3HOWJ

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3howJ00
2W48A 2JMWA 5JLWA 2LD5A 2HDDA 3H0GJ 1AKHA 3HGYA 2TCTA 4FE4A 3HOZJ 1IRZA 3OSFA 1IDYA 4A3CJ 1MH4A 1IJWC 1XS9A 2R93J 2AO9A 3TP3A 2VKVA 3TW7A 1P7JA 5F08A 3JRFA 1SANA 4V2GA 1JKQC 2ID6A 2Y30A 1JUPA 1H8AC 2R92J 5FKMA 1JTXA 5IYCJ 4LOCA 2LVSA 4MIMA 1FTZA 5EEAA 5IOZA 1ETOA 1MH3A 5EGOA 3QPLA 1RESA 4IHYA 1OCTC 4V2FA 2VI6A 2DA2A 2CUFA 1ZK8A 1RR7A 4AUXA 1UHSA 2NS8A 4DW6A 2KT0A 3HOUJ 1K83J 4CYCA 3FIWA 2ME0A 4S0HB 2ECCA 2HYJA 1TC3C 2CRGA 2LKXA 2LP0A 3BR3A 5FJ8J 3PO2J 1QVTA 3HKZN 3Q0UA 4GFBA 5E3MA 1NK2P 1XC5A 3LOCA 2DMUA 4DYRA 2EZIA 3JRGA 4QSHA 4A3GJ 5M5WJ 1FTTA 2ME6A 1MSEC 5IOYA 3F0CA 5IP9J 2DJNA 1LE8B 1T33A 3BQZA 2HXIA 4XK4A 4A3JJ 3TW6A 2QCOA 5EGOB 4M3BA 5FKKA 3JRHA 2CU7A 3S1NJ 1OCPA 1JUMA 4A3IJ 3BG5A 1MBHA 1EF4A 1MNMC 1NTCA 2CUEA 2H8RA 2IEKA 1HF0A 2GLOA 3NAUA 2K9SA 3Q0VA 3GTQJ 2CQQA 3O8GA 2Y9ZA 2JA6J 2CJJA 2IAIA 2B63J 3LSPA 2JN6A 2XSDC 2X6OA 3Q3SA 2X48A 3JRIA 2LY9A 2VUMJ 1VI0A 3WHCA 3BG3A 2FX0A 2IBDA 2XB5A 5IP7J 2XPVA 3HBLA 4A3KJ 1BA5A 5C3EJ 3ZQGA 2WV1A 3TEDA 4XICA 1O4XA 4X6AJ 3GBGA 3CCYA 2LK2A 2DA6A 4JX6A 1JT0A 2MGQA 4HNVA 4FISA 4Y52J 4A3DJ 1WPKA 4QTRA 4MFDA 3PO3J 1G2HA 2CQXA 5M3MJ 3HDDA 3GTKJ 2WAQN 1ZTRA 2MSYA 4M3GA 4MFEA 1BL0A 3GTLJ 5M3FJ 1RETA 1XG1A 1BW6A 3HEFA 3SFIA 3HOVJ 2N8GA 2L0KA 4A93J 4C3JJ 3M4OJ 2LLKA 1Y1VJ 1HOMA 1A6IA 2M8GX 2Y0SN 3CDLA 3GTMJ 3GTOJ 1Z77A 2YUSA 4C3IJ 3JRAA 1B8IA 2HQ5A 1Q1VA 3BT9A 2EZHA 4QIWN 2DMTA 1POGA 1RKWA 2EQRA 5FKNA 4XRMA 4DYCA 1AU7A 4L5EA 1MBKA 1WH5A 5J1RA 2DA4A 3A01A 1DU6A 1E3OC 1OFCX 2OF7A 3RKQA 3I4NJ 3Q0WA 4DZJA 2JJ7A 2K40A 5J3LA 1NK3P 1Z0XA 4B3AA 2JA7J 1I3QJ 2NVXJ 3G1LA 2XGDA 5M5YJ 3SDGA 5EDNA 1R9TJ 2R7ZJ 1IUFA 1X58A 3K7AJ 5JLXA 4DYQA 2MW8A 3ZQHA 5GPAA 1X2NA 4UUSB 1D5YA 1ETXA 2M2EA 2O9LA 5EZHA 4Y7NJ 4I6ZA 1AHDP 2XRLA 2E2JJ 3JR9A 5E3LA 3NARA 4D7MA 5J1UA 2OPTA 4A3LJ 2DA3A 3MN2A 2O8KA 1VFCA 1LFBA 1ZKGA 2RAEA 5EZGA 1ZR4A 1JKPC 2EZKA 2R5ZB 1W0UA 3C2BA 2JWTA 4CYCB 1GUUA 5C44J 4D5FA 1GVDA 5GPCA 1APLC 5E3OA 2ECBA 2NVQJ 1MBEA 2M34A 3QPSA 5HODA 1U9OA 2K9QA 2VKEA 1P7IA 2D5VA 1JTYA 5F1JA 4B1RA 3BR6A 4G12A 3JREA 1UG2A 4UUSA 3BTCA 4J19A 5K7HA 3DCFA 1VNDA 4EEFG 5F0HA 1HDPA 1A5JA 4W1UA 2AHQA 1BW5A 5EYRA 2ELKA 4I76A 3FKIJ 1MBFA 5GP9A 1S7EA 1IDZA 4M6VA 4A3EJ 4B4CA 2JA8J 1QPIA 2I10A 1FIAA 1WCMJ 3LSGA 3PM1A 1F36A 1GV2A 3JRBA 4RDUA 1OJLA 4XIDA 3FK7A 1MBGA 1TWFJ 3BTIA 2DMQA 3ZQIA 1ITYA 1WH7A 3BR1A 2DMPA 1ETVA 1QRYA 2DA7A 2L7FP 4RBOA 3CMYA 3S1RJ 2NVYJ 4A3BJ 2FJ1A 1IV6A 1B72B 2EBIA 3ZOBA 4BBRJ 5F04A 3CQZJ 2DN0A 1FIPA 3S15J 4IHXA 3OIOA 2R0QC 3ZQFA 2JK3A 3HM5A 2NOGA 5DS9A 1JJ8C 2P81A 3S17J 3VPRA 4JX4A 1H89C 4DZPA 3L1PA 2NVTJ 1B72A 2E19A 2JA5J 5E3NA 1HCRA 3WHBA 3IH2A 4AYBN 1SFOJ 2YU9J 1FEXA 4ABZA 5EF6A 4FTHA 3A01B 3DEWA 4M3FA 3QQAA 5IYBJ 5DTDA 1TWAJ 1GV5A 2WB1N 3E7LA 1RKTA 1GT0C 1ZGWA 5K7ZA 1IC8A 3S2HJ 3S2DJ 5FLVA 3H3VK 3S14J 2GM4A 2COBA 2DTZA 5IYDJ 4X1EA 5F0CA 1JKOC 1ZQ3P 1U9NA 3LSRA 4XRSA 2MG4A 2XB0X 2LFBA 4BY1J 2ZB9A 3GTJJ 3IH4A 4A69C 3O8HA 2R5YB 2XPUA 1LFUP 2L9RA 3BG9A 4W97A 2YS9A 4NDLA 2HOSA 3MVPA 2L7MP 3ZQLA 1WI3A 1AKHB 1U78A 4IHWA 1ZR2A 5IPAA 5IP6A 2ID3A 5EG0A 2HI3A 1RPWA 3S1QJ 2XGCA 1X2MA 3BR2A 2R5ZA 3BR5A 3A03A 1MSFC 3FK6A 3FISA 3A02A 5BNGA 4JYKA 2E2HJ 1B8IB 1QVUA 3W6VA 5F0FA 3IH3A 4BXXJ 3GTGJ 2DMNA 2DA1A 1YRNA 3G1OA 4M3EA 4IHVA 4AC0A 1PUFA 2HOTA 2E1OA 4UUTA 1F43A 4A3FJ 2Y9YA 3BTLA 3IV5A 3HOXJ 1UMQA 4C3HJ 2XPWA 4C2MJ 1ETQA 1YRNB 4D5CA 1Y1WJ 5FKLA 3GTPJ 5F27A 4BBSJ 1BJZA 5FKOA 4BKXA 2H1KA 3BQYA 1HLVA 3G1MA 5M5XJ 3I4MJ 2EH3A 5C4JJ 4M3DA 3BR0A 1MBJA 2K9NA 1IGNA 1LE8A 1IG7A 3K2AA 1PUFB 2HOAA 1ETWA 2NS7A 3D1NI 1TWHJ 4A3MJ 4FCYA 3OSGA 3SJMA 4FE7A 2O7OA 1ENHA 2M9HA 3RZDJ 1JKRC 2EZLA 5FLMJ 2XGEA 1I50J 2FD5A 3RQIA 3UKGA 1JJ6C 3RZOJ 4MLOA 2R5YA 1GDTA 1TWCJ 3HOYJ 3JRCA 4MO7A 2LTPA 3S1MJ 3JRDA 2Y2ZA 1T56A 9ANTA 3LSJA 2M0CA 2E2IJ 1JUSA 3B6AA 2QF7A 1CQTA 2GBYA 3B6CA 3HGGA 4D7NA 3MKLA 5J1YA 2DA5A 1DU0A 3ZQCA 4XRSG 1VF9A 1JGGA 4JP0A 2KDZA 1WGXA 1I6HJ 4BY7J 1ETKA 1TWGJ 2HXOA 5EG0B 3HB9A 2X9DA 1ORKA 4JX5A 1U8BA 1HDDC 3S16J 3LNQA 2LR8A 2L7ZA 1FJLA 1W0TA 4IEJA 1JT6A 2PMZN 1K61A 3BTJA 2Y31A 5K7FA 3HOWJ 3M3YJ 2FQ4A 3TP0A 1ETYA 2VPRA 3OOUA 1H88C 5C4XJ 2G0EA 2TRTA
chains in the Genus database with same CATH superfamily
1RUNA 2JMWA 1ZG5A 1WHUA 2LD5A 2CW8A 1ON2A 3HGYA 2DT5A 3P5JA 1MDMB 1AKHA 4RGRA 2IXSA 3RCOA 3OSFA 4B09A 5IT3A 1SMTA 2OQGA 2X85A 2EINH 1ZRDA 4A3CJ 1D1BA 4A5NA 2VOPA 1XGOA 1SVLA 1XS9A 3L2RA 2Y0MA 3ELKA 1T98A 3TGNA 1TNTA 1O3RA 2NNYA 1LDJA 3JRFA 4UVAA 2CG4A 4ITVA 2W85A 2GIZA 4MGRA 3OR1C 4L0ZB 3IWFA 1JTXA 2LKPA 4LGWA 3FM5A 3KP7A 1CGPA 1VQNI 2VIXA 3PFIA 1MH3A 1PUEE 2QVOA 1EA3A 3QPLA 1I27A 2G7UA 2CV2A 1OCTC 1S72I 2GXBA 1OYIA 2CUFA 1ZK8A 1L0OC 3BZCA 3CLQA 1LDKB 3SHFA 2NS8A 2E36A 1K6OA 4NBQA 2HDCA 1UG0A 2O61A 1O3TA 4CYCA 3G6EI 4P1WA 5F1RA 4S0HB 1ZG3A 5LHIA 4XONA 1HSJA 5FJ8J 3PO2J 3HHHA 2QYOA 1FOWA 2XF5A 2B9SA 1FBSA 2EZIA 4QSHA 2ELHA 2ME6A 1MSEC 2EWNA 3F0CA 4AM3A 2YPRA 3KPHA 1XPXA 3TOBA 3TMOA 2PG4A 5E8GA 3TW6A 1Z6TA 4CCNA 4WWCA 3CTAA 1XB4A 4G8XA 2CU7A 2MD0A 2V6CA 2M1BA 4ZDOA 2W82A 4A3IJ 3BG5A 3GZ5A 3M1EA 4PUSA 1MNMC 1BIAA 1NTCA 2H8RA 5D4SA 4IJAA 2K9SA 2L4MA 3M8EA 2X51A 5HLTA 2CQQA 3O8GA 3QAHA 5J40A 3F23A 1BJAA 2JN6A 2R7TA 2JSCA 3BC8A 2KFDA 2XSDC 2PMZA 2WV0A 2R7VA 3E1SA 2X6OA 1IUYA 3CDHA 3CJQB 1BM9A 1UHWA 4M71A 4XRFA 4XN3A 3WHCA 2FX0A 2B0LA 5IP7J 1BA5A 1IV8A 1BC8C 5C3EJ 3HXLA 2VL8A 1HSTA 4ZC3A 3R6SA 2P6TA 2V26A 2IJLA 5CVIA 4XICA 3TO9A 4RMNA 2E5NA 3K2ZA 1LKXA 2ADUA 2UV1A 1O4XA 4X6AJ 3GBGA 3CCYA 2DA6A 3GEZA 1J0RA 1JT0A 2MGQA 3PQKA 5ERIA 4E7SA 4QPQA 1GXQA 3L00A 1P92A 2WAQN 3FMQA 1YO5C 2MSYA 3B02A 4BGDA 4C2UA 2VQGA 1RETA 3SFIA 3H35A 3HEFA 3HOVJ 3VEPA 2VKHA 2A6EF 4G6DA 3V42A 1TL8A 2DFHA 3RYPA 3M4OJ 2LLKA 1SFKA 2FUG2 3J80K 1OLTA 4V19K 2A5YB 1SD6A 2EV6A 2W1OA 2DFFA 1D8KA 3CJNA 5HDGA 2YUSA 4C3IJ 2YX7A 2L9SA 3ONQA 1MKMA 4BQNA 5A2QK 2EZHA 4QIWN 2A05A 4CZZA 3VYRB 4AVZA 2UZKA 2LG4A 2H94A 4HX8A 3PSIA 4O3MA 1J09A 3AG3H 4M9ZA 2E7XA 2OF7A 3RKQA 3K1NA 3OWTA 3Q0WA 2JJ7A 3AG1H 4PSXA 1Z0XA 4KIBA 2NVXJ 2VT2A 3G1LA 1RNLA 4ASNA 2XGDA 3SDGA 5GADJ 2OZUA 3G73A 3SEQA 5DUKA 1IUFA 3HSFA 4Z6YA 4G6TB 5JVGF 1XTAA 4LLNA 4KMUX 2ZNYA 2XHKA 1QBJA 3GFMA 1MMSA 2MW8A 4JQFA 1X2NA 3T1BA 4LITA 2O9LA 3CC4I 3T0YA 3J7AY 2XRLA 2XVCA 5D6EA 2OC6A 1AOYA 3NARA 1FT9A 5CLSA 5GAGJ 3QYEA 1WVRA 4HSRA 2LH9A 3E6CC 1K4TA 3SXYA 1JKPC 1E2XA 3VSLA 4IRGA 2DK8A 3AKZA 2R5ZB 1G3YA 3S2WA 2WY7Q 2HVSA 4ANJA 3QOPA 3WTYC 2K85A 2PJRB 2VC1A 2DAOA 3GF2A 3QPSA 1CF7A 1DUXC 3KZZA 3RPUD 2R4GA 5ILSA 4HA8A 3SDBA 3HZJA 1O3SA 3VWBA 1P7IA 3PSFA 1QPMA 5JI6A 3KP2A 3FBNB 3BR6A 2DW4A 4O6JA 1Y39A 1SFXA 2FMLA 4J19A 3E3VA 1EKEA 4Q4ZF 4DBRA 5F0HA 2JRMA 2E35A 2HKXA 2ZO4A 1D1AA 2IT0A 4I76A 1VQ7I 2W84A 5GP9A 1MGTA 4HQMA 2EK5A 4CXFA 4OINF 3HL2A 4A3EJ 4HZFA 2W25A 2OQRA 4Y33A 1QPIA 2CGPA 2R3SA 1FIAA 3QRFF 1C0WA 1WCMJ 3LSGA 3PM1A 1G59A 1MW7A 3JRBA 4RDUA 1EV7A 1MDMA 1MBGA 1CF7B 4NHJA 4FX4A 3G3ZA 3LMMA 4HYEA 4UV8A 3VODA 3ZQIA 2ZMEC 2YSRA 2DDBA 5LLQA 2DA7A 2QZ8A 2IA1A 1KQ9A 3M9AA 4XOPA 3L2QA 4A3BJ 1B72B 2BY2A 3R60A 3H9QA 5F04A 5E79C 3MCZA 1W4MA 4AWXB 4IRHA 1YS7A 2RNJA 1FIPA 2GWRA 5TISC 3CC2I 4Q5SF 5HS8A 3J81Z 3I0TA 4XR6A 1O3QA 3ZQFA 4XLNF 3HM5A 3PIPF 5FFXA 4CICA 3W2AA 5FD5A 4P5OA 2DFIA 2P81A 3EPZA 4EMSA 3S17J 3LFKA 4BAYA 4DJAA 1XSXA 4IXAA 3TO6A 3TL4X 2NVTJ 1BI3A 1B72A 1OYWA 3FXMA 4S05A 3WHBA 3QU3A 1LNWA 4BHPA 2V1UA 3TBIA 3OL3A 2DPDA 4I02A 3Q5FA 3QYFA 2F5EA 5EF6A 3WGGA 3DEWA 2XASA 2Y69H 4PGGA 3F6VA 5IYBJ 1J75A 1VQLI 1FOKA 2WB1N 1GT0C 2Y75A 3ECHA 2PI0A 5IY5H 4EATA 3GXOA 2IS4A 2VT3A 2COBA 3WTXC 1FP1D 4U0YA 1Q1HA 4AIHA 1OISA 3QPTA 2LFBA 3GTJJ 2QQ8A 1MMDA 1N25A 3V8KA 2KRFA 4W97A 3BG7A 3ZXSA 3WTUC 2H8WA 3MVPA 2V79A 1OPCA 3JW4A 1P4WA 1R4MB 3S32A 4EM0B 1OR7C 5E8IA 4KUMA 2HWVA 5ICCA 4PSWA 3CC7I 3RYRA 2QQAA 4UVCA 3IRQA 3F8FA 3TQNA 3BR2A 2KZGA 3BR5A 2BXYA 2BE5F 2K4JA 1P6RA 1TT5B 3DTKA 1OKRA 4JYKA 4FASD 2E2HJ 3OL4A 2XSJC 3R0AA 1OMIA 3W6VA 2DJIA 3IH3A 4IOAF 4BXXJ 1SAXA 2YR2A 1R5GA 5DM7F 3H5RA 1YRNA 5DYMA 4M3EA 4LLLA 2KIUA 4AC0A 1YOVB 3GZ6A 1PUFA 4UUTA 1F43A 3LSIA 4A3FJ 4DNCA 4AIDA 4DIQA 2M7AA 1OR7A 3H5NA 2VBXA 2XPWA 3SYTA 3ABMH 1K7AA 2ISYA 5DV5A 1Y1WJ 3GTPJ 2XF7A 4GCVA 3GFLA 1Z9CA 2H1KA 2M5WA 1HXDA 1X19A 3BQYA 1MD0A 3D0SA 5EEGA 1BN5A 2MLGA 5M5XJ 5C4JJ 4M3DA 2WY8Q 1ONVA 2BY1A 1IGNA 5F6FA 2DLLA 1ZELA 1IG7A 1SAUA 2KRCA 2ZXHA 3K70D 5B5EC 1A36A 4M6YA 2Z99A 3X2QH 4F3QA 5AIQA 1ENHA 3H3ZA 2Y0SA 3K0LA 3ZMVA 2KQRA 2EZLA 5FLMJ 1SMYF 2W24A 2F5CA 2E1MB 4DBQA 1I50J 2A6HF 2E5ZA 3C7JA 3BPXA 3TKYA 2ZXJA 1TWCJ 2R7OA 3J7ZI 3JRCA 1Z3YA 5CVVA 3EUKL 2LBFA 3JRDA 4IZZA 