3HOWJ

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3howJ00
3HOWJ 1RPWA 2L9RA 4W1UA 1OCPA 4C3HJ 1AKHA 4A69C 2EQRA 2M8GX 4XRSG 4EEFG 2R5ZB 2O7OA 1ZR4A 4AC0A 3MVPA 1ETVA 2DA2A 2EBIA 3QPSA 4DZJA 1BA5A 2LLKA 2CUFA 3BR2A 2VKVA 2XGEA 3OIOA 4B4CA 3HOUJ 1ORKA 1FIPA 1WH5A 3BTIA 4XK4A 2VKEA 5J1RA 3FKIJ 5IP6A 5GPCA 2IEKA 1F36A 1IC8A 2GLOA 4A3MJ 1R9TJ 2FD5A 3JREA 1VFCA 5FKOA 3BR1A 2Y0SN 4ABZA 1EF4A 5GPAA 3HGGA 2DMTA 1P7IA 1VNDA 3SJMA 3GTMJ 3ZQGA 5K7FA 5EF6A 2NVXJ 3CDLA 3A02A 1WH7A 4DYQA 4MIMA 3OSFA 2M34A 1JT0A 3W6VA 3A01B 5IPAA 2CU7A 2QCOA 5E3NA 4MO7A 2LK2A 2P81A 1TWHJ 4QSHA 1APLC 5BNGA 1TC3C 1IDYA 2QF7A 1I6HJ 3LSPA 2WAQN 3MKLA 5FLMJ 1W0TA 4GFBA 3LOCA 5DS9A 1LFBA 2JA5J 4LOCA 1WGXA 3ZQCA 4A3DJ 1WCMJ 1QVTA 2Y9YA 4M3EA 3BR0A 2XSDC 1WI3A 3FK7A 3GTJJ 1P7JA 3LNQA 4IHXA 2E2JJ 1Z0XA 2XB5A 2GM4A 5E3LA 3GTOJ 2OF7A 1B72A 3PO2J 2R5YA 2ID3A 1Z77A 2E19A 4RBOA 2EH3A 2VUMJ 4V2GA 1JTYA 3B6CA 2Y9ZA 3H0GJ 4A3GJ 2HQ5A 3HB9A 2Y30A 1SFOJ 3I4NJ 3SFIA 1NK2P 1MBKA 4UUTA 4I76A 4D5CA 2YU9J 1XS9A 1MBFA 2LKXA 1MBEA 4D7MA 5M5YJ 3RKQA 2ECBA 1X58A 1HOMA 2FJ1A 1PUFA 4IHWA 2DA5A 2ME6A 2KDZA 2FQ4A 4AUXA 3GTPJ 1MH3A 1OFCX 4W97A 3M4OJ 4BXXJ 3CQZJ 5EEAA 3LSRA 1IDZA 2HI3A 2EZKA 2NVQJ 2IAIA 2JN6A 2DA1A 5FKKA 3S1NJ 1IRZA 1UG2A 3BTLA 5C44J 2TCTA 5EDNA 4A3CJ 1ITYA 1B8IB 2AO9A 2VI6A 4MFEA 1HLVA 1U78A 2DTZA 2JWTA 1H89C 3HGYA 4MLOA 3TP3A 2TRTA 4M3GA 4DYRA 5EZHA 5F1JA 1CQTA 2XGCA 4XIDA 3S2HJ 1IGNA 2IBDA 5FJ8J 5C4JJ 4I6ZA 2LD5A 2ME0A 5J1UA 2DA6A 3WHBA 3FISA 2DN0A 1JJ8C 4DYCA 4RDUA 2XPWA 3ZQHA 3IH3A 1DU0A 4Y52J 2E1OA 4HNVA 3JRCA 1IJWC 2DA4A 2LVSA 3DEWA 1MNMC 3SDGA 4D5FA 3JRGA 4S0HB 3BR5A 4D7NA 2NVYJ 1GV5A 5E3OA 5E3MA 1AU7A 1RKTA 3GBGA 3A03A 1BL0A 1HCRA 3PO3J 5HODA 3QPLA 4BY1J 2HOSA 2NVTJ 3Q0VA 5IOYA 3TEDA 5GP9A 2RAEA 1TWAJ 1JKQC 1D5YA 1RESA 2L7FP 1BW6A 3ZOBA 5F0HA 2AHQA 2ECCA 5IYCJ 2XGDA 2CRGA 3BT9A 5EGOA 3TP0A 1ETYA 1SANA 1LFUP 4X1EA 4B3AA 3E7LA 1X2NA 5FKLA 4XICA 3JR9A 1YRNA 3O8GA 1NK3P 4XRMA 2K9NA 1YRNB 1U9NA 4FTHA 4V2FA 1ZQ3P 4JP0A 1TWFJ 2WV1A 1FIAA 3HBLA 1FTTA 1ZK8A 4UUSB 1W0UA 1BJZA 1JUSA 1JTXA 4QIWN 3S1MJ 3HOZJ 1VI0A 3CMYA 1MSEC 5K7ZA 4JX5A 2HOTA 4XRSA 9ANTA 5IYDJ 2NS7A 1ETQA 4FE4A 4A3JJ 4C2MJ 3ZQIA 3O8HA 3TW6A 5M5XJ 1HDPA 2XPVA 3WHCA 3Q0WA 4CYCA 2JA8J 2CQQA 2DMNA 3TW7A 1JKOC 4FE7A 4CYCB 3GTGJ 4BBRJ 1G2HA 1XG1A 2DMQA 3BR3A 1DU6A 2E2IJ 3BQZA 2FX0A 3F0CA 5F27A 2COBA 2PMZN 3HKZN 3IV5A 1WPKA 2CUEA 2LTPA 3RZOJ 1RETA 2R93J 1B72B 3B6AA 3BR6A 2DA7A 1JKPC 1XC5A 3PM1A 4G12A 3H3VK 2X48A 3S1QJ 4A3FJ 1AKHB 3QQAA 3A01A 3BQYA 2R0QC 2JMWA 4FCYA 2MGQA 1FTZA 2GBYA 1MBJA 3D1NI 4J19A 1S7EA 1GV2A 5FKMA 2HOAA 1QRYA 2K40A 3G1MA 3JRDA 3JRHA 3HDDA 1Q1VA 1O4XA 4M3FA 4MFDA 1GVDA 1LE8B 5FKNA 5IYBJ 5IP9J 5M3FJ 3OSGA 3HM5A 1QVUA 3BG3A 5EG0B 2XRLA 2MG4A 5F08A 2MW8A 2X9DA 4A3KJ 1IG7A 5EG0A 1UHSA 5J1YA 4A3IJ 2N8GA 2Y31A 3BTCA 1VF9A 1ETWA 2EZHA 1TWGJ 2LFBA 1ZGWA 3Q0UA 2X6OA 2L7MP 3C2BA 2I10A 1X2MA 2JK3A 1QPIA 3NARA 2JJ7A 3Q3SA 4DZPA 3JRBA 1PUFB 1RR7A 2L7ZA 2JA7J 2YS9A 1H88C 1FEXA 1HF0A 3HOYJ 4M3BA 1E3OC 4BBSJ 3GTLJ 2M0CA 1ETKA 1U8BA 3S1RJ 3L1PA 1B8IA 1BW5A 5FLVA 1JJ6C 4JX4A 3S14J 2NS8A 2O9LA 4L5EA 2L0KA 4A3BJ 1NTCA 2CQXA 2VPRA 4C3IJ 2DJNA 2M2EA 5M5WJ 2W48A 1A6IA 1UMQA 4IEJA 3FK6A 3RZDJ 1ETOA 2HYJA 4C3JJ 3HOXJ 4B1RA 2H8RA 1ZR2A 1MBGA 2R92J 3K2AA 2XB0X 1MSFC 1JKRC 2D5VA 2WB1N 1POGA 3LSGA 1U9OA 1JUMA 2K9QA 1RKWA 2ELKA 1ETXA 4A3LJ 1K61A 2LP0A 3JRFA 3ZQLA 2K9SA 1ZTRA 2YUSA 3NAUA 5C3EJ 1MH4A 2NOGA 2DMUA 4NDLA 2R5YB 2HXOA 3RQIA 3VPRA 2E2HJ 5M3MJ 3JRAA 1H8AC 1Y1VJ 3UKGA 2EZLA 2M9HA 5F04A 3BTJA 1I50J 2R5ZA 1JT6A 4BKXA 2Y2ZA 4FISA 5JLWA 1Y1WJ 2G0EA 1JGGA 3S15J 3M3YJ 5F0FA 1IV6A 2LR8A 1K83J 4QTRA 4JX6A 3CCYA 2H1KA 4M3DA 5EZGA 3G1OA 3DCFA 1TWCJ 3HOVJ 3S16J 2KT0A 4Y7NJ 3GTKJ 1F43A 2LY9A 1MBHA 2OPTA 2HDDA 2JA6J 5K7HA 1OJLA 5C4XJ 4DW6A 3JRIA 3BG9A 4A93J 2EZIA 3HEFA 1GDTA 2R7ZJ 4IHVA 4A3EJ 2ZB9A 3S17J 3K7AJ 3IH4A 5F0CA 2DMPA 2CJJA 1GT0C 3MN2A 2B63J 5JLXA 2ID6A 1AHDP 1HDDC 5EGOB 2DA3A 1IUFA 4BY7J 2O8KA 1FJLA 3ZQFA 4M6VA 5DTDA 4X6AJ 4JYKA 5J3LA 1JUPA 1T56A 1T33A 5EYRA 1A5JA 2XPUA 3FIWA 1OCTC 1GUUA 3G1LA 3S2DJ 4AYBN 2HXIA 1LE8A 5IOZA 3OOUA 3LSJA 1ENHA 3I4MJ 1ZKGA 1I3QJ 4IHYA 2MSYA 3BG5A 4UUSA 3IH2A 3GTQJ 5IP7J
chains in the Genus database with same CATH superfamily
3GYHX 4W1UA 1J2XA 4XOPA 4L0ZB 5LGUA 3TQNA 4XRSG 3L09A 2W7NA 4L9NA 2JVGA 1IN4A 1SEUA 3K70C 3KLNA 3OYJA 3BWGA 1ETVA 3R0JA 3OL3A 1YIOA 2LLKA 2LKPA 4EQQA 4LB5A 1N75A 2CUFA 3L2RA 4Q5SF 2XGEA 3TL4X 3WTXC 1TZLA 1KU3A 3OIOA 3QU3A 1JGSA 2G7UA 1S8NA 2VXDA 4B09A 4BS9A 1OQYA 2NNYA 4XKVA 1F36A 1IC8A 2GLOA 5J4YA 2FNAA 5FKOA 2ZMEC 1RIOH 1BI2A 5GPAA 2R7WA 3H9GA 4BQNA 4U7DA 2KLOA 2BV6A 3KYDB 3A2KA 5K7FA 1YJWI 2OC6A 3IKTA 2DJIA 4BDYA 3ZMDA 4PZJA 2KRHA 3ML6A 4MIMA 4ETSA 4F92B 1YFHA 2M34A 3LQQA 2OU2A 1CGPA 2V6CA 3W6VA 3A01B 2CU7A 2Y0MA 1ZRFA 2DK5A 2LYCA 4BL0B 2V7FA 5BNGA 1B6AA 2NOJB 1TC3C 1IDYA 4CHUA 2WAQN 4NC8A 3MKLA 4KA4A 2WY7Q 3D5SC 4R1HA 3E3VA 2PJRB 1RUNA 5FROA 2VOPA 2BYVE 2P5VA 4U0VA 2BXZA 3SZPA 2Z3YA 4AIDA 2XSDC 2FBKA 2MLKA 1SFXA 3W6JB 3LNQA 1ERDA 4BHCA 2E2JJ 2XB5A 2GM4A 5E3LA 3PO2J 1B72A 2XAUA 2R5YA 4CZCA 2VUMJ 5DV5A 1XGSA 2NAZA 4YIRX 3V7RA 4RAFA 2ICWG 2Y48A 4WXHA 2HQ5A 2CQ7A 3ZMUA 1B1BA 4UVBA 1NK2P 3V8KA 1FBSA 2EK5A 4BEHA 3F6OA 1J0RA 1R7JA 1IF1A 1N78A 3O3KA 1I3AA 1MBFA 3RKQA 1XX5A 5M5YJ 3I55I 4ZDOA 3H3UA 2W57A 1RZ4A 3F8MA 3VEPA 1HOMA 1PUFA 4IHWA 1Z7UA 1FX7A 2KDZA 2AQEA 2O3FA 2W00A 3BROA 2EFWA 2LOOA 4LLGF 2WWYA 1OFCX 3M4OJ 3S2WA 3F8BA 3WG7H 4HDUA 4MHGA 3WU1B 5TRDA 2KFDA 2NVQJ 1T2KA 3P9KA 2IAIA 1FSHA 1R5GA 4HV6A 5IT3A 4PSXA 2TCTA 2IS4A 3H5NA 2XAJA 2F2EA 2CQKA 2A6TA 3CF5F 2VI6A 3JTHA 2GWRA 1HLVA 2FRHA 2HYGD 4U7BA 2DTZA 1H89C 3HGYA 5ILUA 4RB0A 3G71I 3FXJA 3C1DA 3GFLA 1ZYRF 4M3GA 4KT6A 3M8FA 2XGCA 2A69F 3D0SA 2WY8Q 1R4NB 4LG0B 4D1QA 3DU5A 1T8IA 2ZJPF 2WAEA 1B9MA 1I39A 2OD5A 3CUQC 2KPMA 3F72A 3DEUA 4MNUA 2CW8A 1EJ9A 4EGZA 2DA6A 1QGPA 2HNHA 2VJ4A 4RLQA 3FISA 3H92A 1QQIA 1YO5C 4RDUA 3D5LA 2FEZA 3ZQHA 4PFOA 3IH3A 5L3GA 2O6GE 4FASD 2E1OA 3FHNA 2DA4A 3SDGA 1LVAA 1TT5B 3DFGA 5E3OA 1Z21A 3E0JB 4UB8C 4UV8A 3K4JA 3H9JA 1HCRA 3PO3J 3TMOA 3GFMA 4IOAF 5HODA 3QPLA 5D4SA 4H0EA 4BY1J 2YX4A 2GA2A 3HHGA 3Q0VA 1BOBA 4M72A 1YQAA 4XR6A 5FGMA 4HF0A 4N0BA 1BW6A 3IWZA 1FYLA 1Z67A 2XGDA 2RVCA 1WWXA 4B3AA 5CVIA 2M8EA 1NK3P 3GZNB 3NEUA 4FHTA 1F4KA 4JP0A 3CZ6A 2WV1A 3HBLA 2GXBA 1D8KA 1I1GA 4UUSB 1W0UA 5HOOA 2RQPA 2DOEA 3J7YJ 1JUSA 1JTXA 1A04A 2JSPA 4QIWN 3FXQA 2LKSA 3HOZJ 3CMYA 1MSEC 5FD5A 1X4PA 3SYTA 1RNLA 1MW7A 3R4KA 5LHHA 1TW3A 2M4GA 3IL2A 1WSUA 3ZP5A 1W36D 3S32A 1Q1HA 3AG1H 3HTSB 4I0AA 4XNFA 3VYRB 1ODDA 1R5ID 1D1BA 4S05A 2CG4A 2EILH 4YIIA 3Q0WA 1IUYA 4CYCA 2CQQA 1S6LA 5JHFA 5DUIA 2DMNA 1RR8C 4YFNF 2FMYA 3F23A 2QM3A 2NNNA 3HYIA 2DT6A 2E2IJ 3SXYA 4FX4A 3BPXA 3F0CA 3CMAI 3HKZN 3Q9VA 4KYWA 2GAUA 2LTPA 2ISZA 1D8JA 3KEOA 1P92A 3BR6A 1OLTA 3FKJA 2RREA 1JKPC 2VL8A 4I01A 2E60A 1XC5A 1SD4A 3S1QJ 1CF7B 1NH3A 4IX7A 4A3FJ 1DPUA 2NYXA 4FCYA 1LVKA 3CUQA 2ZJRF 3LMMA 3A4CA 2XKPA 3D1NI 4BNCA 4MTEA 2ZCWA 2WC2A 1XMAA 5LEJA 2HS5A 5KK1A 3JRDA 2VLAA 4LK1F 1Q1VA 3FWEA 3RTRA 1W1WE 4DOZA 1LE8B 2QSGX 4GXOA 3R6SA 3L2QA 5FO5A 3LSMA 4I99C 2AXTC 3HM5A 2P5LC 3BG3A 2D1HA 3T5XA 3LSIA 1E2XA 2OCCH 2VBWA 4AIHA 1OCRH 5F08A 4HQEA 1LEAA 1UHSA 5J1YA 1E0EA 2LY2A 4ASNA 3DKWA 1C0WA 2Y31A 3C2GA 4DBQA 4EV0A 2DFFA 2I5UA 2JUCA 3JAMK 2DQLA 1ZGWA 4PK4A 1E3PA 2I10A 2FBHA 5ILVA 3DXJF 1G8XA 2JJ7A 4DZPA 1FYKA 2E7XA 4ESFA 3M1CA 3OWTA 1R6RA 5LGTA 2CV1A 2YS9A 5D8KB 1DP3A 3C18A 2ZXJA 3TO6A 3HOYJ 4BXUA 4M74A 4OAYA 1W7PA 3U2RA 3H3ZA 4WF2A 1KQ9A 4RM3A 1D0YA 1ZRDA 3GTLJ 1Z9CA 2JVHA 2DDAA 1ETKA 4A6EA 2BVMA 2VKDA 1YI2I 1TQIA 3S1RJ 1ULYA 4HLYA 2BBYA 1WJBA 1A36A 3G4SI 1E3HA 4CCOA 2R7VA 1B59A 5FLVA 3CLQA 3EQLF 4JX4A 4U87A 4F3QA 3OR2C 4KISA 3LFKA 3X2QH 1NTCA 4CCKA 2DODA 3CCUI 2BY1A 2CFOA 4M73A 3AL0B 5M5WJ 1IN5A 5D5UB 2W48A 1Z7LA 2VJJA 3EUHC 5DCMA 1ONVA 1IXRC 2H8RA 4L5IA 1TNSA 3V42A 1OYYA 5LLQA 2VJ5A 2J5PA 1ZR2A 2O8XA 2CV0A 5E20A 1MSFC 1OR7A 3DKYA 3PNTA 1POGA 1MMSA 2WA0A 1P9QC 4XSXF 2JUGA 4S04A 1S3JA 2KJCA 1NG6A 2A68F 1U9OA 1Z91A 3DTIA 1J9IA 2JPCA 3D5RC 1SD5A 2ZSHB 1ETXA 1K61A 2KIQA 3M07A 2V1XA 1WRJA 3NAUA 5J8CA 4V19K 1T39A 1P4AA 1MMGA 1Y1VJ 5CVRA 3PNYA 3OV8A 4HA8A 3F9KA 2UXXA 4RGRA 4UXNA 2DFEA 3W2AA 2IW5A 2DPUA 5F04A 1I50J 1XCVA 2OJED 1LB2A 4B48A 1JT6A 2OZ6A 5JLWA 1Y1WJ 4XRFA 1ZH5A 4LIVA 4DGWB 1VQ8I 5D5WB 3S15J 5K5QA 2FBIA 2XC7A 4OAZA 3GFJA 1IV6A 3KFWX 1SVMA 3V7CA 4JX6A 2BVLA 4P96A 5EZGA 3HPGA 1X1DA 3JSOA 2KT0A 2QBYB 3GO5A 2F4IA 3OIQA 2L3DA 1MNDA 5J47A 3GCMA 3NWSA 3R61A 3TDUC 4NHJA 2PX9A 3CO6C 2OPTA 3OS1A 1XB4A 1WJAA 3HOTA 4OU0A 