3HOWJ

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3howJ00
1B72B 3JRHA 4A3KJ 2CJJA 2DA7A 2L7ZA 1LFUP 2ID3A 3S17J 3B6CA 4FCYA 1BJZA 2EBIA 1UMQA 3BG3A 2DMTA 1I6HJ 4BBRJ 3I4MJ 3A01B 3PM1A 1ITYA 4MFDA 3GTQJ 1IDZA 4IHVA 3GTKJ 2K9QA 3H3VK 1EF4A 4V2GA 1MBFA 3BQZA 1MBJA 1XS9A 3Q0WA 1WCMJ 1JKQC 1K83J 1WH5A 3FIWA 4FE7A 1T33A 1Y1VJ 3SFIA 4DYCA 5EDNA 2DTZA 2X48A 2R5YA 5M3FJ 1BA5A 3H0GJ 2VUMJ 1WI3A 4AYBN 2E2HJ 2G0EA 3JRBA 3BT9A 3MN2A 3OSGA 2TRTA 2DMUA 1H8AC 3HOWJ 4A3BJ 1ETKA 3O8GA 1X2NA 1HLVA 2YU9J 3RZOJ 4A93J 3Q0VA 4MFEA 2M9HA 1A5JA 5K7FA 3ZQHA 1HCRA 3BTCA 4B4CA 1JTXA 3LSGA 2LVSA 1GDTA 2GM4A 2L7FP 5F08A 2EQRA 4L5EA 3S16J 2NVQJ 2HOSA 4M3EA 2NVYJ 4B3AA 4IEJA 1B8IA 2Y30A 4DYQA 1MSEC 2JA8J 4BBSJ 4G12A 3A01A 2DA1A 3JRIA 1IRZA 2EZHA 3RQIA 1IC8A 3FK6A 3OSFA 5EZGA 3S15J 1OCPA 4DZPA 5BNGA 2M34A 1LE8A 2P81A 2M2EA 2FX0A 2XPVA 2EZIA 1TWHJ 2CUEA 4A3JJ 3HOVJ 4DZJA 2CU7A 1H88C 3B6AA 3S1MJ 2CQQA 4M3DA 3GTOJ 1B72A 2WV1A 5EGOB 2R5YB 1TC3C 5EEAA 5GPCA 1JJ6C 1ENHA 3BR3A 2HOTA 5F0HA 2AO9A 1I3QJ 5M5WJ 3S2DJ 3BTIA 3JR9A 1JKOC 2JJ7A 4A3DJ 1E3OC 4W1UA 3G1OA 2LY9A 5EZHA 1ETVA 3G1MA 1TWGJ 3HKZN 1ZTRA 4A69C 5FKLA 3GTMJ 1F36A 4B1RA 5C3EJ 2KDZA 2MG4A 3HGGA 4JX4A 1RKWA 5IYDJ 4X6AJ 1VNDA 2YUSA 3ZQFA 1JUPA 1LFBA 3BG5A 1RR7A 1GV5A 2X9DA 4EEFG 2XPWA 1JT0A 1YRNB 2K40A 2NVTJ 3GTPJ 1UG2A 2Y9ZA 2VKEA 4IHYA 3HM5A 3JRAA 1WGXA 4S0HB 4BKXA 2VI6A 3BTLA 1RETA 4RBOA 3PO2J 3S1RJ 2N8GA 3BR2A 4C3JJ 3IV5A 3D1NI 1JKPC 4GFBA 2EZKA 3SJMA 3M4OJ 1LE8B 4D5CA 4XRSA 4CYCB 3QPSA 1WH7A 2O9LA 2LLKA 1GV2A 1AKHA 3G1LA 3CQZJ 1HF0A 4M6VA 2NS7A 3JRCA 3K2AA 1GT0C 1RKTA 5J1YA 4A3FJ 2XGEA 4M3FA 2L0KA 3FISA 2DMQA 1A6IA 4BY1J 1YRNA 1MSFC 2ME6A 4MLOA 5EG0A 3O8HA 1JUMA 2ELKA 5JLWA 3IH4A 1QRYA 2XB0X 5FKNA 2QCOA 2LFBA 2HI3A 2GLOA 2QF7A 1FJLA 2DA4A 3LNQA 3GTJJ 1W0TA 2Y0SN 4DW6A 1O4XA 4IHWA 2NVXJ 3MVPA 3GTLJ 2MW8A 1NTCA 1ETYA 1H89C 1QVTA 2RAEA 2K9SA 2XB5A 3FK7A 2L9RA 4A3GJ 3BQYA 3RKQA 2D5VA 1T56A 2DA3A 5F0CA 1JKRC 2HQ5A 4UUTA 5M3MJ 3TEDA 2LK2A 5DS9A 1SFOJ 2E1OA 1IDYA 1Y1WJ 4AUXA 2JMWA 5IPAA 2HXIA 2HYJA 1ZQ3P 1BW6A 1U78A 5C4XJ 5E3OA 2HDDA 5F27A 1MBKA 2JA7J 2HOAA 2ZB9A 3TW6A 2K9NA 3DCFA 1HDDC 1DU0A 1QPIA 3MKLA 1JGGA 1HOMA 1TWCJ 2I10A 4AC0A 1MH3A 4IHXA 2JK3A 1ZK8A 3HOUJ 2O8KA 5E3NA 1GUUA 3S14J 1P7IA 2X6OA 3QQAA 1MH4A 5EYRA 4MIMA 3F0CA 1IG7A 2R0QC 2NOGA 1P7JA 4FISA 5K7ZA 1W0UA 3A02A 3HOZJ 1DU6A 2B63J 3L1PA 1MBEA 5JLXA 2DA5A 4M3BA 3JRDA 1HDPA 1APLC 5K7HA 1OCTC 5GP9A 1JUSA 3TP3A 1ETXA 2YS9A 4I76A 4QIWN 4UUSB 4W97A 2FQ4A 2R92J 1JT6A 2LKXA 1JJ8C 4J19A 3M3YJ 1AKHB 3ZOBA 2GBYA 1D5YA 5DTDA 2EH3A 2OF7A 3BR1A 5IOYA 5GPAA 5F04A 2PMZN 2DN0A 5IP7J 5E3LA 2LR8A 3TP0A 2L7MP 5E3MA 3HDDA 3GTGJ 1QVUA 2KT0A 3S2HJ 2ME0A 2XSDC 1S7EA 2MSYA 1B8IB 1I50J 1XG1A 4JX5A 2E19A 4FE4A 1OFCX 3IH3A 5J1UA 2JA5J 4QSHA 2H8RA 5FKKA 1X58A 2DA6A 1AU7A 2H1KA 4XICA 3E7LA 1PUFA 4DYRA 2Y31A 2R5ZA 2Y9YA 4C2MJ 1RESA 1SANA 2M8GX 4I6ZA 2CUFA 5EGOA 1FTTA 2HXOA 3CMYA 5FKMA 5IYBJ 2O7OA 4NDLA 4A3IJ 3FKIJ 4V2FA 2DA2A 4D7MA 1FIPA 4XIDA 1VF9A 4C3HJ 4A3LJ 3JRGA 3OOUA 2CRGA 1CQTA 1F43A 1UHSA 2Y2ZA 3HBLA 1GVDA 1TWFJ 1MBHA 3C2BA 1ZR2A 1IUFA 9ANTA 2VPRA 4CYCA 2XGDA 2JN6A 1Q1VA 1XC5A 3K7AJ 3NAUA 3HB9A 3WHBA 2AHQA 4JP0A 4RDUA 3LSRA 5IP6A 2DMPA 3LSPA 2XRLA 3GBGA 1RPWA 1ETQA 1ZR4A 4JX6A 2DMNA 2W48A 3HEFA 1JTYA 3HOXJ 1VFCA 5IP9J 1FTZA 3A03A 4C3IJ 3RZDJ 2FD5A 1K61A 5J1RA 5HODA 3IH2A 1BW5A 1ZGWA 5F0FA 1POGA 3ZQGA 2CQXA 5F1JA 2JA6J 4XRSG 1ETOA 3VPRA 2R5ZB 2E2IJ 4X1EA 1FEXA 4A3CJ 2E2JJ 4ABZA 2TCTA 1VI0A 3S1NJ 4HNVA 5C4JJ 2R7ZJ 1TWAJ 2LTPA 1ORKA 4JYKA 3CDLA 4Y52J 1X2MA 4Y7NJ 1Z0XA 2NS8A 4XK4A 3NARA 3UKGA 1MNMC 1U9NA 2R93J 5FJ8J 3HGYA 4BY7J 1BL0A 2FJ1A 2DJNA 2WB1N 4QTRA 3ZQLA 3OIOA 2LP0A 1WPKA 3SDGA 1IJWC 3S1QJ 2XPUA 3HOYJ 1ETWA 3LSJA 1IV6A 2IAIA 1PUFB 3Q3SA 4MO7A 2IEKA 1ZKGA 3BR6A 5IYCJ 3JREA 5C44J 1Z77A 2ID6A 3BR0A 1G2HA 2MGQA 2VKVA 2ECBA 5FLMJ 3QPLA 1R9TJ 3LOCA 4XRMA 1U9OA 5M5YJ 3W6VA 2ECCA 3ZQIA 4A3MJ 3I4NJ 1FIAA 2COBA 1U8BA 5FKOA 5J3LA 5EF6A 3BG9A 3WHCA 1OJLA 1NK3P 4A3EJ 4M3GA 3Q0UA 1NK2P 1IGNA 2JWTA 3DEWA 1MBGA 5IOZA 4UUSA 1AHDP 5FLVA 4D5FA 3BTJA 3TW7A 3ZQCA 2LD5A 3CCYA 4BXXJ 2XGCA 2IBDA 5M5XJ 2EZLA 3PO3J 4FTHA 3BR5A 2OPTA 4LOCA 3JRFA 2M0CA 2WAQN 5EG0B 4D7NA
chains in the Genus database with same CATH superfamily
5FFZA 3U21A 1KYZA 4KJZA 3GFJA 1Y0NA 1R00A 2PG4A 2KRHA 2O03A 4F52A 3B6CA 2W25A 1UHMA 4XN0A 5LEJA 1YS6A 1VQOI 3CC4I 2CSOA 1UMQA 4ZDLA 2L02A 2XSJC 1N25A 3JAMK 3A01B 3JTGA 3H9GA 4MFDA 1X1BA 3S8PA 2FXAA 1FSHA 1MJBA 4G9YA 2RC4A 4DGWB 3H3VK 1SD4A 4V2GA 1J2XA 4HNUA 4LGWA 3DBRB 3K4JA 3RPQA 2JVHA 2Q8KA 2D1HA 3ABLH 2V1UA 3FXQA 1R36A 3OYKA 1NG7A 1T33A 3E6MA 3WGHA 5CVIA 3LQRA 2ZFWA 3OYAA 1BA5A 2HZDA 2RVCA 1EH8A 1R58A 4L18B 2E2HJ 3JRBA 1P2FA 3BT9A 4C9YA 3A0HC 2R7UA 4I98B 4IX7A 3OSGA 2IJLA 3J7ZI 3HOWJ 1J59A 3VOEA 1VQNI 4A3BJ 4GDFA 3BLYA 2VBZA 2YU9J 2A5YB 3RKXA 1PVEA 2M9HA 4Y33A 1LPQA 3PNYA 1ZN2A 2D2WA 2P4WA 1JTXA 4A2UA 2GM4A 2F4IA 4HZFA 4CCOA 3I3LA 3TGNA 5KNLA 4IVNA 2FBHA 1AA7A 4CCLA 2NVQJ 1J0RA 4M9SA 2NVYJ 4CH7A 1IRFA 1B8IA 5KAIC 3IAS2 4DYQA 2JA8J 5IT9K 1R1UA 1HSJA 1IRZA 2DA1A 3S2WA 4R1HA 1U2WA 4AD9A 1O57A 3V8KA 3SZPA 1OCPA 2R4GA 5F64A 5BNGA 2IW5A 4WF2A 2LMDA 1SD6A 3TOBA 4CCKA 2FE3A 2FX0A 2EZIA 1TWHJ 1TBXA 3HOVJ 4GXOA 2LF8A 2A61A 4WWCA 5DYMA 1I3AA 3CC7I 1B6AA 2V4JC 3HHHA 4IZZA 1U3EM 4CZCA 1QQIA 4I0AA 3ROUA 4F92B 3V7CA 5F1RA 4YRVA 1OISA 3H5RA 1W36D 3BG7A 1O3RA 1IRXA 3BR3A 3QU3A 4QLCU 2MA3A 3FM3A 3H9QA 3BTIA 3JR9A 2JJ7A 3RCOA 4FASD 3F3XA 3H1CA 3I54A 4W1UA 3NWTA 4XRFA 2CW7A 1ON2A 2EIMH 2LY9A 3G1OA 4KA4A 2E5ZA 1TWGJ 2VPLA 5AONA 2FOKA 5AIQA 3UNGC 1FLIA 5C3EJ 3HJEA 3DLLF 1RKWA 3CCSI 5IYDJ 1KQ0A 3Q9SA 2YUSA 1Y56A 3OYDA 1KYWA 1LFBA 2V6EA 4U87A 3E1SA 4BEHA 3GCMA 1GV5A 2XPWA 3R6SA 1OCRH 3J7AO 4ZZDA 5GTHC 3GTPJ 1UG2A 4IHYA 4F3QA 3OYEA 2QBYA 1WGXA 2IS4A 1GVJA 1D5VA 3BY6A 1FOWA 3QP5A 4RBOA 3CCEI 1X3UA 4LFUA 1WJDA 4GFBA 3BR2A 3PO2J 3PFIA 4RMNA 3TKYA 2VONA 2WY8Q 2WA0A 4LD5A 1WI9A 3NQOA 4D5CA 1FC3A 1HKQA 4HSTA 4M71A 1ZLKA 3QPSA 1WH7A 2ELHA 2LLKA 3OYIA 3RYRA 3G1LA 3CQZJ 1SVLA 4KITB 2NS7A 3F8FA 4GO1A 2L9NA 1W4MA 4B09A 5DCMB 1GT0C 2OCEA 1ZRDA 3WU1B 2ZNYA 4EMSA 1O3TA 2PBIA 3L2RA 2QVOA 3EETA 2ELKA 3GO5A 2VL8A 2XB0X 3IH4A 4EJUA 4YFXF 3K6GA 1L0OC 2HI3A 2GLOA 3IAM2 1FJLA 2HFHA 5DD8A 4BHBA 4RM3A 2W1OA 4IHWA 2Y0SN 3IHUA 4KIBA 4N4OB 4HX7A 1LVAA 3GTLJ 2M7BA 4G6TB 4RAZA 4G7OF 2M1BA 2RAEA 1S29A 4BUPA 4A3GJ 2EFPA 1JKRC 3HYIA 1MJ9A 2COMA 4IO9F 3TEDA 1IAWA 3CC2I 4I0BA 5K5RA 1DPRA 1I39A 3QPHA 4Y3OA 3LFKA 2HYJA 2GIVA 1YW7A 5KVRA 4M9XA 3CDHA 1TQIA 3O2PE 4I01A 3ZMUA 5ED4A 2HOAA 3QAHA 4FHTA 2E1MC 2L9VA 2HS5A 5GAGJ 3H9JA 3S93A 2EJRA 1HW1A 5ILSA 3ECHA 1KZHA 5TJJA 3M8EA 4N9IA 3QPTA 3V4GA 1Z91A 3OYJA 1XDSA 1ZK8A 4ZH4F 3HOUJ 2XVCA 2KIFA 2O8KA 3OS2A 3NWSA 4E7IA 3LSKA 3DLAA 2M7AA 1IG7A 2VBYA 3GF2A 1ZG1A 4J00A 2HTSA 1XB4A 5K7ZA 1W0UA 3A02A 1PP8F 2BW3B 3E6BA 1YX5A 2DOEA 3KEOA 1MBEA 3W2WA 2OTLI 4IQ4A 5H20A 3JRDA 4QPOA 3JSPA 1HDPA 4KDPA 1BI1A 2EPFA 1FOXA 5GP9A 1JGSA 1JUSA 2DXIA 2YS9A 1O3SA 4QIWN 4XONA 2R92J 1D0YA 3GVAA 2E1MB 1JT6A 2LKXA 2L5QA 3M3YJ 4AIDA 1D5YA 2FBKA 1XX5A 2EH3A 5GPAA 5GTIC 5E8GA 1BN5A 2DN0A 4EM1A 5IP7J 5D5VB 3OYMA 1K6YA 2L7MP 2OUMA 5DUKA 1MMNA 3OYLA 3AL0C 1S3JA 4LLGF 3RPUD 3DKXA 1XG1A 1S5LC 4IOAF 1P9QC 3MWMA 2C6YA 4PGHA 2WAQA 4FETA 4H4KC 3WTZA 1USSA 2P6SA 3F23A 1SMTA 2ZBKA 5FKKA 2H8RA 2DA6A 4EQQA 3AG4H 4U0WA 3WTSC 2CH0A 3ASOH 1OCOH 4XICA 1F1ZA 2UXNA 3BDDA 1G3YA 2Y31A 4M74A 2R5ZA 2A3SA 2IGOA 3OMYA 4AIHA 3TOAA 1DQUA 2EFNA 1RESA 2Y0SA 4ESBA 4AIKA 1SVMA 5B66C 4MEXF 3KIOA 4ON0A 4EATA 3VYRB 1ULYA 1DUXC 3KP6A 3SHFA 5HLIA 3ESWB 1LUJB 3K4CA 5FD5A 5FKMA 2F4OB 2DODA 3C2GA 4E7SA 3WG9A 3J80Z 3EUHA 3LSHA 3RPUA 1DGWY 1FSEA 4D7MA 1G3SA 2PLYA 1E17A 3EQLF 3VSKA 3CCMI 2R7TA 3G3ZA 3MMYB 1UHSA 2HWVA 1GVDA 4A6EA 3O3KA 2D1VA 3GFIA 2JN6A 1XC5A 1BIBA 4AU7A 5DCMA 4JP0A 1S72I 4RDUA 3VYUB 1X1CA 3LSPA 3EYYA 2DMPA 3GFLA 4BQNA 3K4LA 1RPWA 2JRTA 1ETQA 1XMXA 2DMNA 1FOYA 1R6RA 1S8NA 1YO5C 1USTA 1Z21A 3K69A 2CQNA 3A03A 2Y69H 2FU4A 2FD5A 1D0ZA 2RKHA 5J1RA 1P92A 3CCLI 1GLNA 2F5EA 3ZQGA 1R22A 1LDJA 5ICGA 1FX7A 3L2CA 2E2IJ 2LSOA 4X1EA 2EV5A 1RC9A 4A5MA 1YOVB 4IJAA 2GOMA 1JI8A 2LTPA 1WJFA 4B44A 2M5WA 1BR1A 1V54H 4E7HA 4HX8A 3FXLA 4L9TA 2ZJ2A 1VZ0A 3GLXA 1Y8RB 4RS8A 5FJ8J 2EK5A 3HGYA 3F8BA 4N4NB 2E1NA 4QTRA 3U1DA 2LP0A 3OV8A 1WPKA 4RB0A 4KUMA 2PJPA 1NHAA 1LKXA 1KU9A 1TW3A 2O5RA 3QYEA 5HLTA 3HOYJ 2M8EA 3LSJA 1IV6A 1FYLA 3CUQC 4KNYA 4G7ZF 1D0XA 3ISPA 3P9KA 3CLQA 4HDUA 3V42A 3ZQ7A 4D0PA 1G2HA 2XAFA 3AG1H 3QPLA 1U9OA 3LSIA 5M5YJ 4KMFA 2ECCA 2CS3A 3ZQIA 3ZN0A 3FBNB 2COBA 5HLGA 2HVQA 2HDWA 3QRFF 1MNDA 1FWZA 3V7SA 