3HOWJ

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3howJ00
1UG2A 4C3JJ 3OSGA 3JRAA 2EQRA 3TW6A 5EGOA 2R0QC 2LR8A 1HOMA 2DA7A 3DCFA 3PO3J 3S1RJ 3S1NJ 1JKRC 2L9RA 3RKQA 1B72A 5HODA 1W0TA 2MW8A 4A3DJ 2ID6A 1IGNA 2ME0A 4UUSA 2WAQN 2VKEA 3Q0WA 4X1EA 5M5WJ 2H1KA 1MBJA 2W48A 4A3BJ 1QPIA 1JKPC 1Z77A 1AHDP 2GBYA 2R5YA 2ZB9A 2ME6A 5FKKA 1LE8A 1WGXA 5FKOA 1Y1VJ 3S17J 3G1MA 5EYRA 4DZPA 3LSJA 5E3NA 1IG7A 1ENHA 2ECBA 3HKZN 5J1YA 1H88C 3TP0A 1UHSA 2HI3A 2X48A 3BQZA 5M5XJ 3S2DJ 5IYCJ 2CU7A 2LTPA 1JUMA 1NTCA 3ZOBA 5DTDA 3RZDJ 4XRSA 1X2MA 3JRDA 1HF0A 1YRNA 1ORKA 3BG9A 4B1RA 3JRBA 1ZGWA 2Y9YA 4A3CJ 5FLMJ 1DU6A 3PM1A 4MLOA 2XB5A 1BL0A 3HDDA 3S16J 3HM5A 3OIOA 3HBLA 5F0HA 1IC8A 1GUUA 2XRLA 4C2MJ 2CUEA 3BT9A 2HXOA 4MFDA 3GTOJ 3PO2J 1LFBA 4GFBA 1FJLA 1IUFA 4M3DA 2Y2ZA 3IV5A 3L1PA 2EZHA 3HOUJ 1MBGA 4JYKA 3F0CA 3K7AJ 2DJNA 5F0CA 4DZJA 4A3JJ 1Q1VA 5F27A 5J1UA 1JTXA 4IHYA 4D7MA 4D7NA 2JA8J 4V2GA 1I6HJ 4BY1J 3BR3A 1EF4A 2E1OA 3I4NJ 3GTMJ 4XRMA 2JJ7A 1MBHA 1FTZA 1PUFA 1H8AC 4MO7A 1ETWA 4W1UA 1OFCX 1K83J 3FK7A 1JJ8C 1JTYA 3Q3SA 2LFBA 4CYCA 4C3HJ 3BR2A 5EZHA 2XPVA 1FIAA 3IH4A 2RAEA 5EG0A 3BR1A 4XRSG 5DS9A 2HOAA 1JJ6C 1S7EA 5E3OA 3CCYA 2XPUA 4AYBN 4XIDA 2R5ZB 1A6IA 2CRGA 5K7FA 2Y9ZA 1QVTA 2JA7J 3B6AA 4A3LJ 5GP9A 1G2HA 1A5JA 1WH7A 3A02A 2K9QA 3MVPA 2Y0SN 1B8IA 3CMYA 3SFIA 4XICA 5GPCA 2M8GX 2HYJA 4A3GJ 1RKTA 2VKVA 4QSHA 3JR9A 2D5VA 1FIPA 2O9LA 2VPRA 2EZLA 2E2IJ 3H0GJ 2XGCA 1QRYA 3FIWA 1T33A 4JX6A 3GTGJ 4QIWN 3HOYJ 1MNMC 1CQTA 2IBDA 2YU9J 1TWAJ 4XK4A 1IDZA 3GTKJ 4A69C 1MBEA 3C2BA 1F36A 3LSPA 5EGOB 1RETA 3RZOJ 4RDUA 2DA3A 3OOUA 2R7ZJ 2WB1N 1AU7A 2DMQA 5GPAA 1HDDC 2B63J 3S15J 2E2HJ 3JRIA 2L7ZA 3CDLA 5FLVA 1BW5A 2DA4A 3HB9A 4QTRA 2R5YB 1TWGJ 4D5CA 3TEDA 1RKWA 2O8KA 1OCPA 1LE8B 3IH2A 4L5EA 2ECCA 3RQIA 5IYBJ 3ZQHA 5FKMA 2JA5J 2DMTA 2OF7A 3DEWA 1TC3C 2LKXA 1D5YA 1BJZA 4A3FJ 4BY7J 3HOXJ 3SJMA 2HXIA 5EZGA 3ZQCA 3G1OA 2VI6A 2LD5A 4S0HB 2M34A 1P7IA 2COBA 2FQ4A 2G0EA 2PMZN 1NK2P 1YRNB 2DMUA 3QPLA 1ZR2A 2JA6J 3A01A 4FE4A 5JLWA 2DA1A 2VUMJ 4Y7NJ 2JN6A 3JRGA 4Y52J 3MKLA 3S14J 2TRTA 1JKQC 1QVUA 1SANA 3LOCA 4RBOA 1GDTA 3G1LA 2JMWA 1MSEC 4FE7A 3BG5A 3FKIJ 3WHBA 2R93J 4HNVA 3FK6A 2NVQJ 1R9TJ 3Q0VA 1APLC 2LP0A 3WHCA 1RESA 5EF6A 5JLXA 4DYRA 2KDZA 2QCOA 1I50J 2MG4A 1ZK8A 3GTJJ 1MBKA 3FISA 1ETQA 1OCTC 5K7ZA 1VF9A 2LLKA 5J3LA 2IEKA 2Y31A 4MIMA 2JWTA 1LFUP 2NVYJ 2GLOA 4LOCA 1AKHA 5E3MA 2JK3A 2XSDC 1T56A 1WCMJ 3OSFA 2MSYA 2EZIA 4A3IJ 2DTZA 1X2NA 2DMPA 3BTJA 4IHXA 2ELKA 1PUFB 1JGGA 2YUSA 1POGA 9ANTA 3BQYA 4DW6A 1VI0A 2NS7A 3M3YJ 5J1RA 1U9OA 1FEXA 1P7JA 1VNDA 3MN2A 3QQAA 5EG0B 4C3IJ 4X6AJ 5M3MJ 5IOZA 1Y1WJ 4V2FA 5F0FA 1F43A 1GVDA 1ETOA 3LSRA 4I76A 3NAUA 3B6CA 2DA6A 2HQ5A 2R5ZA 1HDPA 2AO9A 3LSGA 1MH4A 5IP9J 5C44J 2KT0A 1RR7A 3JRHA 3ZQLA 2YS9A 2O7OA 3BTCA 1ZTRA 3UKGA 2WV1A 1B8IB 3IH3A 4M3BA 1ZKGA 2NVTJ 2CUFA 1MH3A 2R92J 2DA5A 1U9NA 5F1JA 5F04A 1TWHJ 4I6ZA 4JX4A 3W6VA 3BTLA 4NDLA 3HGYA 1ZQ3P 4FTHA 2AHQA 2XPWA 1B72B 3E7LA 5FJ8J 2H8RA 4UUSB 1U78A 4MFEA 2IAIA 1DU0A 4M3FA 1U8BA 1O4XA 1JKOC 1OJLA 1XS9A 1IDYA 2MGQA 1WH5A 5M5YJ 3CQZJ 2FX0A 3BR5A 1ITYA 5FKLA 3O8HA 2EZKA 1W0UA 1UMQA 1XG1A 2M0CA 2HDDA 2X9DA 4G12A 1JT0A 4IEJA 3ZQGA 2M9HA 3ZQFA 3BR6A 2TCTA 2FD5A 5EDNA 3Q0UA 2HOTA 3H3VK 3M4OJ 5IP6A 5IPAA 4B3AA 5IYDJ 2OPTA 5M3FJ 4J19A 2DMNA 1E3OC 1Z0XA 5IP7J 2Y30A 3K2AA 4AC0A 2QF7A 1ETXA 1VFCA 1IRZA 3TP3A 1RPWA 2N8GA 1SFOJ 4UUTA 5C4XJ 4BBSJ 4AUXA 1JT6A 3A01B 3TW7A 3GTLJ 2E2JJ 5C3EJ 4M6VA 3BG3A 2HOSA 2X6OA 1WPKA 2XGDA 1TWFJ 1MBFA 3JRCA 4A3EJ 3JREA 4FISA 3HEFA 1K61A 3HGGA 4EEFG 3HOWJ 4BXXJ 1ETYA 1WI3A 1JUSA 1MSFC 3HOZJ 1I3QJ 3I4MJ 4DYCA 1FTTA 2L0KA 3O8GA 5K7HA 4JX5A 5BNGA 5EEAA 2L7FP 3GTQJ 1BW6A 2EBIA 1ETVA 4BKXA 1H89C 1GV5A 2XGEA 1HCRA 3S2HJ 1NK3P 5E3LA 3BR0A 2DN0A 3JRFA 1JUPA 2K9NA 1AKHB 3GTPJ 5FKNA 3QPSA 4A3KJ 2LK2A 2CQQA 4A3MJ 2K9SA 1X58A 3D1NI 3LNQA 2P81A 4D5FA 2DA2A 1XC5A 4BBRJ 4CYCB 2CJJA 4JP0A 2M2EA 2CQXA 4W97A 2L7MP 2E19A 4B4CA 4DYQA 4IHWA 3ZQIA 3VPRA 1GV2A 4A93J 2FJ1A 2LY9A 2ID3A 2NOGA 3HOVJ 1GT0C 3SDGA 3GBGA 3A03A 1ZR4A 3NARA 1ETKA 1BA5A 5F08A 4FCYA 3S1MJ 4M3GA 2I10A 1HLVA 4M3EA 1IV6A 5C4JJ 2LVSA 2NVXJ 2NS8A 2K40A 3S1QJ 4ABZA 2GM4A 2XB0X 2EH3A 5IOYA 3BTIA 4IHVA 1IJWC 1TWCJ
chains in the Genus database with same CATH superfamily
4C3JJ 2W4SA 3DTKA 1N25A 4AVZA 1FT9A 1HOMA 3DCFA 3S1RJ 2VE8A 1B72A 1P4AA 2EB7A 2PFBA 5HOOA 2P8TA 1ZRCA 1QA6A 2IGNA 2EV0A 2H6CA 1B1BA 2O3FA 1KONA 2BEOA 4BXUA 2H1KA 1U5TA 5ICGA 2E1CA 4PSXA 1Z77A 3TOBA 3SFZA 2GBYA 4RB1A 4G7OF 3CP2A 3S17J 2VT2A 2VKDA 3C3WA 3I55I 1BOBA 3EYYA 1ENHA 1B9NA 4ZYDA 1UHSA 4XKBA 2HI3A 1PVEA 1VQOI 1OMIA 3OYMA 3NWSA 4EMSA 1DUXC 1JUMA 4M6XA 1NTCA 2QSHX 3AG1H 2PQ8A 3P7NA 4XRSA 1HF0A 4F55A 2A5YB 3WGGA 1BR2A 4RB2C 3GZ6A 2WB1A 1CF7B 2AQFA 3A2KA 4XBFA 2WV0A 2Y9YA 3OV8A 2M1BA 2GAUA 4XKCA 3CMAI 4YIIA 3RIRA 3E1SA 4G9YA 3DTIA 5FLMJ 1DU6A 4EM0B 1WSUA 2KIFA 4HF0A 3OYGA 2XB5A 5JR3A 5FLXZ 3EUKL 2DT7B 3HDDA 3OIOA 5F0HA 3T8RA 1SFEA 1IC8A 4HV6A 4PUSA 4BH9A 2ZO4A 1FZPB 2H1LA 4C2MJ 3CMMA 3WGIA 1SMTA 2DOAA 2OAZA 4OIQF 2BZTA 2R3SA 1FJLA 5LD2C 1Z7UA 4PCQA 3U9GA 1SFXA 3HOUJ 5HNHA 3F0CA 1B4AA 2W00A 4NC7A 5F27A 3OYJA 3J7ZI 2JA8J 3DEEA 5K5OA 2E1OA 3SEZA 3GXOA 3I4NJ 3DU6A 3GTMJ 1RZ4A 2EIKH 4HNTA 1YW9A 3KEQA 1CGPA 1SAXA 1PUFA 1H8AC 4W1UA 1V3FA 2VT3A 2Z2SB 4KIBA 1XCVA 3K4JA 1JTYA 5ILSA 4CYCA 4C3HJ 3Q9VA 1IN6A 2FOKA 5EZHA 1KQ8A 1FIAA 2RAEA 3SDBA 5EG0A 2WC2A 1R1VA 4XRSG 1L3LA 2QA4I 3HZJA 2IA1A 1JJ6C 1YHQI 2Q2EA 2XPUA 2MD0A 5D5XB 4AYBN 2HR3A 2Z1DA 4RLQA 3HUGB 1V55H 5K7FA 2RV8A 5CVRA 3B6AA 2DOFA 3DLAA 5GP9A 1G2HA 1R7JA 3CDHA 1XGSA 4XKVA 3CO6C 1Z1DA 3KPHA 3UR3C 4G6QA 4MQ9F 3SFIA 4S05A 3CMYA 3HG9A 1K78B 2M8GX 2HYJA 4I01A 5K1YA 4U88A 2JTVA 2YX7A 1BBYA 4CA0A 2VKVA 3H35A 2VPRA 4C9YA 2XUBA 4OMYA 2DYRH 1YW8A 3T1BA 1T33A 3QPHA 1PP7U 1ZGJA 4C2UA 3K10A 4UUVA 1TWAJ 2ADUA 1UZCA 3BY6A 5E18F 2E34A 3LFKA 2O5RA 1IDZA 3WG7H 1F36A 5GAEJ 2STTA 3CUOA 2HS5A 3HYIA 4A6DA 3RZOJ 4HX8A 2DA3A 2R7ZJ 3K6GA 2EV5A 3E5UA 2IGMA 2DMQA 5GPAA 2FBKA 2E2HJ 1XSVA 2GIZA 2QENA 3BOQA 3QAHA 4PK4A 2JVHA 3DPUA 3OS0A 3CDLA 3J81K 3KZZA 3KX2A 2Z99A 4IX7A 2HQRA 1LUJB 3HC7A 4LGWA 4D5CA 3TEDA 1RKWA 2O8KA 1LE8B 3IH2A 4C30A 4L5EA 1YX5A 3FBIB 5IYBJ 3L2VA 4M6YA 2QSFX 2HFHA 1ON1A 5FKMA 2A68F 3U21A 1I39A 1KQ9A 2OF7A 2JA5J 3DEWA 2DFHA 2LKXA 1BJZA 4A3FJ 2F4OB 4BY7J 3WTUC 2HXIA 1WKMA 4HAMA 2NS0A 2XSJC 3G1OA 1VQLI 4L9NA 2M34A 2FQ4A 2W85A 2GOMA 2PMZN 3GF2A 1YRNB 2DPDA 2ZFWA 5DD4A 4NQWA 3CCJI 1O3TA 2PJPA 4OU0A 4IHSA 3IP4B 2F2EA 5FLXK 4Y7NJ 1QPMA 5HLHA 2JN6A 3CC4I 2M4GA 3FWEA 3MKLA 3CJQB 3V8LA 1F4KA 1IN8A 2OBPA 2ZSHB 2ZCWA 2KRCA 3L09A 2YU3A 2DBBA 2DJIA 2LREA 3OMYA 1SC7A 4HEA2 3BG6A 1ZK8A 2IGOA 2WA0A 4A6EA 3LQQA 3PSFA 4FX0A 1Z3YA 4P9FA 4XKWA 5ICEA 2VBWA 4KMUX 5J3LA 3O2PE 3WTSC 1FYKA 1D8KA 2NVYJ 1TQIA 5AIPA 4O3MA 1IF1A 1WJDA 3EUHA 5IY5H 1MIJA 4BHCA 2VKHA 1WQ2A 2LY1A 4A3IJ 3BP8A 2DTZA 1FMVA 1X2NA 2P6TA 3OYLA 3H5NA 4IHXA 2M45A 4E7JA 4B09A 4LK0F 3CD6I 1Z9CA 2FE3A 2MBFA 1ONVA 2DCEA 3E6MA 3ISPA 3HPHA 5ILVA 3K4NA 2NS7A 1X4OA 1T08B 3AL0C 1EH7A 1FEXA 2ESNA 3HTUA 4S04A 1R1TA 2AXTC 3QQAA 4IPAA 4UB6C 5IOZA 1Y1WJ 2ESHA 2FXAA 2Z5UA 2EWNA 1UG0A 4BE2A 1XTAA 3B6CA 2HQ5A 4UV8A 3WU2C 2DDAA 2HOEA 1IV8A 4XLNF 4P5OA 2EIMH 3GX4X 2IRFG 2KT0A 4K2EA 3JRHA 5B5EC 3ESWB 2OC6A 4GCVA 3BTCA 1ZTRA 3OYEA 3UKGA 2W82A 4LB6B 1MW7A 3PQJA 2PEXA 1B8IB 3F8FA 2F6CA 5IT3A 2LF7A 2CUFA 2BW3A 3QU6A 1X1BA 3FM5A 1ZLKA 4F7ZA 4BQAA 1LQ1A 1TWHJ 1LDDA 3HGYA 3H1CA 4I98B 4EATA 2XKOA 3HSRA 2VOOA 1TLHB 4OWRB 1U78A 4MFEA 3TBIA 4M3FA 1LVKA 1O4XA 3FM3A 4QWQA 4ZYAA 3WTTC 4WXDA 2JT1A 3F8CA 4CCOA 4EGZA 2QQ9A 2ZXIA 2QWWA 5LFAA 5HDGA 2EZKA 1W0UA 1UMQA 4ZYHA 4A5MA 3QP6A 2QSGX 1E0EA 1QZZA 3T0YA 2X9DA 1Y8RB 2P5VA 1GLNA 2CMPA 3BR6A 5EDNA 3OIPA 2ISYA 4Q4ZF 1UELB 3M4OJ 1G6NA 1D1AA 1FOYA 1OCZH 5CVIA 4J19A 2DMNA 3K4CA 3A0HC 3WTYC 3CUQB 4MGRA 3PUBA 2MC3A 2WAQA 4H0EA 3I4PA 3TP3A 2VLAA 4GYGA 2W57A 2XROA 1SFOJ 4AIDA 4IL6C 4ZZDA 4BBSJ 1JT6A 3ECHA 2R7WA 1ZG1A 4NB5A 1H9TA 3H36A 1B6AA 3GTLJ 3FKJA 4ASNA 3M8EA 2E2JJ 2V1XA 4M6VA 2R7XA 4MEYF 4FQGA 1KU2A 1P6RA 2XGDA 3HKZA 3VEPA 2IT0A 4XONA 3RCOA 4U87A 4L5IA 2FUG2 4FISA 2I8DA 1K61A 1UB9A 3G6EI 2UWMA 3GFLA 5CYVA 4ON0A 1MDMB 1FX7A 2VQLA 2Y69H 2K4JA 3QP5A 3DXJF 2GA1A 3I4MJ 2QZ8A 2XIGA 4L0YB 5K7HA 3O8GA 1G4DA 5BNGA 1YOVB 5HVQC 1AWCA 3ZGKA 1W5TA 2EBIA 1H89C 2JRTA 2HDCA 3QYFA 5JVGF 1JUPA 2XDVA 3E0JB 4I7HA 5FKNA 1P4XA 3QPSA 2EFWA 3IWZA 2OZ6A 4ENMA 4XN0A 3CCLI 2M8EA 4XSXF 1V5GA 1XN7A 2NAZA 2L02A 4QPOA 4BQQA 4D5FA 3O3KA 2MA3A 1YE9A 3F6VA 3VYUB 1Y6IA 1SAUA 1XSDA 4B4CA 2XRNA 3ZQIA 2R7QA 2VC0A 1X1AA 3VPRA 1XGMA 2A3SA 2KKOA 3ZN0A 4UXNA 4BGDA 3DKWA 