2F5DA 3BG9A 4KIBA 1P2FA 2QVOA 2X4HA 3CDHA 3PQKA 3HEFA 3QWLA 4IHVA 2R4GA 4N4OB 5J40A 4A3EJ 4B3XA 4IVNA 5CJ9A 6PAXA 3IH4A 2MA3A 3DBHB 2ESHA 1R5HA 3CUQB 4DBRA 2B63J 4U0WA 4PJNA 5EJCA 2EWNA 4XLFA 2DA3A 1OCZH 2FOWA 3K4MA 4BY7J 2O8KA 4ZZDA 1LFPA 3KP6A 5DTDA 5ICCA 3TDZC 3WTSC 1T56A 1JUPA 3RYPA 2FOKA 3ABUA 1GUUA 4E4HA 3K1PA 4G6DA 5CVUA 4AYBN 4CA0A 5HDKA 3KPHA 1X1CA 5A2QK 1LE8A 3OOUA 3WGGA 2NXNB 1I3QJ 1ZRCA 3U9GA 2X1EA 3GZ5A 2DLLA 2CS3A 4NC7A 5D6EA 1RPWA 4I02A 4Y17A 3BJ6A 1TQPA 5HDGA 5L3EA 1AKHA 3CP8A 2P7CB 1KA8A 3KP4A 4I7HA 4A69C 3COAC 3CJQB 1V5EA 3ZCOA 5JVGF 3OR1C 2R5ZB 4EEFG 4ENNA 1R1VA 1XD7A 3KP7A 2DA2A 2EFQA 4FX0A 5FFZA 1JHFA 2QKMB 2VBXA 3TGNA 2RV8A 5ICEA 1FY7A 2G9WA 4IZZA 2VKVA 3DQVC 3O2PE 3ZQQA 3WTYC 1T08B 4XK4A 1R00A 1YW8A 3CUOA 3M1EA 5EEHA 1FBUA 3AG2H 3FKIJ 4II3A 2P7VB 1BIBA 1WHUA 2X6YA 4LG3A 2P8TA 2RQQA 2BY0A 4A3MJ 1R9TJ 1FSEA 2FD5A 3HG9A 1VFCA 4XOTA 4PUSA 2L4MA 4ABZA 2BGCA 2V6EA 1P7IA 1YHQI 1VNDA 1PYVA 4BDZA 1J5YA 2PLYA 1VQOI 1UHWA 3GTMJ 4UHTA 2NVXJ 2IPQX 5JI6A 5FFXA 3CLOA 4DYQA 2RN7A 3F6VA 3BJAA 2K4JA 4RAYA 3K0LA 3QAHA 4QPOA 2DYRH 4OIPF 4HQMA 1U5TB 1QNTA 4BACA 4GFBA 4N9IA 1W5TA 1R58A 2JA5J 1Y6IA 1PJRA 2HR3A 1WJDA 3IP4B 4UB6C 1WCMJ 2K4BA 2ACJA 2EFOA 3ELKA 1SMTA 2K02A 2YR2A 2K3PA 5EEGA 1WI3A 3GTJJ 2ZXWH 2K7LA 3WGHA 2C6YA 1Z77A 2E19A 1SD6A 4RBOA 1A31A 2VODA 4V2GA 3F21A 2HVQA 3EUKL 2FMLA 2GQQA 2Y9ZA 3M8JA 2FF4A 1SFOJ 3SFIA 2IP2A 1K78B 1KGSA 2Q0OA 4UUTA 3GFIA 3DTEA 2DOAA 1MBEA 2ECBA 1GXQA 1X58A 3FHZA 1DPRA 2FJ1A 3VYTB 4KUMA 5E17F 2V1NA 2DA5A 3HUGA 1QBJA 3HSEA 5ED4A 3H36A 1MH3A 1VQ7I 3M8EA 2ZMEA 4W97A 4XMYA 5EEAA 2IGOA 3HC7A 2ZMEB 3ZMVA 2HI3A 3K4BA 4HPQA 4IKFA 3IAM2 1FNNA 5KCMA 1IRZA 2CW7A 2HU9A 1SAXA 1VQ9I 3LA7A 1U2WA 3E6MA 4HG2A 4EATA 4MFEA 2YSRA 4G94A 3IHUA 2DK8A 5FLXK 4CCNA 1O57A 4EJVA 3ONQA 4MLOA 4RM2A 2MH9A 2EFNA 2TRTA 3IAS2 5EZHA 2VOOA 1FYMA 3RPUD 3S2HJ 3J7AY 4XLNF 4UV9A 2IBDA 3NWTA 4BXFA 2RGVA 4LG0A 2ME0A 3WTUC 1XMXA 3ZQ7A 2VONA 1ZLJA 3PSFA 3G3ZA 2KRCA 2EPFA 3HKZA 1JJ8C 2XVCA 4Y13A 2QWWA 1QHHD 2P6SA 3K4CA 2ZFWA 4CDGA 4HNVA 1BC7C 1IJWC 1DU0A 2LVSA 1Z1DA 1MNMC 4Y3OA 4D5FA 3JRGA 4S0HB 1TBXA 3DTKA 2NVYJ 1U5TC 3BJOA 1DGWY 3F8NA 1RKTA 2AS5F 3GBGA 1KZHA 1SC7A 1FOKA 2V9VA 3C7JA 5L3BA 1RRJA 1YW7A 1MKMA 3V8JA 3TO9A 3WTZA 1YITI 2HOSA 1YE9A 3GF2A 4ZYDA 2NVTJ 2BHYA 1X1AA 1D5YA 2UUZA 1RESA 4R8HA 2L7FP 4BYYA 2VT2A 2MD5A 3IRRA 2Z33A 3T8TA 2Q1ZB 1YX3A 3CDIA 1FPQA 2NRAC 5EGOA 1QA6A 2UZKA 3LSKA 3TP0A 2XAGA 2AQFA 3OS2A 2COMA 1WI9A 4CGZA 2QGUA 2IS6A 2IJLA 3O8GA 5FB2A 2KRFA 2PJPA 2K9LA 2W84A 3A0HC 4BQAA 4V2FA 1ZQ3P 1BM9A 1FIAA 1O3QA 2O61A 4IQJA 1ZK8A 3RKYA 2A3SA 2GXAA 5AIQA 3ABKH 4WXCA 1X1PA 3WODF 2A07F 5K7ZA 2A6EF 3C3WA 2VQLA 1FMVA 3G73A 2PI0A 5GTIC 4C2MJ 1YG2A 1MZBA 2ZBKA 3ZQIA 3OY9A 4KIGA 1KU2A 3TW6A 3S8PA 1PVEA 1FP2A 1HDPA 5H20A 1MJ9A 3BC8A 3VWBA 5FLXZ 2JA8J 4CO8A 4PJ0C 4CYCB 3GTGJ 2FE3A 2D2WA 3ZGKA 1DU6A 4HNUA 3CCVI 5HLTA 2F5VA 1WPKA 4QWQA 3RZOJ 1RETA 4HX7A 5ERIA 2R93J 3B6AA 2DA7A 3Q5FA 2D45A 1HW5A 1O3RA 3FMSA 1F9NA 3V7SA 3J7AO 2CFXA 3GWZA 3L2VA 3QQAA 3A01A 2XKOA 5F6FA 1SAUA 3RPUA 1T0FC 3OYDA 1MBJA 2V9KA 2HOAA 4J00A 1P4WA 1U0JA 5DD8A 1WQ2A 3BP8A 3CCLI 3ISPA 4KITB 1R23A 1GVDA 1TNTA 3AAFA 3MAJA 1LDJA 1VQKI 2F4MB 4G9YA 2W25A 5EG0B 4B8XA 4HLXA 1J7KA 2MG4A 2MW8A 2X9DA 4I0BA 2LY1A 5E1WA 1AA7A 1PP8F 2N8GA 2CMPA 4E7HA 2M30A 2WAFA 3SHFA 1R71A 3O6BB 4ZYEA 1ETWA 1TWGJ 3OYMA 4MEYF 1YW9A 2LFBA 3P9IA 1R1UA 2HOEA 3CTAA 2KL4A 2X6OA 3WE3A 3Q3SA 1XGNA 2E5ZA 5A2QZ 1PUFB 4OIOF 1A6QA 5D5VB 1O3SA 2EJRA 4DJAA 5CVJA 2KMUA 4Z2YA 1H88C 1FC3A 3EDPA 2L9NA 2DPDA 1D1AA 2HPIA 1WJFA 4BJ6C 2Z5UA 2X51A 1JXSA 4N9HA 3L00A 1WJCA 3VB2A 4CCJA 3F8FA 3LL7A 3K2ZA 4MTDA 3R0AA 3OL4A 3VOEA 1H0MA 1LPQA 3S14J 2EV5A 2NVUB 1BI1A 2NS8A 3SQNA 2O5RA 4AYBA 2E1NA 2L0KA 4PDKA 2A6HF 3WGIA 4OIQF 4Q48A 4C3IJ 2DJNA 2HQAA 2QKLB 2M2EA 1V55H 3HRUA 4KJZA 1Y8RB 2R7XA 4G7ZF 1A6IA 5H6RA 2ZNYA 1IO2A 3RYRA 1ETOA 1GXPA 4KT5C 3CCJI 3VSKA 2X1CA 2PG4A 5LRSA 1V54H 1JKRC 1FOWA 5BMZA 1REPC 2K9MA 2M0MA 3LSGA 4NQWA 3ZN0A 4YEJA 2DQRA 5KNLA 3DF8A 2L5QA 2ELKA 1HC8A 5AIPA 3ESWB 1S29A 1V4RA 2LP0A 3JRFA 4AIKA 2DCEA 2DMUA 2GZWA 3SZGA 2HXOA 2L9SA 4HAMA 2E2HJ 2A5WA 2BY2A 1H8AC 3NQOA 1BC8C 5GADJ 5DD4A 3UKGA 1HXDA 5CQGA 1WZ2A 3ABMH 5KAIC 1IV8A 1QPMA 1I6XA 1G4DA 2Y2ZA 2JZYA 2G0EA 4U88A 1BOAA 3DPTA 3DPUA 2V1UA 3KX2A 4WK8F 1PP7U 3CJNA 2JSCA 3DWLE 3HOVJ 1TWCJ 1W36C 4AIJA 4C2TA 1S7AA 1ZHFA 3EUHA 3AFHA 5C4XJ 2DU9A 4A93J 2V26A 2EA2A 4N4NB 5CQEA 2ZXHA 1G3YA 1LKXA 1Y8QB 4ZH4F 2ZB9A 3PNVA 3K7AJ 3RSNA 5F0CA 2DMPA 2A5YB 2M4KA 2Y0SA 2Z2SB 3MZYA 4GCVA 4XKBA 2DOFA 4CYDA 3I0TA 2KHMA 4P5OA 4ZYAA 3F22A 1Z6TA 5L3FA 4EGYA 1FJLA 4X6AJ 3G2BA 4Q4ZF 2CSOA 2XPUA 1WKMA 4OOIA 2VE8A 1PDNC 4HBLA 1O3TA 2HXIA 5IOZA 3IUOA 1I5ZA 1ZKGA 2W24A 1MIJA 2PMHA 1OCOH 3F3XA 3I59B 3I71A 3SEZA 2MSYA 3BG5A 4UUSA 1K7AA 3GTQJ 3HOWJ 2ESNA 1MJBA 3MWMA 1USSA 2L9RA 2LG4A 2M7BA 2DFIA 3BOQA 4C3HJ 3TBIA 2EQRA 3IWFA 1R1TA 2M8GX 3K9TA 3ULQB 3LAPA 4EM2A 4OWRB 1W7PD 1IXSB 2GOXB 4OINF 2O7OA 3E6DA 2OCEA 4CCMA 3L7WA 4AC0A 4DZJA 4E7ZA 2EBIA 1YJNI 1Y39A 3CC2I 4E7KA 2F4OB 3B02A 5DCFA 3BR2A 5B1BH 2V4JC 4B4CA 1Z3YA 1ORKA 1U8RA 1IN6A 1WH5A 2QEXI 3U1DA 2R7TA 5J1RA 2HVRA 5GPCA 4YELA 4LLNA 2IEKA 3B73A 1XTAA 1HA8A 4ANJA 3KZIC 3BR1A 2Y0SN 2R7RA 3FBIB 4PGHA 3CESA 1D1CA 4QPQA 1I1SA 4L9JA 3ZQGA 4RB2C 3WU2C 5LHIA 2E1CA 3KLOA 4M6XA 1WH7A 5D8LB 3HSRA 2ZSIB 1OR7C 4E6KG 3OSFA 4WCGA 1D5VA 5LBQA 5IPAA 1VQMI 1D0ZA 1UAAA 2QCOA 2PMUA 1IN8A 2LK2A 2P81A 3SDBA 4QSHA 5BS6A 1J59A 5FLMJ 1ZLKA 4IRIA 2CW0F 5DS9A 1LFBA 1WGXA 3ZQCA 2IS1A 3BCAA 2PEXA 1MMNA 3DPLC 2YX7A 2Y9YA 3L9FA 3BR0A 1U3EM 5J4VA 4EJUA 3J80K 4GYGA 3E6BA 5K5OA 3BG7A 4IHXA 1MMDA 4NC6A 3J7ZI 3E5XA 1QZZA 4A0YA 5IY5H 2ID3A 1W4MA 3I9V2 4BJ5C 4XLAA 2VKHA 4Z6YA 4RAZA 1FOXA 1JTYA 4HF2A 2BY3A 4J01A 3BLYA 3I64A 4KMFA 4A3GJ 5HS9A 3K1NA 2Y30A 3KEQA 2M87A 3OYCA 2EINH 1MBKA 1ON2A 4E7SA 1D3YA 2VQHA 4I76A 2EIKH 2LKXA 2Y69H 2L7KA 3V4GA 1XSXA 1K6YA 4GDFA 1ON1A 4AUXA 3GTPJ 4DQ2A 1MNEA 4A6DA 1HBXG 1H9GA 2CV2A 1JHHA 1BI0A 3LSRA 5BOXA 1X1BA 4AVZA 1IDZA 2Z1DA 4L9TA 3BZKA 2X85A 2JN6A 3S1NJ 4OMZA 3OYNA 3WE2A 3BTLA 3T1BA 5C44J 5L3DA 2XF5A 1NHAA 1B8IB 3VFZA 1DUXC 2OV7A 3PUFA 2DYSH 5HDNA 2IRFG 3REOA 1Y56A 3CCQI 4ITVA 2FSWA 2RC4A 2JQ7A 3TP3A 4A5MA 3HXLA 2KIFA 1CQTA 5F1JA 4XIDA 4M9XA 2BW3A 2GOMA 2LH9A 4EJTA 2Q2EB 1VQ6I 5DEQA 5C4JJ 4I6ZA 1G59A 2Q2EA 5D6FA 4ZZLA 3CMEI 4BH9A 3GVAA 2DAOA 1X3ZB 3IKVA 3WHBA 3ERED 5GTHC 4DYCA 3KEYA 1ZG3A 1BIAA 2MC3A 2W1OA 1QZEA 3K1MA 4AU7A 4RMNA 4Y52J 4D9JA 3KP3A 1BR2A 2ZKZA 3DEWA 4XQFA 2E35A 3PFIA 3I58A 3M7GA 4D7NA 3P5JA 3ASOH 2VBYA 3H0DA 5E8IA 2XF7A 3DLLF 3RIRA 4LIUA 1TP4A 1BL0A 3OYIA 2A05A 1L3LA 1J75A 1BN5A 1JE8A 1ZGAA 1GHCA 4ZYHA 5IOYA 4PCQA 5GP9A 2RAEA 2M5WA 4BEHB 4RGUA 3ZOBA 3BPVA 5F0HA 2AHQA 2MFZA 3AKZA 3BT9A 1XSDA 4RAGA 3ABLH 3IRQA 2FQ3A 3A0BC 1ETYA 1XGMA 4JQFA 4G6TB 3DV8A 1FT9A 4XLHA 4X1EA 5E1XA 1VQNI 3MQ0A 3VODA 3E7LA 5J6XA 5IT9Z 1X2NA 4XICA 1YRNA 3BZCA 3FX3A 4XRMA 2BOLA 4NUBA 4XM3A 1YRNB 3FXOA 1B4AA 3JW4A 4FTHA 5DUKA 2EIJH 1OMIA 4IRHA 1TWFJ 4HEA2 4RLFA 1FTTA 1I27A 2ZJ2A 1BJZA 4A0XA 3HRSA 2JTVA 3K10A 4UVAA 3SZTA 1IZ1A 3L2CA 3S1MJ 3ROUA 4CSWA 2Q8KA 1TLHB 3TOBA 3J81K 2HOTA 5DM6F 2ZC2A 3ZPLA 1WVRA 2IS2A 2R3SA 1LNWA 1W5SA 5LRRA 2OBPA 3AG4H 2W82A 2XROA 1SD7A 2ZJQF 2X0LA 1HKQA 2KP6A 3CD6I 4G8XA 2DDBA 3CMMA 3KYLA 1FOYA 2XPVA 1QO0D 3ZR8X 3KETA 1UCRA 2E1MB 2P4WA 3FDYA 3TW7A 1STZA 4FE7A 3LSHA 3AL0C 3FM5A 2XASA 4BBRJ 1SVOA 1XG1A 5HS8A 2K86A 2DMQA 2R7QA 3BR3A 1T95A 5ICFA 4BE2A 2CUJA 3BQZA 3BDDA 2FX0A 1W5CC 2QQAA 2COBA 2M45A 4LK0F 4KMUX 3MKZA 2CUEA 1RUOA 1UZCA 2ETHA 3I53A 5HVQC 3QPHA 4WWCA 4G12A 3ZMZA 2PBIA 3CC7I 3K4LA 3BQYA 3NRVA 1Z6RA 2XDVA 3FXKA 3BZ6A 2MGQA 4CZZA 4A12A 4GRIA 2GBYA 4J19A 1S7EA 2HYFA 4D0PA 2OQGA 2VBZA 1GV2A 1UB9A 2VE9A 2LF8A 1X4OA 3G1MA 2RKHA 3I56I 2IVMA 1X3UA 4EMSA 2DFHA 1EH6A 3HDDA 3I5UA 1Z05A 3H5AA 2OTLI 2L54A 4ZTFA 2A61A 3SEQA 5IYBJ 4O3MA 2QYOA 5M3FJ 1K6OA 2IGNA 3E5QA 1QVUA 2QQ8A 2XRLA 4PJMA 5ICGA 3PL8A 1R49A 1IG7A 5EG0A 4JK1X 4A3IJ 4F7ZA 1FP1D 3MKWB 4BE0A 3BTCA 4Y15A 2EZHA 5B3SH 3LAJA 2L9VA 3GEZA 2HDWA 3KYCB 3Q0UA 4HV5A 2L7MP 3C2BA 5LHGA 1X2MA 5HNHA 3JRBA 4LJZF 2QQ9A 4Y33A 2LBFA 3LWFA 2JA7J 2G7HA 4LITA 3QYFA 3OYHA 4LB6B 3LFUA 3L2WA 1FEXA 1E3OC 1EKEA 2KQRA 4CCLA 1LUJB 3WTTC 2KZVA 4HX8A 3WG9A 2M0CA 5F64A 3C2HA 1OYIA 3UNGC 4IL6C 2HTSA 2QENA 1BW5A 2KISA 3JTGA 2VIXA 1JJ6C 2BHZA 2E1MC 3T0YA 3OOPA 3ZMTA 4BU2A 2O9LA 4L5EA 3VSLA 4UUVA 4ZC3A 2HKOA 4OMYA 4XLEA 4ZYGA 5FRMA 1KONA 3MCZA 4HYEA 1TTYA 1JI8A 1SMYF 2MC4A 1QZYA 1G3WA 4IEJA 3FK6A 4F52A 2H09A 2KJBA 3HOXJ 3HTUA 2BXYA 2R92J 3K2AA 4XSZF 2JPBA 3R60A 