1U8BA 5L3FA 5A2QK 1D1BA 5LHIA 4CO8A 1R49A 2HU9A 4FQGA 3D5RC 4II3A 4M3GA 3Q0UA 4E7ZA 5J8FA 1JE8A 1E3HA 2V1XA 4C2UA 3DTKA 4RGUA 3CCRI 1H9TA 4IHTA 4D5FA 2Z33A 1G3WA 2G7HA 3HTUA 4PCQA 3CCYA 4QWQA 2IBDA 5M5XJ 4BGDA 2OPTA 1Z6RA 3DEUA 4LOCA 2IA0A 3JRFA 2M0CA 3ASNH 2ISYA 1K79A 2ADUA 3ML6A 2XGXA 3T1BA 2OAZA 3FKJA 3HSRA 4U0VA 4RB2C 1V3FA 2O6GE 2EA2A 4B43A 2ID3A 2IS1A 4FX4A 4Z6YA 4FCYA 2HQNA 1BJZA 1KONA 2DMTA 4BBRJ 2NXNB 5D6EA 4BJ6C 1YHQI 1SAUA 1UELB 1R5GA 4HRIA 2ZKZA 3QP6A 4IHVA 2K9QA 5JFRA 2MLGA 3WE3A 3L2WA 2CUJA 1EF4A 1MBFA 3BQZA 2X4HA 3HSEA 2EINH 5LBQA 1VQPI 3CMAI 3FDYA 1K83J 3LA3A 2OBPA 3FIWA 1BC8C 2CW8A 2DTZA 5JHUA 4A5NA 2R5YA 1IO2A 2ZNZA 3H0GJ 5GADJ 5FRMA 5D5UB 2XRNA 3AG2H 1WI3A 2G0EA 2NAZA 3CF2A 6PAXA 4HNTA 2DTRA 3F8MA 3GYHX 3DPTA 2CV1A 2X1EA 4HAMA 3IL2A 1YW9A 1TZLA 3OIQA 1BR4A 1X2NA 5FLXZ 1HLVA 1R5HA 3H3UA 3P9CA 3DPUA 2CW0F 3HSFA 4MFEA 3FXKA 2K3PA 3GEZA 4AM3A 1A5JA 3ZQHA 3LFUA 3BJOA 2X6XA 2A68F 2LY2A 2L7FP 5F08A 2ESNA 2XASA 1YJ9I 2STWA 1SFEA 4OOIA 4LG3A 4L5EA 3S16J 3BOQA 4FX0A 3DXJF 1IN5A 2V79A 3FXOA 2XIGA 4B3AA 4IEJA 2QWWA 4BNCA 1QZZA 4Y15A 4QPQA 2P6TA 2DO7A 2VE8A 3N97A 4Y17A 4XNFA 3RQIA 1IC8A 1ZREA 1U5TA 4HG2A 3S15J 1HA8A 1BI3A 3L00A 4X0GA 2OTJI 3K70D 1LE8A 2P81A 3DP7A 5IT9Z 3TO6A 2CUEA 5JI6A 1SFKA 4KIFA 3CESA 4DZJA 3X2QH 1K78A 4XOTA 2CQQA 1HQCA 2LNBA 1Y39A 1Z6TA 1EA3A 3GTOJ 3BZ6A 2IGNA 5CQGA 4A12A 4HLYA 5GPCA 3M8JA 3KZIC 1ENHA 1I6XA 2HOTA 5D8LB 2AXTC 4F93B 3R0JA 3HHGA 1I3QJ 3BJAA 2PEXA 3F6VA 1BOAA 2L7KA 4MHGA 3K4MA 4MQVA 5FRNA 3CP8A 3FHNA 3HC7A 3GXOA 3L2UA 3CMMA 3TO9A 1XSXA 1ETVA 2Z2SB 3M8FA 2QKLB 1A31A 2BHYA 3D5LA 3SYTA 1IXSB 5FKLA 3V8LA 4B1RA 4IRHA 2KDZA 3M07A 4JX4A 4OWRB 1LJ9A 1QO0D 4YFNF 1ACIA 1VNDA 2CUZA 1MW7A 3I71A 5CVVA 4ENMA 2O0YA 2AQEA 4A0ZA 1JUPA 2BEOA 1Z67A 3BG5A 3K10A 1U5TC 3ABMH 1VTNC 2X9DA 1F4KA 4EEFG 2WC2A 4MQ9F 4BH9A 3IC7A 5ILUA 1D3YA 4HSRA 2JVGA 5BPIA 2FUG2 2K40A 4PK4A 2NVTJ 3V7RA 2BYVE 2Y9ZA 4LMYA 1W1WE 3JRAA 4WXCA 2R3SA 1RETA 3S1RJ 4C3JJ 3D1NI 1BIAA 3SEZA 1LNWA 5J6XA 4C2TA 2O8XA 2LBFA 3MZHA 2OZUA 1LDKB 5CJ9A 2LBFB 1HF0A 4ANJA 1T0FA 1HSTA 3ZQQA 3OIPA 3IRQA 4K2EA 2K5CA 2RQPA 4PGGA 3KETA 1IW7F 4A3FJ 2XGEA 1YITI 4E6KG 4XKWA 5F6FA 3T8RA 3FISA 2A05A 2DMQA 1R71A 4BY1J 3LSMA 3TL4X 2PN6A 3JCUC 4MLOA 1Y8QB 1JUMA 4GRIA 2NNNA 1YQAA 1IN7A 4YIIA 5IT3A 5LFAA 4LLLA 3AG3H 1TW2A 1G3TA 2DLLA 3CZ6A 3E5UA 3HUGA 3TMOA 2IPQX 1ZRCA 4OIQF 1X1AA 2M45A 4MGRA 2MW8A 2VT2A 4XLEA 4ZDOA 3HG9A 1NTCA 4LK0F 1QZYA 1BJAA 1ETYA 2Z16A 2DQLA 2K9SA 2XB5A 4XSZF 2XV4S 3BQYA 3PIPF 3RKQA 2D5VA 2HQ5A 1CGPA 1PUEE 4ASNA 2VJ5A 2DT5A 4LIVA 2YX7A 1SFOJ 2K7LA 1IDYA 4LJZF 1Y1WJ 2VASA 4E70A 2GOXB 1I1GA 4OINF 2JZYA 1RIOH 2BY3A 1IF1A 1U78A 3S3OA 1TNSA 5F27A 2JA7J 5HNFA 3KFWX 4IF4A 2M0MA 1P4AA 1DU0A 5DUIA 1JGGA 4XN3A 4AC0A 1W7PA 2JK3A 2IRFG 5KCMA 2HTJA 1GUUA 5BMZA 3QQAA 2X6OA 2LC2A 3BWGA 2HPMA 2G9WA 5LGUA 4OIOF 3BCAA 4NUBA 3L9FA 2R0QC 3I56I 1P7JA 3T8TA 4FISA 4L9NA 2DT6A 1J7KA 1DU6A 3SDBA 2RREA 1A6QA 1RRJA 3K0LA 4AYBA 1VQLI 1X3WB 2LY1A 4ZYDA 5K1YA 4A6DA 2QBYB 5BPDA 2DA5A 1ON1A 1APLC 1LB2A 3F8NA 3C1DA 1V5FA 5D5WB 5E1WA 2A69F 2LH9A 4W97A 4UUSB 4BXUA 1AKHB 5CQEA 1ZG3A 4Y13A 2OF7A 3BR1A 4Q47A 5IOYA 3IKVA 5GAHJ 2K02A 5F04A 4EVIA 5E3LA 3K4KA 5B3SH 2LR8A 1RR8C 4O6JA 2MD5A 3I9V2 4B3XA 1JXSA 2XSDC 1I50J 2E19A 1KQ8A 4L0YB 1OFCX 2JPCA 2L01A 2TDXA 2JA5J 2Y75A 3L2QA 3DQVC 4IPAA 4QSHA 3U1KA 3DKWA 3KP4A 3FM5A 4DQ2A 2A07F 1J9IA 5D6FA 2BY0A 2R7QA 2CV0A 4KN7X 4YELA 2DQRA 4LITA 3PQKA 1M1EB 4IKFA 3HOSA 2BOLA 2L54A 1RI7A 2KL4A 5EGOA 2W00A 2P5LC 2BVMA 2HXOA 1J09A 3LA7A 3KP5A 3M1EA 1UAAA 1R4NB 1QU3A 4RLQA 1H0MA 4BJTA 4BDZA 1OLTA 4NDLA 3RTRA 3FKIJ 3K70C 1FMVA 2DA2A 1WJEA 4HQMA 3LAPA 1W36C 2XAHA 3EPZA 2DYRH 3CD6I 3F8CA 2KISA 3QYBA 1ERDA 2IP2A 1BOBA 1CQTA 3E6CC 1F43A 2NYXA 2VIXA 2ZC2A 1TWFJ 2KKOA 1D1AA 1UJ8A 1ZR2A 5HDGA 2VPRA 4BU2A 3S3NA 4CYCA 3PL8A 5EG0B 2UXXA 1Z7LA 3WHBA 3CJQB 4JOMA 1A04A 1S7OA 2RQQA 4EM2A 3LSRA 2ICWG 5JR3A 1WJAA 5IY5H 3VYTB 4UVBA 1IV8A 4G7HF 2PI0A 2W48A 3T0YA 2F6CA 1FP2A 3AKZA 1VFCA 3C3WA 5IP9J 2A6EF 5HODA 1OYIA 1BW5A 3VYSB 3DEEA 3OYCA 4UVAA 1QBJA 3CP2A 3ZMDA 2QQ8A 2CQXA 1B9MA 3PSFA 3F6OA 4CDGA 2R5ZB 2WBMA 1FEXA 4ABZA 1VI0A 3S1NJ 1NG6A 2R7VA 3LA2A 3R4KA 4AWXB 5L3CA 2UUZA 4S05A 1FMWA 4JYKA 1P4WA 1T8IA 1X2MA 4RB1A 2NVUB 4Y7NJ 1YX3A 1Z0XA 1OR7C 3ABUA 1MNMC 2R93J 2RNJA 1J5YA 4PFPA 4ENJA 1BL0A 4HBLA 1HBXG 4XKCA 2MLKA 2WB1N 2LOOA 4BHPA 3ZQLA 2QSGX 3DPLC 3HUGB 3J80K 2XROA 2KZGA 2E36A 1IJWC 2F5FA 4YG2F 2R7FA 2QEXI 2IAIA 4DBRA 5D4RA 2CG4A 1G8XA 1PUFB 4L9JA 3Q3SA 1Z3YA 2PFBA 2OZ6A 1ZKGA 3BR6A 2VXDA 3K2ZA 3H36A 3JREA 4CGZA 5C44J 2X6YA 3KPHA 2WV0A 1WSUA 2ECBA 1OYWA 2KJBA 1YG2A 3AAFA 1B1BA 3LOCA 5ILVA 1R9TJ 2RDPA 1E2XA 2QQAA 4XLCA 2A5WA 2WAFA 1ONVA 1KA8A 5FKOA 5J3LA 4R79A 1REPC 3BG9A 1OJLA 2MYSA 2IA2A 1NK3P 1R23A 2ESHA 2JA2A 4A3EJ 1EJ9A 5EJCA 3WGIA 4H0EA 1IGNA 1QHGA 3FXMA 1T2KA 3W6KB 3KZZA 5AIPA 1MBGA 4UUSA 5FLVA 3E0JB 4HW0A 4I2OA 5CLSA 5EEGA 1C0WA 2KRCA 1BM9A 5DV5A 4ENNA 4XR6A 3ZQCA 3MQ0A 4NC7A 5FO5A 2YR2A 4BXXJ 2XGCA 3CCQI 1SD5A 5K5OA 5JHFA 1MMDA 4HV6A 1FY7A 4CA0A 2WAQN 3TO7A 4F7ZA 1YI2I 5B5EC 2L7ZA 4OMZA 3CMEI 1LFUP 1HKTA 4Q4ZF 4Q5SF 2VBWA 2VQLA 5LEKA 3S17J 3KZYA 3J7AY 3BROA 3DWLE 2EBIA 2IVMA 3BG3A 5L3DA 1MNEA 1ITYA 3GTQJ 2ZXWH 3P7NA 3W3CA 3PUFA 3ZGKA 2XUBA 2F5CA 3A4CA 4G6QA 2HNHA 4PJNA 2PJRB 3K9TA 5TGTA 3S3MA 3VB2A 5E8IA 3ZPLA 3R0AA 1XD7A 4XOPA 4EGZA 1O7FA 3Q0WA 1WCMJ 4P5OA 3FWEA 4CZZA 1XTAA 4YIFA 4C30A 4NHJA 2VOOA 4BAYA 1WH5A 2XKOA 1BI2A 4FE7A 1QZEA 1UB9A 3R60A 3SFIA 5EDNA 3BZCA 4BE1A 1LQ1A 3RKYA 4MEYF 3WTYC 5M3FJ 2VUMJ 3TDUC 2A6TA 4IOCF 3PQJA 4IHSA 5A2QZ 2MH9A 3SXYA 3KYDB 3L09A 3CDIA 2BXZA 1TQPA 2EILH 1ETKA 3AL0B 3O8GA 2BXYA 1LDDA 4A93J 3CLOA 2WADA 2KPMA 4KICA 3CUOA 5ICEA 5K7FA 4XMYA 5E1ZB 3BTCA 1OQYA 4LG0B 5H6RA 3HIFA 2CYYA 2LVSA 3WTVC 1HXDA 2VOPA 4I7HA 1G4DA 1XGNA 2L3DA 4WX9A 4UB6C 1R1VA 3RIRA 3RI4A 2EQRA 5LRRA 1TT5B 3HTSB 3GX4X 3SFZA 3HOTA 1U8RA 2XAGA 2Y30A 2HYGD 4ZC3A 3OR2C 1RZ4A 3LWFA 4BBSJ 4O3MA 3JRIA 2EZHA 2M3AA 1ZYRF 3GZNB 3NRVA 3FK6A 5EZGA 2GXBA 3FMSA 2DAOA 3D0SA 1K6OA 2M34A 3OYHA 3FZVA 4XQFA 5FGMA 2KRFA 2M2EA 2XPVA 1ZGJA 2P7VB 3KEYA 1H88C 3B6AA 2DT7B 2BY1A 2H27A 4NQWB 3OYNA 1B9NA 2FNPA 1B72A 2WV1A 2R5YB 1TC3C 2ZJRF 2DI3A 1VQKI 3FMQA 4PSXA 5EEAA 2V1NA 3E3VA 3GMEA 4XLHA 2JRMA 4F55A 2J5OA 5F0HA 2AO9A 4I09A 2EV0A 4ETSA 4PJLA 5ERIA 2RNGA 1SAXA 4RAGA 4WCGA 1F9NA 3QU6A 4RGXA 3V8JA 4DNCA 4E7KA 4HF1A 4NC6A 2I8DA 2JT1A 3OYFA 2DOAA 1S6LA 4RLFA 1T39A 1KU2A 1XMAA 2EB7A 3G71I 4A69C 5FLXK 1F36A 2MG4A 3HGGA 4PJMA 4IL6C 1Z3XA 4X6AJ 2M4KA 1BR2A 3KE2A 2DYSH 1P4XA 2KJCA 3ZQFA 2VKDA 4ENKA 4ITVA 2R7SA 2XAUA 4JK1X 1RR7A 2R7DA 2QSFX 1W5SA 2DPUA 2YX4A 5HDKA 2JQ7A 3K4NA 4ESJA 3SZGA 3KYCB 3D5SC 4Q48A 2K9MA 3HM5A 4GYIA 4BXFA 4S0HB 2F5DA 2H8WA 4BKXA 2VI6A 3ZMTA 2EZKA 1WQ2A 1LE8B 3ULQB 3KCCA 4XRSA 1W7PD 4B8XA 4I02A 3IRRA 1MJAA 2O9LA 3IUOA 4B47A 1AKHA 5E79C 2LG4A 3IP4B 2ZMEB 3JRCA 3RJPA 5LGNA 1W5TA 1XN7A 5J1YA 2W85A 3LMMA 3M1CA 3Q5FA 2L0KA 1I1SA 5D5XB 1MSFC 2JSCA 4ZYHA 2WB1A 5EG0A 3M7GA 3O8HA 3FXUA 4P9FA 1YFHA 4MTEA 1PDNC 5FKNA 4EGYA 3BCBA 2LFBA 2OC6A 2QF7A 2K4BA 2DA4A 2FQ3A 3LNQA 3GTJJ 1O4XA 4EJTA 2W57A 4DIQA 2NVXJ 2L9SA 3MVPA 3E5QA 2CMPA 3ERED 3H35A 3WG7H 4OAYA 4XORA 3Q9VA 2L9RA 2DA3A 5F0CA 5M3MJ 4BHCA 2LK2A 2VQCA 1FPQA 4BQAA 1ODDA 1N78A 3S32A 5DS9A 3GLLA 3BC8A 1UCRA 2MC4A 2ZXJA 3P9IA 5DD4A 5ICCA 2OD5A 2JMWA 5IPAA 4CCMA 1DP3A 3QOPA 2HXIA 4ZYAA 5HOOA 1BW6A 2P0WA 3I59B 5E3OA 2HDDA 5CPRB 2CWEA 2B9SA 3KX2A 2X51A 4HOBA 4UV8A 4BE2A 1OCZH 4ZJZA 4L5JA 1HOMA 1D1CA 1TWCJ 2QQ9A 5D4SA 4UNOA 1MH3A 2X85A 4IHXA 1T6SA 1T08B 1Y6IA 4KYWA 3PJRA 2X6WA 5E18F 3I4PA 2KQRA 2UZKA 3EUHC 3S14J 2ZMEC 1TP4A 1MH4A 5EYRA 3ZMZA 4F91B 3F0CA 1OR7A 3ZP5A 4UB8C 3IWZA 2XAJA 1FP1D 2NOGA 2J5PA 3GZ6A 1A35A 1EH6A 5J40A 3HOZJ 2MD0A 3CTAA 2EIJH 4GGGA 1R7JA 5DEQA 5JLXA 3FBIB 1E0EA 1FBQA 3DTIA 2VN2A 3ZXSA 1DP7P 3GFMA 2ZSIB 3JTHA 4EM0B 2W7NA 3TP3A 3MKZA 3W2VA 4I76A 4BYYA 5E20A 4BS9A 1JJ8C 2QGUA 2HDCA 1EKEA 3DU6A 4AIJA 2LREA 2GBYA 3JSOA 3K4BA 4EJWA 1UG0A 1U0JA 3EUKL 1FYMA 2HGCA 2HQRA 5HS9A 1K4SA 3TP0A 5E3MA 3JW4A 2FF4A 1QVUA 1YYVA 2DBBA 1SMYF 2E35A 2FEZA 2KT0A 1O3QA 2ME0A 4DOZA 1B8IB 4JQFA 4MTDA 2K27A 3COAC 2E7WA 4FE4A 4D1QA 5J1UA 4I99C 1HW5A 4BDYA 4WK8F 4E7JA 4OAZA 2YSRA 2OV7A 2I5UA 2H1KA 2KP6A 2GIZA 2WAEA 3A0BC 2K3FA 4CXFA 2R7XA 3E7LA 1PUFA 3B73A 1BI0A 4DYRA 2IXSA 1WKMA 2Y9YA 1X1DA 4C2MJ 1SANA 4FT8A 1EH7A 2Q2EA 3U9GA 4A0XA 1TT0A 1MKMA 1ZGAA 1OYYA 4ZTFA 1ZARA 4RAYA 4ESFA 4U88A 3CMYA 1FZPB 2IS2A 1IN6A 2OU2A 2W84A 1W5CC 5IYBJ 3WTXC 1Z7UA 1S7AA 1KGSA 5ICFA 4V2FA 2KHMA 4XKVA 4HPQA 1XPXA 1FIPA 1TLHB 