3HOYG

Complete rna polymerase ii elongation complex vi
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoyG01
1X3GA 3A74A 2K4KA 4DNIA 5IP7G 1UWVA 2VUMG 4A3CH 3KYHC 1YJNA 3GO5A 1K9MC 4JI4Q 1VQ9A 5IYBH 3W5OA 2CKZB 2K5HA 3TS2A 4A3FG 2R6GA 5M3MG 1IZ6A 2MQHA 2C35B 3SGIA 4A75A 2CWAA 4HJ5A 2YTVA 3I4OA 1KL9A 1UE5A 4R4QA 3CC7A 1XPRA 3HOZH 3ER0A 2R92G 3ULPA 4DR6L 1XMOL 4GKJQ 5EAYA 2OWOA 3M3YH 2Y0SG 1VQJA 1J6QA 3M4QA 4IJHA 2NZHA 4XIGS 3J7ZC 2E5LL 4B3RL 2UXDQ 3F2DA 5IYCH 4LF7Q 2R7ZG 3J80i 1PV4A 1JJGA 1LYLA 1WFQA 5AJ3Q 3PUYA 4EQ5A 3K0XA 2N49A 1YBYA 3I4NH 4DR7L 3GTQH 2VQEL 1VQOA 3K7UC 5FLMH 3RLNA 1OXVA 5GQOA 4POFA 3S17H 4A3GG 4DV7L 1UE1A 1QVFA 1IBML 3AQQA 1VQEA 4BBRG 3H3VI 2H5XA 1PH3A 3HFZB 2HQLA 3AEVA 3A5UA 3GTMH 1BBWA 1XNQL 1HZBA 1Q86C 4A3LG 1WYDA 3BZCA 3I55A 3ERSX 1VS0A 3BZKA 3K81C 4A3DG 4IPGA 4LF5L 1HH2P 1IXRA 1AE3A 3I4MG 5DLQE 3S15H 2ES2A 2FXQA 1VQNA 4LF6L 2V1CC 2JE6I 2F52A 4QQBX 3PO2H 4GOPC 4ME3A 1PVOA 1N8RC 3CPFA 4OWWB 1Q46A 4DR1L 4OX9L 3HOWH 1NTGA 4B3SQ 4P73A 1EIFA 2I5LX 2Q2IA 3TREA 3W1BA 4HJ9A 1SE8A 2WP8J 1VQFA 3FKIG 4YHHQ 3HOUH 3H3VH 3CMAA 3ICEA 1L1OB 4DV1L 3HOXH 4DR2L 1PA6A 4BY7G 3PO3H 4JCVE 3CCVA 4AQYL 1PH1A 4A3BH 2E5LQ 4B3RQ 5JJLA 3CCUA 3PUXA 5LMNL 1SRUA 2PQAA 5C0XG 4DV5Q 3PV0A 1Q82C 5IP9H 4DR7Q 2I5HA 2VQEQ 4DAMA 3J80c 2VQFL 2JEAI 2UU9L 4UPAA 1EUJA 4KLKA 4DV0Q 2IHFA 2VZAA 3T1HL 4JI7L 2JA7H 3S14H 4GN3B 1PH5A 3CC4A 4LFAL 4GKKL 2ATWA 4LWCA 1HZCA 3TS0A 1EQRA 4DR3Q 2WAQE 1YJ9A 2JA6G 5LMUL 5BR8L 2GVAA 3H15A 1HR0L 4JBMA 4IFDG 1X65A 4ALPA 3UDIA 2B63H 2DUDA 2HIVA 1QZHA 2UUCL 1WOCA 4LUVA 1K83H 5H1SE 4LF6Q 1VCIA 3U4VA 1NY4A 5M5YH 3UDFA 2ZJQA 2KHIA 4UP8A 2I0QA 3OW2A 1E24A 2NZOA 2NVYH 4LFBQ 2LSSA 3KF6B 1A63A 4DR1Q 4OX9Q 3AFPA 1XNRQ 2PI2A 1Z47A 1KHIA 4GNXA 4BA2I 2HIXA 5C4JH 4LNQA 4WJ4A 1I6HH 1YHBA 4A3FH 1VQAA 4DV1Q 3CCSA 4DR2Q 1A62A 1VQIA 2E8GA 5LMNW 1FJGQ 4OO1G 4QGUA 1KXLA 3UE1A 2ID0A 4DV2L 3JC66 4IPHA 4OWXB 3GTOH 2XGTA 2R92H 1VQLA 4A3EG 1V9PA 3ULJA 1J5EL 1EFWA 1TXYA 5LMNQ 4POGA 2NN6I 1UE6A 2JA8H 4J15A 4HJ8A 1PH7A 4B3MQ 2R7ZH 4Y52H 1HJPA 4R4IA 5IWAL 4X62Q 4DV3L 2MFIA 2Q2HA 5JEAJ 2JQOA 3GD7A 4KHZA 1N33L 4JG2A 1ASYA 3PF4A 5IYDG 3GDEA 3HKZE 4QJFA 4XTCS 1I50H 1I5FA 3H0GG 1FGUA 3PUWA 4DUZQ 1EQQA 3J81j 1I94Q 1HNZL 4LFAQ 4JI7Q 4A3GH 4GKKQ 3B6YA 3S24A 1XPUA 5JJIA 5LMUQ 4DK3C 2LXKA 4DAYB 4X65Q 1IBKL 1N32L 4BY1G 3U50C 1GD7A 1WCMH 3S1NH 2B29A 1SFOH 2NVTH 5HY6A 4TQUS 2UXCL 5HGQA 4NXMQ 4QIWE 4K0KL 5ELNA 4JI5Q 1K73C 2K5VA 3EN2A 1NMFA 4DUYL 1LTLA 3HOYG 4R4OA 4QL5A 3NEMA 5C0XI 2CWPA 1ASZA 4P71A 3AFQA 5M5WH 1PHJA 2ZTCA 1U5KA 1CUKA 1NMGA 2EXDA 3G48A 1SLJA 3HKSA 4LUZA 4R1JA 1HNXQ 1VQDA 3UDXA 2ZTEA 2AWNA 4IPCA 3G4SA 4DR5L 1EOVA 1QZGA 4KHPL 3RR5A 1YHAA 4APVA 4DV2Q 1YEZA 3J7A5 3S2DH 5GAHC 4BY7H 5M5XH 4A3JG 1HZ9A 2F3IA 1JT8A 1SROA 4A3MG 2UXBL 4JBWA 4IJLA 4UP9A 1TWHH 3BJUA 4IFDI 2OTLA 2AWOA 1X3FA 4IO9A 4LF8Q 1TWAH 1Q8KA 1L1OA 1P16A 4OWTB 4JYAL 1JE5A 2K75A 2ALYB 4MZ9A 4GS3A 4JI2L 1O7IA 4O0AA 3JAMc 1JMCA 2PMZE 3Q8DA 1HNZQ 4YWMA 3STBC 4IOAA 5GADC 4GOPA 2R93G 1KIXA 2YTYA 1PYBA 4JI8L 1IBKQ 2MO1A 3A5ZB 4JBJA 3T1HQ 1KD1C 3KFUA 1N32Q 3KJOA 1Z9FA 5C4XH 3HOVH 3J81i 5C44G 3OTOL 4A3IG 4OO1I 2VS1A 2UXCQ 1L2FA 5C3EH 3S1QH 3KJPA 4A93H 4BXXH 2HHHL 1W2BA 1YITA 1FVIA 3L7ZC 3E0EA 3F1ZA 5M3FG 3GTGH 4YCUA 1X54A 3KLWA 1OXSC 1N9WA 4A3CG 2K5NA 2RHSB 4YCVA 3ZJYC 4DR6Q 2HT1A 1XMOQ 1PH8A 3PGZA 1KQSA 1YZ6A 3S2HH 1OXTA 1CKNB 2CCZA 5IYBG 1UE7A 4L5RC 1VQ7A 2NVQH 2D0OA 4GOPB 3CP0A 1X9NA 2K52A 4KHPQ 4BBSH 4H02A 1X55A 5ELOA 1Y1VG 3NELA 3RLOA 3HOZG 2UXBQ 3KF6A 4X66L 1Y1WH 4A76A 1Q1BA 4LUOA 3RNUA 