4KHPL 4CDCC 3MXPA 5KGUA 1R4PB 1I6VC 1EYCA 1VF5C 2ZM6Q 3M4PA 1B8AA 3KFUA 4LUVA 5T1GA 1KLGD 5A35A 2I0QA 2JA7B 4BA1I 5E3FA 1QUQB 5GADC 1YJNA 2HHHL 2F0WA 5JPMC 1MHWC 2K04A 1OXVA 4RKLA 2A68D 4FYDA 2A1AA 3SR1A 2I5LX 1LV9A 1SDFA 3NK9A 4IFDG 4JI2L 2O5JC 3FKIG 3Q0AA 1C4QA 3HRZC 2Z0SA 3K58A 1QJOA 2JA5H 4ABNA 1G291 1SFOB 3N52A 4ZKBB 1V1QA 4RHRA 1V1PB 3PIP3 4UPAA 2OCEA 5FLXc 4P73A 4A3DG 4A3FG 1KXLA 3VA7A 3NQTA 3GDEA 3I70A 1IL8A 4CJ2C 4RGNA 3T1YL 2UUAQ 4LUOA 2F0TA 3IFDA 4A3DH 2UUBQ 1Y8PB 1JR0D 1X3QA 5KYIA 3DEOA 4HIMA 2DNEA 2WINB 2Z6BA 3I91A 4A3GB 2N88A 2IT1A 3T1HL 4CJ1B 1NCVA 4OL7A 1ESRA 4DV3Q 1A8VA 2J4XA 1KC8C 5C0XI 3NE5B 1BKBA 4UP7A 5D14A 4OIJA 5M5XB 2ASBA 2GVBA 3A74A 2K6AA 4K6DA 3S16H 4JI1Q 4A3GH 4GZYC 2KUMA 3J7A5 4NXML 1BVSA 1SNDA 5IGEA 3GTQH 3DLLA 2BDNA 2CWPA 1KDAA 1WD0A 1JE4A 4YHHL 2Q2UA 4B3RL 2EYHA 4JI6L 2BH8A 2XTIA 4KK7A 5M5WB 3ER0A 4DUZQ 1N36Q 5GQOA 4JBWA 3G6JB 2I5MX 3SK8A 4IQZA 4B9XA 1YJWA 4RHSA 2UUCQ 1B3AA 5CORA 4GN4B 1KAAA 5IWAQ 2D9UA 3OTOL 4CKEA 1K83H 2Q2IA 3CC7A 4LF7L 2X69A 2K01A 4M1UB 4P2CB 3MA2B 2JA7G 2Z8LA 1VF7A 1XMQQ 1MJEA 2ENBA 4DV1Q 2N78A 1PRTC 5ELOA 3S9WA 1EWHA 4LF9Q 4DV7Q 4FO2A 1X3GA 5IYDG 1QVCA 3HEJA 4H7BA 1KLUD 2VXWA 4DR5Q 3VDYA 2A6HD 2UXBL 3NSWA 1EY9A 3MXNA 4R4IA 2RDGA 3BVGA 2JA7H 2VW9A 3TP7A 4O2DA 3GTLH 4NMZA 1PMRA 2GVAA 5ELNA 4B3MQ 4DAYA 1RTOA 4P74A 5C5LA 5LMUL 5CBEE 4ZYSA 3AB9A 2IY5B 4KJNA 2R7DA 2CW0C 2X6LA 2SDFA 1BCPF 3TZUA 3R3OA 4JV5Q 2KCMA 3S14H 4BBSH 1XTCD 4GN3B 1Q1EA 4A3KG 1V8QA 1X3PA 2CH4A 2KHIA 5EKIA 4OWWB 1FNVA 3GO5A 3D3RA 3IKJA 4RCOA 2XGTA 4I65A 3S24A 1ET6A 1HUNA 4RFBA 2CW0D 1BO0A 2F0NA 4L6TB 3I55A 1EEID 4IUVA 3T56B 4C3IG 1ESFA 5K5PA 5JJLA 4DR7L 1EU4A 1XX8A 1CSPA 4PZ8A 1NTGA 5DM63 4GLXA 2IX1A 1VMCA 1QVFA 5T1IA 1SMYC 2HHHQ 4XXEA 1AE2A 5GROA 4HJAA 5JEAG 2F0PA 1IW7D 3NWSA 3H15A 2VUMG 4DV4Q 1W6KA 1BR9A 3GTOB 3HOUG 3SE0A 3KOJA 3R93A 4X66Q 3WOFA 3TSSA 4DUYL 4PMWA 4K0KL 3S1NH 3NXWA 4MZ9A 4JI7L 3GTJH 1SE4A 5IYCG 1VQDA 1YI2A 3CQZH 1TWHB 4OELB 1RCVD 4IUQA 2L15A 5ISRA 5C3WA 1MI2A 1BQQT 3PO3G 1I4QA 1X32A 1QUQA 1U0LA 1IBLQ 1BBUA 2B2TC 4JV5L 4BBSG 4DPGA 3CCSA 1BBXC 2SNMA 1QG7A 4A3IG 4WRDA 3I56A 1OTCA 1STAA 2D0OA 2A68C 1C48A 3OW7A 4NXNL 3TRZA 1C9OA 3HOUB 5CC4A 1XNQL 2EY6A 1CT1D 3MEHA 1D1IA 3UDGA 4OO1G 3D4DA 4U673 2RKSA 4RGTA 3FPUB 3SEBA 4KTAA 4RKBA 5HGQA 4JI5Q 4JI0Q 5K36H 4HCEA 4DU9A 3SVMA 4ZUIA 1PRTF 5KRUA 3DHQA 4XYQA 4K5WA 3A7LA 3F1ZA 4X6AH 2FMMA 2JYOA 2ICEC 2FHTA 3C2PA 4HCSA 2Z6KA 2F0FA 2EYPA 2B8FA 1QE6A 3TP8A 1E7ZA 1TXYA 5DLQE 4PMCA 5CV7A 1SYFA 4NDXA 1P16A 5M5YB 1I4PA 3HG9A 1EIYB 3CC4A 5IYBG 2XSCA 2X6GA 3BG3A 1V43A 4X66L 1KDCA 4AYBE 1IBKL 1Y1VH 2JQOA 5ELEA 4DV6Q 4MTNA 5IP9H 3VYTA 4DF7A 4FXGC 3GTOH 4BY1H 1QB5D 5BN4A 2KENA 3E6ZX 4GKJQ 2M00A 2R93B 1NR2A 2BA0A 4HTHA 3RZDH 2Y0SG 3F2UA 1HR0W 4Y52H 4ZK9B 1SMYD 2BA1A 4FNFA 3S1MB 2A8VA 1E3PA 2R3ZA 2PO4A 3L0OA 4HN7A 1HZAA 4GN5A 4H13C 1NUCA 2B2YC 2A69C 1FYCA 2RSOA 2O4XA 3PF4A 1X3FA 4P75A 2NYZD 1N34L 3I4LA 4LF5L 1X54A 4A3CH 1PXUA 4ILWA 2ZJPA 1UAPA 4TRDA 3OWEB 1EYGA 4XQJA 1STYA 3I4NH 1U4PA 2WV6D 1L2FA 1EOVA 3UI2A 1Q8IA 2ES2A 3C3LA 1PYWD 1FGUA 4DGZA 4LFAQ 4DKAC 1ASZA 2CHBD 3SDZA 3ULJA 2CFMA 4KHVA 4JI5L 3TREA 2K5NA 5D3DA 4JI4L 2UXCQ 3ICEA 4DR2L 2WAQE 3PO2H 1UE6A 1LTID 1S5ED 2AWOA 1CI3M 2JA8G 2H4OA 4LAAA 4ME5A 4PZ6A 3F2DA 5FLMG 1VQGA 4MTKA 5J22A 2BE5D 3HOZB 2QEJC 1VQFA 3DXJC 3VR4A 1HQMC 1S40A 3CPFA 3NBHA 1R9TH 3FKIH 2F0MA 2P5ZX 1PRTD 1F2ZA 3HOZH 4YIJA 4L5QA 1SNMA 1M4VA 2KHSA 1XNRL 2PZUA 4P71A 3KK7A 1HZ9A 2Z9HA 1G8ZD 5BR8Q 4O0AA 1IBMQ 1QOHA 4IFDI 1EFID 3KLWA 4B3SL 3K5NA 1PH1A 3K5LA 3KLRA 3A7AB 1SSOA 3R8BA 1SJED 3DWQA 3HZXA 4B3TQ 5CGKA 2L5TA 1BDOA 1D2BA 4C56C 2L4NA 2F3VA 3CCUA 1S4ZA 2K5HA 3RZDB 4RH6A 2XVSA 5G3LD 2NVTB 2EZVA 2AQ1B 2EDGA 2B2UA 4RGMA 3CU7A 5KEEA 4XQQA 3FHWA 4PV1C 1PHJA 3Q22A 2KCNA 2I07B 3S1QH 1G6ZA 3S2HH 2QKIC 4OGQC 1SMXA 2LSSA 2F1MA 2JE6I 5CV6A 4A3FB 1XXGA 1K8OA 1L0WA 4DV3L 3ULLA 2NVQB 1STEA 2UU9L 1Y14B 2EYOA 2K5WA 1A3VA 1WTVA 4NXNQ 1CQFA 3D31A 3NTHA 3RMHA 3PUYA 1U5KA 2ZTDA 2UXCL 3J81c 4NP5A 3KF8B 4PNYA 2E5LL 4A3MH 3J7AV 3VYRA 4L5RC 3M4QA 3A5UA 4IUPA 4IO9A 2JA6H 1EY8A 2C5CA 5IGGA 4B3RQ 1VQ6A 4OO1I 3JAMc 1IKLA 4IZ8A 2DY7A 5AFWA 4X3KA 4FP5D 5IOCA 2CQAA 1JJGA 4DV2Q 1DGSA 5LL6S 2PW7A 4LFBQ 4U68A 2HCCA 1H9RA 2WFWA 3TP5A 3MHBA 3SXHA 4BWGB 4G57A 3M7NA 3CRLC 3L9AX 2F52A 5BR8L 3GTMH 5GAHC 1VQ7A 1K9MC 3MEFA 4LK1C 4J6HA 2K7VA 2HT1A 3AYHB 1EQRA 4P72A 4X62Q 1BNZA 1GHJA 1GKHA 4DR4L 3I90A 5M3MG 4DV6L 3FMCA 4BY7G 5CV9A 4AQYL 2IX3A 1XJVA 4LW1A 5JEAH 1VQMA 2HDLA 3U4VA 1VCIA 4KJOA 4XQNA 4A3GG 5I2YA 2ALYB 3NUCA 1GVPA 4OXPA 1E1OA 3W1GA 5C4XH 5C4JH 1LTAD 1QNKA 1EQQA 1O7LA 5M3FH 4RMFA 4PG3A 1PFMA 3W2DA 1SAPA 5IYDH 1STHA 3IRBA 4YWLA 1RF2D 4WORA 3ERQA 4LF4Q 4A3JG 1HCZA 1HXYD 5BN3A 2NBFA 3K5OA 1RD9D 2LFNA 3MXNB 2CVRA 2K5DA 4A3MG 3QOJA 3J80E 3M4OH 1IW7C 1SYCA 4HJ7A 2UXDQ 4B08A 4OIKA 4IUUA 1KL9A 5DM73 2R61A 5E7NA 5BN5A 3AU7A 1EY6A 4JI4Q 3DM1A 3GTGH 3EIVA 1O7ZA 1MJCA 3CCVA 4BY1B 1PTOC 3I4NB 2AUKA 4KLKA 2QEXA 3HOWH 2XWBB 3HKZG 2K75A 1SNPA 1CQVA 2JA8H 1H9MA 1A63A 1SYGA 3GV6A 3KYHC 4K2LA 4DXFA 3IL8A 4C3JH 1SJHD 4IFDH 3GV3A 3CCMA 1T5XD 2XRQD 1AW7A 4LF7Q 1PRTB 2IX0A 3BVZA 4V0BA 1N32L 4IURA 1XMQL 4GNXC 3ZJYC 4E6IA 1STNA 4DR4Q 5I2XA 1MBYA 1EOTA 1EZ8A 3W1BA 2AQ3B 3GTMB 1JWMD 4LFCQ 4N9TA 3MXGA 4DV7L 4F88A 1EYDA 2GN5A 2DJGC 2YTVA 3OOCA 3STBD 1F2MA 3ERSX 5ELDA 1A3TA 2Q2HA 4RGOS 4OEMB 1HJPA 4FXKC 1A6XA 1HNWQ 1PFBA 5KNBA 2IJ0A 5I6WA 2PCFB 3JAMi 5FJ8H 3K7UC 2A6ED 1TY2A 3EQLC 5C0XJ 3SK5A 4K6LA 1LABA 1MGSA 1NY4A 4JI8L 3IFTA 4GNXB 1ILPA 3WOEA 2B39A 5JJKA 3DUZA 4K5VA 5IT9c 3FKIB 2YTYA 3AMUA 1B2TA 2DN8A 5COYA 1S72A 2EYJA 2WB1G 1YHAA 3CD6A 1UNSA 4H02A 1JC7A 3NEMA 2ID0A 2VQEL 1II3A 2RDHA 3LX0A 2E5LQ 1SNCA 5C4JB 5C44B 3G4SA 2ZXOA 4BY1G 5JVH3 5M5YH 4YY3L 2DY8A 3D4WA 4DR3Q 1VQNA 1FR3A 3MTSA 2EJFC 4A93H 1SN8A 5E4XA 3HOWB 1TWGH 2QCPX 3CP0A 2J7ZA 1WCMG 1VMPA 3PIOA 4LFBL 1KDBA 4APVA 1YEZA 3BZKA 1CSQA 3G48A 1M90C 4QUFA 2UUBL 1Z47A 1AE3A 1D6EC 2B2UC 3TS2A 1STBA 3C1FA 3RR5A 2EXDA 3DWPA 3TEHB 1K8AC 3WWVA 1BCPC 3FVQA 2QW7A 1K8GA 4DV4L 1H9JA 2NN6I 5JVG3 2RBMA 1STGA 5IT9L 4DV0L 2B2WA 1D8LA 4DNIA 3S15B 4JK1C 4DUYQ 4LMQD 1TS2A 5D65A 3T1YQ 4GLVB 3LWUA 3UDXA 4A3JH 3H0GG 1HNZQ 4LF5Q 4R8NA 2AKWB 1TWHH 1YZ6A 1GUNA 5L37A 3UDIA 2R92G 3P1HA 2B29A 3T1HQ 2E2JB 1W6JA 2F3IA 1T5EA 1E0BA 2LXJA 1HQRD 1W3SA 5J3BA 2EYLA 2OTJA 1S5BD 4ULLA 4G4KA 3SK4A 2PW5A 4OHJA 5M3MH 1SYEA 4DK1A 1EY0A 1HZCA 4NW2A 1DCZA 1CK1A 1XPRA 1R9TB 2VZAA 4GKKL 4DFAA 3I7FA 4JI0L 1PTOF 4YY3Q 5FK9C 4C3IB 4IJLA 3S14B 4DA2A 1JB7A 2Q8TA 3PUWA 4R4OA 1Q3LA 2PQAB 1JJCB 1OXXK 2UUCL 2HUGA 3S1RH 2KA7A 1A3UA 3VYUA 4R9WA 1HUMA 1LTBD 1D5XC 1Q82C 2Z1CA 1VQBA 3UE1A 3CCRA 2E2IB 3TQYA 2KHJA 3SGIA 3PGZA 1VQEA 5J39A 4X65Q 1DD2A 1Z7TA 4L5SA 1Z6HA 2B2VC 1BXTA 1PTOH 2NVTH 2ZTCA 5C6AA 2R92B 2KEDA 1LO5D 1ONLA 1Y1VG 4RCNA 4A3LH 4WJ4A 2EYMA 3FEWX 2RQXA 1Q8KA 4A93B 1DOKA 4EQ5A 2Q8RE 5E1FA 1EY4A 2L12A 1SE8A 1TY0A 1LTGD 2BOSA 4TVAB 4DR6L 4A3BG 1B7YB 4JW0A 4KY6A 2C9OA 4UHVA 1GM5A 3MAQA 5IGFA 1PV4A 2VB2X 1HRJA 2OTLA 1CA5A 1VQCA 2B2VA 4DAYB 1SROA 2Z6KC 5C4HA 3DMUA 3KBXA 3K0YA 1SYBA 1CHQD 4K2KA 3PUZA 1DJRD 1E2ZA 2FINB 1LT6D 2VNUD 1WTQA 1FD7D 1ENAA 4G7OC 3CQZB 3B6YA 1I6HB 4KN4C 3CHBD 1F9SA 3HKZB 3BS1A 1Z9FA 1K0RA 5JJIA 2DGYA 5C0XG 2IHFA 2K52A 1VQ9A 3EN2A 2E8GA 1X9NA 4KKTA 2LY7A 2RF4A 4DR2Q 3PO2B 1DOMA 3DEPA 4IPCA 1RODA 2JSOA 4DR7Q 2L1BA 3QR8A 3GTLB 4FF1A 2JEAI 3E0EA 3NPPA 4DV2L 3NELA 1UE7A 2F03A 1J8IA 4JOIA 2MP1A 4QMGA 4F87A 2IW3A 4WJWA 2KCTA 2YV5A 3TBIB 2C35B 1PA6A 1TWFB 3PO3H 4POGA 4N8FA 1K3RA 4QUCA 3HOVG 5FLXE 1JE5A 4A3IB 3I4MB 4J1MA 2MGSA 1SNOA 1PH3A 1SEBD 3H0GB 1VQ8A 1X65A 5CV5A 1IYJB 1X56A 1PH2A 3PO3B 4I7ZC 4C1NK 3MFYA 2JJQA 4A3LG 1CZWA 4A3BB 1V1PA 2RVLA 3J80L 5FKAC 3NBHB 3MXUA 5IP7G 2XRSD 3OWFA 1GUSA 1HTLD 3P20A 3H3VI 4OWTB 3SHLA 3PF5A 4CDFC 5C44H 3D0FA 3CAMA 1DONA 2V4DA 1HNZL 4JVZA 1DM0B 2XWJB 1PH5A 2ICIA 3EBEA 4KV6A 4CGYB 2LKVA 2HD3A 2WP8J 4LF4L 2IWHA 2XIWA 2IPKD 3TDQA 2R6GA 2MHVA 2EIFA 1UEBA 2N8NA 4YWKA 4MIUA 1L1OA 4DV5Q 2MNAA 2WIIB 3MZ5A 3CKIB 1U4RA 1K3BC 2WKCA 1XMOL 1BUVT 1HR0Q 1G2TA 4GNXA 3IAYA 3GTJB 1JOKA 1FGBD 3I4NG 4JBJA 5IE8A 1GOZA 1YBYA 1ZYRC 2B2WC 3CPWA 4IPDA 4KN7C 5EQ0A 1UEAB 3HOVH 4H0LC 