1MIJA 1JHHA 1VF9A 2V1DA 3I64A 4C3HJ 4EJOA 3JRGA 3VDXA 4HQEA 4P9UA 2YU3A 2EFQA 5TISC 3ONQA 4RA2A 2M4GA 3KLNA 1IUFA 3BG6A 9ANTA 1IXRC 1BBYA 5DM6F 2XGDA 1YTYA 1Q1VA 1HC8A 3NAUA 3HB9A 1LVKA 1O7LA 1ZH5A 2M30A 2H09A 2VB6A 4N0BA 3FF5A 3CF5F 5IP6A 1WJBA 1ZELA 2E71A 3GWZA 1IN8A 2XRLA 1VQ5I 1ZR4A 2LKPA 4JX6A 3ABKH 2GAUA 1PJRA 2OCCH 4HX4A 1I5ZA 3QODA 3WGGA 4C3IJ 3RZDJ 4L9VA 3H92A 1CF7A 3IH2A 4XKBA 2FOWA 1ZGWA 3I0TA 5F0FA 1OCCH 2Z3YA 3REOA 2GXGA 5F1JA 5TRDA 2JA6J 1U5TB 2E5NA 1X1PA 4AVZA 1ETOA 3VPRA 2QSHX 4A3CJ 4G94A 4HF0A 3CCJI 2TCTA 4HNVA 1TWAJ 1KU3A 2AXLA 1ORKA 3H0DA 4OIRF 1S9HA 5LLQA 1YW8A 4LK1F 3CDLA 1TTYA 2FNAA 3ZR8X 4XM3A 3H5NA 2FA5A 4M6YA 3CCUI 2NS8A 4E4HA 1GHCA 3BP8A 1U9NA 1MZBA 2H94A 2Y48A 5K5QA 3WODF 2DJNA 4OU0A 3C2HA 3OIOA 2DW4A 3R61A 1ZHFA 4EJVA 1V5GA 4PJJA 1ETWA 3OL3A 4CICA 2WY7Q 2RV8A 1VQ4I 3VWBA 3C7JA 2HPIA 2IEKA 3OWTA 5IYCJ 1LFPA 2ZXHA 1Z77A 3RKWA 2ID6A 3DBHB 2EIKH 3FXJA 3LSTA 2MGQA 2PX9A 2VKVA 2CQ7A 3EDPA 2P7CB 2R7OA 2DDAA 2B0LA 1GXQA 3HRTA 2BGCA 4A3MJ 3I4NJ 2KIMA 5B1AH 5LD2C 2BHZA 5EF6A 3WHCA 2H6BA 3OYBA 2VXZA 5BOXA 2BW3A 4S04A 4R8HA 1K4TA 3LAJA 1F5TA 3P5JA 3VSLA 1MDMB 2E60A 1A36A 3DEWA 3DFGA 3ELKA 3PNVA 4L0ZB 1IUYA 4P1WA 1R1TA 3OOPA 3BTJA 3T5XA 2VJ4A 4HA8A 2LD5A 1L3LA 5HDNA 4KT5C 4LG0A 3PO3J 3OS1A 4FTHA 4CYDA 1UFMA 5J8CA 1FNNA 4CCNA 4PJ0C 5HS8A 2HVSA 2BY2A 1RNLA 1AWCA 4IRGA 1B72B 3JRHA 4A3KJ 2CJJA 3RYPA 2DA7A 1N75A 3MD2A 1T0FC 4YFKF 3TBIA 2CGPA 2FBIA 4KMUX 2W82A 2EV6A 4G6DA 5CKTA 2H1LA 3DF8A 1I6HJ 5J4YA 3I4MJ 3WE2A 3PM1A 2KDOA 3G2BA 3HXLA 1FT9A 1IDZA 4CCJA 2VT3A 2L4MA 2P5KA 3GTKJ 1OPCA 4IRIA 2XDVA 1MBJA 1W7PB 1XS9A 3K1MA 2OJED 1JKQC 2H6CA 4DYCA 1Y1VJ 5FROA 2X48A 1QNTA 4PFOA 4M72A 4Z2YA 4IXAA 2BVLA 1VQ9I 1KU7A 3VFZA 3RSNA 4N9HA 4AYBN 2RGVA 1BC7C 2OQRA 3MN2A 2TRTA 2DMUA 1H8AC 3OY9A 1LEAA 3B02A 3MKWB 2PMZA 2ZSHB 1LEBA 4OIPF 3RZOJ 4LLNA 4UVCA 2QUFA 1R5ID 3Q0VA 4BACA 1IXCA 1SVOA 2DPDA 2IS6A 3CUQB 3CUQA 1SEUA 1HCRA 2G7UA 4B4CA 2RN7A 3HPHA 3LSGA 1H9GA 3W6JB 1YJWI 5LGTA 2NS0A 4ZYGA 1GDTA 2MABA 2JPBA 2R7WA 3I58A 3GZ5A 1MGTA 4UV9A 3EUAA 4BEHB 3DTEA 5HLHA 4M3EA 3WU2C 2HOSA 3PNTA 2XHKA 3IWFA 1CF7B 3WU0A 2PMHA 1MSEC 3F21A 4G12A 1XGMA 3A01A 1FYKA 3C18A 1J75A 1IRGA 3CO7C 4CHUA 1WFXA 4UXNA 3OSFA 1XSVA 1XCVA 2DCEA 4G8XA 4DZPA 2DDBA 2ACJA 1DDNA 2JSPA 3OR1C 4A3JJ 2K4JA 2CU7A 3PSIA 1WJ5A 3S1MJ 4V19K 2F4MB 4CSWA 1YIOA 4M3DA 1NH3A 4WXHA 1I27A 2XF7A 5EGOB 2D45A 1QHHD 2B7EA 2XAQA 1JJ6C 2HOEA 4ZYEA 4ZTJA 4KIGA 3HPGA 1TQMA 3SZTA 1VQ8I 2IGMA 3E5XA 5M5WJ 3I59A 1R4MB 3S2DJ 3OS0A 4MNUA 4M6XA 2QA4I 1JKOC 4A3DJ 1YLFA 1E3OC 1U6GA 3OL4A 4HV5A 2HYFA 3U2RA 4XLAA 4P96A 5EZHA 2VQHA 2CV2A 3G1MA 5B1BH 3HKZN 1ZTRA 2CQKA 3GTMJ 4TV7A 1QPMA 3PUBA 3L2VA 5HS7A 1Y0UA 4EV0A 1GXPA 1MMSA 2L2OA 3A1YA 1K78B 2YPRA 2DK8A 1G6NA 2HEOA 3CJNA 1MMAA 1V55H 3ZRGA 4RM2A 2HZTA 3K1PA 3PFYA 1JT0A 5HVQC 2EFWA 4RB3C 3G4SI 4U7BA 3ZMVA 2QLZA 1YRNB 1QGPA 2EWNA 2R7RA 3HZJA 2VKEA 1TNTA 1ZLJA 1E3PA 1X3ZB 3BTLA 3DBLB 1JKPC 2N8GA 3IV5A 3SJMA 4XLNF 1N77A 3M4OJ 3F9KA 2M87A 5H2FC 4KN4X 2NOJB 2GZWA 4CYCB 3IKTA 4A0YA 2JUCA 2UV1A 2MH2A 1GV2A 2L4AA 5LRSA 3H3ZA 5KHDA 2CFXA 2KIUA 2GA1A 4M6VA 2LF7A 3K2AA 4WXDA 2EFOA 2FRHA 5KAFC 1Z05A 1RKTA 4M3FA 1VQ6I 1A6IA 4GYGA 3DV8A 1WVRA 1X4PA 1G59A 1HW2A 5EEHA 2IGKA 2STTA 5HNHA 1YRNA 2ME6A 4YIRX 1MDMA 4KFCA 2K85A 1T95A 2KLOA 4PDKA 5JLWA 3CO6C 1QRYA 1WWXA 1D8JA 2QCOA 2Q0OA 2LDUA 2ZJPF 3FMRA 3I55I 1W0TA 4DW6A 5BS6A 1JHFA 5DCFA 3HRMA 2XF6A 3ZN1A 2Y0MA 1SFXA 3MEXA 1H89C 2ZFUA 1QVTA 2Z9OA 3FK7A 3RDIA 2X1CA 1UHWA 2DOFA 2VE9A 1SFUA 3FX3A 3VODA 2QYOA 1T56A 1AOYA 4UUTA 2BE5F 4DBQA 1XGOA 3AFHA 2E1OA 1X4OA 4LIUA 3HL2A 2QKMB 4AUXA 1RUOA 2ZXIA 3QWLA 3KP2A 4ZDPA 1YJNI 2V9PA 4U0YA 1ZQ3P 3MFKA 4D9JA 5C4XJ 2WWYA 2BZTA 1MBKA 5E1XA 2JUGA 4HDVA 2ZB9A 3TW6A 5JVTA 2Z1DA 3CJTB 2K9NA 2OQGA 3DCFA 1K7AA 1WJCA 3MKYB 1QPIA 3J81K 1HDDC 3MKLA 4P55A 1B59A 2I10A 3WTWC 4O5VA 1ZRFA 2VC1A 2LYCA 1Q1HA 5E3NA 1Z1DA 1P7IA 3GUDA 1SC7A 3ERMA 3GW2A 4MIMA 4M73A 2AQFA 1T38A 4NC8A 2ZO4A 1VQMI 2HKOA 2VJJA 5H6QA 2QQBA 2HR3A 4BE0A 2B63J 3L1PA 2VKHA 2MC3A 2X1DA 4B48A 3BPVA 2NNYA 3F72A 4M3BA 3PIOF 3ABTA 5K7HA 5FD6A 1OCTC 3F22A 1UZCA 1XSDA 2GQQA 3FXRA 2BBYA 1ETXA 4RGRA 2DFHA 1V4RA 1IZ1A 4XLPF 2FQ4A 2DJIA 2O3FA 4LB5A 3M9AA 3J7YJ 4J19A 4XBFA 3ZOBA 1YE9A 2XKPA 4PSWA 5DTDA 4GCVA 2V26A 2GXAA 2P5VA 4XLFA 4YEJA 2PMZN 2KZVA 1MD0A 4PUSA 5L3GA 1Z9CA 1STZA 2MFZA 3HDDA 5CVJA 1P6RA 3GTGJ 3S2HJ 2XF5A 3JAMZ 1S7EA 2MSYA 4JX5A 4Y4RA 3CCVI 2W4SA 3IH3A 4XL9A 4HYEA 2W24A 4RGSA 5CVUA 1X58A 2ELJA 2PJRA 1AU7A 3FHZA 2WTEA 3HRSA 3KP7A 4UHTA 2E7XA 5FB2A 4KT6A 4UUVA 2GA2A 2Q1ZB 3ECOA 3UR3C 2KFDA 3SQNA 4BQOA 5D8KB 3ZCOA 2M8GX 4I6ZA 3G73A 3NEUA 1ZG5A 3MZ8A 4OMYA 1FBSA 2CUFA 2DFEA 2EA4A 1FTTA 2QZ8A 2E1CA 2V9KA 2HQAA 2LKSA 4HLXA 2V7FA 5LHGA 1V5EA 1SD7A 2VQGA 1IN4A 3KYLA 1WZ2A 2O7OA 2VJIA 4A3IJ 2ISZA 1HKSA 4LB6B 2DU9A 2V6CA 4J01A 2FMLA 4RAFA 1OMIA 2GWRA 4XIDA 2PMUA 4A3LJ 4IQJA 3I53A 3OOUA 2X0LA 1XDUA 2CRGA 4U7DA 2Y2ZA 2Z5UA 2DK5A 1WRJA 3HBLA 5CYVA 5LHHA 4CUGA 1MBHA 3C2BA 3K1NA 5J4VA 2HVRA 3QYFA 1FBUA 2PQ8A 5CVRA 3E97A 3K7AJ 1DPUA 2AHQA 1YS7A 3KEQA 1YIJI 3I5UA 2KMUA 3BJ6A 3GBGA 3TQNA 3N05A 2K9LA 4BL0B 3HEFA 1JTYA 3HOXJ 3L7WA 2ETHA 2ZJQF 1FTZA 1PP7U 3H5AA 1K61A 2LRDA 1X19A 1MMGA 2IA1A 2HKXA 3G6EI 5GAEJ 1POGA 2DFFA 3DU5A 4II2A 2VBXA 3KLOA 3LQQA 4XRSG 3HKZA 3QOEA 3TDZC 2ZCWA 5KK1A 4NQWA 2E2JJ 1XGSA 2Q2EB 2NRAC 5C4JJ 2R7ZJ 3VEPA 2JTVA 4BQQA 1KQ9A 4Y52J 2F5VA 1B4AA 3ZMSA 3HRUA 2VC0A 4NBQA 2F2EA 5E17F 4XK4A 3NARA 3UKGA 1DGRM 2UWMA 2VODA 1WHUA 4BY7J 2FJ1A 1OKRA 2FSWA 1QA6A 1RUNA 4ZZLA 4XSXF 3SDGA 1T98A 3S1QJ 2Z99A 2XPUA 3LL7A 3KP3A 4KISA 5FFXA 3WTTC 4DJAA 4M9ZA 4MO7A 2FMYA 2A6HF 2BV6A 3MAJA 1XCBA 3O6BB 2IT0A 3BZKA 3BR0A 4PZJA 2V9VA 3WTUC 5L3EA 3A2KA 3W2AA 3EYIA 5FLMJ 3E6DA 4XRMA 3J81Z 2MBFA 3W6VA 1PYVA 3RQ4A 3SEQA 1FIAA 2QM3A 4NNJA 1TL8A 3MZYA 4NB5A 2QENA 2CFOA 2DFIA 4HF2A 2P8TA 1ZAOA 2E34A 2AS5F 1NK2P 1D8KA 2KIQA 4BJ5C 2JWTA 3DKYA 5JVGF 5DDGA 2O61A 5IOZA 3CJRB 1AHDP 1XMKA 5J47A 4HEA2 2OA4A 3N4MA 3TW7A 1EV7A 2ZMEA 5DM7F 5BQTA 4UY8I 2F48A 1FOKA 4JBAA 2EZLA 2XC7A 3BR5A 4E7LA 2CO5A 1VQ7I 2VLAA 2K86A 3OYGA 5L3BA 3BPXA 3MCZA 4L5IA 4AVPA 4D7NA
chains in the Genus database with same CATH topology
1B72B 3JRHA 4A3KJ 2CJJA 2DA7A 2L7ZA 1LFUP 2ID3A 3S17J 3B6CA 4FCYA 1BJZA 2EBIA 1UMQA 3BG3A 2DMTA 1I6HJ 4BBRJ 3I4MJ 3A01B 3PM1A 1ITYA 4MFDA 3GTQJ 1IDZA 4IHVA 3GTKJ 2K9QA 3H3VK 1EF4A 4V2GA 1MBFA 3BQZA 1MBJA 1XS9A 3Q0WA 1WCMJ 1JKQC 1K83J 1WH5A 3FIWA 4FE7A 1T33A 1Y1VJ 3SFIA 4DYCA 5EDNA 2DTZA 2X48A 2R5YA 5M3FJ 1BA5A 3H0GJ 2VUMJ 1WI3A 4AYBN 2E2HJ 2G0EA 3JRBA 3BT9A 3MN2A 3OSGA 2TRTA 2DMUA 1H8AC 3HOWJ 4A3BJ 1ETKA 3O8GA 1X2NA 1HLVA 2YU9J 3RZOJ 4A93J 3Q0VA 4MFEA 2M9HA 1A5JA 5K7FA 3ZQHA 1HCRA 3BTCA 4B4CA 1JTXA 3LSGA 2LVSA 1GDTA 2GM4A 2L7FP 5F08A 2EQRA 4L5EA 3S16J 2NVQJ 2HOSA 4M3EA 2NVYJ 4B3AA 4IEJA 1B8IA 2Y30A 4DYQA 1MSEC 2JA8J 4BBSJ 4G12A 3A01A 2DA1A 3JRIA 1IRZA 2EZHA 3RQIA 1IC8A 3FK6A 3OSFA 5EZGA 3S15J 1OCPA 4DZPA 5BNGA 2M34A 1LE8A 2P81A 2M2EA 2FX0A 2XPVA 2EZIA 1TWHJ 2CUEA 4A3JJ 3HOVJ 4DZJA 2CU7A 1H88C 3B6AA 3S1MJ 2CQQA 4M3DA 3GTOJ 1B72A 2WV1A 5EGOB 2R5YB 1TC3C 5EEAA 5GPCA 1JJ6C 1ENHA 3BR3A 2HOTA 5F0HA 2AO9A 1I3QJ 5M5WJ 3S2DJ 3BTIA 3JR9A 1JKOC 2JJ7A 4A3DJ 1E3OC 4W1UA 3G1OA 2LY9A 5EZHA 1ETVA 3G1MA 1TWGJ 3HKZN 1ZTRA 4A69C 5FKLA 3GTMJ 1F36A 4B1RA 5C3EJ 2KDZA 2MG4A 3HGGA 4JX4A 1RKWA 5IYDJ 4X6AJ 1VNDA 2YUSA 3ZQFA 1JUPA 1LFBA 3BG5A 1RR7A 1GV5A 2X9DA 4EEFG 2XPWA 1JT0A 1YRNB 2K40A 2NVTJ 3GTPJ 1UG2A 2Y9ZA 2VKEA 4IHYA 3HM5A 3JRAA 1WGXA 4S0HB 4BKXA 2VI6A 3BTLA 1RETA 4RBOA 3PO2J 3S1RJ 2N8GA 3BR2A 4C3JJ 3IV5A 3D1NI 1JKPC 4GFBA 2EZKA 3SJMA 3M4OJ 1LE8B 4D5CA 4XRSA 4CYCB 3QPSA 1WH7A 2O9LA 2LLKA 1GV2A 1AKHA 3G1LA 3CQZJ 1HF0A 4M6VA 2NS7A 3JRCA 3K2AA 1GT0C 1RKTA 5J1YA 4A3FJ 2XGEA 4M3FA 2L0KA 3FISA 2DMQA 1A6IA 4BY1J 1YRNA 1MSFC 2ME6A 4MLOA 5EG0A 3O8HA 1JUMA 2ELKA 5JLWA 3IH4A 1QRYA 2XB0X 5FKNA 2QCOA 2LFBA 2HI3A 2GLOA 2QF7A 1FJLA 2DA4A 3LNQA 3GTJJ 1W0TA 2Y0SN 4DW6A 1O4XA 4IHWA 2NVXJ 3MVPA 3GTLJ 2MW8A 1NTCA 1ETYA 1H89C 1QVTA 2RAEA 2K9SA 2XB5A 3FK7A 2L9RA 4A3GJ 3BQYA 3RKQA 2D5VA 1T56A 2DA3A 5F0CA 1JKRC 2HQ5A 4UUTA 5M3MJ 3TEDA 2LK2A 5DS9A 1SFOJ 2E1OA 1IDYA 1Y1WJ 4AUXA 2JMWA 5IPAA 2HXIA 2HYJA 1ZQ3P 1BW6A 1U78A 5C4XJ 5E3OA 2HDDA 5F27A 1MBKA 2JA7J 2HOAA 2ZB9A 3TW6A 2K9NA 3DCFA 1HDDC 1DU0A 1QPIA 3MKLA 1JGGA 1HOMA 1TWCJ 2I10A 4AC0A 1MH3A 4IHXA 2JK3A 1ZK8A 3HOUJ 2O8KA 5E3NA 1GUUA 3S14J 1P7IA 2X6OA 3QQAA 1MH4A 5EYRA 4MIMA 3F0CA 1IG7A 2R0QC 2NOGA 1P7JA 4FISA 5K7ZA 1W0UA 3A02A 3HOZJ 1DU6A 2B63J 3L1PA 1MBEA 5JLXA 2DA5A 4M3BA 3JRDA 1HDPA 1APLC 5K7HA 1OCTC 5GP9A 1JUSA 3TP3A 