4A3EH 4A3KG 3ULLA 4DV7Q 2ZJRA 4JI1L 2RCNA 1IBMQ 4JYAQ 2ZTDA 1OXUA 2ZM6L 1HNWL 3G6EA 3E9HA 2BA0A 3I4NG 3RZDH 4HJAA 1XNQQ 5GAGC 1EWIA 5IYDH 2N8NA 4Y7NH 1GO3E 5FLMG 1DGSA 1G51A 1X6OA 2YV5A 3H0GH 4JC0A 4OXPA 4L5SA 4LF5Q 1NJIC 1JB7A 1YI2A 3W1GA 2EIFA 5FJ8G 2IX1A 3OTOQ 2E2JH 1G6PA 4KI0A 5IP7H 2VUMH 4BY1H 3GTKH 1A8VA 4DV6L 1S3OA 2B3GA 1NE3A 2HHHQ 1A0IA 2Z6KC 2E2IH 3J81c 3CCQA 4YY3L 2KCTA 4X64L 4C3JH 4L5TA 1PYSB 4DKAC 3M7NA 2IX0A 5M3MH 2A19A 2R7FA 4GN4B 1PH2A 2XTIA 3OYYA 2AHOB 2A8VA 3K7AH 1V43A 1VQCA 2RHQB 3I56A 4AQYQ 3L2PA 1VQ6A 2UUAL 4JI4L 1LUZA 3S16H 3HOWG 2VNUD 1VQMA 2MNAA 1XMQL 1AE2A 2JA5G 1BVSA 2D0PA 1IYJB 2WFWA 4YCWA 4HIKA 3HOUG 5E7NA 4JOIC 2VQFQ 3HOXG 3I7FA 1CSPA 2K14A 2UU9Q 3CW2C 1S40A 4A3JH 3PO3G 2KCMA 4A3BG 2WAQG 2JK8A 3CQZH 4NB3A 1HR0W 3L0OA 1PFSA 1HNWQ 4NPSA 2KHJA 3I2ZA 2E2HH 4GLXA 3K80C 5IP9G 1PH6A 4BBRH 4GN5A 3D31A 5BR8Q 4P75A 5AJ3L 1HR0Q 3BU2A 2OQKA 1KRSA 4RMFA 4A3LH 4GNXC 3LGJA 3TQYA 3GTLH 1RL2A 4MTNA 3CCLA 4DR4Q 2UUCQ 5J3BA 3PUVA 4A3DH 2VW9A 1N36L 3I4MH 3KOJA 1HZAA 1QVGA 3RZOH 1TWCH 4WJ3M 1BBUA 1Q12A 4B3TL 3FHWA 4DV6Q 3CCJA 1C9OA 3PUZA 3DLLA 4P74A 1FL0A 1NBWA 2PI2E 4YY3Q 3CCRA 2N3SA 3CCMA 4DV4L 4HIMA 2B63G 4X6AH 1B70B 4X64Q 3PCOB 2L15A 3T1YL 2IY5B 2IHEA 3M4OH 3FKIH 1PH9A 4EX5A 4A4IA 1M90C 4QY7A 3IRBA 5JEAG 3M85A 3CXCA 4MNOA 2UUAQ 2Z0SA 4UY8C 4NXNL 1MJEA 1XMQQ 2EQSA 2VL6A 3EBEA 1J5EQ 3NENA 2F4VL 4YWKA 1D8LA 4B3SL 1I3QH 3HKZG 1XJVA 5IY0A 4JI6L 5IWAQ 2AMCB 4YHHL 4DV3Q 3KF8B 4AYBE 1N33Q 1Y1VH 2IT1A 2GN5A 3K8AA 4JI3L 1H95A 1Q1EA 2WB1E 5FLXc 2QEXA 1CKNA 4LFCL 1C7YA 4AH6A 1VQ5A 3TRZA 4R4CA 1Q81C 1VQPA 4O2DA 4A3KH 3CMEA 2JA8G 4R4TA 1QVCA 3KDFB 1W3SA 2CQOA 2QGQA 3CPWA 4DV5L 2NVXH 2OTJA 1GKHA 2RF4A 1B8AA 2JA6H 5IT9c 1QUQA 4JI0L 3E9IA 3G71A 3S1MH 4K0KQ 3U58A 1PH4A 4DV0L 4C2MH 2N78A 1N36Q 1YHQA 4DUYQ 3U4ZA 1EIYB 4B3TQ 3TEHB 1G291 5C0XJ 5FJ8H 4LF9L 2AKWB 1U0LA 1JJCB 4DR3L 1VQKA 3PF5A 5JJKA 1WCMG 1K3RA 1IBLL 4DV4Q 3CCEA 2Q2UA 2NN6G 2YYZA 3T1YQ 2JEBI 1L1OC 5IE8A 4DR5Q 1SN8A 1R9TH 2D62A 4C3IH 2UUBL 4PZ7A 1N34L 3UDGA 4NXNQ 1YIJA 4JBKA 4LFBL 2F4VQ 4P72A 1QUQB 1M1KC 1VQGA 3PSIA 4AYBG 4IFDJ 4FDBA 3F2CA 1CSQA 1SMXA 4C3HH 2JA5H 1OXXK 2WB1G 3CAMA 1XNRL 1D7QA 1MJCA 4JI6Q 3A0JA 5IYCG 1K8AC 1KAWA 4PMWA 2ZJPA 4JI3Q 2QA4A 1XPOA 4JI2Q 1WJJA 1P8LA 3M9BA 4AIMA 4DPGA 3VDYA 4LFCQ 1FJGL 1K0RA 4LF4L 1C0AA 1S72A 3FP9A 2YTXA 4GLVB 1RIPA 3CD6A 4GLAC 2Z6KA 2JJQA 1K8GA 1IL2A 1KRTA 4JI8Q 4RG1A 4PZ8A 4B3ML 3CC2A 1VQ4A 4X62L 1WI5A 1X3EA 4JI0Q 3F8TA 4JV5L 1VQBA 2BA1A 4DR4L 1XTDA 4DUZL 2MO0A 2R7DA 2OCEA 1UEBA 3RN2A 1I94L 1SR3A 1BKBA 2A1AA 1Y14B 4LF9Q 1E22A 4PG3A 1AH9A 1E7ZA 3HOYH 1Q7YC 5C4XG 3GTJH 4JOIA 4X65L 1CKMA 1E1TA 4IOCA 1IBLQ 3HOVG 3M4PA 2BH8A 5C3EG 3PO2G 4A93G 4BXXG 3DM3A 2K50A 3CF5A 4NXML 3RLFA 4DK6C 4JI5L 3D0FA 2JA9A 2UUBQ 1CKOA 1N34Q 2PQAB 1MKHA 2OQ0A 4IPDA 4X66Q 1VQ8A 1E1OA 4L5QA 4A3MH 4PZ6A 4UP7A 4GKJL 3F2BA 4JI1Q 1GM5A 4HIDA 2KENA 2PNHA 5GROA 4YWLA 2GVBA 4BA1I 1V1QA 1TWFH 5GAEC 3PIOA 2ZM6Q 1KC8C 1HNXL 3AYHB 4BBSG 2UXDL 3PIPA 3EIVA 2YU9H 4LF7L 4LF4Q 2Y0SE 3S1RH 3STBD 4OONA 1YVCA 1Y1WG 4HJ7A 3MXNB 1TWGH 2JA7G 3UE0A 2CFMA 2VY3A 2R93H 1YNXA 4LF8L 4TVAB 3JAMi 5K36G 1YJWA 3NBHB 2DGYA 4JV5Q 1VQHA 5C44H 1B7YB 1X56A 4A3IH 1JJ2A 2KBNA 4LW1A 1MIUA 2ASBA 4HIOA 3GTPH 1OTCA 1LM0A 2LXJA 1E3PA 1EYGA 1T9HA 2Q2TA 2BH2A 3KDFA 1L0WA 1GVPA 4GNXB 3RN5A 3WWVA 2I5MX 3MEFA 5M3FH
chains in the Genus database with same CATH superfamily