2OA4A 3N05A 2V9PA 5CYVA 3H35A 4IJAA 3H1CA 1JUMA 4MGRA 4NBQA 2ADUA 2K9QA 2QUFA 4YG2F 2OTJI 3ECHA 2F5FA 2QLZA 4A3LJ 2OUMA 5E79C 1ZTRA 2YUSA 5C3EJ 3HOSA 1MH4A 2NOGA 4I98B 2QA4I 5LFAA 4B44A 3HRMA 3RI4A 4XL9A 3P9CA 1YYVA 3DEEA 3JRAA 2JRTA 3K4NA 3KP5A 2EZLA 5JHUA 1YTYA 5FRNA 2M9HA 1Y0NA 4FT8A 3F8CA 4K2EA 4AVPA 3MKYB 3K4KA 4BKXA 1H9TA 1XDUA 3CCSI 1JGGA 2H6CA 2XAQA 3S3OA 4KNYA 3M3YJ 2IGKA 1V3FA 3FMQA 2P5KA 1HSJA 2VQGA 1K83J 4QTRA 2BZTA 5HNFA 1YS6A 4IPAA 2H1KA 4KIFA 3G1OA 3DCFA 3GUDA 3ZN1A 3OYFA 3KE2A 4Y7NJ 3HPHA 5CKTA 1K4TA 1ZREA 4YRVA 4LD5A 3DBLB 1FBQA 1HSTA 2LY9A 4IXAA 1MBHA 4OIRF 1IAWA 3SFZA 4F91B 2JA6J 4XONA 2FA5A 2EB7A 1OJLA 4DW6A 1T0FA 4BGDA 2XAHA 4CH7A 3BCBA 5HLHA 5CLSA 1GDTA 2WADA 2EIMH 4U0YA 4C9YA 3FXLA 4ON0A 4LMYA 3EYIA 4YFKF 1GT0C 4PGGA 2AXLA 4LGWA 3WTWC 4F55A 5JLXA 2ID6A 5EGOB 1IUFA 4HF1A 1XMKA 2FNPA 3CC4I 4M6VA 1RI7A 3PQJA 4E7JA 1J09A 5TJJA 4XN0A 2BEOA 4JYKA 2FU4A 5LGNA 2PJRA 2M3AA 1T33A 2CUZA 3PUBA 4KICA 2CGPA 1IRFA 4IHTA 3FIWA 1BI3A 1OCTC 1KU9A 2W85A 2DW4A 3G1LA 3S2DJ 1GLNA 2V1DA 3OYAA 4RB1A 5TISC 3WTVC 4ENKA 2GIZA 2H27A 4IHYA 4XLCA 3IH2A 1ZG5A 2WV0A 3I59A 3JCUC 3BG6A 4IRGA 1OCPA 2K3FA 4EM1A 1EA3A 3QU6A 4L5JA 1X3WB 2XAFA 1T98A 3KZYA 4EM0B 3U21A 5D5XB 1OPCA 2IA0A 2VC0A 2LDUA 5ILSA 1ZR4A 2ELJA 2K85A 3MVPA 3QPSA 5DYMA 3OYEA 1BA5A 4GO1A 3RJPA 5K5RA 3QODA 5KHDA 4AD9A 3MFKA 2VT3A 5GAHJ 4IF4A 4IOCF 3HOUJ 1FIPA 1SFUA 4Y4RA 3BTIA 2VKEA 3HL2A 5IP6A 1MDMB 3CF2A 4BUPA 1EH8A 1TW2A 3ASNH 3RDIA 1ZN2A 2HQRA 1GVJA 3JREA 1EF4A 1UJ8A 3HGGA 2DMTA 2CYYA 1S72I 3GLLA 2IT0A 3OYLA 2HFHA 2H6BA 3SJMA 1YIJI 4II2A 2LNBA 4HNTA 4R79A 4M6YA 1YS7A 2E36A 5EF6A 1T38A 3CDLA 3A02A 3PFYA 2F6CA 2ZNZA 3GZ6A 1UG0A 3ZXSA 4PJLA 2P6TA 4E7LA 4IHSA 4GGGA 4Q47A 3CCEI 1JT0A 2O03A 3QYEA 1WFXA 4BHPA 5E8GA 2OZUA 5E3NA 4MO7A 4L18B 1TWHJ 1APLC 2ZFUA 4AM3A 3H9QA 2IA1A 2M7AA 1IRGA 4P55A 2QF7A 1I6HJ 3LSPA 2M1BA 3GMEA 1W0TA 1Y0UA 4HRIA 3LOCA 5L3CA 3M9AA 5E1ZB 4F93B 4LOCA 3QRFF 3EUAA 2LC2A 4A3DJ 1KU7A 4ESJA 1QVTA 1V5FA 4M3EA 4IQ4A 4O6JA 2ELHA 1QU3A 2VB6A 1ZGJA 1U6GA 3S3NA 3FK7A 3HJEA 1KYZA 1P7JA 1VQ4I 4BAYA 1Z0XA 2R7OA 3GTOJ 2OF7A 2EH3A 2KIUA 1N25A 2P0WA 3B6CA 3RCOA 2MYSA 3H0GJ 3I4NJ 3HB9A 1MD0A 4CXFA 1UELB 2UV1A 3W6KB 2LMDA 4D5CA 2YU9J 2HEOA 1XS9A 2O0YA 1MJAA 2W4SA 4D7MA 3PJRA 3QPTA 1LDDA 5J8FA 2ME6A 1LDKB 2LREA 2FQ4A 1K79A 1KQ0A 4BXXJ 3CQZJ 2XHKA 4ESBA 1FMWA 1XCBA 2RNJA 1L0OC 4HW0A 4RS8A 2EZKA 3QOPA 2WTEA 2DA1A 5FKKA 2Y75A 4A5NA 4YFXF 4FQGA 1UG2A 2PFBA 1DGRM 1IW7F 1UFMA 5EDNA 4KN4X 3AG3H 2VXZA 3W2VA 3PIPF 3L2UA 4A3CJ 1ITYA 2AO9A 3K69A 3Q9SA 2XRNA 3DKXA 4P1WA 2HZTA 2K27A 2GIVA 1U78A 3W2WA 3E5UA 2JWTA 3EYYA 2HWVA 4UY8I 1ZARA 4DYRA 5H6QA 1DQUA 1FWZA 2PN6A 5HLIA 1U5TA 1IGNA 3DLAA 3OYGA 5FJ8J 2LD5A 4L9VA 1XDSA 3A1YA 1HKTA 5J1UA 3MMYB 5D4RA 1A35A 2DN0A 2IXSA 2I8DA 4M71A 2DT5A 4H4KC 1LEBA 2XPWA 3PSIA 2KKOA 3FF5A 2XV4S 2HDCA 3JRCA 1S7OA 1HW2A 2E34A 3TOAA 2STWA 4G7OF 4HX4A 1NG7A 3BR5A 3FXMA 3QP5A 1GV5A 5E3MA 1AU7A 4KN7X 2HQNA 3FXRA 1N77A 3A03A 4CICA 3GXOA 3RPQA 4EJOA 1IN7A 1P4XA 3U1KA 3TEDA 1IXCA 4KFCA 5DDGA 1TWAJ 1JKQC 4PSWA 2ECCA 4BQOA 4P9FA 2CRGA 2DI3A 4M9ZA 5IYCJ 3GW2A 2MLGA 5AONA 1TT0A 1SANA 4XORA 3WU0A 1LFUP 2Z99A 4QLCU 3K6GA 1HQCA 5FKLA 1S9HA 4FETA 3JR9A 3OYBA 2K9NA 4XLPF 1U9NA 2VN2A 3KCCA 3VYUB 2V79A 1VQLI 1R22A 1RC9A 5BQTA 3KZZA 1E17A 2HZDA 3BY6A 2QZ8A 4WXDA 4M9SA 2STTA 1VI0A 5H2FC 2CO5A 2KDOA 4JX5A 4XKCA 2F5EA 4XRSA 9ANTA 5IYDJ 2NS7A 1ETQA 4FE4A 4MQ9F 4A3JJ 2MH2A 1ZELA 1VQ5I 2HGCA 4XKWA 1O7LA 1XGOA 4RGXA 4I2OA 3O8HA 4IO9F 2JRMA 1SFEA 3MEXA 5M5XJ 4PFPA 3WHCA 1YOVB 4ZTJA 1T6SA 1MMAA 1JKOC 3H5RA 2NS0A 2HVSA 2HKXA 3FBNB 3CCRI 3N97A 1G2HA 1G3SA 3CJRB 1LJ9A 2L4AA 2EV0A 3FZVA 2CQNA 5JFRA 5F27A 1QHGA 2PMZN 3IV5A 3I54A 1OCCH 2MD0A 5JVTA 1G3TA 1BJAA 3OS0A 2FUG2 1WJEA 4UVCA 2DXIA 1B72B 2XF6A 2L01A 2EFPA 2PQ8A 3RKWA 1CF7A 3PM1A 3H3VK 1F1ZA 2X48A 4CUGA 2JA2A 1AKHB 1XSVA 2R0QC 1KQ8A 1R4MB 2JMWA 4E70A 3FXUA 4A2UA 2ZXIA 3OIPA 1XPXA 1FTZA 5DCMB 1F5TA 3J81Z 3KP2A 5CPRB 5FKMA 3TKYA 4DIQA 1B9NA 1QRYA 3T8RA 2K40A 2F5CA 2EA4A 4A0ZA 1XN7A 3JRHA 2X6WA 2X6XA 2B9SA 3E6CC 3HHHA 3OYKA 1O4XA 3ABTA 1ACIA 4M3FA 3UR3C 3CO7C 4MFDA 3QOEA 3GLXA 3PIOF 5FKNA 5IP9J 2XSJC 3OSGA 1S5LC 1Z3XA 1R36A 5TGTA 5CVVA 1TL8A 5B66C 5E18F 3G6EI 4A3KJ 3CCMI 3VYSB 1YLFA 2LSOA 2ISYA 3LA3A 4EVIA 1VF9A 3EPZA 5K1YA 1D0XA 3LSTA 1P6RA 1BR4A 2DTRA 3P7NA 4UNOA 3MZHA 2E71A 2JK3A 1QPIA 2L02A 3CP2A 4ENJA 5LEKA 1FLIA 3NARA 1YJ9I 2B0LA 5GAGJ 1DDNA 2PMZA 5HLGA 3N4MA 2XUBA 1RR7A 4BQQA 1FZPB 2F48A 2L7ZA 2Z16A 1AOYA 1USTA 5F1RA 1DP7P 1M1EB 1W7PB 2LBFB 1VQPI 4XBFA 2CH0A 1HF0A 4HZFA 4M3BA 2KIMA 1LQ1A 4BBSJ 2MBFA 4HDVA 1SVLA 3ZRGA 1MDMA 4DNCA 1U8BA 1MGTA 2TDXA 3OMYA 4L0YB 2DT7B 2XGXA 1IRXA 3L1PA 4MQVA 2YU3A 1KYWA 5B5EC 1B8IA 3EETA 1ZG1A 3IC7A 2MABA 1WJ5A 2J5OA 4RGSA 2Z9OA 2OAZA 2B7EA 4TV7A 1AWCA 3TO7A 2UWMA 1YX5A 2FXAA 4A3BJ 2CQXA 2VPRA 3V8LA 4XN3A 4LLLA 3HZJA 3MZ8A 3HRTA 1O7FA 2DO7A 5DM7F 2BW3B 3KIOA 3MD2A 3I4PA 1UMQA 1K78A 3QP6A 4P9UA 3J80Z 3RZDJ 1VTNC 2HYJA 4C3JJ 4B1RA 1MBGA 2XB0X 5FD6A 2H94A 2VJIA 3HSFA 4BHBA 2D5VA 2WB1N 3W3CA 1OISA 3HUGB 1EH7A 2CWEA 2BE5F 3LA2A 4HSRA 5BPIA 1K4SA 1X19A 3E1SA 3DBRB 1RKWA 2YPRA 4RA2A 3ERMA 2GA1A 5B1AH 2H8WA 3ZQLA 2K9SA 4HOBA 1VZ0A 4NDLA 2R5YB 3RQIA 2R7FA 3VPRA 2RDPA 5M3MJ 4ZDPA 1BR1A 1V5GA 2IGMA 3LQRA 3QYBA 4C30A 2H1LA 2D1VA 3S3MA 3DP7A 4ENMA 3E97A 3S93A 3BTJA 4MEXF 2EV6A 2R5ZA 2WBMA 2E5NA 2GXGA 4ZJZA 2KZGA 4FISA 5IT9K 5KVRA 4JBAA 3ECOA 4BE1A 1UHMA 2OQRA 5F0FA 4EJWA 1TQMA 2LR8A 3FM3A 4JOMA 2QSFX 3K70D 2JT1A 4ZDLA 5KAFC 4RB3C 3CCYA 1EV7A 5JR3A 4G7HF 2QBYA 2UXNA 4M3DA 2LRDA 2VASA 2QQBA 4O5VA 3RQ4A 3S16J 4WX9A 4HSTA 4LFUA 3GTKJ 2E7WA 2R7SA 2WB1A 2HPMA 1BBYA 4PJJA 2VQCA 3HIFA 1F43A 3CJTB 3VDXA 2HDDA 4I09A 2IA2A 5K7HA 2K5CA 3JRIA 1PUEE 2R7DA 3FMRA 2HTJA 2L2OA 2DBBA 2RNGA 2X1DA 4GYIA 4G6QA 1OYWA 2EZIA 5HS7A 2R7ZJ 4NB5A 4AWXB 4B47A 3S17J 4C2UA 2CJJA 2ZO4A 1HKSA 3I3LA 1HW1A 3MN2A 4NNJA 2VC1A 2VPLA 5BPDA 1AHDP 1HDDC 4E7IA 3JSPA 2R7UA 3ZQFA 1G6NA 3JAMZ 2LF7A 5J3LA 5GAEJ 4NQWB 4X0GA 4KDPA 2XIGA 5EYRA 1A5JA 3RKXA 2QSHX 1ZAOA 3ZMSA 3LSJA 1ENHA 3I4MJ 3GX4X 1OKRA 4YIFA 4B43A 4BJTA 5LD2C 1SFKA 3DU6A 2WAQA 5IP7J
chains in the Genus database with same CATH topology
3HOWJ 1RPWA 2L9RA 4W1UA 1OCPA 4C3HJ 1AKHA 4A69C 2EQRA 2M8GX 4XRSG 4EEFG 2R5ZB 2O7OA 1ZR4A 4AC0A 3MVPA 1ETVA 2DA2A 2EBIA 3QPSA 4DZJA 1BA5A 2LLKA 2CUFA 3BR2A 2VKVA 2XGEA 3OIOA 4B4CA 3HOUJ 1ORKA 1FIPA 1WH5A 3BTIA 4XK4A 2VKEA 5J1RA 3FKIJ 5IP6A 5GPCA 2IEKA 1F36A 1IC8A 2GLOA 4A3MJ 1R9TJ 2FD5A 3JREA 1VFCA 5FKOA 3BR1A 2Y0SN 4ABZA 1EF4A 5GPAA 3HGGA 2DMTA 1P7IA 1VNDA 3SJMA 3GTMJ 3ZQGA 5K7FA 5EF6A 2NVXJ 3CDLA 3A02A 1WH7A 4DYQA 4MIMA 3OSFA 2M34A 1JT0A 3W6VA 3A01B 5IPAA 2CU7A 2QCOA 5E3NA 4MO7A 2LK2A 2P81A 1TWHJ 4QSHA 1APLC 5BNGA 1TC3C 1IDYA 2QF7A 1I6HJ 3LSPA 2WAQN 3MKLA 5FLMJ 1W0TA 4GFBA 3LOCA 5DS9A 1LFBA 2JA5J 4LOCA 1WGXA 3ZQCA 4A3DJ 1WCMJ 1QVTA 2Y9YA 4M3EA 3BR0A 2XSDC 1WI3A 3FK7A 3GTJJ 1P7JA 3LNQA 4IHXA 2E2JJ 1Z0XA 2XB5A 2GM4A 5E3LA 3GTOJ 2OF7A 1B72A 3PO2J 2R5YA 2ID3A 1Z77A 2E19A 4RBOA 2EH3A 2VUMJ 4V2GA 1JTYA 3B6CA 2Y9ZA 3H0GJ 4A3GJ 2HQ5A 3HB9A 2Y30A 1SFOJ 3I4NJ 3SFIA 1NK2P 1MBKA 4UUTA 4I76A 4D5CA 2YU9J 1XS9A 1MBFA 2LKXA 1MBEA 4D7MA 5M5YJ 3RKQA 2ECBA 1X58A 1HOMA 2FJ1A 1PUFA 4IHWA 2DA5A 2ME6A 2KDZA 2FQ4A 4AUXA 3GTPJ 1MH3A 1OFCX 4W97A 3M4OJ 4BXXJ 3CQZJ 5EEAA 3LSRA 1IDZA 2HI3A 2EZKA 2NVQJ 2IAIA 2JN6A 2DA1A 5FKKA 3S1NJ 1IRZA 1UG2A 3BTLA 5C44J 2TCTA 5EDNA 4A3CJ 1ITYA 1B8IB 2AO9A 2VI6A 4MFEA 1HLVA 1U78A 2DTZA 2JWTA 1H89C 3HGYA 4MLOA 3TP3A 2TRTA 4M3GA 4DYRA 5EZHA 5F1JA 1CQTA 2XGCA 4XIDA 3S2HJ 1IGNA 2IBDA 5FJ8J 5C4JJ 4I6ZA 2LD5A 2ME0A 5J1UA 2DA6A 3WHBA 3FISA 2DN0A 1JJ8C 4DYCA 4RDUA 2XPWA 3ZQHA 3IH3A 1DU0A 4Y52J 2E1OA 4HNVA 3JRCA 1IJWC 2DA4A 2LVSA 3DEWA 1MNMC 3SDGA 4D5FA 3JRGA 4S0HB 3BR5A 4D7NA 2NVYJ 1GV5A 5E3OA 5E3MA 1AU7A 1RKTA 3GBGA 3A03A 1BL0A 1HCRA 3PO3J 5HODA 3QPLA 4BY1J 2HOSA 2NVTJ 3Q0VA 5IOYA 3TEDA 5GP9A 2RAEA 1TWAJ 1JKQC 1D5YA 1RESA 2L7FP 1BW6A 3ZOBA 5F0HA 2AHQA 2ECCA 5IYCJ 2XGDA 2CRGA 3BT9A 5EGOA 3TP0A 1ETYA 1SANA 1LFUP 4X1EA 4B3AA 3E7LA 1X2NA 5FKLA 4XICA 3JR9A 1YRNA 3O8GA 1NK3P 4XRMA 2K9NA 1YRNB 1U9NA 4FTHA 4V2FA 1ZQ3P 4JP0A 1TWFJ 2WV1A 1FIAA 3HBLA 1FTTA 1ZK8A 4UUSB 1W0UA 1BJZA 1JUSA 1JTXA 4QIWN 3S1MJ 3HOZJ 1VI0A 3CMYA 1MSEC 5K7ZA 4JX5A 2HOTA 4XRSA 9ANTA 5IYDJ 2NS7A 1ETQA 4FE4A 4A3JJ 4C2MJ 3ZQIA 3O8HA 3TW6A 5M5XJ 1HDPA 2XPVA 3WHCA 3Q0WA 4CYCA 2JA8J 2CQQA 2DMNA 3TW7A 1JKOC 4FE7A 4CYCB 3GTGJ 4BBRJ 1G2HA 1XG1A 2DMQA 3BR3A 1DU6A 2E2IJ 3BQZA 2FX0A 3F0CA 5F27A 2COBA 2PMZN 3HKZN 3IV5A 1WPKA 2CUEA 2LTPA 3RZOJ 1RETA 2R93J 1B72B 3B6AA 3BR6A 2DA7A 