3HOYG

Complete rna polymerase ii elongation complex vi
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoyG01
1NTGA 1IBKL 1BKBA 1R9TH 2RCNA 4JOIA 3L2PA 1PH3A 4NXML 2D0PA 4R4QA 4OO1G 3I4NH 4GOPC 1VQGA 4GNXC 4AIMA 4JI6L 4IFDG 2ATWA 2ALYB 3B6YA 4XTCS 4JBKA 3J81j 2A19A 4DV4Q 4MZ9A 3M85A 1Q81C 2E8GA 2C35B 2K52A 2WAQG 2ASBA 1T9HA 1L1OC 4IOCA 2IX1A 3KJOA 1TWGH 1WJJA 1TWCH 2KHJA 4MNOA 4KLKA 3ULLA 2QA4A 3PCOB 4A76A 1Q7YC 4LF5L 1CUKA 2PI2A 3E0EA 5M3MH 3KFUA 5BR8L 1GKHA 5JEAJ 3A5UA 4A3KH 3PO3H 2CWAA 3NBHB 4GOPB 2IY5B 1PH2A 5M5XH 5C4JH 3AEVA 4HJ8A 4BY1H 4KHPL 5IWAL 3TS2A 2UXDL 1Q86C 4Y7NH 1X3EA 1I50H 3J81i 1KAWA 2Q2TA 3PUVA 1N9WA 3M4OH 1WYDA 2NVTH 3K0XA 2PQAB 5IT9c 4JI2L 2AHOB 4P71A 1N36Q 1YHBA 2PQAA 1G51A 3NEMA 2YTVA 4KI0A 2B63H 2I5MX 1Q1EA 1PH7A 5IYCH 2GVAA 2JA5H 3FHWA 3CPFA 3W1GA 1N36L 1MJCA 3G4SA 1N34Q 1QVFA 3PF4A 2JE6I 4GOPA 5IYDH 3SGIA 5C44H 4K0KQ 1WCMG 1K3RA 2FXQA 5GROA 1IXRA 1X56A 2OQKA 3TREA 4LF5Q 3S1RH 4DV2L 3DLLA 4Y52H 4OWXB 5M5YH 1SRUA 3WWVA 3PV0A 2D62A 4WJ4A 4BBRH 4A3DH 2F3IA 3KF8B 4FDBA 3G48A 3F2DA 1Y1WG 4JI6Q 2BH2A 4BBRG 2WB1E 3HFZB 4YWLA 3J80i 2MO1A 3E9HA 4OXPA 4A3JH 3GTMH 1XPOA 3CCJA 2JA7G 2R92G 1E1TA 1JT8A 1X65A 3CC4A 3CC2A 4GLAC 4GN3B 1I5FA 4NXNL 1EWIA 1MIUA 5HY6A 3U58A 1PH9A 4NPSA 4DR3L 1IBKQ 4IPHA 2JK8A 5IYDG 2CQOA 3RZOH 4LUZA 2UUCL 4WJ3M 4P75A 3RNUA 4JV5Q 5M3FG 1PH4A 3AQQA 4X64L 4JI2Q 4DUZQ 1VQ7A 3GTJH 4IJHA 3W1BA 4X65L 3T1YQ 4IOAA 2RHSB 1PFSA 1VQBA 4BBSG 4B3MQ 2HIXA 4LF4Q 3HOUH 3CW2C 2OCEA 1YHQA 3H3VI 3K7UC 2VUMH 3AFPA 4HIDA 3FP9A 2Z6KC 5E7NA 4LFBQ 3JC66 5C0XI 4R4OA 1TXYA 3S1NH 1VQ6A 2OTLA 2ZM6Q 3EN2A 3HOYH 3HOUG 4R4CA 3CCEA 2UUAL 4BBSH 2NZOA 2LXJA 1GO3E 3NENA 1LM0A 5H1SE 3ULPA 3G6EA 3HKZE 3I2ZA 3LGJA 4OONA 4DV4L 3CD6A 3U50C 2CKZB 2LXKA 1HNZL 1HR0Q 2WB1G 3BZKA 5C3EH 4OX9L 1IBML 1HNXL 2KHIA 3EBEA 1PA6A 3FKIH 1VQLA 1OXVA 3ZJYC 2QGQA 5K36G 3OTOL 1FL0A 1A0IA 2KCTA 2GN5A 2RHQB 3KDFB 4PMWA 2JA7H 4DV3L 1XMQQ 2R92H 3BZCA 3CP0A 1YIJA 2MFIA 4DR2L 1CKOA 1S40A 2N8NA 1KC8C 1G6PA 2VQFL 1N8RC 2HHHQ 5GQOA 1QVCA 1RL2A 4A3DG 4X62L 3F1ZA 1IBMQ 1EYGA 2IX0A 4GLVB 4LF9Q 2ZTCA 3STBD 1NBWA 3AFQA 1YHAA 1K8GA 4DR6L 1PYBA 4L5RC 1OXXK 2UXCQ 3K8AA 5FLXc 2BA0A 1XNQQ 4O0AA 4A3FG 1VQ5A 1C0AA 3Q8DA 4YHHQ 3GDEA 1N33Q 4YWKA 3STBC 3I56A 3A74A 4ME3A 1UEBA 1E1OA 1UE6A 2OQ0A 4B3TQ 3ULJA 1YITA 4JI8Q 2VZAA 1XMOL 2IT1A 3S17H 3UDFA 2R7DA 1VQIA 1YJNA 1CSPA 5GAHC 2NVYH 1YI2A 2B63G 2N78A 4QJFA 4UPAA 1C9OA 4DPGA 3M3YH 1VCIA 3HOXH 1JJCB 4A3JG 1N32L 4DV6L 1XNQL 2B29A 5JJKA 4DR1Q 3CCSA 4LF6Q 4A3CG 4A93G 1OXUA 2VQFQ 4DR6Q 1L2FA 1K73C 2XGTA 4DR2Q 3S1MH 1JJGA 4LF9L 2A1AA 5IY0A 3JAMc 4DV3Q 1XMQL 1D7QA 4TQUS 2K5NA 2JA9A 3U4VA 1GM5A 1EFWA 1HZ9A 4RG1A 4C3JH 2HHHL 2JJQA 3PUWA 1W2BA 5GAGC 2NVXH 5IP9H 4IPDA 4O2DA 5GADC 4QGUA 4AQYQ 2HIVA 3M7NA 3S2DH 5FJ8H 1WCMH 3M9BA 4GNXA 1VQMA 1TWAH 4RMFA 4NB3A 2NZHA 2NVQH 4B3RQ 3OTOQ 3PUZA 2I0QA 4X6AH 2K4KA 1YVCA 3HKSA 3MXNB 1KQSA 4BA1I 4DAYB 1HR0W 4DV6Q 1E24A 2EXDA 2YV5A 2JEAI 2R7ZG 4HJ5A 1HNZQ 1VQHA 1L1OB 2JEBI 2Y0SE 4C3HH 4A3LH 2VS1A 1P8LA 4JI3L 3KF6B 1XMOQ 1VQ9A 3PUYA 4OWWB 2MO0A 1XJVA 2HQLA 3ERSX 2Z6KA 2L15A 1X6OA 1IZ6A 3H0GG 4DV2Q 4UY8C 3S16H 2UXBQ 2VUMG 4K0KL 2MQHA 1Q12A 4GN4B 2Q2UA 1FGUA 3K81C 2PI2E 4JYAQ 4LFBL 3UE0A 5C0XJ 4DNIA 2QEXA 2E2IH 4DR4L 3T1YL 1MJEA 1Q46A 4H02A 1K0RA 3UDIA 4IPGA 4JOIC 4YY3L 3AYHB 4HIKA 3RLOA 4LWCA 5M3MG 3HOXG 4JV5L 1AH9A 1SLJA 4X62Q 4YCWA 3HOVG 1E7ZA 3CCQA 2Y0SG 1NJIC 2R93H 3GD7A 2D0OA 4DK6C 4YCVA 4DR3Q 2R6GA 1VQAA 3RN2A 4NXNQ 1DGSA 1EUJA 4LF8Q 1SMXA 1OXTA 1FJGL 2VQEQ 2Z0SA 4A75A 5IWAQ 2VNUD 2UXDQ 3D0FA 4TVAB 4KHPQ 4LFCQ 1IBLL 3HOZG 4IFDI 4DV5Q 1ASYA 2R7FA 1HNXQ 3KOJA 4OO1I 1VQJA 1VQEA 3ER0A 2F4VL 3MEFA 4QQBX 1J6QA 1U0LA 1KD1C 1EQRA 3S15H 2NN6I 5LMNW 1Y1WH 3GO5A 4LFAL 1B7YB 2WAQE 3F2CA 5LMUQ 1PH1A 4LNQA 1UE1A 4DV7Q 3RLFA 5C4XG 3K80C 5AJ3Q 2DGYA 4JI7L 2ZM6L 2KENA 2ZJPA 1IYJB 3HOZH 2IHFA 1PH8A 2K5VA 5GAEC 2VW9A 3PGZA 3CCLA 2JA6G 2DUDA 3FKIG 4AYBE 4C3IH 5C44G 4DV5L 1QZHA 3CCMA 4HJ7A 1N34L 2UUBQ 3CMAA 1S3OA 1CKNA 5FLMH 3CPWA 3HOWG 3I4MH 5JJLA 4QY7A 4R1JA 1G291 1HJPA 2VQEL 4BY7G 1H95A 3CAMA 5IYCG 4LF8L 3F8TA 2WP8J 4DV1Q 3S14H 1Y1VG 4X65Q 3L7ZC 4DAMA 1K83H 4ALPA 4B3SQ 2I5HA 2E2HH 3PUXA 2N49A 1XPUA 5IYBG 3I55A 1NMGA 3A0JA 4IJLA 2JA8G 3HOYG 3M4PA 5ELOA 1UE5A 1K9MC 2YYZA 3K7AH 1QVGA 1TWFH 3J7A5 5IE8A 4DR5L 3GTQH 3PO3G 1CKNB 4A3KG 2PMZE 4UP8A 3NELA 1X9NA 2UUBL 4L5TA 3D31A 4DV7L 1A8VA 2IHEA 4A3LG 2EQSA 3BU2A 4UP7A 3UDGA 4LFAQ 3PSIA 5M3FH 1Q1BA 4AH6A 4JI3Q 5AJ3L 1CKMA 4DUYL 4JI7Q 5C3EG 1HZCA 2HT1A 4HJAA 3OYYA 2V1CC 2YTXA 1VQKA 4NXMQ 1VQ8A 1EQQA 1IBLQ 2RF4A 3KJPA 1M1KC 4JI0L 1TWHH 5LMNL 3I4NG 2K50A 3GTOH 1LYLA 4JBJA 4DR5Q 3EIVA 1KRTA 1PHJA 1FJGQ 3F2BA 2F4VQ 2XTIA 3GTPH 1HNWQ 1A63A 1I94L 1UWVA 4LFCL 3G71A 4YWMA 1JE5A 2Q2IA 3I4OA 4A3EH 3H3VH 1GVPA 1HZAA 2K75A 4BXXH 4GNXB 1EIYB 5IP7H 4C2MH 2ZJQA 1HZBA 1PH6A 4A3CH 5JEAG 1KIXA 2JA8H 4XIGS 3E9IA 5IYBH 4JI1L 1YJWA 2E2JH 4DR4Q 4POFA 3OW2A 2E5LQ 4JYAL 1KHIA 1J5EQ 4R4IA 1FVIA 1B70B 1XPRA 1N32Q 3PO2H 4A3GG 4JG2A 4YY3Q 1NY4A 3DM3A 3PIPA 4JBMA 3I4MG 1XNRQ 1JMCA 5EAYA 4GKJQ 5BR8Q 4LW1A 4JI8L 5DLQE 4A3IH 1SN8A 2ZJRA 4A3FH 1OTCA 2UXBL 2MNAA 1VQNA 5LMUL 4GN5A 2BA1A 4LUOA 4QIWE 2OWOA 2KCMA 2OTJA 4L5QA 2AMCB 1PV4A 1A62A 1KL9A 4BXXG 3VDYA 4HIOA 3TS0A 4JBWA 1X3FA 4P73A 3CF5A 3KYHC 1SFOH 4HJ9A 2AWNA 4JC0A 3J80c 1OXSC 4POGA 1X3GA 1BBUA 3TQYA 4A3MH 1C7YA 1KXLA 3TEHB 4LF7Q 1BBWA 4JI5L 4JI5Q 1Y14B 3JAMi 3CMEA 1WOCA 4AQYL 1VQOA 3W5OA 1E22A 1JB7A 5C0XG 2NN6G 2CWPA 4MTNA 4BA2I 2LSSA 4DR7L 3RLNA 3H15A 4EX5A 1WI5A 2UU9L 2VY3A 5ELNA 1W3SA 2K5HA 3S2HH 1M90C 1E3PA 1X54A 2BH8A 3HKZG 4X66Q 4GLXA 4YCUA 2A8VA 2R93G 3TRZA 4DV0Q 2K14A 4LUVA 3KF6A 3U4ZA 3RN5A 1LTLA 4GKKQ 1I6HH 1PH5A 3CCUA 1V1QA 1L1OA 1X55A 2CFMA 4BY1G 3CCRA 1BVSA 4PZ7A 4GS3A 3CC7A 1VQ4A 3UDXA 2UXCL 3GTLH 1Z47A 4J15A 1AE3A 4X66L 3T1HL 1P16A 4DK3C 1V43A 1VS0A 4GKKL 1N33L 3J81c 2UU9Q 3GTKH 4JI4Q 1IL2A 1J5EL 1SROA 4DKAC 1O7IA 1Q8KA 1Y1VH 1PYSB 2E5LL 1WFQA 1V9PA 2R7ZH 1HH2P 2ID0A 4B3RL 4DUZL 4HIMA 1PVOA 1VQDA 5FLMG 1YEZA 2N3SA 3HOWH 4LF7L 2UUCQ 4DR7Q 3S24A 3L0OA 4A4IA 1GD7A 4JCVE 4P74A 2JA6H 5FJ8G 4A3BG 5HGQA 4A3MG 4KHZA 4IFDJ 5IP9G 3BJUA 3GTGH 1QUQB 2EIFA 4QL5A 2H5XA 1S72A 3KDFA 3CCVA 5C4XH 1HR0L 2CCZA 2KBNA 1QUQA 4OX9Q 1L0WA 5LMNQ 4IO9A 1U5KA 4JI0Q 4DR1L 4LF6L 2GVBA 1YNXA 2WFWA 1AE2A 1KRSA 2JQOA 2AKWB 3I7FA 3PF5A 4JI4L 4L5SA 1VQCA 5J3BA 4A93H 2AWOA 1ASZA 3IRBA 3T1HQ 4OWTB 3J7ZC 2UUAQ 1RIPA 1NE3A 4DUYQ 3RZDH 4APVA 3RR5A 1LUZA 2B3GA 1Q82C 1VQFA 1SE8A 1EIFA 1NMFA 4A3BH 4B3TL 2YTYA 1CSQA 4BY7H 4A3IG 1JJ2A 5M5WH 1MKHA 4YHHL 1I3QH 3CXCA 1YZ6A 1QZGA 4GKJL 4DV0L 3ICEA 4LF4L 3PO2G 4A3GH 1XNRL 3CQZH 1UE7A 1VQPA 2JA5G 4IPCA 1SR3A 4R4TA 3UE1A 1YJ9A 4JI1Q 3HOVH 2Q2HA 4X64Q 3PIOA 3M4QA 3A5ZB 4UP9A 2YU9H 4PZ6A 1EOVA 4PG3A 4PZ8A 2I5LX 4B3ML 2VL6A 5IP7G 2ZTEA 3S1QH 4B3SL 2ZTDA 2PNHA 1B8AA 4P72A 5JJIA 1I94Q 1XTDA 1YBYA 1Z9FA 2F52A 3KLWA 4EQ5A 4DV1L 2ES2A 1K8AC 1HNWL 4A3EG 3H0GH 1D8LA 4AYBG
chains in the Genus database with same CATH superfamily
2KECA 3VMMA 1XYIA 1HRJA 1BOSA 2ALZA 1BKBA 2O5JC 1N34H 4JK1C 2RCNA 3L2PA 3K5LA 1HPCA 1VQGA 2ALYB 4ZKCB 3B6YA 3KF8A 4C5CA 2K28A 1VKZA 4QWDA 1R9TA 1CQVA 2VXWA 2C35B 2V58A 1T9HA 4IOCA 4B3MH 4GZYC 1TWGH 1SJED 2W6MA 3KFUA 5CORA 4XQNA 1CUKA 3E0EA 1DZ1A 1GKHA 1FKAH 1D2BA 4KKTA 2YL2A 3PR5B 5AFWA 4EQNA 3PO3H 3P7JA 2Z1CA 4ZQIA 4CDFC 4Y7NH 1X3EA 3M4OH 4YQWA 1KAWA 1HR0H 5KT6A 1WYDA 2NVTH 4M7EA 4EGVA 4BBSB 2PQAB 1SBBB 3N42B 4J6HA 3NWTA 1UNSA 1G51A 1SXTA 2A69D 2B63H 2HD3A 1Q1EA 4M8AA 4IHJF 3JRWA 1TS2A 4HMJA 2X0SA 1JX4A 1MJCA 3PF4A 4JI0H 2KSWA 5IYDH 3GTMA 4YAJB 1Y8PB 2VA2A 3SGIA 2XCPA 2EZVA 4EEQA 4O3SA 2FLLA 1IXRA 3I4NB 4Q5VA 3TP8A 4R8UB 3DLLA 4IUUA 4MTDA 1L0YB 1A3UA 4QWCA 3PV0A 2R92A 2W6ZA 2R7ZB 1PLFA 2F3IA 2MGSA 4FDBA 1H9MA 2VPSA 5IOCA 2BH2A 1KDAA 4BBRG 4YWLA 1O75A 2JEIA 2MO1A 3E9HA 2JEFA 4A3JH 1E1TA 4IUPA 3CC2A 5C3WA 4HR7B 3P75A 1EUDB 3TIIA 1EWIA 1MIUA 3NXWA 1PH9A 1IBKQ 3KXYT 3E0JA 3R3OA 4UAIA 5IYDG 1LT6D 3J7AF 4NMZA 2W9CB 4EBEA 4LUZA 1EZ1A 2UVWA 3J81W 2QEJC 3QWNA 1I6UA 2KHSA 4X64L 4RCNA 2EJGC 3W1BA 5FLXW 4KV6A 2RHSB 1DOMA 3V6KA 1ML0D 2CH4W 2HIXA 4LF4Q 3N8DA 5EWEA 2K03A 5KFOA 1CQFA 1T36A 3MFYA 4MIUA 3K7UC 3GTPB 4YJ2F 3HOXB 5KFVA 4OIKA 1H9KA 4KY5A 3NHHA 2W6OA 1JQYD 1TXYA 3W2DA 1UUPA 4JV1A 2WB1A 2E74C 2UUAL 5KFRA 2PBZA 4ME5A 1H9RA 2CHBD 1GO3E 3NENA 1LM0A 1TT2A 5KFSA 2SCUB 5IT9E 2UU9H 4DV4L 4DK0A 1AUVA 3U50C 5DEHA 3HG9A 1DIKA 1KDCA 5K36G 2F4IA 3HOZB 2F0EA 2RDFA 2Z9HA 1EOTA 1ESFA 2PNRC 2FPPB 2F0WA 1PRTC 5EPJA 1N8RC 4X66H 4ZLTF 4PWQA 1MD2D 1U4LA 4X62L 4K8IA 2ZTCA 4ILWA 1NBWA 1OXXK 2UXCQ 3K8AA 4DXGA 5FLXc 4O0AA 5T1IA 1VQ5A 1C0AA 3Q8DA 4QIWA 1STYA 1EZ6A 4Q8EA 1ENFA 4OELB 3N43B 4ULLA 4ZAIA 4RGNA 2VZAA 4I50F 1XMOL 2IJ0A 2R7DA 2UVVA 1F77A 3K3PA 2R93B 5GAHC 3S1QB 3CQZA 4QJFA 4UPAA 2XVSA 1S5CD 4EBDA 4DV6L 2B29A 3KUPA 1I4PA 2YZGA 1SNMA 1RTNA 4A3CG 1EYDA 2EYOA 2HVQA 3F8NA 4EGQA 2VQFQ 3S1MH 1K73C 1JJGA 4JI3H 5IY0A 1CHQD 4RHRA 3DXJC 1XMQL 3GLKA 2B2WA 2XNAC 1D5MC 2SOBA 1EFWA 5FD6A 3C46A 4RG1A 3R2IA 5GAGC 4AQYQ 4IPDA 5FO7B 1K1QA 1SEIA 2AUJD 2DY8A 1WCMH 3M9BA 1FR3A 4H13C 2NUAB 2AGOA 5KT7A 3OTOQ 2RGRA 4X6AH 3HKSA 5KFIA 2BQ3A 5CGKA 1HR0W 4FYDA 3DEPA 3NTIA 4HJ5A 1E2WA 2RDIA 1L1OB 4A3JB 2C5CA 1JXLA 4B3SH 1ZYRD 3OWFA 4NW2A 5C3XA 1IW7D 3KF6B 2YZMA 1E4EA 1XMOQ 5CV4A 1FJGH 1HFGA 4OWWB 2RDJA 2R84A 3H0GG 1PZID 2OXPA 2F0OA 1SMYC 1SEBD 5E4XA 4J9PA 2VUMG 2FK1A 4K0KL 2Y0SA 3KLRA 4CDCC 2NYZD 3CVZA 2IMWP 1M0WA 3UE0A 2FKLA 4G3IA 2QEXA 1RTOA 1WTWA 3T1YL 4H02A 4ZRZA 4IPGA 4JOIC 3RLOA 3HOXG 1AH9A 2DPJA 1AW7A 3CCQA 2W6QA 5JQWA 4DK6C 1WTQA 5CV9A 3RN2A 1DV1A 1JOQA 5D3IB 4ZKBB 4LF8Q 1SMXA 1SYEA 2ICEC 5IWAQ 1IW7C 3GV3A 3WNZA 4LFCQ 5IT9W 4IFDI 2HVRA 4LK1C 1HNXQ 4OO1I 3KHHA 4GKJH 2EYJA 1M6VA 1KD1C 3S15H 3CRKC 5HGTA 1I4XA 3RMHA 1KNEA 3CHBD 1Y1WH 4TRDA 1K0SA 3K5HA 4J9QA 3KAKA 1B7YB 1PMRA 3MWDA 5LMUQ 4DV7Q 4IUVA 5C4XG 2NU8B 2F0DA 2DGYA 2NUCA 2ZM6L 2DZDA 4U6PA 1PH8A 3UI2A 3C1FA 4AYBE 3I4MB 3AU7A 2UXBH 1S3OA 4LJZC 5LMUH 1S0NA 1G291 1HJPA 1FD7D 1FGBD 5IYCG 1HQMC 4ZYSA 4DL4A 5DLFA 1Y1VG 2UVRA 5KG5A 1RJPA 2N55A 1K83H 3RZOB 2XWJB 1GJXA 1PRTB 1HNZH 3HOYB 5IYBG 4DLKA 2YYAA 3A0JA 5JEAH 5EPLA 3NTKA 3T5JA 1UE5A 3J7A5 1TWFH 2YCHA 1VMPA 2VUMB 2YU9B 1CKNB 3S2DB 4F88A 1HUNA 2K5DA 3EA6A 1WTRA 2WE6A 2UUBL 3KAJA 3MR6A 1MI2A 4A2BA 3D31A 4DV7L 4A3LG 3UDGA 1IOVA 1S4ZA 1CKMA 4DFAA 1HZCA 5EOYA 1J8IA 3G6XA 2W57A 2BE5C 1VQ8A 2TSSA 5LOVF 3M4IA 1IBLQ 2R8KA 4AYBB 3KJPA 4JI0L 1TWHH 4DV1H 2C00A 1WTXA 1WCMB 3EIVA 4IURA 2F4VQ 5KFDA 4O2AF 2XTIA 3G6JB 2JP1A 4APMA 1I94L 1UWVA 4LFCL 4KJOA 1JE5A 3V05A 4EVOA 5L1KA 1GVPA 5KFLA 2Z6BA 2R8GA 1N33H 3V4SA 2R8IA 1HZBA 2O2LD 4Y7NB 1XNQH 4B08A 1KIXA 4KY7A 4EG0A 3E9IA 2NVTB 1EIGA 1YJWA 2XRSD 4ZK9B 2E2JH 4LFAH 4B3RH 1UEAB 4OEMB 3WO0A 5KGUA 1KHIA 2R7MA 2W9BB 2F0SA 1J5EQ 5CA0F 4LF9H 1XPRA 3PO2H 3DHQA 2GA4B 4YY3Q 1NY4A 3DM3A 3GTKB 5I2YA 3NQIA 1EQVA 3PVXA 1SN8A 5DM73 2VQFH 2QK4A 4ED7A 2UXDH 1VQNA 4LF6H 2OWOA 1RKNA 1S0MA 3GV7B 2W7OA 1ENCA 2AU0A 1F9PA 5JVLA 2DPIA 4HIOA 3KHGA 2E76C 4U7CA 2XC9A 3G8CA 2CW0D 1ZKOA 3KYHC 4DAYA 1DONA 