1X3GA 1X3QA 2F0LA 3A74A 3BVGA 4HEDA 1WCMB 4DNIA 2NVTB 1TWHA 4LF5H 5DGAA 3DUZA 1YJNA 1WTWA 4ED1A 2QYZA 4ECVA 2CKZB 4RNMA 1E4EA 3WDNA 4XQNA 5KKNB 4IUUA 2KCCA 1IZ6A 3QB3A 2EXZA 4PMBA 4RB3C 3SGIA 5JVG3 4DR1H 3EPGA 2PBZA 4GKJQ 1XPRA 3ER0A 3GQCA 1XMOL 2OWOA 2C28A 1VF7A 4P2CB 1V4YA 2PMZB 1L0XB 1SNCA 4IJHA 2NZHA 4OEMB 4XIGS 3J7ZC 2UXDQ 4DV1H 5IYCH 1PV4A 1LYLA 3S2DB 2OXPA 1LTGD 1Q8IA 4EQ5A 4BY7B 3KUPA 4H44C 4DR7L 2VQEL 1VQOA 3RLNA 5GQOA 3S17H 3IKJA 1PK8A 3A8JE 2CQYA 2RDHA 1OO9B 1TS3A 3BQ1A 1UEAB 1VQEA 2HCCA 4V0BA 3QOLA 2I80A 3NP8A 2ASJA 1B44D 1QNUA 3HFZB 5FK9C 1PH3A 3AEVA 1XNQL 4A3LG 1HZBA 1FNVA 4LH6A 4GKKH 4I4TF 3BZKA 1X32A 4IAJA 1EZ6A 1AE3A 1HR0H 3RB0A 2ES2A 3O13A 4TQSA 2V1CC 5CBEE 3WO1A 1D6EC 3BDLA 2B2UC 3JAML 2NU7B 5KFEA 1STNA 4F50A 1RDPD 4OWWB 4Y8VB 1XX8A 1MBYA 1EWHA 4B3SQ 2F0SA 2M00A 1RTOA 4YHHQ 1PX2A 3ICEA 2ZDHA 2FPIB 4KN7C 1PA6A 4O4HF 4J9RA 2KCNA 2R87A 1PTOC 4AQYL 4LMYA 2NVQB 1PTOF 1K83A 5FLXW 3WOFA 5I6WA 4RHRA 2KHSA 5JJLA 2Q8IB 5LMNL 5L1LA 2XCAA 2VQFL 1O78A 1Y1WB 2F0VA 4DV0Q 3V2TA 2IHFA 2VZAA 3S14H 3CC4A 1TQOA 2XN9C 4LWCA 4DR3Q 2WAQE 2GVAA 3MXNA 3H15A 4TQRA 4TV8F 4IFDG 2W6ZA 1X65A 4ALPA 1EEID 4MTEA 3JRXA 2V9WA 4RKLA 5H1SE 1CQVA 1NY4A 1GUSA 2VUMB 3UDFA 3VA7A 4IWYA 4UP8A 3TINA 2UVWA 4LFBQ 2LSSA 5C5JA 3D6WA 3SVMA 1WH2A 1I4QA 1Z47A 1KHIA 3TBIB 4GNXA 3LMLA 5M3MB 4A3FH 4U6PA 4C3IG 1WCMA 3MJFA 4DV4H 5LMNW 3KLSX 3T5JA 4QGUA 1O80A 2FLNA 3GTOH 2R92H 1VQLA 4OL7A 4PNYA 3RJ0A 4C3HG 1EFWA 2FE3A 1TXYA 4POGA 4E4TA 3IN5A 1VAJA 1KNAA 4C1NK 4B3MQ 4CGYB 4UAIA 4R4IA 4TV9F 1EY5A 1LO5D 1IOWA 5CC4A 1FKAH 3Q2OA 1ASYA 1RD9D 3GDEA 1WD0A 1I50H 3CQZB 3D3RA 4IURA 4DUZQ 3K57A 1I94Q 1SNDA 4LFAQ 2L55A 2E2HB 5BMVF 4JI2H 3B6YA 2OEOA 3FDSA 3E5SA 2OH2A 1IBKL 1N32L 1J8IA 1EY6A 5HY6A 4K0KL 5ELNA 2A69D 5CGKA 5I6YA 1K73C 1O7YA 3I4MB 4WJWA 2LKVA 1NMFA 1JQYD 1LTLA 3HOYG 3RFCA 4YAJB 4S3SA 5KG4A 4KY7A 5ELCA 2R7NA 2ZTCA 1CUKA 4LUZA 1SJED 3I4LA 3M4OB 3PIO3 2HDMA 5A2QE 2JA6A 2AWNA 4IPCA 3G4SA 2E76C 1EOVA 5T1GA 4KHPL 4QCLA 1A15A 3U9OA 1YHAA 3LWEA 1GSHA 4DV2Q 4C5CA 1TIID 5GAHC 1BDOA 3H91A 3V96A 4C2MA 3S9WA 3VPDA 1FD7D 4UP9A 2FLPA 2UUBH 4EQNA 2OTLA 1X3FA 4CHTB 4I7ZC 1TWAH 5C0XH 1P16A 3K59A 3NBIA 2IA6A 1CE8A 2K75A 2YRXA 2K1BA 5FO7B 2R82A 1S9FA 1JWSD 1XTCD 3NPPA 4YIJA 3P20A 1JMCA 4JI1H 3ERQA 1JKJB 4R8UB 1SYDA 5KFAA 1HNWH 5EPJA 3JSLA 4FBTA 5KFDA 1EIGA 2KSWA 1S5DD 4PMCA 1D1KA 2K28A 3DMUA 4CDCC 1KABA 4JI8L 1LT6D 5IIFA 4EQPA 1B3QA 3KJOA 1Y1WA 3HOVH 4G3IA 4A3IG 1L2FA 3J7AK 1BNCA 3KJPA 4ED3A 4A93H 1BCPD 1S5ED 3I72A 4RKBA 2D5DA 1NR4A 1FVIA 4KY5A 2EOTA 3E0EA 3GTGH 4YCUA 5KT4A 1X54A 2R85A 4FM9A 3T51B 4A3CG 3FDTA 3H0GA 1XMOQ 4HYKA 3G6JB 3NXWA 1OXTA 1CKNB 4EEYA 4L5RC 4Q45A 3HGBA 4RU9A 1K3BC 2B2YC 2IX3A 4TRDA 1X9NA 4RAZA 5DLFA 3Q22A 4CKEA 3K5LA 2VUMA 4BBSH 5D14A 3X3NA 3M9MB 2UUAH 4A2BA 1Y1VG 3NELA 2DY7A 4OHJA 4A3EB 1Q1BA 3ULLA 2ZJRA 2RCNA 3K0YA 2CW8A 2ZM6L 2FMAA 3OOCA 3I4NG 1XNQQ 1EWIA 3IL8A 1ENCA 2LFNA 5EPLA 4YP3A 1JB7A 4IR9A 4FXGC 1QOHA 5FJ8G 2FP4B 3TSSA 2E2JH 4BY1B 1G6PA 4Q0YA 4NLGA 3FMCA 1N36H 1JWUD 2DZDA 1KLGD 2G9HD 4YY3L 3OWEB 2YU9A 5BN4A 4CDEC 3C2PA 4DKAC 1MSGA 2A19A 1KLUD 4DL7A 3PVXA 1VQCA 4G7ZC 4AQYQ 4C5BA 3L2PA 1VQ6A 2EYOA 3S16H 3A7LA 4O1NA 2JN4A 2RVLA 1SNMA 2VB2X 1XMQL 1SCUB 4HIKA 3KHRA 3BDOA 2A5HA 2VQFQ 4NXNH 3OPOA 2DIKA 4A3JH 3CVZA 3PO3G 1SYEA 1CZGA 1ML0D 4ECYA 3J80W 4JI6H 3RUPA 1PFSA 2KHJA 3HP3A 5IP9G 2ICEC 5IGFA 1RJRA 3K3PA 4RGNA 1TWGB 4U7CA 1KRSA 4A3LH 3PR4A 2AQ4A 4FXDA 3GTLH 1RK5A 4DV5H 1RKNA 1C3OA 3SE0A 4HMJA 3KOJA 1HZAA 4WJ3M 4NMZA 1Q12A 2MP1A 2MCTA 4BS9A 5C44B 4ZCKA 4B9XA 4R8UA 2HVSA 2PI2E 1EIHA 2N3SA 3ETJA 1BXRA 4IRCA 4LF9H 3N44B 4MN3A 4X64Q 4LMQD 2RGRA 4MV4A 5JVH3 2IY5B 1IBLH 1GXDC 3NWTA 2IL8A 4EX5A 1WTXA 1UNSA 5JEAG 