3EYIA 2COMA 2RREA 4PFPA 3RQ4A 1H0MA 1N78A 1ZH5A 1TW2A 1WJFA 3KP2A 4E7ZA 4GGGA 4XSZF 4BS9A 4BUPA 3LQRA 2X6XA 2GOXB 3FXMA 4U0VA 3NARA 2QQAA 4XOPA 3E5XA 2BOLA 4A5NA 1XPXA 3TDZC 4IZZA 2XC7A 2LNBA 3F6OA 2EFQA 2NYXA 1HLVA 2BBYA 5FFZA 2DW4A 2QBYA 2NS8A 3BPVA 2L9VA 5BQTA 2XB0X 3KE2A 3JW4A 1ERDA 5IOYA 2LRDA 3BTIA 1TWCJ 1Z3XA 3T8TA 3JRAA 2EQRA 3N97A 2Z33A 2R0QC 3K0LA 2HKOA 4CYDA 3SHFA 3F9KA 3RKQA 3DBHB 3J7AO 3S1NJ 2HPIA 4XLCA 3DLLF 2CV0A 4UUSA 3S93A 2LDUA 4X1EA 5M5WJ 2ISZA 4A3BJ 1JKPC 3CJRB 2V6EA 4P1WA 2R5YA 2ME6A 4HRIA 3TMOA 3N05A 1MJ9A 5FKOA 4L9JA 2NNYA 5BMZA 4U0WA 4E6KG 2VODA 3OYKA 4L9VA 5ICFA 1U3EM 1ZAOA 3I56I 3TGNA 4AM3A 2E36A 1S7OA 3BQZA 3ULQB 5M5XJ 1S8NA 3ZP5A 2EFNA 2OD5A 2R7TA 2LTPA 5TGTA 3VDXA 1KU9A 1X2MA 3ELKA 3CLOA 2RQPA 3PL8A 5CQEA 2DT5A 1ORKA 2QVOA 2X85A 3JRBA 1ZGWA 2AQEA 2ZJRF 2DLLA 3BJAA 1MNEA 4A3CJ 4KNYA 2E7WA 5E8IA 1VQ7I 3HOSA 3PM1A 4MLOA 2HU9A 3MWMA 2DT6A 1BL0A 3S16J 3HBLA 1K4TA 3C2GA 4L18B 3EQLF 2BY3A 2EA4A 3P9IA 2DAOA 2M0MA 3HPGA 2ZJQF 3BT9A 2KQRA 3PO2J 3GTOJ 4HYEA 1LFBA 4RM2A 1GHCA 3G71I 1Y39A 2LOOA 3H0DA 3WTZA 3L1PA 2HTSA 4HZFA 2DJNA 4A3JJ 3QRFF 1Q1VA 1JTXA 4IHYA 1NG6A 4F3QA 4OMZA 5E17F 2UXXA 5JHUA 2Y48A 1SFUA 2L54A 4V2GA 4BAYA 3C1DA 3BR3A 4PDKA 4II3A 2ZXJA 2DQLA 1MMAA 1Z6RA 3CO7C 5CQGA 4DBQA 2OUMA 4BU2A 1R6RA 4DJAA 5F1RA 2ELJA 1ETWA 3K9TA 3F8BA 1FY7A 1OFCX 3CF2A 2UV1A 3FK7A 2B7EA 2OV7A 2OQRA 2QGUA 5ED4A 2R7RA 5HLIA 3BR2A 2XPVA 3L2QA 3BR1A 4IXAA 3TQNA 2DYSH 4MHGA 2KFDA 1LJ9A 2KRFA 3BPXA 4E7LA 2ZMEB 5E3OA 1E2XA 2JZYA 2O61A 4ZYGA 2R5ZB 4B47A 1QVTA 2JA7J 5EJCA 3E5QA 2RVCA 3I59A 5LRRA 3DP7A 5LHGA 3OYIA 1A5JA 2BHYA 2VJ5A 3NQOA 1ZRDA 3MVPA 4KFCA 4XICA 3FBNB 2A6HF 2QQBA 2LBFA 1YG2A 1R4MB 2FQ3A 2E35A 4XLFA 3TKYA 4HW0A 1FIPA 3AG2H 3PSIA 1P2FA 3FDYA 3PJRA 2R7UA 4HV5A 3H5RA 1QHHD 2R7VA 3FIWA 1J0RA 5DYMA 3HOYJ 3TO6A 4X0GA 3ONQA 4L9TA 1VQ4I 3W3CA 1IN4A 2BE5F 2ZNYA 1XB4A 3C2BA 3FMSA 3LSPA 4YFXF 4PGHA 1DGWY 4KITB 2NNNA 5FD5A 1T2KA 1VQ5I 2WB1N 1YTYA 4HBLA 1AU7A 1DDNA 1HDDC 3S15J 4MTDA 2D1VA 5D8KB 1JE8A 2I5UA 3DF8A 1HKTA 1U5TB 1X3ZB 2HVRA 3I3LA 4XMYA 5FLVA 3DQVC 1BW5A 2PJRB 4QTRA 4ZTFA 3WE3A 4CZCA 5L3CA 4E7HA 4A2UA 2ECCA 1ZYRF 3RQIA 5K5RA 2XAHA 1EV7A 2GA2A 3AFHA 2H09A 1T98A 2XHKA 1MJAA 2FNAA 1SD4A 1VQ9I 3M7GA 4E70A 1NHAA 1Z6TA 1FBSA 3GFJA 2A6TA 5EZGA 3U1KA 3ZMDA 1J75A 3PIPF 3RSNA 1ZLJA 3R0AA 2MH9A 2HNHA 1P7IA 3F21A 4M71A 4LG3A 2R7OA 3CCQI 4BJ6C 2B9SA 1W7PD 4QLCU 4XM3A 5L3DA 4Y52J 2K02A 4DOZA 1D8JA 1TQMA 1QVUA 3CCVI 3LOCA 4RBOA 1BIAA 3FKIJ 3WHBA 2R93J 4HNVA 3FK6A 2NVQJ 1R9TJ 3WHCA 2KDZA 1I50J 1D0ZA 1FWZA 1YW7A 2DFFA 3TDUC 3FISA 3VYRB 1LFUP 4N9IA 2IEKA 3FXUA 4KT5C 4L5JA 2OCCH 4DBRA 2JK3A 3E97A 4CSWA 3CESA 5EEGA 4MQVA 2EINH 4JOMA 2V1UA 1WJBA 3EDPA 2MSYA 1BI1A 2EZIA 2F5CA 4E7IA 2PN6A 2VOPA 4CCJA 1STZA 2XAJA 2A61A 4PJ0C 3BTJA 5LLQA 3HOTA 2VQGA 1PUFB 1VQMI 5LGUA 2VQCA 1S3JA 3P5JA 4HOBA 1UFMA 2ZNZA 2P7VB 4XLHA 1V4RA 9ANTA 2G9WA 4DW6A 3C18A 1VI0A 2FBHA 2OU2A 1A36A 2AS5F 1U9OA 4JBAA 1XDSA 5H6QA 2F5EA 3LA2A 3L2WA 5EG0B 2K3FA 1Y56A 5F0FA 3DBLB 3IC7A 2H6BA 2RNJA 1ACIA 2DODA 4I76A 4YFNF 2W1OA 2A5WA 2P5KA 5FO5A 5J40A 1ZGAA 2X6WA 1KYZA 2O0YA 2VASA 4ZTJA 3LSGA 4ETSA 1KYWA 1UHMA 2FSWA 1XMKA 3IKVA 4RS8A 3ZQLA 2YS9A 3DPTA 4EJWA 3OYBA 5TJJA 3RYPA 4A0ZA 4Y3OA 5K5QA 4EM2A 4RAGA 3GO5A 2HPMA 2Z3YA 3EUHC 1RR8C 4CZZA 2R92J 2DA5A 5B3SH 3R60A 5F04A 4I6ZA 4GXOA 1BI3A 3BTLA 2XPWA 2E60A 3GZ5A 3QODA 4P96A 4AU7A 3K1NA 2ELHA 3KP7A 2K9MA 4WXCA 3RKWA 2VBYA 3DTEA 2X1DA 1OLTA 2GQQA 2MGQA 4ITVA 3RPQA 1T95A 3CQZJ 1O3SA 1ITYA 3BR5A 4D9JA 3OR2C 2PLYA 1HC8A 5BPIA 3OYHA 2CGPA 2PX9A 2UZKA 5HS8A 2HDDA 4NHJA 2L4MA 3F72A 4Q5SF 1X4PA 1QU3A 5E1WA 2KIQA 5J4YA 3BCBA 2VL8A 1AOYA 3I71A 3Q0UA 3M8FA 1D3YA 3RKYA 3ZRGA 5IP6A 2CQNA 3CP8A 1ODDA 5IPAA 5DM7F 2HQNA 2OPTA 5DD8A 4G6DA 5M3FJ 3GLXA 1E3OC 3AG3H 4IQJA 1REPC 1ZELA 3KZIC 4R8HA 5IP7J 4ZC3A 4ESBA 3OYAA 3BJOA 2Y30A 4AC0A 1VFCA 3IAM2 2ZJPF 4JK1X 2M5WA 5BS6A 3KYDB 1VQPI 3M8JA 4NQWB 3EUAA 4UNOA 4EQQA 2DOEA 3KYLA 2STWA 1EA3A 1O3RA 2A07F 3QYEA 5C3EJ 2HVSA 2VQHA 2FRHA 1WPKA 1W7PB 4G7HF 4RGRA 1TWFJ 2X1CA 5CPRB 4OIRF 3JRCA 1O7FA 3HEFA 3HGGA 4LJZF 2P0WA 3HOWJ 3ROUA 2UXNA 3HXLA 1ETYA 2W25A 1LFPA 3E3VA 4KA4A 1JUSA 1MSFC 1C0WA 4HSTA 3I54A 2L0KA 1IO2A 3H9QA 3Q9SA 5A2QZ 1ETVA 3MQ0A 3S2HJ 2XGEA 1HCRA 3L7WA 4MNUA 5E3LA 3BR0A 5E20A 2K9NA 4YFKF 5F64A 2MYSA 4LMYA 2CQQA 3G2BA 1F1ZA 4BNCA 4PJLA 1FBUA 2K9SA 4PZJA 2M30A 5AONA 2DA2A 1V5FA 4EJOA 5JHFA 3IAS2 2CJJA 3JTHA 4IRIA 4OIOF 1D0XA 1LDKB 2DI3A 2DDBA 5LGNA 2L7MP 2BXYA 1FYLA 3VSLA 4IHWA 3DEUA 5D4SA 4EJTA 2YX4A 1J9IA 5CVUA 3LSMA 2P6SA 3QWLA 2LSOA 1NH3A 2LY9A 2ID3A 4NNJA 3G3ZA 3PNTA 4LFUA 4NBQA 3VFZA 2KHMA 3D5SC 1QHGA 4CUGA 2XV4S 1X3WB 2V1NA 1RUOA 1BOAA 4IJAA 4CCLA 4IOAF 4HNUA 2OQGA 4GDFA 4FCYA 3IRRA 3S1MJ 3SYTA 4ESFA 5C4JJ 1Z21A 1X1PA 1TBXA 3JTGA 4CDGA 1R00A 3CTAA 2KDOA 4I0AA 2QKLB 3UNGC 4XQFA 4M9ZA 2GM4A 1J59A 3D0SA 1SD7A 2BW3B 4IHVA 1IJWC 1W5SA 4LLGF 1DP7P 1IXRC 5EGOA 4Y15A 3OYFA 3VYTB 1FNNA 2LR8A 1QZYA 3HJEA 2L9RA 1JHHA 5H20A 2JPBA 5HODA 1W0TA 2V9PA 4A3DJ 2ID6A 2BY1A 2OZUA 3ABUA 2ME0A 1IGNA 2FEZA 1R58A 5LBQA 3M1EA 2WAQN 3GCMA 4HQMA 3JSPA 2JSPA 1TNTA 5TISC 1HSJA 2K5CA 3Q0WA 4N4NB 2Y0SA 1QPIA 3S2WA 1R49A 1AHDP 1TT5B 2ZB9A 3KLOA 5FKKA 1QO0D 1Y1VJ 4AIHA 1RUNA 4N0BA 2OCEA 5EYRA 4DZPA 3CJNA 5E3NA 1IG7A 2GIVA 3RYRA 2V9KA 2CW8A 2ECBA 2HKXA 3DKXA 3HKZN 5J1YA 3OS1A 4BDYA 1W36D 2E1MC 4FHTA 2CW0F 2K3PA 1H88C 2CU7A 3HRSA 1TQPA 3DBRB 3ZOBA 5HLTA 1E3PA 3CCMI 3RZDJ 3JRDA 1K6OA 3J7YJ 2P5LC 3S32A 2V26A 3BG9A 4BXFA 1YLFA 3GYHX 4IOCF 2ZSIB 3L2CA 3VODA 1OCRH 4RB0A 2F5DA 5L3BA 3AL0B 2IJLA 1MJBA 3CDIA 3HRMA 4PGGA 5JVTA 1GVJA 3CJTB 3QOEA 4GYIA 3K70C 2GXGA 2MLGA 3HM5A 1X3UA 3RI4A 4F92B 2EV6A 3B73A 3ZR8X 1BC8C 1S5LC 2EA2A 4F91B 3G4SI 2EILH 1I6XA 2XRLA 1QGPA 4MFDA 2HDWA 3OWTA 2E7XA 4GFBA 1IUFA 4M3DA 3VYSB 2KJBA 2EZHA 1MBGA 1YJNI 1OISA 3HTSB 5F0CA 2EJRA 4RLFA 5HDNA 3EPZA 4WXHA 2KIUA 5J8CA 2ZXHA 3JAMZ 1SD6A 4D7MA 4OAZA 4D7NA 3H9GA 3SZPA 5GTHC 2PMUA 4BY1J 2E1NA 1G3TA 2FF4A 1T38A 1EF4A 2KP6A 2RC4A 4E7KA 4MTEA 4XRMA 2BY0A 2KZGA 1E3HA 3I9V2 4L0ZB 1RI7A 2V9VA 3JCUC 1FTZA 1W36C 1OCCH 4BE0A 4G6TB 3ASOH 3I0TA 5FD6A 4XLAA 2HTJA 3MD2A 3OS2A 3I53A 1OCOH 3OIQA 2DQRA 3ERMA 4AD9A 3K4LA 3W2WA 3IHUA 2LFBA 3PUFA 3CMEI 1L0OC 4KUMA 1XCBA 2BGCA 2HZTA 1HKSA 1O7LA 5D6EA 3NRVA 1U8RA 3MCZA 1UAAA 5E79C 4RB3C 2HYFA 1YIOA 1BM9A 1K7AA 2F4IA 1VQ8I 5DS9A 1P92A 2HOAA 5GAGJ 1N77A 1S7EA 3CCYA 2ZBKA 4XIDA 4YRVA 5BOXA 1IXSB 2JPCA 2CRGA 1ON2A 1YITI 2F4MB 3COAC 4A3LJ 3OYCA 4C2TA 4E4HA 1AA7A 3R0JA 1XGNA 4Y4RA 3OYNA 4AIJA 2ZKZA 3A02A 5KK1A 3W6JB 5LHIA 1FPQA 1HXDA 1R5ID 1G3YA 1SVLA 2BXZA 4A3GJ 3JR9A 2D5VA 1A31A 3H0GJ 3I5UA 2XGCA 3LSTA 4YEJA 3ZMZA 2A6EF 3D5RC 1G8XA 1XMXA 4AVPA 3WU1B 4HDVA 3RJPA 2NXNB 3ABKH 4JX6A 3GTGJ 3V4GA 3IRQA 2EK5A 4XR6A 1CQTA 2IBDA 2YU9J 2LC2A 4XK4A 3LAPA 4CHUA 3R61A 2IS2A 3GTKJ 4A69C 2RNGA 1MBEA 2LYCA 2CV1A 2NRAC 3FZVA 2CWEA 3B02A 4RDUA 2OTJI 3R4KA 4UVAA 2DFEA 1S72I 4KYWA 1OYYA 4R1HA 2O6GE 2IP2A 3JRIA 3P9CA 1P9QC 4OOIA 1W1WE 2WWYA 3BZ6A 1ZHFA 3SXYA 3MKYB 3V8JA 4RMNA 2R5YB 1OCPA 2D45A 2X1EA 3A1YA 1FOXA 3KZYA 3ZQHA 1FMWA 1OR7C 1Y0UA 4PJNA 5HDKA 5J6XA 1D5YA 4BJ5C 1U6GA 2CUZA 4BYYA 4LIVA 3CC2I 1LVAA 2NOJB 2HVQA 2DTRA 3SJMA 2CO5A 3ZQCA 4AWXB 2OJED 3FXLA 2VI6A 3KLNA 1VQKI 5B1BH 3ZMVA 2LD5A 4S0HB 1S7AA 3BWGA 3DPLC 1VQNI 2COBA 1NK2P 3E6DA 4BEHA 2DMUA 3EETA 3QPLA 1ZR2A 4H4KC 3V7RA 1U2WA 3A01A 5D5WB 1YQAA 1N75A 3RTRA 2DA1A 2KMUA 4IF4A 1FSEA 2BV6A 4RM3A 2TRTA 4D0PA 4KIFA 4HX7A 1SANA 4LG0B 1GDTA 3DU5A 3DKYA 3G1LA 2G7HA 3KEYA 2QYOA 4N4OB 3Q0VA 2HYGD 3WGHA 1APLC 5JLXA 4HX4A 3DFGA 2XAUA 5HS9A 1KU3A 1TW3A 3GW2A 1OCTC 4KT6A 5FROA 1VF9A 5KAIC 5K7ZA 2CW7A 2Y31A 3PNVA 4I09A 1UJ8A 2GLOA 2C6YA 2CFOA 4JQFA 5DCMB 5E3MA 1AKHA 2KJCA 4J00A 2IPQX 2XSDC 2FNPA 1T56A 4ANJA 3F23A 3V7CA 1SFKA 1YI2I 2GXAA 1W4MA 1LEAA 2DMPA 2KPMA 4RAZA 3PQKA 2ELKA 2WTEA 2AXLA 3OY9A 1MGTA 2YUSA 4Z2YA 1POGA 1G59A 5DM6F 4M73A 2QM3A 1R23A 4F93B 4WX9A 3FXKA 3ML6A 2ZJ2A 4EV0A 1P7JA 2H8WA 3BC8A 3LAJA 4C3IJ 4B43A 3HL2A 4D1QA 1YO5C 4HF2A 1F43A 1ETOA 3BROA 1OR7A 1VZ0A 3GVAA 3LSRA 2FMYA 3ASNH 1LPQA 2ZMEA 3M9AA 2ZXWH 2R5ZA 2RN7A 4Z6YA 2W24A 4DNCA 1HDPA 2MABA 4F52A 4ENJA 4WWCA 1MH4A 5IP9J 5C44J 1RR7A 2L5QA 3GEZA 4UVCA 2WADA 5LEJA 3E6BA 2XF6A 1I1GA 4UVBA 2MH2A 2L9SA 2XKPA 4M3BA 2LBFB 3MZHA 5FRMA 3MKWB 1ZKGA 2RKHA 3FX3A 2VN2A 4DGWB 3IUOA 3ZMSA 1U9NA 5D8LB 1QNTA 1BC7C 3IWFA 3W6VA 4JX4A 1ZQ3P 4NDLA 3ZCOA 5AIQA 4LK1F 2AHQA 3SQNA 1B72B 2K9LA 1S6LA 2VJ4A 4IO9F 3A4CA 4KIGA 5CVJA 3ZPLA 2MLKA 3FXRA 1D1BA 1JKOC 3PFIA 1XS9A 1WH5A 4DIQA 5M5YJ 4RA2A 2VBXA 2FX0A 4ZH4F 4O6JA 4OAYA 5FKLA 