2BW3A 1AA7A 2PBIA 3DBHB 3FWEA 3LSJA 4CH7A 5BMZA 3AG2H 2QBYA 3IP4B 2Q1ZB 4KN7X 2E2IJ 1JUSA 3AFHA 4XKVA 1G3WA 2VKDA 2VBZA 4AYBA 2KP6A 2DA5A 2EFWA 3PJRA 4UXNA 3ZQCA 1VF9A 3E5XA 3WU2C 1NG6A 2RC4A 4JP0A 2R7RA 1WGXA 1ODDA 4KN4X 4BY7J 3TOAA 1P9QC 1TWGJ 5EG0B 1WJEA 2ICWG 3H5AA 2XKOA 4DGWB 1FJLA 1FC3A 1YJ9I 2M30A 1OCOH 1JT6A 3JSPA 2V4JC 1EH6A 4M74A 3H92A 2O3FA 2BVMA 1O7FA 4TV7A 3QYBA 1H88C 3MD2A 2AXLA 3PFYA 1FMWA 5JLWA 2JA2A 4BDYA 4FE4A 1F4KA 3ZQQA 2V9PA 3KFWX 1IRZA 3CZ6A 1WRJA 3H3UA 1XGMA 4I0BA 4XNFA 2VN2A 2J5PA 3BOQA 2R7XA 1IJWC 4HV6A 2R93J 4M73A 3S93A 2H1LA 4AIKA 1ZN2A 3TW7A 1WKMA 1P7JA 5F08A 2FSWA 5HS9A 2QGUA 4BXUA 1K78B 5D5UB 2FRHA 5LHHA 4LG0B 2KKOA 1PDNC 3F8NA 3V7CA 3LL7A 2VOOA 3Q9VA 3MEXA 5E17F 1ZGJA 1FP2A 1W7PD 3RTRA 2QKLB 3F3XA 5DD4A 4ZYGA 5EGOA 3K4CA 2VPLA 4D1QA 1ZARA 3K69A 2BY3A 5LHGA 3ZPLA 5LGUA 2K4BA 3MZHA 1Y8RB 1RR7A 3R61A 2P0WA 4KT5C 2QSGX 3DKYA 4Q47A 1W7PA 1IRXA 1K83J 2FBKA 3OS2A 1DGRM 2P8TA 5L3DA 3FIWA 3ZN1A 4GGGA 2ECCA 3HRSA 4XKBA 5FB2A 1DP7P 3QODA 1QVTA 3HKZN 5E3MA 3O6BB 3P9KA 1NK2P 4LLGF 2A68F 2DMUA 5L3GA 4HF1A 1DP3A 1B4AA 2DI3A 4A3GJ 5M5WJ 1JHFA 1R36A 5IOYA 2G9WA 3QP6A 5IP9J 3WG7H 1OYYA 2HXIA 2IA0A 2O5RA 5EGOB 3N4MA 1XGSA 5FKKA 4M72A 1IN4A 2PJPA 2LYCA 2R7QA 3MWMA 4ON0A 1R7JA 1EF4A 2CUEA 1I3AA 2DOEA 4CCLA 1IF1A 2GLOA 1OCCH 3OV8A 4EJTA 2Y9ZA 3GTQJ 1Z3XA 4XKCA 2JA6J 2QQ9A 3JAMZ 4RGXA 3U1DA 2BYVE 1REPC 5DM6F 3WTSC 2LY9A 1W36C 3H0DA 1YIOA 2VUMJ 1PVEA 3I58A 2XB5A 3MQ0A 3V8JA 2XPVA 3HBLA 4CSWA 2F2EA 4C30A 4IVNA 5KK1A 5LGTA 5B1AH 2R7UA 2L02A 4HPQA 2Z9OA 1ZAOA 2JTVA 4CCKA 1YHQI 1P4XA 2CQNA 3I5UA 1Y0UA 3HIFA 3MMYB 2PLYA 1YJWI 3DU5A 2VJJA 4JX6A 4P96A 4HNVA 3I59A 4FISA 3E5QA 2JUCA 4Y52J 4MFDA 3HDDA 3GTKJ 1ZTRA 3KEQA 2PN6A 3GFJA 1R1UA 3GVAA 4KT6A 5M3FJ 4ZTJA 3J81K 1B59A 2N8GA 2FMYA 2A5WA 4C3JJ 3WE3A 2DYSH 3FXRA 1HQCA 5D4RA 2HYFA 3L2CA 3JRAA 1S8NA 1W7PB 1GXPA 2HQ5A 1Q1VA 4HEA2 5KNLA 1D8JA 1BI1A 3GO5A 2LSOA 2LDUA 4XRMA 4MTDA 4YFNF 1X3UA 2V1DA 4L5EA 3ESWB 4D0PA 2VJ5A 1XSVA 1E3OC 1VQ5I 1ERDA 2EV5A 2VQCA 1MJ9A 4EJWA 3OS0A 1X1PA 4E7IA 1LB2A 2FOKA 3CJRB 2K40A 1I3QJ 2I5UA 3FKJA 3NWSA 5M5YJ 5EDNA 4HG2A 4BE0A 3BPVA 1X58A 3K7AJ 3WE2A 1JGSA 5D5VB 3LQRA 2KIFA 3E5UA 4BJ5C 1KGSA 2BVLA 3A0BC 3BP8A 3ZQHA 5GPAA 2GAUA 1D5YA 1SFEA 4N4OB 4I6ZA 1T95A 3KE2A 4Y4RA 1LQ1A 3DEEA 2PQ8A 1S7OA 5ED4A 5J1UA 2OPTA 3KP5A 4A3LJ 3MN2A 2O8KA 3CP2A 1LFBA 1ZKGA 1TQIA 3DXJF 5EZGA 5B66C 3IWZA 4CCJA 4FT8A 3C2BA 3CMAI 4BNCA 4ZTFA 1KZHA 4LD5A 4PJLA 1S5LC 3RKXA 3QU6A 2HZTA 1APLC 2CMPA 3LQQA 5E3OA 2DO7A 2NVQJ 1TW3A 2M34A 5HODA 2K9QA 1FY7A 1RC9A 3LSHA 1JTYA 1QHHD 1Z7LA 3K1PA 5F1JA 5H6RA 5CVRA 4A6EA 1OCZH 1USTA 3CD6I 3WGHA 1UG2A 3OYHA 3RQ4A 3DCFA 1VNDA 2X6YA 4LG3A 4RAGA 1A5JA 4II3A 3H9JA 1BW5A 5EYRA 3EYIA 5AIPA 1V3FA 1I1SA 3FKIJ 1MBFA 1KONA 2MC4A 3K1MA 1Z67A 1IDZA 4I01A 5DDGA 1UJ8A 2P7VB 2JA8J 3G4SI 4XLFA 1I39A 1W5CC 1VQ4I 2F48A 3NEUA 4PCQA 1F36A 3A1YA 4XLAA 1XMAA 4HOBA 4IF4A 2E34A 4XLCA 4YIIA 1ITYA 2DFEA 2A69F 4XORA 1QRYA 1IN8A 1D0ZA 2EIKH 2AS5F 1LVAA 2L7FP 3L09A 4RBOA 1VQMI 2NVYJ 2OTJI 2FJ1A 1IV6A 3JTHA 2ZMEA 4N9IA 3SZTA 3DKWA 4HNUA 3J80Z 4P9UA 3F8BA 4Z2YA 3CLOA 5AONA 2F4IA 1O57A 4Y15A 2DN0A 4IQJA 1MIJA 2FEZA 1XX5A 4A0XA 1O7LA 4IHXA 3OIOA 2EFPA 2M4KA 4BQQA 2RV8A 1KU9A 2KIQA 2M4GA 4J01A 3DKXA 4CZCA 2UUZA 3VPRA 3CUQC 3CO7C 4UV9A 1XD7A 1YX5A 4A0YA 4DZPA 3K6GA 4BYYA 1R1VA 1G4DA 2VE8A 1V5FA 2JA5J 5E3NA 4YG2F 4DOZA 2NRAC 4AYBN 3J7AO 1SD4A 1TBXA 4XBFA 1FEXA 4FTHA 2PJRA 1A35A 3K4MA 3ZMSA 4M3FA 3QQAA 1R5ID 3F22A 1K79A 5DTDA 2HVRA 2R7FA 3BDDA 1WJFA 5J4VA 3S2DJ 5FLVA 4UY8I 4ZJZA 3H3VK 1X1AA 2CYYA 1QZYA 3S14J 1YG2A 4R1HA 5F0CA 1JKOC 2LRDA 3LSRA 4HRIA 2MD5A 4ZZLA 2ACJA 4OIQF 4XRSA 2FNAA 3GX4X 2MG4A 2XB0X 4RAYA 2GOMA 4BY1J 4B47A 3PIOF 3IH4A 1R58A 2PMHA 1E3HA 2L9RA 3BG9A 1X3ZB 4BDZA 1ZRCA 1UFMA 2MBFA 4IHTA 3I55I 3BCAA 4J00A 1MJAA 5D8KB 1U78A 1R49A 5IPAA 3OY9A 4YEJA 2FBHA 2HI3A 1FBUA 5EEHA 3BJAA 3RKYA 1D0YA 4HLYA 4E7HA 3A03A 1MSFC 1XMXA 3Q9SA 3FISA 2DODA 1TNSA 3DPUA 3VYUB 3DQVC 5BNGA 2H6CA 4RAFA 4ZDLA 1B8IB 2CQ7A 5F0FA 3HOTA 2A61A 3GTGJ 3MZYA 2DMNA 2KL4A 5JHFA 2VBWA 1J59A 2WWYA 2VODA 3N05A 4WXCA 5D6FA 2HOTA 3C3WA 2HQAA 3BG6A 3DU6A 2HTSA 2Y9YA 1DPRA 3BTLA 4OAZA 5JFRA 6PAXA 3C1DA 1GVJA 2NVUB 1UMQA 4CUGA 3UR3C 1HBXG 5A2QZ 3DLLF 2LF7A 1KA8A 1QZEA 4UHTA 4G7ZF 5F27A 3HPHA 5FKOA 4BKXA 1SVMA 2PEXA 1HLVA 2VASA 4XSZF 5HNFA 1TW2A 5E1WA 3FBIB 4ZH4F 3R0JA 2OTLI 3A2KA 3K2AA 3ZRGA 3CCUI 1IN7A 2NS7A 2VJIA 3D1NI 1TWHJ 4OIPF 2DXIA 5H20A 4BQOA 2ZMEB 3NQOA 3OYAA 4NUBA 2GA1A 3J7YJ 3OSGA 4YFKF 2DOAA 2Q2EA 4FE7A 3K70C 1PP8F 2R7DA 1IN5A 4D9JA 3I4PA 3I3LA 4N4NB 3CUQA 1ZRFA 1I5ZA 1TP4A 3AL0C 4LJZF 3FXQA 1R71A 1G3SA 2R5YA 2JVGA 1LEBA 3HOYJ 3GLLA 2L9VA 3LSTA 9ANTA 3VYSB 2BBYA 4Y17A 5GAEJ 5J4YA 1UHMA 2X1CA 5CYVA 2FQ3A 4P9FA 3D5LA 2GBYA 4IQ4A 3DFGA 3R4KA 4U88A 3MKLA 2RREA 4CYDA 1NHAA 3LWFA 1DU0A 2VQHA 2CQKA 2JPCA 3ABKH 3U9GA 4XRSG 3I64A 5LBQA 2MA3A 2KDZA 3VYTB 3HUGA 4KIGA 2MH2A 4PZJA 2OBPA 4BU2A 2X6WA 3F9KA 4HDUA 1DGWY 1ORKA 4JX5A 3TO7A 2HQRA 2M3AA 2X1EA 2L7ZA 3FXOA 2IPQX 3FHZA 2PMZN 3HG9A 4BH9A 3AAFA 3HOWJ 5FROA 4F52A 4I0AA 1GLNA 2DTRA 2E60A 2EIMH 2VB6A 3TP0A 4AD9A 1ETYA 3PNTA 4HBLA 3B73A 1H9GA 1SD7A 5C4XJ 2G0EA 5D5XB 2W48A 3BJOA 2BOLA 4G94A 3FMSA 3SQNA 1FYMA 3WGIA 1YFHA 1IDYA 3ISPA 1OQYA 2KLOA 5IT9K 4L0YB 2ZFUA 4KA4A 1MH4A 2V9KA 1IO2A 3GWZA 4LG0A 1OCRH 3RI4A 2EV0A 2PFBA 3TP3A 4HQEA 1U5TA 1TLHB 4WCGA 1U0JA 1SANA 4MQ9F 2HEOA 2C6YA 2Q0OA 1SD5A 3CDIA 5JHUA 5FKMA 5FLXK 1V4RA 2WAEA 1PJRA 2DT7B 4CO8A 2ELJA 1G8XA 4RGUA 1FTZA 1DPUA 5IOZA 5BPDA 1ETOA 3HHGA 1YLFA 2M0MA 2FOWA 1H0MA 2A07F 1E3PA 2XC7A 4AUXA 2KT0A 4U7BA 2HOEA 1U5TC 2ME0A 2HYJA 2P4WA 1TC3C 2CRGA 1R5HA 1TQPA 3SZGA 2LP0A 2STTA 3BR3A 5E20A 3JAMK 3Q0UA 3S3NA 3E6BA 4DYRA 3VSKA 1YE9A 4QWQA 3OYDA 3JRGA 3P9CA 4IOCF 1MNEA 1S9HA 3T8RA 4G7OF 2VXDA 2V1XA 1IW7F 3HC7A 1U6GA 2BEOA 2DJNA 2O8XA 4R8HA 4CA0A 3G71I 3AG4H 3ABUA 3ZGKA 2H6BA 4A3JJ 3CF5F 5H2FC 2QCOA 1YW8A 2IGMA 1FYLA 2BZTA 3S1NJ 4P55A 2HKOA 5CQGA 4PFPA 5K1YA 2IEKA 1HF0A 4FETA 4XMYA 4HDVA 1IN6A 1XCBA 5HLIA 4F92B 1TQMA 5LEJA 3NWTA 2B63J 3LSPA 3OR2C 3TDUC 4L9NA 4Y3OA 1YTYA 3Q3SA 2VBYA 3JRIA 3ECOA 1A31A 1QU3A 3UNGC 4EM1A 3BG3A 3S3MA 4AIJA 1UAAA 2ETHA 2XV4S 2J5OA 1QNTA 1BOBA 1ON1A 1UB9A 3F8MA 3ZQGA 2WV1A 2LY2A 1BI2A 1KYZA 1UCRA 2ZC2A 4HF0A 1YIJI 1WJBA 2LK2A 4UVBA 2FA5A 4LMYA 2XIGA 2VJ4A 4E4HA 2XROA 2NAZA 2DT6A 2CW7A 5M3MJ 1LDDA 4M3GA 4MFEA 2CV1A 5L3CA 1NH3A 4KITB 1XG1A 4HV5A 1Z7UA 5GTHC 4RB1A 4Y13A 3E0JB 3IRRA 2L0KA 2GZWA 3GFIA 2RGVA 3ZMUA 2D1VA 1A6IA 2KJCA 4GYIA 1EJ9A 5CJ9A 5ICFA 3CCVI 4IKFA 3GTMJ 3GTOJ 1Z77A 4LIVA 5BQTA 3GZNB 3GCMA 2Z16A 4OMYA 3L2VA 1B8IA 4CCOA 2XAFA 2XKPA 3I59B 1RKWA 2EQRA 2MH9A 2JT1A 3HTSB 1AU7A 2H27A 4HLXA 4HF2A 2OUMA 4UB6C 1MBKA 5ILUA 3OYBA 2XAQA 3O3KA 4NC7A 2DA4A 1EH8A 3A01A 3C18A 1VQ9I 1DU6A 1XCVA 3V8LA 3I4NJ 1YW7A 5L3FA 5K5QA 2HS5A 3V7RA 4DZJA 3FXUA 3CCJI 1NK3P 4B3AA 2JA7J 1X1DA 1WQ2A 3KYLA 2O0YA 2QWWA 4PJJA 3WTTC 4BHCA 2R7ZJ 4HX7A 2A3SA 2L9NA 3DTIA 3P7NA 4DYQA 1WSUA 5FLXZ 2HPIA 1R1TA 2ZNZA 5HVQC 1BIBA 2XDVA 4BL0B 2KHMA 4UUSB 2M2EA 5TJJA 3U1KA 4IPAA 5EZHA 4Y7NJ 2E2JJ 1QA6A 3PNVA 5E3LA 4EJVA 1TT0A 1BI0A 3CO6C 2JZYA 2OD5A 2DA3A 4NC6A 3W3CA 2B7EA 4II2A 4C9YA 2RAEA 1FMVA 2AXTC 2MYSA 3JSOA 1IZ1A 3C2HA 1Y6IA 1LJ9A 4HSTA 4KFCA 5ICEA 1TZLA 4BHBA 5DUIA 2W4SA 4BACA 1XSDA 5GPCA 3LA2A 4LB5A 1AWCA 1MBEA 4X0GA 2KPMA 3EYYA 4OMZA 1ZH5A 1R23A 2D5VA 2E7WA 1ZG1A 3V4GA 1YJNI 3A4CA 3KP4A 4B3XA 4EM2A 4UUSA 3BTCA 3K9TA 2E1MC 3BWGA 2RDPA 1FOYA 4BXFA 3KETA 2X4HA 1D5VA 4WK8F 1HDPA 1WWXA 2OU2A 4W1UA 2YX4A 2WB1A 3IHUA 1B6AA 2GXGA 2ELKA 2K7LA 3DF8A 4RM2A 1T0FA 1DQUA 2CS3A 1D0XA 4ZYAA 4E6KG 3CF2A 3WODF 4B4CA 1FSHA 2F5VA 2HR3A 2X1DA 4UNOA 4I98B 1SVOA 4I7HA 2GIVA 5JVTA 2RVCA 3EUHA 4OIRF 1GHCA 1WJAA 2WAFA 2WC2A 2XAHA 1GV2A 3ZR8X 1OJLA 4XIDA 2JQ7A 4ENKA 4ESBA 2DMQA 5CQEA 3CUQB 1WH7A 2HTJA 1I1GA 1ETVA 2BV6A 4L5JA 4RAZA 5F64A 1BOAA 4BEHB 1TTYA 2Q2EB 3CMYA 2VONA 1ZGAA 2DQLA 2ZCWA 4GYGA 3ZOBA 2E71A 1HKTA 2MFZA 1U3EM 1X4OA 1BR1A 2QA4I 3I53A 1T38A 3IAS2 4K2EA 3S15J 1U8RA 1R4NB 1KU7A 1T2KA 2ZSIB 1JJ8C 1NG7A 3HUGB 1HC8A 3LSMA 3S8PA 1DDNA 3E97A 2RQQA 3L1PA 2OCCH 2K3PA 2K27A 2LF8A 2E19A 2JPBA 3DLAA 1HCRA 1A04A 2L3DA 2NXNB 1SFOJ 2ISZA 5GTIC 2WADA 4ABZA 2M45A 3A01B 3ZMDA 3T5XA 2OZ6A 1KU2A 3RDIA 4I2OA 4RLQA 1E17A 2DBBA 4XKWA 4E70A 2OJED 5K7ZA 2EA2A 1FBQA 5EJCA 2L4AA 1IC8A 2A6TA 3ROUA 3FXKA 2JRTA 2GM4A 5IYDJ 1HW5A 1IRGA 1KQ8A 1L3LA 5TRDA 3F21A 4WF2A 3FM3A 3U2RA 4KMFA 2QQBA 3M1CA 5H6QA 4A69C 2P5LC 1S29A 2XPUA 4ENNA 1LFUP 2CUZA 4NDLA 1P2FA 3GUDA 3KEOA 3ZQLA 2V6EA 3HRMA 1ZYRF 1WI3A 1AKHB 4IHWA 1LVKA 1ZR2A 