4A3KB 4JI3L 2G5DA 3R2TA 2RCNA 4IPGA 1HH2P 3BDOA 3CW2C 1HA6A 3A56A 4OX9L 5C3EH 2K05A 2MJ8A 4GOPA 2YTXA 4Z9CB 3PCOB 3G71A 4QQBX 1D1KA 1N33L 1ICFB 3L7ZC 2NUCA 2ZXPA 1N9WA 2EPBA 1H9SA 2NVXB 4X3TA 2EOTA 4N8X1 2PI2A 1ZYRD 1LLRD 2RHQB 5C4XB 2LS01 1ENFA 4HEDA 1D5MC 4EX5A 5IP9G 1I50B 3H94A 1FJGL 1NMGA 3SK6A 3QIAA 3WDNA 5DEHA 1F2YA 1TT2A 4ZUJA 3S1RB 1PDQA 3R2IA 1L1OB 1EL0A 2F0LA 1TVXA 1I3QB 3BYYB 4R8IA 2WB1E 4GOPC 4XTCS 1JOOA 3GP7A 1VQHA 2F0DA 2E2IH 1E24A 4BXXH 2EXZA 3GTPH 4JPBW 4LF8Q 4BY7B 2K33A 1TIID 4LJZC 5JEAJ 2EYFA 4MHEA 2IL8A 1B44D 3CF5A 3NP8A 3X3NA 4CKBA 2B3GA 4K14A 4Y7NH 5A2QL 2VUMB 4C2MB 1J5EQ 4ME3A 3KJPA 4X64Q 3S2DH 3J81j 1VDZA 4AH6A 2NTTA 3S16B 3I73A 2KECA 3KJOA 2JA9A 3UE0A 5AJ3L 4G7HC 2NWGA 1F9QA 1CUKA 5NUCA 3S1QB 2BDOA 3TN2A 3T53B 2RA4A 5HY6A 5LMNQ 3KF6B 5CBAE 1HFGA 3GTGB 4UY8C 1N36L 4A3JB 2NVQH 1FNUA 3I2ZA 5IGDA 5C5MA 3BZDB 3QWNA 1JWUD 1LTTD 4KKSA 1HFNA 3RZOH 2PZWA 3I72A 2RSNA 1JOQA 4DNTB 4HAEA 3P7JA 3MFGA 3CCQA 5EJWA 3I3CA 5EAYA 4KI0A 3LNNA 1ZXTA 4IFDJ 5FO9B 2A6EC 1U4LA 1CZGA 1RDPD 1YNXA 2WACA 1WTXA 2E74C 1W2BA 5C4XG 1Q12A 1IBKQ 1DYQA 4KMUC 1SBBB 1I50H 1LM0A 1SE2A 4A3DB 5G3LF 1B70B 1NSNS 3J7AF 3OIQA 1YIJA 2CKZB 2E2JH 1WYDA 3OHXC 3K80C 4IOCA 4JCVE 3CCLA 3S17B 1LT4D 2PMZB 1F9PA 3OW2A 4LUZA 2CH4W 3X3MA 4QL5A 1AP0A 1I4GA 3CCEA 5ELFA 3JAML 1ZKOA 4L63B 4BBRH 4X64L 1YVCA 2KOLA 4PMBA 4Q0FA 4IN3A 2KJXA 5A2QE 3HP3A 3C46A 2VUMH 1L0XB 1DOLA 3U4ZA 3E3XA 1CKMA 2B63B 1M1KC 2NVYB 3S2DB 3MWYW 5C3XA 1WTWA 2G9HD 3I4OA 1LT5D 4CBVA 2F0EA 3OYYA 3GTPB 3FP9A 1C7YA 1T9HA 3GTKH 4ZCKA 1Y1WB 3FRPB 3HOYB 1A0IA 1JICA 4ZKCB 2LXKA 4AQYQ 4A3MB 4A3EG 3M3YB 4JI7Q 3D6CA 4DR3L 3M85A 3K81C 4ALPA 1O7YA 1PFNA 3VYSA 3JAME 1JQYD 3S15H 4IPHA 1E22A 3KUPA 2A5HA 3NENA 5TSSA 1QWYA 3AQQA 3A55A 1QNUA 3GD7A 1IBLL 1IYUA 1M8AA 1KD1C 1LTLA 1XNRQ 1DXMA 5I9PA 2A19A 2VS1A 4K0KQ 1KHIA 4JOIC 4AIMA 4B3SQ 1G91A 3HOUH 1FNWA 1KIXA 1NAPA 3E9IA 1H9KA 1KAWA 3T16A 2PYKA 2F0HA 5H1SE 3L2PA 2DJFC 5ELCA 5CYUA 1KNAA 3O13A 5E4WC 4CDDC 1IYVA 2VL6A 4XYOA 1WVLA 3V05A 1V1OA 2HQLA 1Q81C 2O5IC 2OXPA 4B9WA 1C8CA 3U50C 2R7FA 3NQIA 1MIUA 4LF6L 1S3OA 2NZ1D 2ZJRA 2R7ZG 3KDFA 3K57A 5FJ8G 1PFSA 2PNRC 4C3IH 1PYBA 2AMCB 4C3HG 1I4RA 2Z4HA 4CJ0B 3H91A 1Y8NB 4KY7A 1JWSD 3NHHA 2O2LD 5GAEC 1RIPA 5JPNC 1PLFA 3H09A 1Y69U 1XTDA 3A8KE 2AUJD 1B1ZA 1JMCA 4ZQ3A 2F0UA 2L0CA 3T13A 5KNDA 2E2DC 4R1JA 2JN4A 1F2LA 3CMEA 4R4QA 1DZ1A 4HJ8A 3STBC 1ENCA 1FVIA 4GKKQ 3S2HB 2CQOA 4ID6A 1CHPD 1EYAA 2RCFA 1TWCH 1I4HA 4C1NI 3S1MH 5I9OA 1HNWL 4C3JG 5M5WH 1N8RC 1LACA 2A69D 3D8GA 5CV4A 4FF3A 3TMEA 1N32Q 3RN5A 4IJHA 2HQEA 3HKSA 1IL2A 3GQBA 2KBNA 5F2DA 3ND9A 4EVOA 1Y1VB 4IUNA 4A3CG 4TQUS 4LFCL 5LHY1 1YNJD 3EJIA 2RHSB 2WAQG 4OONA 4JG2A 4FXDA 1EU3A 4DXGA 1SE3A 1L0YB 2B2YA 1YNJC 1NE3A 4BXXG 1SR3A 1EWIA 3W5OA 1RKNA 2F4VQ 2F0SA 2L11A 3OMGA 1BBWA 4NXMQ 2JK8A 1HA5A 3ITPA 1K83B 3BVMA 5DNFA 5IIFA 2BE5C 1EY5A 3HOVB 4LF6Q 1SFOH 1OXUA 2F3WA 3NTKA 1NMFA 5M3FG 1LTSD 3J7YW 4JYAL 3K5MA 3LWEA 4A3EB 1BCPB 1AZPA 2E75C 3OIPA 3K6OA 4XT1B 3UDFA 4YCWA 3TS0A 2Y0SE 4FF2A 2EY5A 4LWCA 1MKHA 1XMOQ 1PH7A 1B3QA 5IT9E 1TR5A 3CCJA 1A15A 2EJMA 1EEFD 2B63G 2D2CC 2Z4IA 1JORA 1A62A 2D0PA 2OEOA 3Q6SA 4HR7B 4DN4M 4JI6Q 5C3EB 2A6HC 4IALA 1D7QA 2F0VA 4DV0Q 2A73B 2UXBQ 1TS4A 4JI3Q 4FVMA 1VQLA 1SRUA 1HNXQ 3M9BA 2WB1B 4Q5VA 1PH9A 1Q90A 3J7ZC 3W3AA 5EKLA 3T51B 4BBSB 3KDFB 4I7AA 2E2HB 4B3ML 5IY0A 4LF9L 2SOBA 1VQOA 4A3IH 5KYLA 1IBML 1AN8A 4K8IA 4YCUA 4UDUC 3GTKB 1BCPD 1Y1WH 3HOYH 2K32A 2FXQA 1CA6A 4F8MA 2MQHA 2TSSA 3HKZE 1TS3A 4AYBB 4A3BH 3F8TA 1WFQA 3Q8DA 1CTMA 4ZRZA 1QILA 2Y0SB 4YCVA 4X3SA 1CKNB 2NVYH 1YITA 4DK3C 3U9OA 1PH4A 2KVMA 2FFKB 2AWNA 2F4IA 1WCMB 3M4OB 2K1BA 4C3JB 3PIPA 1U4MA 1V9PA 2D62A 4V190 1PYSB 1XPOA 5CV8A 1YJ9A 3J81i 1MSGA 3VR2A 4OWXB 2YU9B 5CR3A 2R92H 3TZDA 1Q86C 1KRTA 3RNUA 3K0XA 1J5EL 5HGTA 3NTIA 2GA4B 4F7XA 5C44G 1OO9B 4HMIA 3BDCA 1B9MA 4JI2Q 4DK0A 4HIOA 1S5CD 2MPMA 3RLNA 5K36G 5AJ3Q 1GHKA 1NBWA 3E0JA 1QVGA 1B53A 2B8GA 4DV5L 5IP7H 1CM9A 3K7AB 1WOCA 2F0GA 4C3HH 2VQEQ 1ICWA 1WTRA 1PTOD 2I5HA 1J9OA 5DAUA 4GLAC 1HPCA 1ASYA 3RLFA 1CKOA 2NN6H 1MSHA 1GUOA 2PQAA 1SXTA 3T4AC 2NVXH 4L5TA 5EBCA 2ZJQA 1BOSA 3HS0C 3U9SA 1ET9A 2ZTEA 4EQPA 3RN2A 4H44C 3G6EA 1TS5A 1VQ4A 4HIDA 3E9HA 4A3KH 4DR6Q 3H3VH 4OX9Q 2MFIA 4BBRG 2I46A 4GS3A 2PZTA 1QZGA 1C0AA 5EPLA 4GOPB 1D5ZC 5EBDA 4LFAL 4X3UA 2MO1A 1JJ2A 4CDEC 3G7LA 4XT3B 3A0JA 3I8ZA 3VR6A 2VQFL 1TWFH 1F77A 3MVVA 5C0XH 1UUPA 3NBIA 1YNND 1I5FA 4PQXA 2WKDA 1FL0A 1VS0A 2EJGC 5EGTA 5J1ZA 2J0TD 3HOXB 2DNCA 2AQ2B 1I3QH 3DM3A 3ND8A 2K14A 3CMAA 3EA6A 4KHZA 3CXCA 4TKOB 1CKNA 3HFZB 1E2WA 1Y1WG 3HOYG 3J81E 4IUTA 2K5VA 5IWAL 3OTOQ 1EFWA 2B63H 4QCLA 4JBKA 1XNQQ 5I6YA 3HOZG 2MO0A 3VR5A 4DV1L 3M4YA 5CMDA 1I4XA 1G51A 2NZOA 2R93H 3K8AA 4PZ7A 4DK6C 3J80i 1K0SA 5M9OA 4KY5A 4QIWB 4NKLA 1EWCA 4HJ5A 1KNEA 3QO2A 1RJTA 1XPUA 3S1NB 4KD4A 1K8MA 3J80c 4GKJL 4JC0A 2PQEA 1L1OC 1HZBA 2CWAA 2K5QA 2JA6B 2QA4A 4QB4A 4HJ9A 2KCCA 2UUAL 3OSOA 3QJYA 4M8AA 1EIGA 2WAQB 1GO3E 1CFMA 1XYIA 1OXTA 1B4OA 1VQIA 5IGBA 4K5XA 2K03A 2N3SA 1G2SA 5M3MB 1GJXA 2TMPA 3S17H 3RLOA 1I6HH 2VQFQ 2NN6G 3EROA 4X65L 4EQNA 3Q24A 1IXRA 1PH6A 5D3IB 1GD7A 2QDLA 3I4MH 3QB3A 4UP9A 2OT2A 3H3VC 5IGCA 2DUDA 3K59A 4QJFA 2NB0A 4CKCA 1X6OA 1PZKD 3Q23A 1SNQA 1HR0L 3KLSX 3I4MG 3HOXH 4JI8Q 4YHHQ 1NJIC 3RUZA 5IYBH 1GUGA 1EIHA 1VQKA 4UP8A 4C2MH 4DUZL 4DNRB 1F9RA 4KKUA 4MNOA 1WI5A 3RD4A 1GUTA 3H0GH 5LL6X 4QY7A 4R4TA 4WJ3M 2EVBA 2H5XA 1VQ5A 4QGUA 1KTKA 2NZHA 3HGBA 2PPBC 5KIXA 3PO2G 1JCKB 4TSSA 4X62L 1VQJA 1TKWB 2EY2A 4BY7H 1EQVA 1YHQA 2YYZA 3FDTA 4ZLTF 2ZXRA 3MC0B 3QG1A 4NB3A 1ZEQX 2JA8B 5JAVA 4BA2I 1SYDA 4IOAA 5JJZA 4UAIA 1PH8A 4B3TL 5C4ZA 1TWGB 1LT3D 3N6RA 3HOXG 1K73C 1Q46A 2QDBA 4AYBG 1EZ6A 2HIVA 3F2BA 3U58A 1IZ6A 1WCMH 1A2UA 4QF4A 1YNNC 3AEVA 4JBMA 2HIXA 3E5SA 4HIKA 2OQ0A 2V1CC 1TQOA 1N33Q 4FDBA 5LMUQ 3TP6A 1H95A 3A54A 5IODA 1FJGQ 2LMCB 3NWTA 2BCOA 4A93G 3V2TA 1O78A 2N55A 5HURA 3L3OC 4O42A 1AH9A 2ATWA 1EIFA 4DAPA 4LNQA 5IYCH 2R93G 5C3EG 3A5ZB 2F0JA 4RAUC 4ODGA 1WD1A 4A76A 1WTPA 4A4IA 2HDMA 4A3EH 1YHBA 2L55A 3HOWG
chains in the Genus database with same CATH topology
4LF6L 1S3OA 2ZM6L 5HGQA 4JI5Q 2ZJRA 2R7ZG 2OTJA 3KDFA 4JI0Q 5FJ8G 1PFSA 4C3IH 3BJUA 1PYBA 2AMCB 5M3MH 5GAGC 3F1ZA 4X6AH 1HZCA 3AFQA 3PUXA 5GAEC 1RIPA 1XPRA 2VZAA 4GKKL 3I7FA 4JI0L 1SLJA 1XTDA 4YY3Q 2Z6KA 1JMCA 4IJLA 1E7ZA 1JB7A 1TXYA 5DLQE 3PUWA 4R4OA 4R1JA 2AHOB 2PQAB 3CMEA 1QZHA 1JJCB 1OXXK 4R4QA 2UUCL 4HJ8A 1P16A 3STBC 1FVIA 1O7IA 3S1RH 4GKKQ 2Q2TA 5LMNL 1EIYB 2CQOA 3CC4A 5IYBG 4A3FH 4DR1Q 1Q82C 1V43A 1TWCH 4X66L 1VQBA 3UE1A 4AYBE 3PUVA 1Y1VH 2JQOA 3CCRA 4DV6Q 2PI2E 4MTNA 4A75A 3S1MH 1HNWL 5IP9H 1I94Q 3TQYA 2KHJA 2VY3A 3SGIA 3PGZA 5M5WH 1VQEA 1N8RC 1HNXL 1IBKL 4X65Q 4BY1H 3GTOH 4L5SA 2KENA 4GKJQ 3RN5A 1N32Q 4IJHA 2BA0A 3KF6A 3HKSA 3RZDH 1IL2A 2Y0SG 1LYLA 2KBNA 1HR0W 2NVTH 1N34Q 2ZTCA 4Y52H 2BA1A 4A3CG 2A8VA 2K50A 4TQUS 1E3PA 4LFCL 3L0OA 1TWAH 1Y1VG 3PV0A 4A3LH 4WJ4A 1HZAA 1Q8KA 4GN5A 2RHSB 2WAQG 4EQ5A 4OONA 4JG2A 1SE8A 1X3FA 4P75A 3PF4A 4TVAB 1N34L 4POFA 4BXXG 2IHEA 1NE3A 4LF5L 1X54A 1SR3A 4XIGS 1EWIA 3ULPA 4A3BG 4DR6L 3W5OA 2BH2A 1B7YB 3M3YH 4A3CH 1OXSC 2EQSA 2ZJPA 2F4VQ 1EYGA 1BBWA 1GM5A 2QGQA 3I4NH 4NXMQ 2K4KA 1L2FA 2JK8A 1EOVA 1PV4A 2YU9H 2ES2A 2OTLA 1VQCA 1Q7YC 1FGUA 1UE5A 1E1TA 1SROA 4LFAQ 4DAYB 2Z6KC 4DKAC 1ASZA 1LUZA 2PMZE 2CFMA 1KRSA 1OXUA 4JI5L 3ULJA 1SFOH 1NMFA 3PUZA 3TREA 2F4VL 5M3FG 2K5NA 4JI4L 2VNUD 2UXCQ 4JYAL 3ICEA 4DR2L 2WAQE 4KHPQ 3PO2H 1UE6A 3B6YA 2R7ZH 2AWOA 4LF8L 3JC66 1Z9FA 1K0RA 2JA8G 5JJIA 2DGYA 5C0XG 2IHFA 3F2DA 4PZ6A 2K52A 5FLMG 1VQGA 1VQ9A 3UDFA 4YCWA 3EN2A 2PNHA 3K7AH 1UWVA 2E8GA 3PSIA 3TS0A 2Y0SE 1VQAA 4LWCA 1X9NA 1MKHA 4JYAQ 2RF4A 1XMOQ 4DR2Q 1VQFA 1PH7A 2OQKA 1EUJA 4IPCA 3CC2A 4DR7Q 3CCJA 1S40A 3CPFA 2UXDL 2JEAI 3E0EA 4DV2L 1R9TH 2OWOA 3HOZG 3FKIH 3NELA 1UE7A 2B63G 4JOIA 1A62A 1G6PA 2D0PA 3HOZH 3AFPA 4L5QA 2KCTA 1Q1BA 4JI6Q 2YV5A 1PA6A 2C35B 2E2HH 1XNRL 1D7QA 4P71A 4DR1L 4DV0Q 3PO3H 4DR5L 4POGA 5FLMH 1K3RA 1HZ9A 3HOVG 2UXBQ 1N36Q 4JI3Q 2JA5G 5BR8Q 1JE5A 4O0AA 1I94L 1IBMQ 4DUZQ 1SRUA 1VQLA 1HNXQ 4IFDI 3M9BA 1UE1A 3KLWA 3LGJA 1PH9A 4B3SL 3J7ZC 1PH1A 1PH3A 5M5XH 3KDFB 1VQ8A 1X65A 1IYJB 1X56A 1PH2A 3BZCA 4B3ML 4B3TQ 