3O8HA 3BJ6A 4HLYA 1GXPA 1XG1A 1PP8F 3J80Z 4MEXF 2V1DA 3CCRI 2JSCA 2ETHA 4G12A 1QZEA 2PJRA 1SD5A 2CQKA 3K4MA 5LGTA 2LKPA 3ZQGA 3ZQFA 4FT8A 2TCTA 1ZG3A 3J81Z 3LA3A 2QQ8A 2VONA 3H3VK 4B3AA 2K27A 4B44A 3L9FA 3T5XA 2IS4A 1Z0XA 3K2ZA 1CF7A 4BACA 2QF7A 1IRZA 1FC3A 5DUIA 1IUYA 2CSOA 2LMDA 1XSXA 3U1DA 5C4XJ 4AUXA 1HBXG 3VB2A 3K69A 2UUZA 5LRSA 1Y8QB 2L4AA 4G94A 1DPUA 3M1CA 1FYMA 2HOSA 2A69F 2GXBA 4OIPF 1YS6A 2TDXA 1EKEA 1MBFA 3HHHA 1D0YA 3BCAA 2CV2A 4A3EJ 4YG2F 4A0YA 1P4WA 3KIOA 3Q5FA 1SMYF 4LB5A 3J7AY 5LEKA 1EJ9A 4XOTA 5ERIA 4EEFG 3W6KB 1SEUA 5CLSA 1QBJA 1WI3A 2HGCA 1ZARA 5EEHA 3ZN1A 3HOZJ 2H27A 1I3QJ 2Q8KA 1TT0A 5DEQA 1FTTA 3F3XA 2NVUB 4JX5A 3GZNB 4OINF 3MFKA 1E17A 1T0FA 1BW6A 4BKXA 1IXCA 2V6CA 3WTWC 1K4SA 1NK3P 2DN0A 2E5NA 5FB2A 4XRFA 3GTPJ 2PMHA 4A3KJ 4KJZA 2LK2A 3D5LA 3RPUA 3MKZA 1RNLA 4A3MJ 5FRNA 1X58A 2DO7A 3D1NI 3LSIA 1HQCA 3IL2A 3NEUA 2PBIA 2P4WA 1WRJA 4CYCB 1ZN2A 1WHUA 4JP0A 3OOPA 2CQXA 1PDNC 3VOEA 4IKFA 2E19A 1I27A 3MZYA 5CVVA 2VJIA 2IVMA 2ACJA 4ZDLA 2VB6A 1S29A 2DXIA 1LEBA 4NUBA 1GV2A 2VJJA 1LDJA 2FJ1A 1KGSA 5FFXA 2Q2EB 4XLPF 1QQIA 4N9HA 4NC8A 3CCEI 1MMNA 3HOVJ 4UB8C 2MD5A 1GT0C 3HUGA 4BE1A 1UHWA 3SDGA 3L2RA 2KIMA 1ETKA 1BA5A 5F08A 3LSKA 1HW1A 4ENKA 2I10A 3E6CC 2BVLA 2V7FA 1K78A 3WE2A 2LVSA 2K40A 2X6YA 2EFPA 2IXSA 1PJRA 1W5CC 2K7LA 5D5VB 5HNFA 1KQ0A 2A05A 3FHNA 1YIJI 2L3DA 2EH3A 3WODF 3I64A 4I99C 4I2OA 4Q48A 3PIOF 2XAQA 2FA5A 2R7FA 1UG2A 4RGXA 1WJ5A 3OSGA 1USSA 3TW6A 4AYBA 2LH9A 2XAFA 3R6SA 2DA7A 3PO3J 1J7KA 4A12A 5JFRA 1JKRC 2R7SA 2MW8A 1SVMA 2RDPA 4CCMA 1ZRFA 1WVRA 2FU4A 2PG4A 3KCCA 3LA7A 5J47A 5FGMA 5E1XA 3F22A 2VKEA 1FP1D 2HQAA 1MBJA 2W48A 3J80K 4ZZLA 3FMRA 4IVNA 4EGYA 3OL4A 1LE8A 1EH6A 1WGXA 2DFIA 1A35A 1JHFA 3G1MA 1F5TA 4A0XA 2L9NA 5KAFC 3LSJA 1B9MA 4EJUA 1LB2A 4WK8F 4HDUA 4HF1A 4LLLA 4CCKA 3TP0A 3DWLE 3K4KA 3MZ8A 2X48A 3S2DJ 3V7SA 1GXQA 2D1HA 5IYCJ 4LIUA 4BQOA 4Y33A 5DTDA 3KEOA 4AIKA 2Y0MA 2VXDA 1MMDA 3H3UA 1YRNA 4B1RA 1OQYA 1Z67A 2Y75A 4ZYEA 2CFXA 2XAGA 4RGSA 3SEQA 1V5EA 3LWFA 3ZQ7A 2VPLA 5CJ9A 4Y17A 3ZXSA 4BHPA 3GMEA 3HRTA 3P9KA 5ILUA 4IRHA 4B8XA 3FXOA 3K1MA 2KZVA 1Z7LA 1MMSA 1GUUA 3KP4A 3AAFA 2CUEA 1W7PA 1BR4A 2J5OA 2HXOA 4KN4X 4ZJZA 2GWRA 2Y2ZA 3IV5A 4JYKA 1R36A 2M87A 4UHTA 3K7AJ 1X1CA 4DZJA 4M74A 2PMZA 5J1UA 5DCFA 1BJAA 4HG2A 3L00A 3H5AA 1I6HJ 1IZ1A 1JXSA 1Z91A 1WI9A 2K86A 3WTVC 2XVCA 3PFYA 2JJ7A 2F5FA 2Q0OA 1MBHA 3H3ZA 4Q47A 4XNFA 2O8XA 1BIBA 3QPTA 1DP3A 2ZC2A 4NC6A 4MO7A 3M07A 1T8IA 4CGZA 1O3QA 4XORA 4ESJA 1Q1HA 3CUQC 4ENNA 1K83J 1WFXA 1JJ8C 3CF5F 1MZBA 3Q3SA 3F8NA 2DU9A 2CH0A 3FHZA 3CCSI 2E5ZA 3IH4A 5JI6A 1I5ZA 4HA8A 4BQNA 1FSHA 2CYYA 2VIXA 3DV8A 2W84A 5D6FA 2RGVA 1A6IA 1K79A 2IA2A 3GWZA 4U0YA 4CCNA 2Y9ZA 3TL4X 4FX4A 1FOWA 2HEOA 3VWBA 2GZWA 2JUCA 4XN3A 1IRXA 1RRJA 3VSKA 1B59A 3WTXC 1J09A 1BI0A 1R22A 5J4VA 1WH7A 2K9QA 1DGRM 2CS3A 2X4HA 2Y0SN 5E8GA 4LD5A 1B8IA 1EH8A 5GPCA 4KDPA 5LHHA 2VXZA 3FXQA 4LLNA 3K70D 2KRHA 1WJEA 3ECOA 1RKTA 3MAJA 4QSHA 4BJTA 2O9LA 2FOWA 2E2IJ 2EZLA 3K4BA 3X2QH 4G8XA 4M9SA 5TRDA 1QRYA 1ULYA 1MNDA 5E1ZB 4QIWN 2HZDA 3ABMH 1HW5A 3FXJA 4M72A 4CICA 1MNMC 1I1SA 1LKXA 4XLEA 5EGOB 3KYCB 3S3MA 1USTA 1RETA 2DK8A 1U0JA 3C2HA 3OOUA 1WJAA 4WF2A 2B63J 1HW2A 4HLXA 3HSFA 2L7ZA 5DDGA 2W7NA 1PUEE 4IHTA 4G7ZF 2DA4A 3HB9A 2YPRA 1TWGJ 3F8MA 3QU3A 1R71A 1FLIA 5B66C 1XMAA 4E7SA 2DMTA 4ZDPA 1FOKA 3A0BC 1TC3C 5HS7A 1S9HA 3AG4H 2QUFA 2QEXI 3OL3A 3CUQA 2V4JC 3HOXJ 3MEXA 4B3XA 2XF7A 3H9JA 1TTYA 1KU7A 1VQ6I 3ERED 2KISA 2G0EA 2X0LA 2ZFUA 4EM1A 4BHBA 3BZCA 2JA6J 3WU0A 3S8PA 5H2FC 3OYDA 3JSOA 2LG4A 2F48A 4FE4A 5JLWA 4GRIA 3S3NA 2VUMJ 2DPUA 1R5HA 5ICCA 3C7JA 1J5YA 3LL7A 3JRGA 4UY8I 3S14J 4PJMA 1JKQC 3GUDA 2JQ7A 2IS6A 2JMWA 3O6BB 1MSEC 4FE7A 3BG5A 4GO1A 2LP0A 3QOPA 4FASD 5A2QK 1RESA 2FBIA 5DUKA 5KVRA 3TO9A 2QCOA 2MG4A 4DYRA 5EF6A 3L2UA 4YELA 1MDMA 3N4MA 1D5VA 2L7KA 3GTJJ 3CLQA 3KP6A 1M1EB 5BPDA 1MBKA 5IT9Z 1ETQA 1XDUA 5F6FA 5GTIC 1WJCA 2LLKA 4MIMA 2JWTA 1UCRA 1WWXA 3REOA 1A04A 4LOCA 3RKXA 3HSEA 2BVMA 1RC9A 4U7DA 6PAXA 4KMFA 4J01A 3KETA 2BHZA 2DK5A 1WCMJ 4P9UA 3OSFA 4BL0B 3CC7I 2KLOA 5H6RA 3GFIA 2K4BA 1JGGA 4V19K 1RIOH 3KP3A 4FETA 2WAEA 2L2OA 4Y13A 3BQYA 4B48A 3M3YJ 2P7CB 1BI2A 3SZGA 1BR1A 5J1RA 2EIJH 3HRUA 1VNDA 1SVOA 3MN2A 4PJJA 4X6AJ 4CH7A 3HHGA 5M3MJ 2WY8Q 2M4KA 2PI0A 2M7AA 4V2FA 1GVDA 4TV7A 2L01A 2QKMB 3K1PA 3LSHA 3FMQA 3ABLH 1ZREA 3NAUA 1TNSA 2DA6A 2E1MB 5DV5A 4I02A 2AO9A 2VC1A 2HWVA 1TL8A 1Z05A 1OKRA 4I0BA 4WCGA 1G3SA 4U7BA 2QBYB 2O7OA 5KNLA 2WV1A 2M3AA 2MFZA 2CG4A 3IH3A 3SZTA 4XL9A 2BY2A 1LNWA 2NVTJ 3ABTA 1MH3A 4HQEA 2JUGA 5F1JA 1IAWA 4P55A 4CO8A 1IN7A 4FTHA 1J2XA 2EFOA 1HA8A 2IGKA 3E7LA 5FJ8J 4R79A 2H8RA 3QYBA 4UUSB 2IAIA 4KN7X 1DQUA 1DU0A 1IN5A 2E71A 1U8BA 1NG7A 1OJLA 2KL4A 1IDYA 1FP2A 3GLLA 4HPQA 5L3FA 2CQ7A 2EPFA 1V54H 2ICWG 3ZQQA 1YS7A 4YIRX 3S3OA 2VBZA 5D5UB 1OPCA 1IRFA 3KFWX 2M0CA 2LF8A 1JT0A 2ZMEC 2R4GA 4IQ4A 1YFHA 4IEJA 2B0LA 4II2A 2M9HA 3NWTA 3BZKA 2O03A 2FD5A 2X51A 4UV9A 2IS1A 2HOTA 1DPRA 1T39A 4KICA 3GFMA 4RAFA 5IYDJ 4KISA 3HIFA 2WBMA 4EJVA 2JVGA 3ZMTA 1K6YA 2CUJA 2K85A 4EVIA 4RAYA 1TP4A 3AKZA 3K2AA 4O5VA 1ETXA 2XGXA 4HSRA 1RPWA 4RGUA 2OA4A 2N8GA 3V8KA 3TOAA 4BEHB 2F5VA 2WAFA 1HSTA 1G3WA 4UUTA 1XX5A 1YJ9I 3IKTA 3A01B 3V42A 2IA0A 2R7DA 2MC4A 4DQ2A 4IRGA 2XF5A 3TW7A 3ZMUA 4LITA 1R5GA 1Y0NA 1JGSA 5KCMA 3BG3A 5D4RA 1MD0A 1JI8A 2X6OA 3CZ6A 4YIFA 1TZLA 1X1DA 1I3AA 2M7BA 4LG0A 1XGOA 3JAMK 3LMMA 3JREA 1R1UA 1R4NB 5GADJ 5IT9K 4BXXJ 1BN5A 2YR2A 2Q1ZB 3KP5A 5L3GA 1YJWI 5L3EA 1U5TC 3RDIA 4DYCA 2FMLA 5EEAA 3BG7A 2L7FP 3GTQJ 2YSRA 1GV5A 3RPUD 2JRMA 1IW7F 4PSWA 3H92A 3TO7A 2D2WA 2OTLI 3JRFA 1O57A 1IRGA 1OYWA 1AKHB 2XASA 5DCMA 2JA2A 3FF5A 2H94A 3W2VA 2RQQA 2WY7Q 2LY2A 3LNQA 1HKQA 5CKTA 2P81A 3OR1C 1XC5A 4BBRJ 1VTNC 3LFUA 2LKSA 2M2EA 4W97A 3I58A 2VE9A 2QLZA 5KHDA 4DYQA 1MKMA 1MMGA 1WZ2A 1YX3A 4CXFA 1XD7A 4A93J 2NOGA 3BDDA 2Z16A 4M9XA 1OYIA 3BLYA 3GBGA 5J8FA 5HLGA 3A03A 3I59B 1FBQA 1ZR4A 1D1CA 3MMYB 1ZG5A 5GAHJ 2G7UA 2V79A 1YYVA 3W2AA 5B1AH 3CCUI 1F9NA 2J5PA 1H9GA 4M3GA 4BDZA 1A6QA 3U2RA 1T6SA 4M3EA 1IV6A 1T0FC 2NVXJ 1KA8A 3S1QJ 1KZHA 4ABZA 4ZDOA 2IW5A 3G73A 3WG9A 1X19A 4QPQA 3PNYA 1PYVA 2Z9OA 2BYVE 4PFOA
chains in the Genus database with same CATH topology
1UG2A 4C3JJ 3OSGA 3JRAA 2EQRA 3TW6A 5EGOA 2R0QC 2LR8A 1HOMA 2DA7A 3DCFA 3PO3J 3S1RJ 3S1NJ 1JKRC 2L9RA 3RKQA 1B72A 5HODA 1W0TA 2MW8A 4A3DJ 2ID6A 1IGNA 2ME0A 4UUSA 2WAQN 2VKEA 3Q0WA 4X1EA 5M5WJ 2H1KA 1MBJA 2W48A 4A3BJ 1QPIA 1JKPC 1Z77A 1AHDP 2GBYA 2R5YA 2ZB9A 2ME6A 5FKKA 1LE8A 1WGXA 5FKOA 1Y1VJ 3S17J 3G1MA 5EYRA 4DZPA 3LSJA 5E3NA 1IG7A 1ENHA 2ECBA 3HKZN 5J1YA 1H88C 3TP0A 1UHSA 2HI3A 2X48A 3BQZA 5M5XJ 3S2DJ 5IYCJ 2CU7A 2LTPA 1JUMA 1NTCA 3ZOBA 5DTDA 3RZDJ 4XRSA 1X2MA 3JRDA 1HF0A 1YRNA 1ORKA 3BG9A 4B1RA 3JRBA 1ZGWA 2Y9YA 4A3CJ 5FLMJ 1DU6A 3PM1A 4MLOA 2XB5A 1BL0A 3HDDA 3S16J 3HM5A 3OIOA 3HBLA 5F0HA 1IC8A 1GUUA 2XRLA 4C2MJ 2CUEA 3BT9A 2HXOA 4MFDA 3GTOJ 3PO2J 1LFBA 4GFBA 1FJLA 1IUFA 4M3DA 2Y2ZA 3IV5A 3L1PA 2EZHA 3HOUJ 1MBGA 4JYKA 3F0CA 3K7AJ 2DJNA 5F0CA 4DZJA 4A3JJ 1Q1VA 5F27A 5J1UA 1JTXA 4IHYA 4D7MA 4D7NA 2JA8J 4V2GA 1I6HJ 4BY1J 3BR3A 1EF4A 2E1OA 3I4NJ 3GTMJ 4XRMA 2JJ7A 1MBHA 1FTZA 1PUFA 1H8AC 4MO7A 1ETWA 4W1UA 1OFCX 1K83J 3FK7A 1JJ8C 1JTYA 3Q3SA 2LFBA 4CYCA 4C3HJ 3BR2A 5EZHA 2XPVA 1FIAA 3IH4A 2RAEA 5EG0A 3BR1A 4XRSG 5DS9A 2HOAA 1JJ6C 1S7EA 5E3OA 3CCYA 2XPUA 4AYBN 4XIDA 2R5ZB 1A6IA 2CRGA 5K7FA 2Y9ZA 1QVTA 2JA7J 3B6AA 4A3LJ 5GP9A 1G2HA 1A5JA 1WH7A 3A02A 2K9QA 3MVPA 2Y0SN 1B8IA 3CMYA 3SFIA 4XICA 5GPCA 2M8GX 2HYJA 4A3GJ 1RKTA 2VKVA 4QSHA 3JR9A 2D5VA 1FIPA 2O9LA 2VPRA 2EZLA 2E2IJ 3H0GJ 2XGCA 1QRYA 3FIWA 1T33A 4JX6A 3GTGJ 4QIWN 3HOYJ 1MNMC 1CQTA 2IBDA 2YU9J 1TWAJ 4XK4A 1IDZA 3GTKJ 4A69C 1MBEA 3C2BA 1F36A 3LSPA 5EGOB 1RETA 3RZOJ 4RDUA 2DA3A 3OOUA 2R7ZJ 2WB1N 1AU7A 2DMQA 5GPAA 1HDDC 2B63J 3S15J 2E2HJ 3JRIA 2L7ZA 3CDLA 5FLVA 1BW5A 2DA4A 3HB9A 4QTRA 2R5YB 1TWGJ 4D5CA 3TEDA 1RKWA 2O8KA 1OCPA 1LE8B 3IH2A 4L5EA 2ECCA 3RQIA 5IYBJ 3ZQHA 5FKMA 2JA5J 2DMTA 2OF7A 3DEWA 1TC3C 2LKXA 1D5YA 1BJZA 4A3FJ 4BY7J 3HOXJ 3SJMA 2HXIA 5EZGA 3ZQCA 3G1OA 2VI6A 2LD5A 4S0HB 2M34A 1P7IA 2COBA 2FQ4A 2G0EA 2PMZN 1NK2P 1YRNB 2DMUA 3QPLA 1ZR2A 2JA6J 3A01A 4FE4A 5JLWA 2DA1A 2VUMJ 4Y7NJ 2JN6A 3JRGA 4Y52J 3MKLA 3S14J 2TRTA 1JKQC 1QVUA 1SANA 3LOCA 4RBOA 1GDTA 3G1LA 2JMWA 1MSEC 4FE7A 3BG5A 3FKIJ 3WHBA 2R93J 4HNVA 3FK6A 2NVQJ 1R9TJ 3Q0VA 1APLC 2LP0A 3WHCA 1RESA 5EF6A 5JLXA 4DYRA 2KDZA 2QCOA 1I50J 2MG4A 1ZK8A 3GTJJ 1MBKA 3FISA 1ETQA 1OCTC 5K7ZA 1VF9A 2LLKA 5J3LA 2IEKA 2Y31A 4MIMA 2JWTA 1LFUP 2NVYJ 2GLOA 4LOCA 1AKHA 5E3MA 2JK3A 2XSDC 1T56A 1WCMJ 3OSFA 2MSYA 2EZIA 4A3IJ 2DTZA 1X2NA 