1ETXA 2YS9A 4I76A 4QIWN 4UUSB 4W97A 2FQ4A 2R92J 1JT6A 2LKXA 1JJ8C 4J19A 3M3YJ 1AKHB 3ZOBA 2GBYA 1D5YA 5DTDA 2EH3A 2OF7A 3BR1A 5IOYA 5GPAA 5F04A 2PMZN 2DN0A 5IP7J 5E3LA 2LR8A 3TP0A 2L7MP 5E3MA 3HDDA 3GTGJ 1QVUA 2KT0A 3S2HJ 2ME0A 2XSDC 1S7EA 2MSYA 1B8IB 1I50J 1XG1A 4JX5A 2E19A 4FE4A 1OFCX 3IH3A 5J1UA 2JA5J 4QSHA 2H8RA 5FKKA 1X58A 2DA6A 1AU7A 2H1KA 4XICA 3E7LA 1PUFA 4DYRA 2Y31A 2R5ZA 2Y9YA 4C2MJ 1RESA 1SANA 2M8GX 4I6ZA 2CUFA 5EGOA 1FTTA 2HXOA 3CMYA 5FKMA 5IYBJ 2O7OA 4NDLA 4A3IJ 3FKIJ 4V2FA 2DA2A 4D7MA 1FIPA 4XIDA 1VF9A 4C3HJ 4A3LJ 3JRGA 3OOUA 2CRGA 1CQTA 1F43A 1UHSA 2Y2ZA 3HBLA 1GVDA 1TWFJ 1MBHA 3C2BA 1ZR2A 1IUFA 9ANTA 2VPRA 4CYCA 2XGDA 2JN6A 1Q1VA 1XC5A 3K7AJ 3NAUA 3HB9A 3WHBA 2AHQA 4JP0A 4RDUA 3LSRA 5IP6A 2DMPA 3LSPA 2XRLA 3GBGA 1RPWA 1ETQA 1ZR4A 4JX6A 2DMNA 2W48A 3HEFA 1JTYA 3HOXJ 1VFCA 5IP9J 1FTZA 3A03A 4C3IJ 3RZDJ 2FD5A 1K61A 5J1RA 5HODA 3IH2A 1BW5A 1ZGWA 5F0FA 1POGA 3ZQGA 2CQXA 5F1JA 2JA6J 4XRSG 1ETOA 3VPRA 2R5ZB 2E2IJ 4X1EA 1FEXA 4A3CJ 2E2JJ 4ABZA 2TCTA 1VI0A 3S1NJ 4HNVA 5C4JJ 2R7ZJ 1TWAJ 2LTPA 1ORKA 4JYKA 3CDLA 4Y52J 1X2MA 4Y7NJ 1Z0XA 2NS8A 4XK4A 3NARA 3UKGA 1MNMC 1U9NA 2R93J 5FJ8J 3HGYA 4BY7J 1BL0A 2FJ1A 2DJNA 2WB1N 4QTRA 3ZQLA 3OIOA 2LP0A 1WPKA 3SDGA 1IJWC 3S1QJ 2XPUA 3HOYJ 1ETWA 3LSJA 1IV6A 2IAIA 1PUFB 3Q3SA 4MO7A 2IEKA 1ZKGA 3BR6A 5IYCJ 3JREA 5C44J 1Z77A 2ID6A 3BR0A 1G2HA 2MGQA 2VKVA 2ECBA 5FLMJ 3QPLA 1R9TJ 3LOCA 4XRMA 1U9OA 5M5YJ 3W6VA 2ECCA 3ZQIA 4A3MJ 3I4NJ 1FIAA 2COBA 1U8BA 5FKOA 5J3LA 5EF6A 3BG9A 3WHCA 1OJLA 1NK3P 4A3EJ 4M3GA 3Q0UA 1NK2P 1IGNA 2JWTA 3DEWA 1MBGA 5IOZA 4UUSA 1AHDP 5FLVA 4D5FA 3BTJA 3TW7A 3ZQCA 2LD5A 3CCYA 4BXXJ 2XGCA 2IBDA 5M5XJ 2EZLA 3PO3J 4FTHA 3BR5A 2OPTA 4LOCA 3JRFA 2M0CA 2WAQN 5EG0B 4D7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B72 B;  3JRH A;  4A3K J;  2CJJ A;  2DA7 A;  2L7Z A;  1LFU P;  2ID3 A;  3S17 J;  3B6C A;  4FCY A;  1BJZ A;  2EBI A;  1UMQ A;  3BG3 A;  2DMT A;  1I6H J;  4BBR J;  3I4M J;  3A01 B;  3PM1 A;  1ITY A;  4MFD A;  3GTQ J;  1IDZ A;  4IHV A;  3GTK J;  2K9Q A;  3H3V K;  1EF4 A;  4V2G A;  1MBF A;  3BQZ A;  1MBJ A;  1XS9 A;  3Q0W A;  1WCM J;  1JKQ C;  1K83 J;  1WH5 A;  3FIW A;  4FE7 A;  1T33 A;  1Y1V J;  3SFI A;  4DYC A;  5EDN A;  2DTZ A;  2X48 A;  2R5Y A;  5M3F J;  1BA5 A;  3H0G J;  2VUM J;  1WI3 A;  4AYB N;  2E2H J;  2G0E A;  3JRB A;  3BT9 A;  3MN2 A;  3OSG A;  2TRT A;  2DMU A;  1H8A C;  3HOW J;  4A3B J;  1ETK A;  3O8G A;  1X2N A;  1HLV A;  2YU9 J;  3RZO J;  4A93 J;  3Q0V A;  4MFE A;  2M9H A;  1A5J A;  5K7F A;  3ZQH A;  1HCR A;  3BTC A;  4B4C A;  1JTX A;  3LSG A;  2LVS A;  1GDT A;  2GM4 A;  2L7F P;  5F08 A;  2EQR A;  4L5E A;  3S16 J;  2NVQ J;  2HOS A;  4M3E A;  2NVY J;  4B3A A;  4IEJ A;  1B8I A;  2Y30 A;  4DYQ A;  1MSE C;  2JA8 J;  4BBS J;  4G12 A;  3A01 A;  2DA1 A;  3JRI A;  1IRZ A;  2EZH A;  3RQI A;  1IC8 A;  3FK6 A;  3OSF A;  5EZG A;  3S15 J;  1OCP A;  4DZP A;  5BNG A;  2M34 A;  1LE8 A;  2P81 A;  2M2E A;  2FX0 A;  2XPV A;  2EZI A;  1TWH J;  2CUE A;  4A3J J;  3HOV J;  4DZJ A;  2CU7 A;  1H88 C;  3B6A A;  3S1M J;  2CQQ A;  4M3D A;  3GTO J;  1B72 A;  2WV1 A;  5EGO B;  2R5Y B;  1TC3 C;  5EEA A;  5GPC A;  1JJ6 C;  1ENH A;  3BR3 A;  2HOT A;  5F0H A;  2AO9 A;  1I3Q J;  5M5W J;  3S2D J;  3BTI A;  3JR9 A;  1JKO C;  2JJ7 A;  4A3D J;  1E3O C;  4W1U A;  3G1O A;  2LY9 A;  5EZH A;  1ETV A;  3G1M A;  1TWG J;  3HKZ N;  1ZTR A;  4A69 C;  5FKL A;  3GTM J;  1F36 A;  4B1R A;  5C3E J;  2KDZ A;  2MG4 A;  3HGG A;  4JX4 A;  1RKW A;  5IYD J;  4X6A J;  1VND A;  2YUS A;  3ZQF A;  1JUP A;  1LFB A;  3BG5 A;  1RR7 A;  1GV5 A;  2X9D A;  4EEF G;  2XPW A;  1JT0 A;  1YRN B;  2K40 A;  2NVT J;  3GTP J;  1UG2 A;  2Y9Z A;  2VKE A;  4IHY A;  3HM5 A;  3JRA A;  1WGX A;  4S0H B;  4BKX A;  2VI6 A;  3BTL A;  1RET A;  4RBO A;  3PO2 J;  3S1R J;  2N8G A;  3BR2 A;  4C3J J;  3IV5 A;  3D1N I;  1JKP C;  4GFB A;  2EZK A;  3SJM A;  3M4O J;  1LE8 B;  4D5C A;  4XRS A;  4CYC B;  3QPS A;  1WH7 A;  2O9L A;  2LLK A;  1GV2 A;  1AKH A;  3G1L A;  3CQZ J;  1HF0 A;  4M6V A;  2NS7 A;  3JRC A;  3K2A A;  1GT0 C;  1RKT A;  5J1Y A;  4A3F J;  2XGE A;  4M3F A;  2L0K A;  3FIS A;  2DMQ A;  1A6I A;  4BY1 J;  1YRN A;  1MSF C;  2ME6 A;  4MLO A;  5EG0 A;  3O8H A;  1JUM A;  2ELK A;  5JLW A;  3IH4 A;  1QRY A;  2XB0 X;  5FKN A;  2QCO A;  2LFB A;  2HI3 A;  2GLO A;  2QF7 A;  1FJL A;  2DA4 A;  3LNQ A;  3GTJ J;  1W0T A;  2Y0S N;  4DW6 A;  1O4X A;  4IHW A;  2NVX J;  3MVP A;  3GTL J;  2MW8 A;  1NTC A;  1ETY A;  1H89 C;  1QVT A;  2RAE A;  2K9S A;  2XB5 A;  3FK7 A;  2L9R A;  4A3G J;  3BQY A;  3RKQ A;  2D5V A;  1T56 A;  2DA3 A;  5F0C A;  1JKR C;  2HQ5 A;  4UUT A;  5M3M J;  3TED A;  2LK2 A;  5DS9 A;  1SFO J;  2E1O A;  1IDY A;  1Y1W J;  4AUX A;  2JMW A;  5IPA A;  2HXI A;  2HYJ A;  1ZQ3 P;  1BW6 A;  1U78 A;  5C4X J;  5E3O A;  2HDD A;  5F27 A;  1MBK A;  2JA7 J;  2HOA A;  2ZB9 A;  3TW6 A;  2K9N A;  3DCF A;  1HDD C;  1DU0 A;  1QPI A;  3MKL A;  1JGG A;  1HOM A;  1TWC J;  2I10 A;  4AC0 A;  1MH3 A;  4IHX A;  2JK3 A;  1ZK8 A;  3HOU J;  2O8K A;  5E3N A;  1GUU A;  3S14 J;  1P7I A;  2X6O A;  3QQA A;  1MH4 A;  5EYR A;  4MIM A;  3F0C A;  1IG7 A;  2R0Q C;  2NOG A;  1P7J A;  4FIS A;  5K7Z A;  1W0U A;  3A02 A;  3HOZ J;  1DU6 A;  2B63 J;  3L1P A;  1MBE A;  5JLX A;  2DA5 A;  4M3B A;  3JRD A;  1HDP A;  1APL C;  5K7H A;  1OCT C;  5GP9 A;  1JUS A;  3TP3 A;  1ETX A;  2YS9 A;  4I76 A;  4QIW N;  4UUS B;  4W97 A;  2FQ4 A;  2R92 J;  1JT6 A;  2LKX A;  1JJ8 C;  4J19 A;  3M3Y J;  1AKH B;  3ZOB A;  2GBY A;  1D5Y A;  5DTD A;  2EH3 A;  2OF7 A;  3BR1 A;  5IOY A;  5GPA A;  5F04 A;  2PMZ N;  2DN0 A;  5IP7 J;  5E3L A;  2LR8 A;  3TP0 A;  2L7M P;  5E3M A;  3HDD A;  3GTG J;  1QVU A;  2KT0 A;  3S2H J;  2ME0 A;  2XSD C;  1S7E A;  2MSY A;  1B8I B;  1I50 J;  1XG1 A;  4JX5 A;  2E19 A;  4FE4 A;  1OFC X;  3IH3 A;  5J1U A;  2JA5 J;  4QSH A;  2H8R A;  5FKK A;  1X58 A;  2DA6 A;  1AU7 A;  2H1K A;  4XIC A;  3E7L A;  1PUF A;  4DYR A;  2Y31 A;  2R5Z A;  2Y9Y A;  4C2M J;  1RES A;  1SAN A;  2M8G X;  4I6Z A;  2CUF A;  5EGO A;  1FTT A;  2HXO A;  3CMY A;  5FKM A;  5IYB J;  2O7O A;  4NDL A;  4A3I J;  3FKI J;  4V2F A;  2DA2 A;  4D7M A;  1FIP A;  4XID A;  1VF9 A;  4C3H J;  4A3L J;  3JRG A;  3OOU A;  2CRG A;  1CQT A;  1F43 A;  1UHS A;  2Y2Z A;  3HBL A;  1GVD A;  1TWF J;  1MBH A;  3C2B A;  1ZR2 A;  1IUF A;  9ANT A;  2VPR A;  4CYC A;  2XGD A;  2JN6 A;  1Q1V A;  1XC5 A;  3K7A J;  3NAU A;  3HB9 A;  3WHB A;  2AHQ A;  4JP0 A;  4RDU A;  3LSR A;  5IP6 A;  2DMP A;  3LSP A;  2XRL A;  3GBG A;  1RPW A;  1ETQ A;  1ZR4 A;  4JX6 A;  2DMN A;  2W48 A;  3HEF A;  1JTY A;  3HOX J;  1VFC A;  5IP9 J;  1FTZ A;  3A03 A;  4C3I J;  3RZD J;  2FD5 A;  1K61 A;  5J1R A;  5HOD A;  3IH2 A;  1BW5 A;  1ZGW A;  5F0F A;  1POG A;  3ZQG A;  2CQX A;  5F1J A;  2JA6 J;  4XRS G;  1ETO A;  3VPR A;  2R5Z B;  2E2I J;  4X1E A;  1FEX A;  4A3C J;  2E2J J;  4ABZ A;  2TCT A;  1VI0 A;  3S1N J;  4HNV A;  5C4J J;  2R7Z J;  1TWA J;  2LTP A;  1ORK A;  4JYK A;  3CDL A;  4Y52 J;  1X2M A;  4Y7N J;  1Z0X A;  2NS8 A;  4XK4 A;  3NAR A;  3UKG A;  1MNM C;  1U9N A;  2R93 J;  5FJ8 J;  3HGY A;  4BY7 J;  1BL0 A;  2FJ1 A;  2DJN A;  2WB1 N;  4QTR A;  3ZQL A;  3OIO A;  2LP0 A;  1WPK A;  3SDG A;  1IJW C;  3S1Q J;  2XPU A;  3HOY J;  1ETW A;  3LSJ A;  1IV6 A;  2IAI A;  1PUF B;  3Q3S A;  4MO7 A;  2IEK A;  1ZKG A;  3BR6 A;  5IYC J;  3JRE A;  5C44 J;  1Z77 A;  2ID6 A;  3BR0 A;  1G2H A;  2MGQ A;  2VKV A;  2ECB A;  5FLM J;  3QPL A;  1R9T J;  3LOC A;  4XRM A;  1U9O A;  5M5Y J;  3W6V A;  2ECC A;  3ZQI A;  4A3M J;  3I4N J;  1FIA A;  2COB A;  1U8B A;  5FKO A;  5J3L A;  5EF6 A;  3BG9 A;  3WHC A;  1OJL A;  1NK3 P;  4A3E J;  4M3G A;  3Q0U A;  1NK2 P;  1IGN A;  2JWT A;  3DEW A;  1MBG A;  5IOZ A;  4UUS A;  1AHD P;  5FLV A;  4D5F A;  3BTJ A;  3TW7 A;  3ZQC A;  2LD5 A;  3CCY A;  4BXX J;  2XGC A;  2IBD A;  5M5X J;  2EZL A;  3PO3 J;  4FTH A;  3BR5 A;  2OPT A;  4LOC A;  3JRF A;  2M0C A;  2WAQ N;  5EG0 B;  4D7N A; 
#chains in the Genus database with same CATH topology