1HFNA 3EFXD 4KJNA 3D4WA 1OXSC 4POGA 1RJRA 5H80A 3TQYA 4UCTA 2RDHA 4UCVA 4MAMA 4RB2C 5IGCA 1WOCA 4CKEA 4AQYL 4CDDC 4A3MB 1EEID 2NN6G 1M4VA 2VY3A 4RNOA 1GUTA 3DM1A 3SK8A 3S2HH 5C6AA 3EYYA 3HEJA 1GUOA 2O03A 2BQUA 5KFPA 4ED1A 5I6WA 1VBHA 3K0YA 3KF6A 4Q8FA 4GKKQ 1I6VC 3CCUA 1L1OA 5FLXL 1H9SA 3R23A 4FO2A 1JOKA 1MBYA 4DR3H 3DMUA 4J15A 4GKKL 1KAAA 4DL5A 2B2VA 2C9OA 1JKJB 3URYA 3LWEA 4JI4Q 1B2TA 2PZUA 4DKAC 3HZXA 5KRUA 1V9PA 5C1OA 5LYJF 1G6ZA 5ELEA 4DUZL 2L11A 5FLMG 5M5YB 2M9VA 1W6KA 1K8OA 1NSNS 4A4IA 4JCVE 5FK9C 5FJ8G 4OO1H 1IOWA 4KHZA 1F9RA 4LF4H 5IP9G 3ZYYX 3BJUA 4QL5A 1S72A 3OHAA 2H5XA 4JI8H 1XWEA 3KDFA 4S3SA 1QNKA 1HR0L 2CCZA 1QUQA 5C5JA 1L0WA 3Q8SB 4IO9A 4EBCA 3NQTA 1YNXA 3E3XA 3J80L 2AKWB 2K33A 1XTCD 4RUCA 4DV6H 3IAYA 3BQ1A 2AWOA 3HOUB 1S68A 3IRBA 3T1HQ 1WTOA 1TWCA 3PW2A 3ERQA 4APVA 1LUZA 4XX0B 1EIFA 4FF1A 3J81E 4J9OA 1I6HB 1CSQA 1CI3M 2HHHH 1JJ2A 5M5WH 1YZ6A 1L2ZA 1BCPD 4TV9F 5F9NA 3CQZH 1UE7A 3UE1A 5KNDA 5LP6F 4X64Q 4F50A 4FM9A 3M4QA 4XT1B 1EOVA 4PZ8A 4AYBA 4ETSA 2I5LX 1DV2A 1TVXA 2SNMA 1TIID 2VL6A 2ZTEA 3S1QH 3T5LA 2JA5A 1B8AA 2L5TA 3C0FB 4LH7A 3D3RA 1IYUA 2AQ1B 2F52A 1HNWL 1MGSA 5KNBA 2J7ZA 3BJYA 2G5DA 3N41B 4MA0A 1SFOB 3CU7A 1IBKL 2NU9B 1SCUB 4YHHH 4X3SA 1GGOA 4NXML 2XN9C 4OO1G 5KT2A 5JPMC 4C3IB 4GNXC 3TQ1A 4IFDG 5C3EB 3BQ0A 4XQQA 2K7VA 1B9NA 2A6HD 2WB1B 4JBKA 2YU9A 1BXTA 5DAUA 3J81j 4DV4Q 2PVPA 1Z2PX 2EVBA 2EY1A 4X3TA 5EJWA 3Q0AA 2K52A 1I7NA 5BMVF 4JUZA 3VYUA 3FKIA 3ULLA 4MNOA 4KLKA 4IFDH 4TQSA 3MXUA 5M3MH 4ECYA 5BR8L 5KYIA 4FBTA 4O1NA 1FYCA 4C3JG 1I50B 2CWAA 4GOPB 5D1PA 3GQCA 1ZHSA 4FVMA 5CV5A 4O3RA 3GTGA 3OSNA 4C1NI 4YR2A 5CA1F 4NP5A 4RCOA 1TKWB 5K5PA 4JI2L 4BY7B 2VB2X 1YHBA 2MCTA 1SYXB 2HDMA 2YTVA 4KTAA 4ME6A 3MAQA 1ILQA 4DXFA 4RU9A 4QWAA 3CPFA 1N36L 1I4HA 2B8FA 1N34Q 1QVFA 1ZQ7A 4WD3A 2JE6I 4GOPA 1JICA 1MSGA 3FDSA 2YRXA 2EYFA 4FXGC 1DD2A 5C44H 1WCMG 1K3RA 5A2QE 1X56A 2OQKA 2A5HA 3TREA 4LF5Q 1PDQA 4DV2L 4YBZB 1I4QA 5JVG3 3FPPA 5DLGA 4RGMA 1VF5C 4Y52H 5M5YH 1SRUA 1GUGA 3K5NA 3OSOA 4BBRH 3AMUA 2ZDQA 3G48A 3GIPA 2R8JA 4JI6Q 2HJWA 3J80i 1K3BC 5C5MA 3VR4A 3GTMH 1JCKB 1F2LA 3CCJA 1ILPA 5KT3A 2R92G 1JT8A 3CC4A 4GLAC 4GN3B 1Y1WA 1I5FA 5T1GA 1E2ZA 1AEXA 4NXNL 4FF3A 3T13A 3U58A 5KFTA 1T5EA 2J0TD 4NPSA 4R7RA 2V4DA 4KD4A 1HHVA 3ETJA 3RBEA 5D3DA 4JI6H 5BN5A 2JA8B 3M9NB 4WJ3M 5IT9L 3E5SA 3PW0A 2JXMB 1PH4A 3AQQA 4JI2Q 1VQ7A 4XDXA 3GTJH 4IOAA 5KFGA 3S2HB 4O4IF 3HOUH 4KK7A 3N44B 5KFXA 1EEFD 2VUMH 4HIDA 3AB9A 4O4LF 1TWFB 3T5HA 4DL3A 5D1OB 1CS0A 3HBLA 3S1NH 2OTLA 2E2IA 3EN2A 3HOYH 3EPIA 3HOUG 4ECXA 3S1NB 5DQHA 5CV6A 2C28A 1O7ZA 3V6HA 5CC4A 4ECVA 4JI4H 5H1SE 3ULPA 2RBMA 3HKZE 4OONA 4E6IA 2V4QA 4JVZA 2CKZB 2WB1G 5C3EH 2B2VC 1R4PB 3LNNA 4K6DA 4B9XA 1HNXL 1D5XC 1IBML 5F9LA 3Q8QB 3NSWA 4C3IG 2YS6A 3GTQB 4JV2A 3T5KA 2PZTA 4H0LC 2KCTA 1A0IA 4PMWA 2GN5A 2JA7H 5KIXA 4DV3L 2PMZA 1Y8OB 3CP0A 3VA7A 2MFIA 5C8YF 1G6PA 2VQFL 2PPBC 4MV9A 5GQOA 3L4JA 2QW7A 3U9SA 5IYZF 4A3DG 2XIWA 5EZYF 4ECSA 1N32H 4LF9Q 2IX0A 4GLVB 1J5EH 2K32A 2QF7A 1JLLB 1CK1A 4C1NK 3AFQA 1YHAA 3MR5A 4DUYH 2E2JB 2I8CA 5D1OA 4RB0A 4C5BA 2BA0A 4A3FG 5EQ0A 4YHHQ 4JV0A 1H9SB 3GDEA 2F0NA 1N48A 1DXMA 4ME3A 5LMNH 1UE6A 1JWMD 1SSOA 2W71A 1GUSA 3UDFA 4J0MA 1I94H 3HKZB 4NKLA 1AN8A 4BWSC 2NVYH 2AUKA 4RKBA 2OEOA 5KFAA 3RD4A 1X3PA 4A3JG 4EQOA 1N32L 4R8IA 5JJKA 3RGXA 3RUZA 3QG1A 4X64H 4LF6Q 3CCSA 4IZOA 3KHLA 1OXUA 1QB5D 4DR6Q 4HCEA 4EYHB 1L2FA 3I70A 1LV9A 2A1AA 3JAMc 5L1JA 4ED0A 1D7QA 2K5NA 2JA9A 2C2EA 4TQRA 2XCLA 1IKLA 1B53A 1LTID 3M7NA 5IP9H 3JAML 3P20A 1WD1A 3DWPA 2AQ2B 3S2DH 1QNUA 3K5IA 2FFKB 4CJ0B 4RMFA 4B3RQ 4IRCA 5JH7F 4I7ZC 3D4RA 3T1HH 4IUTA 4J8QA 1SNDA 4DV6Q 5KFHA 2F0UA 5JVH3 3SK4A 2ENBA 1GOZA 1HNZQ 1STNA 2JEBI 1B3QA 2KJXA 1P8LA 4CC6A 1KJ9A 5IGDA 4CKCA 2MO0A 1LT3D 3T56B 3R5HA 3ERSX 2Z6KA 2L15A 2UXBQ 2W9CA 2Q8TA 1Y69U 1IBLH 1WH2A 1A9XA 2PI2E 3Q1KA 5C0XJ 4FXKC 4UCUA 3UDIA 1K0RA 1SNCA 4X3UA 1DCZA 4MV1A 1SLJA 4YCWA 3HOVG 5JOBA 2FMCA 4YCVA 3SR1A 3QOJA 2R6GA 1VQAA 1KTKA 4QUFA 3MR3A 1NNXA 1DGSA 1IHZA 4N9TA 5K2MA 3WO1A 5L1LA 2R92B 2PQEA 2VQEQ 2Z0SA 3BDLA 3FKIB 4KHPQ 4DF7A 1BDOA 3TQTA 4LFCH 5EDWA 1U9RA 4KHPH 2G9DA 1VQJA 1VQEA 2F4VL 2VQEH 3MEFA 3MWEA 2JEJA 1XNRH 1C48A 1J6QA 2HUGA 1HQRD 3T53B 2NN6I 3OMGA 2F0JA 3GO5A 2NBFA 4GC6A 2J6TA 3OUUA 4L63B 1PH1A 2WAQE 4J9SA 5FPRA 1SFOA 4KHVA 1VDZA 1OWTA 2K1BA 5DQIA 2ZJPA 1IYJB 2SNSA 3HOZH 5GAEC 2VW9A 3CCLA 4XXEA 2JA6G 4I55F 3K59A 4IZ8A 4C3IH 1SYGA 5C44G 1QZHA 3GTJB 2CW8A 3I4MH 4QY7A 2W70A 3CAMA 2R6FA 1CHPD 2B8GA 4F4ZA 4DL7A 3L7ZC 3S16B 3OIPA 3A8IE 1DOLA 4DAMA 4ALPA 3SK6A 1TWFA 2K01A 3I55A 4EFEA 5C4ZA 1AN7A 5BR8H 3K7AH 2EYMA 3TIGA 4DR5L 3GTQH 4ZHQF 3MR2A 3GTJA 4UP8A 3EROA 5C4XB 4AQYH 2F0VA 3TBIB 3R5FA 1PXUA 2ZT9C 5CBEE 2EQSA 1NUCA 3J80E 4RHSA 4UP7A 4LFAQ 4BBRB 4X62H 1LTGD 1Q1BA 4AH6A 4DR6H 3MZ5A 1JWSD 4RFBA 2V1CC 1JE4A 1VQKA 3NBHA 1EQQA 4DU9A 3I4NG 1RODA 1FJGQ 2M05A 1KRTA 3T16A 3F2BA 1XMOH 1JR0D 3N40P 1A63A 1B04A 2NVYB 4YWMA 2Q2IA 3H3VH 4A3EH 2FJ2A 2EJFC 4GNXB 1EIYB 1B50A 4KY6A 4C2MH 1EU4A 1PH6A 5JEAG 4POFA 2E5LQ 4JYAL 4RUAA 1FVIA 4ED3A 2Y0SB 1N32Q 3RB4A 4A3GG 1N56A 4WRDA 3QJYA 3MA2B 4JBMA 3KBGA 1PRTD 3BYTB 4FU0A 4Q0YA 1JMCA 5EAYA 3S17B 5BR8Q 4JI8L 5DLQE 2GLTA 4A3FH 1LT4D 5LL6X 5EPKA 2UXBL 3GIJA 2BDNA 3WDNA 5LMUL 4UFZA 1S97A 4QIWE 4F7XA 1EL0A 4J9RA 2OTJA 4L5QA 1PV4A 1A62A 3FMCA 1GLVA 1KL9A 2ZXOA 4TV8F 1SYDA 3CF5A 2KCNA 2ZJTA 1GSHA 2HCCA 2EOTA 3DWQA 5JJZA 4JC0A 3K6OA 5DGBA 1UAPA 4A3MH 1Y8NB 3G6VA 3H3VC 5KNCA 1A15A 4JI5Q 2MJ8A 4MV4A 1WSCA 5FPOA 2IW3A 4IN3A 4DV2H 1B3AA 4DV7H 4MTNA 2LSSA 3NPPA 3RLNA 3H15A 4ZUJA 2L0CA 5ELNA 1W3SA 1EY0A 1M90C 2R93G 1O7YA 4X66Q 4L8JA 4YCUA 4QW9A 3VPCA 3Q22A 1HNXH 3K3VA 3MFHA 4CDEC 1JDEA 2B63A 1LTLA 1I6HH 1PH5A 5A2QL 2W9BA 2CFMA 3HKZA 2DN8A 1IBKH 4QIWB 4QWEA 4YJ3F 1AZQA 1EU3A 1VQ4A 3UDXA 2XWBB 2B2WC 2UXCL 3LMLA 1B44D 1WTVA 4DK3C 4O3NA 1V43A 1VS0A 1N33L 3RIZA 3J81c 2UU9Q 1IL2A 1O7IA 1PYSB 2EPBA 4ED2A 2EY2A 2MUYA 2ZM6H 3HOWH 1YEZA 2A73B 2KA7A 3Q8PB 2WKDA 1EFID 3L0OA 4K5XA 4FS1A 4A3DB 3PW4A 5F2DA 4A3BG 4XT3B 5DGAA 3KHRA 5KFMA 4RNNA 5E4WC 4O3OA 1DM0B 2UVUA 2VPQA 1T3NA 3H4BA 2PMZB 1QUQB 1ICWA 1S03G 5C4XH 1HA6A 2W6PA 1AZPA 5LMNQ 1U5KA 3MTSA 4JI0Q 4LF6L 3RB6A 2NVQB 1W6JA 1AE2A 1CM9A 2WFWA 3IFDA 3I7FA 4JI4L 3R2TA 3O13A 1VQCA 5J3BA 4A93H 3H0GA 1ASZA 3PMFA 3J7ZC 1Z2NX 5CBAE 3RR5A 5TSSA 2B3GA 1B9MA 1IBMH 1SE8A 4ID6A 2YTYA 4BY7H 3GIKA 1UC8A 1VMCA 4FF2A 4EFBA 4OIJA 3KK7A 3KALA 3CXCA 3H91A 3PO3B 2L1BA 4GKJL 1PFNA 4DV0L 3PO2G 2JA5G 4IPCA 4R4TA 1XX8A 2X69A 1KLGD 1PRTF 2Q2HA 4MV7A 3MC0B 4UP9A 5FOBB 4V0BA 4IUNA 5JUMA 2ZTDA 1SE2A 1I94Q 4O2BF 4J9NA 1XTDA 4HR7A 2FLPA 1YNNC 4EQ5A 3PIO3 4RAYA 4F4XA 2ZXPA 3J81L 1D8LA 4IRKA 1G8ZD 1NTGA 2HCIA 5KKNB 2FLNA 3T51B 2WAQA 2K6AA 4R4QA 3I4NH 1SDFA 4JI6L 4AIMA 2RGVA 3RJ0A 2ATWA 4LFBH 4TSSA 1LTSD 5EGTA 1K28A 4MZ9A 5C5LA 1Q81C 2E8GA 4DAVA 4MA5A 2OF1A 4J9KA 4P2CB 2ASBA 2R61A 2IX1A 5D8DA 1ET9A 2QA4A 1WJJA 2EJMA 4LF5L 3PCOB 4DUZH 2QCPX 2CQAA 4BWGB 1KNAA 3M9MB 2PYKA 3JRXA 4MHEA 2F0IA 2DIKA 3A7AB 5HV6A 5J39A 2OH2A 3DWAA 3GTMB 3M4OB 3NBHB 3MWYW 2IY5B 1PH2A 5M5XH 4J9LA 3PW5A 3HP3A 4KHPL 1S0OA 1A3TA 4YIJA 3P1HA 3C2PA 3TS2A 1Q86C 4A3GB 2UXDL 2HVSA 4NLGA 1VAJA 4ZUIA 4J9MA 1EQTA 1ZETA 5IT9c 4CGYB 1N36Q 2PQAA 1V8QA 1PX2A 3NEMA 3N6RA 1V51A 5IYCH 2GVAA 4JPBW 3HRZC 3W1GA 5D14A 2A68C 3G4SA 2J9GA 4FBUA 4QCLA 2B2YA 2IL8A 4PV1C 3GTGB 2FXQA 4QB4A 1I50A 4FP5D 5LL6b 4O4HF 3M9OB 5DM63 2FK3A 2DWCA 1K1SA 3QFFA 4C3JB 1FNWA 1WCMA 4JI1H 2JA7A 2Z4IA 3KF8B 3F2DA 4CHTB 1Y1WG 2F0LA 2WB1E 3HFZB 2D2CC 4LAAA 1HTPA 4OXPA 1XPOA 2I87A 4HTHA 1X65A 4Q44A 4CBVA 5K36H 4DNRB 3MWMA 4G7OC 5HY6A 1SMYD 4DR3L 2JK8A 2UUAH 4GKKH 2CQOA 1K83B 3RZOH 3FDTA 3J7AK 3L9AX 3BDCA 4IR9A 4DUZQ 3BQ2A 4X65L 3TP5A 1VQBA 4BBSG 4OX9H 3K57A 3I3CA 3NE5B 4ECWA 1YHQA 1PZJD 3FP9A 2Z6KC 5C44B 1PYWD 3F2UA 4LFBQ 3JC66 1C3OA 4R4OA 1KJJA 2R8HA 1EZ8A 5G3LF 3CCEA 1WVLA 5G3LD 3HB9A 4BBSH 5LL6S 4RB1A 2FB9A 2LXJA 3RB0A 1TA8A 3OOCA 5KFJA 1Z2OX 1RYRA 1CFMA 3LGJA 4OHJA 2LXKA 2P0AA 4OX9L 3BZKA 4RAZA 5EKKA 5FO9B 3X3MA 2H1EA 1PA6A 4H7BA 2CVRA 3ZJYC 4IRDA 2QGQA 2SDFA 1FL0A 2RHQB 3KDFB 2RDGA 4CJ1B 1XMQQ 1T5XD 1YIJA 2TMPA 3GILA 4DR2L 1KC8C 1S40A 2N8NA 4ZQ3A 5KG6A 2HHHQ 4G7HC 2DJGC 4YY3H 1QVCA 3F1ZA 1IBMQ 3BDOA 1EYGA 2F1MA 5IGEA 5T14A 4DV4H 4DR6L 2X6GA 2XCAA 2Z8LA 1I4GA 1S5FD 1XNQQ 1EWHA 2VA3A 1CZWA 1EY6A 3BG5A 1N33Q 1C8CA 3NBIA 3STBC 3A74A 2OQ0A 4B3TQ 3ULJA 1YITA 4PQXA 2W7PA 4C56C 1AUXA 3GIIA 2XIGA 1U4RA 1X32A 1Q3LA 4L6TB 1CSPA 1D1KA 3J80W 1YI2A 2B63G 4F4WA 1B4OA 1WTPA 4DPGA 1C9OA 1VCIA 3HOXH 2CQYA 1W96A 4DR1Q 4A93G 1BCPC 3BAAA 2XGTA 4DR2Q 5KFEA 3RUPA 5ELCA 4ED6A 1X3QA 4K5WA 3FRPB 2NVXB 2QKIC 1GM5A 1HZ9A 1STBA 3L3OC 2HHHL 2JJQA 2H4OA 3PUWA 4WFN3 1W2BA 2NVXH 4O2DA 4A3BB 3NP8A 4FXDA 2F0MA 5FJ8H 4KD3A 4GNXA 3TP7A 1VQMA 1TWAH 3RAQA 2NZHA 2NVQH 4DR4H 3D8GA 3JAMW 2I0QA 1UNNC 3HXLA 1YNJD 1YVCA 4PDBA 4BA1I 1ICFB 4DAYB 2GPSA 1E24A 2YV5A 2JEAI 2P5ZX 1RYSA 1WTHA 4GC7A 1G2SA 3HS0C 4WJWA 4HYKA 2I07B 2KVMA 2VS1A 4JI3L 2XGQA 2EDGA 1HNWH 3QIAA 3PUYA 3MFIA 4N8FA 2HQLA 2IPKD 3SK5A 4DV2Q 3RBDA 2F0TA 5HBRB 5CR3A 1S5ED 4HNUA 4NXMH 3MEHA 3KLSX 4JI5H 2IA6A 1EIHA 1Q12A 4GN4B 2F3WA 1FGUA 2PO4A 4JYAQ 5J2TF 1NR2A 4DR4L 4I4TF 1F2YA 4ECQA 1Q46A 2FJZA 2WIIB 4HIKA 1KJIA 3OPOA 5L9XA 1E7ZA 1NJIC 3J7AV 5ELDA 1A6XA 1ZHQA 4DR3Q 4Z9CB 3GV6A 4NXNQ 3MJFA 2K5QA 3OW7A 3KTMA 1EUJA 2C22A 1HTLD 1FJGL 1OXTA 2KCCA 5KEEA 4A75A 2VNUD 3D0FA 4QMGA 1EY7A 1ASYA 3KOJA 4O3PA 3ER0A 1R9TB 2JN4A 4QQBX 3RTXA 4ED8A 2R7LA 2C2DA 1AFPA 1DJRD 1EQRA 1TAEA 1RCVD 2JA6A 2OT2A 2L9HA 3F2CA 1NR4A 5I4DA 3SDZA 2E5LH 1RF2D 2FMAA 1Y1WB 3K80C 5HURA 4PNYA 5AJ3Q 4JI7L 1TWGB 1BGWA 1JB3A 5IGBA 3PGZA 2DUDA 1SYFA 2F0KA 2B2YC 1EYZA 2RQXA 4DV5L 1N34L 2V59A 4HJ7A 3BZDB 5KG0A 3CMAA 5KX5F 1CKNA 5FLMH 2J4XA 3CPWA 5JJLA 4R1JA 2RA4A 1H95A 5I9PA 1EYCA 2KQ3A 3SI8A 2WP8J 4DV1Q 1GSOA 4X65Q 2CZGA 4K14A 4OGQC 3A56A 4B3SQ 4C2MB 2I5HA 3NK9A 3PUXA 1BF4A 3HOWB 4CKBA 1LTAD 1NMGA 2L4NA 4IJLA 4ZCKA 2JA8G 3CKIB 4DAPA 3M4PA 2ZXRA 3HOYG 4F4YA 1K9MC 2YYZA 3A55A 5FO8B 3OTOH 3IFTA 3RAXA 5IE8A 4I7HA 4UHVA 3QOLA 5BN3A 4YB8B 5KFYA 3NELA 5KFCA 2BCOA 4L5TA 1OO9B 1R4QB 3OMCA 1A8VA 3BU2A 3PSIA 5M3FH 4JI3Q 5AJ3L 4JI7Q 4DUYL 3BA8A 3MXGA 1MSHA 3DF7A 1BNCA 1HUMA 2NN6H 2M2LA 3EQLC 3OYYA 4HJAA 5FD5A 4NXMQ 2W9AA 1W93A 4TUYF 2IP4A 4DL6A 2RF4A 4IQZA 2EY6A 5LMNL 4FF4A 3GTOH 1PK8A 1E0BA 1LYLA 4JBJA 4DR5Q 3GTPH 2YS7A 4Q45A 1TWHB 3EPGA 2EXZA 2E2DC 1IKMA 4RB3C 3RV4A 2R3ZA 1HZAA 2PCFB 4YR0A 3A8KE 2BE5D 2A68D 2A6HC 2RVLA 4I65A 5JVDF 1PTOC 1C4QA 4XIGS 5CV8A 5IYBH 4JI1L 3H4DA 4Q0FA 1GHKA 2PZWA 4I7AA 3EJIA 4R4IA 1B70B 1EYAA 1GXDC 1TR5A 3R5XA 4JG2A 3GV5B 3QB3A 4J1MA 2LKVA 1XNRQ 4RAUC 3I8ZA 5D65A 4GKJQ 2JA5B 3MXPA 5DG8A 4LW1A 2ZJRA 1ZEQX 1QCBD 2MNAA 2NU7B 3GQBA 3VYSA 3PQIA 2BA1A 4GN5A 4LUOA 1CZGA 4LF8H 3CRLC 2AMCB 1CQJB 4IALA 3MXNA 1EUCB 3VDYA 3TS0A 4JBWA 1A2TA 4HJ9A 1MHWC 2AWNA 4B3TH 4RKLA 2Q8RE 1RHPA 2R7KA 4LMYA 1BBUA 1KXLA 1C7YA 1A3VA 3FVQA 4LF7Q 1BJTA 2L55A 1TS3A 1TWCB 5M9OA 4A3EB 1S5DD 2E75C 4F87A 5CAEB 1E22A 2V9WA 1RJTA 4KKUA 3QZ8A 1WI5A 4K5VA 2UU9L 3HOVB 4DNTB 1X54A 2BH8A 3HKZG 1CA6A 