5IY0A 2JJQA 4A3LG 4LF9L 1VQOA 4A3IH 1KQSA 1IBML 1PVOA 4NPSA 4YCUA 2JEBI 3CCUA 3NBHB 2K5HA 2N49A 5IP7G 3F2CA 1Y1WH 3HOYH 1RL2A 2FXQA 2MQHA 3HKZE 3H3VI 3FHWA 4A3BH 2UU9Q 1PHJA 4OWTB 4RG1A 5LMNW 3F8TA 1WFQA 3S1QH 3S2HH 3Q8DA 1SMXA 2LSSA 3PF5A 1X55A 2JE6I 5C44H 4YCVA 1JT8A 1CKNB 2NVYH 3CAMA 3D0FA 4DK3C 1YITA 4J15A 1VQPA 1PH4A 1X3EA 1HNZL 1J6QA 1WJJA 2AWNA 4DAMA 1L0WA 4DV3L 2CCZA 4R4CA 1P8LA 3ULLA 3PIPA 1PH5A 2UU9L 2JA6G 3EBEA 1Y14B 4NXNQ 3BU2A 1V9PA 3D31A 2D62A 2WP8J 1PYSB 1XPOA 4LF4L 4JI1L 1YJ9A 3J81i 3PUYA 1U5KA 2ZTDA 4OWXB 2UXCL 2R6GA 4QIWE 4YWMA 3J81c 2EIFA 2R92H 1UEBA 2N8NA 4KHPL 3KF8B 1Q86C 1KRTA 2E5LL 4YWKA 3RNUA 4A3MH 1L1OA 3K0XA 1J5EL 4DV5Q 2MNAA 4L5RC 5C44G 3M4QA 3A5UA 2ZM6Q 4IO9A 2JA6H 4JI2Q 3M4PA 1B8AA 4B3RQ 3KFUA 4LUVA 4HIOA 1VQ6A 2I0QA 4BA1I 5GADC 1QUQB 1YJNA 1XMOL 2HHHL 4OO1I 3JAMc 3RLNA 5K36G 5AJ3Q 1HR0Q 1JJGA 1NBWA 1OXVA 4GNXA 4DV2Q 1DGSA 1QVGA 4DV5L 4LF6Q 5IP7H 2A1AA 4C3HH 1WOCA 3I4NG 2I5LX 4JBJA 2VQEQ 4LFBQ 4IFDG 5IE8A 4JI2L 2WFWA 1YBYA 2I5HA 3FKIG 4GLAC 1ASYA 3RLFA 1CKOA 2Z0SA 4IPDA 3CPWA 2JA5H 3M7NA 1G291 3HOVH 2F52A 2PQAA 2NVXH 4JI3L 4L5TA 5BR8L 2ZJQA 1V1QA 2RCNA 2ZTEA 1HH2P 4IPGA 3CW2C 3GTMH 5GAHC 1VQ7A 4OX9L 1K9MC 5C3EH 4UPAA 3RN2A 2OCEA 3MEFA 4GOPA 2YTXA 5FLXc 4P73A 3PCOB 2HT1A 4A3DG 4A3FG 1KXLA 3AYHB 1EQRA 4P72A 4X62Q 3G6EA 3GDEA 3G71A 1VQ4A 3L7ZC 1N33L 1GKHA 1N9WA 3E9HA 4HIDA 4DR4L 4A3KH 4DR6Q 5M3MG 4DV6L 2PI2A 2RHQB 3T1YL 3H3VH 4BY7G 4AQYL 2UUAQ 4OX9Q 1XJVA 4LUOA 4LW1A 2MFIA 4EX5A 5IP9G 4BBRG 1VQMA 4GS3A 3U4VA 1NMGA 1VCIA 1FJGL 4A3GG 1QZGA 4A3DH 2UUBQ 1C0AA 4GOPB 4LFAL 2ALYB 2MO1A 4HIMA 3W1GA 1GVPA 1L1OB 1E1OA 4OXPA 5C4XH 5C4JH 1JJ2A 3A0JA 4GOPC 1EQQA 2WB1E 2VQFL 4XTCS 1TWFH 5M3FH 2IT1A 1VQHA 4RMFA 3T1HL 4PG3A 1I5FA 2E2IH 1E24A 4BXXH 1FL0A 3GTPH 5IYDH 3IRBA 4LF8Q 1VS0A 4YWLA 1A8VA 4DV3Q 1KC8C 5C0XI 5JEAJ 1BKBA 4UP7A 1I3QH 2ASBA 2GVBA 3A74A 3CF5A 3DM3A 4A3JG 4LF4Q 4JI1Q 2K14A 3S16H 4A3GH 3J7A5 3CMAA 4NXML 1BVSA 4KHZA 2B3GA 3MXNB 4Y7NH 3CXCA 4A3MG 3M4OH 3GTQH 1CKNA 3DLLA 2UXDQ 4HJ7A 3HFZB 1J5EQ 1Y1WG 3HOYG 2CWPA 4ME3A 3KJPA 2K5VA 4X64Q 5IWAL 3OTOQ 1KL9A 4YHHL 1EFWA 2Q2UA 3J81j 2B63H 3S2DH 5E7NA 4AH6A 4B3RL 4JI6L 4JI4Q 4JBKA 1XNQQ 2BH8A 3GTGH 2XTIA 3EIVA 2MO0A 3ER0A 2JA9A 3KJOA 3UE0A 5GQOA 1MJCA 5AJ3L 4JBWA 3CCVA 2I5MX 4DV1L 1CUKA 1YJWA 1G51A 2UUCQ 4KLKA 2NZOA 4GN4B 2QEXA 2R93H 3K8AA 3HOWH 4PZ7A 3HKZG 5IWAQ 3OTOL 3CC7A 4LF7L 1K83H 2K75A 2Q2IA 2JA8H 4DK6C 5HY6A 3J80i 5LMNQ 3KF6B 1A63A 2JA7G 3KYHC 4UY8C 1XMQQ 1N36L 1MJEA 4C3JH 4DV1Q 2NVQH 2N78A 3I2ZA 5ELOA 4HJ5A 3CCMA 4LF9Q 4DV7Q 4LF7Q 2IX0A 3RZOH 1XPUA 1X3GA 5IYDG 3J80c 4GKJL 1N32L 1QVCA 4JC0A 1XMQL 1L1OC 4GNXC 1HZBA 2CWAA 3ZJYC 4DR4Q 4DR5Q 3VDYA 3CCQA 3W1BA 5EAYA 2UXBL 4LFCQ 4KI0A 2QA4A 4HJ9A 4DV7L 4R4IA 2UUAL 2JA7H 4IFDJ 2VW9A 2GN5A 4O2DA 3GTLH 2YTVA 3STBD 1GO3E 2GVAA 5ELNA 1YNXA 1OXTA 3ERSX 1VQIA 4B3MQ 2Q2HA 1W2BA 5C4XG 1Q12A 4P74A 2N3SA 1HJPA 1IBKQ 1HNWQ 5LMUL 3S17H 2IY5B 3RLOA 1I6HH 1I50H 1LM0A 3JAMi 5FJ8H 2R7DA 2NN6G 2VQFQ 3K7UC 4X65L 1IXRA 1PH6A 1GD7A 4JV5Q 1B70B 3I4MH 2KCMA 5C0XJ 4UP9A 1YIJA 2CKZB 3S14H 2DUDA 2E2JH 4BBSH 1WYDA 3K80C 4GN3B 1NY4A 1Q1EA 4QJFA 4JI8L 4IOCA 4A3KG 4JCVE 3CCLA 4GNXB 1X6OA 5JJKA 2KHIA 3OW2A 4LUZA 4OWWB 5IT9c 2YTYA 3GO5A 4QL5A 1S72A 2XGTA 1HR0L 3S24A 2WB1G 1YHAA 3CD6A 3CCEA 3HOXH 3I4MG 4H02A 4JI8Q 3NEMA 4BBRH 4X64L 2ID0A 4YHHQ 1YVCA 2VQEL 1NJIC 3I55A 5IYBH 1VQKA 2VUMH 4UP8A 4C2MH 4DUZL 4QQBX 2E5LQ 5JJLA 3U4ZA 4DR7L 1CKMA 4MNOA 1WI5A 3H0GH 1M1KC 3G4SA 1CSPA 4PZ8A 4QY7A 3I4OA 1NTGA 4R4TA 4WJ3M 4BY1G 2H5XA 1VQ5A 4QGUA 2NZHA 4GLXA 2IX1A 5M5YH 3OYYA 4YY3L 4DR3Q 1VQNA 3PO2G 1QVFA 3FP9A 1VQJA 4X62L 4BY7H 2HHHQ 4A93H 1SN8A 1AE2A 1YHQA 5GROA 1C7YA 1T9HA 4HJAA 2YYZA 1TWGH 3GTKH 5JEAG 4NB3A 3CP0A 1WCMG 3H15A 1A0IA 3PIOA 4AQYQ 2LXKA 4LFBL 2VUMG 4BA2I 4APVA 4A3EG 1YEZA 3BZKA 4DV4Q 4JI7Q 1CSQA 4DR3L 3M85A 3K81C 4ALPA 3G48A 3HOUG 1M90C 2UUBL 4IOAA 1Z47A 1AE3A 1PH8A 4B3TL 3KOJA 4X66Q 3HOXG 1K73C 4DUYL 3S15H 4PMWA 1Q46A 3TS2A 4IPHA 3RR5A 4K0KL 2EXDA 4AYBG 2HIVA 3S1NH 1E22A 3TEHB 3F2BA 3U58A 3WWVA 1K8AC 3NENA 1IZ6A 1WCMH 3AQQA 1K8GA 4DV4L 3AEVA 3GD7A 4MZ9A 4JI7L 2NN6I 2HIXA 3GTJH 4HIKA 1IBLL 4JBMA 2OQ0A 5IYCG 2V1CC 1KD1C 1LTLA 1XNRQ 1VQDA 1N33Q 1YI2A 4DV0L 2A19A 1D8LA 2VS1A 4DNIA 4FDBA 3CQZH 4DUYQ 5LMUQ 4K0KQ 2L15A 3T1YQ 1H95A 4GLVB 1KHIA 4JOIC 4AIMA 4B3SQ 3PO3G 3UDXA 4A3JH 3HOUH 1QUQA 1KIXA 1U0LA 1IBLQ 3H0GG 1BBUA 4JV5L 1FJGQ 4BBSG 3E9IA 4DPGA 3CCSA 1HNZQ 4A93G 1KAWA 4A3IG 4LF5Q 2AKWB 5H1SE 1TWHH 3L2PA 3I56A 1OTCA 1YZ6A 2D0OA 1AH9A 4NXNL 3UDIA 2R92G 3TRZA 2ATWA 1EIFA 4LNQA 1C9OA 2VL6A 5IYCH 2B29A 1XNQL 2R93G 5C3EG 3A5ZB 3T1HQ 3UDGA 2HQLA 1Q81C 4OO1G 4A76A 2F3IA 4A4IA 4A3EH 2LXJA 3U50C 1YHBA 2R7FA 1W3SA 5J3BA 1MIUA 3HOWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 L;  1S3O A;  2ZM6 L;  5HGQ A;  4JI5 Q;  2ZJR A;  2R7Z G;  2OTJ A;  3KDF A;  4JI0 Q;  5FJ8 G;  1PFS A;  4C3I H;  3BJU A;  1PYB A;  2AMC B;  5M3M H;  5GAG C;  3F1Z A;  4X6A H;  1HZC A;  3AFQ A;  3PUX A;  5GAE C;  1RIP A;  1XPR A;  2VZA A;  4GKK L;  3I7F A;  4JI0 L;  1SLJ A;  1XTD A;  4YY3 Q;  2Z6K A;  1JMC A;  4IJL A;  1E7Z A;  1JB7 A;  1TXY A;  5DLQ E;  3PUW A;  4R4O A;  4R1J A;  2AHO B;  2PQA B;  3CME A;  1QZH A;  1JJC B;  1OXX K;  4R4Q A;  2UUC L;  4HJ8 A;  1P16 A;  3STB C;  1FVI A;  1O7I A;  3S1R H;  4GKK Q;  2Q2T A;  5LMN L;  1EIY B;  2CQO A;  3CC4 A;  5IYB G;  4A3F H;  4DR1 Q;  1Q82 C;  1V43 A;  1TWC H;  4X66 L;  1VQB A;  3UE1 A;  4AYB E;  3PUV A;  1Y1V H;  2JQO A;  3CCR A;  4DV6 Q;  2PI2 E;  4MTN A;  4A75 A;  3S1M H;  1HNW L;  5IP9 H;  1I94 Q;  3TQY A;  2KHJ A;  2VY3 A;  3SGI A;  3PGZ A;  5M5W H;  1VQE A;  1N8R C;  1HNX L;  1IBK L;  4X65 Q;  4BY1 H;  3GTO H;  4L5S A;  2KEN A;  4GKJ Q;  3RN5 A;  1N32 Q;  4IJH A;  2BA0 A;  3KF6 A;  3HKS A;  3RZD H;  1IL2 A;  2Y0S G;  1LYL A;  2KBN A;  1HR0 W;  2NVT H;  1N34 Q;  2ZTC A;  4Y52 H;  2BA1 A;  4A3C G;  2A8V A;  2K50 A;  4TQU S;  1E3P A;  4LFC L;  3L0O A;  1TWA H;  1Y1V G;  3PV0 A;  4A3L H;  4WJ4 A;  1HZA A;  1Q8K A;  4GN5 A;  2RHS B;  2WAQ G;  4EQ5 A;  4OON A;  4JG2 A;  1SE8 A;  1X3F A;  4P75 A;  3PF4 A;  4TVA B;  1N34 L;  4POF A;  4BXX G;  2IHE A;  1NE3 A;  4LF5 L;  1X54 A;  1SR3 A;  4XIG S;  1EWI A;  3ULP A;  4A3B G;  4DR6 L;  3W5O A;  2BH2 A;  1B7Y B;  3M3Y H;  4A3C H;  1OXS C;  2EQS A;  2ZJP A;  2F4V Q;  1EYG A;  1BBW A;  1GM5 A;  2QGQ A;  3I4N H;  4NXM Q;  2K4K A;  1L2F A;  2JK8 A;  1EOV A;  1PV4 A;  2YU9 H;  2ES2 A;  2OTL A;  1VQC A;  1Q7Y C;  1FGU A;  1UE5 A;  1E1T A;  1SRO A;  4LFA Q;  4DAY B;  2Z6K C;  4DKA C;  1ASZ A;  1LUZ A;  2PMZ E;  2CFM A;  1KRS A;  1OXU A;  4JI5 L;  3ULJ A;  1SFO H;  1NMF A;  3PUZ A;  3TRE A;  2F4V L;  5M3F G;  2K5N A;  4JI4 L;  2VNU D;  2UXC Q;  4JYA L;  3ICE A;  4DR2 L;  2WAQ E;  4KHP Q;  3PO2 H;  1UE6 A;  3B6Y A;  2R7Z H;  2AWO A;  4LF8 L;  3JC6 6;  1Z9F A;  1K0R A;  2JA8 G;  5JJI A;  2DGY A;  5C0X G;  2IHF A;  3F2D A;  4PZ6 A;  2K52 A;  5FLM G;  1VQG A;  1VQ9 A;  3UDF A;  4YCW A;  3EN2 A;  2PNH A;  3K7A H;  1UWV A;  2E8G A;  3PSI A;  3TS0 A;  2Y0S E;  1VQA A;  4LWC A;  1X9N A;  1MKH A;  4JYA Q;  2RF4 A;  1XMO Q;  4DR2 Q;  1VQF A;  1PH7 A;  2OQK A;  1EUJ A;  4IPC A;  3CC2 A;  4DR7 Q;  3CCJ A;  1S40 A;  3CPF A;  2UXD L;  2JEA I;  3E0E A;  4DV2 L;  1R9T H;  2OWO A;  3HOZ G;  3FKI H;  3NEL A;  1UE7 A;  2B63 G;  4JOI A;  1A62 A;  1G6P A;  2D0P A;  3HOZ H;  3AFP A;  4L5Q A;  2KCT A;  1Q1B A;  4JI6 Q;  2YV5 A;  1PA6 A;  2C35 B;  2E2H H;  1XNR L;  1D7Q A;  4P71 A;  4DR1 L;  4DV0 Q;  3PO3 H;  4DR5 L;  4POG A;  5FLM H;  1K3R A;  1HZ9 A;  3HOV G;  2UXB Q;  1N36 Q;  4JI3 Q;  2JA5 G;  5BR8 Q;  1JE5 A;  4O0A A;  1I94 L;  1IBM Q;  4DUZ Q;  1SRU A;  1VQL A;  1HNX Q;  4IFD I;  3M9B A;  1UE1 A;  3KLW A;  3LGJ A;  1PH9 A;  4B3S L;  3J7Z C;  1PH1 A;  1PH3 A;  5M5X H;  3KDF B;  1VQ8 A;  1X65 A;  1IYJ B;  1X56 A;  1PH2 A;  3BZC A;  4B3M L;  4B3T Q;  5IY0 A;  2JJQ A;  4A3L G;  4LF9 L;  1VQO A;  4A3I H;  1KQS A;  1IBM L;  1PVO A;  4NPS A;  4YCU A;  2JEB I;  3CCU A;  3NBH B;  2K5H A;  2N49 A;  5IP7 G;  3F2C A;  1Y1W H;  3HOY H;  1RL2 A;  2FXQ A;  2MQH A;  3HKZ E;  3H3V I;  3FHW A;  4A3B H;  2UU9 Q;  1PHJ A;  4OWT