1PTOD 3IRBA 4MNOA 2Z0SA 3TQ1A 2P0AA 1Z7TA 1N34H 2R8KA 1I6UA 2DPJA 1IW7C 5KFQA 2AMCB 2ZXRA 5KG1A 3HOZB 4JI3L 1ZQ7A 2A74C 2WACA 3MAQA 1AN7A 2DLNA 5DG9A 1C7YA 2E74C 5FLXc 1HUMA 1CKNA 2X69A 2QEXA 4AH6A 3M3YB 4MA0A 4EG0A 1Q81C 4O2DA 3NTIA 2JA8G 4ECTA 2C9OA 2XSCA 1QVCA 4R4TA 2QW7A 2CQOA 2K01A 5L9XA 3ETHA 2GPSA 3GTQB 1BO0A 2F0UA 1QUQA 5LMNH 2JA5A 4IFDH 4K0KQ 1SEIA 5I9PA 2B2YA 3RUZA 3U4ZA 4B3TQ 3TEHB 5KYIA 2GPWA 1U4PA 3RMHA 4TUYF 5JJKA 3GIKA 2WAQA 1JWMD 5J39A 3LNNA 2NN6G 3JZIA 3T1YQ 2W9CB 2K05A 1L1OC 4X65H 3NUCA 5IE8A 1SN8A 3V6JA 4YAKB 1R9TH 4O3OA 2A6EC 4C3IH 3OIPA 1EEFD 1SNPA 3L3OC 3UDGA 3U9TA 4JI5H 1HFGA 1QE6A 3HOWB 1VQGA 4AYBG 3C1FA 4J8QA 3F2CA 1SMXA 4C3HH 2O5IC 2WB1G 1XNRL 4ZK9B 4RH6A 5IYCG 3A7AB 2ZJPA 3HOXB 1XPOA 3F8NA 1WJJA 1P8LA 1FJGL 1WTRA 1K0RA 1C0AA 2ENBA 4FS2A 2YTXA 2QDLA 1RIPA 1GGOA 1HNXH 3MVVA 5IGGA 2JJQA 2IMWP 1EZ8A 1IL2A 4JI8Q 2K7VA 2J6UA 1G2TA 1CFMA 3CC2A 2KQ3A 1X3EA 3BA9A 1VQBA 5D1PA 5IGEA 3RGXA 2EJMA 4DR4L 2XWJB 2SOBA 5COYA 3RN2A 2OCEA 1UEBA 2O5JC 2YW2A 3WNZA 3QFFA 4XQJA 1SR3A 5JQWA 2A1AA 1LLRD 4PG3A 2YRWA 4ECRA 1E7ZA 3HOYH 3M7GA 1Q7YC 3GTOA 4J9PA 5C4XG 3GTJH 1I4HA 5FO9B 1SNQA 2BH8A 5FPOA 2F0DA 3G6YA 2IPKD 2B63B 4BXXG 4MA5A 4NXML 1IBKH 1N32H 2FB9A 4QWEA 2JA9A 1GHKA 4ZI7F 1GJXA 3VR2A 4OELB 2PN1A 4U673 1GUTA 1EYDA 4GKJL 4UP7A 3F2BA 3KAJA 3TP8A 1GM5A 2F0WA 2GVBA 2ZM6Q 3FMAA 3NE5B 3AYHB 2UXDL 3DHQA 2PZTA 3N43B 2Y0SE 3S1RH 1HA6A 1S5BD 1TS2A 4B3RH 2C2DA 5I47A 3GIMA 2HGSA 3UE0A 2QF7A 5LA6F 1BNZA 3I8ZA 2L0CA 4LF8L 4TVAB 2R8IA 4JV5Q 1ESRA 3DWPA 4A3IH 3NK9A 2ASBA 4DL5A 2KBNA 4LW1A 1FNUA 4HIOA 1IBMH 3VYTA 3MHBA 1TY2A 2QKIC 1GVPA 3QZ7A 3RN5A 3BU2A 1V1PB 1B1ZA 3RV4A 4R8IA 4MV7A 4PDBA 2K5QA 4A3CH 3EPIA 5L1JA 4DAPA 3GO5A 3MFHA 1SEBD 1W96A 3MXUA 1TWAA 2TSSA 3W5OA 2K32A 2BOSA 1O7LA 3LX0A 4XDXA 3TS2A 2W9BB 3DWQA 4A3FG 5CA0F 3T5LA 1S0MA 3MFIA 4HSPA 3R93A 4OX9H 3HS0C 4FP5D 4ULLA 1KL9A 1UE5A 4R4QA 5F2DA 3CC7A 4HJ5A 2NUAB 2R92G 3ULPA 5KFNA 5EAYA 1AZPA 2W9CA 5KFXA 1VQJA 2VPQA 1PXUA 5KFVA 4H13C 4LF7Q 3J80i 1F2ZA 1SE4A 3KK7A 1WFQA 5M5XB 2WKCA 3K0XA 1XWEA 2VUGA 3I4NH 2YYAA 4EBEA 1E4FT 1TWHB 2J6SA 4FF3A 5D65A 4DV7L 5ELBA 1QVFA 2V59A 2C22A 2JEFA 2UU9H 3AQQA 4BBRG 1STAA 5KFOA 3NHHA 3T1HH 4JI7H 3H3VI 2H5XA 2CH4W 2HQLA 1JT8A 3A5UA 3GV3A 1Q86C 1WYDA 1ZXTA 2NBFA 3BZCA 4O42A 1PYWD 3K81C 5A2QL 1HH2P 2H4OA 3AMUA 5BR8H 3OMGA 4RNNA 3UFXB 2A69C 2KJXA 2JSOA 1VQNA 2PYKA 1B6SA 2JE6I 4IRKA 5C3EB 2JA7A 5KGUA 3PN1A 1NNXA 2YCHA 1LV9A 1CK1A 3MXGA 2EPBA 4MIUA 2YS6A 1A2TA 2NU8B 1JOKA 3FKIG 4KK7A 4XYLB 1C4QA 3CMAA 2BQUA 1GYFA 2HVQA 3QIAA 3J80E 3S2HB 3PO3H 4JCVE 4KKUA 2E5LQ 3N42B 3A8IE 3CCUA 2NUCA 5L1IA 5C0XG 4UCSA 1B53A 5IP9H 2B2VC 4ABNA 4IRDA 4DAMA 1DJRD 3J80c 4YR2A 1SYGA 1XMQH 1J5EH 1GUNA 2PCFB 2VOBA 4PQXA 4UPAA 1S10A 1EUJA 4KLKA 2QEJC 4GN3B 5IWAH 4DV3H 4LFAL 1N33H 1ZKOA 2Z8LA 3VR4A 3G6XA 1TT2A 1EQRA 5K36H 3RZDB 4ECQA 1JC7A 3HG9A 3J7AF 5JAVA 2ASDA 3I90A 5GONF 1QZHA 4YB8B 2UUCL 4LUVA 4LF6Q 1S5FD 2PW5A 2K04A 5JUMA 5M5YH 3GTKB 2ZJQA 1JOOA 2I0QA 2UXCH 2EYLA 5JEAH 2XC9A 2NVYH 2E2IB 4RWSC 1A63A 4O4IF 4DR1Q 4DUYH 1EY0A 4KKSA 4QW8A 2LS01 1XNRQ 2EYPA 2PI2A 4C3JB 1IW7D 2HIXA 5C4JH 4BA2I 1I6HH 5DNFA 1V1PA 1YHBA 1E4GT 1VQAA 4DV1Q 2FJZA 4FU0A 1EYZA 1HXYD 1FJGQ 1VQIA 1BCPB 1V51A 4EGJA 4OO1G 5CV7A 2JEJA 4LJZC 4DV2L 3JC66 4IPHA 4OWXB 4Q5VA 2XGTA 3M9OB 2YL2A 2Y0SB 4HNUA 4N8X1 2FHTA 1UE6A 2JA8H 3OUZA 2R7ZH 3R5FA 3KBGA 4Y52H 1EQTA 2UXBH 2R7MA 3QO2A 2RGVA 2MFIA 2Q2HA 4DR4Q 1F9QA 1VBGA 1EQQA 1SYXB 3J81j 1IYVA 4JI7Q 4GKKQ 1XPUA 2KVMA 5LMUQ 1WTQA 2LXKA 3L4KA 4IALA 4O2AF 4DLKA 3S1NH 1R4QB 