3BVZA 3GTQA 1HA5A 1QWYA 4IWXA 4DV0Q 2K14A 1RD9D 3V96A 2IX3A 3A8JE 1EY4A 3ONAB 4NDXA 3U4ZA 2VOBA 2WV6D 3VYTA 3FMAA 1V1QA 1X55A 2R93A 4BY1G 1PTOH 4PZ7A 2XRQD 1TS5A 4X66L 3T1HL 1P16A 4EQPA 1LTRD 2E2IB 4KMUC 3SE7A 3MVVA 3OIQA 3QO2A 1WFQA 1E2VA 2DNEA 2LFNA 3JZIA 3LWBA 2D5DA 2E2HB 2NVXA 2EY5A 3V2TA 4LF7L 1RK5A 2K04A 4M1UB 2UUCQ 3S24A 4DR7Q 5EWFA 3H20A 1GD7A 1STHA 4P74A 3OUZA 1XXGA 5EKLA 1B6SA 2D9UA 2EIFA 3N6XA 3CCVA 1ZYRC 1S10A 4IUQA 1ZXTA 4DR1L 2GVBA 4JV5H 5L37A 4L5SA 3W3AA 1O78A 5EKIA 3SXHA 4OWTB 3D6WA 2UUAQ 1MZBA 1S9FA 1NE3A 2R85A 4DUYQ 3RZDH 1TU2B 1VQFA 4V190 2DNCA 1NMFA 4A3BH 1LLRD 2CW0C 5KT5A 2BQRA 4XQJA 1NCVA 4A3IG 4BY1B 2AQ3B 5KYLA 2NU6B 2ASLA 4HN7A 4YHHL 1I3QH 4N8X1 5CYUA 1Z7TA 4R8NA 1QZGA 2YZNA 4LF4L 1J9OA 4QF4A 1BNZA 1XNRL 3M4YA 4UDUC 1VQPA 2KEEA 4A3GH 2FP4B 3JAME 1SR3A 1YJ9A 3PIOA 4EGJA 3NTHA 3A5ZB 4PG3A 4HMIA 4PMCA 1AP0A 3Q24A 4B3SL 2PNHA 4P72A 4MTEA 3TINA 2XGPA 4DN4M 1YBYA 1Z9FA 3KLWA 2MHVA 1U4MA 5IGGA 3WOFA 3GTKA 1K8AC 4A3EG 1E4GT 2XD4A 1XDNA 2DJFC 2K05A 2A69C 3Q2OA 1R9TH 1PH3A 4JOIA 3PW7A 2D0PA 3V4ZA 3J7YW 4GOPC 2UXCH 2QYZA 2WACA 3FPUB 4XTCS 1F9QA 2A19A 5KFBA 4EYIB 2HDLA 3M85A 4MV6A 2W8LA 2WAQG 1YNND 1IL8A 1L1OC 3KJOA 5GONF 1TWCH 2KHJA 4A76A 1Q7YC 1JDBB 2PI2A 1BCPB 1QG7A 1KC7A 4KN4C 5JEAJ 3SVMA 3A5UA 4A3KH 4WBNF 3K58A 1U4PA 5I9OA 5C4JH 5M5WB 3Q23A 3AEVA 4HJ8A 4BY1H 2VR1A 5IWAL 1D1IA 2Q2TA 3J81i 1I50H 3PUVA 1N9WA 4A3KB 1VF7A 4MV3A 2QILA 3K0XA 5I6YA 3PZPA 2AHOB 4P71A 2WTFA 4KI0A 2I5MX 1PH7A 2L12A 2JA5H 3FHWA 5FKAC 1ET6A 1B6RA 2JYOA 4KKSA 2KOLA 3GV8B 4U673 4K0KQ 5GROA 1HXYD 3ETHA 2NTSA 3S1RH 4MV8A 1BO0A 2F0FA 1STAA 1BBXC 2UUCH 4OWXB 5KFNA 4DR7H 3WWVA 3T1YH 2D62A 4WJ4A 3NWSA 4A3DH 1C30A 3IG0A 3NUCA 3X3NA 4U68A 1TY0A 3S1MB 2ASDA 2B39A 3IKJA 1DOKA 3U9OA 1LABA 3U9TA 2JA7G 1QILA 3VR2A 4LMQD 1GUNA 2JEGA 4JW0A 3OHXC 2LS01 4IPHA 4PMBA 2I46A 3S14B 2PN1A 1LO5D 2UUCL 2B2TA 4P75A 3RNUA 4JV5Q 2OLSA 5M3FG 5KT4A 5DQGA 5J22A 4IJHA 3T1YQ 2ICIA 1PFSA 1Y1VB 4B3MQ 4OL7A 3CW2C 2OCEA 3BYYB 3H3VI 4HNTA 3AFPA 5A35A 5E7NA 2IBKA 1S5BD 4R9WA 2B2TC 5ELBA 3GTLB 5C0XI 4HAEA 1VQ6A 2FK2A 2ZM6Q 4R4CA 4H44C 3GIDA 1FNVA 2NZOA 1NAPA 5C4HA 3A7LA 5COYA 1SNQA 2EYHA 3G6EA 3I2ZA 2WAQB 1G2TA 3CD6A 2K5WA 3TP6A 5KG2A 1HNZL 1HR0Q 1LACA 2EE1A 4CC5A 1M0TA 3R93A 2KHIA 3EBEA 2MP1A 2RSOA 3FKIH 1VQLA 4EEYA 1RK6A 1OXVA 2I80A 1SNOA 2QDLA 1G91A 3ORRA 3OTOL 1E4EB 3UFXB 3S9WA 2R92H 4HQ6A 3BZCA 2SEBD 4DV0H 1CKOA 4RGTA 2E2HA 1JORA 1CTMA 3S15B 5KFQA 1RL2A 2IWHA 1O80A 4MTKA 1IYVA 5KFZA 4XYMB 3V6JA 3STBD 1K8GA 4RGOS 2AQ4A 1PYBA 4L5RC 2R82A 1L0XB 3DUZA 1CE8A 1PZKD 1F9SA 3VR3A 3OWEB 1PTOD 5L1IA 4YWKA 4XYLB 1ESRA 3I56A 2R86A 1UEBA 1E1OA 4A3FB 1D5ZC 3LP8A 1TS4A 3H0GB 4A3IB 4JI8Q 4RZQA 2IT1A 3S17H 5KG1A 3FEWX 1VQIA 1YJNA 3BABA 3I4LA 2O4XA 2N78A 3M3YH 1JJCB 3CQZB 1XNQL 4TKOB 4RZRA 2FPGB 3GIMA 2WINB 4ODGA 1SE4A 4XZ3B 1WR2A 4JI7H 2VQDA 2FPIB 4LF9L 2VUGA 4DV3Q 4TQUS 3U4VA 2ZDHA 4C3JH 2LMCB 1BXRA 4RWSC 3ITPA 5GADC 4QGUA 2HIVA 2F0PA 3TSSA 4C3HG 1F2ZA 5FLXE 5I2XA 5C4JB 4NB3A 3PUZA 1BUVT 1M8AA 2K4KA 1STEA 4K8JA 1WD0A 3MXNB 3BA9A 5I47A 4HCSA 1KQSA 4A93B 4DL2A 3PR4A 1GHJA 2EXDA 1LTTD 1SNPA 2F3VA 4LH6A 2R7ZG 2CW7A 3HGBA 1VQHA 4QUCA 2G9HD 2Y0SE 3RGZA 4C3HH 5LA6F 4A3LH 2B63B 5KG4A 1CT1D 1STGA 3PN1A 3TZDA 1VQ9A 2NTTA 1XJVA 4LSAA 3RB3A 4UY8C 5KFUA 1X6OA 1IZ6A 3S16H 1K83A 3R8BA 1Q90A 2UUBH 3EVQA 1EHIA 1QE6A 2MQHA 3SE0A 2Q2UA 2YRWA 3K81C 3TMEA 4A2AA 5KFFA 3QR8A 4LFBL 3S1RB 3Q6SA 4DNIA 2E2IH 3K7AB 1MJEA 3BG3A 4YY3L 3RFCA 3AYHB 4JV5L 4LWCA 5M3MG 1ULZA 4C5AA 2Z4HA 4X62Q 1JOOA 1TQOA 3I72A 1SAPA 2VUMA 2Y0SG 1II3A 4G7ZC 3GD7A 2R93H 5CB4F 2D0OA 5DG9A 2WYOA 4FS2A 4UCSA 2RSNA 1O7LA 1TWHA 2B2UC 1Z6HA 2JA7B 2ASJA 5M3FB 3OHBA 3VPDA 2F03A 2UXDQ 4IWYA 4TVAB 1B1ZA 3VR5A 1IBLL 4DV5Q 3HOZG 4UCRA 2R7FA 2J6UA 2FHTA 1U0LA 3T4AC 2JSOA 3JSLA 2KEDA 5LMNW 5E3FA 3M3YB 2ZDGA 4X65H 3KBXA 4LFAL 1E4FT 4LNQA 3RZDB 1KJQA 3JSNA 1UE1A 3H40A 3RLFA 2M00A 3K5OA 3MHBA 1V1PA 2FMMA 2KENA 1KDBA 2Q8IB 4LF7H 1BQQT 2IHFA 3QZ7A 2K5VA 2WKCA 3FKIG 3IL8A 4WORA 2UUBQ 1JC7A 3CCMA 5LXTF 4G57A 1PTOF 3HOWG 1V1OA 4E4TA 2VQEL 2F4VH 4BY7G 3VA5A 4LF8L 3F8TA 4C2MA 3S14H 2CH4A 3GTLA 4R8UA 2BR0A 2E2HH 2N49A 1XPUA 5LHY1 1KLUD 3VYRA 5ELOA 3MFGA 1RJQA 1Y1VA 3SEBA 3I91A 1QVGA 3PO2B 1JWUD 4QWBA 3PO3G 4IR1A 4A3KG 4BS9A 4ZOLF 2EYLA 2PMZE 1V4YA 2HQEA 1X9NA 1GYFA 2MPMA 5E1FA 3H09A 2B2UA 4DA2A 2IHEA 1KJ8A 2N88A 4QW8A 2JA6B 3ORQA 1V1PB 4KN7C 5A2QW 3C3LA 5C3EG 3WOEA 4UCOA 2HT1A 3VPBA 4JYAH 2YTXA 1SYCA 3RF2A 3TN2A 5KG3A 2J6SA 1SE3A 1SYBA 2QDBA 1M1KC 3Q8RB 1H9JA 2K50A 4XYQA 5KFWA 4DR5H 1M7JA 2W6NA 1PHJA 5DNFA 1HNWQ 5IODA 3I90A 3TDQA 2W8KA 3G7LA 3G71A 3I4OA 1I4RA 2GPWA 3E6ZX 2K75A 5C1PA 4BXXH 3RV3A 4O42A 5IP7H 2PW7A 2ZJQA 4A3CH 5J1ZA 2JA8H 4N9PA 4B9WA 4RH6A 4DR4Q 3OW2A 4ECTA 3H6MA 5KG7A 1FNUA 3BVMA 4HNVA 1ONLA 5M3MB 3PIPA 4O3QA 3I4MG 1QOHA 3I12A 4M9UA 4HEDA 2F0QA 1LT5D 2BOSA 4A3IH 4DV5H 4DR2H 1OTCA 1SJHD 2WDTA 1PTOB 2DY7A 1EWCA 5IWAH 4DR1H 2XSCA 2KCMA 1RDPD 5BN4A 5CMDA 3PIP3 5JPNC 1D6EC 5BPHA 2A74C 5IIFA 4XYOA 4F8MA 3GP7A 4BXXG 4YP3A 2NB0A 1KBLA 1X3FA 4P73A 5IGFA 1SFOH 1T94A 2DLNA 4ECRA 2A6EC 1GSAA 4HSPA 3J80c 3C1EA 4HSVA 4DK1A 1X3GA 5EBCA 1KABA 1EY9A 3G6YA 3TEHB 3ND9A 1BBWA 4JI5L 1Y14B 3VR6A 4C3HB 3JAMi 2EYPA 4G4KA 3CMEA 4FNFA 1VQOA 3W5OA 4K6LA 1JB7A 5ELFA 5C0XG 1TWAA 2CWPA 1LTBD 3KLSA 5ISRA 4BA2I 4DR7L 2V4RA 3GTOA 4EX5A 3A54A 3K5MA 5BPFA 2K5HA 2R7NA 1BCPF 1I3QB 4ABNA 1E3PA 4Y8VB 2PW5A 2A8VA 4GLXA 4ZI7F 1EY5A 3TRZA 1I7LA 1UC9A 2RKSA 4LUVA 1ENAA 2NZ1D 2V5AA 1XMQH 3OSPA 3RN5A 1KEEA 3D4DA 3CCRA 1HCZA 1BVSA 4GS3A 3CC7A 1YNJC 2R87A 3GTLH 1Z47A 4NXNH 4LSXA 3ND8A 4K2KA 3E5NA 1DYQA 1AE3A 4RNMA 1BR9A 2LY7A 2X6LA 4RA8A 1CA5A 3GTKH 4CJ2C 4YR3A 4Q43A 1J5EL 1SROA 1Q8KA 1Y1VH 2E5LL 2R7ZH 3I73A 1HH2P 2ID0A 4B3RL 2BDOA 1GUWA 4HIMA 3GTPA 1PVOA 1VQDA 1QJOA 2KUMA 2N3SA 4YAKB 3L4KA 5C0XH 2O5IC 1TY2A 2JA6H 5HGQA 4A3MG 3LX0A 5EWGA 5NUCA 2VB3X 4IFDJ 2HGSA 5DG7A 3GTGH 4K0KH 3IN5A 1I3QA 4OX9Q 2KBNA 4IAJA 3GTOB 1A2UA 4JI2H 2NWGA 1KRSA 1TWAB 2JQOA 2AGPA 3PF5A 2FINB 4X3KA 1Q8IA 5JAVA 3GIQA 1RIPA 1N36H 1Q82C 2A6ED 3TZUA 3DEOA 3LWUA 4ECZA 2C2RA 4B3TL 2FE3A 4MN3A 2ATLA 4ECUA 2R7ZA 1EY8A 4K2LA 5M5XB 1MKHA 2RCFA 3SHLA 4DGZA 4DV3H 5J2UF 4L1KA 3ICEA 2NVYA 5KFKA 3NGDA 1F2MA 3BVGA 4JI1Q 3N52A 3HOVH 2AGQA 1PFMA 2F0GA 3M7GA 2YU9H 4PZ6A 3UQ8A 4B3ML 1B33N 5IP7G 3D6CA 2F0HA 1K8MA 4LF5H 1JIHA 5JJIA 3H94A 3BS1A 1CQIB 1VBGA 4DV1L 2ES2A 5CV7A 5EBDA 2YW2A 1TWGA 3H0GH 1PFBA 4AYBG
chains in the Genus database with same CATH topology
1NTGA 1IBKL 1BKBA 1R9TH 2RCNA 4JOIA 3L2PA 1PH3A 4NXML 2D0PA 4R4QA 4OO1G 3I4NH 4GOPC 1VQGA 4GNXC 4AIMA 4JI6L 4IFDG 2ATWA 2ALYB 3B6YA 4XTCS 4JBKA 3J81j 2A19A 4DV4Q 4MZ9A 3M85A 1Q81C 2E8GA 2C35B 2K52A 2WAQG 2ASBA 1T9HA 1L1OC 4IOCA 2IX1A 3KJOA 1TWGH 1WJJA 1TWCH 2KHJA 4MNOA 4KLKA 3ULLA 2QA4A 3PCOB 4A76A 1Q7YC 4LF5L 1CUKA 2PI2A 3E0EA 5M3MH 3KFUA 5BR8L 1GKHA 5JEAJ 3A5UA 4A3KH 3PO3H 2CWAA 3NBHB 4GOPB 2IY5B 1PH2A 5M5XH 5C4JH 3AEVA 4HJ8A 4BY1H 4KHPL 5IWAL 3TS2A 2UXDL 1Q86C 4Y7NH 1X3EA 1I50H 3J81i 1KAWA 2Q2TA 3PUVA 1N9WA 3M4OH 1WYDA 2NVTH 3K0XA 2PQAB 5IT9c 4JI2L 2AHOB 4P71A 1N36Q 1YHBA 2PQAA 1G51A 3NEMA 2YTVA 4KI0A 2B63H 2I5MX 1Q1EA 1PH7A 5IYCH 2GVAA 2JA5H 3FHWA 3CPFA 3W1GA 1N36L 1MJCA 3G4SA 1N34Q 1QVFA 3PF4A 2JE6I 4GOPA 5IYDH 3SGIA 5C44H 4K0KQ 1WCMG 1K3RA 2FXQA 5GROA 1IXRA 1X56A 2OQKA 3TREA 4LF5Q 3S1RH 4DV2L 3DLLA 4Y52H 4OWXB 5M5YH 1SRUA 3WWVA 3PV0A 2D62A 4WJ4A 4BBRH 4A3DH 2F3IA 3KF8B 4FDBA 3G48A 3F2DA 1Y1WG 4JI6Q 2BH2A 4BBRG 2WB1E 3HFZB 4YWLA 3J80i 2MO1A 3E9HA 4OXPA 4A3JH 3GTMH 1XPOA 3CCJA 2JA7G 2R92G 1E1TA 1JT8A 1X65A 3CC4A 3CC2A 4GLAC 4GN3B 1I5FA 4NXNL 1EWIA 1MIUA 5HY6A 3U58A 1PH9A 4NPSA 4DR3L 1IBKQ 4IPHA 2JK8A 5IYDG 2CQOA 3RZOH 4LUZA 2UUCL 4WJ3M 4P75A 3RNUA 4JV5Q 5M3FG 1PH4A 3AQQA 4X64L 4JI2Q 4DUZQ 1VQ7A 3GTJH 4IJHA 3W1BA 4X65L 3T1YQ 4IOAA 2RHSB 1PFSA 1VQBA 4BBSG 4B3MQ 2HIXA 4LF4Q 3HOUH 3CW2C 2OCEA 1YHQA 3H3VI 3K7UC 2VUMH 3AFPA 4HIDA 3FP9A 2Z6KC 5E7NA 4LFBQ 3JC66 5C0XI 4R4OA 1TXYA 3S1NH 1VQ6A 2OTLA 2ZM6Q 3EN2A 3HOYH 3HOUG 4R4CA 3CCEA 2UUAL 4BBSH 2NZOA 2LXJA 1GO3E 3NENA 1LM0A 5H1SE 3ULPA 3G6EA 3HKZE 3I2ZA 3LGJA 4OONA 4DV4L 3CD6A 3U50C 2CKZB 2LXKA 1HNZL 1HR0Q 2WB1G 3BZKA 5C3EH 4OX9L 1IBML 1HNXL 2KHIA 3EBEA 1PA6A 3FKIH 1VQLA 1OXVA 3ZJYC 2QGQA 5K36G 3OTOL 1FL0A 1A0IA 2KCTA 2GN5A 2RHQB 3KDFB 4PMWA 2JA7H 4DV3L 1XMQQ 2R92H 3BZCA 3CP0A 1YIJA 2MFIA 4DR2L 1CKOA 1S40A 2N8NA 1KC8C 1G6PA 2VQFL 1N8RC 2HHHQ 5GQOA 1QVCA 1RL2A 4A3DG 4X62L 3F1ZA 1IBMQ 1EYGA 2IX0A 4GLVB 4LF9Q 2ZTCA 3STBD 1NBWA 3AFQA 1YHAA 1K8GA 4DR6L 1PYBA 4L5RC 1OXXK 2UXCQ 3K8AA 5FLXc 2BA0A 1XNQQ 4O0AA 4A3FG 1VQ5A 1C0AA 3Q8DA 4YHHQ 3GDEA 1N33Q 4YWKA 3STBC 3I56A 3A74A 4ME3A 1UEBA 1E1OA 1UE6A 2OQ0A 4B3TQ 3ULJA 1YITA 4JI8Q 2VZAA 1XMOL 2IT1A 3S17H 3UDFA 2R7DA 1VQIA 1YJNA 1CSPA 5GAHC 2NVYH 1YI2A 2B63G 2N78A 4QJFA 4UPAA 1C9OA 4DPGA 3M3YH 1VCIA 3HOXH 1JJCB 4A3JG 1N32L 4DV6L 1XNQL 2B29A 5JJKA 4DR1Q 3CCSA 4LF6Q 4A3CG 4A93G 1OXUA 2VQFQ 4DR6Q 1L2FA 1K73C 2XGTA 4DR2Q 3S1MH 1JJGA 4LF9L 2A1AA 5IY0A 3JAMc 4DV3Q 1XMQL 1D7QA 4TQUS 2K5NA 2JA9A 3U4VA 1GM5A 1EFWA 1HZ9A 4RG1A 4C3JH 2HHHL 2JJQA 3PUWA 1W2BA 5GAGC 2NVXH 5IP9H 4IPDA 4O2DA 5GADC 4QGUA 4AQYQ 2HIVA 3M7NA 3S2DH 5FJ8H 1WCMH 3M9BA 4GNXA 1VQMA 1TWAH 4RMFA 4NB3A 2NZHA 2NVQH 4B3RQ 3OTOQ 3PUZA 2I0QA 4X6AH 2K4KA 1YVCA 3HKSA 3MXNB 1KQSA 4BA1I 4DAYB 1HR0W 4DV6Q 1E24A 2EXDA 2YV5A 2JEAI 2R7ZG 4HJ5A 1HNZQ 1VQHA 1L1OB 2JEBI 2Y0SE 4C3HH 4A3LH 2VS1A 1P8LA 4JI3L 3KF6B 1XMOQ 1VQ9A 3PUYA 4OWWB 2MO0A 1XJVA 2HQLA 3ERSX 2Z6KA 2L15A 1X6OA 1IZ6A 3H0GG 4DV2Q 4UY8C 3S16H 2UXBQ 2VUMG 4K0KL 2MQHA 1Q12A 4GN4B 2Q2UA 1FGUA 3K81C 2PI2E 4JYAQ 4LFBL 3UE0A 5C0XJ 4DNIA 2QEXA 2E2IH 4DR4L 3T1YL 1MJEA 1Q46A 4H02A 1K0RA 3UDIA 4IPGA 4JOIC 4YY3L 3AYHB 4HIKA 3RLOA 4LWCA 5M3MG 3HOXG 4JV5L 1AH9A 1SLJA 4X62Q 4YCWA 3HOVG 1E7ZA 3CCQA 2Y0SG 1NJIC 2R93H 3GD7A 2D0OA 4DK6C 4YCVA 4DR3Q 2R6GA 1VQAA 3RN2A 4NXNQ 1DGSA 1EUJA 4LF8Q 1SMXA 1OXTA 1FJGL 2VQEQ 2Z0SA 4A75A 5IWAQ 2VNUD 2UXDQ 3D0FA 4TVAB 4KHPQ 4LFCQ 1IBLL 3HOZG 4IFDI 4DV5Q 1ASYA 2R7FA 1HNXQ 3KOJA 4OO1I 1VQJA 1VQEA 3ER0A 2F4VL 3MEFA 4QQBX 1J6QA 1U0LA 1KD1C 1EQRA 3S15H 2NN6I 5LMNW 1Y1WH 3GO5A 4LFAL 1B7YB 2WAQE 3F2CA 5LMUQ 1PH1A 4LNQA 1UE1A 4DV7Q 3RLFA 5C4XG 3K80C 5AJ3Q 2DGYA 4JI7L 2ZM6L 2KENA 2ZJPA 1IYJB 3HOZH 2IHFA 1PH8A 2K5VA 5GAEC 2VW9A 3PGZA 3CCLA 2JA6G 2DUDA 3FKIG 4AYBE 4C3IH 5C44G 4DV5L 1QZHA 3CCMA 4HJ7A 1N34L 2UUBQ 3CMAA 1S3OA 1CKNA 5FLMH 3CPWA 3HOWG 3I4MH 5JJLA 4QY7A 4R1JA 1G291 1HJPA 2VQEL 4BY7G 1H95A 3CAMA 5IYCG 4LF8L 3F8TA 2WP8J 4DV1Q 3S14H 1Y1VG 4X65Q 3L7ZC 4DAMA 1K83H 4ALPA 4B3SQ 2I5HA 2E2HH 3PUXA 2N49A 1XPUA 5IYBG 3I55A 1NMGA 3A0JA 4IJLA 2JA8G 3HOYG 3M4PA 5ELOA 1UE5A 1K9MC 2YYZA 3K7AH 1QVGA 1TWFH 3J7A5 5IE8A 4DR5L 3GTQH 3PO3G 1CKNB 4A3KG 2PMZE 4UP8A 3NELA 1X9NA 2UUBL 4L5TA 3D31A 4DV7L 1A8VA 2IHEA 4A3LG 2EQSA 3BU2A 4UP7A 3UDGA 4LFAQ 3PSIA 5M3FH 1Q1BA 4AH6A 4JI3Q 5AJ3L 1CKMA 4DUYL 4JI7Q 5C3EG 1HZCA 2HT1A 4HJAA 3OYYA 2V1CC 2YTXA 1VQKA 4NXMQ 1VQ8A 1EQQA 1IBLQ 2RF4A 3KJPA 1M1KC 4JI0L 1TWHH 5LMNL 3I4NG 2K50A 3GTOH 1LYLA 4JBJA 4DR5Q 3EIVA 1KRTA 1PHJA 