1JKPC 1XC5A 3PM1A 4G12A 3H3VK 2X48A 3S1QJ 4A3FJ 1AKHB 3QQAA 3A01A 3BQYA 2R0QC 2JMWA 4FCYA 2MGQA 1FTZA 2GBYA 1MBJA 3D1NI 4J19A 1S7EA 1GV2A 5FKMA 2HOAA 1QRYA 2K40A 3G1MA 3JRDA 3JRHA 3HDDA 1Q1VA 1O4XA 4M3FA 4MFDA 1GVDA 1LE8B 5FKNA 5IYBJ 5IP9J 5M3FJ 3OSGA 3HM5A 1QVUA 3BG3A 5EG0B 2XRLA 2MG4A 5F08A 2MW8A 2X9DA 4A3KJ 1IG7A 5EG0A 1UHSA 5J1YA 4A3IJ 2N8GA 2Y31A 3BTCA 1VF9A 1ETWA 2EZHA 1TWGJ 2LFBA 1ZGWA 3Q0UA 2X6OA 2L7MP 3C2BA 2I10A 1X2MA 2JK3A 1QPIA 3NARA 2JJ7A 3Q3SA 4DZPA 3JRBA 1PUFB 1RR7A 2L7ZA 2JA7J 2YS9A 1H88C 1FEXA 1HF0A 3HOYJ 4M3BA 1E3OC 4BBSJ 3GTLJ 2M0CA 1ETKA 1U8BA 3S1RJ 3L1PA 1B8IA 1BW5A 5FLVA 1JJ6C 4JX4A 3S14J 2NS8A 2O9LA 4L5EA 2L0KA 4A3BJ 1NTCA 2CQXA 2VPRA 4C3IJ 2DJNA 2M2EA 5M5WJ 2W48A 1A6IA 1UMQA 4IEJA 3FK6A 3RZDJ 1ETOA 2HYJA 4C3JJ 3HOXJ 4B1RA 2H8RA 1ZR2A 1MBGA 2R92J 3K2AA 2XB0X 1MSFC 1JKRC 2D5VA 2WB1N 1POGA 3LSGA 1U9OA 1JUMA 2K9QA 1RKWA 2ELKA 1ETXA 4A3LJ 1K61A 2LP0A 3JRFA 3ZQLA 2K9SA 1ZTRA 2YUSA 3NAUA 5C3EJ 1MH4A 2NOGA 2DMUA 4NDLA 2R5YB 2HXOA 3RQIA 3VPRA 2E2HJ 5M3MJ 3JRAA 1H8AC 1Y1VJ 3UKGA 2EZLA 2M9HA 5F04A 3BTJA 1I50J 2R5ZA 1JT6A 4BKXA 2Y2ZA 4FISA 5JLWA 1Y1WJ 2G0EA 1JGGA 3S15J 3M3YJ 5F0FA 1IV6A 2LR8A 1K83J 4QTRA 4JX6A 3CCYA 2H1KA 4M3DA 5EZGA 3G1OA 3DCFA 1TWCJ 3HOVJ 3S16J 2KT0A 4Y7NJ 3GTKJ 1F43A 2LY9A 1MBHA 2OPTA 2HDDA 2JA6J 5K7HA 1OJLA 5C4XJ 4DW6A 3JRIA 3BG9A 4A93J 2EZIA 3HEFA 1GDTA 2R7ZJ 4IHVA 4A3EJ 2ZB9A 3S17J 3K7AJ 3IH4A 5F0CA 2DMPA 2CJJA 1GT0C 3MN2A 2B63J 5JLXA 2ID6A 1AHDP 1HDDC 5EGOB 2DA3A 1IUFA 4BY7J 2O8KA 1FJLA 3ZQFA 4M6VA 5DTDA 4X6AJ 4JYKA 5J3LA 1JUPA 1T56A 1T33A 5EYRA 1A5JA 2XPUA 3FIWA 1OCTC 1GUUA 3G1LA 3S2DJ 4AYBN 2HXIA 1LE8A 5IOZA 3OOUA 3LSJA 1ENHA 3I4MJ 1ZKGA 1I3QJ 4IHYA 2MSYA 3BG5A 4UUSA 3IH2A 3GTQJ 5IP7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW J;  1RPW A;  2L9R A;  4W1U A;  1OCP A;  4C3H J;  1AKH A;  4A69 C;  2EQR A;  2M8G X;  4XRS G;  4EEF G;  2R5Z B;  2O7O A;  1ZR4 A;  4AC0 A;  3MVP A;  1ETV A;  2DA2 A;  2EBI A;  3QPS A;  4DZJ A;  1BA5 A;  2LLK A;  2CUF A;  3BR2 A;  2VKV A;  2XGE A;  3OIO A;  4B4C A;  3HOU J;  1ORK A;  1FIP A;  1WH5 A;  3BTI A;  4XK4 A;  2VKE A;  5J1R A;  3FKI J;  5IP6 A;  5GPC A;  2IEK A;  1F36 A;  1IC8 A;  2GLO A;  4A3M J;  1R9T J;  2FD5 A;  3JRE A;  1VFC A;  5FKO A;  3BR1 A;  2Y0S N;  4ABZ A;  1EF4 A;  5GPA A;  3HGG A;  2DMT A;  1P7I A;  1VND A;  3SJM A;  3GTM J;  3ZQG A;  5K7F A;  5EF6 A;  2NVX J;  3CDL A;  3A02 A;  1WH7 A;  4DYQ A;  4MIM A;  3OSF A;  2M34 A;  1JT0 A;  3W6V A;  3A01 B;  5IPA A;  2CU7 A;  2QCO A;  5E3N A;  4MO7 A;  2LK2 A;  2P81 A;  1TWH J;  4QSH A;  1APL C;  5BNG A;  1TC3 C;  1IDY A;  2QF7 A;  1I6H J;  3LSP A;  2WAQ N;  3MKL A;  5FLM J;  1W0T A;  4GFB A;  3LOC A;  5DS9 A;  1LFB A;  2JA5 J;  4LOC A;  1WGX A;  3ZQC A;  4A3D J;  1WCM J;  1QVT A;  2Y9Y A;  4M3E A;  3BR0 A;  2XSD C;  1WI3 A;  3FK7 A;  3GTJ J;  1P7J A;  3LNQ A;  4IHX A;  2E2J J;  1Z0X A;  2XB5 A;  2GM4 A;  5E3L A;  3GTO J;  2OF7 A;  1B72 A;  3PO2 J;  2R5Y A;  2ID3 A;  1Z77 A;  2E19 A;  4RBO A;  2EH3 A;  2VUM J;  4V2G A;  1JTY A;  3B6C A;  2Y9Z A;  3H0G J;  4A3G J;  2HQ5 A;  3HB9 A;  2Y30 A;  1SFO J;  3I4N J;  3SFI A;  1NK2 P;  1MBK A;  4UUT A;  4I76 A;  4D5C A;  2YU9 J;  1XS9 A;  1MBF A;  2LKX A;  1MBE A;  4D7M A;  5M5Y J;  3RKQ A;  2ECB A;  1X58 A;  1HOM A;  2FJ1 A;  1PUF A;  4IHW A;  2DA5 A;  2ME6 A;  2KDZ A;  2FQ4 A;  4AUX A;  3GTP J;  1MH3 A;  1OFC X;  4W97 A;  3M4O J;  4BXX J;  3CQZ J;  5EEA A;  3LSR A;  1IDZ A;  2HI3 A;  2EZK A;  2NVQ J;  2IAI A;  2JN6 A;  2DA1 A;  5FKK A;  3S1N J;  1IRZ A;  1UG2 A;  3BTL A;  5C44 J;  2TCT A;  5EDN A;  4A3C J;  1ITY A;  1B8I B;  2AO9 A;  2VI6 A;  4MFE A;  1HLV A;  1U78 A;  2DTZ A;  2JWT A;  1H89 C;  3HGY A;  4MLO A;  3TP3 A;  2TRT A;  4M3G A;  4DYR A;  5EZH A;  5F1J A;  1CQT A;  2XGC A;  4XID A;  3S2H J;  1IGN A;  2IBD A;  5FJ8 J;  5C4J J;  4I6Z A;  2LD5 A;  2ME0 A;  5J1U A;  2DA6 A;  3WHB A;  3FIS A;  2DN0 A;  1JJ8 C;  4DYC A;  4RDU A;  2XPW A;  3ZQH A;  3IH3 A;  1DU0 A;  4Y52 J;  2E1O A;  4HNV A;  3JRC A;  1IJW C;  2DA4 A;  2LVS A;  3DEW A;  1MNM C;  3SDG A;  4D5F A;  3JRG A;  4S0H B;  3BR5 A;  4D7N A;  2NVY J;  1GV5 A;  5E3O A;  5E3M A;  1AU7 A;  1RKT A;  3GBG A;  3A03 A;  1BL0 A;  1HCR A;  3PO3 J;  5HOD A;  3QPL A;  4BY1 J;  2HOS A;  2NVT J;  3Q0V A;  5IOY A;  3TED A;  5GP9 A;  2RAE A;  1TWA J;  1JKQ C;  1D5Y A;  1RES A;  2L7F P;  1BW6 A;  3ZOB A;  5F0H A;  2AHQ A;  2ECC A;  5IYC J;  2XGD A;  2CRG A;  3BT9 A;  5EGO A;  3TP0 A;  1ETY A;  1SAN A;  1LFU P;  4X1E A;  4B3A A;  3E7L A;  1X2N A;  5FKL A;  4XIC A;  3JR9 A;  1YRN A;  3O8G A;  1NK3 P;  4XRM A;  2K9N A;  1YRN B;  1U9N A;  4FTH A;  4V2F A;  1ZQ3 P;  4JP0 A;  1TWF J;  2WV1 A;  1FIA A;  3HBL A;  1FTT A;  1ZK8 A;  4UUS B;  1W0U A;  1BJZ A;  1JUS A;  1JTX A;  4QIW N;  3S1M J;  3HOZ J;  1VI0 A;  3CMY A;  1MSE C;  5K7Z A;  4JX5 A;  2HOT A;  4XRS A;  9ANT A;  5IYD J;  2NS7 A;  1ETQ A;  4FE4 A;  4A3J J;  4C2M J;  3ZQI A;  3O8H A;  3TW6 A;  5M5X J;  1HDP A;  2XPV A;  3WHC A;  3Q0W A;  4CYC A;  2JA8 J;  2CQQ A;  2DMN A;  3TW7 A;  1JKO C;  4FE7 A;  4CYC B;  3GTG J;  4BBR J;  1G2H A;  1XG1 A;  2DMQ A;  3BR3 A;  1DU6 A;  2E2I J;  3BQZ A;  2FX0 A;  3F0C A;  5F27 A;  2COB A;  2PMZ N;  3HKZ N;  3IV5 A;  1WPK A;  2CUE A;  2LTP A;  3RZO J;  1RET A;  2R93 J;  1B72 B;  3B6A A;  3BR6 A;  2DA7 A;  1JKP C;  1XC5 A;  3PM1 A;  4G12 A;  3H3V K;  2X48 A;  3S1Q J;  4A3F J;  1AKH B;  3QQA A;  3A01 A;  3BQY A;  2R0Q C;  2JMW A;  4FCY A;  2MGQ A;  1FTZ A;  2GBY A;  1MBJ A;  3D1N I;  4J19 A;  1S7E A;  1GV2 A;  5FKM A;  2HOA A;  1QRY A;  2K40 A;  3G1M A;  3JRD A;  3JRH A;  3HDD A;  1Q1V A;  1O4X A;  4M3F A;  4MFD A;  1GVD A;  1LE8 B;  5FKN A;  5IYB J;  5IP9 J;  5M3F J;  3OSG A;  3HM5 A;  1QVU A;  3BG3 A;  5EG0 B;  2XRL A;  2MG4 A;  5F08 A;  2MW8 A;  2X9D A;  4A3K J;  1IG7 A;  5EG0 A;  1UHS A;  5J1Y A;  4A3I J;  2N8G A;  2Y31 A;  3BTC A;  1VF9 A;  1ETW A;  2EZH A;  1TWG J;  2LFB A;  1ZGW A;  3Q0U A;  2X6O A;  2L7M P;  3C2B A;  2I10 A;  1X2M A;  2JK3 A;  1QPI A;  3NAR A;  2JJ7 A;  3Q3S A;  4DZP A;  3JRB A;  1PUF B;  1RR7 A;  2L7Z A;  2JA7 J;  2YS9 A;  1H88 C;  1FEX A;  1HF0 A;  3HOY J;  4M3B A;  1E3O C;  4BBS J;  3GTL J;  2M0C A;  1ETK A;  1U8B A;  3S1R J;  3L1P A;  1B8I A;  1BW5 A;  5FLV A;  1JJ6 C;  4JX4 A;  3S14 J;  2NS8 A;  2O9L A;  4L5E A;  2L0K A;  4A3B J;  1NTC A;  2CQX A;  2VPR A;  4C3I J;  2DJN A;  2M2E A;  5M5W J;  2W48 A;  1A6I A;  1UMQ A;  4IEJ A;  3FK6 A;  3RZD J;  1ETO A;  2HYJ A;  4C3J J;  3HOX J;  4B1R A;  2H8R A;  1ZR2 A;  1MBG A;  2R92 J;  3K2A A;  2XB0 X;  1MSF C;  1JKR C;  2D5V A;  2WB1 N;  1POG A;  3LSG A;  1U9O A;  1JUM A;  2K9Q A;  1RKW A;  2ELK A;  1ETX A;  4A3L J;  1K61 A;  2LP0 A;  3JRF A;  3ZQL A;  2K9S A;  1ZTR A;  2YUS A;  3NAU A;  5C3E J;  1MH4 A;  2NOG A;  2DMU A;  4NDL A;  2R5Y B;  2HXO A;  3RQI A;  3VPR A;  2E2H J;  5M3M J;  3JRA A;  1H8A C;  1Y1V J;  3UKG A;  2EZL A;  2M9H A;  5F04 A;  3BTJ A;  1I50 J;  2R5Z A;  1JT6 A;  4BKX A;  2Y2Z A;  4FIS A;  5JLW A;  1Y1W J;  2G0E A;  1JGG A;  3S15 J;  3M3Y J;  5F0F A;  1IV6 A;  2LR8 A;  1K83 J;  4QTR A;  4JX6 A;  3CCY A;  2H1K A;  4M3D A;  5EZG A;  3G1O A;  3DCF A;  1TWC J;  3HOV J;  3S16 J;  2KT0 A;  4Y7N J;  3GTK J;  1F43 A;  2LY9 A;  1MBH A;  2OPT A;  2HDD A;  2JA6 J;  5K7H A;  1OJL A;  5C4X J;  4DW6 A;  3JRI A;  3BG9 A;  4A93 J;  2EZI A;  3HEF A;  1GDT A;  2R7Z J;  4IHV A;  4A3E J;  2ZB9 A;  3S17 J;  3K7A J;  3IH4 A;  5F0C A;  2DMP A;  2CJJ A;  1GT0 C;  3MN2 A;  2B63 J;  5JLX A;  2ID6 A;  1AHD P;  1HDD C;  5EGO B;  2DA3 A;  1IUF A;  4BY7 J;  2O8K A;  1FJL A;  3ZQF A;  4M6V A;  5DTD A;  4X6A J;  4JYK A;  5J3L A;  1JUP A;  1T56 A;  1T33 A;  5EYR A;  1A5J A;  2XPU A;  3FIW A;  1OCT C;  1GUU A;  3G1L A;  3S2D J;  4AYB N;  2HXI A;  1LE8 A;  5IOZ A;  3OOU A;  3LSJ A;  1ENH A;  3I4M J;  1ZKG A;  1I3Q J;  4IHY A;  2MSY A;  3BG5 A;  4UUS A;  3IH2 A;  3GTQ J;  5IP7 J; 
#chains in the Genus database with same CATH topology