5GAHJ 2ID3A 5IP6A 3SZPA 3VOEA 3KP3A 4DQ2A 1Y8QB 1ZLJA 2HFHA 3IUOA 1X2MA 2XGCA 3S1QJ 3PNYA 1F9NA 3KIOA 2R5ZA 1QQIA 1FOXA 5HS7A 2R7WA 2K9MA 5J6XA 3OMYA 2NS0A 3VB2A 4JK1X 1QVUA 3W6KB 2IP2A 5DCMB 3FDYA 3BZKA 5KAFC 3U21A 3F72A 2K86A 4IX7A 3M07A 2ZFWA 2E1OA 3LA3A 2HYGD 4WXHA 2DQRA 4RGSA 3IV5A 3JCUC 4YIRX 2PX9A 3OIQA 2ESNA 1VQPI 3HSRA 2W57A 2XAGA 4C3HJ 4CGZA 2ESHA 2WAQA 4C2MJ 3WG9A 4D5CA 4E7ZA 4UUVA 2BHYA 1BJZA 3DP7A 2EFNA 2RNGA 1E0EA 3DPLC 3WTWC 4A5MA 3G1MA 1Z6RA 2OCEA 1JE8A 3BR0A 2JSPA 4B44A 2KIMA 2ZSHB 2K9NA 3ZMTA 4ZYDA 2DOFA 1PUFB 1ZREA 1Z91A 2KZVA 3KLOA 4GXOA 2HOAA 2GQQA 3HYIA 4FCYA 3T8TA 4F7ZA 2NYXA 3IKVA 1LFPA 3OYGA 2O7OA 5CVJA 4A12A 4PGHA 2XGEA 1K4SA 2FD5A 3RQIA 3UKGA 1N78A 1X1BA 5ICGA 2K3FA 3ERMA 4F93B 5LEKA 2I8DA 2H09A 2ZXIA 3GLXA 5L3BA 3GYHX 4IHSA 3S1MJ 2V7FA 1T56A 4O5VA 3BZ6A 4L5IA 4FX0A 2M0CA 4EQQA 3DBLB 2BGCA 2QM3A 1J5YA 1W1WE 2QF7A 3OOPA 1V5EA 2HQNA 3QP5A 3HGGA 2XAUA 2IS2A 4S04A 1X1CA 2HNHA 4QPOA 4M9XA 1FLIA 1I6HJ 4ESJA 4KICA 3MFKA 5ILVA 3HOSA 1G3TA 2HXOA 1HKQA 2X9DA 3CMMA 4E7LA 4HX4A 1U8BA 4H0EA 1V54H 2LR8A 3BY6A 2F4OB 4OWRB 1W0TA 1WI9A 3I56I 1XN7A 2QBYB 2NNNA 4MTEA 4BJTA 5JR3A 2M8EA 2AQEA 2Y31A 3LFUA 5K7FA 3M3YJ 5CKTA 2FQ4A 2JUGA 2VPRA 4BEHA 1STZA 5B1BH 4N0BA 2TRTA 1SEUA 2D45A 2LMDA 1QZZA 4G7HF 2HDDA 3H0GJ 1F5TA 2K02A 2DU9A 2TCTA 4H4KC 4QLCU 3HOZJ 3K4JA 4L9VA 3ABLH 4KDPA 2EPFA 1QGPA 3AL0B 2CFXA 1UZCA 1WZ2A 2QSHX 3WU1B 3OYKA 1M1EB 2AO9A 1BBYA 3H9GA 4XN0A 3OYFA 1ULYA 4PJ0C 4YFXF 2QUFA 2VKVA 3HRUA 3OS1A 3KZYA 4GDFA 1V55H 4YRVA 2P5VA 1K6YA 4V2GA 1JKQC 4A0ZA 3BROA 1XDUA 2ID6A 3KX2A 2Y30A 3L9FA 1BR2A 1P4AA 1JUPA 3RKWA 1H8AC 1R00A 1VQ6I 2R92J 1YS6A 5IYCJ 4LOCA 2LVSA 3ERED 4MIMA 4E7KA 1IXCA 5EEAA 2CV0A 3GMEA 1RESA 1W5SA 3K4KA 4EJOA 4IHYA 4V2FA 1D1CA 2VI6A 2DA2A 3ZMZA 3F8CA 3IL2A 1FPQA 1B1BA 4ZDPA 1UHSA 4DW6A 3HOUJ 3P9IA 3FMRA 2X6XA 1U5TB 1B9MA 3VFZA 3FXLA 3CESA 3ZN0A 2LKXA 5KCMA 5IT9Z 1YW9A 4GFBA 1XC5A 1YQAA 3LOCA 4GO1A 3CCRI 4L9JA 2L01A 1FTTA 2GA2A 3EDPA 2WTEA 1KQ0A 3H1CA 1HW2A 2G7HA 1LE8B 1T33A 3M8FA 3BQZA 4XK4A 2R7SA 2DK5A 1MMAA 4XLEA 1KU3A 2LOOA 4KNYA 1JHHA 4OOIA 3CMEI 4M3BA 1YITI 3JRHA 1IAWA 3PQJA 1OCPA 1JUMA 1UELB 1LEAA 3NRVA 4PK4A 4RB0A 1WJ5A 1YYVA 2L7KA 1MBHA 1R22A 5DD8A 2M87A 5FO5A 4B8XA 1KYWA 4RA2A 3NAUA 2K9LA 3Q0VA 3RPQA 3ASOH 3IC7A 4ENMA 2CJJA 2IAIA 1YI2I 3WTZA 3RIRA 4XLPF 1Z1DA 1PP7U 3KZIC 3MAJA 2X48A 2MC3A 3KP6A 1VI0A 2IBDA 4A3KJ 2IW5A 2LNBA 4XLHA 4EVIA 2RN7A 3OYLA 3EETA 1Z21A 4U0VA 1FZPB 5J47A 3TEDA 4M6XA 2QEXI 2QKMB 1S6LA 2LBFB 2ZJPF 3I9V2 1ACIA 5DEQA 5BPIA 1JI8A 2E1CA 5LRRA 3ZCOA 3OIPA 2PMUA 1FYKA 3V7SA 4XL9A 1I6XA 4A3DJ 1WPKA 4QTRA 2CUJA 3PO3J 1G2HA 3HSEA 2CQXA 3FXJA 4HAMA 4RB2C 3QOEA 2UXXA 5E1ZB 1BL0A 4RS8A 3WTVC 4OIOF 3GTLJ 2EIJH 2W00A 3EUAA 1BW6A 2ZJQF 1RZ4A 1A6QA 2QENA 3TDZC 4A93J 3CP8A 4CHUA 2Q8KA 1Y1VJ 1HOMA 2MLKA 2M8GX 2Y0SN 3CDLA 4B48A 4IL6C 2V9VA 2CWEA 2UXNA 2RQPA 3O2PE 4NB5A 3BT9A 4PDKA 4CCMA 5B3SH 3L2WA 2IRFG 4OU0A 2DMTA 1BR4A 1POGA 2P5KA 5FKNA 4BS9A 2AQFA 3DV8A 4CDGA 4DYCA 5FRMA 3IKTA 1JXSA 3KYCB 5HOOA 1J7KA 1WH5A 5J1RA 4EV0A 4ESFA 4NQWB 4KIFA 3W6JB 2D1HA 2ZJ2A 1OFCX 2DYRH 1R6RA 4XOTA 2BY0A 5J3LA 2ZKZA 1K78A 1XGNA 3PL8A 3OYJA 5LFAA 3M7GA 1T8IA 5D5WB 2FF4A 1R9TJ 5HDNA 3N97A 4KISA 5JLXA 1XMKA 3H36A 2VLAA 3L2UA 2GOXB 4BQAA 2XUBA 4MEYF 1YX3A 4XQFA 1T6SA 3I54A 5HDKA 1ETXA 1AHDP 2FU4A 2XGXA 2YU3A 3JR9A 4G6QA 4BE2A 4D7MA 4ZYHA 1WJCA 2QLZA 5BS6A 4I99C 4ZZDA 4IO9F 3MKWB 2F6CA 2Y48A 2F5DA 4WXDA 3HKZA 3WU0A 1ZR4A 1VFCA 3SEZA 3VDXA 1Y0NA 4F55A 2EZKA 1W0UA 3PUBA 2IVMA 2JWTA 2XF6A 4CYCB 2HU9A 1GUUA 2HPMA 2EJRA 5C44J 3KEYA 4D5FA 1GVDA 3E6MA 2QSFX 4PJNA 2KMUA 3BLYA 2ECBA 2IS6A 3DTEA 1D3YA 2L5QA 4HW0A 1U9OA 2VKEA 1HA8A 5DCMA 2BXZA 2FBIA 4B1RA 5L3EA 2UWMA 4G12A 3JREA 2DCEA 2EFQA 1X4PA 1QHGA 2IGKA 4PJMA 3COAC 3DWLE 5K7HA 4IRIA 4JBAA 5DCFA 3LAPA 4EEFG 3E6DA 1FWZA 3SFZA 3CCSI 2AHQA 3S3OA 2OV7A 3HJEA 4U7DA 1PYVA 4NNJA 1H9TA 1S7EA 4I09A 5FD6A 4M6VA 4FHTA 2I10A 2CFOA 1J9IA 2Z33A 3CJTB 2KRHA 3FK7A 1TWFJ 3BTIA 3FHNA 4L18B 1FX7A 4XSXF 2ZJRF 5CPRB 3BR1A 2DMPA 4E7JA 1RUOA 2P7CB 3KLNA 3ML6A 3K4BA 4RB3C 5HLHA 3S1RJ 4BJ6C 2EBIA 4BBRJ 4LIUA 3CCLI 3MZ8A 4XM3A 3CQZJ 1VTNC 3L7WA 3I71A 3ZQ7A 1HKSA 2OAZA 2R0QC 2JK3A 2NOGA 5DS9A 2CSOA 3RSNA 2GXAA 2E1NA 5K5RA 2CW0F 3K4LA 4JX4A 3DPTA 4MQVA 3DBRB 3BJ6A 1H89C 5J8CA 1N75A 3HPGA 3EQLF 1IXRC 4GRIA 4RM3A 1HW1A 3IH2A 5K5OA 2YU9J 2VXZA 2F4MB 4KYWA 1FSEA 4JOMA 5LGNA 4LFUA 4ETSA 3W2VA 3OYMA 1VQOI 4C2TA 2DDAA 1RIOH 1T08B 1TWAJ 1GV5A 3D5RC 4AVPA 4U0WA 4EGYA 1VQ8I 3E7LA 1RKTA 2XRNA 1ZGWA 1QO0D 4PFOA 3S2HJ 1USSA 2IGNA 1T0FC 2DTZA 4X1EA 4U87A 1VZ0A 1U9NA 1ZQ3P 2M7BA 1Y56A 2LY1A 3RJPA 4A2UA 5LRSA 2BW3B 1EH7A 4RLFA 2W7NA 3EUHC 2ZB9A 4AU7A 2HDWA 3FZVA 3CCEI 2IGOA 2VC0A 5FGMA 1MNDA 3O8HA 4LK1F 2R5YB 4MEXF 5HNHA 2STWA 2HZDA 1XDSA 2YS9A 2HOSA 2OA4A 3RPUA 2L7MP 3W2WA 3OYIA 2KISA 4MNUA 4MHGA 1J2XA 2EA4A 2XAJA 3MKZA 2FNPA 3REOA 3HRTA 1LUJB 3ABTA 5EG0A 2JVHA 1RPWA 1W5TA 4WX9A 3OYCA 3GW2A 4FQGA 4N9HA 1W36D 3FK6A 1MZBA 3G2BA 3A02A 4L9TA 4YELA 3BCBA 5E1XA 2LKSA 3ULQB 2MABA 2DA1A 1V5GA 3G1OA 1RR8C 4IHVA 1IRFA 3QWLA 5KHDA 4R79A 2KDOA 3HOXJ 1MJBA 3F6OA 3LA7A 2Z3YA 2LREA 5FFZA 3HTUA 2EFOA 3D5SC 2TDXA 4ZYEA 1U2WA 4LK0F 1ETQA 3M8JA 1YRNB 2IS1A 4G9YA 4HNTA 5FKLA 5BOXA 4BBSJ 5E18F 3QPHA 3DEUA 3I4MJ 1B9NA 2BHZA 2EH3A 3MKYB 1RRJA 1BC7C 1G6NA 1MBJA 1MMNA 3OYNA 2DPUA 2HGCA 3FX3A 5J8FA 1LE8A 2ZBKA 2X0LA 1ETWA 1S3JA 5CVUA 3LAJA 4A3MJ 1F1ZA 4Q48A 2P6SA 2D2WA 5LD2C 3SJMA 1MMGA 2COMA 2M9HA 5HLGA 3A0HC 3RZDJ 1JKRC 1Z05A 2Z2SB 1WFXA 3LSKA 3FF5A 1JJ6C 2CH0A 5FRNA 3RZOJ 1WJDA 4NQWA 4MLOA 5TGTA 1GDTA 4OAYA 3ASNH 4MO7A 4M9SA 4A6DA 4EGZA 2LTPA 4NC8A 4EJUA 2Y2ZA 2HVQA 1VQKI 2KJBA 3K10A 4ENJA 3B6AA 1CQTA 3K4NA 3B6CA 4D7NA 1ZHFA 5J1YA 2WA0A 4YIFA 2FE3A 1X3WB 2F5FA 1JGGA 2K5CA 3CCMI 3CCQI 2O6GE 3IAM2 2NOJB 2LC2A 2O03A 1ZLKA 2VQLA 1ETKA 2EB7A 2ZXWH 2EILH 2L2OA 1N77A 2V1NA 2WBMA 3HB9A 1S7AA 4F91B 1HDDC 3S16J 4KJZA 3LNQA 1SC7A 1T39A 2FXAA 4LB6B 2Z5UA 1LPQA 4B43A 2VE9A 3C2GA 4IEJA 3OYEA 4BE1A 1K61A 3BTJA 3JTGA 2L54A 2IA2A 3PUFA 5D8LB 1RI7A 3KYDB 4BUPA 2RKHA 4UB8C 3KCCA 2Z1DA 3OOUA 1SFUA 5KAIC 3ZP5A 3CUOA 1IXSB 5KVRA 1FNNA 2CO5A
chains in the Genus database with same CATH topology
2W48A 2JMWA 5JLWA 2LD5A 2HDDA 3H0GJ 1AKHA 3HGYA 2TCTA 4FE4A 3HOZJ 1IRZA 3OSFA 1IDYA 4A3CJ 1MH4A 1IJWC 1XS9A 2R93J 2AO9A 3TP3A 2VKVA 3TW7A 1P7JA 5F08A 3JRFA 1SANA 4V2GA 1JKQC 2ID6A 2Y30A 1JUPA 1H8AC 2R92J 5FKMA 1JTXA 5IYCJ 4LOCA 2LVSA 4MIMA 1FTZA 5EEAA 5IOZA 1ETOA 1MH3A 5EGOA 3QPLA 1RESA 4IHYA 1OCTC 4V2FA 2VI6A 2DA2A 2CUFA 1ZK8A 1RR7A 4AUXA 1UHSA 2NS8A 4DW6A 2KT0A 3HOUJ 1K83J 4CYCA 3FIWA 2ME0A 4S0HB 2ECCA 2HYJA 1TC3C 2CRGA 2LKXA 2LP0A 3BR3A 5FJ8J 3PO2J 1QVTA 3HKZN 3Q0UA 4GFBA 5E3MA 1NK2P 1XC5A 3LOCA 2DMUA 4DYRA 2EZIA 3JRGA 4QSHA 4A3GJ 5M5WJ 1FTTA 2ME6A 1MSEC 5IOYA 3F0CA 5IP9J 2DJNA 1LE8B 1T33A 3BQZA 2HXIA 4XK4A 4A3JJ 3TW6A 2QCOA 5EGOB 4M3BA 5FKKA 3JRHA 2CU7A 3S1NJ 1OCPA 1JUMA 4A3IJ 3BG5A 1MBHA 1EF4A 1MNMC 1NTCA 2CUEA 2H8RA 2IEKA 1HF0A 2GLOA 3NAUA 2K9SA 3Q0VA 3GTQJ 2CQQA 3O8GA 2Y9ZA 2JA6J 2CJJA 2IAIA 2B63J 3LSPA 2JN6A 2XSDC 2X6OA 3Q3SA 2X48A 3JRIA 2LY9A 2VUMJ 1VI0A 3WHCA 3BG3A 2FX0A 2IBDA 2XB5A 5IP7J 2XPVA 3HBLA 4A3KJ 1BA5A 5C3EJ 3ZQGA 2WV1A 3TEDA 4XICA 1O4XA 4X6AJ 3GBGA 3CCYA 2LK2A 2DA6A 4JX6A 1JT0A 2MGQA 4HNVA 4FISA 4Y52J 4A3DJ 1WPKA 4QTRA 4MFDA 3PO3J 1G2HA 2CQXA 5M3MJ 3HDDA 3GTKJ 2WAQN 1ZTRA 2MSYA 4M3GA 4MFEA 1BL0A 3GTLJ 5M3FJ 1RETA 1XG1A 1BW6A 3HEFA 3SFIA 3HOVJ 2N8GA 2L0KA 4A93J 4C3JJ 3M4OJ 2LLKA 1Y1VJ 1HOMA 1A6IA 2M8GX 2Y0SN 3CDLA 3GTMJ 3GTOJ 1Z77A 2YUSA 4C3IJ 3JRAA 1B8IA 2HQ5A 1Q1VA 3BT9A 2EZHA 4QIWN 2DMTA 1POGA 1RKWA 2EQRA 5FKNA 4XRMA 4DYCA 1AU7A 4L5EA 1MBKA 1WH5A 5J1RA 2DA4A 3A01A 1DU6A 1E3OC 1OFCX 2OF7A 3RKQA 3I4NJ 3Q0WA 4DZJA 2JJ7A 2K40A 5J3LA 1NK3P 1Z0XA 4B3AA 2JA7J 1I3QJ 2NVXJ 3G1LA 2XGDA 5M5YJ 3SDGA 5EDNA 1R9TJ 2R7ZJ 1IUFA 1X58A 3K7AJ 5JLXA 4DYQA 2MW8A 3ZQHA 5GPAA 1X2NA 4UUSB 1D5YA 1ETXA 2M2EA 2O9LA 5EZHA 4Y7NJ 4I6ZA 1AHDP 2XRLA 2E2JJ 3JR9A 5E3LA 3NARA 4D7MA 5J1UA 2OPTA 4A3LJ 2DA3A 3MN2A 2O8KA 1VFCA 1LFBA 1ZKGA 2RAEA 5EZGA 1ZR4A 1JKPC 2EZKA 2R5ZB 1W0UA 3C2BA 2JWTA 4CYCB 1GUUA 5C44J 4D5FA 1GVDA 5GPCA 1APLC 5E3OA 2ECBA 2NVQJ 1MBEA 2M34A 3QPSA 5HODA 1U9OA 2K9QA 2VKEA 1P7IA 2D5VA 1JTYA 5F1JA 4B1RA 3BR6A 4G12A 3JREA 1UG2A 4UUSA 3BTCA 4J19A 5K7HA 3DCFA 1VNDA 4EEFG 5F0HA 1HDPA 1A5JA 4W1UA 2AHQA 1BW5A 5EYRA 2ELKA 4I76A 3FKIJ 1MBFA 5GP9A 1S7EA 1IDZA 4M6VA 4A3EJ 4B4CA 2JA8J 1QPIA 2I10A 1FIAA 1WCMJ 3LSGA 3PM1A 1F36A 1GV2A 3JRBA 4RDUA 1OJLA 4XIDA 3FK7A 1MBGA 1TWFJ 3BTIA 2DMQA 3ZQIA 1ITYA 1WH7A 3BR1A 2DMPA 1ETVA 1QRYA 2DA7A 2L7FP 