B;  4RG1 A;  5LMN W;  3F8T A;  1WFQ A;  3S1Q H;  3S2H H;  3Q8D A;  1SMX A;  2LSS A;  3PF5 A;  1X55 A;  2JE6 I;  5C44 H;  4YCV A;  1JT8 A;  1CKN B;  2NVY H;  3CAM A;  3D0F A;  4DK3 C;  1YIT A;  4J15 A;  1VQP A;  1PH4 A;  1X3E A;  1HNZ L;  1J6Q A;  1WJJ A;  2AWN A;  4DAM A;  1L0W A;  4DV3 L;  2CCZ A;  4R4C A;  1P8L A;  3ULL A;  3PIP A;  1PH5 A;  2UU9 L;  2JA6 G;  3EBE A;  1Y14 B;  4NXN Q;  3BU2 A;  1V9P A;  3D31 A;  2D62 A;  2WP8 J;  1PYS B;  1XPO A;  4LF4 L;  4JI1 L;  1YJ9 A;  3J81 i;  3PUY A;  1U5K A;  2ZTD A;  4OWX B;  2UXC L;  2R6G A;  4QIW E;  4YWM A;  3J81 c;  2EIF A;  2R92 H;  1UEB A;  2N8N A;  4KHP L;  3KF8 B;  1Q86 C;  1KRT A;  2E5L L;  4YWK A;  3RNU A;  4A3M H;  1L1O A;  3K0X A;  1J5E L;  4DV5 Q;  2MNA A;  4L5R C;  5C44 G;  3M4Q A;  3A5U A;  2ZM6 Q;  4IO9 A;  2JA6 H;  4JI2 Q;  3M4P A;  1B8A A;  4B3R Q;  3KFU A;  4LUV A;  4HIO A;  1VQ6 A;  2I0Q A;  4BA1 I;  5GAD C;  1QUQ B;  1YJN A;  1XMO L;  2HHH L;  4OO1 I;  3JAM c;  3RLN A;  5K36 G;  5AJ3 Q;  1HR0 Q;  1JJG A;  1NBW A;  1OXV A;  4GNX A;  4DV2 Q;  1DGS A;  1QVG A;  4DV5 L;  4LF6 Q;  5IP7 H;  2A1A A;  4C3H H;  1WOC A;  3I4N G;  2I5L X;  4JBJ A;  2VQE Q;  4LFB Q;  4IFD G;  5IE8 A;  4JI2 L;  2WFW A;  1YBY A;  2I5H A;  3FKI G;  4GLA C;  1ASY A;  3RLF A;  1CKO A;  2Z0S A;  4IPD A;  3CPW A;  2JA5 H;  3M7N A;  1G29 1;  3HOV H;  2F52 A;  2PQA A;  2NVX H;  4JI3 L;  4L5T A;  5BR8 L;  2ZJQ A;  1V1Q A;  2RCN A;  2ZTE A;  1HH2 P;  4IPG A;  3CW2 C;  3GTM H;  5GAH C;  1VQ7 A;  4OX9 L;  1K9M C;  5C3E H;  4UPA A;  3RN2 A;  2OCE A;  3MEF A;  4GOP A;  2YTX A;  5FLX c;  4P73 A;  3PCO B;  2HT1 A;  4A3D G;  4A3F G;  1KXL A;  3AYH B;  1EQR A;  4P72 A;  4X62 Q;  3G6E A;  3GDE A;  3G71 A;  1VQ4 A;  3L7Z C;  1N33 L;  1GKH A;  1N9W A;  3E9H A;  4HID A;  4DR4 L;  4A3K H;  4DR6 Q;  5M3M G;  4DV6 L;  2PI2 A;  2RHQ B;  3T1Y L;  3H3V H;  4BY7 G;  4AQY L;  2UUA Q;  4OX9 Q;  1XJV A;  4LUO A;  4LW1 A;  2MFI A;  4EX5 A;  5IP9 G;  4BBR G;  1VQM A;  4GS3 A;  3U4V A;  1NMG A;  1VCI A;  1FJG L;  4A3G G;  1QZG A;  4A3D H;  2UUB Q;  1C0A A;  4GOP B;  4LFA L;  2ALY B;  2MO1 A;  4HIM A;  3W1G A;  1GVP A;  1L1O B;  1E1O A;  4OXP A;  5C4X H;  5C4J H;  1JJ2 A;  3A0J A;  4GOP C;  1EQQ A;  2WB1 E;  2VQF L;  4XTC S;  1TWF H;  5M3F H;  2IT1 A;  1VQH A;  4RMF A;  3T1H L;  4PG3 A;  1I5F A;  2E2I H;  1E24 A;  4BXX H;  1FL0 A;  3GTP H;  5IYD H;  3IRB A;  4LF8 Q;  1VS0 A;  4YWL A;  1A8V A;  4DV3 Q;  1KC8 C;  5C0X I;  5JEA J;  1BKB A;  4UP7 A;  1I3Q H;  2ASB A;  2GVB A;  3A74 A;  3CF5 A;  3DM3 A;  4A3J G;  4LF4 Q;  4JI1 Q;  2K14 A;  3S16 H;  4A3G H;  3J7A 5;  3CMA A;  4NXM L;  1BVS A;  4KHZ A;  2B3G A;  3MXN B;  4Y7N H;  3CXC A;  4A3M G;  3M4O H;  3GTQ H;  1CKN A;  3DLL A;  2UXD Q;  4HJ7 A;  3HFZ B;  1J5E Q;  1Y1W G;  3HOY G;  2CWP A;  4ME3 A;  3KJP A;  2K5V A;  4X64 Q;  5IWA L;  3OTO Q;  1KL9 A;  4YHH L;  1EFW A;  2Q2U A;  3J81 j;  2B63 H;  3S2D H;  5E7N A;  4AH6 A;  4B3R L;  4JI6 L;  4JI4 Q;  4JBK A;  1XNQ Q;  2BH8 A;  3GTG H;  2XTI A;  3EIV A;  2MO0 A;  3ER0 A;  2JA9 A;  3KJO A;  3UE0 A;  5GQO A;  1MJC A;  5AJ3 L;  4JBW A;  3CCV A;  2I5M X;  4DV1 L;  1CUK A;  1YJW A;  1G51 A;  2UUC Q;  4KLK A;  2NZO A;  4GN4 B;  2QEX A;  2R93 H;  3K8A A;  3HOW H;  4PZ7 A;  3HKZ G;  5IWA Q;  3OTO L;  3CC7 A;  4LF7 L;  1K83 H;  2K75 A;  2Q2I A;  2JA8 H;  4DK6 C;  5HY6 A;  3J80 i;  5LMN Q;  3KF6 B;  1A63 A;  2JA7 G;  3KYH C;  4UY8 C;  1XMQ Q;  1N36 L;  1MJE A;  4C3J H;  4DV1 Q;  2NVQ H;  2N78 A;  3I2Z A;  5ELO A;  4HJ5 A;  3CCM A;  4LF9 Q;  4DV7 Q;  4LF7 Q;  2IX0 A;  3RZO H;  1XPU A;  1X3G A;  5IYD G;  3J80 c;  4GKJ L;  1N32 L;  1QVC A;  4JC0 A;  1XMQ L;  1L1O C;  4GNX C;  1HZB A;  2CWA A;  3ZJY C;  4DR4 Q;  4DR5 Q;  3VDY A;  3CCQ A;  3W1B A;  5EAY A;  2UXB L;  4LFC Q;  4KI0 A;  2QA4 A;  4HJ9 A;  4DV7 L;  4R4I A;  2UUA L;  2JA7 H;  4IFD J;  2VW9 A;  2GN5 A;  4O2D A;  3GTL H;  2YTV A;  3STB D;  1GO3 E;  2GVA A;  5ELN A;  1YNX A;  1OXT A;  3ERS X;  1VQI A;  4B3M Q;  2Q2H A;  1W2B A;  5C4X G;  1Q12 A;  4P74 A;  2N3S A;  1HJP A;  1IBK Q;  1HNW Q;  5LMU L;  3S17 H;  2IY5 B;  3RLO A;  1I6H H;  1I50 H;  1LM0 A;  3JAM i;  5FJ8 H;  2R7D A;  2NN6 G;  2VQF Q;  3K7U C;  4X65 L;  1IXR A;  1PH6 A;  1GD7 A;  4JV5 Q;  1B70 B;  3I4M H;  2KCM A;  5C0X J;  4UP9 A;  1YIJ A;  2CKZ B;  3S14 H;  2DUD A;  2E2J H;  4BBS H;  1WYD A;  3K80 C;  4GN3 B;  1NY4 A;  1Q1E A;  4QJF A;  4JI8 L;  4IOC A;  4A3K G;  4JCV E;  3CCL A;  4GNX B;  1X6O A;  5JJK A;  2KHI A;  3OW2 A;  4LUZ A;  4OWW B;  5IT9 c;  2YTY A;  3GO5 A;  4QL5 A;  1S72 A;  2XGT A;  1HR0 L;  3S24 A;  2WB1 G;  1YHA A;  3CD6 A;  3CCE A;  3HOX H;  3I4M G;  4H02 A;  4JI8 Q;  3NEM A;  4BBR H;  4X64 L;  2ID0 A;  4YHH Q;  1YVC A;  2VQE L;  1NJI C;  3I55 A;  5IYB H;  1VQK A;  2VUM H;  4UP8 A;  4C2M H;  4DUZ L;  4QQB X;  2E5L Q;  5JJL A;  3U4Z A;  4DR7 L;  1CKM A;  4MNO A;  1WI5 A;  3H0G H;  1M1K C;  3G4S A;  1CSP A;  4PZ8 A;  4QY7 A;  3I4O A;  1NTG A;  4R4T A;  4WJ3 M;  4BY1 G;  2H5X A;  1VQ5 A;  4QGU A;  2NZH A;  4GLX A;  2IX1 A;  5M5Y H;  3OYY A;  4YY3 L;  4DR3 Q;  1VQN A;  3PO2 G;  1QVF A;  3FP9 A;  1VQJ A;  4X62 L;  4BY7 H;  2HHH Q;  4A93 H;  1SN8 A;  1AE2 A;  1YHQ A;  5GRO A;  1C7Y A;  1T9H A;  4HJA A;  2YYZ A;  1TWG H;  3GTK H;  5JEA G;  4NB3 A;  3CP0 A;  1WCM G;  3H15 A;  1A0I A;  3PIO A;  4AQY Q;  2LXK A;  4LFB L;  2VUM G;  4BA2 I;  4APV A;  4A3E G;  1YEZ A;  3BZK A;  4DV4 Q;  4JI7 Q;  1CSQ A;  4DR3 L;  3M85 A;  3K81 C;  4ALP A;  3G48 A;  3HOU G;  1M90 C;  2UUB L;  4IOA A;  1Z47 A;  1AE3 A;  1PH8 A;  4B3T L;  3KOJ A;  4X66 Q;  3HOX G;  1K73 C;  4DUY L;  3S15 H;  4PMW A;  1Q46 A;  3TS2 A;  4IPH A;  3RR5 A;  4K0K L;  2EXD A;  4AYB G;  2HIV A;  3S1N H;  1E22 A;  3TEH B;  3F2B A;  3U58 A;  3WWV A;  1K8A C;  3NEN A;  1IZ6 A;  1WCM H;  3AQQ A;  1K8G A;  4DV4 L;  3AEV A;  3GD7 A;  4MZ9 A;  4JI7 L;  2NN6 I;  2HIX A;  3GTJ H;  4HIK A;  1IBL L;  4JBM A;  2OQ0 A;  5IYC G;  2V1C C;  1KD1 C;  1LTL A;  1XNR Q;  1VQD A;  1N33 Q;  1YI2 A;  4DV0 L;  2A19 A;  1D8L A;  2VS1 A;  4DNI A;  4FDB A;  3CQZ H;  4DUY Q;  5LMU Q;  4K0K Q;  2L15 A;  3T1Y Q;  1H95 A;  4GLV B;  1KHI A;  4JOI C;  4AIM A;  4B3S Q;  3PO3 G;  3UDX A;  4A3J H;  3HOU H;  1QUQ A;  1KIX A;  1U0L A;  1IBL Q;  3H0G G;  1BBU A;  4JV5 L;  1FJG Q;  4BBS G;  3E9I A;  4DPG A;  3CCS A;  1HNZ Q;  4A93 G;  1KAW A;  4A3I G;  4LF5 Q;  2AKW B;  5H1S E;  1TWH H;  3L2P A;  3I56 A;  1OTC A;  1YZ6 A;  2D0O A;  1AH9 A;  4NXN L;  3UDI A;  2R92 G;  3TRZ A;  2ATW A;  1EIF A;  4LNQ A;  1C9O A;  2VL6 A;  5IYC H;  2B29 A;  1XNQ L;  2R93 G;  5C3E G;  3A5Z B;  3T1H Q;  3UDG A;  2HQL A;  1Q81 C;  4OO1 G;  4A76 A;  2F3I A;  4A4I A;  4A3E H;  2LXJ A;  3U50 C;  1YHB A;  2R7F A;  1W3S A;  5J3B A;  1MIU A;  3HOW G; 
#chains in the Genus database with same CATH topology
 2D5D A;  2ZM6 L;  1WTH A;  3URY A;  4S3S A;  3BJU A;  1RHP A;  5GAG C;  3BYT B;  2HCI A;  3AFQ A;  3PUX A;  3J81 L;  3A8I E;  4CHT B;  1SLJ A;  1AZQ A;  3OMC A;  4OO1 H;  3A8J E;  4DAV A;  3M7G A;  2SNS A;  3PMF A;  4KD3 A;  1TWC B;  3ZYY X;  2AHO B;  1GUW A;  1QZH A;  1R4Q B;  2SEB D;  1AEX A;  4Y7N B;  1O7I A;  1WTO A;  2Q2T A;  5LMN L;  2VB3 X;  3CRK C;  4A3F H;  4DR1 Q;  2G9D A;  3PUV A;  4A75 A;  4BS9 A;  2PI2 E;  1I94 Q;  2B2T A;  2VY3 A;  1HNX L;  4XDX A;  1EY7 A;  1IKM A;  4EGV A;  1BF4 A;  3DWA A;  3KF6 A;  5FO7 B;  1KAB A;  1LYL A;  1N34 Q;  1QCB D;  1S5D D;  3OPO A;  2K50 A;  2M2L A;  1Y8O B;  3EFX D;  1TWA H;  3PV0 A;  5KNC A;  1PZJ D;  3GTQ B;  4G7Z C;  2NTS A;  1IHZ A;  3VA5 A;  4WFN 3;  2ZT9 C;  4POF A;  2IHE A;  2JP1 A;  3ULP A;  4XIG S;  1TWA B;  2BH2 A;  3M3Y H;  2F0K A;  1OXS C;  2EQS A;  1S5F D;  1AFP A;  2EE1 A;  3P75 A;  2QGQ A;  1LTR D;  5FO8 B;  5JOB A;  4N9P A;  1GXD C;  2K4K A;  1K28 A;  4O1N A;  2YU9 H;  1Q7Y C;  1UE5 A;  1E1T A;  2JA5 B;  3KLS A;  1ML0 D;  1LUZ A;  2PMZ E;  1KRS A;  2F4V L;  3PQI A;  1PZI D;  4KHP Q;  2F0Q A;  3FPP A;  1HHV A;  2JXM B;  3RZO B;  2R7Z H;  2F0O A;  5EPK A;  4EQO A;  4LF8 L;  3JC6 6;  2H1E A;  1NR4 A;  2F0I A;  4RWS C;  2PNH A;  3K7A H;  1UWV A;  3PSI A;  4C3H B;  5I4D