 3GYH X;  4W1U A;  1J2X A;  4XOP A;  4L0Z B;  5LGU A;  3TQN A;  4XRS G;  3L09 A;  2W7N A;  4L9N A;  2JVG A;  1IN4 A;  1SEU A;  3K70 C;  3KLN A;  3OYJ A;  3BWG A;  1ETV A;  3R0J A;  3OL3 A;  1YIO A;  2LLK A;  2LKP A;  4EQQ A;  4LB5 A;  1N75 A;  2CUF A;  3L2R A;  4Q5S F;  2XGE A;  3TL4 X;  3WTX C;  1TZL A;  1KU3 A;  3OIO A;  3QU3 A;  1JGS A;  2G7U A;  1S8N A;  2VXD A;  4B09 A;  4BS9 A;  1OQY A;  2NNY A;  4XKV A;  1F36 A;  1IC8 A;  2GLO A;  5J4Y A;  2FNA A;  5FKO A;  2ZME C;  1RIO H;  1BI2 A;  5GPA A;  2R7W A;  3H9G A;  4BQN A;  4U7D A;  2KLO A;  2BV6 A;  3KYD B;  3A2K A;  5K7F A;  1YJW I;  2OC6 A;  3IKT A;  2DJI A;  4BDY A;  3ZMD A;  4PZJ A;  2KRH A;  3ML6 A;  4MIM A;  4ETS A;  4F92 B;  1YFH A;  2M34 A;  3LQQ A;  2OU2 A;  1CGP A;  2V6C A;  3W6V A;  3A01 B;  2CU7 A;  2Y0M A;  1ZRF A;  2DK5 A;  2LYC A;  4BL0 B;  2V7F A;  5BNG A;  1B6A A;  2NOJ B;  1TC3 C;  1IDY A;  4CHU A;  2WAQ N;  4NC8 A;  3MKL A;  4KA4 A;  2WY7 Q;  3D5S C;  4R1H A;  3E3V A;  2PJR B;  1RUN A;  5FRO A;  2VOP A;  2BYV E;  2P5V A;  4U0V A;  2BXZ A;  3SZP A;  2Z3Y A;  4AID A;  2XSD C;  2FBK A;  2MLK A;  1SFX A;  3W6J B;  3LNQ A;  1ERD A;  4BHC A;  2E2J J;  2XB5 A;  2GM4 A;  5E3L A;  3PO2 J;  1B72 A;  2XAU A;  2R5Y A;  4CZC A;  2VUM J;  5DV5 A;  1XGS A;  2NAZ A;  4YIR X;  3V7R A;  4RAF A;  2ICW G;  2Y48 A;  4WXH A;  2HQ5 A;  2CQ7 A;  3ZMU A;  1B1B A;  4UVB A;  1NK2 P;  3V8K A;  1FBS A;  2EK5 A;  4BEH A;  3F6O A;  1J0R A;  1R7J A;  1IF1 A;  1N78 A;  3O3K A;  1I3A A;  1MBF A;  3RKQ A;  1XX5 A;  5M5Y J;  3I55 I;  4ZDO A;  3H3U A;  2W57 A;  1RZ4 A;  3F8M A;  3VEP A;  1HOM A;  1PUF A;  4IHW A;  1Z7U A;  1FX7 A;  2KDZ A;  2AQE A;  2O3F A;  2W00 A;  3BRO A;  2EFW A;  2LOO A;  4LLG F;  2WWY A;  1OFC X;  3M4O J;  3S2W A;  3F8B A;  3WG7 H;  4HDU A;  4MHG A;  3WU1 B;  5TRD A;  2KFD A;  2NVQ J;  1T2K A;  3P9K A;  2IAI A;  1FSH A;  1R5G A;  4HV6 A;  5IT3 A;  4PSX A;  2TCT A;  2IS4 A;  3H5N A;  2XAJ A;  2F2E A;  2CQK A;  2A6T A;  3CF5 F;  2VI6 A;  3JTH A;  2GWR A;  1HLV A;  2FRH A;  2HYG D;  4U7B A;  2DTZ A;  1H89 C;  3HGY A;  5ILU A;  4RB0 A;  3G71 I;  3FXJ A;  3C1D A;  3GFL A;  1ZYR F;  4M3G A;  4KT6 A;  3M8F A;  2XGC A;  2A69 F;  3D0S A;  2WY8 Q;  1R4N B;  4LG0 B;  4D1Q A;  3DU5 A;  1T8I A;  2ZJP F;  2WAE A;  1B9M A;  1I39 A;  2OD5 A;  3CUQ C;  2KPM A;  3F72 A;  3DEU A;  4MNU A;  2CW8 A;  1EJ9 A;  4EGZ A;  2DA6 A;  1QGP A;  2HNH A;  2VJ4 A;  4RLQ A;  3FIS A;  3H92 A;  1QQI A;  1YO5 C;  4RDU A;  3D5L A;  2FEZ A;  3ZQH A;  4PFO A;  3IH3 A;  5L3G A;  2O6G E;  4FAS D;  2E1O A;  3FHN A;  2DA4 A;  3SDG A;  1LVA A;  1TT5 B;  3DFG A;  5E3O A;  1Z21 A;  3E0J B;  4UB8 C;  4UV8 A;  3K4J A;  3H9J A;  1HCR A;  3PO3 J;  3TMO A;  3GFM A;  4IOA F;  5HOD A;  3QPL A;  5D4S A;  4H0E A;  4BY1 J;  2YX4 A;  2GA2 A;  3HHG A;  3Q0V A;  1BOB A;  4M72 A;  1YQA A;  4XR6 A;  5FGM A;  4HF0 A;  4N0B A;  1BW6 A;  3IWZ A;  1FYL A;  1Z67 A;  2XGD A;  2RVC A;  1WWX A;  4B3A A;  5CVI A;  2M8E A;  1NK3 P;  3GZN B;  3NEU A;  4FHT A;  1F4K A;  4JP0 A;  3CZ6 A;  2WV1 A;  3HBL A;  2GXB A;  1D8K A;  1I1G A;  4UUS B;  1W0U A;  5HOO A;  2RQP A;  2DOE A;  3J7Y J;  1JUS A;  1JTX A;  1A04 A;  2JSP A;  4QIW N;  3FXQ A;  2LKS A;  3HOZ J;  3CMY A;  1MSE C;  5FD5 A;  1X4P A;  3SYT A;  1RNL A;  1MW7 A;  3R4K A;  5LHH A;  1TW3 A;  2M4G A;  3IL2 A;  1WSU A;  3ZP5 A;  1W36 D;  3S32 A;  1Q1H A;  3AG1 H;  3HTS B;  4I0A A;  4XNF A;  3VYR B;  1ODD A;  1R5I D;  1D1B A;  4S05 A;  2CG4 A;  2EIL H;  4YII A;  3Q0W A;  1IUY A;  4CYC A;  2CQQ A;  1S6L A;  5JHF A;  5DUI A;  2DMN A;  1RR8 C;  4YFN F;  2FMY A;  3F23 A;  2QM3 A;  2NNN A;  3HYI A;  2DT6 A;  2E2I J;  3SXY A;  4FX4 A;  3BPX A;  3F0C A;  3CMA I;  3HKZ N;  3Q9V A;  4KYW A;  2GAU A;  2LTP A;  2ISZ A;  1D8J A;  3KEO A;  1P92 A;  3BR6 A;  1OLT A;  3FKJ A;  2RRE A;  1JKP C;  2VL8 A;  4I01 A;  2E60 A;  1XC5 A;  1SD4 A;  3S1Q J;  1CF7 B;  1NH3 A;  4IX7 A;  4A3F J;  1DPU A;  2NYX A;  4FCY A;  1LVK A;  3CUQ A;  2ZJR F;  3LMM A;  3A4C A;  2XKP A;  3D1N I;  4BNC A;  4MTE A;  2ZCW A;  2WC2 A;  1XMA A;  5LEJ A;  2HS5 A;  5KK1 A;  3JRD A;  2VLA A;  4LK1 F;  1Q1V A;  3FWE A;  3RTR A;  1W1W E;  4DOZ A;  1LE8 B;  2QSG X;  4GXO A;  3R6S A;  3L2Q A;  5FO5 A;  3LSM A;  4I99 C;  2AXT C;  3HM5 A;  2P5L C;  3BG3 A;  2D1H A;  3T5X A;  3LSI A;  1E2X A;  2OCC H;  2VBW A;  4AIH A;  1OCR H;  5F08 A;  4HQE A;  1LEA A;  1UHS A;  5J1Y A;  1E0E A;  2LY2 A;  4ASN A;  3DKW A;  1C0W A;  2Y31 A;  3C2G A;  4DBQ A;  4EV0 A;  2DFF A;  2I5U A;  2JUC A;  3JAM K;  2DQL A;  1ZGW A;  4PK4 A;  1E3P A;  2I10 A;  2FBH A;  5ILV A;  3DXJ F;  1G8X A;  2JJ7 A;  4DZP A;  1FYK A;  2E7X A;  4ESF A;  3M1C A;  3OWT A;  1R6R A;  5LGT A;  2CV1 A;  2YS9 A;  5D8K B;  1DP3 A;  3C18 A;  2ZXJ A;  3TO6 A;  3HOY J;  4BXU A;  4M74 A;  4OAY A;  1W7P A;  3U2R A;  3H3Z A;  4WF2 A;  1KQ9 A;  4RM3 A;  1D0Y A;  1ZRD A;  3GTL J;  1Z9C A;  2JVH A;  2DDA A;  1ETK A;  4A6E A;  2BVM A;  2VKD A;  1YI2 I;  1TQI A;  3S1R J;  1ULY A;  4HLY A;  2BBY A;  1WJB A;  1A36 A;  3G4S I;  1E3H A;  4CCO A;  2R7V A;  1B59 A;  5FLV A;  3CLQ A;  3EQL F;  4JX4 A;  4U87 A;  4F3Q A;  3OR2 C;  4KIS A;  3LFK A;  3X2Q H;  1NTC A;  4CCK A;  2DOD A;  3CCU I;  2BY1 A;  2CFO A;  4M73 A;  3AL0 B;  5M5W J;  1IN5 A;  5D5U B;  2W48 A;  1Z7L A;  2VJJ A;  3EUH C;  5DCM A;  1ONV A;  1IXR C;  2H8R A;  4L5I A;  1TNS A;  3V42 A;  1OYY A;  5LLQ A;  2VJ5 A;  2J5P A;  1ZR2 A;  2O8X A;  2CV0 A;  5E20 A;  1MSF C;  1OR7 A;  3DKY A;  3PNT A;  1POG A;  1MMS A;  2WA0 A;  1P9Q C;  4XSX F;  2JUG A;  4S04 A;  1S3J A;  2KJC A;  1NG6 A;  2A68 F;  1U9O A;  1Z91 A;  3DTI A;  1J9I A;  2JPC A;  3D5R C;  1SD5 A;  2ZSH B;  1ETX A;  1K61 A;  2KIQ A;  3M07 A;  2V1X A;  1WRJ A;  3NAU A;  5J8C A;  4V19 K;  1T39 A;  1P4A A;  1MMG A;  1Y1V J;  5CVR A;  3PNY A;  3OV8 A;  4HA8 A;  3F9K A;  2UXX A;  4RGR A;  4UXN A;  2DFE A;  3W2A A;  2IW5 A;  2DPU A;  5F04 A;  1I50 J;  1XCV A;  2OJE D;  1LB2 A;  4B48 A;  1JT6 A;  2OZ6 A;  5JLW A;  1Y1W J;  4XRF A;  1ZH5 A;  4LIV A;  4DGW B;  1VQ8 I;  5D5W B;  3S15 J;  5K5Q A;  2FBI A;  2XC7 A;  4OAZ A;  3GFJ A;  1IV6 A;  3KFW X;  1SVM A;  3V7C A;  4JX6 A;  2BVL A;  4P96 A;  5EZG A;  3HPG A;  1X1D A;  3JSO A;  2KT0 A;  2QBY B;  3GO5 A;  2F4I A;  3OIQ A;  2L3D A;  1MND A;  5J47 A;  3GCM A;  3NWS A;  3R61 A;  3TDU C;  4NHJ A;  2PX9 A;  3CO6 C;  2OPT A;  3OS1 A;  1XB4 A;  1WJA A;  3HOT A;  4OU0 A;  2F5D A;  3BG9 A;  4KIB A;  1P2F A;  2QVO A;  2X4H A;  3CDH A;  3PQK A;  3HEF A;  3QWL A;  4IHV A;  2R4G A;  4N4O B;  5J40 A;  4A3E J;  4B3X A;  4IVN A;  5CJ9 A;  6PAX A;  3IH4 A;  2MA3 A;  3DBH B;  2ESH A;  1R5H A;  3CUQ B;  4DBR A;  2B63 J;  4U0W A;  4PJN A;  5EJC A;  2EWN A;  4XLF A;  2DA3 A;  1OCZ H;  2FOW A;  3K4M A;  4BY7 J;  2O8K A;  4ZZD A;  1LFP A;  3KP6 A;  5DTD A;  5ICC A;  3TDZ C;  3WTS C;  1T56 A;  1JUP A;  3RYP A;  2FOK A;  3ABU A;  1GUU A;  4E4H A;  3K1P A;  4G6D A;  5CVU A;  4AYB N;  4CA0 A;  5HDK A;  3KPH A;  1X1C A;  5A2Q K;  1LE8 A;  3OOU A;  3WGG A;  2NXN B;  1I3Q J;  1ZRC A;  3U9G A;  2X1E A;  3GZ5 A;  2DLL A;  2CS3 A;  4NC7 A;  5D6E A;  1RPW A;  4I02 A;  4Y17 A;  3BJ6 A;  1TQP A;  5HDG A;  5L3E A;  1AKH A;  3CP8 A;  2P7C B;  1KA8 A;  3KP4 A;  4I7H A;  4A69 C;  3COA C;  3CJQ B;  1V5E A;  3ZCO A;  5JVG F;  3OR1 C;  2R5Z B;  4EEF G;  4ENN A;  1R1V A;  1XD7 A;  3KP7 A;  2DA2 A;  2EFQ A;  4FX0 A;  5FFZ A;  1JHF A;  2QKM B;  2VBX A;  3TGN A;  2RV8 A;  5ICE A;  1FY7 A;  2G9W A;  4IZZ A;  2VKV A;  3DQV C;  3O2P E;  3ZQQ A;  3WTY C;  1T08 B;  4XK4 A;  1R00 A;  1YW8 A;  3CUO A;  3M1E A;  5EEH A;  1FBU A;  3AG2 H;  3FKI J;  4II3 A;  2P7V B;  1BIB A;  1WHU A;  2X6Y A;  4LG3 A;  2P8T A;  2RQQ A;  2BY0 A;  4A3M J;  1R9T J;  1FSE A;  2FD5 A;  3HG9 A;  1VFC A;  4XOT A;  4PUS A;  2L4M A;  4ABZ A;  2BGC A;  2V6E A;  1P7I A;  1YHQ I;  1VND A;  1PYV A;  4BDZ A;  1J5Y A;  2PLY A;  1VQO I;  1UHW A;  3GTM J;  4UHT A;  2NVX J;  2IPQ X;  5JI6 A;  5FFX A;  3CLO A;  4DYQ A;  2RN7 A;  3F6V A;  3BJA A;  2K4J A;  4RAY A;  3K0L A;  3QAH A;  4QPO A;  2DYR H;  4OIP F;  4HQM A;  1U5T B;  1QNT A;  4BAC A;  4GFB A;  4N9I A;  1W5T A;  1R58 A;  2JA5 J;  1Y6I A;  1PJR A;  2HR3 A;  1WJD A;  3IP4 B;  4UB6 C;  1WCM J;  2K4B A;  2ACJ A;  2EFO A;  3ELK A;  1SMT A;  2K02 A;  2YR2 A;  2K3P A;  5EEG A;  1WI3 A;  3GTJ J;  2ZXW H;  2K7L A;  3WGH A;  2C6Y A;  1Z77 A;  2E19 A;  1SD6 A;  4RBO A;  1A31 A;  2VOD A;  4V2G A;  3F21 A;  2HVQ A;  3EUK L;  2FML A;  2GQQ A;  2Y9Z A;  3M8J A;  2FF4 A;  1SFO J;  3SFI A;  2IP2 A;  1K78 B;  1KGS A;  2Q0O A;  4UUT A;  3GFI A;  3DTE A;  2DOA A;  1MBE A;  2ECB A;  1GXQ A;  1X58 A;  3FHZ A;  1DPR A;  2FJ1 A;  3VYT B;  4KUM A;  5E17 F;  2V1N A;  2DA5 A;  3HUG A;  1QBJ A;  3HSE A;  5ED4 A;  3H36 A;  1MH3 A;  1VQ7 I;  3M8E A;  2ZME A;  4W97 A;  4XMY A;  5EEA A;  2IGO A;  3HC7 A;  2ZME B;  3ZMV A;  2HI3 A;  3K4B A;  4HPQ A;  4IKF A;  3IAM 2;  1FNN A;  5KCM A;  1IRZ A;  2CW7 A;  2HU9 A;  1SAX A;  1VQ9 I;  3LA7 A;  1U2W A;  3E6M A;  4HG2 A;  4EAT A;  4MFE A;  