4RBOA 3CMYA 3S1RJ 2NVYJ 4A3BJ 2FJ1A 1IV6A 1B72B 2EBIA 3ZOBA 4BBRJ 5F04A 3CQZJ 2DN0A 1FIPA 3S15J 4IHXA 3OIOA 2R0QC 3ZQFA 2JK3A 3HM5A 2NOGA 5DS9A 1JJ8C 2P81A 3S17J 3VPRA 4JX4A 1H89C 4DZPA 3L1PA 2NVTJ 1B72A 2E19A 2JA5J 5E3NA 1HCRA 3WHBA 3IH2A 4AYBN 1SFOJ 2YU9J 1FEXA 4ABZA 5EF6A 4FTHA 3A01B 3DEWA 4M3FA 3QQAA 5IYBJ 5DTDA 1TWAJ 1GV5A 2WB1N 3E7LA 1RKTA 1GT0C 1ZGWA 5K7ZA 1IC8A 3S2HJ 3S2DJ 5FLVA 3H3VK 3S14J 2GM4A 2COBA 2DTZA 5IYDJ 4X1EA 5F0CA 1JKOC 1ZQ3P 1U9NA 3LSRA 4XRSA 2MG4A 2XB0X 2LFBA 4BY1J 2ZB9A 3GTJJ 3IH4A 4A69C 3O8HA 2R5YB 2XPUA 1LFUP 2L9RA 3BG9A 4W97A 2YS9A 4NDLA 2HOSA 3MVPA 2L7MP 3ZQLA 1WI3A 1AKHB 1U78A 4IHWA 1ZR2A 5IPAA 5IP6A 2ID3A 5EG0A 2HI3A 1RPWA 3S1QJ 2XGCA 1X2MA 3BR2A 2R5ZA 3BR5A 3A03A 1MSFC 3FK6A 3FISA 3A02A 5BNGA 4JYKA 2E2HJ 1B8IB 1QVUA 3W6VA 5F0FA 3IH3A 4BXXJ 3GTGJ 2DMNA 2DA1A 1YRNA 3G1OA 4M3EA 4IHVA 4AC0A 1PUFA 2HOTA 2E1OA 4UUTA 1F43A 4A3FJ 2Y9YA 3BTLA 3IV5A 3HOXJ 1UMQA 4C3HJ 2XPWA 4C2MJ 1ETQA 1YRNB 4D5CA 1Y1WJ 5FKLA 3GTPJ 5F27A 4BBSJ 1BJZA 5FKOA 4BKXA 2H1KA 3BQYA 1HLVA 3G1MA 5M5XJ 3I4MJ 2EH3A 5C4JJ 4M3DA 3BR0A 1MBJA 2K9NA 1IGNA 1LE8A 1IG7A 3K2AA 1PUFB 2HOAA 1ETWA 2NS7A 3D1NI 1TWHJ 4A3MJ 4FCYA 3OSGA 3SJMA 4FE7A 2O7OA 1ENHA 2M9HA 3RZDJ 1JKRC 2EZLA 5FLMJ 2XGEA 1I50J 2FD5A 3RQIA 3UKGA 1JJ6C 3RZOJ 4MLOA 2R5YA 1GDTA 1TWCJ 3HOYJ 3JRCA 4MO7A 2LTPA 3S1MJ 3JRDA 2Y2ZA 1T56A 9ANTA 3LSJA 2M0CA 2E2IJ 1JUSA 3B6AA 2QF7A 1CQTA 2GBYA 3B6CA 3HGGA 4D7NA 3MKLA 5J1YA 2DA5A 1DU0A 3ZQCA 4XRSG 1VF9A 1JGGA 4JP0A 2KDZA 1WGXA 1I6HJ 4BY7J 1ETKA 1TWGJ 2HXOA 5EG0B 3HB9A 2X9DA 1ORKA 4JX5A 1U8BA 1HDDC 3S16J 3LNQA 2LR8A 2L7ZA 1FJLA 1W0TA 4IEJA 1JT6A 2PMZN 1K61A 3BTJA 2Y31A 5K7FA 3HOWJ 3M3YJ 2FQ4A 3TP0A 1ETYA 2VPRA 3OOUA 1H88C 5C4XJ 2G0EA 2TRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W48 A;  2JMW A;  5JLW A;  2LD5 A;  2HDD A;  3H0G J;  1AKH A;  3HGY A;  2TCT A;  4FE4 A;  3HOZ J;  1IRZ A;  3OSF A;  1IDY A;  4A3C J;  1MH4 A;  1IJW C;  1XS9 A;  2R93 J;  2AO9 A;  3TP3 A;  2VKV A;  3TW7 A;  1P7J A;  5F08 A;  3JRF A;  1SAN A;  4V2G A;  1JKQ C;  2ID6 A;  2Y30 A;  1JUP A;  1H8A C;  2R92 J;  5FKM A;  1JTX A;  5IYC J;  4LOC A;  2LVS A;  4MIM A;  1FTZ A;  5EEA A;  5IOZ A;  1ETO A;  1MH3 A;  5EGO A;  3QPL A;  1RES A;  4IHY A;  1OCT C;  4V2F A;  2VI6 A;  2DA2 A;  2CUF A;  1ZK8 A;  1RR7 A;  4AUX A;  1UHS A;  2NS8 A;  4DW6 A;  2KT0 A;  3HOU J;  1K83 J;  4CYC A;  3FIW A;  2ME0 A;  4S0H B;  2ECC A;  2HYJ A;  1TC3 C;  2CRG A;  2LKX A;  2LP0 A;  3BR3 A;  5FJ8 J;  3PO2 J;  1QVT A;  3HKZ N;  3Q0U A;  4GFB A;  5E3M A;  1NK2 P;  1XC5 A;  3LOC A;  2DMU A;  4DYR A;  2EZI A;  3JRG A;  4QSH A;  4A3G J;  5M5W J;  1FTT A;  2ME6 A;  1MSE C;  5IOY A;  3F0C A;  5IP9 J;  2DJN A;  1LE8 B;  1T33 A;  3BQZ A;  2HXI A;  4XK4 A;  4A3J J;  3TW6 A;  2QCO A;  5EGO B;  4M3B A;  5FKK A;  3JRH A;  2CU7 A;  3S1N J;  1OCP A;  1JUM A;  4A3I J;  3BG5 A;  1MBH A;  1EF4 A;  1MNM C;  1NTC A;  2CUE A;  2H8R A;  2IEK A;  1HF0 A;  2GLO A;  3NAU A;  2K9S A;  3Q0V A;  3GTQ J;  2CQQ A;  3O8G A;  2Y9Z A;  2JA6 J;  2CJJ A;  2IAI A;  2B63 J;  3LSP A;  2JN6 A;  2XSD C;  2X6O A;  3Q3S A;  2X48 A;  3JRI A;  2LY9 A;  2VUM J;  1VI0 A;  3WHC A;  3BG3 A;  2FX0 A;  2IBD A;  2XB5 A;  5IP7 J;  2XPV A;  3HBL A;  4A3K J;  1BA5 A;  5C3E J;  3ZQG A;  2WV1 A;  3TED A;  4XIC A;  1O4X A;  4X6A J;  3GBG A;  3CCY A;  2LK2 A;  2DA6 A;  4JX6 A;  1JT0 A;  2MGQ A;  4HNV A;  4FIS A;  4Y52 J;  4A3D J;  1WPK A;  4QTR A;  4MFD A;  3PO3 J;  1G2H A;  2CQX A;  5M3M J;  3HDD A;  3GTK J;  2WAQ N;  1ZTR A;  2MSY A;  4M3G A;  4MFE A;  1BL0 A;  3GTL J;  5M3F J;  1RET A;  1XG1 A;  1BW6 A;  3HEF A;  3SFI A;  3HOV J;  2N8G A;  2L0K A;  4A93 J;  4C3J J;  3M4O J;  2LLK A;  1Y1V J;  1HOM A;  1A6I A;  2M8G X;  2Y0S N;  3CDL A;  3GTM J;  3GTO J;  1Z77 A;  2YUS A;  4C3I J;  3JRA A;  1B8I A;  2HQ5 A;  1Q1V A;  3BT9 A;  2EZH A;  4QIW N;  2DMT A;  1POG A;  1RKW A;  2EQR A;  5FKN A;  4XRM A;  4DYC A;  1AU7 A;  4L5E A;  1MBK A;  1WH5 A;  5J1R A;  2DA4 A;  3A01 A;  1DU6 A;  1E3O C;  1OFC X;  2OF7 A;  3RKQ A;  3I4N J;  3Q0W A;  4DZJ A;  2JJ7 A;  2K40 A;  5J3L A;  1NK3 P;  1Z0X A;  4B3A A;  2JA7 J;  1I3Q J;  2NVX J;  3G1L A;  2XGD A;  5M5Y J;  3SDG A;  5EDN A;  1R9T J;  2R7Z J;  1IUF A;  1X58 A;  3K7A J;  5JLX A;  4DYQ A;  2MW8 A;  3ZQH A;  5GPA A;  1X2N A;  4UUS B;  1D5Y A;  1ETX A;  2M2E A;  2O9L A;  5EZH A;  4Y7N J;  4I6Z A;  1AHD P;  2XRL A;  2E2J J;  3JR9 A;  5E3L A;  3NAR A;  4D7M A;  5J1U A;  2OPT A;  4A3L J;  2DA3 A;  3MN2 A;  2O8K A;  1VFC A;  1LFB A;  1ZKG A;  2RAE A;  5EZG A;  1ZR4 A;  1JKP C;  2EZK A;  2R5Z B;  1W0U A;  3C2B A;  2JWT A;  4CYC B;  1GUU A;  5C44 J;  4D5F A;  1GVD A;  5GPC A;  1APL C;  5E3O A;  2ECB A;  2NVQ J;  1MBE A;  2M34 A;  3QPS A;  5HOD A;  1U9O A;  2K9Q A;  2VKE A;  1P7I A;  2D5V A;  1JTY A;  5F1J A;  4B1R A;  3BR6 A;  4G12 A;  3JRE A;  1UG2 A;  4UUS A;  3BTC A;  4J19 A;  5K7H A;  3DCF A;  1VND A;  4EEF G;  5F0H A;  1HDP A;  1A5J A;  4W1U A;  2AHQ A;  1BW5 A;  5EYR A;  2ELK A;  4I76 A;  3FKI J;  1MBF A;  5GP9 A;  1S7E A;  1IDZ A;  4M6V A;  4A3E J;  4B4C A;  2JA8 J;  1QPI A;  2I10 A;  1FIA A;  1WCM J;  3LSG A;  3PM1 A;  1F36 A;  1GV2 A;  3JRB A;  4RDU A;  1OJL A;  4XID A;  3FK7 A;  1MBG A;  1TWF J;  3BTI A;  2DMQ A;  3ZQI A;  1ITY A;  1WH7 A;  3BR1 A;  2DMP A;  1ETV A;  1QRY A;  2DA7 A;  2L7F P;  4RBO A;  3CMY A;  3S1R J;  2NVY J;  4A3B J;  2FJ1 A;  1IV6 A;  1B72 B;  2EBI A;  3ZOB A;  4BBR J;  5F04 A;  3CQZ J;  2DN0 A;  1FIP A;  3S15 J;  4IHX A;  3OIO A;  2R0Q C;  3ZQF A;  2JK3 A;  3HM5 A;  2NOG A;  5DS9 A;  1JJ8 C;  2P81 A;  3S17 J;  3VPR A;  4JX4 A;  1H89 C;  4DZP A;  3L1P A;  2NVT J;  1B72 A;  2E19 A;  2JA5 J;  5E3N A;  1HCR A;  3WHB A;  3IH2 A;  4AYB N;  1SFO J;  2YU9 J;  1FEX A;  4ABZ A;  5EF6 A;  4FTH A;  3A01 B;  3DEW A;  4M3F A;  3QQA A;  5IYB J;  5DTD A;  1TWA J;  1GV5 A;  2WB1 N;  3E7L A;  1RKT A;  1GT0 C;  1ZGW A;  5K7Z A;  1IC8 A;  3S2H J;  3S2D J;  5FLV A;  3H3V K;  3S14 J;  2GM4 A;  2COB A;  2DTZ A;  5IYD J;  4X1E A;  5F0C A;  1JKO C;  1ZQ3 P;  1U9N A;  3LSR A;  4XRS A;  2MG4 A;  2XB0 X;  2LFB A;  4BY1 J;  2ZB9 A;  3GTJ J;  3IH4 A;  4A69 C;  3O8H A;  2R5Y B;  2XPU A;  1LFU P;  2L9R A;  3BG9 A;  4W97 A;  2YS9 A;  4NDL A;  2HOS A;  3MVP A;  2L7M P;  3ZQL A;  1WI3 A;  1AKH B;  1U78 A;  4IHW A;  1ZR2 A;  5IPA A;  5IP6 A;  2ID3 A;  5EG0 A;  2HI3 A;  1RPW A;  3S1Q J;  2XGC A;  1X2M A;  3BR2 A;  2R5Z A;  3BR5 A;  3A03 A;  1MSF C;  3FK6 A;  3FIS A;  3A02 A;  5BNG A;  4JYK A;  2E2H J;  1B8I B;  1QVU A;  3W6V A;  5F0F A;  3IH3 A;  4BXX J;  3GTG J;  2DMN A;  2DA1 A;  1YRN A;  3G1O A;  4M3E A;  4IHV A;  4AC0 A;  1PUF A;  2HOT A;  2E1O A;  4UUT A;  1F43 A;  4A3F J;  2Y9Y A;  3BTL A;  3IV5 A;  3HOX J;  1UMQ A;  4C3H J;  2XPW A;  4C2M J;  1ETQ A;  1YRN B;  4D5C A;  1Y1W J;  5FKL A;  3GTP J;  5F27 A;  4BBS J;  1BJZ A;  5FKO A;  4BKX A;  2H1K A;  3BQY A;  1HLV A;  3G1M A;  5M5X J;  3I4M J;  2EH3 A;  5C4J J;  4M3D A;  3BR0 A;  1MBJ A;  2K9N A;  1IGN A;  1LE8 A;  1IG7 A;  3K2A A;  1PUF B;  2HOA A;  1ETW A;  2NS7 A;  3D1N I;  1TWH J;  4A3M J;  4FCY A;  3OSG A;  3SJM A;  4FE7 A;  2O7O A;  1ENH A;  2M9H A;  3RZD J;  1JKR C;  2EZL A;  5FLM J;  2XGE A;  1I50 J;  2FD5 A;  3RQI A;  3UKG A;  1JJ6 C;  3RZO J;  4MLO A;  2R5Y A;  1GDT A;  1TWC J;  3HOY J;  3JRC A;  4MO7 A;  2LTP A;  3S1M J;  3JRD A;  2Y2Z A;  1T56 A;  9ANT A;  3LSJ A;  2M0C A;  2E2I J;  1JUS A;  3B6A A;  2QF7 A;  1CQT A;  2GBY A;  3B6C A;  3HGG A;  4D7N A;  3MKL A;  5J1Y A;  2DA5 A;  1DU0 A;  3ZQC A;  4XRS G;  1VF9 A;  1JGG A;  4JP0 A;  2KDZ A;  1WGX A;  1I6H J;  4BY7 J;  1ETK A;  1TWG J;  2HXO A;  5EG0 B;  3HB9 A;  2X9D A;  1ORK A;  4JX5 A;  1U8B A;  1HDD C;  3S16 J;  3LNQ A;  2LR8 A;  2L7Z A;  1FJL A;  1W0T A;  4IEJ A;  1JT6 A;  2PMZ N;  1K61 A;  3BTJ A;  2Y31 A;  5K7F A;  3HOW J;  3M3Y J;  2FQ4 A;  3TP0 A;  1ETY A;  2VPR A;  3OOU A;  1H88 C;  5C4X J;  2G0E A;  2TRT A; 
#chains in the Genus database with same CATH topology