1FJGQ 3F2BA 2F4VQ 2XTIA 3GTPH 1HNWQ 1A63A 1I94L 1UWVA 4LFCL 3G71A 4YWMA 1JE5A 2Q2IA 3I4OA 4A3EH 3H3VH 1GVPA 1HZAA 2K75A 4BXXH 4GNXB 1EIYB 5IP7H 4C2MH 2ZJQA 1HZBA 1PH6A 4A3CH 5JEAG 1KIXA 2JA8H 4XIGS 3E9IA 5IYBH 4JI1L 1YJWA 2E2JH 4DR4Q 4POFA 3OW2A 2E5LQ 4JYAL 1KHIA 1J5EQ 4R4IA 1FVIA 1B70B 1XPRA 1N32Q 3PO2H 4A3GG 4JG2A 4YY3Q 1NY4A 3DM3A 3PIPA 4JBMA 3I4MG 1XNRQ 1JMCA 5EAYA 4GKJQ 5BR8Q 4LW1A 4JI8L 5DLQE 4A3IH 1SN8A 2ZJRA 4A3FH 1OTCA 2UXBL 2MNAA 1VQNA 5LMUL 4GN5A 2BA1A 4LUOA 4QIWE 2OWOA 2KCMA 2OTJA 4L5QA 2AMCB 1PV4A 1A62A 1KL9A 4BXXG 3VDYA 4HIOA 3TS0A 4JBWA 1X3FA 4P73A 3CF5A 3KYHC 1SFOH 4HJ9A 2AWNA 4JC0A 3J80c 1OXSC 4POGA 1X3GA 1BBUA 3TQYA 4A3MH 1C7YA 1KXLA 3TEHB 4LF7Q 1BBWA 4JI5L 4JI5Q 1Y14B 3JAMi 3CMEA 1WOCA 4AQYL 1VQOA 3W5OA 1E22A 1JB7A 5C0XG 2NN6G 2CWPA 4MTNA 4BA2I 2LSSA 4DR7L 3RLNA 3H15A 4EX5A 1WI5A 2UU9L 2VY3A 5ELNA 1W3SA 2K5HA 3S2HH 1M90C 1E3PA 1X54A 2BH8A 3HKZG 4X66Q 4GLXA 4YCUA 2A8VA 2R93G 3TRZA 4DV0Q 2K14A 4LUVA 3KF6A 3U4ZA 3RN5A 1LTLA 4GKKQ 1I6HH 1PH5A 3CCUA 1V1QA 1L1OA 1X55A 2CFMA 4BY1G 3CCRA 1BVSA 4PZ7A 4GS3A 3CC7A 1VQ4A 3UDXA 2UXCL 3GTLH 1Z47A 4J15A 1AE3A 4X66L 3T1HL 1P16A 4DK3C 1V43A 1VS0A 4GKKL 1N33L 3J81c 2UU9Q 3GTKH 4JI4Q 1IL2A 1J5EL 1SROA 4DKAC 1O7IA 1Q8KA 1Y1VH 1PYSB 2E5LL 1WFQA 1V9PA 2R7ZH 1HH2P 2ID0A 4B3RL 4DUZL 4HIMA 1PVOA 1VQDA 5FLMG 1YEZA 2N3SA 3HOWH 4LF7L 2UUCQ 4DR7Q 3S24A 3L0OA 4A4IA 1GD7A 4JCVE 4P74A 2JA6H 5FJ8G 4A3BG 5HGQA 4A3MG 4KHZA 4IFDJ 5IP9G 3BJUA 3GTGH 1QUQB 2EIFA 4QL5A 2H5XA 1S72A 3KDFA 3CCVA 5C4XH 1HR0L 2CCZA 2KBNA 1QUQA 4OX9Q 1L0WA 5LMNQ 4IO9A 1U5KA 4JI0Q 4DR1L 4LF6L 2GVBA 1YNXA 2WFWA 1AE2A 1KRSA 2JQOA 2AKWB 3I7FA 3PF5A 4JI4L 4L5SA 1VQCA 5J3BA 4A93H 2AWOA 1ASZA 3IRBA 3T1HQ 4OWTB 3J7ZC 2UUAQ 1RIPA 1NE3A 4DUYQ 3RZDH 4APVA 3RR5A 1LUZA 2B3GA 1Q82C 1VQFA 1SE8A 1EIFA 1NMFA 4A3BH 4B3TL 2YTYA 1CSQA 4BY7H 4A3IG 1JJ2A 5M5WH 1MKHA 4YHHL 1I3QH 3CXCA 1YZ6A 1QZGA 4GKJL 4DV0L 3ICEA 4LF4L 3PO2G 4A3GH 1XNRL 3CQZH 1UE7A 1VQPA 2JA5G 4IPCA 1SR3A 4R4TA 3UE1A 1YJ9A 4JI1Q 3HOVH 2Q2HA 4X64Q 3PIOA 3M4QA 3A5ZB 4UP9A 2YU9H 4PZ6A 1EOVA 4PG3A 4PZ8A 2I5LX 4B3ML 2VL6A 5IP7G 2ZTEA 3S1QH 4B3SL 2ZTDA 2PNHA 1B8AA 4P72A 5JJIA 1I94Q 1XTDA 1YBYA 1Z9FA 2F52A 3KLWA 4EQ5A 4DV1L 2ES2A 1K8AC 1HNWL 4A3EG 3H0GH 1D8LA 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTG A;  1IBK L;  1BKB A;  1R9T H;  2RCN A;  4JOI A;  3L2P A;  1PH3 A;  4NXM L;  2D0P A;  4R4Q A;  4OO1 G;  3I4N H;  4GOP C;  1VQG A;  4GNX C;  4AIM A;  4JI6 L;  4IFD G;  2ATW A;  2ALY B;  3B6Y A;  4XTC S;  4JBK A;  3J81 j;  2A19 A;  4DV4 Q;  4MZ9 A;  3M85 A;  1Q81 C;  2E8G A;  2C35 B;  2K52 A;  2WAQ G;  2ASB A;  1T9H A;  1L1O C;  4IOC A;  2IX1 A;  3KJO A;  1TWG H;  1WJJ A;  1TWC H;  2KHJ A;  4MNO A;  4KLK A;  3ULL A;  2QA4 A;  3PCO B;  4A76 A;  1Q7Y C;  4LF5 L;  1CUK A;  2PI2 A;  3E0E A;  5M3M H;  3KFU A;  5BR8 L;  1GKH A;  5JEA J;  3A5U A;  4A3K H;  3PO3 H;  2CWA A;  3NBH B;  4GOP B;  2IY5 B;  1PH2 A;  5M5X H;  5C4J H;  3AEV A;  4HJ8 A;  4BY1 H;  4KHP L;  5IWA L;  3TS2 A;  2UXD L;  1Q86 C;  4Y7N H;  1X3E A;  1I50 H;  3J81 i;  1KAW A;  2Q2T A;  3PUV A;  1N9W A;  3M4O H;  1WYD A;  2NVT H;  3K0X A;  2PQA B;  5IT9 c;  4JI2 L;  2AHO B;  4P71 A;  1N36 Q;  1YHB A;  2PQA A;  1G51 A;  3NEM A;  2YTV A;  4KI0 A;  2B63 H;  2I5M X;  1Q1E A;  1PH7 A;  5IYC H;  2GVA A;  2JA5 H;  3FHW A;  3CPF A;  3W1G A;  1N36 L;  1MJC A;  3G4S A;  1N34 Q;  1QVF A;  3PF4 A;  2JE6 I;  4GOP A;  5IYD H;  3SGI A;  5C44 H;  4K0K Q;  1WCM G;  1K3R A;  2FXQ A;  5GRO A;  1IXR A;  1X56 A;  2OQK A;  3TRE A;  4LF5 Q;  3S1R H;  4DV2 L;  3DLL A;  4Y52 H;  4OWX B;  5M5Y H;  1SRU A;  3WWV A;  3PV0 A;  2D62 A;  4WJ4 A;  4BBR H;  4A3D H;  2F3I A;  3KF8 B;  4FDB A;  3G48 A;  3F2D A;  1Y1W G;  4JI6 Q;  2BH2 A;  4BBR G;  2WB1 E;  3HFZ B;  4YWL A;  3J80 i;  2MO1 A;  3E9H A;  4OXP A;  4A3J H;  3GTM H;  1XPO A;  3CCJ A;  2JA7 G;  2R92 G;  1E1T A;  1JT8 A;  1X65 A;  3CC4 A;  3CC2 A;  4GLA C;  4GN3 B;  1I5F A;  4NXN L;  1EWI A;  1MIU A;  5HY6 A;  3U58 A;  1PH9 A;  4NPS A;  4DR3 L;  1IBK Q;  4IPH A;  2JK8 A;  5IYD G;  2CQO A;  3RZO H;  4LUZ A;  2UUC L;  4WJ3 M;  4P75 A;  3RNU A;  4JV5 Q;  5M3F G;  1PH4 A;  3AQQ A;  4X64 L;  4JI2 Q;  4DUZ Q;  1VQ7 A;  3GTJ H;  4IJH A;  3W1B A;  4X65 L;  3T1Y Q;  4IOA A;  2RHS B;  1PFS A;  1VQB A;  4BBS G;  4B3M Q;  2HIX A;  4LF4 Q;  3HOU H;  3CW2 C;  2OCE A;  1YHQ A;  3H3V I;  3K7U C;  2VUM H;  3AFP A;  4HID A;  3FP9 A;  2Z6K C;  5E7N A;  4LFB Q;  3JC6 6;  5C0X I;  4R4O A;  1TXY A;  3S1N H;  1VQ6 A;  2OTL A;  2ZM6 Q;  3EN2 A;  3HOY H;  3HOU G;  4R4C A;  3CCE A;  2UUA L;  4BBS H;  2NZO A;  2LXJ A;  1GO3 E;  3NEN A;  1LM0 A;  5H1S E;  3ULP A;  3G6E A;  3HKZ E;  3I2Z A;  3LGJ A;  4OON A;  4DV4 L;  3CD6 A;  3U50 C;  2CKZ B;  2LXK A;  1HNZ L;  1HR0 Q;  2WB1 G;  3BZK A;  5C3E H;  4OX9 L;  1IBM L;  1HNX L;  2KHI A;  3EBE A;  1PA6 A;  3FKI H;  1VQL A;  1OXV A;  3ZJY C;  2QGQ A;  5K36 G;  3OTO L;  1FL0 A;  1A0I A;  2KCT A;  2GN5 A;  2RHQ B;  3KDF B;  4PMW A;  2JA7 H;  4DV3 L;  1XMQ Q;  2R92 H;  3BZC A;  3CP0 A;  1YIJ A;  2MFI A;  4DR2 L;  1CKO A;  1S40 A;  2N8N A;  1KC8 C;  1G6P A;  2VQF L;  1N8R C;  2HHH Q;  5GQO A;  1QVC A;  1RL2 A;  4A3D G;  4X62 L;  3F1Z A;  1IBM Q;  1EYG A;  2IX0 A;  4GLV B;  4LF9 Q;  2ZTC A;  3STB D;  1NBW A;  3AFQ A;  1YHA A;  1K8G A;  4DR6 L;  1PYB A;  4L5R C;  1OXX K;  2UXC Q;  3K8A A;  5FLX c;  2BA0 A;  1XNQ Q;  4O0A A;  4A3F G;  1VQ5 A;  1C0A A;  3Q8D A;  4YHH Q;  3GDE A;  1N33 Q;  4YWK A;  3STB C;  3I56 A;  3A74 A;  4ME3 A;  1UEB A;  1E1O A;  1UE6 A;  2OQ0 A;  4B3T Q;  3ULJ A;  1YIT A;  4JI8 Q;  2VZA A;  1XMO L;  2IT1 A;  3S17 H;  3UDF A;  2R7D A;  1VQI A;  1YJN A;  1CSP A;  5GAH C;  2NVY H;  1YI2 A;  2B63 G;  2N78 A;  4QJF A;  4UPA A;  1C9O A;  4DPG A;  3M3Y H;  1VCI A;  3HOX H;  1JJC B;  4A3J G;  1N32 L;  4DV6 L;  1XNQ L;  2B29 A;  5JJK A;  4DR1 Q;  3CCS A;  4LF6 Q;  4A3C G;  4A93 G;  1OXU A;  2VQF Q;  4DR6 Q;  1L2F A;  1K73 C;  2XGT A;  4DR2 Q;  3S1M H;  1JJG A;  4LF9 L;  2A1A A;  5IY0 A;  3JAM c;  4DV3 Q;  1XMQ L;  1D7Q A;  4TQU S;  2K5N A;  2JA9 A;  3U4V A;  1GM5 A;  1EFW A;  1HZ9 A;  4RG1 A;  4C3J H;  2HHH L;  2JJQ A;  3PUW A;  1W2B A;  5GAG C;  2NVX H;  5IP9 H;  4IPD A;  4O2D A;  5GAD C;  4QGU A;  4AQY Q;  2HIV A;  3M7N A;  3S2D H;  5FJ8 H;  1WCM H;  3M9B A;  4GNX A;  1VQM A;  1TWA H;  4RMF A;  4NB3 A;  2NZH A;  2NVQ H;  4B3R Q;  3OTO Q;  3PUZ A;  2I0Q A;  4X6A H;  2K4K A;  1YVC A;  3HKS A;  3MXN B;  1KQS A;  4BA1 I;  4DAY B;  1HR0 W;  4DV6 Q;  1E24 A;  2EXD A;  2YV5 A;  2JEA I;  2R7Z G;  4HJ5 A;  1HNZ Q;  1VQH A;  1L1O B;  2JEB I;  2Y0S E;  4C3H H;  4A3L H;  2VS1 A;  1P8L A;  4JI3 L;  3KF6 B;  1XMO Q;  1VQ9 A;  3PUY A;  4OWW B;  2MO0 A;  1XJV A;  2HQL A;  3ERS X;  2Z6K A;  2L15 A;  1X6O A;  1IZ6 A;  3H0G G;  4DV2 Q;  4UY8 C;  3S16 H;  2UXB Q;  2VUM G;  4K0K L;  2MQH A;  1Q12 A;  4GN4 B;  2Q2U A;  1FGU A;  3K81 C;  2PI2 E;  4JYA Q;  4LFB L;  3UE0 A;  5C0X J;  4DNI A;  2QEX A;  2E2I H;  4DR4 L;  3T1Y L;  1MJE A;  1Q46 A;  4H02 A;  1K0R A;  3UDI A;  4IPG A;  4JOI C;  4YY3 L;  3AYH B;  4HIK A;  3RLO A;  4LWC A;  5M3M G;  3HOX G;  4JV5 L;  1AH9 A;  1SLJ A;  4X62 Q;  4YCW A;  3HOV G;  1E7Z A;  3CCQ A;  2Y0S G;  1NJI C;  2R93 H;  3GD7 A;  2D0O A;  4DK6 C;  4YCV A;  4DR3 Q;  2R6G A;  1VQA A;  3RN2 A;  4NXN Q;  1DGS A;  1EUJ A;  4LF8 Q;  1SMX A;  1OXT A;  1FJG L;  2VQE Q;  2Z0S A;  4A75 A;  5IWA Q;  2VNU D;  2UXD Q;  3D0F A;  4TVA B;  4KHP Q;  4LFC Q;  1IBL L;  3HOZ G;  4IFD I;  4DV5 Q;  1ASY A;  2R7F A;  1HNX Q;  3KOJ A;  4OO1 I;  1VQJ A;  1VQE A;  3ER0 A;  2F4V L;  3MEF A;  4QQB X;  1J6Q A;  1U0L A;  1KD1 C;  1EQR A;  3S15 H;  2NN6 I;  5LMN W;  1Y1W H;  3GO5 A;  4LFA L;  1B7Y B;  2WAQ E;  3F2C A;  5LMU Q;  1PH1 A;  4LNQ A;  1UE1 A;  4DV7 Q;  3RLF A;  5C4X G;  3K80 C;  5AJ3 Q;  2DGY A;  4JI7 L;  2ZM6 L;  2KEN A;  2ZJP A;  1IYJ B;  3HOZ H;  2IHF A;  1PH8 A;  2K5V A;  5GAE C;  2VW9 A;  3PGZ A;  3CCL A;  2JA6 G;  2DUD A;  3FKI G;  4AYB E;  4C3I H;  5C44 G;  4DV5 L;  1QZH A;  3CCM A;  4HJ7 A;  1N34 L;  2UUB Q;  3CMA A;  1S3O A;  1CKN A;  5FLM H;  3CPW A;  3HOW G;  3I4M H;  5JJL A;  4QY7 A;  4R1J A;  1G29 1;  1HJP A;  2VQE L;  4BY7 G;  1H95 A;  3CAM A;  5IYC G;  4LF8 L;  3F8T A;  2WP8 J;  4DV1 Q;  3S14 H;  1Y1V G;  4X65 Q;  3L7Z C;  4DAM A;  1K83 H;  4ALP A;  4B3S Q;  2I5H A;  2E2H H;  3PUX A;  2N49 A;  1XPU A;  5IYB G;  3I55 A;  1NMG A;  3A0J A;  4IJL A;  2JA8 G;  3HOY G;  3M4P A;  5ELO A;  1UE5 A;  1K9M C;  2YYZ A;  3K7A H;  1QVG A;  1TWF H;  3J7A 5;  5IE8 A;  4DR5 L;  3GTQ H;  3PO3 G;  1CKN B;  4A3K G;  2PMZ E;  4UP8 A;  3NEL A;  1X9N A;  2UUB L;  4L5T A;  3D31 A;  4DV7 L;  1A8V A;  2IHE A;  4A3L G;  2EQS A;  3BU2 A;  4UP7 A;  3UDG A;  4LFA Q;  3PSI A;  5M3F H;  1Q1B A;  4AH6 A;  4JI3 Q;  5AJ3 L;  1CKM A;  4DUY L;  4JI7 Q;  5C3E G;  1HZC A;  2HT1 A;  4HJA A;  3OYY A;  2V1C C;  2YTX A;  1VQK A;  4NXM Q;  1VQ8 A;  1EQQ A;  1IBL Q;  2RF4 A;  3KJP A;  1M1K C;  4JI0 L;  1TWH H;  5LMN L;  3I4N G;  2K50 A;  3GTO H;  1LYL A;  4JBJ A;  4DR5 Q;  3EIV A;  1KRT A;  1PHJ A;  1FJG Q;  3F2B A;  2F4V Q;  2XTI A;  3GTP H;  1HNW Q;  1A63 A;  1I94 L;  1UWV A;  4LFC L;  3G71 A;  4YWM A;  1JE5 A;  2Q2I A;  3I4O A;  4A3E H;  3H3V H;  1GVP A;  1HZA A;  2K75 A;  4BXX H;  4GNX B;  1EIY B;  5IP7 H;  4C2M H;  2ZJQ A;  1HZB A;  1PH6 A;  4A3C H;  5JEA G;  1KIX A;  2JA8 H;  4XIG S;  3E9I A;  5IYB H;  4JI1 L;  1YJW A;  2E2J H;  4DR4 Q;  4POF A;  3OW2 A;  2E5L Q;  4JYA L;  1KHI A;  1J5E Q;  4R4I A;  1FVI A;  1B70 B;  1XPR A;  1N32 Q;  3PO2 H;  4A3G G;  4JG2 A;  4YY3 Q;  1NY4 A;  3DM3 A;  3PIP A;  4JBM A;  3I4M G;  1XNR Q;  1JMC A;  5EAY A;  4GKJ Q;  5BR8 Q;  4LW1 A;  4JI8 L;  5DLQ E;  4A3I H;  1SN8 A;  2ZJR A;  4A3F H;  1OTC A;  2UXB L;  2MNA A;  1VQN A;  5LMU L;  4GN5 A;  2BA1 A;  4LUO A;  4QIW E;  2OWO A;  2KCM A;  2OTJ A;  4L5Q A;  2AMC B;  1PV4 A;  1A62 A;  1KL9 A;  4BXX G;  3VDY A;  4HIO A;  3TS0 A;  4JBW A;  1X3F A;  4P73 A;  3CF5 A;  3KYH C;  1SFO H;  4HJ9 A;  2AWN A;  4JC0 A;  3J80 c;  1OXS C;  4POG A;  1X3G A;  1BBU A;  3TQY A;  4A3M H;  1C7Y A;  1KXL A;  3TEH B;  4LF7 Q;  1BBW A;  4JI5 L;  4JI5 Q;  1Y14 B;  3JAM i;  3CME A;  1WOC A;  4AQY L;  1VQO A;  3W5O A;  1E22 A;  1JB7 A;  5C0X G;  2NN6 G;  2CWP A;  4MTN A;  4BA2 I;  2LSS A;  4DR7 L;  3RLN A;  3H15 A;  4EX5 A;  1WI5 A;  2UU9 L;  2VY3 A;  5ELN A;  1W3S A;  2K5H A;  3S2H H;  1M90 C;  1E3P A;  1X54 A;  2BH8 A;  3HKZ G;  4X66 Q;  4GLX A;  4YCU A;  2A8V A;  2R93 G;  3TRZ A;  4DV0 Q;  2K14 A;  4LUV A;  3KF6 A;  3U4Z A;  3RN5 A;  1LTL A;  4GKK Q;  1I6H H;  1PH5 A;  3CCU A;  1V1Q A;  1L1O A;  1X55 A;  2CFM A;  4BY1 G;  3CCR A;  1BVS A;  4PZ7 A;  4GS3 A;  3CC7 A;  1VQ4 A;  3UDX A;  2UXC L;  3GTL H;  1Z47 A;  4J15 A;  1AE3 A;  4X66 L;  3T1H L;  1P16 A;  4DK3 C;  1V43 A;  1VS0 A;  4GKK L;  1N33 L;  3J81 c;  2UU9 Q;  3GTK H;  4JI4 Q;  1IL2 A;  1J5E L;  1SRO A;  4DKA C;  1O7I A;  1Q8K A;  1Y1V H;  1PYS B;  2E5L L;  1WFQ A;  1V9P A;  2R7Z H;  1HH2 P;  2ID0 A;  4B3R L;  4DUZ L;  4HIM A;  1PVO A;  1VQD A;  5FLM G;  1YEZ A;  2N3S A;  3HOW H;  4LF7 L;  2UUC Q;  4DR7 Q;  3S24 A;  3L0O A;  4A4I A;  1GD7 A;  4JCV E;  4P74 A;  2JA6 H;  5FJ8 G;  4A3B G;  5HGQ A;  4A3M G;  4KHZ A;  4IFD J;  5IP9 G;  3BJU A;  3GTG H;  1QUQ B;  2EIF A;  4QL5 A;  2H5X A;  1S72 A;  3KDF A;  3CCV A;  5C4X H;  1HR0 L;  2CCZ A;  2KBN A;  1QUQ A;  4OX9 Q;  1L0W A;  5LMN Q;  4IO9 A;  1U5K A;  4JI0 Q;  4DR1 L;  4LF6 L;  2GVB A;  1YNX A;  2WFW A;  1AE2 A;  1KRS A;  2JQO A;  2AKW B;  3I7F A;  3PF5 A;  4JI4 L;  4L5S A;  1VQC A;  5J3B A;  4A93 H;  2AWO A;  1ASZ A;  3IRB A;  3T1H Q;  4OWT B;  3J7Z C;  2UUA Q;  1RIP A;  1NE3 A;  4DUY Q;  3RZD H;  4APV A;  3RR5 A;  1LUZ A;  2B3G A;  1Q82 C;  1VQF A;  1SE8 A;  1EIF A;  1NMF A;  4A3B H;  4B3T L;  2YTY A;  1CSQ A;  4BY7 H;  4A3I G;  1JJ2 A;  5M5W H;  1MKH A;  4YHH L;  1I3Q H;  3CXC A;  1YZ6 A;  1QZG A;  4GKJ L;  4DV0 L;  3ICE A;  4LF4 L;  3PO2 G;  4A3G H;  1XNR L;  3CQZ H;  1UE7 A;  1VQP A;  2JA5 G;  4IPC A;  1SR3 A;  4R4T A;  3UE1 A;  1YJ9 A;  4JI1 Q;  3HOV H;  2Q2H A;  4X64 Q;  3PIO A;  3M4Q A;  3A5Z B;  4UP9 A;  2YU9 H;  4PZ6 A;  1EOV A;  4PG3 A;  4PZ8 A;  2I5L X;  4B3M L;  2VL6 A;  5IP7 G;  2ZTE A;  3S1Q H;  4B3S L;  2ZTD A;  2PNH A;  1B8A A;  4P72 A;  5JJI A;  1I94 Q;  1XTD A;  1YBY A;  1Z9F A;  2F52 A;  3KLW A;  4EQ5 A;  4DV1 L;  2ES2 A;  1K8A C;  1HNW L;  4A3E G;  3H0G H;  1D8L A;  4AYB G; 