A;  1VQA A;  2A74 C;  1A2T A;  2FJ2 A;  4JYA Q;  2OQK A;  1EUJ A;  2R7Z B;  3CC2 A;  2XN9 C;  2UXD L;  2OWO A;  2L9H A;  1G6P A;  1TU2 B;  1E2V A;  3AFP A;  1Q1B A;  5FOB B;  1O80 A;  5M3F B;  2E2H H;  4FF4 A;  4DR1 L;  4DR5 L;  3D6W A;  5FLM H;  4J8Q A;  4HMJ A;  3D4R A;  2JA5 G;  4ZAI A;  1I94 L;  1B9N A;  3EVQ A;  1UE1 A;  3LGJ A;  5M5X H;  1H9S B;  1NNX A;  3C1E A;  3QOL A;  4HSV A;  3BZC A;  1RTN A;  5EKK A;  4K8J A;  2M9V A;  1JB3 A;  4RA8 A;  2EY1 A;  1KQS A;  2K28 A;  1PVO A;  2KQ3 A;  2RDF A;  4NPS A;  2JEB I;  2MUY A;  1PTO B;  2N49 A;  3F2C A;  4L8J A;  3H6M A;  4BBR B;  1EQT A;  1RL2 A;  3KBG A;  2QF7 A;  1XWE A;  3PIO 3;  2UU9 Q;  5EPJ A;  2Q8I B;  1HTP A;  4RG1 A;  5LMN W;  3ONA B;  5FLX L;  2XNA C;  1X55 A;  3KF8 A;  1JT8 A;  4MN3 A;  1B50 A;  3V96 A;  4J15 A;  1VQP A;  2QIL A;  2E76 C;  1X3E A;  1MD2 D;  1J6Q A;  1WJJ A;  3BDL A;  4DAM A;  4HSP A;  2CCZ A;  4R4C A;  1P8L A;  2FMC A;  1U9R A;  5ELB A;  2JA6 G;  3BU2 A;  1ILQ A;  2OF1 A;  3VR3 A;  4JI1 L;  4YWM A;  2KEE A;  4QIW E;  4KHP L;  4CDC C;  3MXP A;  5KGU A;  1R4P B;  1I6V C;  1EYC A;  1VF5 C;  2ZM6 Q;  3M4P A;  1B8A A;  3KFU A;  4LUV A;  5T1G A;  1KLG D;  5A35 A;  2I0Q A;  2JA7 B;  4BA1 I;  5E3F A;  1QUQ B;  5GAD C;  1YJN A;  2HHH L;  2F0W A;  5JPM C;  1MHW C;  2K04 A;  1OXV A;  4RKL A;  2A68 D;  4FYD A;  2A1A A;  3SR1 A;  2I5L X;  1LV9 A;  1SDF A;  3NK9 A;  4IFD G;  4JI2 L;  2O5J C;  3FKI G;  3Q0A A;  1C4Q A;  3HRZ C;  2Z0S A;  3K58 A;  1QJO A;  2JA5 H;  4ABN A;  1G29 1;  1SFO B;  3N52 A;  4ZKB B;  1V1Q A;  4RHR A;  1V1P B;  3PIP 3;  4UPA A;  2OCE A;  5FLX c;  4P73 A;  4A3D G;  4A3F G;  1KXL A;  3VA7 A;  3NQT A;  3GDE A;  3I70 A;  1IL8 A;  4CJ2 C;  4RGN A;  3T1Y L;  2UUA Q;  4LUO A;  2F0T A;  3IFD A;  4A3D H;  2UUB Q;  1Y8P B;  1JR0 D;  1X3Q A;  5KYI A;  3DEO A;  4HIM A;  2DNE A;  2WIN B;  2Z6B A;  3I91 A;  4A3G B;  2N88 A;  2IT1 A;  3T1H L;  4CJ1 B;  1NCV A;  4OL7 A;  1ESR A;  4DV3 Q;  1A8V A;  2J4X A;  1KC8 C;  5C0X I;  3NE5 B;  1BKB A;  4UP7 A;  5D14 A;  4OIJ A;  5M5X B;  2ASB A;  2GVB A;  3A74 A;  2K6A A;  4K6D A;  3S16 H;  4JI1 Q;  4A3G H;  4GZY C;  2KUM A;  3J7A 5;  4NXM L;  1BVS A;  1SND A;  5IGE A;  3GTQ H;  3DLL A;  2BDN A;  2CWP A;  1KDA A;  1WD0 A;  1JE4 A;  4YHH L;  2Q2U A;  4B3R L;  2EYH A;  4JI6 L;  2BH8 A;  2XTI A;  4KK7 A;  5M5W B;  3ER0 A;  4DUZ Q;  1N36 Q;  5GQO A;  4JBW A;  3G6J B;  2I5M X;  3SK8 A;  4IQZ A;  4B9X A;  1YJW A;  4RHS A;  2UUC Q;  1B3A A;  5COR A;  4GN4 B;  1KAA A;  5IWA Q;  2D9U A;  3OTO L;  4CKE A;  1K83 H;  2Q2I A;  3CC7 A;  4LF7 L;  2X69 A;  2K01 A;  4M1U B;  4P2C B;  3MA2 B;  2JA7 G;  2Z8L A;  1VF7 A;  1XMQ Q;  1MJE A;  2ENB A;  4DV1 Q;  2N78 A;  1PRT C;  5ELO A;  3S9W A;  1EWH A;  4LF9 Q;  4DV7 Q;  4FO2 A;  1X3G A;  5IYD G;  1QVC A;  3HEJ A;  4H7B A;  1KLU D;  2VXW A;  4DR5 Q;  3VDY A;  2A6H D;  2UXB L;  3NSW A;  1EY9 A;  3MXN A;  4R4I A;  2RDG A;  3BVG A;  2JA7 H;  2VW9 A;  3TP7 A;  4O2D A;  3GTL H;  4NMZ A;  1PMR A;  2GVA A;  5ELN A;  4B3M Q;  4DAY A;  1RTO A;  4P74 A;  5C5L A;  5LMU L;  5CBE E;  4ZYS A;  3AB9 A;  2IY5 B;  4KJN A;  2R7D A;  2CW0 C;  2X6L A;  2SDF A;  1BCP F;  3TZU A;  3R3O A;  4JV5 Q;  2KCM A;  3S14 H;  4BBS H;  1XTC D;  4GN3 B;  1Q1E A;  4A3K G;  1V8Q A;  1X3P A;  2CH4 A;  2KHI A;  5EKI A;  4OWW B;  1FNV A;  3GO5 A;  3D3R A;  3IKJ A;  4RCO A;  2XGT A;  4I65 A;  3S24 A;  1ET6 A;  1HUN A;  4RFB A;  2CW0 D;  1BO0 A;  2F0N A;  4L6T B;  3I55 A;  1EEI D;  4IUV A;  3T56 B;  4C3I G;  1ESF A;  5K5P A;  5JJL A;  4DR7 L;  1EU4 A;  1XX8 A;  1CSP A;  4PZ8 A;  1NTG A;  5DM6 3;  4GLX A;  2IX1 A;  1VMC A;  1QVF A;  5T1I A;  1SMY C;  2HHH Q;  4XXE A;  1AE2 A;  5GRO A;  4HJA A;  5JEA G;  2F0P A;  1IW7 D;  3NWS A;  3H15 A;  2VUM G;  4DV4 Q;  1W6K A;  1BR9 A;  3GTO B;  3HOU G;  3SE0 A;  3KOJ A;  3R93 A;  4X66 Q;  3WOF A;  3TSS A;  4DUY L;  4PMW A;  4K0K L;  3S1N H;  3NXW A;  4MZ9 A;  4JI7 L;  3GTJ H;  1SE4 A;  5IYC G;  1VQD A;  1YI2 A;  3CQZ H;  1TWH B;  4OEL B;  1RCV D;  4IUQ A;  2L15 A;  5ISR A;  5C3W A;  1MI2 A;  1BQQ T;  3PO3 G;  1I4Q A;  1X32 A;  1QUQ A;  1U0L A;  1IBL Q;  1BBU A;  2B2T C;  4JV5 L;  4BBS G;  4DPG A;  3CCS A;  1BBX C;  2SNM A;  1QG7 A;  4A3I G;  4WRD A;  3I56 A;  1OTC A;  1STA A;  2D0O A;  2A68 C;  1C48 A;  3OW7 A;  4NXN L;  3TRZ A;  1C9O A;  3HOU B;  5CC4 A;  1XNQ L;  2EY6 A;  1CT1 D;  3MEH A;  1D1I A;  3UDG A;  4OO1 G;  3D4D A;  4U67 3;  2RKS A;  4RGT A;  3FPU B;  3SEB A;  4KTA A;  4RKB A;  5HGQ A;  4JI5 Q;  4JI0 Q;  5K36 H;  4HCE A;  4DU9 A;  3SVM A;  4ZUI A;  1PRT F;  5KRU A;  3DHQ A;  4XYQ A;  4K5W A;  3A7L A;  3F1Z A;  4X6A H;  2FMM A;  2JYO A;  2ICE C;  2FHT A;  3C2P A;  4HCS A;  2Z6K A;  2F0F A;  2EYP A;  2B8F A;  1QE6 A;  3TP8 A;  1E7Z A;  1TXY A;  5DLQ E;  4PMC A;  5CV7 A;  1SYF A;  4NDX A;  1P16 A;  5M5Y B;  1I4P A;  3HG9 A;  1EIY B;  3CC4 A;  5IYB G;  2XSC A;  2X6G A;  3BG3 A;  1V43 A;  4X66 L;  1KDC A;  4AYB E;  1IBK L;  1Y1V H;  2JQO A;  5ELE A;  4DV6 Q;  4MTN A;  5IP9 H;  3VYT A;  4DF7 A;  4FXG C;  3GTO H;  4BY1 H;  1QB5 D;  5BN4 A;  2KEN A;  3E6Z X;  4GKJ Q;  2M00 A;  2R93 B;  1NR2 A;  2BA0 A;  4HTH A;  3RZD H;  2Y0S G;  3F2U A;  1HR0 W;  4Y52 H;  4ZK9 B;  1SMY D;  2BA1 A;  4FNF A;  3S1M B;  2A8V A;  1E3P A;  2R3Z A;  2PO4 A;  3L0O A;  4HN7 A;  1HZA A;  4GN5 A;  4H13 C;  1NUC A;  2B2Y C;  2A69 C;  1FYC A;  2RSO A;  2O4X A;  3PF4 A;  1X3F A;  4P75 A;  2NYZ D;  1N34 L;  3I4L A;  4LF5 L;  1X54 A;  4A3C H;  1PXU A;  4ILW A;  2ZJP A;  1UAP A;  4TRD A;  3OWE B;  1EYG A;  4XQJ A;  1STY A;  3I4N H;  1U4P A;  2WV6 D;  1L2F A;  1EOV A;  3UI2 A;  1Q8I A;  2ES2 A;  3C3L A;  1PYW D;  1FGU A;  4DGZ A;  4LFA Q;  4DKA C;  1ASZ A;  2CHB D;  3SDZ A;  3ULJ A;  2CFM A;  4KHV A;  4JI5 L;  3TRE A;  2K5N A;  5D3D A;  4JI4 L;  2UXC Q;  3ICE A;  4DR2 L;  2WAQ E;  3PO2 H;  1UE6 A;  1LTI D;  1S5E D;  2AWO A;  1CI3 M;  2JA8 G;  2H4O A;  4LAA A;  4ME5 A;  4PZ6 A;  3F2D A;  5FLM G;  1VQG A;  4MTK A;  5J22 A;  2BE5 D;  3HOZ B;  2QEJ C;  1VQF A;  3DXJ C;  3VR4 A;  1HQM C;  1S40 A;  3CPF A;  3NBH A;  1R9T H;  3FKI H;  2F0M A;  2P5Z X;  1PRT D;  1F2Z A;  3HOZ H;  4YIJ A;  4L5Q A;  1SNM A;  1M4V A;  2KHS A;  1XNR L;  2PZU A;  4P71 A;  3KK7 A;  1HZ9 A;  2Z9H A;  1G8Z D;  5BR8 Q;  4O0A A;  1IBM Q;  1QOH A;  4IFD I;  1EFI D;  3KLW A;  4B3S L;  3K5N A;  1PH1 A;  3K5L A;  3KLR A;  3A7A B;  1SSO A;  3R8B A;  1SJE D;  3DWQ A;  3HZX A;  4B3T Q;  5CGK A;  2L5T A;  1BDO A;  1D2B A;  4C56 C;  2L4N A;  2F3V A;  3CCU A;  1S4Z A;  2K5H A;  3RZD B;  4RH6 A;  2XVS A;  5G3L D;  2NVT B;  2EZV A;  2AQ1 B;  2EDG A;  2B2U A;  4RGM A;  3CU7 A;  5KEE A;  4XQQ A;  3FHW A;  4PV1 C;  1PHJ A;  3Q22 A;  2KCN A;  2I07 B;  3S1Q H;  1G6Z A;  3S2H H;  2QKI C;  4OGQ C;  1SMX A;  2LSS A;  2F1M A;  2JE6 I;  5CV6 A;  4A3F B;  1XXG A;  1K8O A;  1L0W A;  4DV3 L;  3ULL A;  2NVQ B;  1STE A;  2UU9 L;  1Y14 B;  2EYO A;  2K5W A;  1A3V A;  1WTV A;  4NXN Q;  1CQF A;  3D31 A;  3NTH A;  3RMH A;  3PUY A;  1U5K A;  2ZTD A;  2UXC L;  3J81 c;  4NP5 A;  3KF8 B;  4PNY A;  2E5L L;  4A3M H;  3J7A V;  3VYR A;  4L5R C;  3M4Q A;  3A5U A;  4IUP A;  4IO9 A;  2JA6 H;  1EY8 A;  2C5C A;  5IGG A;  4B3R Q;  1VQ6 A;  4OO1 I;  3JAM c;  1IKL A;  4IZ8 A;  2DY7 A;  5AFW A;  4X3K A;  4FP5 D;  5IOC A;  2CQA A;  1JJG A;  4DV2 Q;  1DGS A;  5LL6 S;  2PW7 A;  4LFB Q;  4U68 A;  2HCC A;  1H9R A;  2WFW A;  3TP5 A;  3MHB A;  3SXH A;  4BWG B;  4G57 A;  3M7N A;  3CRL C;  3L9A X;  2F52 A;  5BR8 L;  3GTM H;  5GAH C;  1VQ7 A;  1K9M C;  3MEF A;  4LK1 C;  4J6H A;  2K7V A;  2HT1 A;  3AYH B;  1EQR A;  4P72 A;  4X62 Q;  1BNZ A;  1GHJ A;  1GKH A;  4DR4 L;  3I90 A;  5M3M G;  4DV6 L;  3FMC A;  4BY7 G;  5CV9 A;  4AQY L;  2IX3 A;  1XJV A;  4LW1 A;  5JEA H;  1VQM A;  2HDL A;  3U4V A;  1VCI A;  4KJO A;  4XQN A;  4A3G G;  5I2Y A;  2ALY B;  3NUC A;  1GVP A;  4OXP A;  1E1O A;  3W1G A;  5C4X H;  5C4J H;  1LTA D;  1QNK A;  1EQQ A;  1O7L A;  5M3F H;  4RMF A;  4PG3 A;  1PFM A;  3W2D A;  1SAP A;  5IYD H;  1STH A;  3IRB A;  4YWL A;  1RF2 D;  4WOR A;  3ERQ A;  4LF4 Q;  4A3J G;  1HCZ A;  1HXY D;  5BN3 A;  2NBF