2DMPA 3BTJA 4IHXA 2ELKA 1PUFB 1JGGA 2YUSA 1POGA 9ANTA 3BQYA 4DW6A 1VI0A 2NS7A 3M3YJ 5J1RA 1U9OA 1FEXA 1P7JA 1VNDA 3MN2A 3QQAA 5EG0B 4C3IJ 4X6AJ 5M3MJ 5IOZA 1Y1WJ 4V2FA 5F0FA 1F43A 1GVDA 1ETOA 3LSRA 4I76A 3NAUA 3B6CA 2DA6A 2HQ5A 2R5ZA 1HDPA 2AO9A 3LSGA 1MH4A 5IP9J 5C44J 2KT0A 1RR7A 3JRHA 3ZQLA 2YS9A 2O7OA 3BTCA 1ZTRA 3UKGA 2WV1A 1B8IB 3IH3A 4M3BA 1ZKGA 2NVTJ 2CUFA 1MH3A 2R92J 2DA5A 1U9NA 5F1JA 5F04A 1TWHJ 4I6ZA 4JX4A 3W6VA 3BTLA 4NDLA 3HGYA 1ZQ3P 4FTHA 2AHQA 2XPWA 1B72B 3E7LA 5FJ8J 2H8RA 4UUSB 1U78A 4MFEA 2IAIA 1DU0A 4M3FA 1U8BA 1O4XA 1JKOC 1OJLA 1XS9A 1IDYA 2MGQA 1WH5A 5M5YJ 3CQZJ 2FX0A 3BR5A 1ITYA 5FKLA 3O8HA 2EZKA 1W0UA 1UMQA 1XG1A 2M0CA 2HDDA 2X9DA 4G12A 1JT0A 4IEJA 3ZQGA 2M9HA 3ZQFA 3BR6A 2TCTA 2FD5A 5EDNA 3Q0UA 2HOTA 3H3VK 3M4OJ 5IP6A 5IPAA 4B3AA 5IYDJ 2OPTA 5M3FJ 4J19A 2DMNA 1E3OC 1Z0XA 5IP7J 2Y30A 3K2AA 4AC0A 2QF7A 1ETXA 1VFCA 1IRZA 3TP3A 1RPWA 2N8GA 1SFOJ 4UUTA 5C4XJ 4BBSJ 4AUXA 1JT6A 3A01B 3TW7A 3GTLJ 2E2JJ 5C3EJ 4M6VA 3BG3A 2HOSA 2X6OA 1WPKA 2XGDA 1TWFJ 1MBFA 3JRCA 4A3EJ 3JREA 4FISA 3HEFA 1K61A 3HGGA 4EEFG 3HOWJ 4BXXJ 1ETYA 1WI3A 1JUSA 1MSFC 3HOZJ 1I3QJ 3I4MJ 4DYCA 1FTTA 2L0KA 3O8GA 5K7HA 4JX5A 5BNGA 5EEAA 2L7FP 3GTQJ 1BW6A 2EBIA 1ETVA 4BKXA 1H89C 1GV5A 2XGEA 1HCRA 3S2HJ 1NK3P 5E3LA 3BR0A 2DN0A 3JRFA 1JUPA 2K9NA 1AKHB 3GTPJ 5FKNA 3QPSA 4A3KJ 2LK2A 2CQQA 4A3MJ 2K9SA 1X58A 3D1NI 3LNQA 2P81A 4D5FA 2DA2A 1XC5A 4BBRJ 4CYCB 2CJJA 4JP0A 2M2EA 2CQXA 4W97A 2L7MP 2E19A 4B4CA 4DYQA 4IHWA 3ZQIA 3VPRA 1GV2A 4A93J 2FJ1A 2LY9A 2ID3A 2NOGA 3HOVJ 1GT0C 3SDGA 3GBGA 3A03A 1ZR4A 3NARA 1ETKA 1BA5A 5F08A 4FCYA 3S1MJ 4M3GA 2I10A 1HLVA 4M3EA 1IV6A 5C4JJ 2LVSA 2NVXJ 2NS8A 2K40A 3S1QJ 4ABZA 2GM4A 2XB0X 2EH3A 5IOYA 3BTIA 4IHVA 1IJWC 1TWCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG2 A;  4C3J J;  3OSG A;  3JRA A;  2EQR A;  3TW6 A;  5EGO A;  2R0Q C;  2LR8 A;  1HOM A;  2DA7 A;  3DCF A;  3PO3 J;  3S1R J;  3S1N J;  1JKR C;  2L9R A;  3RKQ A;  1B72 A;  5HOD A;  1W0T A;  2MW8 A;  4A3D J;  2ID6 A;  1IGN A;  2ME0 A;  4UUS A;  2WAQ N;  2VKE A;  3Q0W A;  4X1E A;  5M5W J;  2H1K A;  1MBJ A;  2W48 A;  4A3B J;  1QPI A;  1JKP C;  1Z77 A;  1AHD P;  2GBY A;  2R5Y A;  2ZB9 A;  2ME6 A;  5FKK A;  1LE8 A;  1WGX A;  5FKO A;  1Y1V J;  3S17 J;  3G1M A;  5EYR A;  4DZP A;  3LSJ A;  5E3N A;  1IG7 A;  1ENH A;  2ECB A;  3HKZ N;  5J1Y A;  1H88 C;  3TP0 A;  1UHS A;  2HI3 A;  2X48 A;  3BQZ A;  5M5X J;  3S2D J;  5IYC J;  2CU7 A;  2LTP A;  1JUM A;  1NTC A;  3ZOB A;  5DTD A;  3RZD J;  4XRS A;  1X2M A;  3JRD A;  1HF0 A;  1YRN A;  1ORK A;  3BG9 A;  4B1R A;  3JRB A;  1ZGW A;  2Y9Y A;  4A3C J;  5FLM J;  1DU6 A;  3PM1 A;  4MLO A;  2XB5 A;  1BL0 A;  3HDD A;  3S16 J;  3HM5 A;  3OIO A;  3HBL A;  5F0H A;  1IC8 A;  1GUU A;  2XRL A;  4C2M J;  2CUE A;  3BT9 A;  2HXO A;  4MFD A;  3GTO J;  3PO2 J;  1LFB A;  4GFB A;  1FJL A;  1IUF A;  4M3D A;  2Y2Z A;  3IV5 A;  3L1P A;  2EZH A;  3HOU J;  1MBG A;  4JYK A;  3F0C A;  3K7A J;  2DJN A;  5F0C A;  4DZJ A;  4A3J J;  1Q1V A;  5F27 A;  5J1U A;  1JTX A;  4IHY A;  4D7M A;  4D7N A;  2JA8 J;  4V2G A;  1I6H J;  4BY1 J;  3BR3 A;  1EF4 A;  2E1O A;  3I4N J;  3GTM J;  4XRM A;  2JJ7 A;  1MBH A;  1FTZ A;  1PUF A;  1H8A C;  4MO7 A;  1ETW A;  4W1U A;  1OFC X;  1K83 J;  3FK7 A;  1JJ8 C;  1JTY A;  3Q3S A;  2LFB A;  4CYC A;  4C3H J;  3BR2 A;  5EZH A;  2XPV A;  1FIA A;  3IH4 A;  2RAE A;  5EG0 A;  3BR1 A;  4XRS G;  5DS9 A;  2HOA A;  1JJ6 C;  1S7E A;  5E3O A;  3CCY A;  2XPU A;  4AYB N;  4XID A;  2R5Z B;  1A6I A;  2CRG A;  5K7F A;  2Y9Z A;  1QVT A;  2JA7 J;  3B6A A;  4A3L J;  5GP9 A;  1G2H A;  1A5J A;  1WH7 A;  3A02 A;  2K9Q A;  3MVP A;  2Y0S N;  1B8I A;  3CMY A;  3SFI A;  4XIC A;  5GPC A;  2M8G X;  2HYJ A;  4A3G J;  1RKT A;  2VKV A;  4QSH A;  3JR9 A;  2D5V A;  1FIP A;  2O9L A;  2VPR A;  2EZL A;  2E2I J;  3H0G J;  2XGC A;  1QRY A;  3FIW A;  1T33 A;  4JX6 A;  3GTG J;  4QIW N;  3HOY J;  1MNM C;  1CQT A;  2IBD A;  2YU9 J;  1TWA J;  4XK4 A;  1IDZ A;  3GTK J;  4A69 C;  1MBE A;  3C2B A;  1F36 A;  3LSP A;  5EGO B;  1RET A;  3RZO J;  4RDU A;  2DA3 A;  3OOU A;  2R7Z J;  2WB1 N;  1AU7 A;  2DMQ A;  5GPA A;  1HDD C;  2B63 J;  3S15 J;  2E2H J;  3JRI A;  2L7Z A;  3CDL A;  5FLV A;  1BW5 A;  2DA4 A;  3HB9 A;  4QTR A;  2R5Y B;  1TWG J;  4D5C A;  3TED A;  1RKW A;  2O8K A;  1OCP A;  1LE8 B;  3IH2 A;  4L5E A;  2ECC A;  3RQI A;  5IYB J;  3ZQH A;  5FKM A;  2JA5 J;  2DMT A;  2OF7 A;  3DEW A;  1TC3 C;  2LKX A;  1D5Y A;  1BJZ A;  4A3F J;  4BY7 J;  3HOX J;  3SJM A;  2HXI A;  5EZG A;  3ZQC A;  3G1O A;  2VI6 A;  2LD5 A;  4S0H B;  2M34 A;  1P7I A;  2COB A;  2FQ4 A;  2G0E A;  2PMZ N;  1NK2 P;  1YRN B;  2DMU A;  3QPL A;  1ZR2 A;  2JA6 J;  3A01 A;  4FE4 A;  5JLW A;  2DA1 A;  2VUM J;  4Y7N J;  2JN6 A;  3JRG A;  4Y52 J;  3MKL A;  3S14 J;  2TRT A;  1JKQ C;  1QVU A;  1SAN A;  3LOC A;  4RBO A;  1GDT A;  3G1L A;  2JMW A;  1MSE C;  4FE7 A;  3BG5 A;  3FKI J;  3WHB A;  2R93 J;  4HNV A;  3FK6 A;  2NVQ J;  1R9T J;  3Q0V A;  1APL C;  2LP0 A;  3WHC A;  1RES A;  5EF6 A;  5JLX A;  4DYR A;  2KDZ A;  2QCO A;  1I50 J;  2MG4 A;  1ZK8 A;  3GTJ J;  1MBK A;  3FIS A;  1ETQ A;  1OCT C;  5K7Z A;  1VF9 A;  2LLK A;  5J3L A;  2IEK A;  2Y31 A;  4MIM A;  2JWT A;  1LFU P;  2NVY J;  2GLO A;  4LOC A;  1AKH A;  5E3M A;  2JK3 A;  2XSD C;  1T56 A;  1WCM J;  3OSF A;  2MSY A;  2EZI A;  4A3I J;  2DTZ A;  1X2N A;  2DMP A;  3BTJ A;  4IHX A;  2ELK A;  1PUF B;  1JGG A;  2YUS A;  1POG A;  9ANT A;  3BQY A;  4DW6 A;  1VI0 A;  2NS7 A;  3M3Y J;  5J1R A;  1U9O A;  1FEX A;  1P7J A;  1VND A;  3MN2 A;  3QQA A;  5EG0 B;  4C3I J;  4X6A J;  5M3M J;  5IOZ A;  1Y1W J;  4V2F A;  5F0F A;  1F43 A;  1GVD A;  1ETO A;  3LSR A;  4I76 A;  3NAU A;  3B6C A;  2DA6 A;  2HQ5 A;  2R5Z A;  1HDP A;  2AO9 A;  3LSG A;  1MH4 A;  5IP9 J;  5C44 J;  2KT0 A;  1RR7 A;  3JRH A;  3ZQL A;  2YS9 A;  2O7O A;  3BTC A;  1ZTR A;  3UKG A;  2WV1 A;  1B8I B;  3IH3 A;  4M3B A;  1ZKG A;  2NVT J;  2CUF A;  1MH3 A;  2R92 J;  2DA5 A;  1U9N A;  5F1J A;  5F04 A;  1TWH J;  4I6Z A;  4JX4 A;  3W6V A;  3BTL A;  4NDL A;  3HGY A;  1ZQ3 P;  4FTH A;  2AHQ A;  2XPW A;  1B72 B;  3E7L A;  5FJ8 J;  2H8R A;  4UUS B;  1U78 A;  4MFE A;  2IAI A;  1DU0 A;  4M3F A;  1U8B A;  1O4X A;  1JKO C;  1OJL A;  1XS9 A;  1IDY A;  2MGQ A;  1WH5 A;  5M5Y J;  3CQZ J;  2FX0 A;  3BR5 A;  1ITY A;  5FKL A;  3O8H A;  2EZK A;  1W0U A;  1UMQ A;  1XG1 A;  2M0C A;  2HDD A;  2X9D A;  4G12 A;  1JT0 A;  4IEJ A;  3ZQG A;  2M9H A;  3ZQF A;  3BR6 A;  2TCT A;  2FD5 A;  5EDN A;  3Q0U A;  2HOT A;  3H3V K;  3M4O J;  5IP6 A;  5IPA A;  4B3A A;  5IYD J;  2OPT A;  5M3F J;  4J19 A;  2DMN A;  1E3O C;  1Z0X A;  5IP7 J;  2Y30 A;  3K2A A;  4AC0 A;  2QF7 A;  1ETX A;  1VFC A;  1IRZ A;  3TP3 A;  1RPW A;  2N8G A;  1SFO J;  4UUT A;  5C4X J;  4BBS J;  4AUX A;  1JT6 A;  3A01 B;  3TW7 A;  3GTL J;  2E2J J;  5C3E J;  4M6V A;  3BG3 A;  2HOS A;  2X6O A;  1WPK A;  2XGD A;  1TWF J;  1MBF A;  3JRC A;  4A3E J;  3JRE A;  4FIS A;  3HEF A;  1K61 A;  3HGG A;  4EEF G;  3HOW J;  4BXX J;  1ETY A;  1WI3 A;  1JUS A;  1MSF C;  3HOZ J;  1I3Q J;  3I4M J;  4DYC A;  1FTT A;  2L0K A;  3O8G A;  5K7H A;  4JX5 A;  5BNG A;  5EEA A;  2L7F P;  3GTQ J;  1BW6 A;  2EBI A;  1ETV A;  4BKX A;  1H89 C;  1GV5 A;  2XGE A;  1HCR A;  3S2H J;  1NK3 P;  5E3L A;  3BR0 A;  2DN0 A;  3JRF A;  1JUP A;  2K9N A;  1AKH B;  3GTP J;  5FKN A;  3QPS A;  4A3K J;  2LK2 A;  2CQQ A;  4A3M J;  2K9S A;  1X58 A;  3D1N I;  3LNQ A;  2P81 A;  4D5F A;  2DA2 A;  1XC5 A;  4BBR J;  4CYC B;  2CJJ A;  4JP0 A;  2M2E A;  2CQX A;  4W97 A;  2L7M P;  2E19 A;  4B4C A;  4DYQ A;  4IHW A;  3ZQI A;  3VPR A;  1GV2 A;  4A93 J;  2FJ1 A;  2LY9 A;  2ID3 A;  2NOG A;  3HOV J;  1GT0 C;  3SDG A;  3GBG A;  3A03 A;  1ZR4 A;  3NAR A;  1ETK A;  1BA5 A;  5F08 A;  4FCY A;  3S1M J;  4M3G A;  2I10 A;  1HLV A;  4M3E A;  1IV6 A;  5C4J J;  2LVS A;  2NVX J;  2NS8 A;  2K40 A;  3S1Q J;  4ABZ A;  2GM4 A;  2XB0 X;  2EH3 A;  5IOY A;  3BTI A;  4IHV A;  1IJW C;  1TWC J; 
#chains in the Genus database with same CATH topology