3OSOA 5CORA 5JPMC 3R2TA 1SFOH 5E1FA 2NN6H 4NXMQ 4A3DB 1JOQA 1NCVA 3A55A 3OWFA 1TWCB 2A6ED 3HB9A 4J1MA 2L11A 2CWPA 1DZ1A 4P71A 5C1PA 4DAVA 3KHLA 2WKDA 5M5WH 3H40A 2SDFA 1PHJA 1U5KA 1I4PA 3HKSA 3VMMA 1VQDA 2W6OA 1E0BA 4DR5L 1W6KA 1ZETA 4H7BA 3C3LA 1SJHD 4A3JG 4I65A 5JJZA 4DK1A 1STYA 4JBWA 4IJLA 3FVQA 3BJUA 4IFDI 2ZJTA 4RUCA 2EYHA 4JPBW 4LF8Q 4RGTA 1DOMA 1ICFB 1Q8KA 3FEWX 4OWTB 5IGCA 4X66H 1MGSA 2W70A 5KFTA 4M7EA 1O7IA 3LWUA 4O0AA 1STGA 3Q8DA 1HNZQ 5ELFA 1H9RA 5GADC 3GQBA 2R93G 1TY0A 4LSXA 1KIXA 2NVXB 2YTYA 4X3KA 1IL8A 5LHY1 2MO1A 1EYAA 2IJ0A 3A5ZB 4FNFA 1KD1C 3OW7A 2JA6B 3V4SA 1Z9FA 5C4XH 5LXTF 2VS1A 2FPPB 3S1QH 4J9KA 4C2MB 1EU4A 4BXXH 4KD4A 3L7ZC 1RTNA 3E6ZX 3RBDA 3GV7B 1J9OA 5M3FG 1HUNA 4DV6H 1E2VA 1N9WA 3KBXA 2K5NA 2RHSB 4L63B 2F4IA 3PGZA 4ED8A 2CHBD 4B9WA 3RBEA 3D4WA 5CV9A 2D0OA 2WV6D 1B33N 2K52A 1PMRA 2IBKA 2FK3A 3RAQA 3GTKA 1Y8NB 4H02A 3RLOA 3CRLC 2E2IA 1IKLA 1M7JA 1SYBA 3RV3A 4A76A 4MV1A 3RNUA 4A3EH 3NTHA 4DV7Q 2Z1CA 3SK5A 1PTOB 1HTPA 3R5XA 4QWDA 4ED0A 1PFNA 2DY8A 1B9MA 4GKJH 1PRTD 5KFGA 1DM0B 2BA0A 3MFGA 3TZUA 1KDCA 1EOTA 5GAGC 1GSOA 3H0GB 2N8NA 5FOBB 5I9OA 1GO3E 4Y7NH 1DGSA 2YV5A 2F3WA 4OXPA 2Y0SA 3JAMW 1NJIC 4UDUC 1SBBB 3W1GA 2W6NA 3OTOQ 4O3NA 2RBMA 1HRJA 4BY1H 1EL0A 1A8VA 1LTID 1S3OA 2HHHQ 5J1ZA 3KLSA 4N9TA 4YR3A 2B2TC 2NTSA 2EE1A 4Q44A 4ZQ3A 5IGBA 4X64L 2R8HA 4G7HC 4L5TA 3TP7A 2WDTA 2IX0A 5DGBA 4GN4B 2R7FA 1PH2A 1K8OA 1GHJA 2AHOB 3OYYA 1WTVA 1ZHQA 3K7AH 3J81L 2FFKB 3EVQA 4JI4L 2VNUD 3RAXA 4F4YA 2RA4A 2MNAA 2F0QA 2EYJA 1BVSA 1TWCA 3P7JA 3HOUG 3D8GA 1UC8A 2XCLA 3CW2C 4A3MB 4JUZA 4B3SH 1QWYA 4A3BG 4Q8EA 4YHHH 4ZKCB 4NW2A 1HNWQ 2YU9B 3K80C 4LFCH 4DNRB 4BBRH 1OWTA 5AJ3L 2B39A 4HNVA 1RL2A 1ULZA 2J0TD 2UUCQ 5J3BA 1STHA 4PV1C 1Y1VA 2RCFA 3KF8A 4KN4C 3RZOH 2XWBB 4B3TL 1RCVD 4DV0H 3PUZA 2G9DA 4K5WA 4P74A 3UI2A 2KOLA 2PZUA 3CHBD 4K2LA 3CCMA 3CCRA 4X6AH 5HURA 2L5TA 4X3TA 4DR3H 2NVXA 3T1YL 2IHEA 5ISRA 3FKIH 2PQEA 3CXCA 1ENAA 2UUAQ 1MJEA 4UCUA 3NENA 1ZEQX 2RQXA 1T5EA 4KJOA 1I3QH 3HKZG 1XJVA 4LFBH 3FPUB 3BABA 3K8AA 1H95A 2LY7A 2B2UA 1VQ5A 3OSPA 4A3KB 4WRDA 2F0NA 5D1OB 2C2RA 3IAYA 3GIIA 1W3SA 4ZRZA 2XNAC 2ZXOA 2RF4A 4KTAA 5EOYA 2AUJD 4KJNA 4O2BF 4F4ZA 2D9UA 3E9IA 3S1MH 4HQ6A 2RDGA 4B3MH 3IFTA 4ME5A 1N36Q 4EGQA 1AUVA 1YNNC 4K8JA 1CZWA 4KY6A 2AKWB 1JJCB 4HSVA 5IT9L 3PF5A 4DUZH 1I94H 1WCMG 2KA7A 3RB6A 3T16A 2Q2UA 4IHJF 5C4ZA 5KG6A 3I91A 4R8NA 4RCNA 4CKBA 4DR5Q 4LSAA 3V05A 2VA2A 2D62A 1MSHA 1Z2OX 4PZ7A 4OO1H 3PQIA 2C5CA 4NXNQ 5IGDA 4JBKA 5C3XA 3PMFA 4YJ2F 1T94A 1B4OA 4P72A 1QUQB 4K5VA 1M1KC 2F4VQ 4TSSA 5EZYF 2JA5B 2W57A 5J2UF 4UCVA 4QWBA 3L9AX 1D7QA 4JI6Q 3A0JA 5D8DA 4PMWA 5T14A 2QA4A 3VDYA 2FKLA 4F7XA 3NTKA 1S72A 4R9WA 2WAQB 4GLVB 5D3DA 3T13A 3MWEA 3F2UA 1KRTA 4RUAA 4RG1A 4IUQA 4PZ8A 2NVYA 1T5XD 3ZYYX 1VQ4A 4X62L 4JI0Q 4JV5L 3F8TA 3S14B 3DXJC 4FF2A 2GLTA 3BA8A 3WOEA 4EEQA 2R7DA 1BKBA 4LF9Q 3MC0B 1AH9A 2RSNA 1BJTA 3RB3A 4NKLA 1QB5D 2QK4A 4IOCA 1IBLQ 1B2TA 2XIGA 4J0MA 3FPPA 2K50A 4WFN3 3EFXD 1O7ZA 4EFBA 5CV6A 4G4KA 3RLFA 4DK6C 5KT2A 3D0FA 1CKOA 1N34Q 2PQAB 1MKHA 4O4LF 4K6LA 3GTPA 5C3WA 3M4IA 3VR6A 1U4RA 4PZ6A 5KRUA 1UNNC 2EDGA 2I07B 1ZHSA 3T53B 4A3FB 1B9NA 5BPHA 4GC7A 1V1QA 1TWFH 4ED7A 5FD5A 1I4XA 4KMUC 4LF7L 1JICA 5KFRA 1XMOH 2SCUB 4LF4Q 2JYOA 4ZQIA 3GTOB 2R92B 5KFYA 1CQJB 1Y1WG 2YZGA 4ECXA 1TS5A 4DL4A 1S0OA 2SEBD 4OIJA 1CTMA 2CFMA 4NDXA 2VY3A 3VR3A 2R93H 5KFLA 1YNXA 4DR7H 2B8GA 4X3UA 3JAMi 2VQEH 5K36G 2F0EA 4J9NA 3NBHB 2DGYA 4DF7A 3KAKA 4J9SA 1I50B 3R3OA 4FF1A 1E2ZA 4ZUIA 4RZRA 1OTCA 2XCPA 5D1OA 4DN4M 1EYGA 2J9GA 1T9HA 3W3AA 3I3CA 4IUVA 2OTJA 