A;  3K5O A;  1RD9 D;  2LFN A;  3MXN B;  2CVR A;  2K5D A;  4A3M G;  3QOJ A;  3J80 E;  3M4O H;  1IW7 C;  1SYC A;  4HJ7 A;  2UXD Q;  4B08 A;  4OIK A;  4IUU A;  1KL9 A;  5DM7 3;  2R61 A;  5E7N A;  5BN5 A;  3AU7 A;  1EY6 A;  4JI4 Q;  3DM1 A;  3GTG H;  3EIV A;  1O7Z A;  1MJC A;  3CCV A;  4BY1 B;  1PTO C;  3I4N B;  2AUK A;  4KLK A;  2QEX A;  3HOW H;  2XWB B;  3HKZ G;  2K75 A;  1SNP A;  1CQV A;  2JA8 H;  1H9M A;  1A63 A;  1SYG A;  3GV6 A;  3KYH C;  4K2L A;  4DXF A;  3IL8 A;  4C3J H;  1SJH D;  4IFD H;  3GV3 A;  3CCM A;  1T5X D;  2XRQ D;  1AW7 A;  4LF7 Q;  1PRT B;  2IX0 A;  3BVZ A;  4V0B A;  1N32 L;  4IUR A;  1XMQ L;  4GNX C;  3ZJY C;  4E6I A;  1STN A;  4DR4 Q;  5I2X A;  1MBY A;  1EOT A;  1EZ8 A;  3W1B A;  2AQ3 B;  3GTM B;  1JWM D;  4LFC Q;  4N9T A;  3MXG A;  4DV7 L;  4F88 A;  1EYD A;  2GN5 A;  2DJG C;  2YTV A;  3OOC A;  3STB D;  1F2M A;  3ERS X;  5ELD A;  1A3T A;  2Q2H A;  4RGO S;  4OEM B;  1HJP A;  4FXK C;  1A6X A;  1HNW Q;  1PFB A;  5KNB A;  2IJ0 A;  5I6W A;  2PCF B;  3JAM i;  5FJ8 H;  3K7U C;  2A6E D;  1TY2 A;  3EQL C;  5C0X J;  3SK5 A;  4K6L A;  1LAB A;  1MGS A;  1NY4 A;  4JI8 L;  3IFT A;  4GNX B;  1ILP A;  3WOE A;  2B39 A;  5JJK A;  3DUZ A;  4K5V A;  5IT9 c;  3FKI B;  2YTY A;  3AMU A;  1B2T A;  2DN8 A;  5COY A;  1S72 A;  2EYJ A;  2WB1 G;  1YHA A;  3CD6 A;  1UNS A;  4H02 A;  1JC7 A;  3NEM A;  2ID0 A;  2VQE L;  1II3 A;  2RDH A;  3LX0 A;  2E5L Q;  1SNC A;  5C4J B;  5C44 B;  3G4S A;  2ZXO A;  4BY1 G;  5JVH 3;  5M5Y H;  4YY3 L;  2DY8 A;  3D4W A;  4DR3 Q;  1VQN A;  1FR3 A;  3MTS A;  2EJF C;  4A93 H;  1SN8 A;  5E4X A;  3HOW B;  1TWG H;  2QCP X;  3CP0 A;  2J7Z A;  1WCM G;  1VMP A;  3PIO A;  4LFB L;  1KDB A;  4APV A;  1YEZ A;  3BZK A;  1CSQ A;  3G48 A;  1M90 C;  4QUF A;  2UUB L;  1Z47 A;  1AE3 A;  1D6E C;  2B2U C;  3TS2 A;  1STB A;  3C1F A;  3RR5 A;  2EXD A;  3DWP A;  3TEH B;  1K8A C;  3WWV A;  1BCP C;  3FVQ A;  2QW7 A;  1K8G A;  4DV4 L;  1H9J A;  2NN6 I;  5JVG 3;  2RBM A;  1STG A;  5IT9 L;  4DV0 L;  2B2W A;  1D8L A;  4DNI A;  3S15 B;  4JK1 C;  4DUY Q;  4LMQ D;  1TS2 A;  5D65 A;  3T1Y Q;  4GLV B;  3LWU A;  3UDX A;  4A3J H;  3H0G G;  1HNZ Q;  4LF5 Q;  4R8N A;  2AKW B;  1TWH H;  1YZ6 A;  1GUN A;  5L37 A;  3UDI A;  2R92 G;  3P1H A;  2B29 A;  3T1H Q;  2E2J B;  1W6J A;  2F3I A;  1T5E A;  1E0B A;  2LXJ A;  1HQR D;  1W3S A;  5J3B A;  2EYL A;  2OTJ A;  1S5B D;  4ULL A;  4G4K A;  3SK4 A;  2PW5 A;  4OHJ A;  5M3M H;  1SYE A;  4DK1 A;  1EY0 A;  1HZC A;  4NW2 A;  1DCZ A;  1CK1 A;  1XPR A;  1R9T B;  2VZA A;  4GKK L;  4DFA A;  3I7F A;  4JI0 L;  1PTO F;  4YY3 Q;  5FK9 C;  4C3I B;  4IJL A;  3S14 B;  4DA2 A;  1JB7 A;  2Q8T A;  3PUW A;  4R4O A;  1Q3L A;  2PQA B;  1JJC B;  1OXX K;  2UUC L;  2HUG A;  3S1R H;  2KA7 A;  1A3U A;  3VYU A;  4R9W A;  1HUM A;  1LTB D;  1D5X C;  1Q82 C;  2Z1C A;  1VQB A;  3UE1 A;  3CCR A;  2E2I B;  3TQY A;  2KHJ A;  3SGI A;  3PGZ A;  1VQE A;  5J39 A;  4X65 Q;  1DD2 A;  1Z7T A;  4L5S A;  1Z6H A;  2B2V C;  1BXT A;  1PTO H;  2NVT H;  2ZTC A;  5C6A A;  2R92 B;  2KED A;  1LO5 D;  1ONL A;  1Y1V G;  4RCN A;  4A3L H;  4WJ4 A;  2EYM A;  3FEW X;  2RQX A;  1Q8K A;  4A93 B;  1DOK A;  4EQ5 A;  2Q8R E;  5E1F A;  1EY4 A;  2L12 A;  1SE8 A;  1TY0 A;  1LTG D;  2BOS A;  4TVA B;  4DR6 L;  4A3B G;  1B7Y B;  4JW0 A;  4KY6 A;  2C9O A;  4UHV A;  1GM5 A;  3MAQ A;  5IGF A;  1PV4 A;  2VB2 X;  1HRJ A;  2OTL A;  1CA5 A;  1VQC A;  2B2V A;  4DAY B;  1SRO A;  2Z6K C;  5C4H A;  3DMU A;  3KBX A;  3K0Y A;  1SYB A;  1CHQ D;  4K2K A;  3PUZ A;  1DJR D;  1E2Z A;  2FIN B;  1LT6 D;  2VNU D;  1WTQ A;  1FD7 D;  1ENA A;  4G7O C;  3CQZ B;  3B6Y A;  1I6H B;  4KN4 C;  3CHB D;  1F9S A;  3HKZ B;  3BS1 A;  1Z9F A;  1K0R A;  5JJI A;  2DGY A;  5C0X G;  2IHF A;  2K52 A;  1VQ9 A;  3EN2 A;  2E8G A;  1X9N A;  4KKT A;  2LY7 A;  2RF4 A;  4DR2 Q;  3PO2 B;  1DOM A;  3DEP A;  4IPC A;  1ROD A;  2JSO A;  4DR7 Q;  2L1B A;  3QR8 A;  3GTL B;  4FF1 A;  2JEA I;  3E0E A;  3NPP A;  4DV2 L;  3NEL A;  1UE7 A;  2F03 A;  1J8I A;  4JOI A;  2MP1 A;  4QMG A;  4F87 A;  2IW3 A;  4WJW A;  2KCT A;  2YV5 A;  3TBI B;  2C35 B;  1PA6 A;  1TWF B;  3PO3 H;  4POG A;  4N8F A;  1K3R A;  4QUC A;  3HOV G;  5FLX E;  1JE5 A;  4A3I B;  3I4M B;  4J1M A;  2MGS A;  1SNO A;  1PH3 A;  1SEB D;  3H0G B;  1VQ8 A;  1X65 A;  5CV5 A;  1IYJ B;  1X56 A;  1PH2 A;  3PO3 B;  4I7Z C;  4C1N K;  3MFY A;  2JJQ A;  4A3L G;  1CZW A;  4A3B B;  1V1P A;  2RVL A;  3J80 L;  5FKA C;  3NBH B;  3MXU A;  5IP7 G;  2XRS D;  3OWF A;  1GUS A;  1HTL D;  3P20 A;  3H3V I;  4OWT B;  3SHL A;  3PF5 A;  4CDF C;  5C44 H;  3D0F A;  3CAM A;  1DON A;  2V4D A;  1HNZ L;  4JVZ A;  1DM0 B;  2XWJ B;  1PH5 A;  2ICI A;  3EBE A;  4KV6 A;  4CGY B;  2LKV A;  2HD3 A;  2WP8 J;  4LF4 L;  2IWH A;  2XIW A;  2IPK D;  3TDQ A;  2R6G A;  2MHV A;  2EIF A;  1UEB A;  2N8N A;  4YWK A;  4MIU A;  1L1O A;  4DV5 Q;  2MNA A;  2WII B;  3MZ5 A;  3CKI B;  1U4R A;  1K3B C;  2WKC A;  1XMO L;  1BUV T;  1HR0 Q;  1G2T A;  4GNX A;  3IAY A;  3GTJ B;  1JOK A;  1FGB D;  3I4N G;  4JBJ A;  5IE8 A;  1GOZ A;  1YBY A;  1ZYR C;  2B2W C;  3CPW A;  4IPD A;  4KN7 C;  5EQ0 A;  1UEA B;  3HOV H;  4H0L C;  4A3K B;  4JI3 L;  2G5D A;  3R2T A;  2RCN A;  4IPG A;  1HH2 P;  3BDO A;  3CW2 C;  1HA6 A;  3A56 A;  4OX9 L;  5C3E H;  2K05 A;  2MJ8 A;  4GOP A;  2YTX A;  4Z9C B;  3PCO B;  3G71 A;  4QQB X;  1D1K A;  1N33 L;  1ICF B;  3L7Z C;  2NUC A;  2ZXP A;  1N9W A;  2EPB A;  1H9S A;  2NVX B;  4X3T A;  2EOT A;  4N8X 1;  2PI2 A;  1ZYR D;  1LLR D;  2RHQ B;  5C4X B;  2LS0 1;  1ENF A;  4HED A;  1D5M C;  4EX5 A;  5IP9 G;  1I50 B;  3H94 A;  1FJG L;  1NMG A;  3SK6 A;  3QIA A;  3WDN A;  5DEH A;  1F2Y A;  1TT2 A;  4ZUJ A;  3S1R B;  1PDQ A;  3R2I A;  1L1O B;  1EL0 A;  2F0L A;  1TVX A;  1I3Q B;  3BYY B;  4R8I A;  2WB1 E;  4GOP C;  4XTC S;  1JOO A;  3GP7 A;  1VQH A;  2F0D A;  2E2I H;  1E24 A;  4BXX H;  2EXZ A;  3GTP H;  4JPB W;  4LF8 Q;  4BY7 B;  2K33 A;  1TII D;  4LJZ C;  5JEA J;  2EYF A;  4MHE A;  2IL8 A;  1B44 D;  3CF5 A;  3NP8 A;  3X3N A;  4CKB A;  2B3G A;  4K14 A;  4Y7N H;  5A2Q L;  2VUM B;  4C2M B;  1J5E Q;  4ME3 A;  3KJP A;  4X64 Q;  3S2D H;  3J81 j;  1VDZ A;  4AH6 A;  2NTT A;  3S16 B;  3I73 A;  2KEC A;  3KJO A;  2JA9 A;  3UE0 A;  5AJ3 L;  4G7H C;  2NWG A;  1F9Q A;  1CUK A;  5NUC A;  3S1Q B;  2BDO A;  3TN2 A;  3T53 B;  2RA4 A;  5HY6 A;  5LMN Q;  3KF6 B;  5CBA E;  1HFG A;  3GTG B;  4UY8 C;  1N36 L;  4A3J B;  2NVQ H;  1FNU A;  3I2Z A;  5IGD A;  5C5M A;  3BZD B;  3QWN A;  1JWU D;  1LTT D;  4KKS A;  1HFN A;  3RZO H;  2PZW A;  3I72 A;  2RSN A;  1JOQ A;  4DNT B;  4HAE A;  3P7J A;  3MFG A;  3CCQ A;  5EJW A;  3I3C A;  5EAY A;  4KI0 A;  3LNN A;  1ZXT A;  4IFD J;  5FO9 B;  2A6E C;  1U4L A;  1CZG A;  1RDP D;  1YNX A;  2WAC A;  1WTX A;  2E74 C;  1W2B A;  5C4X G;  1Q12 A;  1IBK Q;  1DYQ A;  4KMU C;  1SBB B;  1I50 H;  1LM0 A;  1SE2 A;  4A3D B;  5G3L F;  1B70 B;  1NSN S;  3J7A F;  3OIQ A;  1YIJ A;  2CKZ B;  2E2J H;  1WYD A;  3OHX C;  3K80 C;  4IOC A;  4JCV E;  3CCL A;  3S17 B;  1LT4 D;  2PMZ B;  1F9P A;  3OW2 A;  4LUZ A;  2CH4 W;  3X3M A;  4QL5 A;  1AP0 A;  1I4G A;  3CCE A;  5ELF A;  3JAM L;  1ZKO A;  4L63 B;  4BBR H;  4X64 L;  1YVC A;  2KOL A;  4PMB A;  4Q0F A;  4IN3 A;  2KJX A;  5A2Q E;  3HP3 A;  3C46 A;  2VUM H;  1L0X B;  1DOL A;  3U4Z A;  3E3X A;  1CKM A;  2B63 B;  1M1K C;  2NVY B;  3S2D B;  3MWY W;  5C3X A;  1WTW A;  2G9H D;  3I4O A;  1LT5 D;  4CBV A;  2F0E A;  3OYY A;  3GTP B;  3FP9 A;  1C7Y A;  1T9H A;  3GTK H;  4ZCK A;  1Y1W B;  3FRP B;  3HOY B;  1A0I A;  1JIC A;  4ZKC B;  2LXK A;  4AQY Q;  4A3M B;  4A3E G;  3M3Y B;  4JI7 Q;  3D6C A;  4DR3 L;  3M85 A;  3K81 C;  4ALP A;  1O7Y A;  1PFN A;  3VYS A;  3JAM E;  1JQY D;  3S15 H;  4IPH A;  1E22 A;  3KUP A;  2A5H A;  3NEN A;  5TSS A;  1QWY A;  3AQQ A;  3A55 A;  1QNU A;  3GD7 A;  1IBL L;  1IYU A;  1M8A A;  1KD1 C;  1LTL A;  1XNR Q;  1DXM A;  5I9P A;  2A19 A;  2VS1 A;  4K0K Q;  1KHI A;  4JOI C;  4AIM A;  4B3S Q;  1G91 A;  3HOU H;  1FNW A;  1KIX A;  1NAP A;  3E9I A;  1H9K A;  1KAW A;  3T16 A;  2PYK A;  2F0H A;  5H1S E;  3L2P A;  2DJF C;  5ELC A;  5CYU A;  1KNA A;  3O13 A;  5E4W C;  4CDD C;  1IYV A;  2VL6 