 4C3J J;  2W4S A;  3DTK A;  1N25 A;  4AVZ A;  1FT9 A;  1HOM A;  3DCF A;  3S1R J;  2VE8 A;  1B72 A;  1P4A A;  2EB7 A;  2PFB A;  5HOO A;  2P8T A;  1ZRC A;  1QA6 A;  2IGN A;  2EV0 A;  2H6C A;  1B1B A;  2O3F A;  1KON A;  2BEO A;  4BXU A;  2H1K A;  1U5T A;  5ICG A;  2E1C A;  4PSX A;  1Z77 A;  3TOB A;  3SFZ A;  2GBY A;  4RB1 A;  4G7O F;  3CP2 A;  3S17 J;  2VT2 A;  2VKD A;  3C3W A;  3I55 I;  1BOB A;  3EYY A;  1ENH A;  1B9N A;  4ZYD A;  1UHS A;  4XKB A;  2HI3 A;  1PVE A;  1VQO I;  1OMI A;  3OYM A;  3NWS A;  4EMS A;  1DUX C;  1JUM A;  4M6X A;  1NTC A;  2QSH X;  3AG1 H;  2PQ8 A;  3P7N A;  4XRS A;  1HF0 A;  4F55 A;  2A5Y B;  3WGG A;  1BR2 A;  4RB2 C;  3GZ6 A;  2WB1 A;  1CF7 B;  2AQF A;  3A2K A;  4XBF A;  2WV0 A;  2Y9Y A;  3OV8 A;  2M1B A;  2GAU A;  4XKC A;  3CMA I;  4YII A;  3RIR A;  3E1S A;  4G9Y A;  3DTI A;  5FLM J;  1DU6 A;  4EM0 B;  1WSU A;  2KIF A;  4HF0 A;  3OYG A;  2XB5 A;  5JR3 A;  5FLX Z;  3EUK L;  2DT7 B;  3HDD A;  3OIO A;  5F0H A;  3T8R A;  1SFE A;  1IC8 A;  4HV6 A;  4PUS A;  4BH9 A;  2ZO4 A;  1FZP B;  2H1L A;  4C2M J;  3CMM A;  3WGI A;  1SMT A;  2DOA A;  2OAZ A;  4OIQ F;  2BZT A;  2R3S A;  1FJL A;  5LD2 C;  1Z7U A;  4PCQ A;  3U9G A;  1SFX A;  3HOU J;  5HNH A;  3F0C A;  1B4A A;  2W00 A;  4NC7 A;  5F27 A;  3OYJ A;  3J7Z I;  2JA8 J;  3DEE A;  5K5O A;  2E1O A;  3SEZ A;  3GXO A;  3I4N J;  3DU6 A;  3GTM J;  1RZ4 A;  2EIK H;  4HNT A;  1YW9 A;  3KEQ A;  1CGP A;  1SAX A;  1PUF A;  1H8A C;  4W1U A;  1V3F A;  2VT3 A;  2Z2S B;  4KIB A;  1XCV A;  3K4J A;  1JTY A;  5ILS A;  4CYC A;  4C3H J;  3Q9V A;  1IN6 A;  2FOK A;  5EZH A;  1KQ8 A;  1FIA A;  2RAE A;  3SDB A;  5EG0 A;  2WC2 A;  1R1V A;  4XRS G;  1L3L A;  2QA4 I;  3HZJ A;  2IA1 A;  1JJ6 C;  1YHQ I;  2Q2E A;  2XPU A;  2MD0 A;  5D5X B;  4AYB N;  2HR3 A;  2Z1D A;  4RLQ A;  3HUG B;  1V55 H;  5K7F A;  2RV8 A;  5CVR A;  3B6A A;  2DOF A;  3DLA A;  5GP9 A;  1G2H A;  1R7J A;  3CDH A;  1XGS A;  4XKV A;  3CO6 C;  1Z1D A;  3KPH A;  3UR3 C;  4G6Q A;  4MQ9 F;  3SFI A;  4S05 A;  3CMY A;  3HG9 A;  1K78 B;  2M8G X;  2HYJ A;  4I01 A;  5K1Y A;  4U88 A;  2JTV A;  2YX7 A;  1BBY A;  4CA0 A;  2VKV A;  3H35 A;  2VPR A;  4C9Y A;  2XUB A;  4OMY A;  2DYR H;  1YW8 A;  3T1B A;  1T33 A;  3QPH A;  1PP7 U;  1ZGJ A;  4C2U A;  3K10 A;  4UUV A;  1TWA J;  2ADU A;  1UZC A;  3BY6 A;  5E18 F;  2E34 A;  3LFK A;  2O5R A;  1IDZ A;  3WG7 H;  1F36 A;  5GAE J;  2STT A;  3CUO A;  2HS5 A;  3HYI A;  4A6D A;  3RZO J;  4HX8 A;  2DA3 A;  2R7Z J;  3K6G A;  2EV5 A;  3E5U A;  2IGM A;  2DMQ A;  5GPA A;  2FBK A;  2E2H J;  1XSV A;  2GIZ A;  2QEN A;  3BOQ A;  3QAH A;  4PK4 A;  2JVH A;  3DPU A;  3OS0 A;  3CDL A;  3J81 K;  3KZZ A;  3KX2 A;  2Z99 A;  4IX7 A;  2HQR A;  1LUJ B;  3HC7 A;  4LGW A;  4D5C A;  3TED A;  1RKW A;  2O8K A;  1LE8 B;  3IH2 A;  4C30 A;  4L5E A;  1YX5 A;  3FBI B;  5IYB J;  3L2V A;  4M6Y A;  2QSF X;  2HFH A;  1ON1 A;  5FKM A;  2A68 F;  3U21 A;  1I39 A;  1KQ9 A;  2OF7 A;  2JA5 J;  3DEW A;  2DFH A;  2LKX A;  1BJZ A;  4A3F J;  2F4O B;  4BY7 J;  3WTU C;  2HXI A;  1WKM A;  4HAM A;  2NS0 A;  2XSJ C;  3G1O A;  1VQL I;  4L9N A;  2M34 A;  2FQ4 A;  2W85 A;  2GOM A;  2PMZ N;  3GF2 A;  1YRN B;  2DPD A;  2ZFW A;  5DD4 A;  4NQW A;  3CCJ I;  1O3T A;  2PJP A;  4OU0 A;  4IHS A;  3IP4 B;  2F2E A;  5FLX K;  4Y7N J;  1QPM A;  5HLH A;  2JN6 A;  3CC4 I;  2M4G A;  3FWE A;  3MKL A;  3CJQ B;  3V8L A;  1F4K A;  1IN8 A;  2OBP A;  2ZSH B;  2ZCW A;  2KRC A;  3L09 A;  2YU3 A;  2DBB A;  2DJI A;  2LRE A;  3OMY A;  1SC7 A;  4HEA 2;  3BG6 A;  1ZK8 A;  2IGO A;  2WA0 A;  4A6E A;  3LQQ A;  3PSF A;  4FX0 A;  1Z3Y A;  4P9F A;  4XKW A;  5ICE A;  2VBW A;  4KMU X;  5J3L A;  3O2P E;  3WTS C;  1FYK A;  1D8K A;  2NVY J;  1TQI A;  5AIP A;  4O3M A;  1IF1 A;  1WJD A;  3EUH A;  5IY5 H;  1MIJ A;  4BHC A;  2VKH A;  1WQ2 A;  2LY1 A;  4A3I J;  3BP8 A;  2DTZ A;  1FMV A;  1X2N A;  2P6T A;  3OYL A;  3H5N A;  4IHX A;  2M45 A;  4E7J A;  4B09 A;  4LK0 F;  3CD6 I;  1Z9C A;  2FE3 A;  2MBF A;  1ONV A;  2DCE A;  3E6M A;  3ISP A;  3HPH A;  5ILV A;  3K4N A;  2NS7 A;  1X4O A;  1T08 B;  3AL0 C;  1EH7 A;  1FEX A;  2ESN A;  3HTU A;  4S04 A;  1R1T A;  2AXT C;  3QQA A;  4IPA A;  4UB6 C;  5IOZ A;  1Y1W J;  2ESH A;  2FXA A;  2Z5U A;  2EWN A;  1UG0 A;  4BE2 A;  1XTA A;  3B6C A;  2HQ5 A;  4UV8 A;  3WU2 C;  2DDA A;  2HOE A;  1IV8 A;  4XLN F;  4P5O A;  2EIM H;  3GX4 X;  2IRF G;  2KT0 A;  4K2E A;  3JRH A;  5B5E C;  3ESW B;  2OC6 A;  4GCV A;  3BTC A;  1ZTR A;  3OYE A;  3UKG A;  2W82 A;  4LB6 B;  1MW7 A;  3PQJ A;  2PEX A;  1B8I B;  3F8F A;  2F6C A;  5IT3 A;  2LF7 A;  2CUF A;  2BW3 A;  3QU6 A;  1X1B A;  3FM5 A;  1ZLK A;  4F7Z A;  4BQA A;  1LQ1 A;  1TWH J;  1LDD A;  3HGY A;  3H1C A;  4I98 B;  4EAT A;  2XKO A;  3HSR A;  2VOO A;  1TLH B;  4OWR B;  1U78 A;  4MFE A;  3TBI A;  4M3F A;  1LVK A;  1O4X A;  3FM3 A;  4QWQ A;  4ZYA A;  3WTT C;  4WXD A;  2JT1 A;  3F8C A;  4CCO A;  4EGZ A;  2QQ9 A;  2ZXI A;  2QWW A;  5LFA A;  5HDG A;  2EZK A;  1W0U A;  1UMQ A;  4ZYH A;  4A5M A;  3QP6 A;  2QSG X;  1E0E A;  1QZZ A;  3T0Y A;  2X9D A;  1Y8R B;  2P5V A;  1GLN A;  2CMP A;  3BR6 A;  5EDN A;  3OIP A;  2ISY A;  4Q4Z F;  1UEL B;  3M4O J;  1G6N A;  1D1A A;  1FOY A;  1OCZ H;  5CVI A;  4J19 A;  2DMN A;  3K4C A;  3A0H C;  3WTY C;  3CUQ B;  4MGR A;  3PUB A;  2MC3 A;  2WAQ A;  4H0E A;  3I4P A;  3TP3 A;  2VLA A;  4GYG A;  2W57 A;  2XRO A;  1SFO J;  4AID A;  4IL6 C;  4ZZD A;  4BBS J;  1JT6 A;  3ECH A;  2R7W A;  1ZG1 A;  4NB5 A;  1H9T A;  3H36 A;  1B6A A;  3GTL J;  3FKJ A;  4ASN A;  3M8E A;  2E2J J;  2V1X A;  4M6V A;  2R7X A;  4MEY F;  4FQG A;  1KU2 A;  1P6R A;  2XGD A;  3HKZ A;  3VEP A;  2IT0 A;  4XON A;  3RCO A;  4U87 A;  4L5I A;  2FUG 2;  4FIS A;  2I8D A;  1K61 A;  1UB9 A;  3G6E I;  2UWM A;  3GFL A;  5CYV A;  4ON0 A;  1MDM B;  1FX7 A;  2VQL A;  2Y69 H;  2K4J A;  3QP5 A;  3DXJ F;  2GA1 A;  3I4M J;  2QZ8 A;  2XIG A;  4L0Y B;  5K7H A;  3O8G A;  1G4D A;  5BNG A;  1YOV B;  5HVQ C;  1AWC A;  3ZGK A;  1W5T A;  2EBI A;  1H89 C;  2JRT A;  2HDC A;  3QYF A;  5JVG F;  1JUP A;  2XDV A;  3E0J B;  4I7H A;  5FKN A;  1P4X A;  3QPS A;  2EFW A;  3IWZ A;  2OZ6 A;  4ENM A;  4XN0 A;  3CCL I;  2M8E A;  4XSX F;  1V5G A;  1XN7 A;  2NAZ A;  2L02 A;  4QPO A;  4BQQ A;  4D5F A;  3O3K A;  2MA3 A;  1YE9 A;  3F6V A;  3VYU B;  1Y6I A;  1SAU A;  1XSD A;  4B4C A;  2XRN A;  3ZQI A;  2R7Q A;  2VC0 A;  1X1A A;  3VPR A;  1XGM A;  2A3S A;  2KKO A;  3ZN0 A;  4UXN A;  4BGD A;  3DKW A;  3EYI A;  2COM A;  2RRE A;  4PFP A;  3RQ4 A;  1H0M A;  1N78 A;  1ZH5 A;  1TW2 A;  1WJF A;  3KP2 A;  4E7Z A;  4GGG A;  4XSZ F;  4BS9 A;  4BUP A;  3LQR A;  2X6X A;  2GOX B;  3FXM A;  4U0V A;  3NAR A;  2QQA A;  4XOP A;  3E5X A;  2BOL A;  4A5N A;  1XPX A;  3TDZ C;  4IZZ A;  2XC7 A;  2LNB A;  3F6O A;  2EFQ A;  2NYX A;  1HLV A;  2BBY A;  5FFZ A;  2DW4 A;  2QBY A;  2NS8 A;  3BPV A;  2L9V A;  5BQT A;  2XB0 X;  3KE2 A;  3JW4 A;  1ERD A;  5IOY A;  2LRD A;  3BTI A;  1TWC J;  1Z3X A;  3T8T A;  3JRA A;  2EQR A;  3N97 A;  2Z33 A;  2R0Q C;  3K0L A;  2HKO A;  4CYD A;  3SHF A;  3F9K A;  3RKQ A;  3DBH B;  3J7A O;  3S1N J;  2HPI A;  4XLC A;  3DLL F;  2CV0 A;  4UUS A;  3S93 A;  2LDU A;  4X1E A;  5M5W J;  2ISZ A;  4A3B J;  1JKP C;  3CJR B;  2V6E A;  4P1W A;  2R5Y A;  2ME6 A;  4HRI A;  3TMO A;  3N05 A;  1MJ9 A;  5FKO A;  4L9J A;  2NNY A;  5BMZ A;  4U0W A;  4E6K G;  2VOD A;  3OYK A;  4L9V A;  5ICF A;  1U3E M;  1ZAO A;  3I56 I;  3TGN A;  4AM3 A;  2E36 A;  1S7O A;  3BQZ A;  3ULQ B;  5M5X J;  1S8N A;  3ZP5 A;  2EFN A;  2OD5 A;  2R7T A;  2LTP A;  5TGT A;  3VDX A;  1KU9 A;  1X2M A;  3ELK A;  3CLO A;  2RQP A;  3PL8 A;  5CQE A;  2DT5 A;  1ORK A;  2QVO A;  2X85 A;  3JRB A;  1ZGW A;  2AQE A;  2ZJR F;  2DLL A;  3BJA A;  1MNE A;  4A3C J;  4KNY A;  2E7W A;  5E8I A;  1VQ7 I;  3HOS A;  3PM1 A;  4MLO A;  2HU9 A;  3MWM A;  2DT6 A;  1BL0 A;  3S16 J;  3HBL A;  1K4T A;  3C2G A;  4L18 B;  3EQL F;  2BY3 A;  2EA4 A;  3P9I A;  2DAO A;  2M0M A;  3HPG A;  2ZJQ F;  3BT9 A;  2KQR A;  3PO2 J;  3GTO J;  4HYE A;  1LFB A;  4RM2 A;  1GHC A;  3G71 I;  1Y39 A;  2LOO A;  3H0D A;  3WTZ A;  3L1P A;  2HTS A;  4HZF A;  2DJN A;  4A3J J;  3QRF F;  1Q1V A;  1JTX A;  4IHY A;  1NG6 A;  4F3Q A;  4OMZ A;  5E17 F;  2UXX A;  5JHU A;  2Y48 A;  1SFU A;  2L54 A;  4V2G A;  4BAY A;  3C1D A;  3BR3 A;  4PDK A;  4II3 A;  2ZXJ A;  2DQL A;  1MMA A;  1Z6R A;  3CO7 C;  5CQG A;  4DBQ A;  2OUM A;  4BU2 A;  1R6R A;  4DJA A;  5F1R A;  2ELJ A;  1ETW A;  3K9T A;  3F8B A;  1FY7 A;  1OFC X;  3CF2 A;  2UV1 A;  3FK7 A;  2B7E A;  2OV7 A;  2OQR A;  2QGU A;  5ED4 A;  2R7R A;  5HLI A;  3BR2 A;  2XPV A;  3L2Q A;  3BR1 A;  4IXA A;  3TQN A;  2DYS H;  4MHG A;  2KFD A;  1LJ9 A;  2KRF A;  3BPX A;  4E7L A;  2ZME B;  5E3O A;  1E2X A;  2JZY A;  2O61 A;  4ZYG A;  2R5Z B;  4B47 A;  1QVT A;  2JA7 J;  5EJC A;  3E5Q A;  2RVC A;  3I59 A;  5LRR A;  3DP7 A;  5LHG A;  3OYI A;  1A5J A;  2BHY A;  2VJ5 A;  3NQO A;  1ZRD A;  3MVP A;  4KFC A;  4XIC A;  3FBN B;  2A6H F;  2QQB A;  2LBF A;  1YG2 A;  1R4M B;  2FQ3 A;  2E35 A;  4XLF A;  3TKY A;  4HW0 A;  1FIP A;  3AG2 H;  3PSI