1U4LA 2IWHA 5M3FH 1XNQH 1F77A 1F9SA 3OMCA 5IP7G 2VUMG 1UWVA 4QB4A 4F8MA 1MZBA 1W93A 5FKAC 3KYHC 4JI4Q 5FLXE 1VQ9A 5CV5A 4ECZA 1I4RA 1C30A 2XIWA 2V58A 3A8KE 2K5HA 4HR7A 5JH7F 2FMMA 5M3MG 4M8AA 1S0NA 3P1HA 2UVRA 2MQHA 3W2DA 3WO0A 2CWAA 2YTVA 3I4OA 4DR6L 3DEOA 2A73B 5CR3A 5EBCA 1STBA 4HNTA 5CBAE 1LTAD 4RCOA 1J6QA 1K8MA 3QOJA 1ILPA 2E5LL 2R7ZG 4EGVA 1JJGA 4GZYC 4AQYH 5AJ3Q 4XQQA 1M8AA 1YBYA 2OF1A 1II3A 1HHVA 3SE7A 4Q43A 1F9RA 1U4MA 2WTFA 1Z2PX 4POFA 4X64H 1TWAB 2VQFH 3KXYT 3CRKC 1G2SA 3GTMH 4JW0A 2HD3A 4C5AA 3TN2A 5BPFA 2PO4A 2B2WC 3ERSX 4EFEA 4IPGA 4LF5L 2ZXPA 3S15B 2HVRA 3FRPB 3I4MG 1KJJA 2W8KA 4LF6L 3HOVB 4Q0FA 3PO2H 4ZAIA 4GOPC 4ME3A 4A93B 3VA5A 4JV1A 1N8RC 3CPFA 1Q46A 4DR1L 2O03A 5LOVF 4P73A 1EIFA 4K14A 5EJWA 4HJ9A 2FINB 3GTGB 2A6HC 1VQFA 2WIIB 2WP8J 1DD2A 2YZMA 3HOUH 3PZPA 1L1OB 1EU3A 4DV1L 3DM1A 3NSWA 2ATLA 2NWGA 3R5HA 1PH1A 4A3BH 4IZ8A 5JVDF 3N41B 4B3RQ 3ND8A 2MUYA 2F0TA 4OGQC 4TKOB 4BBSB 1SRUA 2PQAA 1Q82C 5KX5F 3PV0A 2W6PA 2J7ZA 1CS0A 2AGOA 3EQLC 4IUTA 1WVLA 1SSOA 2VXWA 5KT3A 2JA7B 3BDCA 1D1IA 2F0PA 4KHVA 1I6VC 1RHPA 1PH5A 1LTSD 4M9UA 2AQ3B 2XGPA 4GKKL 1HZCA 4XT1B 4UCRA 2HQEA 2R92A 5LMUL 4IR1A 1HR0L 4LH7A 4JBMA 1V1OA 1DOKA 2HDLA 1PFMA 3UDIA 3TIGA 2IW3A 3MXPA 3BQ2A 2HIVA 1K83H 1KDBA 3NBHA 3VYUA 2E2JB 1SYCA 2F1MA 3QWNA 1E24A 1I50A 5KG2A 2F0GA 4L6TB 4K0KH 3ORRA 3N6XA 1EFID 2K33A 4OX9Q 2W9AA 1HTLD 1CT1D 2AUKA 1FYCA 2M9VA 3G7LA 4B3TH 4WJ4A 3T5HA 4LNQA 2V4DA 4QUFA 1EQVA 4DR2Q 1EY4A 5C5MA 1QILA 1KXLA 3GIQA 2BQRA 4E6IA 2VR1A 2ID0A 4ILWA 4KKTA 3S16B 3T1YH 2TMPA 1Q3LA 4O3RA 2R7LA 4A3EG 3ULJA 3GIJA 4KHPH 4DA2A 4J15A 1PH7A 1STEA 1TR5A 2I46A 4X62Q 1EY9A 2JQOA 4JG2A 3ORQA 1PRTC 3HKZE 2RKSA 4QJFA 4XTCS 1I5FA 2F0IA 1FGUA 4L8JA 1PRTF 3TZDA 1HNZL 1A6XA 1YNND 2YS7A 5T1IA 2EY2A 4A3GH 4HAEA 5FD6A 5JJIA 5LP6F 2QDBA 3R23A 4DK3C 4BY1G 1WCMH 2NVTH 3GTLB 1EY8A 1I3QA 4JI8H 4QIWE 5KFZA 4XXEA 4HMIA 2J6TA 5KFCA 5C0XI 5EQ0A 1MI2A 3GLKA 1QCBD 2CZGA 3H4BA 3AFQA 3TP6A 4FF4A 3GIDA 1NMGA 2EXDA 3G48A 2K6AA 1SLJA 3IFDA 4EYIB 3ONAB 3UDXA 1QZGA 3RR5A 5KEEA 2XRSD 3J7A5 3S2DH 3R8BA 2ASLA 4BY7H 3D4RA 2W71A 2F3IA 4FS1A 3HBLA 3GTGA 2AWOA 2NB0A 2B2WA 4IO9A 4DL2A 2CQAA 2R86A 1L1OA 4F4XA 4MZ9A 4JI2L 1TU2B 4EBCA 2PMZE 1U9RA 3T5KA 3STBC 2ZM6H 4GOPA 2XD4A 3Q8PB 1WTOA 3OUUA 5F9LA 3HXLA 5DQIA 2EYMA 3T1HQ 3CKIB 4JBJA 3KFUA 5C5LA 5C44G 3OTOL 4OO1I 2PPBC 2UXCQ 2RDIA 1GUWA 2HHHL 5DQHA 5LYJF 3N40P 2K03A 4H0LC 4ME6A 1VMPA 5NUCA 1TKWB 3KLWA 1RJPA 4MTKA 4YCVA 4DR6Q 3ZJYC 4YY3H 2HT1A 5TSSA 1Z6HA 5IYBG 4RFBA 2F0MA 2F0KA 2NVQH 3CP0A 1R9TB 4C3IB 4ZYSA 2M2LA 1C48A 3HOZG 2UXBQ 4CC5A 2W7OA 1G91A 1Y1WH 2IP4A 3U9SA 4J9MA 4LUOA 4C3HB 4JI1L 1CHQD 1K1QA 5DQGA 4JYAQ 2ZTDA 1HNWL 3JSNA 4ZLTF 1LTTD 5A2QW 4CJ1B 1VF5C 1AUXA 5IYDH 1HQMC 5FLMG 3H0GH 4L5SA 1LTBD 2AQ1B 4JC0A 4LF5Q 4HCSA 4U68A 1A3UA 1YI2A 2VA3A 3PW0A 2EIFA 2DNCA 1EUCB 1GSAA 3C0FB 1M4VA 2IX1A 2XVSA 1LACA 4KI0A 5IP7H 2Z4IA 2VUMH 2K5WA 4K2KA 1CQFA 1ET9A 2B3GA 1F9PA 2Z6KC 2SNSA 4MV6A 3Q23A 3HOYB 1KEEA 4F4WA 1PYSB 2NZ1D 2KECA 2L12A 5M3MH 3GTJB 3M7NA 2F0JA 1JORA 1CQIB 3RGZA 2CW7A 2RHQB 3GTLA 1NR2A 2UUAL 3QR8A 1LUZA 4FXKC 3HOWG 1VQMA 5CV8A 2D0PA 4EYHB 4CBVA 2WFWA 4I55F 4PWQA 5E7NA 4JOIC 2BDOA 3HOXG 4CKCA 1S03G 2JK8A 3CQZH 4NB3A 5KG5A 3HKZB 3L0OA 4JI3H 4NPSA 3I2ZA 2E2HH 4KD3A 3S1RB 1JLLB 2H1EA 3E5NA 4P75A 1H9SB 1HR0Q 1BGWA 4DL6A 2OQKA 1BQQT 4NP5A 3LGJA 3TQYA 5C6AA 4GNXC 3CCLA 1PDQA 1B50A 1N36L 4QIWB 1TVXA 1QVGA 3I4MH 1D5XC 5DEHA 1HCZA 4C1NI 3BYYB 3CCJA 4B08A 1C9OA 4DV6Q 4A3IB 5DLGA 4BWSC 2CW0C 1NSNS 4HIMA 2B63G 2W8LA 1B70B 1KNEA 2A6HD 2L15A 1F2MA 