2YSR A;  4G94 A;  3IHU A;  2DK8 A;  5FLX K;  4CCN A;  1O57 A;  4EJV A;  3ONQ A;  4MLO A;  4RM2 A;  2MH9 A;  2EFN A;  2TRT A;  3IAS 2;  5EZH A;  2VOO A;  1FYM A;  3RPU D;  3S2H J;  3J7A Y;  4XLN F;  4UV9 A;  2IBD A;  3NWT A;  4BXF A;  2RGV A;  4LG0 A;  2ME0 A;  3WTU C;  1XMX A;  3ZQ7 A;  2VON A;  1ZLJ A;  3PSF A;  3G3Z A;  2KRC A;  2EPF A;  3HKZ A;  1JJ8 C;  2XVC A;  4Y13 A;  2QWW A;  1QHH D;  2P6S A;  3K4C A;  2ZFW A;  4CDG A;  4HNV A;  1BC7 C;  1IJW C;  1DU0 A;  2LVS A;  1Z1D A;  1MNM C;  4Y3O A;  4D5F A;  3JRG A;  4S0H B;  1TBX A;  3DTK A;  2NVY J;  1U5T C;  3BJO A;  1DGW Y;  3F8N A;  1RKT A;  2AS5 F;  3GBG A;  1KZH A;  1SC7 A;  1FOK A;  2V9V A;  3C7J A;  5L3B A;  1RRJ A;  1YW7 A;  1MKM A;  3V8J A;  3TO9 A;  3WTZ A;  1YIT I;  2HOS A;  1YE9 A;  3GF2 A;  4ZYD A;  2NVT J;  2BHY A;  1X1A A;  1D5Y A;  2UUZ A;  1RES A;  4R8H A;  2L7F P;  4BYY A;  2VT2 A;  2MD5 A;  3IRR A;  2Z33 A;  3T8T A;  2Q1Z B;  1YX3 A;  3CDI A;  1FPQ A;  2NRA C;  5EGO A;  1QA6 A;  2UZK A;  3LSK A;  3TP0 A;  2XAG A;  2AQF A;  3OS2 A;  2COM A;  1WI9 A;  4CGZ A;  2QGU A;  2IS6 A;  2IJL A;  3O8G A;  5FB2 A;  2KRF A;  2PJP A;  2K9L A;  2W84 A;  3A0H C;  4BQA A;  4V2F A;  1ZQ3 P;  1BM9 A;  1FIA A;  1O3Q A;  2O61 A;  4IQJ A;  1ZK8 A;  3RKY A;  2A3S A;  2GXA A;  5AIQ A;  3ABK H;  4WXC A;  1X1P A;  3WOD F;  2A07 F;  5K7Z A;  2A6E F;  3C3W A;  2VQL A;  1FMV A;  3G73 A;  2PI0 A;  5GTI C;  4C2M J;  1YG2 A;  1MZB A;  2ZBK A;  3ZQI A;  3OY9 A;  4KIG A;  1KU2 A;  3TW6 A;  3S8P A;  1PVE A;  1FP2 A;  1HDP A;  5H20 A;  1MJ9 A;  3BC8 A;  3VWB A;  5FLX Z;  2JA8 J;  4CO8 A;  4PJ0 C;  4CYC B;  3GTG J;  2FE3 A;  2D2W A;  3ZGK A;  1DU6 A;  4HNU A;  3CCV I;  5HLT A;  2F5V A;  1WPK A;  4QWQ A;  3RZO J;  1RET A;  4HX7 A;  5ERI A;  2R93 J;  3B6A A;  2DA7 A;  3Q5F A;  2D45 A;  1HW5 A;  1O3R A;  3FMS A;  1F9N A;  3V7S A;  3J7A O;  2CFX A;  3GWZ A;  3L2V A;  3QQA A;  3A01 A;  2XKO A;  5F6F A;  1SAU A;  3RPU A;  1T0F C;  3OYD A;  1MBJ A;  2V9K A;  2HOA A;  4J00 A;  1P4W A;  1U0J A;  5DD8 A;  1WQ2 A;  3BP8 A;  3CCL I;  3ISP A;  4KIT B;  1R23 A;  1GVD A;  1TNT A;  3AAF A;  3MAJ A;  1LDJ A;  1VQK I;  2F4M B;  4G9Y A;  2W25 A;  5EG0 B;  4B8X A;  4HLX A;  1J7K A;  2MG4 A;  2MW8 A;  2X9D A;  4I0B A;  2LY1 A;  5E1W A;  1AA7 A;  1PP8 F;  2N8G A;  2CMP A;  4E7H A;  2M30 A;  2WAF A;  3SHF A;  1R71 A;  3O6B B;  4ZYE A;  1ETW A;  1TWG J;  3OYM A;  4MEY F;  1YW9 A;  2LFB A;  3P9I A;  1R1U A;  2HOE A;  3CTA A;  2KL4 A;  2X6O A;  3WE3 A;  3Q3S A;  1XGN A;  2E5Z A;  5A2Q Z;  1PUF B;  4OIO F;  1A6Q A;  5D5V B;  1O3S A;  2EJR A;  4DJA A;  5CVJ A;  2KMU A;  4Z2Y A;  1H88 C;  1FC3 A;  3EDP A;  2L9N A;  2DPD A;  1D1A A;  2HPI A;  1WJF A;  4BJ6 C;  2Z5U A;  2X51 A;  1JXS A;  4N9H A;  3L00 A;  1WJC A;  3VB2 A;  4CCJ A;  3F8F A;  3LL7 A;  3K2Z A;  4MTD A;  3R0A A;  3OL4 A;  3VOE A;  1H0M A;  1LPQ A;  3S14 J;  2EV5 A;  2NVU B;  1BI1 A;  2NS8 A;  3SQN A;  2O5R A;  4AYB A;  2E1N A;  2L0K A;  4PDK A;  2A6H F;  3WGI A;  4OIQ F;  4Q48 A;  4C3I J;  2DJN A;  2HQA A;  2QKL B;  2M2E A;  1V55 H;  3HRU A;  4KJZ A;  1Y8R B;  2R7X A;  4G7Z F;  1A6I A;  5H6R A;  2ZNY A;  1IO2 A;  3RYR A;  1ETO A;  1GXP A;  4KT5 C;  3CCJ I;  3VSK A;  2X1C A;  2PG4 A;  5LRS A;  1V54 H;  1JKR C;  1FOW A;  5BMZ A;  1REP C;  2K9M A;  2M0M A;  3LSG A;  4NQW A;  3ZN0 A;  4YEJ A;  2DQR A;  5KNL A;  3DF8 A;  2L5Q A;  2ELK A;  1HC8 A;  5AIP A;  3ESW B;  1S29 A;  1V4R A;  2LP0 A;  3JRF A;  4AIK A;  2DCE A;  2DMU A;  2GZW A;  3SZG A;  2HXO A;  2L9S A;  4HAM A;  2E2H J;  2A5W A;  2BY2 A;  1H8A C;  3NQO A;  1BC8 C;  5GAD J;  5DD4 A;  3UKG A;  1HXD A;  5CQG A;  1WZ2 A;  3ABM H;  5KAI C;  1IV8 A;  1QPM A;  1I6X A;  1G4D A;  2Y2Z A;  2JZY A;  2G0E A;  4U88 A;  1BOA A;  3DPT A;  3DPU A;  2V1U A;  3KX2 A;  4WK8 F;  1PP7 U;  3CJN A;  2JSC A;  3DWL E;  3HOV J;  1TWC J;  1W36 C;  4AIJ A;  4C2T A;  1S7A A;  1ZHF A;  3EUH A;  3AFH A;  5C4X J;  2DU9 A;  4A93 J;  2V26 A;  2EA2 A;  4N4N B;  5CQE A;  2ZXH A;  1G3Y A;  1LKX A;  1Y8Q B;  4ZH4 F;  2ZB9 A;  3PNV A;  3K7A J;  3RSN A;  5F0C A;  2DMP A;  2A5Y B;  2M4K A;  2Y0S A;  2Z2S B;  3MZY A;  4GCV A;  4XKB A;  2DOF A;  4CYD A;  3I0T A;  2KHM A;  4P5O A;  4ZYA A;  3F22 A;  1Z6T A;  5L3F A;  4EGY A;  1FJL A;  4X6A J;  3G2B A;  4Q4Z F;  2CSO A;  2XPU A;  1WKM A;  4OOI A;  2VE8 A;  1PDN C;  4HBL A;  1O3T A;  2HXI A;  5IOZ A;  3IUO A;  1I5Z A;  1ZKG A;  2W24 A;  1MIJ A;  2PMH A;  1OCO H;  3F3X A;  3I59 B;  3I71 A;  3SEZ A;  2MSY A;  3BG5 A;  4UUS A;  1K7A A;  3GTQ J;  3HOW J;  2ESN A;  1MJB A;  3MWM A;  1USS A;  2L9R A;  2LG4 A;  2M7B A;  2DFI A;  3BOQ A;  4C3H J;  3TBI A;  2EQR A;  3IWF A;  1R1T A;  2M8G X;  3K9T A;  3ULQ B;  3LAP A;  4EM2 A;  4OWR B;  1W7P D;  1IXS B;  2GOX B;  4OIN F;  2O7O A;  3E6D A;  2OCE A;  4CCM A;  3L7W A;  4AC0 A;  4DZJ A;  4E7Z A;  2EBI A;  1YJN I;  1Y39 A;  3CC2 I;  4E7K A;  2F4O B;  3B02 A;  5DCF A;  3BR2 A;  5B1B H;  2V4J C;  4B4C A;  1Z3Y A;  1ORK A;  1U8R A;  1IN6 A;  1WH5 A;  2QEX I;  3U1D A;  2R7T A;  5J1R A;  2HVR A;  5GPC A;  4YEL A;  4LLN A;  2IEK A;  3B73 A;  1XTA A;  1HA8 A;  4ANJ A;  3KZI C;  3BR1 A;  2Y0S N;  2R7R A;  3FBI B;  4PGH A;  3CES A;  1D1C A;  4QPQ A;  1I1S A;  4L9J A;  3ZQG A;  4RB2 C;  3WU2 C;  5LHI A;  2E1C A;  3KLO A;  4M6X A;  1WH7 A;  5D8L B;  3HSR A;  2ZSI B;  1OR7 C;  4E6K G;  3OSF A;  4WCG A;  1D5V A;  5LBQ A;  5IPA A;  1VQM I;  1D0Z A;  1UAA A;  2QCO A;  2PMU A;  1IN8 A;  2LK2 A;  2P81 A;  3SDB A;  4QSH A;  5BS6 A;  1J59 A;  5FLM J;  1ZLK A;  4IRI A;  2CW0 F;  5DS9 A;  1LFB A;  1WGX A;  3ZQC A;  2IS1 A;  3BCA A;  2PEX A;  1MMN A;  3DPL C;  2YX7 A;  2Y9Y A;  3L9F A;  3BR0 A;  1U3E M;  5J4V A;  4EJU A;  3J80 K;  4GYG A;  3E6B A;  5K5O A;  3BG7 A;  4IHX A;  1MMD A;  4NC6 A;  3J7Z I;  3E5X A;  1QZZ A;  4A0Y A;  5IY5 H;  2ID3 A;  1W4M A;  3I9V 2;  4BJ5 C;  4XLA A;  2VKH A;  4Z6Y A;  4RAZ A;  1FOX A;  1JTY A;  4HF2 A;  2BY3 A;  4J01 A;  3BLY A;  3I64 A;  4KMF A;  4A3G J;  5HS9 A;  3K1N A;  2Y30 A;  3KEQ A;  2M87 A;  3OYC A;  2EIN H;  1MBK A;  1ON2 A;  4E7S A;  1D3Y A;  2VQH A;  4I76 A;  2EIK H;  2LKX A;  2Y69 H;  2L7K A;  3V4G A;  1XSX A;  1K6Y A;  4GDF A;  1ON1 A;  4AUX A;  3GTP J;  4DQ2 A;  1MNE A;  4A6D A;  1HBX G;  1H9G A;  2CV2 A;  1JHH A;  1BI0 A;  3LSR A;  5BOX A;  1X1B A;  4AVZ A;  1IDZ A;  2Z1D A;  4L9T A;  3BZK A;  2X85 A;  2JN6 A;  3S1N J;  4OMZ A;  3OYN A;  3WE2 A;  3BTL A;  3T1B A;  5C44 J;  5L3D A;  2XF5 A;  1NHA A;  1B8I B;  3VFZ A;  1DUX C;  2OV7 A;  3PUF A;  2DYS H;  5HDN A;  2IRF G;  3REO A;  1Y56 A;  3CCQ I;  4ITV A;  2FSW A;  2RC4 A;  2JQ7 A;  3TP3 A;  4A5M A;  3HXL A;  2KIF A;  1CQT A;  5F1J A;  4XID A;  4M9X A;  2BW3 A;  2GOM A;  2LH9 A;  4EJT A;  2Q2E B;  1VQ6 I;  5DEQ A;  5C4J J;  4I6Z A;  1G59 A;  2Q2E A;  5D6F A;  4ZZL A;  3CME I;  4BH9 A;  3GVA A;  2DAO A;  1X3Z B;  3IKV A;  3WHB A;  3ERE D;  5GTH C;  4DYC A;  3KEY A;  1ZG3 A;  1BIA A;  2MC3 A;  2W1O A;  1QZE A;  3K1M A;  4AU7 A;  4RMN A;  4Y52 J;  4D9J A;  3KP3 A;  1BR2 A;  2ZKZ A;  3DEW A;  4XQF A;  2E35 A;  3PFI A;  3I58 A;  3M7G A;  4D7N A;  3P5J A;  3ASO H;  2VBY A;  3H0D A;  5E8I A;  2XF7 A;  3DLL F;  3RIR A;  4LIU A;  1TP4 A;  1BL0 A;  3OYI A;  2A05 A;  1L3L A;  1J75 A;  1BN5 A;  1JE8 A;  1ZGA A;  1GHC A;  4ZYH A;  5IOY A;  4PCQ A;  5GP9 A;  2RAE A;  2M5W A;  4BEH B;  4RGU A;  3ZOB A;  3BPV A;  5F0H A;  2AHQ A;  2MFZ A;  3AKZ A;  3BT9 A;  1XSD A;  4RAG A;  3ABL H;  3IRQ A;  2FQ3 A;  3A0B C;  1ETY A;  1XGM A;  4JQF A;  4G6T B;  3DV8 A;  1FT9 A;  4XLH A;  4X1E A;  5E1X A;  1VQN I;  3MQ0 A;  3VOD A;  3E7L A;  5J6X A;  5IT9 Z;  1X2N A;  4XIC A;  1YRN A;  3BZC A;  3FX3 A;  4XRM A;  2BOL A;  4NUB A;  4XM3 A;  1YRN B;  3FXO A;  1B4A A;  3JW4 A;  4FTH A;  5DUK A;  2EIJ H;  1OMI A;  4IRH A;  1TWF J;  4HEA 2;  4RLF A;  1FTT A;  1I27 A;  2ZJ2 A;  1BJZ A;  4A0X A;  3HRS A;  2JTV A;  3K10 A;  4UVA A;  3SZT A;  1IZ1 A;  3L2C A;  3S1M J;  3ROU A;  4CSW A;  2Q8K A;  1TLH B;  3TOB A;  3J81 K;  2HOT A;  5DM6 F;  2ZC2 A;  3ZPL A;  1WVR A;  2IS2 A;  2R3S A;  1LNW A;  1W5S A;  5LRR A;  2OBP A;  3AG4 H;  2W82 A;  2XRO A;  1SD7 A;  2ZJQ F;  2X0L A;  1HKQ A;  2KP6 A;  3CD6 I;  4G8X A;  2DDB A;  3CMM A;  3KYL A;  1FOY A;  2XPV A;  1QO0 D;  3ZR8 X;  3KET A;  1UCR A;  2E1M B;  2P4W A;  3FDY A;  3TW7 A;  1STZ A;  4FE7 A;  3LSH A;  3AL0 C;  3FM5 A;  2XAS A;  4BBR J;  1SVO A;  1XG1 A;  5HS8 A;  2K86 A;  2DMQ A;  2R7Q A;  3BR3 A;  1T95 A;  5ICF A;  4BE2 A;  2CUJ A;  3BQZ A;  