 5FFZ A;  3U21 A;  1KYZ A;  4KJZ A;  3GFJ A;  1Y0N A;  1R00 A;  2PG4 A;  2KRH A;  2O03 A;  4F52 A;  3B6C A;  2W25 A;  1UHM A;  4XN0 A;  5LEJ A;  1YS6 A;  1VQO I;  3CC4 I;  2CSO A;  1UMQ A;  4ZDL A;  2L02 A;  2XSJ C;  1N25 A;  3JAM K;  3A01 B;  3JTG A;  3H9G A;  4MFD A;  1X1B A;  3S8P A;  2FXA A;  1FSH A;  1MJB A;  4G9Y A;  2RC4 A;  4DGW B;  3H3V K;  1SD4 A;  4V2G A;  1J2X A;  4HNU A;  4LGW A;  3DBR B;  3K4J A;  3RPQ A;  2JVH A;  2Q8K A;  2D1H A;  3ABL H;  2V1U A;  3FXQ A;  1R36 A;  3OYK A;  1NG7 A;  1T33 A;  3E6M A;  3WGH A;  5CVI A;  3LQR A;  2ZFW A;  3OYA A;  1BA5 A;  2HZD A;  2RVC A;  1EH8 A;  1R58 A;  4L18 B;  2E2H J;  3JRB A;  1P2F A;  3BT9 A;  4C9Y A;  3A0H C;  2R7U A;  4I98 B;  4IX7 A;  3OSG A;  2IJL A;  3J7Z I;  3HOW J;  1J59 A;  3VOE A;  1VQN I;  4A3B J;  4GDF A;  3BLY A;  2VBZ A;  2YU9 J;  2A5Y B;  3RKX A;  1PVE A;  2M9H A;  4Y33 A;  1LPQ A;  3PNY A;  1ZN2 A;  2D2W A;  2P4W A;  1JTX A;  4A2U A;  2GM4 A;  2F4I A;  4HZF A;  4CCO A;  3I3L A;  3TGN A;  5KNL A;  4IVN A;  2FBH A;  1AA7 A;  4CCL A;  2NVQ J;  1J0R A;  4M9S A;  2NVY J;  4CH7 A;  1IRF A;  1B8I A;  5KAI C;  3IAS 2;  4DYQ A;  2JA8 J;  5IT9 K;  1R1U A;  1HSJ A;  1IRZ A;  2DA1 A;  3S2W A;  4R1H A;  1U2W A;  4AD9 A;  1O57 A;  3V8K A;  3SZP A;  1OCP A;  2R4G A;  5F64 A;  5BNG A;  2IW5 A;  4WF2 A;  2LMD A;  1SD6 A;  3TOB A;  4CCK A;  2FE3 A;  2FX0 A;  2EZI A;  1TWH J;  1TBX A;  3HOV J;  4GXO A;  2LF8 A;  2A61 A;  4WWC A;  5DYM A;  1I3A A;  3CC7 I;  1B6A A;  2V4J C;  3HHH A;  4IZZ A;  1U3E M;  4CZC A;  1QQI A;  4I0A A;  3ROU A;  4F92 B;  3V7C A;  5F1R A;  4YRV A;  1OIS A;  3H5R A;  1W36 D;  3BG7 A;  1O3R A;  1IRX A;  3BR3 A;  3QU3 A;  4QLC U;  2MA3 A;  3FM3 A;  3H9Q A;  3BTI A;  3JR9 A;  2JJ7 A;  3RCO A;  4FAS D;  3F3X A;  3H1C A;  3I54 A;  4W1U A;  3NWT A;  4XRF A;  2CW7 A;  1ON2 A;  2EIM H;  2LY9 A;  3G1O A;  4KA4 A;  2E5Z A;  1TWG J;  2VPL A;  5AON A;  2FOK A;  5AIQ A;  3UNG C;  1FLI A;  5C3E J;  3HJE A;  3DLL F;  1RKW A;  3CCS I;  5IYD J;  1KQ0 A;  3Q9S A;  2YUS A;  1Y56 A;  3OYD A;  1KYW A;  1LFB A;  2V6E A;  4U87 A;  3E1S A;  4BEH A;  3GCM A;  1GV5 A;  2XPW A;  3R6S A;  1OCR H;  3J7A O;  4ZZD A;  5GTH C;  3GTP J;  1UG2 A;  4IHY A;  4F3Q A;  3OYE A;  2QBY A;  1WGX A;  2IS4 A;  1GVJ A;  1D5V A;  3BY6 A;  1FOW A;  3QP5 A;  4RBO A;  3CCE I;  1X3U A;  4LFU A;  1WJD A;  4GFB A;  3BR2 A;  3PO2 J;  3PFI A;  4RMN A;  3TKY A;  2VON A;  2WY8 Q;  2WA0 A;  4LD5 A;  1WI9 A;  3NQO A;  4D5C A;  1FC3 A;  1HKQ A;  4HST A;  4M71 A;  1ZLK A;  3QPS A;  1WH7 A;  2ELH A;  2LLK A;  3OYI A;  3RYR A;  3G1L A;  3CQZ J;  1SVL A;  4KIT B;  2NS7 A;  3F8F A;  4GO1 A;  2L9N A;  1W4M A;  4B09 A;  5DCM B;  1GT0 C;  2OCE A;  1ZRD A;  3WU1 B;  2ZNY A;  4EMS A;  1O3T A;  2PBI A;  3L2R A;  2QVO A;  3EET A;  2ELK A;  3GO5 A;  2VL8 A;  2XB0 X;  3IH4 A;  4EJU A;  4YFX F;  3K6G A;  1L0O C;  2HI3 A;  2GLO A;  3IAM 2;  1FJL A;  2HFH A;  5DD8 A;  4BHB A;  4RM3 A;  2W1O A;  4IHW A;  2Y0S N;  3IHU A;  4KIB A;  4N4O B;  4HX7 A;  1LVA A;  3GTL J;  2M7B A;  4G6T B;  4RAZ A;  4G7O F;  2M1B A;  2RAE A;  1S29 A;  4BUP A;  4A3G J;  2EFP A;  1JKR C;  3HYI A;  1MJ9 A;  2COM A;  4IO9 F;  3TED A;  1IAW A;  3CC2 I;  4I0B A;  5K5R A;  1DPR A;  1I39 A;  3QPH A;  4Y3O A;  3LFK A;  2HYJ A;  2GIV A;  1YW7 A;  5KVR A;  4M9X A;  3CDH A;  1TQI A;  3O2P E;  4I01 A;  3ZMU A;  5ED4 A;  2HOA A;  3QAH A;  4FHT A;  2E1M C;  2L9V A;  2HS5 A;  5GAG J;  3H9J A;  3S93 A;  2EJR A;  1HW1 A;  5ILS A;  3ECH A;  1KZH A;  5TJJ A;  3M8E A;  4N9I A;  3QPT A;  3V4G A;  1Z91 A;  3OYJ A;  1XDS A;  1ZK8 A;  4ZH4 F;  3HOU J;  2XVC A;  2KIF A;  2O8K A;  3OS2 A;  3NWS A;  4E7I A;  3LSK A;  3DLA A;  2M7A A;  1IG7 A;  2VBY A;  3GF2 A;  1ZG1 A;  4J00 A;  2HTS A;  1XB4 A;  5K7Z A;  1W0U A;  3A02 A;  1PP8 F;  2BW3 B;  3E6B A;  1YX5 A;  2DOE A;  3KEO A;  1MBE A;  3W2W A;  2OTL I;  4IQ4 A;  5H20 A;  3JRD A;  4QPO A;  3JSP A;  1HDP A;  4KDP A;  1BI1 A;  2EPF A;  1FOX A;  5GP9 A;  1JGS A;  1JUS A;  2DXI A;  2YS9 A;  1O3S A;  4QIW N;  4XON A;  2R92 J;  1D0Y A;  3GVA A;  2E1M B;  1JT6 A;  2LKX A;  2L5Q A;  3M3Y J;  4AID A;  1D5Y A;  2FBK A;  1XX5 A;  2EH3 A;  5GPA A;  5GTI C;  5E8G A;  1BN5 A;  2DN0 A;  4EM1 A;  5IP7 J;  5D5V B;  3OYM A;  1K6Y A;  2L7M P;  2OUM A;  5DUK A;  1MMN A;  3OYL A;  3AL0 C;  1S3J A;  4LLG F;  3RPU D;  3DKX A;  1XG1 A;  1S5L C;  4IOA F;  1P9Q C;  3MWM A;  2C6Y A;  4PGH A;  2WAQ A;  4FET A;  4H4K C;  3WTZ A;  1USS A;  2P6S A;  3F23 A;  1SMT A;  2ZBK A;  5FKK A;  2H8R A;  2DA6 A;  4EQQ A;  3AG4 H;  4U0W A;  3WTS C;  2CH0 A;  3ASO H;  1OCO H;  4XIC A;  1F1Z A;  2UXN A;  3BDD A;  1G3Y A;  2Y31 A;  4M74 A;  2R5Z A;  2A3S A;  2IGO A;  3OMY A;  4AIH A;  3TOA A;  1DQU A;  2EFN A;  1RES A;  2Y0S A;  4ESB A;  4AIK A;  1SVM A;  5B66 C;  4MEX F;  3KIO A;  4ON0 A;  4EAT A;  3VYR B;  1ULY A;  1DUX C;  3KP6 A;  3SHF A;  5HLI A;  3ESW B;  1LUJ B;  3K4C A;  5FD5 A;  5FKM A;  2F4O B;  2DOD A;  3C2G A;  4E7S A;  3WG9 A;  3J80 Z;  3EUH A;  3LSH A;  3RPU A;  1DGW Y;  1FSE A;  4D7M A;  1G3S A;  2PLY A;  1E17 A;  3EQL F;  3VSK A;  3CCM I;  2R7T A;  3G3Z A;  3MMY B;  1UHS A;  2HWV A;  1GVD A;  4A6E A;  3O3K A;  2D1V A;  3GFI A;  2JN6 A;  1XC5 A;  1BIB A;  4AU7 A;  5DCM A;  4JP0 A;  1S72 I;  4RDU A;  3VYU B;  1X1C A;  3LSP A;  3EYY A;  2DMP A;  3GFL A;  4BQN A;  3K4L A;  1RPW A;  2JRT A;  1ETQ A;  1XMX A;  2DMN A;  1FOY A;  1R6R A;  1S8N A;  1YO5 C;  1UST A;  1Z21 A;  3K69 A;  2CQN A;  3A03 A;  2Y69 H;  2FU4 A;  2FD5 A;  1D0Z A;  2RKH A;  5J1R A;  1P92 A;  3CCL I;  1GLN A;  2F5E A;  3ZQG A;  1R22 A;  1LDJ A;  5ICG A;  1FX7 A;  3L2C A;  2E2I J;  2LSO A;  4X1E A;  2EV5 A;  1RC9 A;  4A5M A;  1YOV B;  4IJA A;  2GOM A;  1JI8 A;  2LTP A;  1WJF A;  4B44 A;  2M5W A;  1BR1 A;  1V54 H;  4E7H A;  4HX8 A;  3FXL A;  4L9T A;  2ZJ2 A;  1VZ0 A;  3GLX A;  1Y8R B;  4RS8 A;  5FJ8 J;  2EK5 A;  3HGY A;  3F8B A;  4N4N B;  2E1N A;  4QTR A;  3U1D A;  2LP0 A;  3OV8 A;  1WPK A;  4RB0 A;  4KUM A;  2PJP A;  1NHA A;  1LKX A;  1KU9 A;  1TW3 A;  2O5R A;  3QYE A;  5HLT A;  3HOY J;  2M8E A;  3LSJ A;  1IV6 A;  1FYL A;  3CUQ C;  4KNY A;  4G7Z F;  1D0X A;  3ISP A;  3P9K A;  3CLQ A;  4HDU A;  3V42 A;  3ZQ7 A;  4D0P A;  1G2H A;  2XAF A;  3AG1 H;  3QPL A;  1U9O A;  3LSI A;  5M5Y J;  4KMF A;  2ECC A;  2CS3 A;  3ZQI A;  3ZN0 A;  3FBN B;  2COB A;  5HLG A;  2HVQ A;  2HDW A;  3QRF F;  1MND A;  1FWZ A;  3V7S A;  1U8B A;  5L3F A;  5A2Q K;  1D1B A;  5LHI A;  4CO8 A;  1R49 A;  2HU9 A;  4FQG A;  3D5R C;  4II3 A;  4M3G A;  3Q0U A;  4E7Z A;  5J8F A;  1JE8 A;  1E3H A;  2V1X A;  4C2U A;  3DTK A;  4RGU A;  3CCR I;  1H9T A;  4IHT A;  4D5F A;  2Z33 A;  1G3W A;  2G7H A;  3HTU A;  4PCQ A;  3CCY A;  4QWQ A;  2IBD A;  5M5X J;  4BGD A;  2OPT A;  1Z6R A;  3DEU A;  4LOC A;  2IA0 A;  3JRF A;  2M0C A;  3ASN H;  2ISY A;  1K79 A;  2ADU A;  3ML6 A;  2XGX A;  3T1B A;  2OAZ A;  3FKJ A;  3HSR A;  4U0V A;  4RB2 C;  1V3F A;  2O6G E;  2EA2 A;  4B43 A;  2ID3 A;  2IS1 A;  4FX4 A;  4Z6Y A;  4FCY A;  2HQN A;  1BJZ A;  1KON A;  2DMT A;  4BBR J;  2NXN B;  5D6E A;  4BJ6 C;  1YHQ I;  1SAU A;  1UEL B;  1R5G A;  4HRI A;  2ZKZ A;  3QP6 A;  4IHV A;  2K9Q A;  5JFR A;  2MLG A;  3WE3 A;  3L2W A;  2CUJ A;  1EF4 A;  1MBF A;  3BQZ A;  2X4H A;  3HSE A;  2EIN H;  5LBQ A;  1VQP I;  3CMA I;  3FDY A;  1K83 J;  3LA3 A;  2OBP A;  3FIW A;  1BC8 C;  2CW8 A;  2DTZ A;  5JHU A;  4A5N A;  2R5Y A;  1IO2 A;  2ZNZ A;  3H0G J;  5GAD J;  5FRM A;  5D5U B;  2XRN A;  3AG2 H;  1WI3 A;  2G0E A;  2NAZ A;  3CF2 A;  6PAX A;  4HNT A;  2DTR A;  3F8M A;  3GYH X;  3DPT A;  2CV1 A;  2X1E A;  4HAM A;  3IL2 A;  1YW9 A;  1TZL A;  3OIQ A;  1BR4 A;  1X2N A;  5FLX Z;  1HLV A;  1R5H A;  3H3U A;  3P9C A;  3DPU A;  2CW0 F;  3HSF A;  4MFE A;  3FXK A;  2K3P A;  3GEZ A;  4AM3 A;  1A5J A;  3ZQH A;  3LFU A;  3BJO A;  2X6X A;  2A68 F;  2LY2 A;  2L7F P;  5F08 A;  2ESN A;  2XAS A;  1YJ9 I;  2STW A;  1SFE A;  4OOI A;  4LG3 A;  4L5E A;  3S16 J;  3BOQ A;  4FX0 A;  3DXJ F;  1IN5 A;  2V79 A;  3FXO A;  2XIG A;  4B3A A;  4IEJ A;  2QWW A;  4BNC A;  1QZZ A;  4Y15 A;  4QPQ A;  2P6T A;  2DO7 A;  2VE8 A;  3N97 A;  4Y17 A;  4XNF A;  3RQI A;  1IC8 A;  1ZRE A;  1U5T A;  4HG2 A;  3S15 J;  1HA8 A;  1BI3 A;  3L00 A;  4X0G A;  2OTJ I;  3K70 D;  1LE8 A;  2P81 A;  3DP7 A;  5IT9 Z;  3TO6 A;  2CUE A;  5JI6 A;  1SFK A;  4KIF A;  3CES A;  4DZJ A;  3X2Q H;  1K78 A;  4XOT A;  2CQQ A;  1HQC A;  2LNB A;  1Y39 A;  1Z6T A;  1EA3 A;  3GTO J;  3BZ6 A;  2IGN A;  5CQG A;  4A12 A;  4HLY A;  5GPC A;  3M8J A;  3KZI C;  1ENH A;  1I6X A;  2HOT A;  5D8L B;  2AXT C;  4F93 B;  3R0J A;  3HHG A;  1I3Q J;  3BJA A;  2PEX A;  3F6V A;  1BOA A;  2L7K A;  4MHG A;  3K4M A;  4MQV A;  5FRN A;  3CP8 A;  3FHN A;  3HC7 A;  3GXO A;  3L2U A;  3CMM A;  3TO9 A;  1XSX A;  1ETV A;  2Z2S B;  3M8F A;  2QKL B;  1A31 A;  2BHY A;  3D5L A;  3SYT A;  1IXS B;  5FKL A;  3V8L A;  4B1R A;  4IRH A;  2KDZ A;  3M07 A;  4JX4 A;  4OWR B;  1LJ9 A;  1QO0 D;  4YFN F;  1ACI A;  1VND A;  2CUZ A;  1MW7 A;  3I71 A;  5CVV A;  4ENM A;  2O0Y