3M4OH 1K28A 4XX0B 5K2MA 4QW9A 2LMCB 4EQOA 5ELDA 4QY7A 3M85A 1M90C 4FBUA 1GUOA 4UY8C 1I4GA 4NXNL 2EQSA 3A54A 4LF6H 2F4VL 3AB9A 2JEIA 4YWKA 2PZWA 2BDNA 2E75C 4JI6L 4ED6A 3GTMA 1Y1VB 3GV8B 3KF8B 4AYBE 1KBLA 2IT1A 2GN5A 1SE2A 5LL6b 2WB1E 1XNRH 1JDEA 4R4CA 2D2CC 5EKLA 1VQPA 4A3KH 1RK6A 3CMEA 1R9TA 1FJGH 5CMDA 5KNBA 1Y8PB 2X6LA 3IG0A 4DV5L 1GKHA 1ET6A 3I4NB 1HA5A 1B8AA 3RIZA 3MZ5A 5FLXL 4JI0L 1LT4D 1LT5D 2N78A 5L1KA 1YHQA 4KV6A 4ODGA 4LF9L 3BAAA 5BN3A 1U0LA 4DR4H 3Q24A 3K5OA 3G8CA 4XYMB 1WD1A 1G8ZD 1IBLL 2B2VA 4DV4Q 2FPGB 3TP5A 3Q8SB 2RSOA 4DNTB 1KJ9A 5LMUH 2JEBI 4QWAA 5DG7A 2EZVA 4RB1A 2Q8RE 1N34L 1KC7A 4NXMH 4LAAA 1YIJA 5BN5A 2PVPA 3MWYW 4IFDJ 1TAEA 5G3LF 4GC6A 2Z9HA 2JA5H 3D4DA 1MJCA 1K8AC 3GTJA 1XXGA 1SMYC 4JI2Q 3M9BA 1CA5A 1VMCA 4LFCQ 4DXGA 1DYQA 3PO3B 4LF4L 3FP9A 3HRZC 2UXDH 4RB2C 4IUPA 2Z6KA 4RHSA 1K8GA 3AU7A 5KYLA 2AU0A 3M4YA 5J2TF 3JRWA 2V4RA 3E3XA 1L0YB 1TS4A 2BA1A 4LK1C 1GLVA 2NU9B 3MA2B 4LF8H 3HKZA 2MO0A 5KT5A 1EWCA 2DJFC 1E22A 1H9SA 1AEXA 1HNZH 5KT7A 3ITPA 4JOIA 2KEEA 1CKMA 1E1TA 4X65L 3K5MA 5IODA 3M4PA 5C3EG 3PO2G 3CF5A 4IWXA 1JR0D 4IUNA 2FK1A 3T56B 4JI5L 1KJIA 4QIWA 5HGTA 2DWCA 4Z9CB 5M5YB 2UUBQ 4ETSA 2WE6A 4XZ3B 3MFYA 5HBRB 3RTXA 2FMCA 2NVYB 1S97A 3H09A 1D5ZC 3I12A 1EUDB 3N52A 3VYRA 4L5QA 2FLLA 5C4JB 4JI1Q 1I6HB 2KENA 2PNHA 4BA1I 1HNXL 3MEHA 3K6OA 2GA4B 3PIPA 4DFAA 2BQ3A 3J7YW 4HN7A 4OONA 3STBD 1YVCA 1RODA 4HJ7A 4DL3A 1TWGH 3X3MA 5KFWA 2JA8B 2A68C 2R7ZB 2RDJA 3BJYA 2HUGA 5ELEA 4C56C 1VQHA 5I4DA 2HJWA 5C44H 3OHBA 3OHAA 4DV7H 1ESFA 3GTPB 2PMZA 3K3VA 2LXJA 2P5ZX 3KHHA 2Q2TA 3J81W 1PLFA 1L0WA 1WR2A 2I5MX 5CB4F 3MEFA 5KFUA 4JV0A 2K4KA 3S1NB 3BVZA 5DAUA 1SFOB 1HFNA 3TIIA 1K9MC 1AW7A 1ICWA 1ENFA 5IYBH 1PZID 2VB3X 4C3JG 3OTOH 4IN3A 2R6GA 1NUCA 3GILA 2C35B 2HHHH 4A75A 4I50F 2N55A 3HOZH 5E4WC 5M5WB 4AYBB 3M3YH 3SK6A 2WB1B 2Y0SG 2R8GA 3M4QA 3R2IA 4B3RL 3F2DA 4J9OA 2ALZA 2FK2A 3I73A 1DV2A 3PR5B 3PUYA 2DJGC 2N49A 3TQTA 5JPNC 3GTQH 5EGTA 3K7UC 5FLMH 3TDQA 1JE4A 3S17B 1DCZA 1OXVA 1M0TA 4K8IA 4A3GG 4ED2A 4YJ3F 1UE1A 3HEJA 1IBML 4IZOA 4HR7B 4N8FA 2Z6BA 3H4DA 5JOBA 3BZDB 1BBXC 1BBWA 4LFAH 3EROA 3I55A 3V4ZA 1VS0A 4A3DG 3UQ8A 5KT6A 1IXRA 3S15H 4N9PA 5DLQE 3MWMA 4F87A 2FXQA 3P75A 5C4XB 4R7RA 3Q8QB 1JXLA 4RAUC 2F52A 3S1QB 3PW2A 4QQBX 3H6MA 2UUCH 1PVOA 5AFWA 4J9LA 3HOWH 1DV1A 2VPSA 4OX9L 1NTGA 3PW7A 2I5LX 2Q2IA 3TREA 3W1BA 1SE8A 3J7AV 2PNRC 3URYA 3H3VH 1VDZA 3HOXH 4DR2L 4BY7G 3C1EA 4WORA 3CCVA 1WSCA 3Q8RB 4EBDA 4ECUA 1S68A 1AN8A 1KJQA 1BR9A 2EY1A 3PUXA 1D2BA 2B2TA 1AZQA 4DV5Q 4DV2H 3H94A 3K5NA 4A2AA 5EDWA 5KFIA 4DR7Q 2ZDQA 2I5HA 2EVBA 2VQEQ 2JEAI 5CA1F 2UU9L 1RJQA 1KDAA 2DPIA 3VR5A 5IT9W 3T1HL 4JI7L 2JA7H 4L1KA 4APMA 5KFMA 2W6MA 2PW7A 5C4HA 1Y8OB 2ATWA 3TS0A 4ECWA 4Q8FA 1YJ9A 4M1UB 3J80L 2WINB 1A2UA 3VYSA 5KIXA 4XYQA 5BR8L 4Y7NB 2CW0D 2JA6G 2JEGA 2F3VA 2B63H 2R7ZA 1KTKA 1ILQA 2DUDA 1F2YA 3A56A 2HCIA 1WOCA 1VCIA 1Q90A 3U4VA 1FGBD 2KHIA 4F88A 3OW2A 2NZOA 1BOSA 3CQZA 3KF6B 3M9NB 3AFPA 3C46A 2E2HA 1ZYRC 1EY7A 3Q1KA 2EJGC 3CCSA 4QF4A 1A62A 3K7AB 2E8GA 5J22A 3L4JA 3PW5A 1SFOA 3UE1A 5JVLA 2K5DA 2F0OA 4O3PA 4MHEA 5FPRA 4DR5H 1V9PA 4MV9A 1J5EL 4O3QA 5LMNQ 2NN6I 1FR3A 1RF2D 2ZT9C 5KNDA 4HJ8A 1XYIA 3NQIA 1LTRD 3QZ8A 2V4QA 3GIPA 1M0WA 1HJPA 2V5AA 3LP8A 2F4VH 5IWAL 4DV3L 1N33L 5JEAJ 3GD7A 4KHZA 3PF4A 1AFPA 4AYBA 1D5MC 5IYDG 1TA8A 3H0GG 3PUWA 2WB1A 3DF7A 2Q8TA 3S24A 4BBRB 2KEDA 1S5CD 4DK0A 2W6QA 4JK1C 1SNOA 5LL6S 4DAYB 4X65Q 4ZUJA 3QJYA 1GD7A 3U50C 2L9HA 4CJ2C 2B29A 1JDBB 4TQUS 1DXMA 5HGQA 2UXCL 1DONA 2J4XA 4JI5Q 2BCOA 2K5VA 3RZOB 3EN2A 4DUYL 5DG8A 5FO8B 4JI0H 