A;  4XYO A;  1WVL A;  3V05 A;  1V1O A;  2HQL A;  1Q81 C;  2O5I C;  2OXP A;  4B9W A;  1C8C A;  3U50 C;  2R7F A;  3NQI A;  1MIU A;  4LF6 L;  1S3O A;  2NZ1 D;  2ZJR A;  2R7Z G;  3KDF A;  3K57 A;  5FJ8 G;  1PFS A;  2PNR C;  4C3I H;  1PYB A;  2AMC B;  4C3H G;  1I4R A;  2Z4H A;  4CJ0 B;  3H91 A;  1Y8N B;  4KY7 A;  1JWS D;  3NHH A;  2O2L D;  5GAE C;  1RIP A;  5JPN C;  1PLF A;  3H09 A;  1Y69 U;  1XTD A;  3A8K E;  2AUJ D;  1B1Z A;  1JMC A;  4ZQ3 A;  2F0U A;  2L0C A;  3T13 A;  5KND A;  2E2D C;  4R1J A;  2JN4 A;  1F2L A;  3CME A;  4R4Q A;  1DZ1 A;  4HJ8 A;  3STB C;  1ENC A;  1FVI A;  4GKK Q;  3S2H B;  2CQO A;  4ID6 A;  1CHP D;  1EYA A;  2RCF A;  1TWC H;  1I4H A;  4C1N I;  3S1M H;  5I9O A;  1HNW L;  4C3J G;  5M5W H;  1N8R C;  1LAC A;  2A69 D;  3D8G A;  5CV4 A;  4FF3 A;  3TME A;  1N32 Q;  3RN5 A;  4IJH A;  2HQE A;  3HKS A;  1IL2 A;  3GQB A;  2KBN A;  5F2D A;  3ND9 A;  4EVO A;  1Y1V B;  4IUN A;  4A3C G;  4TQU S;  4LFC L;  5LHY 1;  1YNJ D;  3EJI A;  2RHS B;  2WAQ G;  4OON A;  4JG2 A;  4FXD A;  1EU3 A;  4DXG A;  1SE3 A;  1L0Y B;  2B2Y A;  1YNJ C;  1NE3 A;  4BXX G;  1SR3 A;  1EWI A;  3W5O A;  1RKN A;  2F4V Q;  2F0S A;  2L11 A;  3OMG A;  1BBW A;  4NXM Q;  2JK8 A;  1HA5 A;  3ITP A;  1K83 B;  3BVM A;  5DNF A;  5IIF A;  2BE5 C;  1EY5 A;  3HOV B;  4LF6 Q;  1SFO H;  1OXU A;  2F3W A;  3NTK A;  1NMF A;  5M3F G;  1LTS D;  3J7Y W;  4JYA L;  3K5M A;  3LWE A;  4A3E B;  1BCP B;  1AZP A;  2E75 C;  3OIP A;  3K6O A;  4XT1 B;  3UDF A;  4YCW A;  3TS0 A;  2Y0S E;  4FF2 A;  2EY5 A;  4LWC A;  1MKH A;  1XMO Q;  1PH7 A;  1B3Q A;  5IT9 E;  1TR5 A;  3CCJ A;  1A15 A;  2EJM A;  1EEF D;  2B63 G;  2D2C C;  2Z4I A;  1JOR A;  1A62 A;  2D0P A;  2OEO A;  3Q6S A;  4HR7 B;  4DN4 M;  4JI6 Q;  5C3E B;  2A6H C;  4IAL A;  1D7Q A;  2F0V A;  4DV0 Q;  2A73 B;  2UXB Q;  1TS4 A;  4JI3 Q;  4FVM A;  1VQL A;  1SRU A;  1HNX Q;  3M9B A;  2WB1 B;  4Q5V A;  1PH9 A;  1Q90 A;  3J7Z C;  3W3A A;  5EKL A;  3T51 B;  4BBS B;  3KDF B;  4I7A A;  2E2H B;  4B3M L;  5IY0 A;  4LF9 L;  2SOB A;  1VQO A;  4A3I H;  5KYL A;  1IBM L;  1AN8 A;  4K8I A;  4YCU A;  4UDU C;  3GTK B;  1BCP D;  1Y1W H;  3HOY H;  2K32 A;  2FXQ A;  1CA6 A;  4F8M A;  2MQH A;  2TSS A;  3HKZ E;  1TS3 A;  4AYB B;  4A3B H;  3F8T A;  1WFQ A;  3Q8D A;  1CTM A;  4ZRZ A;  1QIL A;  2Y0S B;  4YCV A;  4X3S A;  1CKN B;  2NVY H;  1YIT A;  4DK3 C;  3U9O A;  1PH4 A;  2KVM A;  2FFK B;  2AWN A;  2F4I A;  1WCM B;  3M4O B;  2K1B A;  4C3J B;  3PIP A;  1U4M A;  1V9P A;  2D62 A;  4V19 0;  1PYS B;  1XPO A;  5CV8 A;  1YJ9 A;  3J81 i;  1MSG A;  3VR2 A;  4OWX B;  2YU9 B;  5CR3 A;  2R92 H;  3TZD A;  1Q86 C;  1KRT A;  3RNU A;  3K0X A;  1J5E L;  5HGT A;  3NTI A;  2GA4 B;  4F7X A;  5C44 G;  1OO9 B;  4HMI A;  3BDC A;  1B9M A;  4JI2 Q;  4DK0 A;  4HIO A;  1S5C D;  2MPM A;  3RLN A;  5K36 G;  5AJ3 Q;  1GHK A;  1NBW A;  3E0J A;  1QVG A;  1B53 A;  2B8G A;  4DV5 L;  5IP7 H;  1CM9 A;  3K7A B;  1WOC A;  2F0G A;  4C3H H;  2VQE Q;  1ICW A;  1WTR A;  1PTO D;  2I5H A;  1J9O A;  5DAU A;  4GLA C;  1HPC A;  1ASY A;  3RLF A;  1CKO A;  2NN6 H;  1MSH A;  1GUO A;  2PQA A;  1SXT A;  3T4A C;  2NVX H;  4L5T A;  5EBC A;  2ZJQ A;  1BOS A;  3HS0 C;  3U9S A;  1ET9 A;  2ZTE A;  4EQP A;  3RN2 A;  4H44 C;  3G6E A;  1TS5 A;  1VQ4 A;  4HID A;  3E9H A;  4A3K H;  4DR6 Q;  3H3V H;  4OX9 Q;  2MFI A;  4BBR G;  2I46 A;  4GS3 A;  2PZT A;  1QZG A;  1C0A A;  5EPL A;  4GOP B;  1D5Z C;  5EBD A;  4LFA L;  4X3U A;  2MO1 A;  1JJ2 A;  4CDE C;  3G7L A;  4XT3 B;  3A0J A;  3I8Z A;  3VR6 A;  2VQF L;  1TWF H;  1F77 A;  3MVV A;  5C0X H;  1UUP A;  3NBI A;  1YNN D;  1I5F A;  4PQX A;  2WKD A;  1FL0 A;  1VS0 A;  2EJG C;  5EGT A;  5J1Z A;  2J0T D;  3HOX B;  2DNC A;  2AQ2 B;  1I3Q H;  3DM3 A;  3ND8 A;  2K14 A;  3CMA A;  3EA6 A;  4KHZ A;  3CXC A;  4TKO B;  1CKN A;  3HFZ B;  1E2W A;  1Y1W G;  3HOY G;  3J81 E;  4IUT A;  2K5V A;  5IWA L;  3OTO Q;  1EFW A;  2B63 H;  4QCL A;  4JBK A;  1XNQ Q;  5I6Y A;  3HOZ G;  2MO0 A;  3VR5 A;  4DV1 L;  3M4Y A;  5CMD A;  1I4X A;  1G51 A;  2NZO A;  2R93 H;  3K8A A;  4PZ7 A;  4DK6 C;  3J80 i;  1K0S A;  5M9O A;  4KY5 A;  4QIW B;  4NKL A;  1EWC A;  4HJ5 A;  1KNE A;  3QO2 A;  1RJT A;  1XPU A;  3S1N B;  4KD4 A;  1K8M A;  3J80 c;  4GKJ L;  4JC0 A;  2PQE A;  1L1O C;  1HZB A;  2CWA A;  2K5Q A;  2JA6 B;  2QA4 A;  4QB4 A;  4HJ9 A;  2KCC A;  2UUA L;  3OSO A;  3QJY A;  4M8A A;  1EIG A;  2WAQ B;  1GO3 E;  1CFM A;  1XYI A;  1OXT A;  1B4O A;  1VQI A;  5IGB A;  4K5X A;  2K03 A;  2N3S A;  1G2S A;  5M3M B;  1GJX A;  2TMP A;  3S17 H;  3RLO A;  1I6H H;  2VQF Q;  2NN6 G;  3ERO A;  4X65 L;  4EQN A;  3Q24 A;  1IXR A;  1PH6 A;  5D3I B;  1GD7 A;  2QDL A;  3I4M H;  3QB3 A;  4UP9 A;  2OT2 A;  3H3V C;  5IGC A;  2DUD A;  3K59 A;  4QJF A;  2NB0 A;  4CKC A;  1X6O A;  1PZK D;  3Q23 A;  1SNQ A;  1HR0 L;  3KLS X;  3I4M G;  3HOX H;  4JI8 Q;  4YHH Q;  1NJI C;  3RUZ A;  5IYB H;  1GUG A;  1EIH A;  1VQK A;  4UP8 A;  4C2M H;  4DUZ L;  4DNR B;  1F9R A;  4KKU A;  4MNO A;  1WI5 A;  3RD4 A;  1GUT A;  3H0G H;  5LL6 X;  4QY7 A;  4R4T A;  4WJ3 M;  2EVB A;  2H5X A;  1VQ5 A;  4QGU A;  1KTK A;  2NZH A;  3HGB A;  2PPB C;  5KIX A;  3PO2 G;  1JCK B;  4TSS A;  4X62 L;  1VQJ A;  1TKW B;  2EY2 A;  4BY7 H;  1EQV A;  1YHQ A;  2YYZ A;  3FDT A;  4ZLT F;  2ZXR A;  3MC0 B;  3QG1 A;  4NB3 A;  1ZEQ X;  2JA8 B;  5JAV A;  4BA2 I;  1SYD A;  4IOA A;  5JJZ A;  4UAI A;  1PH8 A;  4B3T L;  5C4Z A;  1TWG B;  1LT3 D;  3N6R A;  3HOX G;  1K73 C;  1Q46 A;  2QDB A;  4AYB G;  1EZ6 A;  2HIV A;  3F2B A;  3U58 A;  1IZ6 A;  1WCM H;  1A2U A;  4QF4 A;  1YNN C;  3AEV A;  4JBM A;  2HIX A;  3E5S A;  4HIK A;  2OQ0 A;  2V1C C;  1TQO A;  1N33 Q;  4FDB A;  5LMU Q;  3TP6 A;  1H95 A;  3A54 A;  5IOD A;  1FJG Q;  2LMC B;  3NWT A;  2BCO A;  4A93 G;  3V2T A;  1O78 A;  2N55 A;  5HUR A;  3L3O C;  4O42 A;  1AH9 A;  2ATW A;  1EIF A;  4DAP A;  4LNQ A;  5IYC H;  2R93 G;  5C3E G;  3A5Z B;  2F0J A;  4RAU C;  4ODG A;  1WD1 A;  4A76 A;  1WTP A;  4A4I A;  2HDM A;  4A3E H;  1YHB A;  2L55 A;  3HOW G; 
#chains in the Genus database with same CATH homology
 4LF6 L;  1S3O A;  2ZM6 L;  5HGQ A;  4JI5 Q;  2ZJR A;  2R7Z G;  2OTJ A;  3KDF A;  4JI0 Q;  5FJ8 G;  1PFS A;  4C3I H;  3BJU A;  1PYB A;  2AMC B;  5M3M H;  5GAG C;  3F1Z A;  4X6A H;  1HZC A;  3AFQ A;  3PUX A;  5GAE C;  1RIP A;  1XPR A;  2VZA A;  4GKK L;  3I7F A;  4JI0 L;  1SLJ A;  1XTD A;  4YY3 Q;  2Z6K A;  1JMC A;  4IJL A;  1E7Z A;  1JB7 A;  1TXY A;  5DLQ E;  3PUW A;  4R4O A;  4R1J A;  2AHO B;  2PQA B;  3CME A;  1QZH A;  1JJC B;  1OXX K;  4R4Q A;  2UUC L;  4HJ8 A;  1P16 A;  3STB C;  1FVI A;  1O7I A;  3S1R H;  4GKK Q;  2Q2T A;  5LMN L;  1EIY B;  2CQO A;  3CC4 A;  5IYB G;  4A3F H;  4DR1 Q;  1Q82 C;  1V43 A;  1TWC H;  4X66 L;  1VQB A;  3UE1 A;  4AYB E;  3PUV A;  1Y1V H;  2JQO A;  3CCR A;  4DV6 Q;  2PI2 E;  4MTN A;  4A75 A;  3S1M H;  1HNW L;  5IP9 H;  1I94 Q;  3TQY A;  2KHJ A;  2VY3 A;  3SGI A;  3PGZ A;  5M5W H;  1VQE A;  1N8R C;  1HNX L;  1IBK L;  4X65 Q;  4BY1 H;  3GTO H;  4L5S A;  2KEN A;  4GKJ Q;  3RN5 A;  1N32 Q;  4IJH A;  2BA0 A;  3KF6 A;  3HKS A;  3RZD H;  1IL2 A;  2Y0S G;  1LYL A;  2KBN A;  1HR0 W;  2NVT H;  1N34 Q;  2ZTC A;  4Y52 H;  2BA1 A;  4A3C G;  2A8V A;  2K50 A;  4TQU S;  1E3P A;  4LFC L;  3L0O A;  1TWA H;  1Y1V G;  3PV0 A;  4A3L H;  4WJ4 A;  1HZA A;  1Q8K A;  4GN5 A;  2RHS B;  2WAQ G;  4EQ5 A;  4OON A;  4JG2 A;  1SE8 A;  1X3F A;  4P75 A;  3PF4 A;  4TVA B;  1N34 L;  4POF A;  4BXX G;  2IHE A;  1NE3 A;  4LF5 L;  1X54 A;  1SR3 A;  4XIG S;  1EWI A;  3ULP A;  4A3B G;  4DR6 L;  3W5O A;  2BH2 A;  1B7Y B;  3M3Y H;  4A3C H;  1OXS C;  2EQS A;  2ZJP A;  2F4V Q;  1EYG A;  1BBW A;  1GM5 A;  2QGQ A;  3I4N H;  4NXM Q;  2K4K A;  1L2F A;  2JK8 A;  1EOV A;  1PV4 A;  2YU9 H;  2ES2 A;  2OTL A;  1VQC A;  1Q7Y C;  1FGU A;  1UE5 A;  1E1T A;  1SRO A;  4LFA Q;  4DAY B;  2Z6K C;  4DKA C;  1ASZ A;  1LUZ A;  2PMZ E;  2CFM A;  1KRS A;  1OXU A;  4JI5 L;  3ULJ A;  1SFO H;  1NMF A;  3PUZ A;  3TRE A;  2F4V L;  5M3F G;  2K5N A;  4JI4 L;  2VNU D;  2UXC Q;  4JYA L;  3ICE A;  4DR2 L;  2WAQ E;  4KHP Q;  3PO2 H;  1UE6 A;  3B6Y A;  2R7Z H;  2AWO A;  4LF8 L;  3JC6 6;  1Z9F A;  1K0R