A;  1P2F A;  3FDY A;  3PJR A;  2R7U A;  4HV5 A;  3H5R A;  1QHH D;  2R7V A;  3FIW A;  1J0R A;  5DYM A;  3HOY J;  3TO6 A;  4X0G A;  3ONQ A;  4L9T A;  1VQ4 I;  3W3C A;  1IN4 A;  2BE5 F;  2ZNY A;  1XB4 A;  3C2B A;  3FMS A;  3LSP A;  4YFX F;  4PGH A;  1DGW Y;  4KIT B;  2NNN A;  5FD5 A;  1T2K A;  1VQ5 I;  2WB1 N;  1YTY A;  4HBL A;  1AU7 A;  1DDN A;  1HDD C;  3S15 J;  4MTD A;  2D1V A;  5D8K B;  1JE8 A;  2I5U A;  3DF8 A;  1HKT A;  1U5T B;  1X3Z B;  2HVR A;  3I3L A;  4XMY A;  5FLV A;  3DQV C;  1BW5 A;  2PJR B;  4QTR A;  4ZTF A;  3WE3 A;  4CZC A;  5L3C A;  4E7H A;  4A2U A;  2ECC A;  1ZYR F;  3RQI A;  5K5R A;  2XAH A;  1EV7 A;  2GA2 A;  3AFH A;  2H09 A;  1T98 A;  2XHK A;  1MJA A;  2FNA A;  1SD4 A;  1VQ9 I;  3M7G A;  4E70 A;  1NHA A;  1Z6T A;  1FBS A;  3GFJ A;  2A6T A;  5EZG A;  3U1K A;  3ZMD A;  1J75 A;  3PIP F;  3RSN A;  1ZLJ A;  3R0A A;  2MH9 A;  2HNH A;  1P7I A;  3F21 A;  4M71 A;  4LG3 A;  2R7O A;  3CCQ I;  4BJ6 C;  2B9S A;  1W7P D;  4QLC U;  4XM3 A;  5L3D A;  4Y52 J;  2K02 A;  4DOZ A;  1D8J A;  1TQM A;  1QVU A;  3CCV I;  3LOC A;  4RBO A;  1BIA A;  3FKI J;  3WHB A;  2R93 J;  4HNV A;  3FK6 A;  2NVQ J;  1R9T J;  3WHC A;  2KDZ A;  1I50 J;  1D0Z A;  1FWZ A;  1YW7 A;  2DFF A;  3TDU C;  3FIS A;  3VYR B;  1LFU P;  4N9I A;  2IEK A;  3FXU A;  4KT5 C;  4L5J A;  2OCC H;  4DBR A;  2JK3 A;  3E97 A;  4CSW A;  3CES A;  5EEG A;  4MQV A;  2EIN H;  4JOM A;  2V1U A;  1WJB A;  3EDP A;  2MSY A;  1BI1 A;  2EZI A;  2F5C A;  4E7I A;  2PN6 A;  2VOP A;  4CCJ A;  1STZ A;  2XAJ A;  2A61 A;  4PJ0 C;  3BTJ A;  5LLQ A;  3HOT A;  2VQG A;  1PUF B;  1VQM I;  5LGU A;  2VQC A;  1S3J A;  3P5J A;  4HOB A;  1UFM A;  2ZNZ A;  2P7V B;  4XLH A;  1V4R A;  9ANT A;  2G9W A;  4DW6 A;  3C18 A;  1VI0 A;  2FBH A;  2OU2 A;  1A36 A;  2AS5 F;  1U9O A;  4JBA A;  1XDS A;  5H6Q A;  2F5E A;  3LA2 A;  3L2W A;  5EG0 B;  2K3F A;  1Y56 A;  5F0F A;  3DBL B;  3IC7 A;  2H6B A;  2RNJ A;  1ACI A;  2DOD A;  4I76 A;  4YFN F;  2W1O A;  2A5W A;  2P5K A;  5FO5 A;  5J40 A;  1ZGA A;  2X6W A;  1KYZ A;  2O0Y A;  2VAS A;  4ZTJ A;  3LSG A;  4ETS A;  1KYW A;  1UHM A;  2FSW A;  1XMK A;  3IKV A;  4RS8 A;  3ZQL A;  2YS9 A;  3DPT A;  4EJW A;  3OYB A;  5TJJ A;  3RYP A;  4A0Z A;  4Y3O A;  5K5Q A;  4EM2 A;  4RAG A;  3GO5 A;  2HPM A;  2Z3Y A;  3EUH C;  1RR8 C;  4CZZ A;  2R92 J;  2DA5 A;  5B3S H;  3R60 A;  5F04 A;  4I6Z A;  4GXO A;  1BI3 A;  3BTL A;  2XPW A;  2E60 A;  3GZ5 A;  3QOD A;  4P96 A;  4AU7 A;  3K1N A;  2ELH A;  3KP7 A;  2K9M A;  4WXC A;  3RKW A;  2VBY A;  3DTE A;  2X1D A;  1OLT A;  2GQQ A;  2MGQ A;  4ITV A;  3RPQ A;  1T95 A;  3CQZ J;  1O3S A;  1ITY A;  3BR5 A;  4D9J A;  3OR2 C;  2PLY A;  1HC8 A;  5BPI A;  3OYH A;  2CGP A;  2PX9 A;  2UZK A;  5HS8 A;  2HDD A;  4NHJ A;  2L4M A;  3F72 A;  4Q5S F;  1X4P A;  1QU3 A;  5E1W A;  2KIQ A;  5J4Y A;  3BCB A;  2VL8 A;  1AOY A;  3I71 A;  3Q0U A;  3M8F A;  1D3Y A;  3RKY A;  3ZRG A;  5IP6 A;  2CQN A;  3CP8 A;  1ODD A;  5IPA A;  5DM7 F;  2HQN A;  2OPT A;  5DD8 A;  4G6D A;  5M3F J;  3GLX A;  1E3O C;  3AG3 H;  4IQJ A;  1REP C;  1ZEL A;  3KZI C;  4R8H A;  5IP7 J;  4ZC3 A;  4ESB A;  3OYA A;  3BJO A;  2Y30 A;  4AC0 A;  1VFC A;  3IAM 2;  2ZJP F;  4JK1 X;  2M5W A;  5BS6 A;  3KYD B;  1VQP I;  3M8J A;  4NQW B;  3EUA A;  4UNO A;  4EQQ A;  2DOE A;  3KYL A;  2STW A;  1EA3 A;  1O3R A;  2A07 F;  3QYE A;  5C3E J;  2HVS A;  2VQH A;  2FRH A;  1WPK A;  1W7P B;  4G7H F;  4RGR A;  1TWF J;  2X1C A;  5CPR B;  4OIR F;  3JRC A;  1O7F A;  3HEF A;  3HGG A;  4LJZ F;  2P0W A;  3HOW J;  3ROU A;  2UXN A;  3HXL A;  1ETY A;  2W25 A;  1LFP A;  3E3V A;  4KA4 A;  1JUS A;  1MSF C;  1C0W A;  4HST A;  3I54 A;  2L0K A;  1IO2 A;  3H9Q A;  3Q9S A;  5A2Q Z;  1ETV A;  3MQ0 A;  3S2H J;  2XGE A;  1HCR A;  3L7W A;  4MNU A;  5E3L A;  3BR0 A;  5E20 A;  2K9N A;  4YFK F;  5F64 A;  2MYS A;  4LMY A;  2CQQ A;  3G2B A;  1F1Z A;  4BNC A;  4PJL A;  1FBU A;  2K9S A;  4PZJ A;  2M30 A;  5AON A;  2DA2 A;  1V5F A;  4EJO A;  5JHF A;  3IAS 2;  2CJJ A;  3JTH A;  4IRI A;  4OIO F;  1D0X A;  1LDK B;  2DI3 A;  2DDB A;  5LGN A;  2L7M P;  2BXY A;  1FYL A;  3VSL A;  4IHW A;  3DEU A;  5D4S A;  4EJT A;  2YX4 A;  1J9I A;  5CVU A;  3LSM A;  2P6S A;  3QWL A;  2LSO A;  1NH3 A;  2LY9 A;  2ID3 A;  4NNJ A;  3G3Z A;  3PNT A;  4LFU A;  4NBQ A;  3VFZ A;  2KHM A;  3D5S C;  1QHG A;  4CUG A;  2XV4 S;  1X3W B;  2V1N A;  1RUO A;  1BOA A;  4IJA A;  4CCL A;  4IOA F;  4HNU A;  2OQG A;  4GDF A;  4FCY A;  3IRR A;  3S1M J;  3SYT A;  4ESF A;  5C4J J;  1Z21 A;  1X1P A;  1TBX A;  3JTG A;  4CDG A;  1R00 A;  3CTA A;  2KDO A;  4I0A A;  2QKL B;  3UNG C;  4XQF A;  4M9Z A;  2GM4 A;  1J59 A;  3D0S A;  1SD7 A;  2BW3 B;  4IHV A;  1IJW C;  1W5S A;  4LLG F;  1DP7 P;  1IXR C;  5EGO A;  4Y15 A;  3OYF A;  3VYT B;  1FNN A;  2LR8 A;  1QZY A;  3HJE A;  2L9R A;  1JHH A;  5H20 A;  2JPB A;  5HOD A;  1W0T A;  2V9P A;  4A3D J;  2ID6 A;  2BY1 A;  2OZU A;  3ABU A;  2ME0 A;  1IGN A;  2FEZ A;  1R58 A;  5LBQ A;  3M1E A;  2WAQ N;  3GCM A;  4HQM A;  3JSP A;  2JSP A;  1TNT A;  5TIS C;  1HSJ A;  2K5C A;  3Q0W A;  4N4N B;  2Y0S A;  1QPI A;  3S2W A;  1R49 A;  1AHD P;  1TT5 B;  2ZB9 A;  3KLO A;  5FKK A;  1QO0 D;  1Y1V J;  4AIH A;  1RUN A;  4N0B A;  2OCE A;  5EYR A;  4DZP A;  3CJN A;  5E3N A;  1IG7 A;  2GIV A;  3RYR A;  2V9K A;  2CW8 A;  2ECB A;  2HKX A;  3DKX A;  3HKZ N;  5J1Y A;  3OS1 A;  4BDY A;  1W36 D;  2E1M C;  4FHT A;  2CW0 F;  2K3P A;  1H88 C;  2CU7 A;  3HRS A;  1TQP A;  3DBR B;  3ZOB A;  5HLT A;  1E3P A;  3CCM I;  3RZD J;  3JRD A;  1K6O A;  3J7Y J;  2P5L C;  3S32 A;  2V26 A;  3BG9 A;  4BXF A;  1YLF A;  3GYH X;  4IOC F;  2ZSI B;  3L2C A;  3VOD A;  1OCR H;  4RB0 A;  2F5D A;  5L3B A;  3AL0 B;  2IJL A;  1MJB A;  3CDI A;  3HRM A;  4PGG A;  5JVT A;  1GVJ A;  3CJT B;  3QOE A;  4GYI A;  3K70 C;  2GXG A;  2MLG A;  3HM5 A;  1X3U A;  3RI4 A;  4F92 B;  2EV6 A;  3B73 A;  3ZR8 X;  1BC8 C;  1S5L C;  2EA2 A;  4F91 B;  3G4S I;  2EIL H;  1I6X A;  2XRL A;  1QGP A;  4MFD A;  2HDW A;  3OWT A;  2E7X A;  4GFB A;  1IUF A;  4M3D A;  3VYS B;  2KJB A;  2EZH A;  1MBG A;  1YJN I;  1OIS A;  3HTS B;  5F0C A;  2EJR A;  4RLF A;  5HDN A;  3EPZ A;  4WXH A;  2KIU A;  5J8C A;  2ZXH A;  3JAM Z;  1SD6 A;  4D7M A;  4OAZ A;  4D7N A;  3H9G A;  3SZP A;  5GTH C;  2PMU A;  4BY1 J;  2E1N A;  1G3T A;  2FF4 A;  1T38 A;  1EF4 A;  2KP6 A;  2RC4 A;  4E7K A;  4MTE A;  4XRM A;  2BY0 A;  2KZG A;  1E3H A;  3I9V 2;  4L0Z B;  1RI7 A;  2V9V A;  3JCU C;  1FTZ A;  1W36 C;  1OCC H;  4BE0 A;  4G6T B;  3ASO H;  3I0T A;  5FD6 A;  4XLA A;  2HTJ A;  3MD2 A;  3OS2 A;  3I53 A;  1OCO H;  3OIQ A;  2DQR A;  3ERM A;  4AD9 A;  3K4L A;  3W2W A;  3IHU A;  2LFB A;  3PUF A;  3CME I;  1L0O C;  4KUM A;  1XCB A;  2BGC A;  2HZT A;  1HKS A;  1O7L A;  5D6E A;  3NRV A;  1U8R A;  3MCZ A;  1UAA A;  5E79 C;  4RB3 C;  2HYF A;  1YIO A;  1BM9 A;  1K7A A;  2F4I A;  1VQ8 I;  5DS9 A;  1P92 A;  2HOA A;  5GAG J;  1N77 A;  1S7E A;  3CCY A;  2ZBK A;  4XID A;  4YRV A;  5BOX A;  1IXS B;  2JPC A;  2CRG A;  1ON2 A;  1YIT I;  2F4M B;  3COA C;  4A3L J;  3OYC A;  4C2T A;  4E4H A;  1AA7 A;  3R0J A;  1XGN A;  4Y4R A;  3OYN A;  4AIJ A;  2ZKZ A;  3A02 A;  5KK1 A;  3W6J B;  5LHI A;  1FPQ A;  1HXD A;  1R5I D;  1G3Y A;  1SVL A;  2BXZ A;  4A3G J;  3JR9 A;  2D5V A;  1A31 A;  3H0G J;  3I5U A;  2XGC A;  3LST A;  4YEJ A;  3ZMZ A;  2A6E F;  3D5R C;  1G8X A;  1XMX A;  4AVP A;  3WU1 B;  4HDV A;  3RJP A;  2NXN B;  3ABK H;  4JX6 A;  3GTG J;  3V4G A;  3IRQ A;  2EK5 A;  4XR6 A;  1CQT A;  2IBD A;  2YU9 J;  2LC2 A;  4XK4 A;  3LAP A;  4CHU A;  3R61 A;  2IS2 A;  3GTK J;  4A69 C;  2RNG A;  1MBE A;  2LYC A;  2CV1 A;  2NRA C;  3FZV A;  2CWE A;  3B02 A;  4RDU A;  2OTJ I;  3R4K A;  4UVA A;  2DFE A;  1S72 I;  4KYW A;  1OYY A;  4R1H A;  2O6G E;  2IP2 A;  3JRI A;  3P9C A;  1P9Q C;  4OOI A;  1W1W E;  2WWY A;  3BZ6 A;  1ZHF A;  3SXY A;  3MKY B;  3V8J A;  4RMN A;  2R5Y B;  1OCP A;  2D45 A;  2X1E A;  3A1Y A;  1FOX A;  3KZY A;  3ZQH A;  1FMW A;  1OR7 C;  1Y0U A;  4PJN A;  5HDK A;  5J6X A;  1D5Y A;  4BJ5 C;  1U6G A;  2CUZ A;  4BYY A;  4LIV A;  3CC2 I;  1LVA A;  2NOJ B;  2HVQ A;  2DTR A;  3SJM A;  2CO5 A;  3ZQC A;  4AWX B;  2OJE D;  3FXL A;  2VI6 A;  3KLN A;  1VQK I;  5B1B H;  3ZMV A;  2LD5 A;  4S0H B;  1S7A A;  3BWG A;  3DPL C;  1VQN I;  2COB A;  1NK2 P;  3E6D A;  4BEH A;  2DMU A;  3EET A;  3QPL A;  1ZR2 A;  4H4K C;  3V7R A;  1U2W A;  3A01 A;  5D5W B;  1YQA A;  1N75 A;  3RTR A;  2DA1 A;  2KMU A;  4IF4 A;  1FSE A;  2BV6 A;  4RM3 A;  2TRT A;  4D0P A;  4KIF A;  4HX7 A;  1SAN A;  4LG0 B;  1GDT A;  