 1RUN A;  2JMW A;  1ZG5 A;  1WHU A;  2LD5 A;  2CW8 A;  1ON2 A;  3HGY A;  2DT5 A;  3P5J A;  1MDM B;  1AKH A;  4RGR A;  2IXS A;  3RCO A;  3OSF A;  4B09 A;  5IT3 A;  1SMT A;  2OQG A;  2X85 A;  2EIN H;  1ZRD A;  4A3C J;  1D1B A;  4A5N A;  2VOP A;  1XGO A;  1SVL A;  1XS9 A;  3L2R A;  2Y0M A;  3ELK A;  1T98 A;  3TGN A;  1TNT A;  1O3R A;  2NNY A;  1LDJ A;  3JRF A;  4UVA A;  2CG4 A;  4ITV A;  2W85 A;  2GIZ A;  4MGR A;  3OR1 C;  4L0Z B;  3IWF A;  1JTX A;  2LKP A;  4LGW A;  3FM5 A;  3KP7 A;  1CGP A;  1VQN I;  2VIX A;  3PFI A;  1MH3 A;  1PUE E;  2QVO A;  1EA3 A;  3QPL A;  1I27 A;  2G7U A;  2CV2 A;  1OCT C;  1S72 I;  2GXB A;  1OYI A;  2CUF A;  1ZK8 A;  1L0O C;  3BZC A;  3CLQ A;  1LDK B;  3SHF A;  2NS8 A;  2E36 A;  1K6O A;  4NBQ A;  2HDC A;  1UG0 A;  2O61 A;  1O3T A;  4CYC A;  3G6E I;  4P1W A;  5F1R A;  4S0H B;  1ZG3 A;  5LHI A;  4XON A;  1HSJ A;  5FJ8 J;  3PO2 J;  3HHH A;  2QYO A;  1FOW A;  2XF5 A;  2B9S A;  1FBS A;  2EZI A;  4QSH A;  2ELH A;  2ME6 A;  1MSE C;  2EWN A;  3F0C A;  4AM3 A;  2YPR A;  3KPH A;  1XPX A;  3TOB A;  3TMO A;  2PG4 A;  5E8G A;  3TW6 A;  1Z6T A;  4CCN A;  4WWC A;  3CTA A;  1XB4 A;  4G8X A;  2CU7 A;  2MD0 A;  2V6C A;  2M1B A;  4ZDO A;  2W82 A;  4A3I J;  3BG5 A;  3GZ5 A;  3M1E A;  4PUS A;  1MNM C;  1BIA A;  1NTC A;  2H8R A;  5D4S A;  4IJA A;  2K9S A;  2L4M A;  3M8E A;  2X51 A;  5HLT A;  2CQQ A;  3O8G A;  3QAH A;  5J40 A;  3F23 A;  1BJA A;  2JN6 A;  2R7T A;  2JSC A;  3BC8 A;  2KFD A;  2XSD C;  2PMZ A;  2WV0 A;  2R7V A;  3E1S A;  2X6O A;  1IUY A;  3CDH A;  3CJQ B;  1BM9 A;  1UHW A;  4M71 A;  4XRF A;  4XN3 A;  3WHC A;  2FX0 A;  2B0L A;  5IP7 J;  1BA5 A;  1IV8 A;  1BC8 C;  5C3E J;  3HXL A;  2VL8 A;  1HST A;  4ZC3 A;  3R6S A;  2P6T A;  2V26 A;  2IJL A;  5CVI A;  4XIC A;  3TO9 A;  4RMN A;  2E5N A;  3K2Z A;  1LKX A;  2ADU A;  2UV1 A;  1O4X A;  4X6A J;  3GBG A;  3CCY A;  2DA6 A;  3GEZ A;  1J0R A;  1JT0 A;  2MGQ A;  3PQK A;  5ERI A;  4E7S A;  4QPQ A;  1GXQ A;  3L00 A;  1P92 A;  2WAQ N;  3FMQ A;  1YO5 C;  2MSY A;  3B02 A;  4BGD A;  4C2U A;  2VQG A;  1RET A;  3SFI A;  3H35 A;  3HEF A;  3HOV J;  3VEP A;  2VKH A;  2A6E F;  4G6D A;  3V42 A;  1TL8 A;  2DFH A;  3RYP A;  3M4O J;  2LLK A;  1SFK A;  2FUG 2;  3J80 K;  1OLT A;  4V19 K;  2A5Y B;  1SD6 A;  2EV6 A;  2W1O A;  2DFF A;  1D8K A;  3CJN A;  5HDG A;  2YUS A;  4C3I J;  2YX7 A;  2L9S A;  3ONQ A;  1MKM A;  4BQN A;  5A2Q K;  2EZH A;  4QIW N;  2A05 A;  4CZZ A;  3VYR B;  4AVZ A;  2UZK A;  2LG4 A;  2H94 A;  4HX8 A;  3PSI A;  4O3M A;  1J09 A;  3AG3 H;  4M9Z A;  2E7X A;  2OF7 A;  3RKQ A;  3K1N A;  3OWT A;  3Q0W A;  2JJ7 A;  3AG1 H;  4PSX A;  1Z0X A;  4KIB A;  2NVX J;  2VT2 A;  3G1L A;  1RNL A;  4ASN A;  2XGD A;  3SDG A;  5GAD J;  2OZU A;  3G73 A;  3SEQ A;  5DUK A;  1IUF A;  3HSF A;  4Z6Y A;  4G6T B;  5JVG F;  1XTA A;  4LLN A;  4KMU X;  2ZNY A;  2XHK A;  1QBJ A;  3GFM A;  1MMS A;  2MW8 A;  4JQF A;  1X2N A;  3T1B A;  4LIT A;  2O9L A;  3CC4 I;  3T0Y A;  3J7A Y;  2XRL A;  2XVC A;  5D6E A;  2OC6 A;  1AOY A;  3NAR A;  1FT9 A;  5CLS A;  5GAG J;  3QYE A;  1WVR A;  4HSR A;  2LH9 A;  3E6C C;  1K4T A;  3SXY A;  1JKP C;  1E2X A;  3VSL A;  4IRG A;  2DK8 A;  3AKZ A;  2R5Z B;  1G3Y A;  3S2W A;  2WY7 Q;  2HVS A;  4ANJ A;  3QOP A;  3WTY C;  2K85 A;  2PJR B;  2VC1 A;  2DAO A;  3GF2 A;  3QPS A;  1CF7 A;  1DUX C;  3KZZ A;  3RPU D;  2R4G A;  5ILS A;  4HA8 A;  3SDB A;  3HZJ A;  1O3S A;  3VWB A;  1P7I A;  3PSF A;  1QPM A;  5JI6 A;  3KP2 A;  3FBN B;  3BR6 A;  2DW4 A;  4O6J A;  1Y39 A;  1SFX A;  2FML A;  4J19 A;  3E3V A;  1EKE A;  4Q4Z F;  4DBR A;  5F0H A;  2JRM A;  2E35 A;  2HKX A;  2ZO4 A;  1D1A A;  2IT0 A;  4I76 A;  1VQ7 I;  2W84 A;  5GP9 A;  1MGT A;  4HQM A;  2EK5 A;  4CXF A;  4OIN F;  3HL2 A;  4A3E J;  4HZF A;  2W25 A;  2OQR A;  4Y33 A;  1QPI A;  2CGP A;  2R3S A;  1FIA A;  3QRF F;  1C0W A;  1WCM J;  3LSG A;  3PM1 A;  1G59 A;  1MW7 A;  3JRB A;  4RDU A;  1EV7 A;  1MDM A;  1MBG A;  1CF7 B;  4NHJ A;  4FX4 A;  3G3Z A;  3LMM A;  4HYE A;  4UV8 A;  3VOD A;  3ZQI A;  2ZME C;  2YSR A;  2DDB A;  5LLQ A;  2DA7 A;  2QZ8 A;  2IA1 A;  1KQ9 A;  3M9A A;  4XOP A;  3L2Q A;  4A3B J;  1B72 B;  2BY2 A;  3R60 A;  3H9Q A;  5F04 A;  5E79 C;  3MCZ A;  1W4M A;  4AWX B;  4IRH A;  1YS7 A;  2RNJ A;  1FIP A;  2GWR A;  5TIS C;  3CC2 I;  4Q5S F;  5HS8 A;  3J81 Z;  3I0T A;  4XR6 A;  1O3Q A;  3ZQF A;  4XLN F;  3HM5 A;  3PIP F;  5FFX A;  4CIC A;  3W2A A;  5FD5 A;  4P5O A;  2DFI A;  2P81 A;  3EPZ A;  4EMS A;  3S17 J;  3LFK A;  4BAY A;  4DJA A;  1XSX A;  4IXA A;  3TO6 A;  3TL4 X;  2NVT J;  1BI3 A;  1B72 A;  1OYW A;  3FXM A;  4S05 A;  3WHB A;  3QU3 A;  1LNW A;  4BHP A;  2V1U A;  3TBI A;  3OL3 A;  2DPD A;  4I02 A;  3Q5F A;  3QYF A;  2F5E A;  5EF6 A;  3WGG A;  3DEW A;  2XAS A;  2Y69 H;  4PGG A;  3F6V A;  5IYB J;  1J75 A;  1VQL I;  1FOK A;  2WB1 N;  1GT0 C;  2Y75 A;  3ECH A;  2PI0 A;  5IY5 H;  4EAT A;  3GXO A;  2IS4 A;  2VT3 A;  2COB A;  3WTX C;  1FP1 D;  4U0Y A;  1Q1H A;  4AIH A;  1OIS A;  3QPT A;  2LFB A;  3GTJ J;  2QQ8 A;  1MMD A;  1N25 A;  3V8K A;  2KRF A;  4W97 A;  3BG7 A;  3ZXS A;  3WTU C;  2H8W A;  3MVP A;  2V79 A;  1OPC A;  3JW4 A;  1P4W A;  1R4M B;  3S32 A;  4EM0 B;  1OR7 C;  5E8I A;  4KUM A;  2HWV A;  5ICC A;  4PSW A;  3CC7 I;  3RYR A;  2QQA A;  4UVC A;  3IRQ A;  3F8F A;  3TQN A;  3BR2 A;  2KZG A;  3BR5 A;  2BXY A;  2BE5 F;  2K4J A;  1P6R A;  1TT5 B;  3DTK A;  1OKR A;  4JYK A;  4FAS D;  2E2H J;  3OL4 A;  2XSJ C;  3R0A A;  1OMI A;  3W6V A;  2DJI A;  3IH3 A;  4IOA F;  4BXX J;  1SAX A;  2YR2 A;  1R5G A;  5DM7 F;  3H5R A;  1YRN A;  5DYM A;  4M3E A;  4LLL A;  2KIU A;  4AC0 A;  1YOV B;  3GZ6 A;  1PUF A;  4UUT A;  1F43 A;  3LSI A;  4A3F J;  4DNC A;  4AID A;  4DIQ A;  2M7A A;  1OR7 A;  3H5N A;  2VBX A;  2XPW A;  3SYT A;  3ABM H;  1K7A A;  2ISY A;  5DV5 A;  1Y1W J;  3GTP J;  2XF7 A;  4GCV A;  3GFL A;  1Z9C A;  2H1K A;  2M5W A;  1HXD A;  1X19 A;  3BQY A;  1MD0 A;  3D0S A;  5EEG A;  1BN5 A;  2MLG A;  5M5X J;  5C4J J;  4M3D A;  2WY8 Q;  1ONV A;  2BY1 A;  1IGN A;  5F6F A;  2DLL A;  1ZEL A;  1IG7 A;  1SAU A;  2KRC A;  2ZXH A;  3K70 D;  5B5E C;  1A36 A;  4M6Y A;  2Z99 A;  3X2Q H;  4F3Q A;  5AIQ A;  1ENH A;  3H3Z A;  2Y0S A;  3K0L A;  3ZMV A;  2KQR A;  2EZL A;  5FLM J;  1SMY F;  2W24 A;  2F5C A;  2E1M B;  4DBQ A;  1I50 J;  2A6H F;  2E5Z A;  3C7J A;  3BPX A;  3TKY A;  2ZXJ A;  1TWC J;  2R7O A;  3J7Z I;  3JRC A;  1Z3Y A;  5CVV A;  3EUK L;  2LBF A;  3JRD A;  4IZZ A;  2BW3 A;  1AA7 A;  2PBI A;  3DBH B;  3FWE A;  3LSJ A;  4CH7 A;  5BMZ A;  3AG2 H;  2QBY A;  3IP4 B;  2Q1Z B;  4KN7 X;  2E2I J;  1JUS A;  3AFH A;  4XKV A;  1G3W A;  2VKD A;  2VBZ A;  4AYB A;  2KP6 A;  2DA5 A;  2EFW A;  3PJR A;  4UXN A;  3ZQC A;  1VF9 A;  3E5X A;  3WU2 C;  1NG6 A;  2RC4 A;  4JP0 A;  2R7R A;  1WGX A;  1ODD A;  4KN4 X;  4BY7 J;  3TOA A;  1P9Q C;  1TWG J;  5EG0 B;  1WJE A;  2ICW G;  3H5A A;  2XKO A;  4DGW B;  1FJL A;  1FC3 A;  1YJ9 I;  2M30 A;  1OCO H;  1JT6 A;  3JSP A;  2V4J C;  1EH6 A;  4M74 A;  3H92 A;  2O3F A;  2BVM A;  1O7F A;  4TV7 A;  3QYB A;  1H88 C;  3MD2 A;  2AXL A;  3PFY A;  1FMW A;  5JLW A;  2JA2 A;  4BDY A;  4FE4 A;  1F4K A;  3ZQQ A;  2V9P A;  3KFW X;  1IRZ A;  3CZ6 A;  1WRJ A;  3H3U A;  1XGM A;  4I0B A;  4XNF A;  2VN2 A;  2J5P A;  3BOQ A;  2R7X A;  1IJW C;  4HV6 A;  2R93 J;  4M73 A;  3S93 A;  2H1L A;  4AIK A;  1ZN2 A;  3TW7 A;  1WKM A;  1P7J A;  5F08 A;  2FSW A;  5HS9 A;  2QGU A;  4BXU A;  1K78 B;  5D5U B;  2FRH A;  5LHH A;  4LG0 B;  2KKO A;  1PDN C;  3F8N A;  3V7C A;  3LL7 A;  2VOO A;  3Q9V A;  3MEX A;  5E17 F;  1ZGJ A;  1FP2 A;  1W7P D;  3RTR A;  2QKL B;  3F3X A;  5DD4 A;  4ZYG A;  5EGO A;  3K4C A;  2VPL A;  4D1Q A;  1ZAR A;  3K69 A;  2BY3 A;  5LHG A;  3ZPL A;  5LGU A;  2K4B A;  3MZH A;  1Y8R B;  1RR7 A;  3R61 A;  2P0W A;  4KT5 C;  2QSG X;  3DKY A;  4Q47 A;  1W7P A;  1IRX A;  1K83 J;  2FBK A;  3OS2 A;  1DGR M;  2P8T A;  5L3D A;  3FIW A;  3ZN1 A;  4GGG A;  2ECC A;  3HRS A;  4XKB A;  5FB2 A;  1DP7 P;  3QOD A;  1QVT A;  3HKZ N;  5E3M A;  3O6B B;  3P9K A;  1NK2 P;  4LLG F;  2A68 F;  2DMU A;  5L3G A;  4HF1 A;  1DP3 A;  1B4A A;  2DI3 A;  4A3G J;  5M5W J;  1JHF A;  1R36 A;  5IOY A;  2G9W A;  3QP6 A;  5IP9 J;  3WG7 H;  1OYY A;  2HXI A;  2IA0 A;  2O5R A;  5EGO B;  3N4M A;  1XGS A;  5FKK A;  4M72 A;  1IN4 A;  2PJP A;  2LYC A;  2R7Q A;  3MWM A;  4ON0 A;  1R7J A;  1EF4 A;  2CUE A;  1I3A A;  2DOE A;  4CCL A;  1IF1 A;  2GLO A;  1OCC H;  3OV8 A;  4EJT A;  2Y9Z A;  3GTQ J;  1Z3X A;  4XKC A;  2JA6 J;  2QQ9 A;  3JAM Z;  4RGX A;  3U1D A;  2BYV E;  1REP C;  5DM6 F;  3WTS C;  2LY9 A;  1W36 C;  3H0D A;  1YIO A;  2VUM J;  1PVE A;  3I58 A;  2XB5 A;  3MQ0 A;  3V8J A;  2XPV A;  3HBL A;  4CSW A;  2F2E A;  4C30 A;  4IVN A;  5KK1 A;  5LGT A;  5B1A H;  2R7U A;  2L02 A;  4HPQ A;  2Z9O A;  1ZAO A;  2JTV A;  4CCK A;  1YHQ I;  1P4X A;  2CQN A;  3I5U A;  1Y0U A;  3HIF A;  3MMY B;  2PLY A;  1YJW I;  3DU5 A;  2VJJ A;  4JX6 A;  4P96 A;  4HNV A;  3I59 A;  4FIS A;  3E5Q A;  2JUC A;  4Y52 J;  4MFD A;  3HDD A;  3GTK J;  1ZTR A;  3KEQ A;  2PN6 A;  3GFJ A;  1R1U A;  3GVA