3BDD A;  2FX0 A;  1W5C C;  2QQA A;  2COB A;  2M45 A;  4LK0 F;  4KMU X;  3MKZ A;  2CUE A;  1RUO A;  1UZC A;  2ETH A;  3I53 A;  5HVQ C;  3QPH A;  4WWC A;  4G12 A;  3ZMZ A;  2PBI A;  3CC7 I;  3K4L A;  3BQY A;  3NRV A;  1Z6R A;  2XDV A;  3FXK A;  3BZ6 A;  2MGQ A;  4CZZ A;  4A12 A;  4GRI A;  2GBY A;  4J19 A;  1S7E A;  2HYF A;  4D0P A;  2OQG A;  2VBZ A;  1GV2 A;  1UB9 A;  2VE9 A;  2LF8 A;  1X4O A;  3G1M A;  2RKH A;  3I56 I;  2IVM A;  1X3U A;  4EMS A;  2DFH A;  1EH6 A;  3HDD A;  3I5U A;  1Z05 A;  3H5A A;  2OTL I;  2L54 A;  4ZTF A;  2A61 A;  3SEQ A;  5IYB J;  4O3M A;  2QYO A;  5M3F J;  1K6O A;  2IGN A;  3E5Q A;  1QVU A;  2QQ8 A;  2XRL A;  4PJM A;  5ICG A;  3PL8 A;  1R49 A;  1IG7 A;  5EG0 A;  4JK1 X;  4A3I J;  4F7Z A;  1FP1 D;  3MKW B;  4BE0 A;  3BTC A;  4Y15 A;  2EZH A;  5B3S H;  3LAJ A;  2L9V A;  3GEZ A;  2HDW A;  3KYC B;  3Q0U A;  4HV5 A;  2L7M P;  3C2B A;  5LHG A;  1X2M A;  5HNH A;  3JRB A;  4LJZ F;  2QQ9 A;  4Y33 A;  2LBF A;  3LWF A;  2JA7 J;  2G7H A;  4LIT A;  3QYF A;  3OYH A;  4LB6 B;  3LFU A;  3L2W A;  1FEX A;  1E3O C;  1EKE A;  2KQR A;  4CCL A;  1LUJ B;  3WTT C;  2KZV A;  4HX8 A;  3WG9 A;  2M0C A;  5F64 A;  3C2H A;  1OYI A;  3UNG C;  4IL6 C;  2HTS A;  2QEN A;  1BW5 A;  2KIS A;  3JTG A;  2VIX A;  1JJ6 C;  2BHZ A;  2E1M C;  3T0Y A;  3OOP A;  3ZMT A;  4BU2 A;  2O9L A;  4L5E A;  3VSL A;  4UUV A;  4ZC3 A;  2HKO A;  4OMY A;  4XLE A;  4ZYG A;  5FRM A;  1KON A;  3MCZ A;  4HYE A;  1TTY A;  1JI8 A;  1SMY F;  2MC4 A;  1QZY A;  1G3W A;  4IEJ A;  3FK6 A;  4F52 A;  2H09 A;  2KJB A;  3HOX J;  3HTU A;  2BXY A;  2R92 J;  3K2A A;  4XSZ F;  2JPB A;  3R60 A;  2OA4 A;  3N05 A;  2V9P A;  5CYV A;  3H35 A;  4IJA A;  3H1C A;  1JUM A;  4MGR A;  4NBQ A;  2ADU A;  2K9Q A;  2QUF A;  4YG2 F;  2OTJ I;  3ECH A;  2F5F A;  2QLZ A;  4A3L J;  2OUM A;  5E79 C;  1ZTR A;  2YUS A;  5C3E J;  3HOS A;  1MH4 A;  2NOG A;  4I98 B;  2QA4 I;  5LFA A;  4B44 A;  3HRM A;  3RI4 A;  4XL9 A;  3P9C A;  1YYV A;  3DEE A;  3JRA A;  2JRT A;  3K4N A;  3KP5 A;  2EZL A;  5JHU A;  1YTY A;  5FRN A;  2M9H A;  1Y0N A;  4FT8 A;  3F8C A;  4K2E A;  4AVP A;  3MKY B;  3K4K A;  4BKX A;  1H9T A;  1XDU A;  3CCS I;  1JGG A;  2H6C A;  2XAQ A;  3S3O A;  4KNY A;  3M3Y J;  2IGK A;  1V3F A;  3FMQ A;  2P5K A;  1HSJ A;  2VQG A;  1K83 J;  4QTR A;  2BZT A;  5HNF A;  1YS6 A;  4IPA A;  2H1K A;  4KIF A;  3G1O A;  3DCF A;  3GUD A;  3ZN1 A;  3OYF A;  3KE2 A;  4Y7N J;  3HPH A;  5CKT A;  1K4T A;  1ZRE A;  4YRV A;  4LD5 A;  3DBL B;  1FBQ A;  1HST A;  2LY9 A;  4IXA A;  1MBH A;  4OIR F;  1IAW A;  3SFZ A;  4F91 B;  2JA6 J;  4XON A;  2FA5 A;  2EB7 A;  1OJL A;  4DW6 A;  1T0F A;  4BGD A;  2XAH A;  4CH7 A;  3BCB A;  5HLH A;  5CLS A;  1GDT A;  2WAD A;  2EIM H;  4U0Y A;  4C9Y A;  3FXL A;  4ON0 A;  4LMY A;  3EYI A;  4YFK F;  1GT0 C;  4PGG A;  2AXL A;  4LGW A;  3WTW C;  4F55 A;  5JLX A;  2ID6 A;  5EGO B;  1IUF A;  4HF1 A;  1XMK A;  2FNP A;  3CC4 I;  4M6V A;  1RI7 A;  3PQJ A;  4E7J A;  1J09 A;  5TJJ A;  4XN0 A;  2BEO A;  4JYK A;  2FU4 A;  5LGN A;  2PJR A;  2M3A A;  1T33 A;  2CUZ A;  3PUB A;  4KIC A;  2CGP A;  1IRF A;  4IHT A;  3FIW A;  1BI3 A;  1OCT C;  1KU9 A;  2W85 A;  2DW4 A;  3G1L A;  3S2D J;  1GLN A;  2V1D A;  3OYA A;  4RB1 A;  5TIS C;  3WTV C;  4ENK A;  2GIZ A;  2H27 A;  4IHY A;  4XLC A;  3IH2 A;  1ZG5 A;  2WV0 A;  3I59 A;  3JCU C;  3BG6 A;  4IRG A;  1OCP A;  2K3F A;  4EM1 A;  1EA3 A;  3QU6 A;  4L5J A;  1X3W B;  2XAF A;  1T98 A;  3KZY A;  4EM0 B;  3U21 A;  5D5X B;  1OPC A;  2IA0 A;  2VC0 A;  2LDU A;  5ILS A;  1ZR4 A;  2ELJ A;  2K85 A;  3MVP A;  3QPS A;  5DYM A;  3OYE A;  1BA5 A;  4GO1 A;  3RJP A;  5K5R A;  3QOD A;  5KHD A;  4AD9 A;  3MFK A;  2VT3 A;  5GAH J;  4IF4 A;  4IOC F;  3HOU J;  1FIP A;  1SFU A;  4Y4R A;  3BTI A;  2VKE A;  3HL2 A;  5IP6 A;  1MDM B;  3CF2 A;  4BUP A;  1EH8 A;  1TW2 A;  3ASN H;  3RDI A;  1ZN2 A;  2HQR A;  1GVJ A;  3JRE A;  1EF4 A;  1UJ8 A;  3HGG A;  2DMT A;  2CYY A;  1S72 I;  3GLL A;  2IT0 A;  3OYL A;  2HFH A;  2H6B A;  3SJM A;  1YIJ I;  4II2 A;  2LNB A;  4HNT A;  4R79 A;  4M6Y A;  1YS7 A;  2E36 A;  5EF6 A;  1T38 A;  3CDL A;  3A02 A;  3PFY A;  2F6C A;  2ZNZ A;  3GZ6 A;  1UG0 A;  3ZXS A;  4PJL A;  2P6T A;  4E7L A;  4IHS A;  4GGG A;  4Q47 A;  3CCE I;  1JT0 A;  2O03 A;  3QYE A;  1WFX A;  4BHP A;  5E8G A;  2OZU A;  5E3N A;  4MO7 A;  4L18 B;  1TWH J;  1APL C;  2ZFU A;  4AM3 A;  3H9Q A;  2IA1 A;  2M7A A;  1IRG A;  4P55 A;  2QF7 A;  1I6H J;  3LSP A;  2M1B A;  3GME A;  1W0T A;  1Y0U A;  4HRI A;  3LOC A;  5L3C A;  3M9A A;  5E1Z B;  4F93 B;  4LOC A;  3QRF F;  3EUA A;  2LC2 A;  4A3D J;  1KU7 A;  4ESJ A;  1QVT A;  1V5F A;  4M3E A;  4IQ4 A;  4O6J A;  2ELH A;  1QU3 A;  2VB6 A;  1ZGJ A;  1U6G A;  3S3N A;  3FK7 A;  3HJE A;  1KYZ A;  1P7J A;  1VQ4 I;  4BAY A;  1Z0X A;  2R7O A;  3GTO J;  2OF7 A;  2EH3 A;  2KIU A;  1N25 A;  2P0W A;  3B6C A;  3RCO A;  2MYS A;  3H0G J;  3I4N J;  3HB9 A;  1MD0 A;  4CXF A;  1UEL B;  2UV1 A;  3W6K B;  2LMD A;  4D5C A;  2YU9 J;  2HEO A;  1XS9 A;  2O0Y A;  1MJA A;  2W4S A;  4D7M A;  3PJR A;  3QPT A;  1LDD A;  5J8F A;  2ME6 A;  1LDK B;  2LRE A;  2FQ4 A;  1K79 A;  1KQ0 A;  4BXX J;  3CQZ J;  2XHK A;  4ESB A;  1FMW A;  1XCB A;  2RNJ A;  1L0O C;  4HW0 A;  4RS8 A;  2EZK A;  3QOP A;  2WTE A;  2DA1 A;  5FKK A;  2Y75 A;  4A5N A;  4YFX F;  4FQG A;  1UG2 A;  2PFB A;  1DGR M;  1IW7 F;  1UFM A;  5EDN A;  4KN4 X;  3AG3 H;  2VXZ A;  3W2V A;  3PIP F;  3L2U A;  4A3C J;  1ITY A;  2AO9 A;  3K69 A;  3Q9S A;  2XRN A;  3DKX A;  4P1W A;  2HZT A;  2K27 A;  2GIV A;  1U78 A;  3W2W A;  3E5U A;  2JWT A;  3EYY A;  2HWV A;  4UY8 I;  1ZAR A;  4DYR A;  5H6Q A;  1DQU A;  1FWZ A;  2PN6 A;  5HLI A;  1U5T A;  1IGN A;  3DLA A;  3OYG A;  5FJ8 J;  2LD5 A;  4L9V A;  1XDS A;  3A1Y A;  1HKT A;  5J1U A;  3MMY B;  5D4R A;  1A35 A;  2DN0 A;  2IXS A;  2I8D A;  4M71 A;  2DT5 A;  4H4K C;  1LEB A;  2XPW A;  3PSI A;  2KKO A;  3FF5 A;  2XV4 S;  2HDC A;  3JRC A;  1S7O A;  1HW2 A;  2E34 A;  3TOA A;  2STW A;  4G7O F;  4HX4 A;  1NG7 A;  3BR5 A;  3FXM A;  3QP5 A;  1GV5 A;  5E3M A;  1AU7 A;  4KN7 X;  2HQN A;  3FXR A;  1N77 A;  3A03 A;  4CIC A;  3GXO A;  3RPQ A;  4EJO A;  1IN7 A;  1P4X A;  3U1K A;  3TED A;  1IXC A;  4KFC A;  5DDG A;  1TWA J;  1JKQ C;  4PSW A;  2ECC A;  4BQO A;  4P9F A;  2CRG A;  2DI3 A;  4M9Z A;  5IYC J;  3GW2 A;  2MLG A;  5AON A;  1TT0 A;  1SAN A;  4XOR A;  3WU0 A;  1LFU P;  2Z99 A;  4QLC U;  3K6G A;  1HQC A;  5FKL A;  1S9H A;  4FET A;  3JR9 A;  3OYB A;  2K9N A;  4XLP F;  1U9N A;  2VN2 A;  3KCC A;  3VYU B;  2V79 A;  1VQL I;  1R22 A;  1RC9 A;  5BQT A;  3KZZ A;  1E17 A;  2HZD A;  3BY6 A;  2QZ8 A;  4WXD A;  4M9S A;  2STT A;  1VI0 A;  5H2F C;  2CO5 A;  2KDO A;  4JX5 A;  4XKC A;  2F5E A;  4XRS A;  9ANT A;  5IYD J;  2NS7 A;  1ETQ A;  4FE4 A;  4MQ9 F;  4A3J J;  2MH2 A;  1ZEL A;  1VQ5 I;  2HGC A;  4XKW A;  1O7L A;  1XGO A;  4RGX A;  4I2O A;  3O8H A;  4IO9 F;  2JRM A;  1SFE A;  3MEX A;  5M5X J;  4PFP A;  3WHC A;  1YOV B;  4ZTJ A;  1T6S A;  1MMA A;  1JKO C;  3H5R A;  2NS0 A;  2HVS A;  2HKX A;  3FBN B;  3CCR I;  3N97 A;  1G2H A;  1G3S A;  3CJR B;  1LJ9 A;  2L4A A;  2EV0 A;  3FZV A;  2CQN A;  5JFR A;  5F27 A;  1QHG A;  2PMZ N;  3IV5 A;  3I54 A;  1OCC H;  2MD0 A;  5JVT A;  1G3T A;  1BJA A;  3OS0 A;  2FUG 2;  1WJE A;  4UVC A;  2DXI A;  1B72 B;  2XF6 A;  2L01 A;  2EFP A;  2PQ8 A;  3RKW A;  1CF7 A;  3PM1 A;  3H3V K;  1F1Z A;  2X48 A;  4CUG A;  2JA2 A;  1AKH B;  1XSV A;  2R0Q C;  1KQ8 A;  1R4M B;  2JMW A;  4E70 A;  3FXU A;  4A2U A;  2ZXI A;  3OIP A;  1XPX A;  1FTZ A;  5DCM B;  1F5T A;  3J81 Z;  3KP2 A;  5CPR B;  5FKM A;  3TKY A;  4DIQ A;  1B9N A;  1QRY A;  3T8R A;  2K40 A;  2F5C A;  2EA4 A;  4A0Z A;  1XN7 A;  3JRH A;  2X6W A;  2X6X A;  2B9S A;  3E6C C;  3HHH A;  3OYK A;  1O4X A;  3ABT A;  1ACI A;  4M3F A;  3UR3 C;  3CO7 C;  4MFD A;  3QOE A;  3GLX A;  3PIO F;  5FKN A;  5IP9 J;  2XSJ C;  3OSG A;  1S5L C;  1Z3X A;  1R36 A;  5TGT A;  5CVV A;  1TL8 A;  5B66 C;  5E18 F;  3G6E I;  4A3K J;  3CCM I;  3VYS B;  1YLF A;  2LSO A;  2ISY A;  3LA3 A;  4EVI A;  1VF9 A;  3EPZ A;  5K1Y A;  1D0X A;  3LST A;  1P6R A;  1BR4 A;  2DTR A;  3P7N A;  4UNO A;  3MZH A;  2E71 A;  2JK3 A;  1QPI A;  2L02 A;  3CP2 A;  4ENJ A;  5LEK A;  1FLI A;  3NAR A;  1YJ9 I;  2B0L A;  5GAG J;  1DDN A;  2PMZ A;  5HLG A;  3N4M A;  2XUB A;  1RR7 A;  4BQQ A;  1FZP B;  2F48 A;  2L7Z A;  2Z16 A;  1AOY A;  1UST A;  5F1R A;  1DP7 P;  1M1E B;  1W7P B;  2LBF B;  1VQP I;  4XBF A;  2CH0 A;  1HF0 A;  4HZF A;  4M3B A;  2KIM A;  1LQ1 A;  4BBS J;  2MBF A;  4HDV A;  1SVL