#chains in the Genus database with same CATH topology
 2KEC A;  3VMM A;  1XYI A;  1HRJ A;  1BOS A;  2ALZ A;  1BKB A;  2O5J C;  1N34 H;  4JK1 C;  2RCN A;  3L2P A;  3K5L A;  1HPC A;  1VQG A;  2ALY B;  4ZKC B;  3B6Y A;  3KF8 A;  4C5C A;  2K28 A;  1VKZ A;  4QWD A;  1R9T A;  1CQV A;  2VXW A;  2C35 B;  2V58 A;  1T9H A;  4IOC A;  4B3M H;  4GZY C;  1TWG H;  1SJE D;  2W6M A;  3KFU A;  5COR A;  4XQN A;  1CUK A;  3E0E A;  1DZ1 A;  1GKH A;  1FKA H;  1D2B A;  4KKT A;  2YL2 A;  3PR5 B;  5AFW A;  4EQN A;  3PO3 H;  3P7J A;  2Z1C A;  4ZQI A;  4CDF C;  4Y7N H;  1X3E A;  3M4O H;  4YQW A;  1KAW A;  1HR0 H;  5KT6 A;  1WYD A;  2NVT H;  4M7E A;  4EGV A;  4BBS B;  2PQA B;  1SBB B;  3N42 B;  4J6H A;  3NWT A;  1UNS A;  1G51 A;  1SXT A;  2A69 D;  2B63 H;  2HD3 A;  1Q1E A;  4M8A A;  4IHJ F;  3JRW A;  1TS2 A;  4HMJ A;  2X0S A;  1JX4 A;  1MJC A;  3PF4 A;  4JI0 H;  2KSW A;  5IYD H;  3GTM A;  4YAJ B;  1Y8P B;  2VA2 A;  3SGI A;  2XCP A;  2EZV A;  4EEQ A;  4O3S A;  2FLL A;  1IXR A;  3I4N B;  4Q5V A;  3TP8 A;  4R8U B;  3DLL A;  4IUU A;  4MTD A;  1L0Y B;  1A3U A;  4QWC A;  3PV0 A;  2R92 A;  2W6Z A;  2R7Z B;  1PLF A;  2F3I A;  2MGS A;  4FDB A;  1H9M A;  2VPS A;  5IOC A;  2BH2 A;  1KDA A;  4BBR G;  4YWL A;  1O75 A;  2JEI A;  2MO1 A;  3E9H A;  2JEF A;  4A3J H;  1E1T A;  4IUP A;  3CC2 A;  5C3W A;  4HR7 B;  3P75 A;  1EUD B;  3TII A;  1EWI A;  1MIU A;  3NXW A;  1PH9 A;  1IBK Q;  3KXY T;  3E0J A;  3R3O A;  4UAI A;  5IYD G;  1LT6 D;  3J7A F;  4NMZ A;  2W9C B;  4EBE A;  4LUZ A;  1EZ1 A;  2UVW A;  3J81 W;  2QEJ C;  3QWN A;  1I6U A;  2KHS A;  4X64 L;  4RCN A;  2EJG C;  3W1B A;  5FLX W;  4KV6 A;  2RHS B;  1DOM A;  3V6K A;  1ML0 D;  2CH4 W;  2HIX A;  4LF4 Q;  3N8D A;  5EWE A;  2K03 A;  5KFO A;  1CQF A;  1T36 A;  3MFY A;  4MIU A;  3K7U C;  3GTP B;  4YJ2 F;  3HOX B;  5KFV A;  4OIK A;  1H9K A;  4KY5 A;  3NHH A;  2W6O A;  1JQY D;  1TXY A;  3W2D A;  1UUP A;  4JV1 A;  2WB1 A;  2E74 C;  2UUA L;  5KFR A;  2PBZ A;  4ME5 A;  1H9R A;  2CHB D;  1GO3 E;  3NEN A;  1LM0 A;  1TT2 A;  5KFS A;  2SCU B;  5IT9 E;  2UU9 H;  4DV4 L;  4DK0 A;  1AUV A;  3U50 C;  5DEH A;  3HG9 A;  1DIK A;  1KDC A;  5K36 G;  2F4I A;  3HOZ B;  2F0E A;  2RDF A;  2Z9H A;  1EOT A;  1ESF A;  2PNR C;  2FPP B;  2F0W A;  1PRT C;  5EPJ A;  1N8R C;  4X66 H;  4ZLT F;  4PWQ A;  1MD2 D;  1U4L A;  4X62 L;  4K8I A;  2ZTC A;  4ILW A;  1NBW A;  1OXX K;  2UXC Q;  3K8A A;  4DXG A;  5FLX c;  4O0A A;  5T1I A;  1VQ5 A;  1C0A A;  3Q8D A;  4QIW A;  1STY A;  1EZ6 A;  4Q8E A;  1ENF A;  4OEL B;  3N43 B;  4ULL A;  4ZAI A;  4RGN A;  2VZA A;  4I50 F;  1XMO L;  2IJ0 A;  2R7D A;  2UVV A;  1F77 A;  3K3P A;  2R93 B;  5GAH C;  3S1Q B;  3CQZ A;  4QJF A;  4UPA A;  2XVS A;  1S5C D;  4EBD A;  4DV6 L;  2B29 A;  3KUP A;  1I4P A;  2YZG A;  1SNM A;  1RTN A;  4A3C G;  1EYD A;  2EYO A;  2HVQ A;  3F8N A;  4EGQ A;  2VQF Q;  3S1M H;  1K73 C;  1JJG A;  4JI3 H;  5IY0 A;  1CHQ D;  4RHR A;  3DXJ C;  1XMQ L;  3GLK A;  2B2W A;  2XNA C;  1D5M C;  2SOB A;  1EFW A;  5FD6 A;  3C46 A;  4RG1 A;  3R2I A;  5GAG C;  4AQY Q;  4IPD A;  5FO7 B;  1K1Q A;  1SEI A;  2AUJ D;  2DY8 A;  1WCM H;  3M9B A;  1FR3 A;  4H13 C;  2NUA B;  2AGO A;  5KT7 A;  3OTO Q;  2RGR A;  4X6A H;  3HKS A;  5KFI A;  2BQ3 A;  5CGK A;  1HR0 W;  4FYD A;  3DEP A;  3NTI A;  4HJ5 A;  1E2W A;  2RDI A;  1L1O B;  4A3J B;  2C5C A;  1JXL A;  4B3S H;  1ZYR D;  3OWF A;  4NW2 A;  5C3X A;  1IW7 D;  3KF6 B;  2YZM A;  1E4E A;  1XMO Q;  5CV4 A;  1FJG H;  1HFG A;  4OWW B;  2RDJ A;  2R84 A;  3H0G G;  1PZI D;  2OXP A;  2F0O A;  1SMY C;  1SEB D;  5E4X A;  4J9P A;  2VUM G;  2FK1 A;  4K0K L;  2Y0S A;  3KLR A;  4CDC C;  2NYZ D;  3CVZ A;  2IMW P;  1M0W A;  3UE0 A;  2FKL A;  4G3I A;  2QEX A;  1RTO A;  1WTW A;  3T1Y L;  4H02 A;  4ZRZ A;  4IPG A;  4JOI C;  3RLO A;  3HOX G;  1AH9 A;  2DPJ A;  1AW7 A;  3CCQ A;  2W6Q A;  5JQW A;  4DK6 C;  1WTQ A;  5CV9 A;  3RN2 A;  1DV1 A;  1JOQ A;  5D3I B;  4ZKB B;  4LF8 Q;  1SMX A;  1SYE A;  2ICE C;  5IWA Q;  1IW7 C;  3GV3 A;  3WNZ A;  4LFC Q;  5IT9 W;  4IFD I;  2HVR A;  4LK1 C;  1HNX Q;  4OO1 I;  3KHH A;  4GKJ H;  2EYJ A;  1M6V A;  1KD1 C;  3S15 H;  3CRK C;  5HGT A;  1I4X A;  3RMH A;  1KNE A;  3CHB D;  1Y1W H;  4TRD A;  1K0S A;  3K5H A;  4J9Q A;  3KAK A;  1B7Y B;  1PMR A;  3MWD A;  5LMU Q;  4DV7 Q;  4IUV A;  5C4X G;  2NU8 B;  2F0D A;  2DGY A;  2NUC A;  2ZM6 L;  2DZD A;  4U6P A;  1PH8 A;  3UI2 A;  3C1F A;  4AYB E;  3I4M B;  3AU7 A;  2UXB H;  1S3O A;  4LJZ C;  5LMU H;  1S0N A;  1G29 1;  1HJP A;  1FD7 D;  1FGB D;  5IYC G;  1HQM C;  4ZYS A;  4DL4 A;  5DLF A;  1Y1V G;  2UVR A;  5KG5 A;  1RJP A;  2N55 A;  1K83 H;  3RZO B;  2XWJ B;  1GJX A;  1PRT B;  1HNZ H;  3HOY B;  5IYB G;  4DLK A;  2YYA A;  3A0J A;  5JEA H;  5EPL A;  3NTK A;  3T5J A;  1UE5 A;  3J7A 5;  1TWF H;  2YCH A;  1VMP A;  2VUM B;  2YU9 B;  1CKN B;  3S2D B;  4F88 A;  1HUN A;  2K5D A;  3EA6 A;  1WTR A;  2WE6 A;  2UUB L;  3KAJ A;  3MR6 A;  1MI2 A;  4A2B A;  3D31 A;  4DV7 L;  4A3L G;  3UDG A;  1IOV A;  1S4Z A;  1CKM A;  4DFA A;  1HZC A;  5EOY A;  1J8I A;  3G6X A;  2W57 A;  2BE5 C;  1VQ8 A;  2TSS A;  5LOV F;  3M4I A;  1IBL Q;  2R8K A;  4AYB B;  3KJP A;  4JI0 L;  1TWH H;  4DV1 H;  2C00 A;  1WTX A;  1WCM B;  3EIV A;  4IUR A;  2F4V Q;  5KFD A;  4O2A F;  2XTI A;  3G6J B;  2JP1 A;  4APM A;  1I94 L;  1UWV A;  4LFC L;  4KJO A;  1JE5 A;  3V05 A;  4EVO A;  5L1K A;  1GVP A;  5KFL A;  2Z6B A;  2R8G A;  1N33 H;  3V4S A;  2R8I A;  1HZB A;  2O2L D;  4Y7N B;  1XNQ H;  4B08 A;  1KIX A;  4KY7 A;  4EG0 A;  3E9I A;  2NVT B;  1EIG A;  1YJW A;  2XRS D;  4ZK9 B;  2E2J H;  4LFA H;  4B3R H;  1UEA B;  4OEM B;  3WO0 A;  5KGU A;  1KHI A;  2R7M A;  2W9B B;  2F0S A;  1J5E Q;  5CA0 F;  4LF9 H;  1XPR A;  3PO2 H;  3DHQ A;  2GA4 B;  4YY3 Q;  1NY4 A;  3DM3 A;  3GTK B;  5I2Y A;  3NQI A;  1EQV A;  3PVX A;  1SN8 A;  5DM7 3;  2VQF H;  2QK4 A;  4ED7 A;  2UXD H;  1VQN A;  4LF6 H;  2OWO A;  1RKN A;  1S0M A;  3GV7 B;  2W7O A;  1ENC A;  2AU0 A;  1F9P A;  5JVL A;  2DPI A;  4HIO A;  3KHG A;  2E76 C;  4U7C A;  2XC9 A;  3G8C A;  2CW0 D;  1ZKO A;  3KYH C;  4DAY A;  1DON A;  1HFN A;  3EFX D;  4KJN A;  3D4W A;  1OXS C;  4POG A;  1RJR A;  5H80 A;  3TQY A;  4UCT A;  2RDH A;  4UCV A;  4MAM A;  4RB2 C;  5IGC A;  1WOC A;  4CKE A;  4AQY L;  4CDD C;  4A3M B;  1EEI D;  2NN6 G;  1M4V A;  2VY3 A;  4RNO A;  1GUT A;  3DM1 A;  3SK8 A;  3S2H H;  5C6A A;  3EYY A;  3HEJ A;  1GUO A;  2O03 A;  2BQU A;  5KFP A;  4ED1 A;  5I6W A;  1VBH A;  3K0Y A;  3KF6 A;  4Q8F A;  4GKK Q;  1I6V C;  3CCU A;  1L1O A;  5FLX L;  1H9S A;  3R23 A;  4FO2 A;  1JOK A;  1MBY A;  4DR3 H;  3DMU A;  4J15 A;  4GKK L;  1KAA A;  4DL5 A;  2B2V A;  2C9O A;  1JKJ B;  3URY A;  3LWE A;  4JI4 Q;  1B2T A;  2PZU A;  4DKA C;  3HZX A;  5KRU A;  1V9P A;  5C1O A;  5LYJ F;  1G6Z A;  5ELE A;  4DUZ L;  2L11 A;  5FLM G;  5M5Y B;  2M9V A;  1W6K A;  1K8O A;  1NSN S;  4A4I A;  4JCV E;  5FK9 C;  5FJ8 G;  4OO1 H;  1IOW A;  4KHZ A;  1F9R A;  4LF4 H;  5IP9 G;  3ZYY X;  3BJU A;  4QL5 A;  1S72 A;  3OHA A;  2H5X A;  4JI8 H;  1XWE A;  3KDF A;  4S3S A;  1QNK A;  1HR0 L;  2CCZ A;  1QUQ A;  5C5J A;  1L0W A;  3Q8S B;  4IO9 A;  4EBC A;  3NQT A;  1YNX A;  3E3X A;  3J80 L;  2AKW B;  2K33 A;  1XTC D;  4RUC A;  4DV6 H;  3IAY A;  3BQ1 A;  2AWO A;  3HOU B;  1S68 A;  3IRB A;  3T1H Q;  1WTO A;  1TWC A;  3PW2 A;  3ERQ A;  4APV A;  1LUZ A;  4XX0 B;  1EIF A;  4FF1 A;  3J81 E;  4J9O A;  1I6H B;  1CSQ A;  1CI3 M;  2HHH H;  1JJ2 A;  5M5W H;  1YZ6 A;  1L2Z A;  1BCP D;  4TV9 F;  5F9N A;  3CQZ H;  1UE7 A;  3UE1 A;  5KND A;  5LP6 F;  4X64 Q;  4F50 A;  4FM9 A;  3M4Q A;  4XT1 B;  1EOV A;  4PZ8 A;  4AYB A;  4ETS A;  2I5L X;  1DV2 A;  1TVX A;  2SNM A;  1TII D;  2VL6 A;  2ZTE A;  3S1Q H;  3T5L A;  2JA5 A;  1B8A A;  2L5T A;  3C0F B;  4LH7 A;  3D3R A;  1IYU A;  2AQ1 B;  2F52 A;  1HNW L;  1MGS A;  5KNB A;  2J7Z A;  3BJY A;  2G5D A;  3N41 B;  4MA0 A;  1SFO B;  3CU7 A;  1IBK L;  2NU9 B;  1SCU B;  4YHH H;  4X3S A;  1GGO A;  4NXM L;  2XN9 C;  4OO1 G;  5KT2 A;  5JPM C;  4C3I B;  4GNX C;  3TQ1 A;  4IFD G;  5C3E B;  3BQ0 A;  4XQQ A;  2K7V A;  1B9N A;  2A6H D;  2WB1 B;  4JBK A;  2YU9 A;  1BXT A;  5DAU A;  3J81 j;  4DV4 Q;  2PVP A;  1Z2P X;  2EVB A;  2EY1 A;  4X3T A;  5EJW A;  3Q0A A;  2K52 A;  1I7N A;  5BMV F;  4JUZ A;  3VYU A;  3FKI A;  3ULL A;  4MNO A;  4KLK A;  4IFD H;  4TQS A;  3MXU A;  5M3M H;  4ECY A;  5BR8 L;  5KYI A;  4FBT A;  4O1N A;  1FYC A;  4C3J G;  1I50 B;  2CWA A;  4GOP B;  5D1P A;  3GQC A;  1ZHS A;  4FVM A;  5CV5 A;  4O3R A;  3GTG A;  3OSN A;  4C1N I;  4YR2 A;  5CA1 F;  4NP5 A;  4RCO A;  1TKW B;  5K5P A;  4JI2 L;  4BY7 B;  2VB2 X;  1YHB A;  2MCT A;  1SYX B;  2HDM A;  2YTV A;  4KTA A;  4ME6 A;  3MAQ A;  1ILQ A;  4DXF A;  4RU9 A;  4QWA A;  3CPF A;  1N36 L;  1I4H A;  2B8F A;  1N34 Q;  1QVF A;  1ZQ7 A;  4WD3 A;  2JE6 I;  4GOP A;  1JIC A;  1MSG A;  3FDS A;  2YRX A;  2EYF A;  4FXG C;  1DD2 A;  5C44 H;  1WCM G;  1K3R A;  5A2Q E;  1X56 A;  2OQK A;  2A5H A;  3TRE A;  4LF5 Q;  1PDQ A;  4DV2 L;  4YBZ B;  1I4Q A;  5JVG 3;  3FPP A;  5DLG A;  4RGM A;  1VF5 C;  4Y52 H;  5M5Y H;  1SRU A;  1GUG A;  3K5N A;  3OSO A;  4BBR H;  3AMU A;  2ZDQ A;  3G48 A;  3GIP A;  2R8J A;  4JI6 Q;  2HJW A;  3J80 i;  1K3B C;  5C5M A;  3VR4 A;  3GTM H;  1JCK B;  1F2L A;  3CCJ A;  1ILP A;  5KT3 A;  2R92 G;  1JT8 A;  3CC4 A;  4GLA C;  4GN3 B;  1Y1W A;  1I5F A;  5T1G A;  1E2Z A;  1AEX A;  4NXN L;  4FF3 A;  3T13 A;  3U58 A;  5KFT A;  1T5E A;  2J0T D;  4NPS A;  4R7R A;  2V4D A;  4KD4 A;  1HHV A;  3ETJ A;  3RBE A;  5D3D A;  4JI6 H;  5BN5 A;  2JA8 B;  3M9N B;  4WJ3 M;  5IT9 L;  3E5S A;  3PW0 A;  2JXM B;  1PH4 A;  3AQQ A;  4JI2 Q;  1VQ7 A;  4XDX A;  3GTJ H;  4IOA A;  5KFG A;  3S2H B;  4O4I F;  3HOU H;  4KK7 A;  3N44 B;  5KFX A;  1EEF D;  2VUM H;  4HID A;  3AB9 A;  4O4L F;  1TWF B;  3T5H A;  4DL3 A;  5D1O B;  1CS0 A;  3HBL A;  3S1N H;  2OTL A;  2E2I A;  3EN2 A;  3HOY H;  3EPI A;  3HOU G;  4ECX A;  3S1N B;  5DQH A;  5CV6 A;  2C28 A;  1O7Z A;  3V6H A;  5CC4 A;  4ECV A;  4JI4 H;  5H1S E;  3ULP A;  2RBM A;  3HKZ E;  4OON A;  4E6I A;  2V4Q A;  4JVZ A;  2CKZ B;  2WB1 G;  5C3E H;  2B2V C;  1R4P B;  3LNN A;  4K6D A;  4B9X A;  1HNX L;  1D5X C;  1IBM L;  5F9L A;  3Q8Q B;  3NSW A;  4C3I G;  2YS6 A;  3GTQ B;  4JV2 A;  3T5K A;  2PZT A;  4H0L C;  2KCT A;  1A0I A;  4PMW A;  2GN5 A;  2JA7 H;  5KIX A;  4DV3 L;  2PMZ A;  1Y8O B;  3CP0 A;  3VA7 A;  2MFI A;  5C8Y F;  1G6P A;  2VQF L;  2PPB C;  4MV9 A;  5GQO A;  3L4J A;  2QW7 A;  3U9S A;  5IYZ F;  4A3D G;  2XIW A;  5EZY F;  4ECS A;  1N32 H;  4LF9 Q;  2IX0 A;  4GLV B;  1J5E H;  2K32 A;  2QF7 A;  1JLL B;  1CK1 A;  4C1N K;  3AFQ A;  1YHA A;  3MR5 A;  4DUY H;  2E2J B;  2I8C A;  5D1O A;  4RB0 A;  4C5B A;  2BA0 A;  4A3F G;  5EQ0 A;  4YHH Q;  4JV0 A;  1H9S B;  3GDE A;  2F0N A;  1N48 A;  1DXM A;  4ME3 A;  5LMN H;  1UE6 A;  1JWM D;  1SSO A;  2W71 A;  1GUS A;  3UDF A;  4J0M A;  1I94 H;  3HKZ B;  4NKL A;  1AN8 A;  4BWS C;  2NVY H;  2AUK A;  4RKB A;  2OEO A;  5KFA A;  3RD4 A;  1X3P A;  4A3J G;  4EQO A;  1N32 L;  4R8I A;  5JJK A;  3RGX A;  3RUZ A;  3QG1 A;  4X64 H;  4LF6 Q;  3CCS A;  4IZO A;  3KHL A;  1OXU A;  1QB5 D;  4DR6 Q;  4HCE A;  4EYH B;  1L2F A;  3I70 A;  1LV9 A;  2A1A A;  3JAM c;  5L1J A;  4ED0 A;  1D7Q A;  2K5N A;  2JA9 A;  2C2E A;  4TQR A;  2XCL A;  1IKL A;  1B53 A;  1LTI D;  3M7N A;  5IP9 H;  3JAM L;  3P20 A;  1WD1 A;  3DWP A;  2AQ2 B;  3S2D H;  1QNU A;  3K5I A;  2FFK B;  4CJ0 B;  4RMF A;  4B3R Q;  4IRC A;  5JH7 F;  4I7Z C;  3D4R A;  3T1H H;  4IUT A;  4J8Q A;  1SND A;  4DV6 Q;  5KFH A;  2F0U A;  5JVH 3;  3SK4 A;  2ENB A;  1GOZ A;  1HNZ Q;  1STN A;  2JEB I;  1B3Q A;  2KJX A;  1P8L A;  4CC6 A;  1KJ9 A;  5IGD A;  4CKC A;  2MO0 A;  1LT3 D;  3T56 B;  3R5H A;  3ERS X;  2Z6K A;  2L15 A;  2UXB Q;  2W9C A;  2Q8T A;  1Y69 U;  1IBL H;  1WH2 A;  1A9X A;  2PI2 E;  3Q1K A;  5C0X J;  4FXK C;  4UCU A;  3UDI A;  1K0R A;  1SNC A;  4X3U A;  1DCZ A;  4MV1 A;  1SLJ A;  4YCW A;  3HOV G;  5JOB A;  2FMC A;  4YCV A;  3SR1 A;  3QOJ A;  2R6G A;  1VQA A;  1KTK A;  4QUF A;  3MR3 A;  1NNX A;  1DGS A;  1IHZ A;  4N9T A;  5K2M A;  3WO1 A;  5L1L A;  2R92 B;  2PQE A;  2VQE Q;  2Z0S A;  3BDL A;  3FKI B;  4KHP Q;  4DF7 A;  1BDO A;  3TQT A;  4LFC H;  5EDW A;  1U9R A;  4KHP H;  2G9D A;  1VQJ A;  1VQE A;  2F4V L;  2VQE H;  3MEF A;  3MWE A;  2JEJ A;  1XNR H;  1C48 A;  1J6Q A;  2HUG A;  1HQR D;  3T53 B;  2NN6 I;  3OMG A;  2F0J A;  3GO5 A;  2NBF A;  4GC6 A;  2J6T A;  3OUU A;  4L63 B;  1PH1 A;  2WAQ E;  4J9S A;  5FPR A;  1SFO A;  4KHV A;  1VDZ A;  1OWT A;  2K1B A;  5DQI A;  2ZJP A;  1IYJ B;  2SNS A;  3HOZ H;  5GAE C;  2VW9 A;  3CCL A;  4XXE A;  2JA6 G;  4I55 F;  3K59 A;  4IZ8 A;  4C3I H;  1SYG A;  5C44 G;  1QZH A;  3GTJ B;  2CW8 A;  3I4M H;  4QY7 A;  2W70 A;  3CAM A;  2R6F A;  1CHP D;  2B8G A;  4F4Z A;  4DL7 A;  3L7Z C;  3S16 B;  3OIP A;  3A8I E;  1DOL A;  4DAM A;  4ALP A;  3SK6 A;  1TWF A;  2K01 A;  3I55 A;  4EFE A;  5C4Z A;  1AN7 A;  5BR8 H;  3K7A H;  2EYM A;  3TIG A;  4DR5 L;  3GTQ H;  4ZHQ F;  3MR2 A;  3GTJ A;  4UP8 A;  3ERO A;  5C4X B;  4AQY H;  2F0V A;  3TBI B;  3R5F A;  1PXU A;  2ZT9 C;  5CBE E;  2EQS A;  1NUC A;  3J80 E;  4RHS A;  4UP7 A;  4LFA Q;  4BBR B;  4X62 H;  1LTG D;  1Q1B A;  4AH6 A;  4DR6 H;  3MZ5 A;  1JWS D;  4RFB A;  2V1C C;  1JE4 A;  1VQK A;  3NBH A;  1EQQ A;  4DU9 A;  3I4N G;  1ROD A;  1FJG Q;  2M05 A;  1KRT A;  3T16 A;  3F2B A;  1XMO H;  1JR0 D;  3N40 P;  1A63 A;  1B04 A;  2NVY B;  4YWM A;  2Q2I A;  3H3V H;  4A3E H;  2FJ2 A;  2EJF C;  4GNX B;  1EIY B;  1B50 A;  4KY6 A;  4C2M H;  1EU4 A;  1PH6 A;  5JEA G;  4POF A;  2E5L Q;  4JYA L;  4RUA A;  1FVI A;  4ED3 A;  2Y0S B;  1N32 Q;  3RB4 A;  4A3G G;  1N56 A;  4WRD A;  3QJY A;  3MA2 B;  4JBM A;  3KBG A;  1PRT D;  3BYT B;  4FU0 A;  4Q0Y A;  1JMC A;  5EAY A;  3S17 B;  5BR8 Q;  4JI8 L;  5DLQ E;  2GLT A;  4A3F H;  1LT4 D;  5LL6 X;  5EPK A;  2UXB L;  3GIJ A;  2BDN A;  3WDN A;  5LMU L;  4UFZ A;  1S97 A;  4QIW E;  4F7X A;  1EL0 A;  4J9R A;  2OTJ A;  4L5Q A;  1PV4 A;  1A62 A;  3FMC A;  1GLV A;  1KL9 A;  2ZXO A;  4TV8 F;  1SYD A;  3CF5 A;  2KCN A;  2ZJT A;  1GSH A;  2HCC A;  2EOT A;  3DWQ A;  5JJZ A;  4JC0 A;  3K6O A;  5DGB A;  1UAP A;  4A3M H;  1Y8N B;  3G6V A;  3H3V C;  5KNC A;  1A15 A;  4JI5 Q;  2MJ8 A;  4MV4 A;  1WSC A;  5FPO A;  2IW3 A;  4IN3 A;  4DV2 H;  1B3A A;  4DV7 H;  4MTN A;  2LSS A;  3NPP A;  3RLN A;  3H15 A;  4ZUJ A;  2L0C A;  5ELN A;  1W3S A;  1EY0 A;  1M90 C;  2R93 G;  1O7Y A;  4X66 Q;  4L8J A;  4YCU A;  4QW9 A;  3VPC A;  3Q22 A;  1HNX H;  3K3V A;  3MFH A;  4CDE C;  1JDE A;  2B63 A;  1LTL A;  1I6H H;  1PH5 A;  5A2Q L;  2W9B A;  2CFM A;  3HKZ A;  2DN8 A;  1IBK H;  4QIW B;  4QWE A;  4YJ3 F;  1AZQ A;  1EU3 A;  1VQ4 A;  3UDX A;  2XWB B;  2B2W C;  2UXC L;  3LML A;  1B44 D;  1WTV A;  4DK3 C;  4O3N A;  1V43 A;  1VS0 A;  1N33 L;  3RIZ A;  3J81 c;  2UU9 Q;  1IL2 A;  1O7I A;  1PYS B;  2EPB A;  4ED2 A;  2EY2 A;  2MUY A;  2ZM6 H;  3HOW H;  1YEZ A;  2A73 B;  2KA7 A;  3Q8P B;  2WKD A;  1EFI D;  3L0O A;  4K5X A;  4FS1 A;  4A3D B;  3PW4 A;  5F2D A;  4A3B G;  4XT3 B;  5DGA A;  3KHR A;  5KFM A;  4RNN A;  5E4W C;  4O3O A;  1DM0 B;  2UVU A;  2VPQ A;  1T3N A;  3H4B A;  2PMZ B;  1QUQ B;  1ICW A;  1S03 G;  5C4X H;  1HA6 A;  2W6P A;  1AZP A;  5LMN Q;  1U5K A;  3MTS A;  4JI0 Q;  4LF6 L;  3RB6 A;  2NVQ B;  1W6J A;  1AE2 A;  1CM9 A;  2WFW A;  3IFD A;  3I7F A;  4JI4 L;  3R2T A;  3O13 A;  1VQC A;  5J3B A;  4A93 H;  3H0G A;  1ASZ A;  3PMF A;  3J7Z C;  1Z2N X;  5CBA E;  3RR5 A;  5TSS A;  2B3G A;  1B9M A;  1IBM H;  1SE8 A;  4ID6 A;  2YTY A;  4BY7 H;  3GIK A;  1UC8 A;  1VMC A;  4FF2 A;  4EFB A;  4OIJ A;  3KK7 A;  3KAL A;  3CXC A;  3H91 A;  3PO3 B;  2L1B A;  4GKJ L;  1PFN A;  4DV0 L;  3PO2 G;  2JA5 G;  4IPC A;  4R4T A;  1XX8 A;  2X69 A;  1KLG D;  1PRT F;  2Q2H A;  4MV7 A;  3MC0 B;  4UP9 A;  5FOB B;  4V0B A;  4IUN A;  5JUM A;  2ZTD A;  1SE2 A;  1I94 Q;  4O2B F;  4J9N A;  1XTD A;  4HR7 A;  2FLP A;  1YNN C;  4EQ5 A;  3PIO 3;  4RAY A;  4F4X A;  2ZXP A;  3J81 L;  1D8L A;  4IRK A;  1G8Z D;  1NTG A;  2HCI A;  5KKN B;  2FLN A;  3T51 B;  2WAQ A;  2K6A A;  4R4Q A;  3I4N H;  1SDF A;  4JI6 L;  4AIM A;  2RGV A;  3RJ0 A;  2ATW A;  4LFB H;  4TSS A;  1LTS D;  5EGT A;  1K28 A;  4MZ9 A;  5C5L A;  1Q81 C;  2E8G A;  4DAV A;  4MA5 A;  2OF1 A;  4J9K A;  4P2C B;  2ASB A;  2R61 A;  2IX1 A;  5D8D A;  1ET9 A;  2QA4 A;  1WJJ A;  2EJM A;  4LF5 L;  3PCO B;  4DUZ H;  2QCP X;  2CQA A;  4BWG B;  1KNA A;  3M9M B;  2PYK A;  3JRX A;  4MHE A;  2F0I A;  2DIK A;  3A7A B;  5HV6 A;  5J39 A;  2OH2 A;  3DWA A;  3GTM B;  3M4O B;  3NBH B;  3MWY W;  2IY5 B;  1PH2 A;  5M5X H;  4J9L A;  3PW5 A;  3HP3 A;  4KHP L;  1S0O A;  1A3T A;  4YIJ A;  3P1H A;  3C2P A;  3TS2 A;  1Q86 C;  4A3G B;  2UXD L;  2HVS A;  4NLG A;  1VAJ A;  4ZUI A;  4J9M A;  1EQT A;  1ZET A;  5IT9 c;  4CGY B;  1N36 Q;  2PQA A;  1V8Q A;  1PX2 A;  3NEM A;  3N6R A;  1V51 A;  5IYC H;  2GVA A;  4JPB W;  3HRZ C;  3W1G A;  5D14 A;  2A68 C;  3G4S A;  2J9G A;  4FBU A;  4QCL A;  2B2Y A;  2IL8 A;  4PV1 C;  3GTG B;  2FXQ A;  4QB4 A;  1I50 A;  4FP5 D;  5LL6 b;  4O4H F;  3M9O B;  5DM6 3;  2FK3 A;  2DWC A;  1K1S A;  3QFF A;  4C3J B;  1FNW A;  1WCM A;  4JI1 H;  2JA7 A;  2Z4I A;  3KF8 B;  3F2D A;  4CHT B;  1Y1W G;  2F0L A;  2WB1 E;  3HFZ B;  2D2C C;  4LAA A;  1HTP A;  4OXP A;  1XPO A;  2I87 A;  4HTH A;  1X65 A;  4Q44 A;  4CBV A;  5K36 H;  4DNR B;  3MWM A;  4G7O C;  5HY6 A;  1SMY D;  4DR3 L;  2JK8 A;  2UUA H;  4GKK H;  2CQO A;  1K83 B;  3RZO H;  3FDT A;  3J7A K;  3L9A X;  3BDC A;  4IR9 A;  4DUZ Q;  3BQ2 A;  4X65 L;  3TP5 A;  1VQB A;  4BBS G;  4OX9 H;  3K57 A;  3I3C A;  3NE5 B;  4ECW A;  1YHQ A;  1PZJ D;  3FP9 A;  2Z6K C;  5C44 B;  1PYW D;  3F2U A;  4LFB Q;  3JC6 6;  1C3O A;  4R4O A;  1KJJ A;  2R8H A;  1EZ8 A;  5G3L F;  3CCE A;  1WVL A;  5G3L D;  3HB9 A;  4BBS H;  5LL6 S;  4RB1 A;  2FB9 A;  2LXJ A;  3RB0 A;  1TA8 A;  3OOC A;  5KFJ A;  1Z2O X;  1RYR A;  1CFM A;  3LGJ A;  4OHJ A;  2LXK A;  2P0A A;  4OX9 L;  3BZK A;  4RAZ A;  5EKK A;  5FO9 B;  3X3M A;  2H1E A;  1PA6 A;  4H7B A;  2CVR A;  3ZJY C;  4IRD A;  2QGQ A;  2SDF A;  1FL0 A;  2RHQ B;  3KDF B;  2RDG A;  4CJ1 B;  1XMQ Q;  1T5X D;  1YIJ A;  2TMP A;  3GIL A;  4DR2 L;  1KC8 C;  1S40 A;  2N8N A;  4ZQ3 A;  5KG6 A;  2HHH Q;  4G7H C;  2DJG C;  4YY3 H;  1QVC A;  3F1Z A;  1IBM Q;  3BDO A;  1EYG A;  2F1M A;  5IGE A;  5T14 A;  4DV4 H;  4DR6 L;  2X6G A;  2XCA A;  2Z8L A;  1I4G A;  1S5F D;  1XNQ Q;  1EWH A;  2VA3 A;  1CZW A;  1EY6 A;  3BG5 A;  1N33 Q;  1C8C A;  3NBI A;  3STB C;  3A74 A;  2OQ0 A;  4B3T Q;  3ULJ A;  1YIT A;  4PQX A;  2W7P A;  4C56 C;  1AUX A;  3GII A;  2XIG A;  1U4R A;  1X32 A;  1Q3L A;  4L6T B;  1CSP A;  1D1K A;  3J80 W;  1YI2 A;  2B63 G;  4F4W A;  1B4O A;  1WTP A;  4DPG A;  1C9O A;  1VCI A;  3HOX H;  2CQY A;  1W96 A;  4DR1 Q;  4A93 G;  1BCP C;  3BAA A;  2XGT A;  4DR2 Q;  5KFE A;  3RUP A;  5ELC A;  4ED6 A;  1X3Q A;  4K5W A;  3FRP B;  2NVX B;  2QKI C;  1GM5 A;  1HZ9 A;  1STB A;  3L3O C;  2HHH L;  2JJQ A;  2H4O A;  3PUW A;  4WFN 3;  1W2B A;  2NVX H;  4O2D A;  4A3B B;  3NP8 A;  4FXD A;  2F0M A;  5FJ8 H;  4KD3 A;  4GNX A;  3TP7 A;  1VQM A;  1TWA H;  3RAQ A;  2NZH A;  2NVQ H;  4DR4 H;  3D8G A;  3JAM W;  2I0Q A;  1UNN C;  3HXL A;  1YNJ D;  1YVC A;  4PDB A;  4BA1 I;  1ICF B;  4DAY B;  2GPS A;  1E24 A;  2YV5 A;  2JEA I;  2P5Z X;  1RYS A;  1WTH A;  4GC7 A;  1G2S A;  3HS0 C;  4WJW A;  4HYK A;  2I07 B;  2KVM A;  2VS1 A;  4JI3 L;  2XGQ A;  2EDG A;  1HNW H;  3QIA A;  3PUY A;  3MFI A;  4N8F A;  2HQL A;  2IPK D;  3SK5 A;  4DV2 Q;  3RBD A;  2F0T A;  5HBR B;  5CR3 A;  1S5E D;  4HNU A;  4NXM H;  3MEH A;  3KLS X;  4JI5 H;  2IA6 A;  1EIH A;  1Q12 A;  4GN4 B;  2F3W A;  1FGU A;  2PO4 A;  4JYA Q;  5J2T F;  1NR2 A;  4DR4 L;  4I4T F;  1F2Y A;  4ECQ A;  1Q46 A;  2FJZ A;  2WII B;  4HIK A;  1KJI A;  3OPO A;  5L9X A;  1E7Z A;  1NJI C;  3J7A V;  5ELD A;  1A6X A;  1ZHQ A;  4DR3 Q;  4Z9C B;  3GV6 A;  4NXN Q;  3MJF A;  2K5Q A;  3OW7 A;  3KTM A;  1EUJ A;  2C22 A;  1HTL D;  1FJG L;  1OXT A;  2KCC A;  5KEE A;  4A75 A;  2VNU D;  3D0F A;  4QMG A;  1EY7 A;  1ASY A;  3KOJ A;  4O3P A;  3ER0 A;  1R9T B;  2JN4 A;  4QQB X;  3RTX A;  4ED8 A;  2R7L A;  2C2D A;  1AFP A;  1DJR D;  1EQR A;  1TAE A;  1RCV D;  2JA6 A;  2OT2 A;  2L9H A;  3F2C A;  1NR4 A;  5I4D A;  3SDZ A;  2E5L H;  1RF2 D;  2FMA A;  1Y1W B;  3K80 C;  5HUR A;  4PNY A;  5AJ3 Q;  4JI7 L;  1TWG B;  1BGW A;  1JB3 A;  5IGB A;  3PGZ A;  2DUD A;  1SYF A;  2F0K A;  2B2Y C;  1EYZ A;  2RQX A;  