3DU5 A;  3DKY A;  3G1L A;  2G7H A;  3KEY A;  2QYO A;  4N4O B;  3Q0V A;  2HYG D;  3WGH A;  1APL C;  5JLX A;  4HX4 A;  3DFG A;  2XAU A;  5HS9 A;  1KU3 A;  1TW3 A;  3GW2 A;  1OCT C;  4KT6 A;  5FRO A;  1VF9 A;  5KAI C;  5K7Z A;  2CW7 A;  2Y31 A;  3PNV A;  4I09 A;  1UJ8 A;  2GLO A;  2C6Y A;  2CFO A;  4JQF A;  5DCM B;  5E3M A;  1AKH A;  2KJC A;  4J00 A;  2IPQ X;  2XSD C;  2FNP A;  1T56 A;  4ANJ A;  3F23 A;  3V7C A;  1SFK A;  1YI2 I;  2GXA A;  1W4M A;  1LEA A;  2DMP A;  2KPM A;  4RAZ A;  3PQK A;  2ELK A;  2WTE A;  2AXL A;  3OY9 A;  1MGT A;  2YUS A;  4Z2Y A;  1POG A;  1G59 A;  5DM6 F;  4M73 A;  2QM3 A;  1R23 A;  4F93 B;  4WX9 A;  3FXK A;  3ML6 A;  2ZJ2 A;  4EV0 A;  1P7J A;  2H8W A;  3BC8 A;  3LAJ A;  4C3I J;  4B43 A;  3HL2 A;  4D1Q A;  1YO5 C;  4HF2 A;  1F43 A;  1ETO A;  3BRO A;  1OR7 A;  1VZ0 A;  3GVA A;  3LSR A;  2FMY A;  3ASN H;  1LPQ A;  2ZME A;  3M9A A;  2ZXW H;  2R5Z A;  2RN7 A;  4Z6Y A;  2W24 A;  4DNC A;  1HDP A;  2MAB A;  4F52 A;  4ENJ A;  4WWC A;  1MH4 A;  5IP9 J;  5C44 J;  1RR7 A;  2L5Q A;  3GEZ A;  4UVC A;  2WAD A;  5LEJ A;  3E6B A;  2XF6 A;  1I1G A;  4UVB A;  2MH2 A;  2L9S A;  2XKP A;  4M3B A;  2LBF B;  3MZH A;  5FRM A;  3MKW B;  1ZKG A;  2RKH A;  3FX3 A;  2VN2 A;  4DGW B;  3IUO A;  3ZMS A;  1U9N A;  5D8L B;  1QNT A;  1BC7 C;  3IWF A;  3W6V A;  4JX4 A;  1ZQ3 P;  4NDL A;  3ZCO A;  5AIQ A;  4LK1 F;  2AHQ A;  3SQN A;  1B72 B;  2K9L A;  1S6L A;  2VJ4 A;  4IO9 F;  3A4C A;  4KIG A;  5CVJ A;  3ZPL A;  2MLK A;  3FXR A;  1D1B A;  1JKO C;  3PFI A;  1XS9 A;  1WH5 A;  4DIQ A;  5M5Y J;  4RA2 A;  2VBX A;  2FX0 A;  4ZH4 F;  4O6J A;  4OAY A;  5FKL A;  3O8H A;  3BJ6 A;  4HLY A;  1GXP A;  1XG1 A;  1PP8 F;  3J80 Z;  4MEX F;  2V1D A;  3CCR I;  2JSC A;  2ETH A;  4G12 A;  1QZE A;  2PJR A;  1SD5 A;  2CQK A;  3K4M A;  5LGT A;  2LKP A;  3ZQG A;  3ZQF A;  4FT8 A;  2TCT A;  1ZG3 A;  3J81 Z;  3LA3 A;  2QQ8 A;  2VON A;  3H3V K;  4B3A A;  2K27 A;  4B44 A;  3L9F A;  3T5X A;  2IS4 A;  1Z0X A;  3K2Z A;  1CF7 A;  4BAC A;  2QF7 A;  1IRZ A;  1FC3 A;  5DUI A;  1IUY A;  2CSO A;  2LMD A;  1XSX A;  3U1D A;  5C4X J;  4AUX A;  1HBX G;  3VB2 A;  3K69 A;  2UUZ A;  5LRS A;  1Y8Q B;  2L4A A;  4G94 A;  1DPU A;  3M1C A;  1FYM A;  2HOS A;  2A69 F;  2GXB A;  4OIP F;  1YS6 A;  2TDX A;  1EKE A;  1MBF A;  3HHH A;  1D0Y A;  3BCA A;  2CV2 A;  4A3E J;  4YG2 F;  4A0Y A;  1P4W A;  3KIO A;  3Q5F A;  1SMY F;  4LB5 A;  3J7A Y;  5LEK A;  1EJ9 A;  4XOT A;  5ERI A;  4EEF G;  3W6K B;  1SEU A;  5CLS A;  1QBJ A;  1WI3 A;  2HGC A;  1ZAR A;  5EEH A;  3ZN1 A;  3HOZ J;  2H27 A;  1I3Q J;  2Q8K A;  1TT0 A;  5DEQ A;  1FTT A;  3F3X A;  2NVU B;  4JX5 A;  3GZN B;  4OIN F;  3MFK A;  1E17 A;  1T0F A;  1BW6 A;  4BKX A;  1IXC A;  2V6C A;  3WTW C;  1K4S A;  1NK3 P;  2DN0 A;  2E5N A;  5FB2 A;  4XRF A;  3GTP J;  2PMH A;  4A3K J;  4KJZ A;  2LK2 A;  3D5L A;  3RPU A;  3MKZ A;  1RNL A;  4A3M J;  5FRN A;  1X58 A;  2DO7 A;  3D1N I;  3LSI A;  1HQC A;  3IL2 A;  3NEU A;  2PBI A;  2P4W A;  1WRJ A;  4CYC B;  1ZN2 A;  1WHU A;  4JP0 A;  3OOP A;  2CQX A;  1PDN C;  3VOE A;  4IKF A;  2E19 A;  1I27 A;  3MZY A;  5CVV A;  2VJI A;  2IVM A;  2ACJ A;  4ZDL A;  2VB6 A;  1S29 A;  2DXI A;  1LEB A;  4NUB A;  1GV2 A;  2VJJ A;  1LDJ A;  2FJ1 A;  1KGS A;  5FFX A;  2Q2E B;  4XLP F;  1QQI A;  4N9H A;  4NC8 A;  3CCE I;  1MMN A;  3HOV J;  4UB8 C;  2MD5 A;  1GT0 C;  3HUG A;  4BE1 A;  1UHW A;  3SDG A;  3L2R A;  2KIM A;  1ETK A;  1BA5 A;  5F08 A;  3LSK A;  1HW1 A;  4ENK A;  2I10 A;  3E6C C;  2BVL A;  2V7F A;  1K78 A;  3WE2 A;  2LVS A;  2K40 A;  2X6Y A;  2EFP A;  2IXS A;  1PJR A;  1W5C C;  2K7L A;  5D5V B;  5HNF A;  1KQ0 A;  2A05 A;  3FHN A;  1YIJ I;  2L3D A;  2EH3 A;  3WOD F;  3I64 A;  4I99 C;  4I2O A;  4Q48 A;  3PIO F;  2XAQ A;  2FA5 A;  2R7F A;  1UG2 A;  4RGX A;  1WJ5 A;  3OSG A;  1USS A;  3TW6 A;  4AYB A;  2LH9 A;  2XAF A;  3R6S A;  2DA7 A;  3PO3 J;  1J7K A;  4A12 A;  5JFR A;  1JKR C;  2R7S A;  2MW8 A;  1SVM A;  2RDP A;  4CCM A;  1ZRF A;  1WVR A;  2FU4 A;  2PG4 A;  3KCC A;  3LA7 A;  5J47 A;  5FGM A;  5E1X A;  3F22 A;  2VKE A;  1FP1 D;  2HQA A;  1MBJ A;  2W48 A;  3J80 K;  4ZZL A;  3FMR A;  4IVN A;  4EGY A;  3OL4 A;  1LE8 A;  1EH6 A;  1WGX A;  2DFI A;  1A35 A;  1JHF A;  3G1M A;  1F5T A;  4A0X A;  2L9N A;  5KAF C;  3LSJ A;  1B9M A;  4EJU A;  1LB2 A;  4WK8 F;  4HDU A;  4HF1 A;  4LLL A;  4CCK A;  3TP0 A;  3DWL E;  3K4K A;  3MZ8 A;  2X48 A;  3S2D J;  3V7S A;  1GXQ A;  2D1H A;  5IYC J;  4LIU A;  4BQO A;  4Y33 A;  5DTD A;  3KEO A;  4AIK A;  2Y0M A;  2VXD A;  1MMD A;  3H3U A;  1YRN A;  4B1R A;  1OQY A;  1Z67 A;  2Y75 A;  4ZYE A;  2CFX A;  2XAG A;  4RGS A;  3SEQ A;  1V5E A;  3LWF A;  3ZQ7 A;  2VPL A;  5CJ9 A;  4Y17 A;  3ZXS A;  4BHP A;  3GME A;  3HRT A;  3P9K A;  5ILU A;  4IRH A;  4B8X A;  3FXO A;  3K1M A;  2KZV A;  1Z7L A;  1MMS A;  1GUU A;  3KP4 A;  3AAF A;  2CUE A;  1W7P A;  1BR4 A;  2J5O A;  2HXO A;  4KN4 X;  4ZJZ A;  2GWR A;  2Y2Z A;  3IV5 A;  4JYK A;  1R36 A;  2M87 A;  4UHT A;  3K7A J;  1X1C A;  4DZJ A;  4M74 A;  2PMZ A;  5J1U A;  5DCF A;  1BJA A;  4HG2 A;  3L00 A;  3H5A A;  1I6H J;  1IZ1 A;  1JXS A;  1Z91 A;  1WI9 A;  2K86 A;  3WTV C;  2XVC A;  3PFY A;  2JJ7 A;  2F5F A;  2Q0O A;  1MBH A;  3H3Z A;  4Q47 A;  4XNF A;  2O8X A;  1BIB A;  3QPT A;  1DP3 A;  2ZC2 A;  4NC6 A;  4MO7 A;  3M07 A;  1T8I A;  4CGZ A;  1O3Q A;  4XOR A;  4ESJ A;  1Q1H A;  3CUQ C;  4ENN A;  1K83 J;  1WFX A;  1JJ8 C;  3CF5 F;  1MZB A;  3Q3S A;  3F8N A;  2DU9 A;  2CH0 A;  3FHZ A;  3CCS I;  2E5Z A;  3IH4 A;  5JI6 A;  1I5Z A;  4HA8 A;  4BQN A;  1FSH A;  2CYY A;  2VIX A;  3DV8 A;  2W84 A;  5D6F A;  2RGV A;  1A6I A;  1K79 A;  2IA2 A;  3GWZ A;  4U0Y A;  4CCN A;  2Y9Z A;  3TL4 X;  4FX4 A;  1FOW A;  2HEO A;  3VWB A;  2GZW A;  2JUC A;  4XN3 A;  1IRX A;  1RRJ A;  3VSK A;  1B59 A;  3WTX C;  1J09 A;  1BI0 A;  1R22 A;  5J4V A;  1WH7 A;  2K9Q A;  1DGR M;  2CS3 A;  2X4H A;  2Y0S N;  5E8G A;  4LD5 A;  1B8I A;  1EH8 A;  5GPC A;  4KDP A;  5LHH A;  2VXZ A;  3FXQ A;  4LLN A;  3K70 D;  2KRH A;  1WJE A;  3ECO A;  1RKT A;  3MAJ A;  4QSH A;  4BJT A;  2O9L A;  2FOW A;  2E2I J;  2EZL A;  3K4B A;  3X2Q H;  4G8X A;  4M9S A;  5TRD A;  1QRY A;  1ULY A;  1MND A;  5E1Z B;  4QIW N;  2HZD A;  3ABM H;  1HW5 A;  3FXJ A;  4M72 A;  4CIC A;  1MNM C;  1I1S A;  1LKX A;  4XLE A;  5EGO B;  3KYC B;  3S3M A;  1UST A;  1RET A;  2DK8 A;  1U0J A;  3C2H A;  3OOU A;  1WJA A;  4WF2 A;  2B63 J;  1HW2 A;  4HLX A;  3HSF A;  2L7Z A;  5DDG A;  2W7N A;  1PUE E;  4IHT A;  4G7Z F;  2DA4 A;  3HB9 A;  2YPR A;  1TWG J;  3F8M A;  3QU3 A;  1R71 A;  1FLI A;  5B66 C;  1XMA A;  4E7S A;  2DMT A;  4ZDP A;  1FOK A;  3A0B C;  1TC3 C;  5HS7 A;  1S9H A;  3AG4 H;  2QUF A;  2QEX I;  3OL3 A;  3CUQ A;  2V4J C;  3HOX J;  3MEX A;  4B3X A;  2XF7 A;  3H9J A;  1TTY A;  1KU7 A;  1VQ6 I;  3ERE D;  2KIS A;  2G0E A;  2X0L A;  2ZFU A;  4EM1 A;  4BHB A;  3BZC A;  2JA6 J;  3WU0 A;  3S8P A;  5H2F C;  3OYD A;  3JSO A;  2LG4 A;  2F48 A;  4FE4 A;  5JLW A;  4GRI A;  3S3N A;  2VUM J;  2DPU A;  1R5H A;  5ICC A;  3C7J A;  1J5Y A;  3LL7 A;  3JRG A;  4UY8 I;  3S14 J;  4PJM A;  1JKQ C;  3GUD A;  2JQ7 A;  2IS6 A;  2JMW A;  3O6B B;  1MSE C;  4FE7 A;  3BG5 A;  4GO1 A;  2LP0 A;  3QOP A;  4FAS D;  5A2Q K;  1RES A;  2FBI A;  5DUK A;  5KVR A;  3TO9 A;  2QCO A;  2MG4 A;  4DYR A;  5EF6 A;  3L2U A;  4YEL A;  1MDM A;  3N4M A;  1D5V A;  2L7K A;  3GTJ J;  3CLQ A;  3KP6 A;  1M1E B;  5BPD A;  1MBK A;  5IT9 Z;  1ETQ A;  1XDU A;  5F6F A;  5GTI C;  1WJC A;  2LLK A;  4MIM A;  2JWT A;  1UCR A;  1WWX A;  3REO A;  1A04 A;  4LOC A;  3RKX A;  3HSE A;  2BVM A;  1RC9 A;  4U7D A;  6PAX A;  4KMF A;  4J01 A;  3KET A;  2BHZ A;  2DK5 A;  1WCM J;  4P9U A;  3OSF A;  4BL0 B;  3CC7 I;  2KLO A;  5H6R A;  3GFI A;  2K4B A;  1JGG A;  4V19 K;  1RIO H;  3KP3 A;  4FET A;  2WAE A;  2L2O A;  4Y13 A;  3BQY A;  4B48 A;  3M3Y J;  2P7C B;  1BI2 A;  3SZG A;  1BR1 A;  5J1R A;  2EIJ H;  3HRU A;  1VND A;  1SVO A;  3MN2 A;  4PJJ A;  4X6A J;  4CH7 A;  3HHG A;  5M3M J;  2WY8 Q;  2M4K A;  2PI0 A;  2M7A A;  4V2F A;  1GVD A;  4TV7 A;  2L01 A;  2QKM B;  3K1P A;  3LSH A;  3FMQ A;  3ABL H;  1ZRE A;  3NAU A;  1TNS A;  2DA6 A;  2E1M B;  5DV5 A;  4I02 A;  2AO9 A;  2VC1 A;  2HWV A;  1TL8 A;  1Z05 A;  1OKR A;  4I0B A;  4WCG A;  1G3S A;  4U7B A;  2QBY B;  2O7O A;  5KNL A;  2WV1 A;  2M3A A;  2MFZ A;  2CG4 A;  3IH3 A;  3SZT A;  4XL9 A;  2BY2 A;  1LNW A;  2NVT J;  3ABT A;  1MH3 A;  4HQE A;  2JUG A;  5F1J A;  1IAW A;  4P55 A;  4CO8 A;  1IN7 A;  4FTH A;  1J2X A;  2EFO A;  1HA8 A;  2IGK A;  3E7L A;  5FJ8 J;  4R79 A;  2H8R A;  3QYB A;  4UUS B;  2IAI A;  4KN7 X;  1DQU A;  1DU0 A;  1IN5 A;  2E71 A;  1U8B A;  1NG7 A;  1OJL A;  2KL4 A;  1IDY A;  1FP2 A;  3GLL A;  4HPQ A;  5L3F A;  2CQ7 A;  2EPF A;  1V54 H;  2ICW G;  3ZQQ A;  1YS7 A;  4YIR X;  3S3O A;  2VBZ A;  5D5U B;  1OPC A;  1IRF A;  3KFW X;  2M0C A;  2LF8 A;  1JT0 A;  2ZME C;  2R4G A;  4IQ4 A;  1YFH A;  4IEJ A;  2B0L A;  4II2 A;  2M9H A;  3NWT A;  3BZK A;  2O03 A;  2FD5 A;  2X51 A;  4UV9 A;  2IS1 A;  2HOT A;  1DPR A;  1T39 A;  4KIC A;  3GFM A;  4RAF A;  5IYD J;  4KIS A;  3HIF A;  2WBM A;  4EJV A;  2JVG A;  3ZMT A;  1K6Y A;  2CUJ A;  2K85 A;  4EVI A;  4RAY A;  1TP4 A;  3AKZ A;  3K2A A;  4O5V A;  1ETX A;  2XGX A;  4HSR A;  1RPW A;  4RGU A;  2OA4 A;  2N8G A;  3V8K A;  3TOA A;  4BEH B;  2F5V A;  2WAF A;  1HST A;  1G3W A;  4UUT A;  1XX5 A;  1YJ9 I;  3IKT A;  3A01 B;  3V42 A;  2IA0 A;  2R7D A;  2MC4 A;  4DQ2 A;  4IRG A;  2XF5 A;  3TW7 A;  3ZMU A;  4LIT A;  1R5G A;  1Y0N A;  1JGS A;  5KCM A;  3BG3 A;  5D4R A;  1MD0 A;  1JI8 A;  2X6O A;  3CZ6 A;  4YIF A;  1TZL A;  1X1D A;  1I3A A;  2M7B A;  4LG0 A;  1XGO A;  3JAM K;  3LMM A;  3JRE A;  1R1U A;  1R4N B;  5GAD J;  5IT9 K;  4BXX J;  1BN5 A;  2YR2 A;  2Q1Z B;  3KP5 A;  5L3G A;  1YJW I;  5L3E A;  1U5T C;  3RDI A;  4DYC A;  2FML A;  5EEA A;  3BG7 A;  2L7F P;  3GTQ J;  2YSR A;  1GV5 A;  3RPU D;  2JRM A;  1IW7 F;  4PSW A;  3H92 A;  3TO7 A;  2D2W A;  2OTL I;  3JRF A;  1O57 A;  1IRG A;  1OYW A;  1AKH B;  2XAS A;  5DCM A;  2JA2 A;  3FF5 A;  2H94 A;  3W2V A;  2RQQ A;  2WY7 Q;  2LY2 A;  3LNQ A;  1HKQ A;  5CKT A;  2P81 A;  3OR1 C;  1XC5 A;  4BBR J;  1VTN C;  3LFU A;  2LKS A;  2M2E A;  4W97 A;  3I58 A;  2VE9 A;  2QLZ A;  5KHD A;  4DYQ A;  1MKM A;  1MMG A;  1WZ2 A;  1YX3 A;  4CXF A;  1XD7 A;  4A93 J;  2NOG A;  3BDD A;  2Z16 A;  4M9X A;  1OYI A;  3BLY A;  3GBG A;  5J8F A;  5HLG A;  3A03 A;  3I59 B;  1FBQ A;  1ZR4 A;  1D1C A;  3MMY B;  1ZG5 A;  5GAH J;  2G7U A;  2V79 A;  1YYV A;  3W2A A;  5B1A H;  3CCU I;  1F9N A;  2J5P A;  1H9G A;  4M3G A;  4BDZ A;  1A6Q A;  3U2R A;  1T6S A;  4M3E A;  1IV6 A;  1T0F C;  2NVX J;  1KA8 A;  3S1Q J;  1KZH A;  4ABZ A;  4ZDO A;  2IW5 A;  3G73 A;  3WG9 A;  1X19 A;  4QPQ A;  3PNY A;  1PYV A;  2Z9O A;  2BYV E;  4PFO A; 
#chains in the Genus database with same CATH homology
 1UG2 A;  4C3J J;  3OSG A;  3JRA A;  2EQR A;  3TW6 A;  5EGO A;  2R0Q C;  2LR8 A;  1HOM A;  2DA7 A;  3DCF A;  3PO3 J;  3S1R J;  3S1N J;  1JKR C;  2L9R A;  3RKQ A;  1B72 A;  5HOD A;  1W0T A;  2MW8 A;  4A3D J;  2ID6 A;  1IGN A;  2ME0 A;  4UUS A;  2WAQ N;  2VKE A;  3Q0W A;  4X1E A;  5M5W J;  2H1K A;  1MBJ A;  2W48 A;  4A3B J;  1QPI A;  1JKP C;  1Z77 A;  1AHD P;  2GBY A;  2R5Y A;  2ZB9 A;  2ME6 A;  5FKK A;  1LE8 A;  1WGX A;  5FKO A;  1Y1V J;  3S17 J;  3G1M A;  5EYR A;  4DZP A;  3LSJ A;  5E3N A;  1IG7 A;  1ENH A;  2ECB A;  3HKZ N;  5J1Y A;  1H88 C;  3TP0 A;  1UHS A;  2HI3 A;  2X48 A;  3BQZ A;  5M5X J;  3S2D J;  5IYC J;  2CU7 A;  2LTP A;  1JUM A;  1NTC A;  3ZOB A;  5DTD A;  3RZD J;  4XRS A;  1X2M A;  3JRD A;  1HF0 A;  1YRN A;  1ORK A;  3BG9 A;  4B1R A;  3JRB A;  1ZGW A;  2Y9Y A;  4A3C J;  5FLM J;  1DU6 A;  3PM1 A;  4MLO A;  2XB5 A;  1BL0 A;  3HDD A;  3S16 J;  3HM5 A;  3OIO A;  3HBL A;  5F0H A;  1IC8 A;  1GUU A;  2XRL A;  4C2M J;  2CUE A;  3BT9 A;  2HXO A;  4MFD A;  3GTO J;  3PO2 J;  1LFB A;  4GFB A;  1FJL A;  1IUF A;  4M3D A;  2Y2Z A;  3IV5 A;  3L1P A;  2EZH A;  3HOU J;  1MBG A;  4JYK A;  3F0C A;  3K7A J;  2DJN A;  5F0C A;  4DZJ A;  4A3J J;  1Q1V A;  5F27 A;  5J1U A;  1JTX A;  4IHY A;  4D7M A;  4D7N A;  2JA8 J;  4V2G A;  1I6H J;  4BY1 J;  3BR3 A;  1EF4 A;  2E1O A;  3I4N J;  3GTM J;  4XRM A;  2JJ7 A;  1MBH A;  1FTZ A;  1PUF A;  1H8A C;  4MO7 A;  1ETW A;  4W1U A;  1OFC X;  1K83 J;  3FK7 A;  1JJ8 C;  1JTY A;  3Q3S A;  2LFB A;  4CYC A;  4C3H J;  3BR2 A;  5EZH A;  2XPV A;  1FIA A;  3IH4 A;  2RAE A;  5EG0 A;  3BR1 A;  4XRS G;  5DS9 A;  2HOA A;  1JJ6 C;  1S7E A;  5E3O A;  3CCY A;  2XPU A;  4AYB N;  4XID A;  2R5Z B;  1A6I A;  2CRG A;  5K7F A;  2Y9Z A;  1QVT A;  2JA7 J;  3B6A A;  4A3L J;  5GP9 A;  1G2H A;  1A5J A;  1WH7 A;  3A02 A;  2K9Q A;  3MVP A;  2Y0S N;  1B8I A;  3CMY A;  3SFI A;  4XIC A;  5GPC A;  2M8G X;  2HYJ A;  4A3G J;  1RKT A;  2VKV A;  4QSH A;  3JR9 A;  2D5V A;  1FIP A;  2O9L A;  2VPR A;  2EZL A;  2E2I J;  3H0G J;  2XGC A;  1QRY A;  3FIW A;  1T33 A;  4JX6 A;  3GTG J;  4QIW N;  3HOY J;  1MNM C;  1CQT A;  2IBD A;  2YU9 J;  1TWA J;  4XK4 A;  1IDZ A;  3GTK J;  4A69 C;  1MBE A;  3C2B A;  1F36 A;  3LSP A;  5EGO B;  1RET A;  3RZO J;  4RDU A;  2DA3 A;  3OOU A;  2R7Z J;  2WB1 N;  1AU7 A;  2DMQ A;  5GPA A;  1HDD C;  2B63 J;  3S15 J;  2E2H J;  3JRI A;  2L7Z A;  3CDL A;  5FLV A;  1BW5 A;  2DA4 A;  3HB9 A;  4QTR A;  2R5Y B;  1TWG J;  4D5C A;  3TED A;  1RKW A;  2O8K A;  1OCP A;  1LE8 B;  3IH2 A;  4L5E A;  2ECC A;  3RQI A;  5IYB J;  3ZQH A;  5FKM A;  2JA5 J;  2DMT A;  2OF7 A;  3DEW A;  1TC3 C;  2LKX A;  1D5Y A;  1BJZ A;  4A3F J;  4BY7 J;  3HOX J;  3SJM A;  2HXI A;  5EZG A;  3ZQC A;  3G1O A;  2VI6 A;  2LD5 A;  4S0H B;  2M34 A;  1P7I A;  2COB A;  2FQ4 A;  2G0E A;  2PMZ N;  1NK2 P;  1YRN B;  2DMU A;  3QPL A;  1ZR2 A;  2JA6 J;  3A01 A;  4FE4 A;  5JLW A;  2DA1 A;  2VUM J;  4Y7N J;  2JN6 A;  3JRG A;  4Y52 J;  3MKL A;  3S14 J;  2TRT A;  1JKQ C;  1QVU A;  1SAN A;  3LOC A;  4RBO A;  1GDT A;  3G1L A;  2JMW A;  1MSE C;  4FE7 A;  3BG5 A;  3FKI J;  3WHB A;  2R93 J;  4HNV A;  3FK6 A;  2NVQ J;  1R9T J;  3Q0V A;  1APL C;  2LP0 A;  3WHC A;  1RES A;  5EF6 A;  5JLX A;  4DYR A;  2KDZ A;  2QCO A;  1I50 J;  2MG4 A;  1ZK8 A;  3GTJ J;  1MBK A;  3FIS A;  1ETQ A;  1OCT C;  5K7Z A;  1VF9 A;  2LLK A;  5J3L A;  2IEK A;  2Y31 A;  4MIM A;  2JWT A;  1LFU P;  2NVY J;  2GLO A;  4LOC A;  1AKH A;  5E3M A;  2JK3 A;  2XSD C;  1T56 A;  1WCM J;  3OSF A;  2MSY A;  2EZI A;  4A3I J;  2DTZ A;  1X2N A;  2DMP A;  3BTJ A;  4IHX A;  2ELK A;  1PUF B;  1JGG A;  2YUS A;  1POG A;  9ANT A;  3BQY A;  4DW6 A;  1VI0 A;  2NS7 A;  3M3Y J;  5J1R A;  1U9O A;  1FEX A;  1P7J A;  1VND A;  3MN2 A;  3QQA A;  5EG0 B;  4C3I J;  4X6A J;  5M3M J;  5IOZ A;  1Y1W J;  4V2F A;  5F0F A;  1F43 A;  1GVD A;  1ETO A;  3LSR A;  4I76 A;  3NAU A;  3B6C A;  2DA6 A;  2HQ5 A;  2R5Z A;  1HDP A;  2AO9 A;  3LSG A;  1MH4 A;  5IP9 J;  5C44 J;  2KT0 A;  1RR7 A;  3JRH A;  3ZQL A;  2YS9 A;  2O7O A;  3BTC A;  1ZTR A;  3UKG A;  2WV1 A;  1B8I B;  3IH3 A;  4M3B A;  1ZKG A;  2NVT J;  2CUF A;  1MH3 A;  2R92 J;  2DA5 A;  1U9N A;  5F1J A;  5F04 A;  1TWH J;  4I6Z A;  4JX4 A;  3W6V A;  3BTL A;  4NDL A;  3HGY A;  1ZQ3 P;  4FTH A;  2AHQ A;  2XPW A;  1B72 B;  3E7L A;  5FJ8 J;  2H8R A;  4UUS B;  1U78 A;  4MFE A;  2IAI A;  1DU0 A;  4M3F A;  1U8B A;  1O4X A;  1JKO C;  1OJL A;  1XS9 A;  1IDY A;  2MGQ A;  1WH5 A;  5M5Y J;  3CQZ J;  2FX0 A;  3BR5 A;  1ITY A;  5FKL A;  3O8H A;  2EZK A;  1W0U A;  1UMQ A;  1XG1 A;  2M0C A;  2HDD A;  2X9D A;  4G12 A;  1JT0 A;  4IEJ A;  3ZQG A;  2M9H A;  3ZQF A;  3BR6 A;  2TCT A;  2FD5 A;  5EDN A;  3Q0U A;  2HOT A;  3H3V K;  3M4O J;  5IP6 A;  5IPA A;  4B3A A;  5IYD J;  2OPT A;  5M3F J;  4J19 A;  2DMN A;  1E3O C;  1Z0X A;  5IP7 J;  2Y30 A;  3K2A A;  4AC0 A;  2QF7 A;  1ETX A;  1VFC A;  1IRZ A;  3TP3 A;  1RPW A;  2N8G A;  1SFO J;  4UUT A;  5C4X J;  4BBS J;  4AUX A;  1JT6 A;  3A01 B;  3TW7 A;  3GTL J;  2E2J J;  5C3E J;  4M6V A;  3BG3 A;  2HOS A;  2X6O A;  1WPK A;  2XGD A;  1TWF J;  1MBF A;  3JRC A;  4A3E J;  3JRE A;  4FIS A;  3HEF A;  1K61 A;  3HGG A;  4EEF G;  3HOW J;  4BXX J;  1ETY A;  1WI3 A;  1JUS A;  1MSF C;  3HOZ J;  1I3Q J;  3I4M J;  4DYC A;  1FTT A;  2L0K A;  3O8G A;  5K7H A;  4JX5 A;  5BNG A;  5EEA A;  2L7F P;  3GTQ J;  1BW6 A;  2EBI A;  1ETV A;  4BKX A;  1H89 C;  1GV5 A;  2XGE A;  1HCR A;  3S2H J;  1NK3 P;  5E3L A;  3BR0 A;  2DN0 A;  3JRF A;  1JUP A;  2K9N A;  1AKH B;  3GTP J;  5FKN A;  3QPS A;  4A3K J;  2LK2 A;  2CQQ A;  4A3M J;  2K9S A;  1X58 A;  3D1N I;  3LNQ A;  2P81 A;  4D5F A;  2DA2 A;  1XC5 A;  4BBR J;  4CYC B;  2CJJ A;  4JP0 A;  2M2E A;  2CQX A;  4W97 A;  2L7M P;  2E19 A;  4B4C A;  4DYQ A;  4IHW A;  3ZQI A;  3VPR A;  1GV2 A;  4A93 J;  2FJ1 A;  2LY9 A;  2ID3 A;  2NOG A;  3HOV J;  1GT0 C;  3SDG A;  3GBG A;  3A03 A;  1ZR4 A;  3NAR A;  1ETK A;  1BA5 A;  5F08 A;  4FCY A;  3S1M J;  4M3G A;  2I10 A;  1HLV A;  4M3E A;  1IV6 A;  5C4J J;  2LVS A;  2NVX J;  2NS8 A;  2K40 A;  3S1Q J;  4ABZ A;  2GM4 A;  2XB0 X;  2EH3 A;  5IOY A;  3BTI A;  4IHV A;  1IJW C;  1TWC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...