A;  2AQE A;  4A0Z A;  1JUP A;  2BEO A;  1Z67 A;  3BG5 A;  3K10 A;  1U5T C;  3ABM H;  1VTN C;  2X9D A;  1F4K A;  4EEF G;  2WC2 A;  4MQ9 F;  4BH9 A;  3IC7 A;  5ILU A;  1D3Y A;  4HSR A;  2JVG A;  5BPI A;  2FUG 2;  2K40 A;  4PK4 A;  2NVT J;  3V7R A;  2BYV E;  2Y9Z A;  4LMY A;  1W1W E;  3JRA A;  4WXC A;  2R3S A;  1RET A;  3S1R J;  4C3J J;  3D1N I;  1BIA A;  3SEZ A;  1LNW A;  5J6X A;  4C2T A;  2O8X A;  2LBF A;  3MZH A;  2OZU A;  1LDK B;  5CJ9 A;  2LBF B;  1HF0 A;  4ANJ A;  1T0F A;  1HST A;  3ZQQ A;  3OIP A;  3IRQ A;  4K2E A;  2K5C A;  2RQP A;  4PGG A;  3KET A;  1IW7 F;  4A3F J;  2XGE A;  1YIT I;  4E6K G;  4XKW A;  5F6F A;  3T8R A;  3FIS A;  2A05 A;  2DMQ A;  1R71 A;  4BY1 J;  3LSM A;  3TL4 X;  2PN6 A;  3JCU C;  4MLO A;  1Y8Q B;  1JUM A;  4GRI A;  2NNN A;  1YQA A;  1IN7 A;  4YII A;  5IT3 A;  5LFA A;  4LLL A;  3AG3 H;  1TW2 A;  1G3T A;  2DLL A;  3CZ6 A;  3E5U A;  3HUG A;  3TMO A;  2IPQ X;  1ZRC A;  4OIQ F;  1X1A A;  2M45 A;  4MGR A;  2MW8 A;  2VT2 A;  4XLE A;  4ZDO A;  3HG9 A;  1NTC A;  4LK0 F;  1QZY A;  1BJA A;  1ETY A;  2Z16 A;  2DQL A;  2K9S A;  2XB5 A;  4XSZ F;  2XV4 S;  3BQY A;  3PIP F;  3RKQ A;  2D5V A;  2HQ5 A;  1CGP A;  1PUE E;  4ASN A;  2VJ5 A;  2DT5 A;  4LIV A;  2YX7 A;  1SFO J;  2K7L A;  1IDY A;  4LJZ F;  1Y1W J;  2VAS A;  4E70 A;  2GOX B;  1I1G A;  4OIN F;  2JZY A;  1RIO H;  2BY3 A;  1IF1 A;  1U78 A;  3S3O A;  1TNS A;  5F27 A;  2JA7 J;  5HNF A;  3KFW X;  4IF4 A;  2M0M A;  1P4A A;  1DU0 A;  5DUI A;  1JGG A;  4XN3 A;  4AC0 A;  1W7P A;  2JK3 A;  2IRF G;  5KCM A;  2HTJ A;  1GUU A;  5BMZ A;  3QQA A;  2X6O A;  2LC2 A;  3BWG A;  2HPM A;  2G9W A;  5LGU A;  4OIO F;  3BCA A;  4NUB A;  3L9F A;  2R0Q C;  3I56 I;  1P7J A;  3T8T A;  4FIS A;  4L9N A;  2DT6 A;  1J7K A;  1DU6 A;  3SDB A;  2RRE A;  1A6Q A;  1RRJ A;  3K0L A;  4AYB A;  1VQL I;  1X3W B;  2LY1 A;  4ZYD A;  5K1Y A;  4A6D A;  2QBY B;  5BPD A;  2DA5 A;  1ON1 A;  1APL C;  1LB2 A;  3F8N A;  3C1D A;  1V5F A;  5D5W B;  5E1W A;  2A69 F;  2LH9 A;  4W97 A;  4UUS B;  4BXU A;  1AKH B;  5CQE A;  1ZG3 A;  4Y13 A;  2OF7 A;  3BR1 A;  4Q47 A;  5IOY A;  3IKV A;  5GAH J;  2K02 A;  5F04 A;  4EVI A;  5E3L A;  3K4K A;  5B3S H;  2LR8 A;  1RR8 C;  4O6J A;  2MD5 A;  3I9V 2;  4B3X A;  1JXS A;  2XSD C;  1I50 J;  2E19 A;  1KQ8 A;  4L0Y B;  1OFC X;  2JPC A;  2L01 A;  2TDX A;  2JA5 J;  2Y75 A;  3L2Q A;  3DQV C;  4IPA A;  4QSH A;  3U1K A;  3DKW A;  3KP4 A;  3FM5 A;  4DQ2 A;  2A07 F;  1J9I A;  5D6F A;  2BY0 A;  2R7Q A;  2CV0 A;  4KN7 X;  4YEL A;  2DQR A;  4LIT A;  3PQK A;  1M1E B;  4IKF A;  3HOS A;  2BOL A;  2L54 A;  1RI7 A;  2KL4 A;  5EGO A;  2W00 A;  2P5L C;  2BVM A;  2HXO A;  1J09 A;  3LA7 A;  3KP5 A;  3M1E A;  1UAA A;  1R4N B;  1QU3 A;  4RLQ A;  1H0M A;  4BJT A;  4BDZ A;  1OLT A;  4NDL A;  3RTR A;  3FKI J;  3K70 C;  1FMV A;  2DA2 A;  1WJE A;  4HQM A;  3LAP A;  1W36 C;  2XAH A;  3EPZ A;  2DYR H;  3CD6 I;  3F8C A;  2KIS A;  3QYB A;  1ERD A;  2IP2 A;  1BOB A;  1CQT A;  3E6C C;  1F43 A;  2NYX A;  2VIX A;  2ZC2 A;  1TWF J;  2KKO A;  1D1A A;  1UJ8 A;  1ZR2 A;  5HDG A;  2VPR A;  4BU2 A;  3S3N A;  4CYC A;  3PL8 A;  5EG0 B;  2UXX A;  1Z7L A;  3WHB A;  3CJQ B;  4JOM A;  1A04 A;  1S7O A;  2RQQ A;  4EM2 A;  3LSR A;  2ICW G;  5JR3 A;  1WJA A;  5IY5 H;  3VYT B;  4UVB A;  1IV8 A;  4G7H F;  2PI0 A;  2W48 A;  3T0Y A;  2F6C A;  1FP2 A;  3AKZ A;  1VFC A;  3C3W A;  5IP9 J;  2A6E F;  5HOD A;  1OYI A;  1BW5 A;  3VYS B;  3DEE A;  3OYC A;  4UVA A;  1QBJ A;  3CP2 A;  3ZMD A;  2QQ8 A;  2CQX A;  1B9M A;  3PSF A;  3F6O A;  4CDG A;  2R5Z B;  2WBM A;  1FEX A;  4ABZ A;  1VI0 A;  3S1N J;  1NG6 A;  2R7V A;  3LA2 A;  3R4K A;  4AWX B;  5L3C A;  2UUZ A;  4S05 A;  1FMW A;  4JYK A;  1P4W A;  1T8I A;  1X2M A;  4RB1 A;  2NVU B;  4Y7N J;  1YX3 A;  1Z0X A;  1OR7 C;  3ABU A;  1MNM C;  2R93 J;  2RNJ A;  1J5Y A;  4PFP A;  4ENJ A;  1BL0 A;  4HBL A;  1HBX G;  4XKC A;  2MLK A;  2WB1 N;  2LOO A;  4BHP A;  3ZQL A;  2QSG X;  3DPL C;  3HUG B;  3J80 K;  2XRO A;  2KZG A;  2E36 A;  1IJW C;  2F5F A;  4YG2 F;  2R7F A;  2QEX I;  2IAI A;  4DBR A;  5D4R A;  2CG4 A;  1G8X A;  1PUF B;  4L9J A;  3Q3S A;  1Z3Y A;  2PFB A;  2OZ6 A;  1ZKG A;  3BR6 A;  2VXD A;  3K2Z A;  3H36 A;  3JRE A;  4CGZ A;  5C44 J;  2X6Y A;  3KPH A;  2WV0 A;  1WSU A;  2ECB A;  1OYW A;  2KJB A;  1YG2 A;  3AAF A;  1B1B A;  3LOC A;  5ILV A;  1R9T J;  2RDP A;  1E2X A;  2QQA A;  4XLC A;  2A5W A;  2WAF A;  1ONV A;  1KA8 A;  5FKO A;  5J3L A;  4R79 A;  1REP C;  3BG9 A;  1OJL A;  2MYS A;  2IA2 A;  1NK3 P;  1R23 A;  2ESH A;  2JA2 A;  4A3E J;  1EJ9 A;  5EJC A;  3WGI A;  4H0E A;  1IGN A;  1QHG A;  3FXM A;  1T2K A;  3W6K B;  3KZZ A;  5AIP A;  1MBG A;  4UUS A;  5FLV A;  3E0J B;  4HW0 A;  4I2O A;  5CLS A;  5EEG A;  1C0W A;  2KRC A;  1BM9 A;  5DV5 A;  4ENN A;  4XR6 A;  3ZQC A;  3MQ0 A;  4NC7 A;  5FO5 A;  2YR2 A;  4BXX J;  2XGC A;  3CCQ I;  1SD5 A;  5K5O A;  5JHF A;  1MMD A;  4HV6 A;  1FY7 A;  4CA0 A;  2WAQ N;  3TO7 A;  4F7Z A;  1YI2 I;  5B5E C;  2L7Z A;  4OMZ A;  3CME I;  1LFU P;  1HKT A;  4Q4Z F;  4Q5S F;  2VBW A;  2VQL A;  5LEK A;  3S17 J;  3KZY A;  3J7A Y;  3BRO A;  3DWL E;  2EBI A;  2IVM A;  3BG3 A;  5L3D A;  1MNE A;  1ITY A;  3GTQ J;  2ZXW H;  3P7N A;  3W3C A;  3PUF A;  3ZGK A;  2XUB A;  2F5C A;  3A4C A;  4G6Q A;  2HNH A;  4PJN A;  2PJR B;  3K9T A;  5TGT A;  3S3M A;  3VB2 A;  5E8I A;  3ZPL A;  3R0A A;  1XD7 A;  4XOP A;  4EGZ A;  1O7F A;  3Q0W A;  1WCM J;  4P5O A;  3FWE A;  4CZZ A;  1XTA A;  4YIF A;  4C30 A;  4NHJ A;  2VOO A;  4BAY A;  1WH5 A;  2XKO A;  1BI2 A;  4FE7 A;  1QZE A;  1UB9 A;  3R60 A;  3SFI A;  5EDN A;  3BZC A;  4BE1 A;  1LQ1 A;  3RKY A;  4MEY F;  3WTY C;  5M3F J;  2VUM J;  3TDU C;  2A6T A;  4IOC F;  3PQJ A;  4IHS A;  5A2Q Z;  2MH9 A;  3SXY A;  3KYD B;  3L09 A;  3CDI A;  2BXZ A;  1TQP A;  2EIL H;  1ETK A;  3AL0 B;  3O8G A;  2BXY A;  1LDD A;  4A93 J;  3CLO A;  2WAD A;  2KPM A;  4KIC A;  3CUO A;  5ICE A;  5K7F A;  4XMY A;  5E1Z B;  3BTC A;  1OQY A;  4LG0 B;  5H6R A;  3HIF A;  2CYY A;  2LVS A;  3WTV C;  1HXD A;  2VOP A;  4I7H A;  1G4D A;  1XGN A;  2L3D A;  4WX9 A;  4UB6 C;  1R1V A;  3RIR A;  3RI4 A;  2EQR A;  5LRR A;  1TT5 B;  3HTS B;  3GX4 X;  3SFZ A;  3HOT A;  1U8R A;  2XAG A;  2Y30 A;  2HYG D;  4ZC3 A;  3OR2 C;  1RZ4 A;  3LWF A;  4BBS J;  4O3M A;  3JRI A;  2EZH A;  2M3A A;  1ZYR F;  3GZN B;  3NRV A;  3FK6 A;  5EZG A;  2GXB A;  3FMS A;  2DAO A;  3D0S A;  1K6O A;  2M34 A;  3OYH A;  3FZV A;  4XQF A;  5FGM A;  2KRF A;  2M2E A;  2XPV A;  1ZGJ A;  2P7V B;  3KEY A;  1H88 C;  3B6A A;  2DT7 B;  2BY1 A;  2H27 A;  4NQW B;  3OYN A;  1B9N A;  2FNP A;  1B72 A;  2WV1 A;  2R5Y B;  1TC3 C;  2ZJR F;  2DI3 A;  1VQK I;  3FMQ A;  4PSX A;  5EEA A;  2V1N A;  3E3V A;  3GME A;  4XLH A;  2JRM A;  4F55 A;  2J5O A;  5F0H A;  2AO9 A;  4I09 A;  2EV0 A;  4ETS A;  4PJL A;  5ERI A;  2RNG A;  1SAX A;  4RAG A;  4WCG A;  1F9N A;  3QU6 A;  4RGX A;  3V8J A;  4DNC A;  4E7K A;  4HF1 A;  4NC6 A;  2I8D A;  2JT1 A;  3OYF A;  2DOA A;  1S6L A;  4RLF A;  1T39 A;  1KU2 A;  1XMA A;  2EB7 A;  3G71 I;  4A69 C;  5FLX K;  1F36 A;  2MG4 A;  3HGG A;  4PJM A;  4IL6 C;  1Z3X A;  4X6A J;  2M4K A;  1BR2 A;  3KE2 A;  2DYS H;  1P4X A;  2KJC A;  3ZQF A;  2VKD A;  4ENK A;  4ITV A;  2R7S A;  2XAU A;  4JK1 X;  1RR7 A;  2R7D A;  2QSF X;  1W5S A;  2DPU A;  2YX4 A;  5HDK A;  2JQ7 A;  3K4N A;  4ESJ A;  3SZG A;  3KYC B;  3D5S C;  4Q48 A;  2K9M A;  3HM5 A;  4GYI A;  4BXF A;  4S0H B;  2F5D A;  2H8W A;  4BKX A;  2VI6 A;  3ZMT A;  2EZK A;  1WQ2 A;  1LE8 B;  3ULQ B;  3KCC A;  4XRS A;  1W7P D;  4B8X A;  4I02 A;  3IRR A;  1MJA A;  2O9L A;  3IUO A;  4B47 A;  1AKH A;  5E79 C;  2LG4 A;  3IP4 B;  2ZME B;  3JRC A;  3RJP A;  5LGN A;  1W5T A;  1XN7 A;  5J1Y A;  2W85 A;  3LMM A;  3M1C A;  3Q5F A;  2L0K A;  1I1S A;  5D5X B;  1MSF C;  2JSC A;  4ZYH A;  2WB1 A;  5EG0 A;  3M7G A;  3O8H A;  3FXU A;  4P9F A;  1YFH A;  4MTE A;  1PDN C;  5FKN A;  4EGY A;  3BCB A;  2LFB A;  2OC6 A;  2QF7 A;  2K4B A;  2DA4 A;  2FQ3 A;  3LNQ A;  3GTJ J;  1O4X A;  4EJT A;  2W57 A;  4DIQ A;  2NVX J;  2L9S A;  3MVP A;  3E5Q A;  2CMP A;  3ERE D;  3H35 A;  3WG7 H;  4OAY A;  4XOR A;  3Q9V A;  2L9R A;  2DA3 A;  5F0C A;  5M3M J;  4BHC A;  2LK2 A;  2VQC A;  1FPQ A;  4BQA A;  1ODD A;  1N78 A;  3S32 A;  5DS9 A;  3GLL A;  3BC8 A;  1UCR A;  2MC4 A;  2ZXJ A;  3P9I A;  5DD4 A;  5ICC A;  2OD5 A;  2JMW A;  5IPA A;  4CCM A;  1DP3 A;  3QOP A;  2HXI A;  4ZYA A;  5HOO A;  1BW6 A;  2P0W A;  3I59 B;  5E3O A;  2HDD A;  5CPR B;  2CWE A;  2B9S A;  3KX2 A;  2X51 A;  4HOB A;  4UV8 A;  4BE2 A;  