4DV5 L;  1N34 L;  2V59 A;  4HJ7 A;  3BZD B;  5KG0 A;  3CMA A;  5KX5 F;  1CKN A;  5FLM H;  2J4X A;  3CPW A;  5JJL A;  4R1J A;  2RA4 A;  1H95 A;  5I9P A;  1EYC A;  2KQ3 A;  3SI8 A;  2WP8 J;  4DV1 Q;  1GSO A;  4X65 Q;  2CZG A;  4K14 A;  4OGQ C;  3A56 A;  4B3S Q;  4C2M B;  2I5H A;  3NK9 A;  3PUX A;  1BF4 A;  3HOW B;  4CKB A;  1LTA D;  1NMG A;  2L4N A;  4IJL A;  4ZCK A;  2JA8 G;  3CKI B;  4DAP A;  3M4P A;  2ZXR A;  3HOY G;  4F4Y A;  1K9M C;  2YYZ A;  3A55 A;  5FO8 B;  3OTO H;  3IFT A;  3RAX A;  5IE8 A;  4I7H A;  4UHV A;  3QOL A;  5BN3 A;  4YB8 B;  5KFY A;  3NEL A;  5KFC A;  2BCO A;  4L5T A;  1OO9 B;  1R4Q B;  3OMC A;  1A8V A;  3BU2 A;  3PSI A;  5M3F H;  4JI3 Q;  5AJ3 L;  4JI7 Q;  4DUY L;  3BA8 A;  3MXG A;  1MSH A;  3DF7 A;  1BNC A;  1HUM A;  2NN6 H;  2M2L A;  3EQL C;  3OYY A;  4HJA A;  5FD5 A;  4NXM Q;  2W9A A;  1W93 A;  4TUY F;  2IP4 A;  4DL6 A;  2RF4 A;  4IQZ A;  2EY6 A;  5LMN L;  4FF4 A;  3GTO H;  1PK8 A;  1E0B A;  1LYL A;  4JBJ A;  4DR5 Q;  3GTP H;  2YS7 A;  4Q45 A;  1TWH B;  3EPG A;  2EXZ A;  2E2D C;  1IKM A;  4RB3 C;  3RV4 A;  2R3Z A;  1HZA A;  2PCF B;  4YR0 A;  3A8K E;  2BE5 D;  2A68 D;  2A6H C;  2RVL A;  4I65 A;  5JVD F;  1PTO C;  1C4Q A;  4XIG S;  5CV8 A;  5IYB H;  4JI1 L;  3H4D A;  4Q0F A;  1GHK A;  2PZW A;  4I7A A;  3EJI A;  4R4I A;  1B70 B;  1EYA A;  1GXD C;  1TR5 A;  3R5X A;  4JG2 A;  3GV5 B;  3QB3 A;  4J1M A;  2LKV A;  1XNR Q;  4RAU C;  3I8Z A;  5D65 A;  4GKJ Q;  2JA5 B;  3MXP A;  5DG8 A;  4LW1 A;  2ZJR A;  1ZEQ X;  1QCB D;  2MNA A;  2NU7 B;  3GQB A;  3VYS A;  3PQI A;  2BA1 A;  4GN5 A;  4LUO A;  1CZG A;  4LF8 H;  3CRL C;  2AMC B;  1CQJ B;  4IAL A;  3MXN A;  1EUC B;  3VDY A;  3TS0 A;  4JBW A;  1A2T A;  4HJ9 A;  1MHW C;  2AWN A;  4B3T H;  4RKL A;  2Q8R E;  1RHP A;  2R7K A;  4LMY A;  1BBU A;  1KXL A;  1C7Y A;  1A3V A;  3FVQ A;  4LF7 Q;  1BJT A;  2L55 A;  1TS3 A;  1TWC B;  5M9O A;  4A3E B;  1S5D D;  2E75 C;  4F87 A;  5CAE B;  1E22 A;  2V9W A;  1RJT A;  4KKU A;  3QZ8 A;  1WI5 A;  4K5V A;  2UU9 L;  3HOV B;  4DNT B;  1X54 A;  2BH8 A;  3HKZ G;  1CA6 A;  3BVZ A;  3GTQ A;  1HA5 A;  1QWY A;  4IWX A;  4DV0 Q;  2K14 A;  1RD9 D;  3V96 A;  2IX3 A;  3A8J E;  1EY4 A;  3ONA B;  4NDX A;  3U4Z A;  2VOB A;  2WV6 D;  3VYT A;  3FMA A;  1V1Q A;  1X55 A;  2R93 A;  4BY1 G;  1PTO H;  4PZ7 A;  2XRQ D;  1TS5 A;  4X66 L;  3T1H L;  1P16 A;  4EQP A;  1LTR D;  2E2I B;  4KMU C;  3SE7 A;  3MVV A;  3OIQ A;  3QO2 A;  1WFQ A;  1E2V A;  2DNE A;  2LFN A;  3JZI A;  3LWB A;  2D5D A;  2E2H B;  2NVX A;  2EY5 A;  3V2T A;  4LF7 L;  1RK5 A;  2K04 A;  4M1U B;  2UUC Q;  3S24 A;  4DR7 Q;  5EWF A;  3H20 A;  1GD7 A;  1STH A;  4P74 A;  3OUZ A;  1XXG A;  5EKL A;  1B6S A;  2D9U A;  2EIF A;  3N6X A;  3CCV A;  1ZYR C;  1S10 A;  4IUQ A;  1ZXT A;  4DR1 L;  2GVB A;  4JV5 H;  5L37 A;  4L5S A;  3W3A A;  1O78 A;  5EKI A;  3SXH A;  4OWT B;  3D6W A;  2UUA Q;  1MZB A;  1S9F A;  1NE3 A;  2R85 A;  4DUY Q;  3RZD H;  1TU2 B;  1VQF A;  4V19 0;  2DNC A;  1NMF A;  4A3B H;  1LLR D;  2CW0 C;  5KT5 A;  2BQR A;  4XQJ A;  1NCV A;  4A3I G;  4BY1 B;  2AQ3 B;  5KYL A;  2NU6 B;  2ASL A;  4HN7 A;  4YHH L;  1I3Q H;  4N8X 1;  5CYU A;  1Z7T A;  4R8N A;  1QZG A;  2YZN A;  4LF4 L;  1J9O A;  4QF4 A;  1BNZ A;  1XNR L;  3M4Y A;  4UDU C;  1VQP A;  2KEE A;  4A3G H;  2FP4 B;  3JAM E;  1SR3 A;  1YJ9 A;  3PIO A;  4EGJ A;  3NTH A;  3A5Z B;  4PG3 A;  4HMI A;  4PMC A;  1AP0 A;  3Q24 A;  4B3S L;  2PNH A;  4P72 A;  4MTE A;  3TIN A;  2XGP A;  4DN4 M;  1YBY A;  1Z9F A;  3KLW A;  2MHV A;  1U4M A;  5IGG A;  3WOF A;  3GTK A;  1K8A C;  4A3E G;  1E4G T;  2XD4 A;  1XDN A;  2DJF C;  2K05 A;  2A69 C;  3Q2O A;  1R9T H;  1PH3 A;  4JOI A;  3PW7 A;  2D0P A;  3V4Z A;  3J7Y W;  4GOP C;  2UXC H;  2QYZ A;  2WAC A;  3FPU B;  4XTC S;  1F9Q A;  2A19 A;  5KFB A;  4EYI B;  2HDL A;  3M85 A;  4MV6 A;  2W8L A;  2WAQ G;  1YNN D;  1IL8 A;  1L1O C;  3KJO A;  5GON F;  1TWC H;  2KHJ A;  4A76 A;  1Q7Y C;  1JDB B;  2PI2 A;  1BCP B;  1QG7 A;  1KC7 A;  4KN4 C;  5JEA J;  3SVM A;  3A5U A;  4A3K H;  4WBN F;  3K58 A;  1U4P A;  5I9O A;  5C4J H;  5M5W B;  3Q23 A;  3AEV A;  4HJ8 A;  4BY1 H;  2VR1 A;  5IWA L;  1D1I A;  2Q2T A;  3J81 i;  1I50 H;  3PUV A;  1N9W A;  4A3K B;  1VF7 A;  4MV3 A;  2QIL A;  3K0X A;  5I6Y A;  3PZP A;  2AHO B;  4P71 A;  2WTF A;  4KI0 A;  2I5M X;  1PH7 A;  2L12 A;  2JA5 H;  3FHW A;  5FKA C;  1ET6 A;  1B6R A;  2JYO A;  4KKS A;  2KOL A;  3GV8 B;  4U67 3;  4K0K Q;  5GRO A;  1HXY D;  3ETH A;  2NTS A;  3S1R H;  4MV8 A;  1BO0 A;  2F0F A;  1STA A;  1BBX C;  2UUC H;  4OWX B;  5KFN A;  4DR7 H;  3WWV A;  3T1Y H;  2D62 A;  4WJ4 A;  3NWS A;  4A3D H;  1C30 A;  3IG0 A;  3NUC A;  3X3N A;  4U68 A;  1TY0 A;  3S1M B;  2ASD A;  2B39 A;  3IKJ A;  1DOK A;  3U9O A;  1LAB A;  3U9T A;  2JA7 G;  1QIL A;  3VR2 A;  4LMQ D;  1GUN A;  2JEG A;  4JW0 A;  3OHX C;  2LS0 1;  4IPH A;  4PMB A;  2I46 A;  3S14 B;  2PN1 A;  1LO5 D;  2UUC L;  2B2T A;  4P75 A;  3RNU A;  4JV5 Q;  2OLS A;  5M3F G;  5KT4 A;  5DQG A;  5J22 A;  4IJH A;  3T1Y Q;  2ICI A;  1PFS A;  1Y1V B;  4B3M Q;  4OL7 A;  3CW2 C;  2OCE A;  3BYY B;  3H3V I;  4HNT A;  3AFP A;  5A35 A;  5E7N A;  2IBK A;  1S5B D;  4R9W A;  2B2T C;  5ELB A;  3GTL B;  5C0X I;  4HAE A;  1VQ6 A;  2FK2 A;  2ZM6 Q;  4R4C A;  4H44 C;  3GID A;  1FNV A;  2NZO A;  1NAP A;  5C4H A;  3A7L A;  5COY A;  1SNQ A;  2EYH A;  3G6E A;  3I2Z A;  2WAQ B;  1G2T A;  3CD6 A;  2K5W A;  3TP6 A;  5KG2 A;  1HNZ L;  1HR0 Q;  1LAC A;  2EE1 A;  4CC5 A;  1M0T A;  3R93 A;  2KHI A;  3EBE A;  2MP1 A;  2RSO A;  3FKI H;  1VQL A;  4EEY A;  1RK6 A;  1OXV A;  2I80 A;  1SNO A;  2QDL A;  1G91 A;  3ORR A;  3OTO L;  1E4E B;  3UFX B;  3S9W A;  2R92 H;  4HQ6 A;  3BZC A;  2SEB D;  4DV0 H;  1CKO A;  4RGT A;  2E2H A;  1JOR A;  1CTM A;  3S15 B;  5KFQ A;  1RL2 A;  2IWH A;  1O80 A;  4MTK A;  1IYV A;  5KFZ A;  4XYM B;  3V6J A;  3STB D;  1K8G A;  4RGO S;  2AQ4 A;  1PYB A;  4L5R C;  2R82 A;  1L0X B;  3DUZ A;  1CE8 A;  1PZK D;  1F9S A;  3VR3 A;  3OWE B;  1PTO D;  5L1I A;  4YWK A;  4XYL B;  1ESR A;  3I56 A;  2R86 A;  1UEB A;  1E1O A;  4A3F B;  1D5Z C;  3LP8 A;  1TS4 A;  3H0G B;  4A3I B;  4JI8 Q;  4RZQ A;  2IT1 A;  3S17 H;  5KG1 A;  3FEW X;  1VQI A;  1YJN A;  3BAB A;  3I4L A;  2O4X A;  2N78 A;  3M3Y H;  1JJC B;  3CQZ B;  1XNQ L;  4TKO B;  4RZR A;  2FPG B;  3GIM A;  2WIN B;  4ODG A;  1SE4 A;  4XZ3 B;  1WR2 A;  4JI7 H;  2VQD A;  2FPI B;  4LF9 L;  2VUG A;  4DV3 Q;  4TQU S;  3U4V A;  2ZDH A;  4C3J H;  2LMC B;  1BXR A;  4RWS C;  3ITP A;  5GAD C;  4QGU A;  2HIV A;  2F0P A;  3TSS A;  4C3H G;  1F2Z A;  5FLX E;  5I2X A;  5C4J B;  4NB3 A;  3PUZ A;  1BUV T;  1M8A A;  2K4K A;  1STE A;  4K8J A;  1WD0 A;  3MXN B;  3BA9 A;  5I47 A;  4HCS A;  1KQS A;  4A93 B;  4DL2 A;  3PR4 A;  1GHJ A;  2EXD A;  1LTT D;  1SNP A;  2F3V A;  4LH6 A;  2R7Z G;  2CW7 A;  3HGB A;  1VQH A;  4QUC A;  2G9H D;  2Y0S E;  3RGZ A;  4C3H H;  5LA6 F;  4A3L H;  2B63 B;  5KG4 A;  1CT1 D;  1STG A;  3PN1 A;  3TZD A;  1VQ9 A;  2NTT A;  1XJV A;  4LSA A;  3RB3 A;  4UY8 C;  5KFU A;  1X6O A;  1IZ6 A;  3S16 H;  1K83 A;  3R8B A;  1Q90 A;  2UUB H;  3EVQ A;  1EHI A;  1QE6 A;  2MQH A;  3SE0 A;  2Q2U A;  2YRW A;  3K81 C;  3TME A;  4A2A A;  5KFF A;  3QR8 A;  4LFB L;  3S1R B;  3Q6S A;  4DNI A;  2E2I H;  3K7A B;  1MJE A;  3BG3 A;  4YY3 L;  3RFC A;  3AYH B;  4JV5 L;  4LWC A;  5M3M G;  1ULZ A;  4C5A A;  2Z4H A;  4X62 Q;  1JOO A;  1TQO A;  3I72 A;  1SAP A;  2VUM A;  2Y0S G;  1II3 A;  4G7Z C;  3GD7 A;  2R93 H;  5CB4 F;  2D0O A;  5DG9 A;  2WYO A;  4FS2 A;  4UCS A;  2RSN A;  1O7L A;  1TWH A;  2B2U C;  1Z6H A;  2JA7 B;  2ASJ A;  5M3F B;  3OHB A;  3VPD A;  2F03 A;  2UXD Q;  4IWY A;  4TVA B;  1B1Z A;  3VR5 A;  1IBL L;  4DV5 Q;  3HOZ G;  4UCR A;  2R7F A;  2J6U A;  2FHT A;  1U0L A;  3T4A C;  2JSO A;  3JSL A;  2KED A;  5LMN W;  5E3F A;  3M3Y B;  2ZDG A;  4X65 H;  3KBX A;  4LFA L;  1E4F T;  4LNQ A;  3RZD B;  1KJQ A;  3JSN A;  1UE1 A;  3H40 A;  3RLF A;  2M00 A;  3K5O A;  3MHB A;  1V1P A;  2FMM A;  2KEN A;  1KDB A;  2Q8I B;  4LF7 H;  1BQQ T;  2IHF A;  3QZ7 A;  2K5V A;  2WKC A;  3FKI G;  3IL8 A;  4WOR A;  2UUB Q;  1JC7 A;  3CCM A;  5LXT F;  4G57 A;  1PTO F;  3HOW G;  1V1O A;  4E4T A;  2VQE L;  2F4V H;  4BY7 G;  3VA5 A;  4LF8 L;  3F8T A;  4C2M A;  3S14 H;  2CH4 A;  3GTL A;  4R8U A;  2BR0 A;  2E2H H;  2N49 A;  1XPU A;  5LHY 1;  1KLU D;  3VYR A;  5ELO A;  3MFG A;  1RJQ A;  1Y1V A;  3SEB A;  3I91 A;  1QVG A;  3PO2 B;  1JWU D;  4QWB A;  3PO3 G;  4IR1 A;  4A3K G;  4BS9 A;  4ZOL F;  2EYL A;  2PMZ E;  1V4Y A;  2HQE A;  1X9N A;  1GYF A;  2MPM A;  5E1F A;  3H09 A;  2B2U A;  4DA2 A;  2IHE A;  1KJ8 A;  2N88 A;  4QW8 A;  2JA6 B;  3ORQ A;  1V1P B;  4KN7 C;  5A2Q W;  3C3L A;  5C3E G;  3WOE A;  4UCO A;  2HT1 A;  3VPB A;  4JYA H;  2YTX A;  1SYC A;  3RF2 A;  3TN2 A;  5KG3 A;  2J6S A;  1SE3 A;  1SYB A;  2QDB A;  1M1K C;  3Q8R B;  1H9J A;  2K50 A;  4XYQ A;  5KFW A;  4DR5 H;  1M7J A;  2W6N A;  1PHJ A;  5DNF A;  1HNW Q;  5IOD A;  3I90 A;  3TDQ A;  2W8K A;  3G7L A;  3G71 A;  3I4O A;  1I4R A;  2GPW A;  3E6Z X;  2K75 A;  5C1P A;  4BXX H;  3RV3 A;  4O42 A;  5IP7 H;  2PW7 A;  2ZJQ A;  4A3C H;  5J1Z A;  2JA8 H;  4N9P A;  4B9W A;  4RH6 A;  4DR4 Q;  3OW2 A;  4ECT A;  3H6M A;  5KG7 A;  1FNU A;  3BVM A;  4HNV A;  1ONL A;  5M3M B;  3PIP A;  4O3Q A;  3I4M G;  1QOH A;  3I12 A;  4M9U A;  4HED A;  2F0Q A;  1LT5 D;  2BOS A;  4A3I H;  4DV5 H;  4DR2 H;  1OTC A;  1SJH D;  2WDT A;  1PTO B;  2DY7 A;  1EWC A;  5IWA H;  4DR1 H;  2XSC A;  2KCM A;  1RDP D;  5BN4 A;  5CMD A;  3PIP 3;  5JPN C;  1D6E C;  5BPH A;  2A74 C;  5IIF A;  4XYO A;  4F8M A;  3GP7 A;  4BXX G;  4YP3 A;  2NB0 A;  1KBL A;  1X3F A;  4P73 A;  5IGF A;  1SFO H;  1T94 A;  2DLN A;  4ECR A;  2A6E C;  1GSA A;  4HSP A;  3J80 c;  3C1E A;  4HSV A;  4DK1 A;  1X3G A;  5EBC A;  1KAB A;  1EY9 A;  3G6Y A;  3TEH B;  3ND9 A;  1BBW A;  4JI5 L;  1Y14 B;  3VR6 A;  4C3H B;  3JAM i;  2EYP A;  4G4K A;  3CME A;  4FNF A;  1VQO A;  3W5O A;  4K6L A;  1JB7 A;  5ELF A;  5C0X G;  1TWA A;  2CWP A;  1LTB D;  3KLS A;  5ISR A;  4BA2 I;  4DR7 L;  2V4R A;  3GTO A;  4EX5 A;  3A54 A;  3K5M A;  5BPF A;  2K5H A;  2R7N A;  1BCP F;  1I3Q B;  4ABN A;  1E3P A;  4Y8V B;  2PW5 A;  2A8V A;  4GLX A;  4ZI7 F;  1EY5 A;  3TRZ A;  1I7L A;  1UC9 A;  2RKS A;  4LUV A;  1ENA A;  2NZ1 D;  2V5A A;  1XMQ H;  3OSP A;  3RN5 A;  1KEE A;  3D4D A;  3CCR A;  1HCZ A;  1BVS A;  4GS3 A;  3CC7 A;  1YNJ C;  2R87 A;  3GTL H;  1Z47 A;  4NXN H;  4LSX A;  3ND8 A;  4K2K A;  3E5N A;  1DYQ A;  1AE3 A;  4RNM A;  1BR9 A;  2LY7 A;  2X6L A;  4RA8 A;  1CA5 A;  3GTK H;  4CJ2 C;  4YR3 A;  4Q43 A;  1J5E L;  1SRO A;  1Q8K A;  1Y1V H;  2E5L L;  2R7Z H;  3I73 A;  1HH2 P;  2ID0 A;  4B3R L;  2BDO A;  1GUW A;  4HIM A;  3GTP A;  1PVO A;  1VQD A;  1QJO A;  2KUM A;  2N3S A;  4YAK B;  3L4K A;  5C0X H;  2O5I C;  1TY2 A;  2JA6 H;  5HGQ A;  4A3M G;  3LX0 A;  5EWG A;  5NUC A;  2VB3 X;  4IFD J;  2HGS A;  5DG7 A;  3GTG H;  4K0K H;  3IN5 A;  1I3Q A;  4OX9 Q;  2KBN A;  4IAJ A;  3GTO B;  1A2U A;  4JI2 H;  2NWG A;  1KRS A;  1TWA B;  2JQO A;  2AGP A;  3PF5 A;  2FIN B;  4X3K A;  1Q8I A;  5JAV A;  3GIQ A;  1RIP A;  1N36 H;  1Q82 C;  2A6E D;  3TZU A;  3DEO A;  3LWU A;  4ECZ A;  2C2R A;  4B3T L;  2FE3 A;  4MN3 A;  2ATL A;  4ECU A;  2R7Z A;  1EY8 A;  4K2L A;  5M5X B;  1MKH A;  2RCF A;  3SHL A;  4DGZ A;  4DV3 H;  5J2U F;  4L1K A;  3ICE A;  2NVY A;  5KFK A;  3NGD A;  1F2M A;  3BVG A;  4JI1 Q;  3N52 A;  3HOV H;  2AGQ A;  1PFM A;  2F0G A;  3M7G A;  2YU9 H;  4PZ6 A;  3UQ8 A;  4B3M L;  1B33 N;  5IP7 G;  3D6C A;  2F0H A;  1K8M A;  4LF5 H;  1JIH A;  5JJI A;  3H94 A;  3BS1 A;  1CQI B;  1VBG A;  4DV1 L;  2ES2 A;  5CV7 A;  5EBD A;  2YW2 A;  1TWG A;  3H0G H;  1PFB A;  4AYB G; 