A;  4KT6 A;  5M3F J;  4ZTJ A;  3J81 K;  1B59 A;  2N8G A;  2FMY A;  2A5W A;  4C3J J;  3WE3 A;  2DYS H;  3FXR A;  1HQC A;  5D4R A;  2HYF A;  3L2C A;  3JRA A;  1S8N A;  1W7P B;  1GXP A;  2HQ5 A;  1Q1V A;  4HEA 2;  5KNL A;  1D8J A;  1BI1 A;  3GO5 A;  2LSO A;  2LDU A;  4XRM A;  4MTD A;  4YFN F;  1X3U A;  2V1D A;  4L5E A;  3ESW B;  4D0P A;  2VJ5 A;  1XSV A;  1E3O C;  1VQ5 I;  1ERD A;  2EV5 A;  2VQC A;  1MJ9 A;  4EJW A;  3OS0 A;  1X1P A;  4E7I A;  1LB2 A;  2FOK A;  3CJR B;  2K40 A;  1I3Q J;  2I5U A;  3FKJ A;  3NWS A;  5M5Y J;  5EDN A;  4HG2 A;  4BE0 A;  3BPV A;  1X58 A;  3K7A J;  3WE2 A;  1JGS A;  5D5V B;  3LQR A;  2KIF A;  3E5U A;  4BJ5 C;  1KGS A;  2BVL A;  3A0B C;  3BP8 A;  3ZQH A;  5GPA A;  2GAU A;  1D5Y A;  1SFE A;  4N4O B;  4I6Z A;  1T95 A;  3KE2 A;  4Y4R A;  1LQ1 A;  3DEE A;  2PQ8 A;  1S7O A;  5ED4 A;  5J1U A;  2OPT A;  3KP5 A;  4A3L J;  3MN2 A;  2O8K A;  3CP2 A;  1LFB A;  1ZKG A;  1TQI A;  3DXJ F;  5EZG A;  5B66 C;  3IWZ A;  4CCJ A;  4FT8 A;  3C2B A;  3CMA I;  4BNC A;  4ZTF A;  1KZH A;  4LD5 A;  4PJL A;  1S5L C;  3RKX A;  3QU6 A;  2HZT A;  1APL C;  2CMP A;  3LQQ A;  5E3O A;  2DO7 A;  2NVQ J;  1TW3 A;  2M34 A;  5HOD A;  2K9Q A;  1FY7 A;  1RC9 A;  3LSH A;  1JTY A;  1QHH D;  1Z7L A;  3K1P A;  5F1J A;  5H6R A;  5CVR A;  4A6E A;  1OCZ H;  1UST A;  3CD6 I;  3WGH A;  1UG2 A;  3OYH A;  3RQ4 A;  3DCF A;  1VND A;  2X6Y A;  4LG3 A;  4RAG A;  1A5J A;  4II3 A;  3H9J A;  1BW5 A;  5EYR A;  3EYI A;  5AIP A;  1V3F A;  1I1S A;  3FKI J;  1MBF A;  1KON A;  2MC4 A;  3K1M A;  1Z67 A;  1IDZ A;  4I01 A;  5DDG A;  1UJ8 A;  2P7V B;  2JA8 J;  3G4S I;  4XLF A;  1I39 A;  1W5C C;  1VQ4 I;  2F48 A;  3NEU A;  4PCQ A;  1F36 A;  3A1Y A;  4XLA A;  1XMA A;  4HOB A;  4IF4 A;  2E34 A;  4XLC A;  4YII A;  1ITY A;  2DFE A;  2A69 F;  4XOR A;  1QRY A;  1IN8 A;  1D0Z A;  2EIK H;  2AS5 F;  1LVA A;  2L7F P;  3L09 A;  4RBO A;  1VQM I;  2NVY J;  2OTJ I;  2FJ1 A;  1IV6 A;  3JTH A;  2ZME A;  4N9I A;  3SZT A;  3DKW A;  4HNU A;  3J80 Z;  4P9U A;  3F8B A;  4Z2Y A;  3CLO A;  5AON A;  2F4I A;  1O57 A;  4Y15 A;  2DN0 A;  4IQJ A;  1MIJ A;  2FEZ A;  1XX5 A;  4A0X A;  1O7L A;  4IHX A;  3OIO A;  2EFP A;  2M4K A;  4BQQ A;  2RV8 A;  1KU9 A;  2KIQ A;  2M4G A;  4J01 A;  3DKX A;  4CZC A;  2UUZ A;  3VPR A;  3CUQ C;  3CO7 C;  4UV9 A;  1XD7 A;  1YX5 A;  4A0Y A;  4DZP A;  3K6G A;  4BYY A;  1R1V A;  1G4D A;  2VE8 A;  1V5F A;  2JA5 J;  5E3N A;  4YG2 F;  4DOZ A;  2NRA C;  4AYB N;  3J7A O;  1SD4 A;  1TBX A;  4XBF A;  1FEX A;  4FTH A;  2PJR A;  1A35 A;  3K4M A;  3ZMS A;  4M3F A;  3QQA A;  1R5I D;  3F22 A;  1K79 A;  5DTD A;  2HVR A;  2R7F A;  3BDD A;  1WJF A;  5J4V A;  3S2D J;  5FLV A;  4UY8 I;  4ZJZ A;  3H3V K;  1X1A A;  2CYY A;  1QZY A;  3S14 J;  1YG2 A;  4R1H A;  5F0C A;  1JKO C;  2LRD A;  3LSR A;  4HRI A;  2MD5 A;  4ZZL A;  2ACJ A;  4OIQ F;  4XRS A;  2FNA A;  3GX4 X;  2MG4 A;  2XB0 X;  4RAY A;  2GOM A;  4BY1 J;  4B47 A;  3PIO F;  3IH4 A;  1R58 A;  2PMH A;  1E3H A;  2L9R A;  3BG9 A;  1X3Z B;  4BDZ A;  1ZRC A;  1UFM A;  2MBF A;  4IHT A;  3I55 I;  3BCA A;  4J00 A;  1MJA A;  5D8K B;  1U78 A;  1R49 A;  5IPA A;  3OY9 A;  4YEJ A;  2FBH A;  2HI3 A;  1FBU A;  5EEH A;  3BJA A;  3RKY A;  1D0Y A;  4HLY A;  4E7H A;  3A03 A;  1MSF C;  1XMX A;  3Q9S A;  3FIS A;  2DOD A;  1TNS A;  3DPU A;  3VYU B;  3DQV C;  5BNG A;  2H6C A;  4RAF A;  4ZDL A;  1B8I B;  2CQ7 A;  5F0F A;  3HOT A;  2A61 A;  3GTG J;  3MZY A;  2DMN A;  2KL4 A;  5JHF A;  2VBW A;  1J59 A;  2WWY A;  2VOD A;  3N05 A;  4WXC A;  5D6F A;  2HOT A;  3C3W A;  2HQA A;  3BG6 A;  3DU6 A;  2HTS A;  2Y9Y A;  1DPR A;  3BTL A;  4OAZ A;  5JFR A;  6PAX A;  3C1D A;  1GVJ A;  2NVU B;  1UMQ A;  4CUG A;  3UR3 C;  1HBX G;  5A2Q Z;  3DLL F;  2LF7 A;  1KA8 A;  1QZE A;  4UHT A;  4G7Z F;  5F27 A;  3HPH A;  5FKO A;  4BKX A;  1SVM A;  2PEX A;  1HLV A;  2VAS A;  4XSZ F;  5HNF A;  1TW2 A;  5E1W A;  3FBI B;  4ZH4 F;  3R0J A;  2OTL I;  3A2K A;  3K2A A;  3ZRG A;  3CCU I;  1IN7 A;  2NS7 A;  2VJI A;  3D1N I;  1TWH J;  4OIP F;  2DXI A;  5H20 A;  4BQO A;  2ZME B;  3NQO A;  3OYA A;  4NUB A;  2GA1 A;  3J7Y J;  3OSG A;  4YFK F;  2DOA A;  2Q2E A;  4FE7 A;  3K70 C;  1PP8 F;  2R7D A;  1IN5 A;  4D9J A;  3I4P A;  3I3L A;  4N4N B;  3CUQ A;  1ZRF A;  1I5Z A;  1TP4 A;  3AL0 C;  4LJZ F;  3FXQ A;  1R71 A;  1G3S A;  2R5Y A;  2JVG A;  1LEB A;  3HOY J;  3GLL A;  2L9V A;  3LST A;  9ANT A;  3VYS B;  2BBY A;  4Y17 A;  5GAE J;  5J4Y A;  1UHM A;  2X1C A;  5CYV A;  2FQ3 A;  4P9F A;  3D5L A;  2GBY A;  4IQ4 A;  3DFG A;  3R4K A;  4U88 A;  3MKL A;  2RRE A;  4CYD A;  1NHA A;  3LWF A;  1DU0 A;  2VQH A;  2CQK A;  2JPC A;  3ABK H;  3U9G A;  4XRS G;  3I64 A;  5LBQ A;  2MA3 A;  2KDZ A;  3VYT B;  3HUG A;  4KIG A;  2MH2 A;  4PZJ A;  2OBP A;  4BU2 A;  2X6W A;  3F9K A;  4HDU A;  1DGW Y;  1ORK A;  4JX5 A;  3TO7 A;  2HQR A;  2M3A A;  2X1E A;  2L7Z A;  3FXO A;  2IPQ X;  3FHZ A;  2PMZ N;  3HG9 A;  4BH9 A;  3AAF A;  3HOW J;  5FRO A;  4F52 A;  4I0A A;  1GLN A;  2DTR A;  2E60 A;  2EIM H;  2VB6 A;  3TP0 A;  4AD9 A;  1ETY A;  3PNT A;  4HBL A;  3B73 A;  1H9G A;  1SD7 A;  5C4X J;  2G0E A;  5D5X B;  2W48 A;  3BJO A;  2BOL A;  4G94 A;  3FMS A;  3SQN A;  1FYM A;  3WGI A;  1YFH A;  1IDY A;  3ISP A;  1OQY A;  2KLO A;  5IT9 K;  4L0Y B;  2ZFU A;  4KA4 A;  1MH4 A;  2V9K A;  1IO2 A;  3GWZ A;  4LG0 A;  1OCR H;  3RI4 A;  2EV0 A;  2PFB A;  3TP3 A;  4HQE A;  1U5T A;  1TLH B;  4WCG A;  1U0J A;  1SAN A;  4MQ9 F;  2HEO A;  2C6Y A;  2Q0O A;  1SD5 A;  3CDI A;  5JHU A;  5FKM A;  5FLX K;  1V4R A;  2WAE A;  1PJR A;  2DT7 B;  4CO8 A;  2ELJ A;  1G8X A;  4RGU A;  1FTZ A;  1DPU A;  5IOZ A;  5BPD A;  1ETO A;  3HHG A;  1YLF A;  2M0M A;  2FOW A;  1H0M A;  2A07 F;  1E3P A;  2XC7 A;  4AUX A;  2KT0 A;  4U7B A;  2HOE A;  1U5T C;  2ME0 A;  2HYJ A;  2P4W A;  1TC3 C;  2CRG A;  1R5H A;  1TQP A;  3SZG A;  2LP0 A;  2STT A;  3BR3 A;  5E20 A;  3JAM K;  3Q0U A;  3S3N A;  3E6B A;  4DYR A;  3VSK A;  1YE9 A;  4QWQ A;  3OYD A;  3JRG A;  3P9C A;  4IOC F;  1MNE A;  1S9H A;  3T8R A;  4G7O F;  2VXD A;  2V1X A;  1IW7 F;  3HC7 A;  1U6G A;  2BEO A;  2DJN A;  2O8X A;  4R8H A;  4CA0 A;  3G71 I;  3AG4 H;  3ABU A;  3ZGK A;  2H6B A;  4A3J J;  3CF5 F;  5H2F C;  2QCO A;  1YW8 A;  2IGM A;  1FYL A;  2BZT A;  3S1N J;  4P55 A;  2HKO A;  5CQG A;  4PFP A;  5K1Y A;  2IEK A;  1HF0 A;  4FET A;  4XMY A;  4HDV A;  1IN6 A;  1XCB A;  5HLI A;  4F92 B;  1TQM A;  5LEJ A;  3NWT A;  2B63 J;  3LSP A;  3OR2 C;  3TDU C;  4L9N A;  4Y3O A;  1YTY A;  3Q3S A;  2VBY A;  3JRI A;  3ECO A;  1A31 A;  1QU3 A;  3UNG C;  4EM1 A;  3BG3 A;  3S3M A;  4AIJ A;  1UAA A;  2ETH A;  2XV4 S;  2J5O A;  1QNT A;  1BOB A;  1ON1 A;  1UB9 A;  3F8M A;  3ZQG A;  2WV1 A;  2LY2 A;  1BI2 A;  1KYZ A;  1UCR A;  2ZC2 A;  4HF0 A;  1YIJ I;  1WJB A;  2LK2 A;  4UVB A;  2FA5 A;  4LMY A;  2XIG A;  2VJ4 A;  4E4H A;  2XRO A;  2NAZ A;  2DT6 A;  2CW7 A;  5M3M J;  1LDD A;  4M3G A;  4MFE A;  2CV1 A;  5L3C A;  1NH3 A;  4KIT B;  1XG1 A;  4HV5 A;  1Z7U A;  5GTH C;  4RB1 A;  4Y13 A;  3E0J B;  3IRR A;  2L0K A;  2GZW A;  3GFI A;  2RGV A;  3ZMU A;  2D1V A;  1A6I A;  2KJC A;  4GYI A;  1EJ9 A;  5CJ9 A;  5ICF A;  3CCV I;  4IKF A;  3GTM J;  3GTO J;  1Z77 A;  4LIV A;  5BQT A;  3GZN B;  3GCM A;  2Z16 A;  4OMY A;  3L2V A;  1B8I A;  4CCO A;  2XAF A;  2XKP A;  3I59 B;  1RKW A;  2EQR A;  2MH9 A;  2JT1 A;  3HTS B;  1AU7 A;  2H27 A;  4HLX A;  4HF2 A;  2OUM A;  4UB6 C;  1MBK A;  5ILU A;  3OYB A;  2XAQ A;  3O3K A;  4NC7 A;  2DA4 A;  1EH8 A;  3A01 A;  3C18 A;  1VQ9 I;  1DU6 A;  1XCV A;  3V8L A;  3I4N J;  1YW7 A;  5L3F A;  5K5Q A;  2HS5 A;  3V7R A;  4DZJ A;  3FXU A;  3CCJ I;  1NK3 P;  4B3A A;  2JA7 J;  1X1D A;  1WQ2 A;  3KYL A;  2O0Y A;  2QWW A;  4PJJ A;  3WTT C;  4BHC A;  2R7Z J;  4HX7 A;  2A3S A;  2L9N A;  3DTI A;  3P7N A;  4DYQ A;  1WSU A;  5FLX Z;  2HPI A;  1R1T A;  2ZNZ A;  5HVQ C;  1BIB A;  2XDV A;  4BL0 B;  2KHM A;  4UUS B;  2M2E A;  5TJJ A;  3U1K A;  4IPA A;  5EZH A;  4Y7N J;  2E2J J;  1QA6 A;  3PNV A;  5E3L A;  4EJV A;  1TT0 A;  1BI0 A;  3CO6 C;  2JZY A;  2OD5 A;  2DA3 A;  4NC6 A;  3W3C A;  2B7E A;  4II2 A;  4C9Y A;  2RAE A;  1FMV A;  2AXT C;  2MYS A;  3JSO A;  1IZ1 A;  3C2H A;  1Y6I A;  1LJ9 A;  4HST A;  4KFC A;  5ICE A;  1TZL A;  4BHB A;  5DUI A;  2W4S A;  4BAC A;  1XSD A;  5GPC A;  3LA2 A;  4LB5 A;  1AWC A;  1MBE A;  4X0G A;  2KPM A;  3EYY A;  4OMZ A;  1ZH5 A;  1R23 A;  2D5V A;  2E7W A;  1ZG1 A;  3V4G A;  1YJN I;  3A4C A;  3KP4 A;  4B3X A;  4EM2 A;  4UUS A;  3BTC A;  3K9T A;  2E1M C;  3BWG A;  2RDP A;  1FOY A;  4BXF A;  3KET A;  