1OCZ H;  4ZJZ A;  4L5J A;  1HOM A;  1D1C A;  1TWC J;  2QQ9 A;  5D4S A;  4UNO A;  1MH3 A;  2X85 A;  4IHX A;  1T6S A;  1T08 B;  1Y6I A;  4KYW A;  3PJR A;  2X6W A;  5E18 F;  3I4P A;  2KQR A;  2UZK A;  3EUH C;  3S14 J;  2ZME C;  1TP4 A;  1MH4 A;  5EYR A;  3ZMZ A;  4F91 B;  3F0C A;  1OR7 A;  3ZP5 A;  4UB8 C;  3IWZ A;  2XAJ A;  1FP1 D;  2NOG A;  2J5P A;  3GZ6 A;  1A35 A;  1EH6 A;  5J40 A;  3HOZ J;  2MD0 A;  3CTA A;  2EIJ H;  4GGG A;  1R7J A;  5DEQ A;  5JLX A;  3FBI B;  1E0E A;  1FBQ A;  3DTI A;  2VN2 A;  3ZXS A;  1DP7 P;  3GFM A;  2ZSI B;  3JTH A;  4EM0 B;  2W7N A;  3TP3 A;  3MKZ A;  3W2V A;  4I76 A;  4BYY A;  5E20 A;  4BS9 A;  1JJ8 C;  2QGU A;  2HDC A;  1EKE A;  3DU6 A;  4AIJ A;  2LRE A;  2GBY A;  3JSO A;  3K4B A;  4EJW A;  1UG0 A;  1U0J A;  3EUK L;  1FYM A;  2HGC A;  2HQR A;  5HS9 A;  1K4S A;  3TP0 A;  5E3M A;  3JW4 A;  2FF4 A;  1QVU A;  1YYV A;  2DBB A;  1SMY F;  2E35 A;  2FEZ A;  2KT0 A;  1O3Q A;  2ME0 A;  4DOZ A;  1B8I B;  4JQF A;  4MTD A;  2K27 A;  3COA C;  2E7W A;  4FE4 A;  4D1Q A;  5J1U A;  4I99 C;  1HW5 A;  4BDY A;  4WK8 F;  4E7J A;  4OAZ A;  2YSR A;  2OV7 A;  2I5U A;  2H1K A;  2KP6 A;  2GIZ A;  2WAE A;  3A0B C;  2K3F A;  4CXF A;  2R7X A;  3E7L A;  1PUF A;  3B73 A;  1BI0 A;  4DYR A;  2IXS A;  1WKM A;  2Y9Y A;  1X1D A;  4C2M J;  1SAN A;  4FT8 A;  1EH7 A;  2Q2E A;  3U9G A;  4A0X A;  1TT0 A;  1MKM A;  1ZGA A;  1OYY A;  4ZTF A;  1ZAR A;  4RAY A;  4ESF A;  4U88 A;  3CMY A;  1FZP B;  2IS2 A;  1IN6 A;  2OU2 A;  2W84 A;  1W5C C;  5IYB J;  3WTX C;  1Z7U A;  1S7A A;  1KGS A;  5ICF A;  4V2F A;  2KHM A;  4XKV A;  4HPQ A;  1XPX A;  1FIP A;  1TLH B;  1MIJ A;  1JHH A;  1VF9 A;  2V1D A;  3I64 A;  4C3H J;  4EJO A;  3JRG A;  3VDX A;  4HQE A;  4P9U A;  2YU3 A;  2EFQ A;  5TIS C;  3ONQ A;  4RA2 A;  2M4G A;  3KLN A;  1IUF A;  3BG6 A;  9ANT A;  1IXR C;  1BBY A;  5DM6 F;  2XGD A;  1YTY A;  1Q1V A;  1HC8 A;  3NAU A;  3HB9 A;  1LVK A;  1O7L A;  1ZH5 A;  2M30 A;  2H09 A;  2VB6 A;  4N0B A;  3FF5 A;  3CF5 F;  5IP6 A;  1WJB A;  1ZEL A;  2E71 A;  3GWZ A;  1IN8 A;  2XRL A;  1VQ5 I;  1ZR4 A;  2LKP A;  4JX6 A;  3ABK H;  2GAU A;  1PJR A;  2OCC H;  4HX4 A;  1I5Z A;  3QOD A;  3WGG A;  4C3I J;  3RZD J;  4L9V A;  3H92 A;  1CF7 A;  3IH2 A;  4XKB A;  2FOW A;  1ZGW A;  3I0T A;  5F0F A;  1OCC H;  2Z3Y A;  3REO A;  2GXG A;  5F1J A;  5TRD A;  2JA6 J;  1U5T B;  2E5N A;  1X1P A;  4AVZ A;  1ETO A;  3VPR A;  2QSH X;  4A3C J;  4G94 A;  4HF0 A;  3CCJ I;  2TCT A;  4HNV A;  1TWA J;  1KU3 A;  2AXL A;  1ORK A;  3H0D A;  4OIR F;  1S9H A;  5LLQ A;  1YW8 A;  4LK1 F;  3CDL A;  1TTY A;  2FNA A;  3ZR8 X;  4XM3 A;  3H5N A;  2FA5 A;  4M6Y A;  3CCU I;  2NS8 A;  4E4H A;  1GHC A;  3BP8 A;  1U9N A;  1MZB A;  2H94 A;  2Y48 A;  5K5Q A;  3WOD F;  2DJN A;  4OU0 A;  3C2H A;  3OIO A;  2DW4 A;  3R61 A;  1ZHF A;  4EJV A;  1V5G A;  4PJJ A;  1ETW A;  3OL3 A;  4CIC A;  2WY7 Q;  2RV8 A;  1VQ4 I;  3VWB A;  3C7J A;  2HPI A;  2IEK A;  3OWT A;  5IYC J;  1LFP A;  2ZXH A;  1Z77 A;  3RKW A;  2ID6 A;  3DBH B;  2EIK H;  3FXJ A;  3LST A;  2MGQ A;  2PX9 A;  2VKV A;  2CQ7 A;  3EDP A;  2P7C B;  2R7O A;  2DDA A;  2B0L A;  1GXQ A;  3HRT A;  2BGC A;  4A3M J;  3I4N J;  2KIM A;  5B1A H;  5LD2 C;  2BHZ A;  5EF6 A;  3WHC A;  2H6B A;  3OYB A;  2VXZ A;  5BOX A;  2BW3 A;  4S04 A;  4R8H A;  1K4T A;  3LAJ A;  1F5T A;  3P5J A;  3VSL A;  1MDM B;  2E60 A;  1A36 A;  3DEW A;  3DFG A;  3ELK A;  3PNV A;  4L0Z B;  1IUY A;  4P1W A;  1R1T A;  3OOP A;  3BTJ A;  3T5X A;  2VJ4 A;  4HA8 A;  2LD5 A;  1L3L A;  5HDN A;  4KT5 C;  4LG0 A;  3PO3 J;  3OS1 A;  4FTH A;  4CYD A;  1UFM A;  5J8C A;  1FNN A;  4CCN A;  4PJ0 C;  5HS8 A;  2HVS A;  2BY2 A;  1RNL A;  1AWC A;  4IRG A;  1B72 B;  3JRH A;  4A3K J;  2CJJ A;  3RYP A;  2DA7 A;  1N75 A;  3MD2 A;  1T0F C;  4YFK F;  3TBI A;  2CGP A;  2FBI A;  4KMU X;  2W82 A;  2EV6 A;  4G6D A;  5CKT A;  2H1L A;  3DF8 A;  1I6H J;  5J4Y A;  3I4M J;  3WE2 A;  3PM1 A;  2KDO A;  3G2B A;  3HXL A;  1FT9 A;  1IDZ A;  4CCJ A;  2VT3 A;  2L4M A;  2P5K A;  3GTK J;  1OPC A;  4IRI A;  2XDV A;  1MBJ A;  1W7P B;  1XS9 A;  3K1M A;  2OJE D;  1JKQ C;  2H6C A;  4DYC A;  1Y1V J;  5FRO A;  2X48 A;  1QNT A;  4PFO A;  4M72 A;  4Z2Y A;  4IXA A;  2BVL A;  1VQ9 I;  1KU7 A;  3VFZ A;  3RSN A;  4N9H A;  4AYB N;  2RGV A;  1BC7 C;  2OQR A;  3MN2 A;  2TRT A;  2DMU A;  1H8A C;  3OY9 A;  1LEA A;  3B02 A;  3MKW B;  2PMZ A;  2ZSH B;  1LEB A;  4OIP F;  3RZO J;  4LLN A;  4UVC A;  2QUF A;  1R5I D;  3Q0V A;  4BAC A;  1IXC A;  1SVO A;  2DPD A;  2IS6 A;  3CUQ B;  3CUQ A;  1SEU A;  1HCR A;  2G7U A;  4B4C A;  2RN7 A;  3HPH A;  3LSG A;  1H9G A;  3W6J B;  1YJW I;  5LGT A;  2NS0 A;  4ZYG A;  1GDT A;  2MAB A;  2JPB A;  2R7W A;  3I58 A;  3GZ5 A;  1MGT A;  4UV9 A;  3EUA A;  4BEH B;  3DTE A;  5HLH A;  4M3E A;  3WU2 C;  2HOS A;  3PNT A;  2XHK A;  3IWF A;  1CF7 B;  3WU0 A;  2PMH A;  1MSE C;  3F21 A;  4G12 A;  1XGM A;  3A01 A;  1FYK A;  3C18 A;  1J75 A;  1IRG A;  3CO7 C;  4CHU A;  1WFX A;  4UXN A;  3OSF A;  1XSV A;  1XCV A;  2DCE A;  4G8X A;  4DZP A;  2DDB A;  2ACJ A;  1DDN A;  2JSP A;  3OR1 C;  4A3J J;  2K4J A;  2CU7 A;  3PSI A;  1WJ5 A;  3S1M J;  4V19 K;  2F4M B;  4CSW A;  1YIO A;  4M3D A;  1NH3 A;  4WXH A;  1I27 A;  2XF7 A;  5EGO B;  2D45 A;  1QHH D;  2B7E A;  2XAQ A;  1JJ6 C;  2HOE A;  4ZYE A;  4ZTJ A;  4KIG A;  3HPG A;  1TQM A;  3SZT A;  1VQ8 I;  2IGM A;  3E5X A;  5M5W J;  3I59 A;  1R4M B;  3S2D J;  3OS0 A;  4MNU A;  4M6X A;  2QA4 I;  1JKO C;  4A3D J;  1YLF A;  1E3O C;  1U6G A;  3OL4 A;  4HV5 A;  2HYF A;  3U2R A;  4XLA A;  4P96 A;  5EZH A;  2VQH A;  2CV2 A;  3G1M A;  5B1B H;  3HKZ N;  1ZTR A;  2CQK A;  3GTM J;  4TV7 A;  1QPM A;  3PUB A;  3L2V A;  5HS7 A;  1Y0U A;  4EV0 A;  1GXP A;  1MMS A;  2L2O A;  3A1Y A;  1K78 B;  2YPR A;  2DK8 A;  1G6N A;  2HEO A;  3CJN A;  1MMA A;  1V55 H;  3ZRG A;  4RM2 A;  2HZT A;  3K1P A;  3PFY A;  1JT0 A;  5HVQ C;  2EFW A;  4RB3 C;  3G4S I;  4U7B A;  3ZMV A;  2QLZ A;  1YRN B;  1QGP A;  2EWN A;  2R7R A;  3HZJ A;  2VKE A;  1TNT A;  1ZLJ A;  1E3P A;  1X3Z B;  3BTL A;  3DBL B;  1JKP C;  2N8G A;  3IV5 A;  3SJM A;  4XLN F;  1N77 A;  3M4O J;  3F9K A;  2M87 A;  5H2F C;  4KN4 X;  2NOJ B;  2GZW A;  4CYC B;  3IKT A;  4A0Y A;  2JUC A;  2UV1 A;  2MH2 A;  1GV2 A;  2L4A A;  5LRS A;  3H3Z A;  5KHD A;  2CFX A;  2KIU A;  2GA1 A;  4M6V A;  2LF7 A;  3K2A A;  4WXD A;  2EFO A;  2FRH A;  5KAF C;  1Z05 A;  1RKT A;  4M3F A;  1VQ6 I;  1A6I A;  4GYG A;  3DV8 A;  1WVR A;  1X4P A;  1G59 A;  1HW2 A;  5EEH A;  2IGK A;  2STT A;  5HNH A;  1YRN A;  2ME6 A;  4YIR X;  1MDM A;  4KFC A;  2K85 A;  1T95 A;  2KLO A;  4PDK A;  5JLW A;  3CO6 C;  1QRY A;  1WWX A;  1D8J A;  2QCO A;  2Q0O A;  2LDU A;  2ZJP F;  3FMR A;  3I55 I;  1W0T A;  4DW6 A;  5BS6 A;  1JHF A;  5DCF A;  3HRM A;  2XF6 A;  3ZN1 A;  2Y0M A;  1SFX A;  3MEX A;  1H89 C;  2ZFU A;  1QVT A;  2Z9O A;  3FK7 A;  3RDI A;  2X1C A;  1UHW A;  2DOF A;  2VE9 A;  1SFU A;  3FX3 A;  3VOD A;  2QYO A;  1T56 A;  1AOY A;  4UUT A;  2BE5 F;  4DBQ A;  1XGO A;  3AFH A;  2E1O A;  1X4O A;  4LIU A;  3HL2 A;  2QKM B;  4AUX A;  1RUO A;  2ZXI A;  3QWL A;  3KP2 A;  4ZDP A;  1YJN I;  2V9P A;  4U0Y A;  1ZQ3 P;  3MFK A;  4D9J A;  5C4X J;  2WWY A;  2BZT A;  1MBK A;  5E1X A;  2JUG A;  4HDV A;  2ZB9 A;  3TW6 A;  5JVT A;  2Z1D A;  3CJT B;  2K9N A;  2OQG A;  3DCF A;  1K7A A;  1WJC A;  3MKY B;  1QPI A;  3J81 K;  1HDD C;  3MKL A;  4P55 A;  1B59 A;  2I10 A;  3WTW C;  4O5V A;  1ZRF A;  2VC1 A;  2LYC A;  1Q1H A;  5E3N A;  1Z1D A;  1P7I A;  3GUD A;  1SC7 A;  3ERM A;  3GW2 A;  4MIM A;  4M73 A;  2AQF A;  1T38 A;  4NC8 A;  2ZO4 A;  1VQM I;  2HKO A;  2VJJ A;  5H6Q A;  2QQB A;  2HR3 A;  4BE0 A;  2B63 J;  3L1P A;  2VKH A;  2MC3 A;  2X1D A;  4B48 A;  3BPV A;  2NNY A;  3F72 A;  4M3B A;  3PIO F;  3ABT A;  5K7H A;  5FD6 A;  1OCT C;  3F22 A;  1UZC A;  1XSD A;  2GQQ A;  3FXR A;  2BBY A;  1ETX A;  4RGR A;  2DFH A;  1V4R A;  1IZ1 A;  4XLP F;  2FQ4 A;  2DJI A;  2O3F A;  4LB5 A;  3M9A A;  3J7Y J;  4J19 A;  4XBF A;  3ZOB A;  1YE9 A;  2XKP A;  4PSW A;  5DTD A;  4GCV A;  2V26 A;  2GXA A;  2P5V A;  4XLF A;  4YEJ A;  2PMZ N;  2KZV A;  1MD0 A;  4PUS A;  5L3G A;  1Z9C A;  1STZ A;  2MFZ A;  3HDD A;  5CVJ A;  1P6R A;  3GTG J;  3S2H J;  2XF5 A;  3JAM Z;  1S7E A;  2MSY A;  4JX5 A;  4Y4R A;  3CCV I;  2W4S A;  3IH3 A;  4XL9 A;  4HYE A;  2W24 A;  4RGS A;  5CVU A;  1X58 A;  2ELJ A;  2PJR A;  1AU7 A;  3FHZ A;  2WTE A;  3HRS A;  3KP7 A;  4UHT A;  2E7X A;  5FB2 A;  4KT6 A;  4UUV A;  2GA2 A;  2Q1Z B;  3ECO A;  3UR3 C;  2KFD A;  3SQN A;  4BQO A;  5D8K B;  3ZCO