#chains in the Genus database with same CATH homology
 1NTG A;  1IBK L;  1BKB A;  1R9T H;  2RCN A;  4JOI A;  3L2P A;  1PH3 A;  4NXM L;  2D0P A;  4R4Q A;  4OO1 G;  3I4N H;  4GOP C;  1VQG A;  4GNX C;  4AIM A;  4JI6 L;  4IFD G;  2ATW A;  2ALY B;  3B6Y A;  4XTC S;  4JBK A;  3J81 j;  2A19 A;  4DV4 Q;  4MZ9 A;  3M85 A;  1Q81 C;  2E8G A;  2C35 B;  2K52 A;  2WAQ G;  2ASB A;  1T9H A;  1L1O C;  4IOC A;  2IX1 A;  3KJO A;  1TWG H;  1WJJ A;  1TWC H;  2KHJ A;  4MNO A;  4KLK A;  3ULL A;  2QA4 A;  3PCO B;  4A76 A;  1Q7Y C;  4LF5 L;  1CUK A;  2PI2 A;  3E0E A;  5M3M H;  3KFU A;  5BR8 L;  1GKH A;  5JEA J;  3A5U A;  4A3K H;  3PO3 H;  2CWA A;  3NBH B;  4GOP B;  2IY5 B;  1PH2 A;  5M5X H;  5C4J H;  3AEV A;  4HJ8 A;  4BY1 H;  4KHP L;  5IWA L;  3TS2 A;  2UXD L;  1Q86 C;  4Y7N H;  1X3E A;  1I50 H;  3J81 i;  1KAW A;  2Q2T A;  3PUV A;  1N9W A;  3M4O H;  1WYD A;  2NVT H;  3K0X A;  2PQA B;  5IT9 c;  4JI2 L;  2AHO B;  4P71 A;  1N36 Q;  1YHB A;  2PQA A;  1G51 A;  3NEM A;  2YTV A;  4KI0 A;  2B63 H;  2I5M X;  1Q1E A;  1PH7 A;  5IYC H;  2GVA A;  2JA5 H;  3FHW A;  3CPF A;  3W1G A;  1N36 L;  1MJC A;  3G4S A;  1N34 Q;  1QVF A;  3PF4 A;  2JE6 I;  4GOP A;  5IYD H;  3SGI A;  5C44 H;  4K0K Q;  1WCM G;  1K3R A;  2FXQ A;  5GRO A;  1IXR A;  1X56 A;  2OQK A;  3TRE A;  4LF5 Q;  3S1R H;  4DV2 L;  3DLL A;  4Y52 H;  4OWX B;  5M5Y H;  1SRU A;  3WWV A;  3PV0 A;  2D62 A;  4WJ4 A;  4BBR H;  4A3D H;  2F3I A;  3KF8 B;  4FDB A;  3G48 A;  3F2D A;  1Y1W G;  4JI6 Q;  2BH2 A;  4BBR G;  2WB1 E;  3HFZ B;  4YWL A;  3J80 i;  2MO1 A;  3E9H A;  4OXP A;  4A3J H;  3GTM H;  1XPO A;  3CCJ A;  2JA7 G;  2R92 G;  1E1T A;  1JT8 A;  1X65 A;  3CC4 A;  3CC2 A;  4GLA C;  4GN3 B;  1I5F A;  4NXN L;  1EWI A;  1MIU A;  5HY6 A;  3U58 A;  1PH9 A;  4NPS A;  4DR3 L;  1IBK Q;  4IPH A;  2JK8 A;  5IYD G;  2CQO A;  3RZO H;  4LUZ A;  2UUC L;  4WJ3 M;  4P75 A;  3RNU A;  4JV5 Q;  5M3F G;  1PH4 A;  3AQQ A;  4X64 L;  4JI2 Q;  4DUZ Q;  1VQ7 A;  3GTJ H;  4IJH A;  3W1B A;  4X65 L;  3T1Y Q;  4IOA A;  2RHS B;  1PFS A;  1VQB A;  4BBS G;  4B3M Q;  2HIX A;  4LF4 Q;  3HOU H;  3CW2 C;  2OCE A;  1YHQ A;  3H3V I;  3K7U C;  2VUM H;  3AFP A;  4HID A;  3FP9 A;  2Z6K C;  5E7N A;  4LFB Q;  3JC6 6;  5C0X I;  4R4O A;  1TXY A;  3S1N H;  1VQ6 A;  2OTL A;  2ZM6 Q;  3EN2 A;  3HOY H;  3HOU G;  4R4C A;  3CCE A;  2UUA L;  4BBS H;  2NZO A;  2LXJ A;  1GO3 E;  3NEN A;  1LM0 A;  5H1S E;  3ULP A;  3G6E A;  3HKZ E;  3I2Z A;  3LGJ A;  4OON A;  4DV4 L;  3CD6 A;  3U50 C;  2CKZ B;  2LXK A;  1HNZ L;  1HR0 Q;  2WB1 G;  3BZK A;  5C3E H;  4OX9 L;  1IBM L;  1HNX L;  2KHI A;  3EBE A;  1PA6 A;  3FKI H;  1VQL A;  1OXV A;  3ZJY C;  2QGQ A;  5K36 G;  3OTO L;  1FL0 A;  1A0I A;  2KCT A;  2GN5 A;  2RHQ B;  3KDF B;  4PMW A;  2JA7 H;  4DV3 L;  1XMQ Q;  2R92 H;  3BZC A;  3CP0 A;  1YIJ A;  2MFI A;  4DR2 L;  1CKO A;  1S40 A;  2N8N A;  1KC8 C;  1G6P A;  2VQF L;  1N8R C;  2HHH Q;  5GQO A;  1QVC A;  1RL2 A;  4A3D G;  4X62 L;  3F1Z A;  1IBM Q;  1EYG A;  2IX0 A;  4GLV B;  4LF9 Q;  2ZTC A;  3STB D;  1NBW A;  3AFQ A;  1YHA A;  1K8G A;  4DR6 L;  1PYB A;  4L5R C;  1OXX K;  2UXC Q;  3K8A A;  5FLX c;  2BA0 A;  1XNQ Q;  4O0A A;  4A3F G;  1VQ5 A;  1C0A A;  3Q8D A;  4YHH Q;  3GDE A;  1N33 Q;  4YWK A;  3STB C;  3I56 A;  3A74 A;  4ME3 A;  1UEB A;  1E1O A;  1UE6 A;  2OQ0 A;  4B3T Q;  3ULJ A;  1YIT A;  4JI8 Q;  2VZA A;  1XMO L;  2IT1 A;  3S17 H;  3UDF A;  2R7D A;  1VQI A;  1YJN A;  1CSP A;  5GAH C;  2NVY H;  1YI2 A;  2B63 G;  2N78 A;  4QJF A;  4UPA A;  1C9O A;  4DPG A;  3M3Y H;  1VCI A;  3HOX H;  1JJC B;  4A3J G;  1N32 L;  4DV6 L;  1XNQ L;  2B29 A;  5JJK A;  4DR1 Q;  3CCS A;  4LF6 Q;  4A3C G;  4A93 G;  1OXU A;  2VQF Q;  4DR6 Q;  1L2F A;  1K73 C;  2XGT A;  4DR2 Q;  3S1M H;  1JJG A;  4LF9 L;  2A1A A;  5IY0 A;  3JAM c;  4DV3 Q;  1XMQ L;  1D7Q A;  4TQU S;  2K5N A;  2JA9 A;  3U4V A;  1GM5 A;  1EFW A;  1HZ9 A;  4RG1 A;  4C3J H;  2HHH L;  2JJQ A;  3PUW A;  1W2B A;  5GAG C;  2NVX H;  5IP9 H;  4IPD A;  4O2D A;  5GAD C;  4QGU A;  4AQY Q;  2HIV A;  3M7N A;  3S2D H;  5FJ8 H;  1WCM H;  3M9B A;  4GNX A;  1VQM A;  1TWA H;  4RMF A;  4NB3 A;  2NZH A;  2NVQ H;  4B3R Q;  3OTO Q;  3PUZ A;  2I0Q A;  4X6A H;  2K4K A;  1YVC A;  3HKS A;  3MXN B;  1KQS A;  4BA1 I;  4DAY B;  1HR0 W;  4DV6 Q;  1E24 A;  2EXD A;  2YV5 A;  2JEA I;  2R7Z G;  4HJ5 A;  1HNZ Q;  1VQH A;  1L1O B;  2JEB I;  2Y0S E;  4C3H H;  4A3L H;  2VS1 A;  1P8L A;  4JI3 L;  3KF6 B;  1XMO Q;  1VQ9 A;  3PUY A;  4OWW B;  2MO0 A;  1XJV A;  2HQL A;  3ERS X;  2Z6K A;  2L15 A;  1X6O A;  1IZ6 A;  3H0G G;  4DV2 Q;  4UY8 C;  3S16 H;  2UXB Q;  2VUM G;  4K0K L;  2MQH A;  1Q12 A;  4GN4 B;  2Q2U A;  1FGU A;  3K81 C;  2PI2 E;  4JYA Q;  4LFB L;  3UE0 A;  5C0X J;  4DNI A;  2QEX A;  2E2I H;  4DR4 L;  3T1Y L;  1MJE A;  1Q46 A;  4H02 A;  1K0R A;  3UDI A;  4IPG A;  4JOI C;  4YY3 L;  3AYH B;  4HIK A;  3RLO A;  4LWC A;  5M3M G;  3HOX G;  4JV5 L;  1AH9 A;  1SLJ A;  4X62 Q;  4YCW A;  3HOV G;  1E7Z A;  3CCQ A;  2Y0S G;  1NJI C;  2R93 H;  3GD7 A;  2D0O A;  4DK6 C;  4YCV A;  4DR3 Q;  2R6G A;  1VQA A;  3RN2 A;  4NXN Q;  1DGS A;  1EUJ A;  4LF8 Q;  1SMX A;  1OXT A;  1FJG L;  2VQE Q;  2Z0S A;  4A75 A;  5IWA Q;  2VNU D;  2UXD Q;  3D0F A;  4TVA B;  4KHP Q;  4LFC Q;  1IBL L;  3HOZ G;  4IFD I;  4DV5 Q;  1ASY A;  2R7F A;  1HNX Q;  3KOJ A;  4OO1 I;  1VQJ A;  1VQE A;  3ER0 A;  2F4V L;  3MEF A;  4QQB X;  1J6Q A;  1U0L A;  1KD1 C;  1EQR A;  3S15 H;  2NN6 I;  5LMN W;  1Y1W H;  3GO5 A;  4LFA L;  1B7Y B;  2WAQ E;  3F2C A;  5LMU Q;  1PH1 A;  4LNQ A;  1UE1 A;  4DV7 Q;  3RLF A;  5C4X G;  3K80 C;  5AJ3 Q;  2DGY A;  4JI7 L;  2ZM6 L;  2KEN A;  2ZJP A;  1IYJ B;  3HOZ H;  2IHF A;  1PH8 A;  2K5V A;  5GAE C;  2VW9 A;  3PGZ A;  3CCL A;  2JA6 G;  2DUD A;  3FKI G;  4AYB E;  4C3I H;  5C44 G;  4DV5 L;  1QZH A;  3CCM A;  4HJ7 A;  1N34 L;  2UUB Q;  3CMA A;  1S3O A;  1CKN A;  5FLM H;  3CPW A;  3HOW G;  3I4M H;  5JJL A;  4QY7 A;  4R1J A;  1G29 1;  1HJP A;  2VQE L;  4BY7 G;  1H95 A;  3CAM A;  5IYC G;  4LF8 L;  3F8T A;  2WP8 J;  4DV1 Q;  3S14 H;  1Y1V G;  4X65 Q;  3L7Z C;  4DAM A;  1K83 H;  4ALP A;  4B3S Q;  2I5H A;  2E2H H;  3PUX A;  2N49 A;  1XPU A;  5IYB G;  3I55 A;  1NMG A;  3A0J A;  4IJL A;  2JA8 G;  3HOY G;  3M4P A;  5ELO A;  1UE5 A;  1K9M C;  2YYZ A;  3K7A H;  1QVG A;  1TWF H;  3J7A 5;  5IE8 A;  4DR5 L;  3GTQ H;  3PO3 G;  1CKN B;  4A3K G;  2PMZ E;  4UP8 A;  3NEL A;  1X9N A;  2UUB L;  4L5T A;  3D31 A;  4DV7 L;  1A8V A;  2IHE A;  4A3L G;  2EQS A;  3BU2 A;  4UP7 A;  3UDG A;  4LFA Q;  3PSI A;  5M3F H;  1Q1B A;  4AH6 A;  4JI3 Q;  5AJ3 L;  1CKM A;  4DUY L;  4JI7 Q;  5C3E G;  1HZC A;  2HT1 A;  4HJA A;  3OYY A;  2V1C C;  2YTX A;  1VQK A;  4NXM Q;  1VQ8 A;  1EQQ A;  1IBL Q;  2RF4 A;  3KJP A;  1M1K C;  4JI0 L;  1TWH H;  5LMN L;  3I4N G;  2K50 A;  3GTO H;  1LYL A;  4JBJ A;  4DR5 Q;  3EIV A;  1KRT A;  1PHJ A;  1FJG Q;  3F2B A;  2F4V Q;  2XTI A;  3GTP H;  1HNW Q;  1A63 A;  1I94 L;  1UWV A;  4LFC L;  3G71 A;  4YWM A;  1JE5 A;  2Q2I A;  3I4O A;  4A3E H;  3H3V H;  1GVP A;  1HZA A;  2K75 A;  4BXX H;  4GNX B;  1EIY B;  5IP7 H;  4C2M H;  2ZJQ A;  1HZB A;  1PH6 A;  4A3C H;  5JEA G;  1KIX A;  2JA8 H;  4XIG S;  3E9I A;  5IYB H;  4JI1 L;  1YJW A;  2E2J H;  4DR4 Q;  4POF A;  3OW2 A;  2E5L Q;  4JYA L;  1KHI A;  1J5E Q;  4R4I A;  1FVI A;  1B70 B;  1XPR A;  1N32 Q;  3PO2 H;  4A3G G;  4JG2 A;  4YY3 Q;  1NY4 A;  3DM3 A;  3PIP A;  4JBM A;  3I4M G;  1XNR Q;  1JMC A;  5EAY A;  4GKJ Q;  5BR8 Q;  4LW1 A;  4JI8 L;  5DLQ E;  4A3I H;  1SN8 A;  2ZJR A;  4A3F H;  1OTC A;  2UXB L;  2MNA A;  1VQN A;  5LMU L;  4GN5 A;  2BA1 A;  4LUO A;  4QIW E;  2OWO A;  2KCM A;  2OTJ A;  4L5Q A;  2AMC B;  1PV4 A;  1A62 A;  1KL9 A;  4BXX G;  3VDY A;  4HIO A;  3TS0 A;  4JBW A;  1X3F A;  4P73 A;  3CF5 A;  3KYH C;  1SFO H;  4HJ9 A;  2AWN A;  4JC0 A;  3J80 c;  1OXS C;  4POG A;  1X3G A;  1BBU A;  3TQY A;  4A3M H;  1C7Y A;  1KXL A;  3TEH B;  4LF7 Q;  1BBW A;  4JI5 L;  4JI5 Q;  1Y14 B;  3JAM i;  3CME A;  1WOC A;  4AQY L;  1VQO A;  3W5O A;  1E22 A;  1JB7 A;  5C0X G;  2NN6 G;  2CWP A;  4MTN A;  4BA2 I;  2LSS A;  4DR7 L;  3RLN A;  3H15 A;  4EX5 A;  1WI5 A;  2UU9 L;  2VY3 A;  5ELN A;  1W3S A;  2K5H A;  3S2H H;  1M90 C;  1E3P A;  1X54 A;  2BH8 A;  3HKZ G;  4X66 Q;  4GLX A;  4YCU A;  2A8V A;  2R93 G;  3TRZ A;  4DV0 Q;  2K14 A;  4LUV A;  3KF6 A;  3U4Z A;  3RN5 A;  1LTL A;  4GKK Q;  1I6H H;  1PH5 A;  3CCU A;  1V1Q A;  1L1O A;  1X55 A;  2CFM A;  4BY1 G;  3CCR A;  1BVS A;  4PZ7 A;  4GS3 A;  3CC7 A;  1VQ4 A;  3UDX A;  2UXC L;  3GTL H;  1Z47 A;  4J15 A;  1AE3 A;  4X66 L;  3T1H L;  1P16 A;  4DK3 C;  1V43 A;  1VS0 A;  4GKK L;  1N33 L;  3J81 c;  2UU9 Q;  3GTK H;  4JI4 Q;  1IL2 A;  1J5E L;  1SRO A;  4DKA C;  1O7I A;  1Q8K A;  1Y1V H;  1PYS B;  2E5L L;  1WFQ A;  1V9P A;  2R7Z H;  1HH2 P;  2ID0 A;  4B3R L;  4DUZ L;  4HIM A;  1PVO A;  1VQD A;  5FLM G;  1YEZ A;  2N3S A;  3HOW H;  4LF7 L;  2UUC Q;  4DR7 Q;  3S24 A;  3L0O A;  4A4I A;  1GD7 A;  4JCV E;  4P74 A;  2JA6 H;  5FJ8 G;  4A3B G;  5HGQ A;  4A3M G;  4KHZ A;  4IFD J;  5IP9 G;  3BJU A;  3GTG H;  1QUQ B;  2EIF A;  4QL5 A;  2H5X A;  1S72 A;  3KDF A;  3CCV A;  5C4X H;  1HR0 L;  2CCZ A;  2KBN A;  1QUQ A;  4OX9 Q;  1L0W A;  5LMN Q;  4IO9 A;  1U5K A;  4JI0 Q;  4DR1 L;  4LF6 L;  2GVB A;  1YNX A;  2WFW A;  1AE2 A;  1KRS A;  2JQO A;  2AKW B;  3I7F A;  3PF5 A;  4JI4 L;  4L5S A;  1VQC A;  5J3B A;  4A93 H;  2AWO A;  1ASZ A;  3IRB A;  3T1H Q;  4OWT B;  3J7Z C;  2UUA Q;  1RIP A;  1NE3 A;  4DUY Q;  3RZD H;  4APV A;  3RR5 A;  1LUZ A;  2B3G A;  1Q82 C;  1VQF A;  1SE8 A;  1EIF A;  1NMF A;  4A3B H;  4B3T L;  2YTY A;  1CSQ A;  4BY7 H;  4A3I G;  1JJ2 A;  5M5W H;  1MKH A;  4YHH L;  1I3Q H;  3CXC A;  1YZ6 A;  1QZG A;  4GKJ L;  4DV0 L;  3ICE A;  4LF4 L;  3PO2 G;  4A3G H;  1XNR L;  3CQZ H;  1UE7 A;  1VQP A;  2JA5 G;  4IPC A;  1SR3 A;  4R4T A;  3UE1 A;  1YJ9 A;  4JI1 Q;  3HOV H;  2Q2H A;  4X64 Q;  3PIO A;  3M4Q A;  3A5Z B;  4UP9 A;  2YU9 H;  4PZ6 A;  1EOV A;  4PG3 A;  4PZ8 A;  2I5L X;  4B3M L;  2VL6 A;  5IP7 G;  2ZTE A;  3S1Q H;  4B3S L;  2ZTD A;  2PNH A;  1B8A A;  4P72 A;  5JJI A;  1I94 Q;  1XTD A;  1YBY A;  1Z9F A;  2F52 A;  3KLW A;  4EQ5 A;  4DV1 L;  2ES2 A;  1K8A C;  1HNW L;  4A3E G;  3H0G H;  1D8L A;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...