2X4H A;  1D5V A;  4WK8 F;  1HDP A;  1WWX A;  2OU2 A;  4W1U A;  2YX4 A;  2WB1 A;  3IHU A;  1B6A A;  2GXG A;  2ELK A;  2K7L A;  3DF8 A;  4RM2 A;  1T0F A;  1DQU A;  2CS3 A;  1D0X A;  4ZYA A;  4E6K G;  3CF2 A;  3WOD F;  4B4C A;  1FSH A;  2F5V A;  2HR3 A;  2X1D A;  4UNO A;  4I98 B;  1SVO A;  4I7H A;  2GIV A;  5JVT A;  2RVC A;  3EUH A;  4OIR F;  1GHC A;  1WJA A;  2WAF A;  2WC2 A;  2XAH A;  1GV2 A;  3ZR8 X;  1OJL A;  4XID A;  2JQ7 A;  4ENK A;  4ESB A;  2DMQ A;  5CQE A;  3CUQ B;  1WH7 A;  2HTJ A;  1I1G A;  1ETV A;  2BV6 A;  4L5J A;  4RAZ A;  5F64 A;  1BOA A;  4BEH B;  1TTY A;  2Q2E B;  3CMY A;  2VON A;  1ZGA A;  2DQL A;  2ZCW A;  4GYG A;  3ZOB A;  2E71 A;  1HKT A;  2MFZ A;  1U3E M;  1X4O A;  1BR1 A;  2QA4 I;  3I53 A;  1T38 A;  3IAS 2;  4K2E A;  3S15 J;  1U8R A;  1R4N B;  1KU7 A;  1T2K A;  2ZSI B;  1JJ8 C;  1NG7 A;  3HUG B;  1HC8 A;  3LSM A;  3S8P A;  1DDN A;  3E97 A;  2RQQ A;  3L1P A;  2OCC H;  2K3P A;  2K27 A;  2LF8 A;  2E19 A;  2JPB A;  3DLA A;  1HCR A;  1A04 A;  2L3D A;  2NXN B;  1SFO J;  2ISZ A;  5GTI C;  2WAD A;  4ABZ A;  2M45 A;  3A01 B;  3ZMD A;  3T5X A;  2OZ6 A;  1KU2 A;  3RDI A;  4I2O A;  4RLQ A;  1E17 A;  2DBB A;  4XKW A;  4E70 A;  2OJE D;  5K7Z A;  2EA2 A;  1FBQ A;  5EJC A;  2L4A A;  1IC8 A;  2A6T A;  3ROU A;  3FXK A;  2JRT A;  2GM4 A;  5IYD J;  1HW5 A;  1IRG A;  1KQ8 A;  1L3L A;  5TRD A;  3F21 A;  4WF2 A;  3FM3 A;  3U2R A;  4KMF A;  2QQB A;  3M1C A;  5H6Q A;  4A69 C;  2P5L C;  1S29 A;  2XPU A;  4ENN A;  1LFU P;  2CUZ A;  4NDL A;  1P2F A;  3GUD A;  3KEO A;  3ZQL A;  2V6E A;  3HRM A;  1ZYR F;  1WI3 A;  1AKH B;  4IHW A;  1LVK A;  1ZR2 A;  5GAH J;  2ID3 A;  5IP6 A;  3SZP A;  3VOE A;  3KP3 A;  4DQ2 A;  1Y8Q B;  1ZLJ A;  2HFH A;  3IUO A;  1X2M A;  2XGC A;  3S1Q J;  3PNY A;  1F9N A;  3KIO A;  2R5Z A;  1QQI A;  1FOX A;  5HS7 A;  2R7W A;  2K9M A;  5J6X A;  3OMY A;  2NS0 A;  3VB2 A;  4JK1 X;  1QVU A;  3W6K B;  2IP2 A;  5DCM B;  3FDY A;  3BZK A;  5KAF C;  3U21 A;  3F72 A;  2K86 A;  4IX7 A;  3M07 A;  2ZFW A;  2E1O A;  3LA3 A;  2HYG D;  4WXH A;  2DQR A;  4RGS A;  3IV5 A;  3JCU C;  4YIR X;  2PX9 A;  3OIQ A;  2ESN A;  1VQP I;  3HSR A;  2W57 A;  2XAG A;  4C3H J;  4CGZ A;  2ESH A;  2WAQ A;  4C2M J;  3WG9 A;  4D5C A;  4E7Z A;  4UUV A;  2BHY A;  1BJZ A;  3DP7 A;  2EFN A;  2RNG A;  1E0E A;  3DPL C;  3WTW C;  4A5M A;  3G1M A;  1Z6R A;  2OCE A;  1JE8 A;  3BR0 A;  2JSP A;  4B44 A;  2KIM A;  2ZSH B;  2K9N A;  3ZMT A;  4ZYD A;  2DOF A;  1PUF B;  1ZRE A;  1Z91 A;  2KZV A;  3KLO A;  4GXO A;  2HOA A;  2GQQ A;  3HYI A;  4FCY A;  3T8T A;  4F7Z A;  2NYX A;  3IKV A;  1LFP A;  3OYG A;  2O7O A;  5CVJ A;  4A12 A;  4PGH A;  2XGE A;  1K4S A;  2FD5 A;  3RQI A;  3UKG A;  1N78 A;  1X1B A;  5ICG A;  2K3F A;  3ERM A;  4F93 B;  5LEK A;  2I8D A;  2H09 A;  2ZXI A;  3GLX A;  5L3B A;  3GYH X;  4IHS A;  3S1M J;  2V7F A;  1T56 A;  4O5V A;  3BZ6 A;  4L5I A;  4FX0 A;  2M0C A;  4EQQ A;  3DBL B;  2BGC A;  2QM3 A;  1J5Y A;  1W1W E;  2QF7 A;  3OOP A;  1V5E A;  2HQN A;  3QP5 A;  3HGG A;  2XAU A;  2IS2 A;  4S04 A;  1X1C A;  2HNH A;  4QPO A;  4M9X A;  1FLI A;  1I6H J;  4ESJ A;  4KIC A;  3MFK A;  5ILV A;  3HOS A;  1G3T A;  2HXO A;  1HKQ A;  2X9D A;  3CMM A;  4E7L A;  4HX4 A;  1U8B A;  4H0E A;  1V54 H;  2LR8 A;  3BY6 A;  2F4O B;  4OWR B;  1W0T A;  1WI9 A;  3I56 I;  1XN7 A;  2QBY B;  2NNN A;  4MTE A;  4BJT A;  5JR3 A;  2M8E A;  2AQE A;  2Y31 A;  3LFU A;  5K7F A;  3M3Y J;  5CKT A;  2FQ4 A;  2JUG A;  2VPR A;  4BEH A;  1STZ A;  5B1B H;  4N0B A;  2TRT A;  1SEU A;  2D45 A;  2LMD A;  1QZZ A;  4G7H F;  2HDD A;  3H0G J;  1F5T A;  2K02 A;  2DU9 A;  2TCT A;  4H4K C;  4QLC U;  3HOZ J;  3K4J A;  4L9V A;  3ABL H;  4KDP A;  2EPF A;  1QGP A;  3AL0 B;  2CFX A;  1UZC A;  1WZ2 A;  2QSH X;  3WU1 B;  3OYK A;  1M1E B;  2AO9 A;  1BBY A;  3H9G A;  4XN0 A;  3OYF A;  1ULY A;  4PJ0 C;  4YFX F;  2QUF A;  2VKV A;  3HRU A;  3OS1 A;  3KZY A;  4GDF A;  1V55 H;  4YRV A;  2P5V A;  1K6Y A;  4V2G A;  1JKQ C;  4A0Z A;  3BRO A;  1XDU A;  2ID6 A;  3KX2 A;  2Y30 A;  3L9F A;  1BR2 A;  1P4A A;  1JUP A;  3RKW A;  1H8A C;  1R00 A;  1VQ6 I;  2R92 J;  1YS6 A;  5IYC J;  4LOC A;  2LVS A;  3ERE D;  4MIM A;  4E7K A;  1IXC A;  5EEA A;  2CV0 A;  3GME A;  1RES A;  1W5S A;  3K4K A;  4EJO A;  4IHY A;  4V2F A;  1D1C A;  2VI6 A;  2DA2 A;  3ZMZ A;  3F8C A;  3IL2 A;  1FPQ A;  1B1B A;  4ZDP A;  1UHS A;  4DW6 A;  3HOU J;  3P9I A;  3FMR A;  2X6X A;  1U5T B;  1B9M A;  3VFZ A;  3FXL A;  3CES A;  3ZN0 A;  2LKX A;  5KCM A;  5IT9 Z;  1YW9 A;  4GFB A;  1XC5 A;  1YQA A;  3LOC A;  4GO1 A;  3CCR I;  4L9J A;  2L01 A;  1FTT A;  2GA2 A;  3EDP A;  2WTE A;  1KQ0 A;  3H1C A;  1HW2 A;  2G7H A;  1LE8 B;  1T33 A;  3M8F A;  3BQZ A;  4XK4 A;  2R7S A;  2DK5 A;  1MMA A;  4XLE A;  1KU3 A;  2LOO A;  4KNY A;  1JHH A;  4OOI A;  3CME I;  4M3B A;  1YIT I;  3JRH A;  1IAW A;  3PQJ A;  1OCP A;  1JUM A;  1UEL B;  1LEA A;  3NRV A;  4PK4 A;  4RB0 A;  1WJ5 A;  1YYV A;  2L7K A;  1MBH A;  1R22 A;  5DD8 A;  2M87 A;  5FO5 A;  4B8X A;  1KYW A;  4RA2 A;  3NAU A;  2K9L A;  3Q0V A;  3RPQ A;  3ASO H;  3IC7 A;  4ENM A;  2CJJ A;  2IAI A;  1YI2 I;  3WTZ A;  3RIR A;  4XLP F;  1Z1D A;  1PP7 U;  3KZI C;  3MAJ A;  2X48 A;  2MC3 A;  3KP6 A;  1VI0 A;  2IBD A;  4A3K J;  2IW5 A;  2LNB A;  4XLH A;  4EVI A;  2RN7 A;  3OYL A;  3EET A;  1Z21 A;  4U0V A;  1FZP B;  5J47 A;  3TED A;  4M6X A;  2QEX I;  2QKM B;  1S6L A;  2LBF B;  2ZJP F;  3I9V 2;  1ACI A;  5DEQ A;  5BPI A;  1JI8 A;  2E1C A;  5LRR A;  3ZCO A;  3OIP A;  2PMU A;  1FYK A;  3V7S A;  4XL9 A;  1I6X A;  4A3D J;  1WPK A;  4QTR A;  2CUJ A;  3PO3 J;  1G2H A;  3HSE A;  2CQX A;  3FXJ A;  4HAM A;  4RB2 C;  3QOE A;  2UXX A;  5E1Z B;  1BL0 A;  4RS8 A;  3WTV C;  4OIO F;  3GTL J;  2EIJ H;  2W00 A;  3EUA A;  1BW6 A;  2ZJQ F;  1RZ4 A;  1A6Q A;  2QEN A;  3TDZ C;  4A93 J;  3CP8 A;  4CHU A;  2Q8K A;  1Y1V J;  1HOM A;  2MLK A;  2M8G X;  2Y0S N;  3CDL A;  4B48 A;  4IL6 C;  2V9V A;  2CWE A;  2UXN A;  2RQP A;  3O2P E;  4NB5 A;  3BT9 A;  4PDK A;  4CCM A;  5B3S H;  3L2W A;  2IRF G;  4OU0 A;  2DMT A;  1BR4 A;  1POG A;  2P5K A;  5FKN A;  4BS9 A;  2AQF A;  3DV8 A;  4CDG A;  4DYC A;  5FRM A;  3IKT A;  1JXS A;  3KYC B;  5HOO A;  1J7K A;  1WH5 A;  5J1R A;  4EV0 A;  4ESF A;  4NQW B;  4KIF A;  3W6J B;  2D1H A;  2ZJ2 A;  1OFC X;  2DYR H;  1R6R A;  4XOT A;  2BY0 A;  5J3L A;  2ZKZ A;  1K78 A;  1XGN A;  3PL8 A;  3OYJ A;  5LFA A;  3M7G A;  1T8I A;  5D5W B;  2FF4 A;  1R9T J;  5HDN A;  3N97 A;  4KIS A;  5JLX A;  1XMK A;  3H36 A;  2VLA A;  3L2U A;  2GOX B;  4BQA A;  2XUB A;  4MEY F;  1YX3 A;  4XQF A;  1T6S A;  3I54 A;  5HDK A;  1ETX A;  1AHD P;  2FU4 A;  2XGX A;  2YU3 A;  3JR9 A;  4G6Q A;  4BE2 A;  4D7M A;  4ZYH A;  1WJC A;  2QLZ A;  5BS6 A;  4I99 C;  4ZZD A;  4IO9 F;  3MKW B;  2F6C A;  2Y48 A;  2F5D A;  4WXD A;  3HKZ A;  3WU0 A;  1ZR4 A;  1VFC A;  3SEZ A;  3VDX A;  1Y0N A;  4F55 A;  2EZK A;  1W0U A;  3PUB A;  2IVM A;  2JWT A;  2XF6 A;  4CYC B;  2HU9 A;  1GUU A;  2HPM A;  2EJR A;  5C44 J;  3KEY A;  4D5F A;  1GVD A;  3E6M A;  2QSF X;  4PJN A;  2KMU A;  3BLY A;  2ECB A;  2IS6 A;  3DTE A;  1D3Y A;  2L5Q A;  4HW0 A;  1U9O A;  2VKE A;  1HA8 A;  5DCM A;  2BXZ A;  2FBI A;  4B1R A;  5L3E A;  2UWM A;  4G12 A;  3JRE A;  2DCE A;  2EFQ A;  1X4P A;  1QHG A;  2IGK A;  4PJM A;  3COA C;  3DWL E;  5K7H A;  4IRI A;  4JBA A;  5DCF A;  3LAP A;  4EEF G;  3E6D A;  1FWZ A;  3SFZ A;  3CCS I;  2AHQ A;  3S3O A;  2OV7 A;  3HJE A;  4U7D A;  1PYV A;  4NNJ A;  1H9T A;  1S7E A;  4I09 A;  5FD6 A;  4M6V A;  4FHT A;  2I10 A;  2CFO A;  1J9I A;  2Z33 A;  3CJT B;  2KRH A;  3FK7 A;  1TWF J;  3BTI A;  3FHN A;  4L18 B;  1FX7 A;  4XSX F;  2ZJR F;  5CPR B;  3BR1 A;  2DMP A;  4E7J A;  1RUO A;  2P7C B;  3KLN A;  3ML6 A;  3K4B A;  4RB3 C;  5HLH A;  3S1R J;  4BJ6 C;  2EBI A;  4BBR J;  4LIU A;  3CCL I;  3MZ8 A;  4XM3 A;  3CQZ J;  1VTN C;  3L7W A;  3I71 A;  3ZQ7 A;  1HKS A;  2OAZ A;  2R0Q C;  2JK3 A;  2NOG A;  5DS9 A;  2CSO A;  3RSN A;  2GXA A;  2E1N A;  5K5R A;  2CW0 F;  3K4L A;  4JX4 A;  3DPT A;  4MQV A;  3DBR B;  3BJ6 A;  1H89 C;  5J8C A;  1N75 A;  3HPG A;  3EQL F;  1IXR C;  4GRI A;  4RM3 A;  1HW1 A;  3IH2 A;  5K5O A;  2YU9 J;  2VXZ A;  2F4M B;  4KYW A;  1FSE A;  4JOM A;  5LGN A;  4LFU A;  4ETS A;  3W2V A;  3OYM A;  1VQO I;  4C2T A;  2DDA A;  1RIO H;  1T08 B;  1TWA J;  1GV5 A;  3D5R C;  4AVP A;  4U0W A;  4EGY A;  1VQ8 I;  3E7L A;  1RKT A;  2XRN A;  1ZGW A;  1QO0 D;  4PFO A;  3S2H J;  1USS A;  2IGN A;  1T0F C;  2DTZ A;  4X1E A;  4U87 A;  1VZ0 A;  1U9N A;  1ZQ3 P;  2M7B A;  1Y56 A;  2LY1 