A;  2M8G X;  4I6Z A;  3G73 A;  3NEU A;  1ZG5 A;  3MZ8 A;  4OMY A;  1FBS A;  2CUF A;  2DFE A;  2EA4 A;  1FTT A;  2QZ8 A;  2E1C A;  2V9K A;  2HQA A;  2LKS A;  4HLX A;  2V7F A;  5LHG A;  1V5E A;  1SD7 A;  2VQG A;  1IN4 A;  3KYL A;  1WZ2 A;  2O7O A;  2VJI A;  4A3I J;  2ISZ A;  1HKS A;  4LB6 B;  2DU9 A;  2V6C A;  4J01 A;  2FML A;  4RAF A;  1OMI A;  2GWR A;  4XID A;  2PMU A;  4A3L J;  4IQJ A;  3I53 A;  3OOU A;  2X0L A;  1XDU A;  2CRG A;  4U7D A;  2Y2Z A;  2Z5U A;  2DK5 A;  1WRJ A;  3HBL A;  5CYV A;  5LHH A;  4CUG A;  1MBH A;  3C2B A;  3K1N A;  5J4V A;  2HVR A;  3QYF A;  1FBU A;  2PQ8 A;  5CVR A;  3E97 A;  3K7A J;  1DPU A;  2AHQ A;  1YS7 A;  3KEQ A;  1YIJ I;  3I5U A;  2KMU A;  3BJ6 A;  3GBG A;  3TQN A;  3N05 A;  2K9L A;  4BL0 B;  3HEF A;  1JTY A;  3HOX J;  3L7W A;  2ETH A;  2ZJQ F;  1FTZ A;  1PP7 U;  3H5A A;  1K61 A;  2LRD A;  1X19 A;  1MMG A;  2IA1 A;  2HKX A;  3G6E I;  5GAE J;  1POG A;  2DFF A;  3DU5 A;  4II2 A;  2VBX A;  3KLO A;  3LQQ A;  4XRS G;  3HKZ A;  3QOE A;  3TDZ C;  2ZCW A;  5KK1 A;  4NQW A;  2E2J J;  1XGS A;  2Q2E B;  2NRA C;  5C4J J;  2R7Z J;  3VEP A;  2JTV A;  4BQQ A;  1KQ9 A;  4Y52 J;  2F5V A;  1B4A A;  3ZMS A;  3HRU A;  2VC0 A;  4NBQ A;  2F2E A;  5E17 F;  4XK4 A;  3NAR A;  3UKG A;  1DGR M;  2UWM A;  2VOD A;  1WHU A;  4BY7 J;  2FJ1 A;  1OKR A;  2FSW A;  1QA6 A;  1RUN A;  4ZZL A;  4XSX F;  3SDG A;  1T98 A;  3S1Q J;  2Z99 A;  2XPU A;  3LL7 A;  3KP3 A;  4KIS A;  5FFX A;  3WTT C;  4DJA A;  4M9Z A;  4MO7 A;  2FMY A;  2A6H F;  2BV6 A;  3MAJ A;  1XCB A;  3O6B B;  2IT0 A;  3BZK A;  3BR0 A;  4PZJ A;  2V9V A;  3WTU C;  5L3E A;  3A2K A;  3W2A A;  3EYI A;  5FLM J;  3E6D A;  4XRM A;  3J81 Z;  2MBF A;  3W6V A;  1PYV A;  3RQ4 A;  3SEQ A;  1FIA A;  2QM3 A;  4NNJ A;  1TL8 A;  3MZY A;  4NB5 A;  2QEN A;  2CFO A;  2DFI A;  4HF2 A;  2P8T A;  1ZAO A;  2E34 A;  2AS5 F;  1NK2 P;  1D8K A;  2KIQ A;  4BJ5 C;  2JWT A;  3DKY A;  5JVG F;  5DDG A;  2O61 A;  5IOZ A;  3CJR B;  1AHD P;  1XMK A;  5J47 A;  4HEA 2;  2OA4 A;  3N4M A;  3TW7 A;  1EV7 A;  2ZME A;  5DM7 F;  5BQT A;  4UY8 I;  2F48 A;  1FOK A;  4JBA A;  2EZL A;  2XC7 A;  3BR5 A;  4E7L A;  2CO5 A;  1VQ7 I;  2VLA A;  2K86 A;  3OYG A;  5L3B A;  3BPX A;  3MCZ A;  4L5I A;  4AVP A;  4D7N A; 
#chains in the Genus database with same CATH homology
 1B72 B;  3JRH A;  4A3K J;  2CJJ A;  2DA7 A;  2L7Z A;  1LFU P;  2ID3 A;  3S17 J;  3B6C A;  4FCY A;  1BJZ A;  2EBI A;  1UMQ A;  3BG3 A;  2DMT A;  1I6H J;  4BBR J;  3I4M J;  3A01 B;  3PM1 A;  1ITY A;  4MFD A;  3GTQ J;  1IDZ A;  4IHV A;  3GTK J;  2K9Q A;  3H3V K;  1EF4 A;  4V2G A;  1MBF A;  3BQZ A;  1MBJ A;  1XS9 A;  3Q0W A;  1WCM J;  1JKQ C;  1K83 J;  1WH5 A;  3FIW A;  4FE7 A;  1T33 A;  1Y1V J;  3SFI A;  4DYC A;  5EDN A;  2DTZ A;  2X48 A;  2R5Y A;  5M3F J;  1BA5 A;  3H0G J;  2VUM J;  1WI3 A;  4AYB N;  2E2H J;  2G0E A;  3JRB A;  3BT9 A;  3MN2 A;  3OSG A;  2TRT A;  2DMU A;  1H8A C;  3HOW J;  4A3B J;  1ETK A;  3O8G A;  1X2N A;  1HLV A;  2YU9 J;  3RZO J;  4A93 J;  3Q0V A;  4MFE A;  2M9H A;  1A5J A;  5K7F A;  3ZQH A;  1HCR A;  3BTC A;  4B4C A;  1JTX A;  3LSG A;  2LVS A;  1GDT A;  2GM4 A;  2L7F P;  5F08 A;  2EQR A;  4L5E A;  3S16 J;  2NVQ J;  2HOS A;  4M3E A;  2NVY J;  4B3A A;  4IEJ A;  1B8I A;  2Y30 A;  4DYQ A;  1MSE C;  2JA8 J;  4BBS J;  4G12 A;  3A01 A;  2DA1 A;  3JRI A;  1IRZ A;  2EZH A;  3RQI A;  1IC8 A;  3FK6 A;  3OSF A;  5EZG A;  3S15 J;  1OCP A;  4DZP A;  5BNG A;  2M34 A;  1LE8 A;  2P81 A;  2M2E A;  2FX0 A;  2XPV A;  2EZI A;  1TWH J;  2CUE A;  4A3J J;  3HOV J;  4DZJ A;  2CU7 A;  1H88 C;  3B6A A;  3S1M J;  2CQQ A;  4M3D A;  3GTO J;  1B72 A;  2WV1 A;  5EGO B;  2R5Y B;  1TC3 C;  5EEA A;  5GPC A;  1JJ6 C;  1ENH A;  3BR3 A;  2HOT A;  5F0H A;  2AO9 A;  1I3Q J;  5M5W J;  3S2D J;  3BTI A;  3JR9 A;  1JKO C;  2JJ7 A;  4A3D J;  1E3O C;  4W1U A;  3G1O A;  2LY9 A;  5EZH A;  1ETV A;  3G1M A;  1TWG J;  3HKZ N;  1ZTR A;  4A69 C;  5FKL A;  3GTM J;  1F36 A;  4B1R A;  5C3E J;  2KDZ A;  2MG4 A;  3HGG A;  4JX4 A;  1RKW A;  5IYD J;  4X6A J;  1VND A;  2YUS A;  3ZQF A;  1JUP A;  1LFB A;  3BG5 A;  1RR7 A;  1GV5 A;  2X9D A;  4EEF G;  2XPW A;  1JT0 A;  1YRN B;  2K40 A;  2NVT J;  3GTP J;  1UG2 A;  2Y9Z A;  2VKE A;  4IHY A;  3HM5 A;  3JRA A;  1WGX A;  4S0H B;  4BKX A;  2VI6 A;  3BTL A;  1RET A;  4RBO A;  3PO2 J;  3S1R J;  2N8G A;  3BR2 A;  4C3J J;  3IV5 A;  3D1N I;  1JKP C;  4GFB A;  2EZK A;  3SJM A;  3M4O J;  1LE8 B;  4D5C A;  4XRS A;  4CYC B;  3QPS A;  1WH7 A;  2O9L A;  2LLK A;  1GV2 A;  1AKH A;  3G1L A;  3CQZ J;  1HF0 A;  4M6V A;  2NS7 A;  3JRC A;  3K2A A;  1GT0 C;  1RKT A;  5J1Y A;  4A3F J;  2XGE A;  4M3F A;  2L0K A;  3FIS A;  2DMQ A;  1A6I A;  4BY1 J;  1YRN A;  1MSF C;  2ME6 A;  4MLO A;  5EG0 A;  3O8H A;  1JUM A;  2ELK A;  5JLW A;  3IH4 A;  1QRY A;  2XB0 X;  5FKN A;  2QCO A;  2LFB A;  2HI3 A;  2GLO A;  2QF7 A;  1FJL A;  2DA4 A;  3LNQ A;  3GTJ J;  1W0T A;  2Y0S N;  4DW6 A;  1O4X A;  4IHW A;  2NVX J;  3MVP A;  3GTL J;  2MW8 A;  1NTC A;  1ETY A;  1H89 C;  1QVT A;  2RAE A;  2K9S A;  2XB5 A;  3FK7 A;  2L9R A;  4A3G J;  3BQY A;  3RKQ A;  2D5V A;  1T56 A;  2DA3 A;  5F0C A;  1JKR C;  2HQ5 A;  4UUT A;  5M3M J;  3TED A;  2LK2 A;  5DS9 A;  1SFO J;  2E1O A;  1IDY A;  1Y1W J;  4AUX A;  2JMW A;  5IPA A;  2HXI A;  2HYJ A;  1ZQ3 P;  1BW6 A;  1U78 A;  5C4X J;  5E3O A;  2HDD A;  5F27 A;  1MBK A;  2JA7 J;  2HOA A;  2ZB9 A;  3TW6 A;  2K9N A;  3DCF A;  1HDD C;  1DU0 A;  1QPI A;  3MKL A;  1JGG A;  1HOM A;  1TWC J;  2I10 A;  4AC0 A;  1MH3 A;  4IHX A;  2JK3 A;  1ZK8 A;  3HOU J;  2O8K A;  5E3N A;  1GUU A;  3S14 J;  1P7I A;  2X6O A;  3QQA A;  1MH4 A;  5EYR A;  4MIM A;  3F0C A;  1IG7 A;  2R0Q C;  2NOG A;  1P7J A;  4FIS A;  5K7Z A;  1W0U A;  3A02 A;  3HOZ J;  1DU6 A;  2B63 J;  3L1P A;  1MBE A;  5JLX A;  2DA5 A;  4M3B A;  3JRD A;  1HDP A;  1APL C;  5K7H A;  1OCT C;  5GP9 A;  1JUS A;  3TP3 A;  1ETX A;  2YS9 A;  4I76 A;  4QIW N;  4UUS B;  4W97 A;  2FQ4 A;  2R92 J;  1JT6 A;  2LKX A;  1JJ8 C;  4J19 A;  3M3Y J;  1AKH B;  3ZOB A;  2GBY A;  1D5Y A;  5DTD A;  2EH3 A;  2OF7 A;  3BR1 A;  5IOY A;  5GPA A;  5F04 A;  2PMZ N;  2DN0 A;  5IP7 J;  5E3L A;  2LR8 A;  3TP0 A;  2L7M P;  5E3M A;  3HDD A;  3GTG J;  1QVU A;  2KT0 A;  3S2H J;  2ME0 A;  2XSD C;  1S7E A;  2MSY A;  1B8I B;  1I50 J;  1XG1 A;  4JX5 A;  2E19 A;  4FE4 A;  1OFC X;  3IH3 A;  5J1U A;  2JA5 J;  4QSH A;  2H8R A;  5FKK A;  1X58 A;  2DA6 A;  1AU7 A;  2H1K A;  4XIC A;  3E7L A;  1PUF A;  4DYR A;  2Y31 A;  2R5Z A;  2Y9Y A;  4C2M J;  1RES A;  1SAN A;  2M8G X;  4I6Z A;  2CUF A;  5EGO A;  1FTT A;  2HXO A;  3CMY A;  5FKM A;  5IYB J;  2O7O A;  4NDL A;  4A3I J;  3FKI J;  4V2F A;  2DA2 A;  4D7M A;  1FIP A;  4XID A;  1VF9 A;  4C3H J;  4A3L J;  3JRG A;  3OOU A;  2CRG A;  1CQT A;  1F43 A;  1UHS A;  2Y2Z A;  3HBL A;  1GVD A;  1TWF J;  1MBH A;  3C2B A;  1ZR2 A;  1IUF A;  9ANT A;  2VPR A;  4CYC A;  2XGD A;  2JN6 A;  1Q1V A;  1XC5 A;  3K7A J;  3NAU A;  3HB9 A;  3WHB A;  2AHQ A;  4JP0 A;  4RDU A;  3LSR A;  5IP6 A;  2DMP A;  3LSP A;  2XRL A;  3GBG A;  1RPW A;  1ETQ A;  1ZR4 A;  4JX6 A;  2DMN A;  2W48 A;  3HEF A;  1JTY A;  3HOX J;  1VFC A;  5IP9 J;  1FTZ A;  3A03 A;  4C3I J;  3RZD J;  2FD5 A;  1K61 A;  5J1R A;  5HOD A;  3IH2 A;  1BW5 A;  1ZGW A;  5F0F A;  1POG A;  3ZQG A;  2CQX A;  5F1J A;  2JA6 J;  4XRS G;  1ETO A;  3VPR A;  2R5Z B;  2E2I J;  4X1E A;  1FEX A;  4A3C J;  2E2J J;  4ABZ A;  2TCT A;  1VI0 A;  3S1N J;  4HNV A;  5C4J J;  2R7Z J;  1TWA J;  2LTP A;  1ORK A;  4JYK A;  3CDL A;  4Y52 J;  1X2M A;  4Y7N J;  1Z0X A;  2NS8 A;  4XK4 A;  3NAR A;  3UKG A;  1MNM C;  1U9N A;  2R93 J;  5FJ8 J;  3HGY A;  4BY7 J;  1BL0 A;  2FJ1 A;  2DJN A;  2WB1 N;  4QTR A;  3ZQL A;  3OIO A;  2LP0 A;  1WPK A;  3SDG A;  1IJW C;  3S1Q J;  2XPU A;  3HOY J;  1ETW A;  3LSJ A;  1IV6 A;  2IAI A;  1PUF B;  3Q3S A;  4MO7 A;  2IEK A;  1ZKG A;  3BR6 A;  5IYC J;  3JRE A;  5C44 J;  1Z77 A;  2ID6 A;  3BR0 A;  1G2H A;  2MGQ A;  2VKV A;  2ECB A;  5FLM J;  3QPL A;  1R9T J;  3LOC A;  4XRM A;  1U9O A;  5M5Y J;  3W6V A;  2ECC A;  3ZQI A;  4A3M J;  3I4N J;  1FIA A;  2COB A;  1U8B A;  5FKO A;  5J3L A;  5EF6 A;  3BG9 A;  3WHC A;  1OJL A;  1NK3 P;  4A3E J;  4M3G A;  3Q0U A;  1NK2 P;  1IGN A;  2JWT A;  3DEW A;  1MBG A;  5IOZ A;  4UUS A;  1AHD P;  5FLV A;  4D5F A;  3BTJ A;  3TW7 A;  3ZQC A;  2LD5 A;  3CCY A;  4BXX J;  2XGC A;  2IBD A;  5M5X J;  2EZL A;  3PO3 J;  4FTH A;  3BR5 A;  2OPT A;  4LOC A;  3JRF A;  2M0C A;  2WAQ N;  5EG0 B;  4D7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...