A;  3ZRG A;  1MDM A;  4DNC A;  1U8B A;  1MGT A;  2TDX A;  3OMY A;  4L0Y B;  2DT7 B;  2XGX A;  1IRX A;  3L1P A;  4MQV A;  2YU3 A;  1KYW A;  5B5E C;  1B8I A;  3EET A;  1ZG1 A;  3IC7 A;  2MAB A;  1WJ5 A;  2J5O A;  4RGS A;  2Z9O A;  2OAZ A;  2B7E A;  4TV7 A;  1AWC A;  3TO7 A;  2UWM A;  1YX5 A;  2FXA A;  4A3B J;  2CQX A;  2VPR A;  3V8L A;  4XN3 A;  4LLL A;  3HZJ A;  3MZ8 A;  3HRT A;  1O7F A;  2DO7 A;  5DM7 F;  2BW3 B;  3KIO A;  3MD2 A;  3I4P A;  1UMQ A;  1K78 A;  3QP6 A;  4P9U A;  3J80 Z;  3RZD J;  1VTN C;  2HYJ A;  4C3J J;  4B1R A;  1MBG A;  2XB0 X;  5FD6 A;  2H94 A;  2VJI A;  3HSF A;  4BHB A;  2D5V A;  2WB1 N;  3W3C A;  1OIS A;  3HUG B;  1EH7 A;  2CWE A;  2BE5 F;  3LA2 A;  4HSR A;  5BPI A;  1K4S A;  1X19 A;  3E1S A;  3DBR B;  1RKW A;  2YPR A;  4RA2 A;  3ERM A;  2GA1 A;  5B1A H;  2H8W A;  3ZQL A;  2K9S A;  4HOB A;  1VZ0 A;  4NDL A;  2R5Y B;  3RQI A;  2R7F A;  3VPR A;  2RDP A;  5M3M J;  4ZDP A;  1BR1 A;  1V5G A;  2IGM A;  3LQR A;  3QYB A;  4C30 A;  2H1L A;  2D1V A;  3S3M A;  3DP7 A;  4ENM A;  3E97 A;  3S93 A;  3BTJ A;  4MEX F;  2EV6 A;  2R5Z A;  2WBM A;  2E5N A;  2GXG A;  4ZJZ A;  2KZG A;  4FIS A;  5IT9 K;  5KVR A;  4JBA A;  3ECO A;  4BE1 A;  1UHM A;  2OQR A;  5F0F A;  4EJW A;  1TQM A;  2LR8 A;  3FM3 A;  4JOM A;  2QSF X;  3K70 D;  2JT1 A;  4ZDL A;  5KAF C;  4RB3 C;  3CCY A;  1EV7 A;  5JR3 A;  4G7H F;  2QBY A;  2UXN A;  4M3D A;  2LRD A;  2VAS A;  2QQB A;  4O5V A;  3RQ4 A;  3S16 J;  4WX9 A;  4HST A;  4LFU A;  3GTK J;  2E7W A;  2R7S A;  2WB1 A;  2HPM A;  1BBY A;  4PJJ A;  2VQC A;  3HIF A;  1F43 A;  3CJT B;  3VDX A;  2HDD A;  4I09 A;  2IA2 A;  5K7H A;  2K5C A;  3JRI A;  1PUE E;  2R7D A;  3FMR A;  2HTJ A;  2L2O A;  2DBB A;  2RNG A;  2X1D A;  4GYI A;  4G6Q A;  1OYW A;  2EZI A;  5HS7 A;  2R7Z J;  4NB5 A;  4AWX B;  4B47 A;  3S17 J;  4C2U A;  2CJJ A;  2ZO4 A;  1HKS A;  3I3L A;  1HW1 A;  3MN2 A;  4NNJ A;  2VC1 A;  2VPL A;  5BPD A;  1AHD P;  1HDD C;  4E7I A;  3JSP A;  2R7U A;  3ZQF A;  1G6N A;  3JAM Z;  2LF7 A;  5J3L A;  5GAE J;  4NQW B;  4X0G A;  4KDP A;  2XIG A;  5EYR A;  1A5J A;  3RKX A;  2QSH X;  1ZAO A;  3ZMS A;  3LSJ A;  1ENH A;  3I4M J;  3GX4 X;  1OKR A;  4YIF A;  4B43 A;  4BJT A;  5LD2 C;  1SFK A;  3DU6 A;  2WAQ A;  5IP7 J; 
#chains in the Genus database with same CATH homology
 3HOW J;  1RPW A;  2L9R A;  4W1U A;  1OCP A;  4C3H J;  1AKH A;  4A69 C;  2EQR A;  2M8G X;  4XRS G;  4EEF G;  2R5Z B;  2O7O A;  1ZR4 A;  4AC0 A;  3MVP A;  1ETV A;  2DA2 A;  2EBI A;  3QPS A;  4DZJ A;  1BA5 A;  2LLK A;  2CUF A;  3BR2 A;  2VKV A;  2XGE A;  3OIO A;  4B4C A;  3HOU J;  1ORK A;  1FIP A;  1WH5 A;  3BTI A;  4XK4 A;  2VKE A;  5J1R A;  3FKI J;  5IP6 A;  5GPC A;  2IEK A;  1F36 A;  1IC8 A;  2GLO A;  4A3M J;  1R9T J;  2FD5 A;  3JRE A;  1VFC A;  5FKO A;  3BR1 A;  2Y0S N;  4ABZ A;  1EF4 A;  5GPA A;  3HGG A;  2DMT A;  1P7I A;  1VND A;  3SJM A;  3GTM J;  3ZQG A;  5K7F A;  5EF6 A;  2NVX J;  3CDL A;  3A02 A;  1WH7 A;  4DYQ A;  4MIM A;  3OSF A;  2M34 A;  1JT0 A;  3W6V A;  3A01 B;  5IPA A;  2CU7 A;  2QCO A;  5E3N A;  4MO7 A;  2LK2 A;  2P81 A;  1TWH J;  4QSH A;  1APL C;  5BNG A;  1TC3 C;  1IDY A;  2QF7 A;  1I6H J;  3LSP A;  2WAQ N;  3MKL A;  5FLM J;  1W0T A;  4GFB A;  3LOC A;  5DS9 A;  1LFB A;  2JA5 J;  4LOC A;  1WGX A;  3ZQC A;  4A3D J;  1WCM J;  1QVT A;  2Y9Y A;  4M3E A;  3BR0 A;  2XSD C;  1WI3 A;  3FK7 A;  3GTJ J;  1P7J A;  3LNQ A;  4IHX A;  2E2J J;  1Z0X A;  2XB5 A;  2GM4 A;  5E3L A;  3GTO J;  2OF7 A;  1B72 A;  3PO2 J;  2R5Y A;  2ID3 A;  1Z77 A;  2E19 A;  4RBO A;  2EH3 A;  2VUM J;  4V2G A;  1JTY A;  3B6C A;  2Y9Z A;  3H0G J;  4A3G J;  2HQ5 A;  3HB9 A;  2Y30 A;  1SFO J;  3I4N J;  3SFI A;  1NK2 P;  1MBK A;  4UUT A;  4I76 A;  4D5C A;  2YU9 J;  1XS9 A;  1MBF A;  2LKX A;  1MBE A;  4D7M A;  5M5Y J;  3RKQ A;  2ECB A;  1X58 A;  1HOM A;  2FJ1 A;  1PUF A;  4IHW A;  2DA5 A;  2ME6 A;  2KDZ A;  2FQ4 A;  4AUX A;  3GTP J;  1MH3 A;  1OFC X;  4W97 A;  3M4O J;  4BXX J;  3CQZ J;  5EEA A;  3LSR A;  1IDZ A;  2HI3 A;  2EZK A;  2NVQ J;  2IAI A;  2JN6 A;  2DA1 A;  5FKK A;  3S1N J;  1IRZ A;  1UG2 A;  3BTL A;  5C44 J;  2TCT A;  5EDN A;  4A3C J;  1ITY A;  1B8I B;  2AO9 A;  2VI6 A;  4MFE A;  1HLV A;  1U78 A;  2DTZ A;  2JWT A;  1H89 C;  3HGY A;  4MLO A;  3TP3 A;  2TRT A;  4M3G A;  4DYR A;  5EZH A;  5F1J A;  1CQT A;  2XGC A;  4XID A;  3S2H J;  1IGN A;  2IBD A;  5FJ8 J;  5C4J J;  4I6Z A;  2LD5 A;  2ME0 A;  5J1U A;  2DA6 A;  3WHB A;  3FIS A;  2DN0 A;  1JJ8 C;  4DYC A;  4RDU A;  2XPW A;  3ZQH A;  3IH3 A;  1DU0 A;  4Y52 J;  2E1O A;  4HNV A;  3JRC A;  1IJW C;  2DA4 A;  2LVS A;  3DEW A;  1MNM C;  3SDG A;  4D5F A;  3JRG A;  4S0H B;  3BR5 A;  4D7N A;  2NVY J;  1GV5 A;  5E3O A;  5E3M A;  1AU7 A;  1RKT A;  3GBG A;  3A03 A;  1BL0 A;  1HCR A;  3PO3 J;  5HOD A;  3QPL A;  4BY1 J;  2HOS A;  2NVT J;  3Q0V A;  5IOY A;  3TED A;  5GP9 A;  2RAE A;  1TWA J;  1JKQ C;  1D5Y A;  1RES A;  2L7F P;  1BW6 A;  3ZOB A;  5F0H A;  2AHQ A;  2ECC A;  5IYC J;  2XGD A;  2CRG A;  3BT9 A;  5EGO A;  3TP0 A;  1ETY A;  1SAN A;  1LFU P;  4X1E A;  4B3A A;  3E7L A;  1X2N A;  5FKL A;  4XIC A;  3JR9 A;  1YRN A;  3O8G A;  1NK3 P;  4XRM A;  2K9N A;  1YRN B;  1U9N A;  4FTH A;  4V2F A;  1ZQ3 P;  4JP0 A;  1TWF J;  2WV1 A;  1FIA A;  3HBL A;  1FTT A;  1ZK8 A;  4UUS B;  1W0U A;  1BJZ A;  1JUS A;  1JTX A;  4QIW N;  3S1M J;  3HOZ J;  1VI0 A;  3CMY A;  1MSE C;  5K7Z A;  4JX5 A;  2HOT A;  4XRS A;  9ANT A;  5IYD J;  2NS7 A;  1ETQ A;  4FE4 A;  4A3J J;  4C2M J;  3ZQI A;  3O8H A;  3TW6 A;  5M5X J;  1HDP A;  2XPV A;  3WHC A;  3Q0W A;  4CYC A;  2JA8 J;  2CQQ A;  2DMN A;  3TW7 A;  1JKO C;  4FE7 A;  4CYC B;  3GTG J;  4BBR J;  1G2H A;  1XG1 A;  2DMQ A;  3BR3 A;  1DU6 A;  2E2I J;  3BQZ A;  2FX0 A;  3F0C A;  5F27 A;  2COB A;  2PMZ N;  3HKZ N;  3IV5 A;  1WPK A;  2CUE A;  2LTP A;  3RZO J;  1RET A;  2R93 J;  1B72 B;  3B6A A;  3BR6 A;  2DA7 A;  1JKP C;  1XC5 A;  3PM1 A;  4G12 A;  3H3V K;  2X48 A;  3S1Q J;  4A3F J;  1AKH B;  3QQA A;  3A01 A;  3BQY A;  2R0Q C;  2JMW A;  4FCY A;  2MGQ A;  1FTZ A;  2GBY A;  1MBJ A;  3D1N I;  4J19 A;  1S7E A;  1GV2 A;  5FKM A;  2HOA A;  1QRY A;  2K40 A;  3G1M A;  3JRD A;  3JRH A;  3HDD A;  1Q1V A;  1O4X A;  4M3F A;  4MFD A;  1GVD A;  1LE8 B;  5FKN A;  5IYB J;  5IP9 J;  5M3F J;  3OSG A;  3HM5 A;  1QVU A;  3BG3 A;  5EG0 B;  2XRL A;  2MG4 A;  5F08 A;  2MW8 A;  2X9D A;  4A3K J;  1IG7 A;  5EG0 A;  1UHS A;  5J1Y A;  4A3I J;  2N8G A;  2Y31 A;  3BTC A;  1VF9 A;  1ETW A;  2EZH A;  1TWG J;  2LFB A;  1ZGW A;  3Q0U A;  2X6O A;  2L7M P;  3C2B A;  2I10 A;  1X2M A;  2JK3 A;  1QPI A;  3NAR A;  2JJ7 A;  3Q3S A;  4DZP A;  3JRB A;  1PUF B;  1RR7 A;  2L7Z A;  2JA7 J;  2YS9 A;  1H88 C;  1FEX A;  1HF0 A;  3HOY J;  4M3B A;  1E3O C;  4BBS J;  3GTL J;  2M0C A;  1ETK A;  1U8B A;  3S1R J;  3L1P A;  1B8I A;  1BW5 A;  5FLV A;  1JJ6 C;  4JX4 A;  3S14 J;  2NS8 A;  2O9L A;  4L5E A;  2L0K A;  4A3B J;  1NTC A;  2CQX A;  2VPR A;  4C3I J;  2DJN A;  2M2E A;  5M5W J;  2W48 A;  1A6I A;  1UMQ A;  4IEJ A;  3FK6 A;  3RZD J;  1ETO A;  2HYJ A;  4C3J J;  3HOX J;  4B1R A;  2H8R A;  1ZR2 A;  1MBG A;  2R92 J;  3K2A A;  2XB0 X;  1MSF C;  1JKR C;  2D5V A;  2WB1 N;  1POG A;  3LSG A;  1U9O A;  1JUM A;  2K9Q A;  1RKW A;  2ELK A;  1ETX A;  4A3L J;  1K61 A;  2LP0 A;  3JRF A;  3ZQL A;  2K9S A;  1ZTR A;  2YUS A;  3NAU A;  5C3E J;  1MH4 A;  2NOG A;  2DMU A;  4NDL A;  2R5Y B;  2HXO A;  3RQI A;  3VPR A;  2E2H J;  5M3M J;  3JRA A;  1H8A C;  1Y1V J;  3UKG A;  2EZL A;  2M9H A;  5F04 A;  3BTJ A;  1I50 J;  2R5Z A;  1JT6 A;  4BKX A;  2Y2Z A;  4FIS A;  5JLW A;  1Y1W J;  2G0E A;  1JGG A;  3S15 J;  3M3Y J;  5F0F A;  1IV6 A;  2LR8 A;  1K83 J;  4QTR A;  4JX6 A;  3CCY A;  2H1K A;  4M3D A;  5EZG A;  3G1O A;  3DCF A;  1TWC J;  3HOV J;  3S16 J;  2KT0 A;  4Y7N J;  3GTK J;  1F43 A;  2LY9 A;  1MBH A;  2OPT A;  2HDD A;  2JA6 J;  5K7H A;  1OJL A;  5C4X J;  4DW6 A;  3JRI A;  3BG9 A;  4A93 J;  2EZI A;  3HEF A;  1GDT A;  2R7Z J;  4IHV A;  4A3E J;  2ZB9 A;  3S17 J;  3K7A J;  3IH4 A;  5F0C A;  2DMP A;  2CJJ A;  1GT0 C;  3MN2 A;  2B63 J;  5JLX A;  2ID6 A;  1AHD P;  1HDD C;  5EGO B;  2DA3 A;  1IUF A;  4BY7 J;  2O8K A;  1FJL A;  3ZQF A;  4M6V A;  5DTD A;  4X6A J;  4JYK A;  5J3L A;  1JUP A;  1T56 A;  1T33 A;  5EYR A;  1A5J A;  2XPU A;  3FIW A;  1OCT C;  1GUU A;  3G1L A;  3S2D J;  4AYB N;  2HXI A;  1LE8 A;  5IOZ A;  3OOU A;  3LSJ A;  1ENH A;  3I4M J;  1ZKG A;  1I3Q J;  4IHY A;  2MSY A;  3BG5 A;  4UUS A;  3IH2 A;  3GTQ J;  5IP7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...