A;  3RJP A;  4A2U A;  5LRS A;  2BW3 B;  1EH7 A;  4RLF A;  2W7N A;  3EUH C;  2ZB9 A;  4AU7 A;  2HDW A;  3FZV A;  3CCE I;  2IGO A;  2VC0 A;  5FGM A;  1MND A;  3O8H A;  4LK1 F;  2R5Y B;  4MEX F;  5HNH A;  2STW A;  2HZD A;  1XDS A;  2YS9 A;  2HOS A;  2OA4 A;  3RPU A;  2L7M P;  3W2W A;  3OYI A;  2KIS A;  4MNU A;  4MHG A;  1J2X A;  2EA4 A;  2XAJ A;  3MKZ A;  2FNP A;  3REO A;  3HRT A;  1LUJ B;  3ABT A;  5EG0 A;  2JVH A;  1RPW A;  1W5T A;  4WX9 A;  3OYC A;  3GW2 A;  4FQG A;  4N9H A;  1W36 D;  3FK6 A;  1MZB A;  3G2B A;  3A02 A;  4L9T A;  4YEL A;  3BCB A;  5E1X A;  2LKS A;  3ULQ B;  2MAB A;  2DA1 A;  1V5G A;  3G1O A;  1RR8 C;  4IHV A;  1IRF A;  3QWL A;  5KHD A;  4R79 A;  2KDO A;  3HOX J;  1MJB A;  3F6O A;  3LA7 A;  2Z3Y A;  2LRE A;  5FFZ A;  3HTU A;  2EFO A;  3D5S C;  2TDX A;  4ZYE A;  1U2W A;  4LK0 F;  1ETQ A;  3M8J A;  1YRN B;  2IS1 A;  4G9Y A;  4HNT A;  5FKL A;  5BOX A;  4BBS J;  5E18 F;  3QPH A;  3DEU A;  3I4M J;  1B9N A;  2BHZ A;  2EH3 A;  3MKY B;  1RRJ A;  1BC7 C;  1G6N A;  1MBJ A;  1MMN A;  3OYN A;  2DPU A;  2HGC A;  3FX3 A;  5J8F A;  1LE8 A;  2ZBK A;  2X0L A;  1ETW A;  1S3J A;  5CVU A;  3LAJ A;  4A3M J;  1F1Z A;  4Q48 A;  2P6S A;  2D2W A;  5LD2 C;  3SJM A;  1MMG A;  2COM A;  2M9H A;  5HLG A;  3A0H C;  3RZD J;  1JKR C;  1Z05 A;  2Z2S B;  1WFX A;  3LSK A;  3FF5 A;  1JJ6 C;  2CH0 A;  5FRN A;  3RZO J;  1WJD A;  4NQW A;  4MLO A;  5TGT A;  1GDT A;  4OAY A;  3ASN H;  4MO7 A;  4M9S A;  4A6D A;  4EGZ A;  2LTP A;  4NC8 A;  4EJU A;  2Y2Z A;  2HVQ A;  1VQK I;  2KJB A;  3K10 A;  4ENJ A;  3B6A A;  1CQT A;  3K4N A;  3B6C A;  4D7N A;  1ZHF A;  5J1Y A;  2WA0 A;  4YIF A;  2FE3 A;  1X3W B;  2F5F A;  1JGG A;  2K5C A;  3CCM I;  3CCQ I;  2O6G E;  3IAM 2;  2NOJ B;  2LC2 A;  2O03 A;  1ZLK A;  2VQL A;  1ETK A;  2EB7 A;  2ZXW H;  2EIL H;  2L2O A;  1N77 A;  2V1N A;  2WBM A;  3HB9 A;  1S7A A;  4F91 B;  1HDD C;  3S16 J;  4KJZ A;  3LNQ A;  1SC7 A;  1T39 A;  2FXA A;  4LB6 B;  2Z5U A;  1LPQ A;  4B43 A;  2VE9 A;  3C2G A;  4IEJ A;  3OYE A;  4BE1 A;  1K61 A;  3BTJ A;  3JTG A;  2L54 A;  2IA2 A;  3PUF A;  5D8L B;  1RI7 A;  3KYD B;  4BUP A;  2RKH A;  4UB8 C;  3KCC A;  2Z1D A;  3OOU A;  1SFU A;  5KAI C;  3ZP5 A;  3CUO A;  1IXS B;  5KVR A;  1FNN A;  2CO5 A; 
#chains in the Genus database with same CATH homology
 2W48 A;  2JMW A;  5JLW A;  2LD5 A;  2HDD A;  3H0G J;  1AKH A;  3HGY A;  2TCT A;  4FE4 A;  3HOZ J;  1IRZ A;  3OSF A;  1IDY A;  4A3C J;  1MH4 A;  1IJW C;  1XS9 A;  2R93 J;  2AO9 A;  3TP3 A;  2VKV A;  3TW7 A;  1P7J A;  5F08 A;  3JRF A;  1SAN A;  4V2G A;  1JKQ C;  2ID6 A;  2Y30 A;  1JUP A;  1H8A C;  2R92 J;  5FKM A;  1JTX A;  5IYC J;  4LOC A;  2LVS A;  4MIM A;  1FTZ A;  5EEA A;  5IOZ A;  1ETO A;  1MH3 A;  5EGO A;  3QPL A;  1RES A;  4IHY A;  1OCT C;  4V2F A;  2VI6 A;  2DA2 A;  2CUF A;  1ZK8 A;  1RR7 A;  4AUX A;  1UHS A;  2NS8 A;  4DW6 A;  2KT0 A;  3HOU J;  1K83 J;  4CYC A;  3FIW A;  2ME0 A;  4S0H B;  2ECC A;  2HYJ A;  1TC3 C;  2CRG A;  2LKX A;  2LP0 A;  3BR3 A;  5FJ8 J;  3PO2 J;  1QVT A;  3HKZ N;  3Q0U A;  4GFB A;  5E3M A;  1NK2 P;  1XC5 A;  3LOC A;  2DMU A;  4DYR A;  2EZI A;  3JRG A;  4QSH A;  4A3G J;  5M5W J;  1FTT A;  2ME6 A;  1MSE C;  5IOY A;  3F0C A;  5IP9 J;  2DJN A;  1LE8 B;  1T33 A;  3BQZ A;  2HXI A;  4XK4 A;  4A3J J;  3TW6 A;  2QCO A;  5EGO B;  4M3B A;  5FKK A;  3JRH A;  2CU7 A;  3S1N J;  1OCP A;  1JUM A;  4A3I J;  3BG5 A;  1MBH A;  1EF4 A;  1MNM C;  1NTC A;  2CUE A;  2H8R A;  2IEK A;  1HF0 A;  2GLO A;  3NAU A;  2K9S A;  3Q0V A;  3GTQ J;  2CQQ A;  3O8G A;  2Y9Z A;  2JA6 J;  2CJJ A;  2IAI A;  2B63 J;  3LSP A;  2JN6 A;  2XSD C;  2X6O A;  3Q3S A;  2X48 A;  3JRI A;  2LY9 A;  2VUM J;  1VI0 A;  3WHC A;  3BG3 A;  2FX0 A;  2IBD A;  2XB5 A;  5IP7 J;  2XPV A;  3HBL A;  4A3K J;  1BA5 A;  5C3E J;  3ZQG A;  2WV1 A;  3TED A;  4XIC A;  1O4X A;  4X6A J;  3GBG A;  3CCY A;  2LK2 A;  2DA6 A;  4JX6 A;  1JT0 A;  2MGQ A;  4HNV A;  4FIS A;  4Y52 J;  4A3D J;  1WPK A;  4QTR A;  4MFD A;  3PO3 J;  1G2H A;  2CQX A;  5M3M J;  3HDD A;  3GTK J;  2WAQ N;  1ZTR A;  2MSY A;  4M3G A;  4MFE A;  1BL0 A;  3GTL J;  5M3F J;  1RET A;  1XG1 A;  1BW6 A;  3HEF A;  3SFI A;  3HOV J;  2N8G A;  2L0K A;  4A93 J;  4C3J J;  3M4O J;  2LLK A;  1Y1V J;  1HOM A;  1A6I A;  2M8G X;  2Y0S N;  3CDL A;  3GTM J;  3GTO J;  1Z77 A;  2YUS A;  4C3I J;  3JRA A;  1B8I A;  2HQ5 A;  1Q1V A;  3BT9 A;  2EZH A;  4QIW N;  2DMT A;  1POG A;  1RKW A;  2EQR A;  5FKN A;  4XRM A;  4DYC A;  1AU7 A;  4L5E A;  1MBK A;  1WH5 A;  5J1R A;  2DA4 A;  3A01 A;  1DU6 A;  1E3O C;  1OFC X;  2OF7 A;  3RKQ A;  3I4N J;  3Q0W A;  4DZJ A;  2JJ7 A;  2K40 A;  5J3L A;  1NK3 P;  1Z0X A;  4B3A A;  2JA7 J;  1I3Q J;  2NVX J;  3G1L A;  2XGD A;  5M5Y J;  3SDG A;  5EDN A;  1R9T J;  2R7Z J;  1IUF A;  1X58 A;  3K7A J;  5JLX A;  4DYQ A;  2MW8 A;  3ZQH A;  5GPA A;  1X2N A;  4UUS B;  1D5Y A;  1ETX A;  2M2E A;  2O9L A;  5EZH A;  4Y7N J;  4I6Z A;  1AHD P;  2XRL A;  2E2J J;  3JR9 A;  5E3L A;  3NAR A;  4D7M A;  5J1U A;  2OPT A;  4A3L J;  2DA3 A;  3MN2 A;  2O8K A;  1VFC A;  1LFB A;  1ZKG A;  2RAE A;  5EZG A;  1ZR4 A;  1JKP C;  2EZK A;  2R5Z B;  1W0U A;  3C2B A;  2JWT A;  4CYC B;  1GUU A;  5C44 J;  4D5F A;  1GVD A;  5GPC A;  1APL C;  5E3O A;  2ECB A;  2NVQ J;  1MBE A;  2M34 A;  3QPS A;  5HOD A;  1U9O A;  2K9Q A;  2VKE A;  1P7I A;  2D5V A;  1JTY A;  5F1J A;  4B1R A;  3BR6 A;  4G12 A;  3JRE A;  1UG2 A;  4UUS A;  3BTC A;  4J19 A;  5K7H A;  3DCF A;  1VND A;  4EEF G;  5F0H A;  1HDP A;  1A5J A;  4W1U A;  2AHQ A;  1BW5 A;  5EYR A;  2ELK A;  4I76 A;  3FKI J;  1MBF A;  5GP9 A;  1S7E A;  1IDZ A;  4M6V A;  4A3E J;  4B4C A;  2JA8 J;  1QPI A;  2I10 A;  1FIA A;  1WCM J;  3LSG A;  3PM1 A;  1F36 A;  1GV2 A;  3JRB A;  4RDU A;  1OJL A;  4XID A;  3FK7 A;  1MBG A;  1TWF J;  3BTI A;  2DMQ A;  3ZQI A;  1ITY A;  1WH7 A;  3BR1 A;  2DMP A;  1ETV A;  1QRY A;  2DA7 A;  2L7F P;  4RBO A;  3CMY A;  3S1R J;  2NVY J;  4A3B J;  2FJ1 A;  1IV6 A;  1B72 B;  2EBI A;  3ZOB A;  4BBR J;  5F04 A;  3CQZ J;  2DN0 A;  1FIP A;  3S15 J;  4IHX A;  3OIO A;  2R0Q C;  3ZQF A;  2JK3 A;  3HM5 A;  2NOG A;  5DS9 A;  1JJ8 C;  2P81 A;  3S17 J;  3VPR A;  4JX4 A;  1H89 C;  4DZP A;  3L1P A;  2NVT J;  1B72 A;  2E19 A;  2JA5 J;  5E3N A;  1HCR A;  3WHB A;  3IH2 A;  4AYB N;  1SFO J;  2YU9 J;  1FEX A;  4ABZ A;  5EF6 A;  4FTH A;  3A01 B;  3DEW A;  4M3F A;  3QQA A;  5IYB J;  5DTD A;  1TWA J;  1GV5 A;  2WB1 N;  3E7L A;  1RKT A;  1GT0 C;  1ZGW A;  5K7Z A;  1IC8 A;  3S2H J;  3S2D J;  5FLV A;  3H3V K;  3S14 J;  2GM4 A;  2COB A;  2DTZ A;  5IYD J;  4X1E A;  5F0C A;  1JKO C;  1ZQ3 P;  1U9N A;  3LSR A;  4XRS A;  2MG4 A;  2XB0 X;  2LFB A;  4BY1 J;  2ZB9 A;  3GTJ J;  3IH4 A;  4A69 C;  3O8H A;  2R5Y B;  2XPU A;  1LFU P;  2L9R A;  3BG9 A;  4W97 A;  2YS9 A;  4NDL A;  2HOS A;  3MVP A;  2L7M P;  3ZQL A;  1WI3 A;  1AKH B;  1U78 A;  4IHW A;  1ZR2 A;  5IPA A;  5IP6 A;  2ID3 A;  5EG0 A;  2HI3 A;  1RPW A;  3S1Q J;  2XGC A;  1X2M A;  3BR2 A;  2R5Z A;  3BR5 A;  3A03 A;  1MSF C;  3FK6 A;  3FIS A;  3A02 A;  5BNG A;  4JYK A;  2E2H J;  1B8I B;  1QVU A;  3W6V A;  5F0F A;  3IH3 A;  4BXX J;  3GTG J;  2DMN A;  2DA1 A;  1YRN A;  3G1O A;  4M3E A;  4IHV A;  4AC0 A;  1PUF A;  2HOT A;  2E1O A;  4UUT A;  1F43 A;  4A3F J;  2Y9Y A;  3BTL A;  3IV5 A;  3HOX J;  1UMQ A;  4C3H J;  2XPW A;  4C2M J;  1ETQ A;  1YRN B;  4D5C A;  1Y1W J;  5FKL A;  3GTP J;  5F27 A;  4BBS J;  1BJZ A;  5FKO A;  4BKX A;  2H1K A;  3BQY A;  1HLV A;  3G1M A;  5M5X J;  3I4M J;  2EH3 A;  5C4J J;  4M3D A;  3BR0 A;  1MBJ A;  2K9N A;  1IGN A;  1LE8 A;  1IG7 A;  3K2A A;  1PUF B;  2HOA A;  1ETW A;  2NS7 A;  3D1N I;  1TWH J;  4A3M J;  4FCY A;  3OSG A;  3SJM A;  4FE7 A;  2O7O A;  1ENH A;  2M9H A;  3RZD J;  1JKR C;  2EZL A;  5FLM J;  2XGE A;  1I50 J;  2FD5 A;  3RQI A;  3UKG A;  1JJ6 C;  3RZO J;  4MLO A;  2R5Y A;  1GDT A;  1TWC J;  3HOY J;  3JRC A;  4MO7 A;  2LTP A;  3S1M J;  3JRD A;  2Y2Z A;  1T56 A;  9ANT A;  3LSJ A;  2M0C A;  2E2I J;  1JUS A;  3B6A A;  2QF7 A;  1CQT A;  2GBY A;  3B6C A;  3HGG A;  4D7N A;  3MKL A;  5J1Y A;  2DA5 A;  1DU0 A;  3ZQC A;  4XRS G;  1VF9 A;  1JGG A;  4JP0 A;  2KDZ A;  1WGX A;  1I6H J;  4BY7 J;  1ETK A;  1TWG J;  2HXO A;  5EG0 B;  3HB9 A;  2X9D A;  1ORK A;  4JX5 A;  1U8B A;  1HDD C;  3S16 J;  3LNQ A;  2LR8 A;  2L7Z A;  1FJL A;  1W0T A;  4IEJ A;  1JT6 A;  2PMZ N;  1K61 A;  3BTJ A;  2Y31 A;  5K7F A;  3HOW J;  3M3Y J;  2FQ4 A;  3TP0 A;  1ETY A;  2VPR A;  3OOU A;  1H88 C;  5C4X J;  2G0E A;  2TRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...