A;  2JA8 G;  5JJI A;  2DGY A;  5C0X G;  2IHF A;  3F2D A;  4PZ6 A;  2K52 A;  5FLM G;  1VQG A;  1VQ9 A;  3UDF A;  4YCW A;  3EN2 A;  2PNH A;  3K7A H;  1UWV A;  2E8G A;  3PSI A;  3TS0 A;  2Y0S E;  1VQA A;  4LWC A;  1X9N A;  1MKH A;  4JYA Q;  2RF4 A;  1XMO Q;  4DR2 Q;  1VQF A;  1PH7 A;  2OQK A;  1EUJ A;  4IPC A;  3CC2 A;  4DR7 Q;  3CCJ A;  1S40 A;  3CPF A;  2UXD L;  2JEA I;  3E0E A;  4DV2 L;  1R9T H;  2OWO A;  3HOZ G;  3FKI H;  3NEL A;  1UE7 A;  2B63 G;  4JOI A;  1A62 A;  1G6P A;  2D0P A;  3HOZ H;  3AFP A;  4L5Q A;  2KCT A;  1Q1B A;  4JI6 Q;  2YV5 A;  1PA6 A;  2C35 B;  2E2H H;  1XNR L;  1D7Q A;  4P71 A;  4DR1 L;  4DV0 Q;  3PO3 H;  4DR5 L;  4POG A;  5FLM H;  1K3R A;  1HZ9 A;  3HOV G;  2UXB Q;  1N36 Q;  4JI3 Q;  2JA5 G;  5BR8 Q;  1JE5 A;  4O0A A;  1I94 L;  1IBM Q;  4DUZ Q;  1SRU A;  1VQL A;  1HNX Q;  4IFD I;  3M9B A;  1UE1 A;  3KLW A;  3LGJ A;  1PH9 A;  4B3S L;  3J7Z C;  1PH1 A;  1PH3 A;  5M5X H;  3KDF B;  1VQ8 A;  1X65 A;  1IYJ B;  1X56 A;  1PH2 A;  3BZC A;  4B3M L;  4B3T Q;  5IY0 A;  2JJQ A;  4A3L G;  4LF9 L;  1VQO A;  4A3I H;  1KQS A;  1IBM L;  1PVO A;  4NPS A;  4YCU A;  2JEB I;  3CCU A;  3NBH B;  2K5H A;  2N49 A;  5IP7 G;  3F2C A;  1Y1W H;  3HOY H;  1RL2 A;  2FXQ A;  2MQH A;  3HKZ E;  3H3V I;  3FHW A;  4A3B H;  2UU9 Q;  1PHJ A;  4OWT B;  4RG1 A;  5LMN W;  3F8T A;  1WFQ A;  3S1Q H;  3S2H H;  3Q8D A;  1SMX A;  2LSS A;  3PF5 A;  1X55 A;  2JE6 I;  5C44 H;  4YCV A;  1JT8 A;  1CKN B;  2NVY H;  3CAM A;  3D0F A;  4DK3 C;  1YIT A;  4J15 A;  1VQP A;  1PH4 A;  1X3E A;  1HNZ L;  1J6Q A;  1WJJ A;  2AWN A;  4DAM A;  1L0W A;  4DV3 L;  2CCZ A;  4R4C A;  1P8L A;  3ULL A;  3PIP A;  1PH5 A;  2UU9 L;  2JA6 G;  3EBE A;  1Y14 B;  4NXN Q;  3BU2 A;  1V9P A;  3D31 A;  2D62 A;  2WP8 J;  1PYS B;  1XPO A;  4LF4 L;  4JI1 L;  1YJ9 A;  3J81 i;  3PUY A;  1U5K A;  2ZTD A;  4OWX B;  2UXC L;  2R6G A;  4QIW E;  4YWM A;  3J81 c;  2EIF A;  2R92 H;  1UEB A;  2N8N A;  4KHP L;  3KF8 B;  1Q86 C;  1KRT A;  2E5L L;  4YWK A;  3RNU A;  4A3M H;  1L1O A;  3K0X A;  1J5E L;  4DV5 Q;  2MNA A;  4L5R C;  5C44 G;  3M4Q A;  3A5U A;  2ZM6 Q;  4IO9 A;  2JA6 H;  4JI2 Q;  3M4P A;  1B8A A;  4B3R Q;  3KFU A;  4LUV A;  4HIO A;  1VQ6 A;  2I0Q A;  4BA1 I;  5GAD C;  1QUQ B;  1YJN A;  1XMO L;  2HHH L;  4OO1 I;  3JAM c;  3RLN A;  5K36 G;  5AJ3 Q;  1HR0 Q;  1JJG A;  1NBW A;  1OXV A;  4GNX A;  4DV2 Q;  1DGS A;  1QVG A;  4DV5 L;  4LF6 Q;  5IP7 H;  2A1A A;  4C3H H;  1WOC A;  3I4N G;  2I5L X;  4JBJ A;  2VQE Q;  4LFB Q;  4IFD G;  5IE8 A;  4JI2 L;  2WFW A;  1YBY A;  2I5H A;  3FKI G;  4GLA C;  1ASY A;  3RLF A;  1CKO A;  2Z0S A;  4IPD A;  3CPW A;  2JA5 H;  3M7N A;  1G29 1;  3HOV H;  2F52 A;  2PQA A;  2NVX H;  4JI3 L;  4L5T A;  5BR8 L;  2ZJQ A;  1V1Q A;  2RCN A;  2ZTE A;  1HH2 P;  4IPG A;  3CW2 C;  3GTM H;  5GAH C;  1VQ7 A;  4OX9 L;  1K9M C;  5C3E H;  4UPA A;  3RN2 A;  2OCE A;  3MEF A;  4GOP A;  2YTX A;  5FLX c;  4P73 A;  3PCO B;  2HT1 A;  4A3D G;  4A3F G;  1KXL A;  3AYH B;  1EQR A;  4P72 A;  4X62 Q;  3G6E A;  3GDE A;  3G71 A;  1VQ4 A;  3L7Z C;  1N33 L;  1GKH A;  1N9W A;  3E9H A;  4HID A;  4DR4 L;  4A3K H;  4DR6 Q;  5M3M G;  4DV6 L;  2PI2 A;  2RHQ B;  3T1Y L;  3H3V H;  4BY7 G;  4AQY L;  2UUA Q;  4OX9 Q;  1XJV A;  4LUO A;  4LW1 A;  2MFI A;  4EX5 A;  5IP9 G;  4BBR G;  1VQM A;  4GS3 A;  3U4V A;  1NMG A;  1VCI A;  1FJG L;  4A3G G;  1QZG A;  4A3D H;  2UUB Q;  1C0A A;  4GOP B;  4LFA L;  2ALY B;  2MO1 A;  4HIM A;  3W1G A;  1GVP A;  1L1O B;  1E1O A;  4OXP A;  5C4X H;  5C4J H;  1JJ2 A;  3A0J A;  4GOP C;  1EQQ A;  2WB1 E;  2VQF L;  4XTC S;  1TWF H;  5M3F H;  2IT1 A;  1VQH A;  4RMF A;  3T1H L;  4PG3 A;  1I5F A;  2E2I H;  1E24 A;  4BXX H;  1FL0 A;  3GTP H;  5IYD H;  3IRB A;  4LF8 Q;  1VS0 A;  4YWL A;  1A8V A;  4DV3 Q;  1KC8 C;  5C0X I;  5JEA J;  1BKB A;  4UP7 A;  1I3Q H;  2ASB A;  2GVB A;  3A74 A;  3CF5 A;  3DM3 A;  4A3J G;  4LF4 Q;  4JI1 Q;  2K14 A;  3S16 H;  4A3G H;  3J7A 5;  3CMA A;  4NXM L;  1BVS A;  4KHZ A;  2B3G A;  3MXN B;  4Y7N H;  3CXC A;  4A3M G;  3M4O H;  3GTQ H;  1CKN A;  3DLL A;  2UXD Q;  4HJ7 A;  3HFZ B;  1J5E Q;  1Y1W G;  3HOY G;  2CWP A;  4ME3 A;  3KJP A;  2K5V A;  4X64 Q;  5IWA L;  3OTO Q;  1KL9 A;  4YHH L;  1EFW A;  2Q2U A;  3J81 j;  2B63 H;  3S2D H;  5E7N A;  4AH6 A;  4B3R L;  4JI6 L;  4JI4 Q;  4JBK A;  1XNQ Q;  2BH8 A;  3GTG H;  2XTI A;  3EIV A;  2MO0 A;  3ER0 A;  2JA9 A;  3KJO A;  3UE0 A;  5GQO A;  1MJC A;  5AJ3 L;  4JBW A;  3CCV A;  2I5M X;  4DV1 L;  1CUK A;  1YJW A;  1G51 A;  2UUC Q;  4KLK A;  2NZO A;  4GN4 B;  2QEX A;  2R93 H;  3K8A A;  3HOW H;  4PZ7 A;  3HKZ G;  5IWA Q;  3OTO L;  3CC7 A;  4LF7 L;  1K83 H;  2K75 A;  2Q2I A;  2JA8 H;  4DK6 C;  5HY6 A;  3J80 i;  5LMN Q;  3KF6 B;  1A63 A;  2JA7 G;  3KYH C;  4UY8 C;  1XMQ Q;  1N36 L;  1MJE A;  4C3J H;  4DV1 Q;  2NVQ H;  2N78 A;  3I2Z A;  5ELO A;  4HJ5 A;  3CCM A;  4LF9 Q;  4DV7 Q;  4LF7 Q;  2IX0 A;  3RZO H;  1XPU A;  1X3G A;  5IYD G;  3J80 c;  4GKJ L;  1N32 L;  1QVC A;  4JC0 A;  1XMQ L;  1L1O C;  4GNX C;  1HZB A;  2CWA A;  3ZJY C;  4DR4 Q;  4DR5 Q;  3VDY A;  3CCQ A;  3W1B A;  5EAY A;  2UXB L;  4LFC Q;  4KI0 A;  2QA4 A;  4HJ9 A;  4DV7 L;  4R4I A;  2UUA L;  2JA7 H;  4IFD J;  2VW9 A;  2GN5 A;  4O2D A;  3GTL H;  2YTV A;  3STB D;  1GO3 E;  2GVA A;  5ELN A;  1YNX A;  1OXT A;  3ERS X;  1VQI A;  4B3M Q;  2Q2H A;  1W2B A;  5C4X G;  1Q12 A;  4P74 A;  2N3S A;  1HJP A;  1IBK Q;  1HNW Q;  5LMU L;  3S17 H;  2IY5 B;  3RLO A;  1I6H H;  1I50 H;  1LM0 A;  3JAM i;  5FJ8 H;  2R7D A;  2NN6 G;  2VQF Q;  3K7U C;  4X65 L;  1IXR A;  1PH6 A;  1GD7 A;  4JV5 Q;  1B70 B;  3I4M H;  2KCM A;  5C0X J;  4UP9 A;  1YIJ A;  2CKZ B;  3S14 H;  2DUD A;  2E2J H;  4BBS H;  1WYD A;  3K80 C;  4GN3 B;  1NY4 A;  1Q1E A;  4QJF A;  4JI8 L;  4IOC A;  4A3K G;  4JCV E;  3CCL A;  4GNX B;  1X6O A;  5JJK A;  2KHI A;  3OW2 A;  4LUZ A;  4OWW B;  5IT9 c;  2YTY A;  3GO5 A;  4QL5 A;  1S72 A;  2XGT A;  1HR0 L;  3S24 A;  2WB1 G;  1YHA A;  3CD6 A;  3CCE A;  3HOX H;  3I4M G;  4H02 A;  4JI8 Q;  3NEM A;  4BBR H;  4X64 L;  2ID0 A;  4YHH Q;  1YVC A;  2VQE L;  1NJI C;  3I55 A;  5IYB H;  1VQK A;  2VUM H;  4UP8 A;  4C2M H;  4DUZ L;  4QQB X;  2E5L Q;  5JJL A;  3U4Z A;  4DR7 L;  1CKM A;  4MNO A;  1WI5 A;  3H0G H;  1M1K C;  3G4S A;  1CSP A;  4PZ8 A;  4QY7 A;  3I4O A;  1NTG A;  4R4T A;  4WJ3 M;  4BY1 G;  2H5X A;  1VQ5 A;  4QGU A;  2NZH A;  4GLX A;  2IX1 A;  5M5Y H;  3OYY A;  4YY3 L;  4DR3 Q;  1VQN A;  3PO2 G;  1QVF A;  3FP9 A;  1VQJ A;  4X62 L;  4BY7 H;  2HHH Q;  4A93 H;  1SN8 A;  1AE2 A;  1YHQ A;  5GRO A;  1C7Y A;  1T9H A;  4HJA A;  2YYZ A;  1TWG H;  3GTK H;  5JEA G;  4NB3 A;  3CP0 A;  1WCM G;  3H15 A;  1A0I A;  3PIO A;  4AQY Q;  2LXK A;  4LFB L;  2VUM G;  4BA2 I;  4APV A;  4A3E G;  1YEZ A;  3BZK A;  4DV4 Q;  4JI7 Q;  1CSQ A;  4DR3 L;  3M85 A;  3K81 C;  4ALP A;  3G48 A;  3HOU G;  1M90 C;  2UUB L;  4IOA A;  1Z47 A;  1AE3 A;  1PH8 A;  4B3T L;  3KOJ A;  4X66 Q;  3HOX G;  1K73 C;  4DUY L;  3S15 H;  4PMW A;  1Q46 A;  3TS2 A;  4IPH A;  3RR5 A;  4K0K L;  2EXD A;  4AYB G;  2HIV A;  3S1N H;  1E22 A;  3TEH B;  3F2B A;  3U58 A;  3WWV A;  1K8A C;  3NEN A;  1IZ6 A;  1WCM H;  3AQQ A;  1K8G A;  4DV4 L;  3AEV A;  3GD7 A;  4MZ9 A;  4JI7 L;  2NN6 I;  2HIX A;  3GTJ H;  4HIK A;  1IBL L;  4JBM A;  2OQ0 A;  5IYC G;  2V1C C;  1KD1 C;  1LTL A;  1XNR Q;  1VQD A;  1N33 Q;  1YI2 A;  4DV0 L;  2A19 A;  1D8L A;  2VS1 A;  4DNI A;  4FDB A;  3CQZ H;  4DUY Q;  5LMU Q;  4K0K Q;  2L15 A;  3T1Y Q;  1H95 A;  4GLV B;  1KHI A;  4JOI C;  4AIM A;  4B3S Q;  3PO3 G;  3UDX A;  4A3J H;  3HOU H;  1QUQ A;  1KIX A;  1U0L A;  1IBL Q;  3H0G G;  1BBU A;  4JV5 L;  1FJG Q;  4BBS G;  3E9I A;  4DPG A;  3CCS A;  1HNZ Q;  4A93 G;  1KAW A;  4A3I G;  4LF5 Q;  2AKW B;  5H1S E;  1TWH H;  3L2P A;  3I56 A;  1OTC A;  1YZ6 A;  2D0O A;  1AH9 A;  4NXN L;  3UDI A;  2R92 G;  3TRZ A;  2ATW A;  1EIF A;  4LNQ A;  1C9O A;  2VL6 A;  5IYC H;  2B29 A;  1XNQ L;  2R93 G;  5C3E G;  3A5Z B;  3T1H Q;  3UDG A;  2HQL A;  1Q81 C;  4OO1 G;  4A76 A;  2F3I A;  4A4I A;  4A3E H;  2LXJ A;  3U50 C;  1YHB A;  2R7F A;  1W3S A;  5J3B A;  1MIU A;  3HOW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...