4R4OA 4YBZB 4QL5A 3NEMA 5G3LD 4HCEA 2QCPX 1ASZA 1VKZA 1VBHA 3MTSA 2EYFA 1QNKA 4R1JA 4WBNF 1HNXQ 3FKIB 2X6GA 2ZTEA 1SMYD 3GV6A 5LL6X 1W6JA 4BWGB 3PIP3 4CDDC 1A3VA 5H80A 4APVA 1YEZA 3JAME 5M5XH 1HZ9A 4FVMA 4RGMA 2MHVA 1IYUA 1SROA 5A35A 4K5XA 5IOCA 4A3MG 2O4XA 2UXBL 2ZDGA 5DM63 1TWHH 4ID6A 3K58A 1I3QB 4UCTA 3HZXA 5EWGA 1YNJC 4JYAL 4RZQA 1JE5A 2ALYB 2FJ2A 4GS3A 5KFKA 3JAMc 3SR1A 4YWMA 1UC9A 4IOAA 1RYSA 2BR0A 4YR0A 1G6ZA 4LF4H 2B8FA 5KG3A 1PYBA 1IBKQ 2I87A 1BF4A 1WTHA 1N32Q 1B6RA 4J9QA 2C2EA 1K0SA 3J81i 3S1MB 4MTDA 5C3EH 5EBDA 3OHXC 2YZNA 2BE5C 1QG7A 1W2BA 1YITA 1E2WA 1BXTA 3F1ZA 2AQ2B 1OXSC 3QG1A 5HV6A 2MPMA 3BYTB 4QWCA 4XT3B 4K6DA 4CDFC 1JCKB 1PH8A 1KQSA 3BG3A 1YZ6A 2EY6A 3S2HH 1KJ8A 2CCZA 3H3VC 5F9NA 1UE7A 3KALA 5KFFA 2MJ8A 1VQ7A 1RYRA 4GOPB 5CV4A 4KHPQ 1BUVT 1X55A 5ELOA 4JI4H 1CM9A 3K5IA 3MR6A 1I7LA 3KF6A 4X66L 1A9XA 2A68D 3T4AC 1SDFA 4A3KG 2NYZD 5KFJA 4DXFA 1IBMQ 1OXUA 3NWSA 3G6EA 3E9HA 4MV3A 3GV5B 3BS1A 3RZDH 4HJAA 2CH4A 5KFBA 2JXMB 1C8CA 4J6HA 1G51A 1X6OA 1MD2D 2Z4HA 3J81E 3SXHA 4G7OC 1L2ZA 3DEPA 5EWEA 4RB0A 2X0SA 1H9JA 3EYYA 2CVRA 3GTKH 1NAPA 1H9MA 4DV6L 1NE3A 4RA8A 1A0IA 3SEBA 2E2IH 3J81c 2AGPA 2E2DC 3V6KA 3CCQA 5KG0A 2I8CA 2F0FA 3E0JA 1JX4A 3TMEA 2KCTA 5IYZF 4C3JH 4O3SA 5KFHA 4DAYA 2A8VA 4I7AA 2XTIA 2R84A 1TWGA 1V43A 3I56A 3RB4A 2W7PA 1GUGA 1AE2A 2OT2A 2JA5G 4ZHQF 2R61A 2R8JA 1IYJB 2O2LD 4YCWA 1KAAA 2VQDA 2ICIA 3I7FA 1CSPA 2K14A 1UUPA 2UU9Q 4A3JB 4MV8A 1S40A 3SI8A 2KCMA 3CU7A 2WAQG 4UFZA 1HR0W 1TWFB 1A3TA 3FKIA 4UCOA 1SE3A 2L4NA 4WD3A 1HQRD 2RDFA 4GLXA 5E3FA 1PH6A 3MR3A 1JIHA 4GN5A 3D31A 5BR8Q 5C8YF 1B04A 4RMFA 2C00A 3LWBA 5EKIA 3Q0AA 4MTNA 2R93B 3MWDA 1IOVA 1T36A 1PRTB 3PUVA 4A3DH 3NGDA 2VW9A 3H20A 1CHPD 1TWCH 1O75A 1DIKA 1BBUA 3FHWA 1EHIA 3DWAA 1PZKD 2XRQD 3DLLA 1FL0A 2MGSA 1NBWA 4YY3Q 4DV4L 3I70A 2AGQA 1B3AA 3PCOB 5M3FB 2OLSA 2R3ZA 1H9KA 3GTQA 1PH9A 4A4IA 2XGQA 1UAPA 4QMGA 1XMQQ 2VL6A 5EKKA 3EBEA 1J5EQ 1IKMA 1D8LA 4B3SL 4ZKBB 1GOZA 3SK8A 3ND9A 5IY0A 5IWAQ 4YHHL 4DV3Q 3RD4A 1N33Q 1Y1VH 4JVZA 5IT9E 1Q1EA 4LFCL 1CI3M 3TRZA 4DU9A 1I7NA 4DR2H 3NQTA 2UVUA 3D6CA 3KDFB 4ECSA 2QGQA 3CPWA 1SXTA 2NVXH 5EWFA 2JA6H 5IT9c 3KHGA 2M05A 4V190 2L1BA 3G71A 3BQ0A 3U58A 1PH4A 4DV0L 4C2MH 4ZOLF 3PW4A 4DUYQ 4X62H 1S4ZA 1EIYB 1E4EB 4JV5H 1G291 2DN8A 5FJ8H 5D3IB 5C0XJ 1QJOA 4DR3L 1VQKA 3GTMB 1K3RA 1WTPA 3CCEA 1PZJD 1T3NA 1ZYRD 2YYZA 1XDNA 1R4PB 1F2LA 2UUBL 5KNCA 3PO2B 1RJTA 3G6VA 4LFBL 3KTMA 3BG5A 3PSIA 2R6FA 4FDBA 3SHLA 1CSQA 4JV2A 1OXXK 3CAMA 2WYOA 3HOUB 4IQZA 4FYDA 1PTOH 2JP1A 1X3PA 1KAWA 4JI3Q 3EJIA 4AIMA 1SYFA 4DPGA 4X3SA 2B63A 3VPCA 4RNOA 4A3BB 3KLRA 2EJFC 1Y69U 3CD6A 1MHWC 4GLAC 1Z2NX 4LF7H 1EYCA 5KFPA 2UVVA 1N56A 3K5HA 4B3ML 1AP0A 3OIQA 1SAPA 2N88A 2NTTA 1EZ1A 5KFSA 2QILA 4RGOS 5DM73 1WI5A 4QUCA 1XTDA 1IHZA 1V8QA 4DGZA 4DUZL 1I94L 1TWFA 3BVMA 3MR2A 5CYUA 2F03A 1Y14B 2R7KA 3OSNA 4UHVA 4RAYA 3HOVG 2R93A 4XYOA 4A93G 4CC6A 3DM3A 3SDZA 2EY5A 1K83B 5I2XA 1BCPC 4EVOA 1JB3A 3SK4A 1BCPF 3N8DA 2OQ0A 4IPDA 2KUMA 4X66Q 1VQ8A 4YQWA 1ONLA 1E1OA 4A3MH 5M9OA 4HIDA 3GP7A 5GROA 4YWLA 5GAEC 3PIOA 1YNJD 1LABA 4OIKA 1KC8C 4DR6H 4BBSG 4CJ0B 5I2YA 2F0HA 3EIVA 2YU9H 3VPBA 1N48A 2E5LH 3MXNB 1FNWA 1HPCA 5E4XA 3N6RA 2JA7G 5C1OA 3MR5A 3RF2A 2W9BA 3V6HA 5CAEB 1K1SA 4MAMA 2NU6B 3Q6SA 5EPKA 2DNEA 1YJWA 2G5DA 4I7HA 4G57A 1B7YB 1X56A 2SNMA 2BE5D 1JJ2A 1CA6A 1MIUA 3GTPH 3EA6A 4A3GB 1M6VA 5KG7A 1LM0A 4JYAH 1PFBA 4HTHA 1E3PA 5L37A 4FO2A 2BH2A 5K5PA 3KDFA 4GNXB 3WWVA 1DOLA 1LT3D
chains in the Genus database with same CATH topology
1X3GA 3A74A 2K4KA 4DNIA 5IP7G 1UWVA 2VUMG 4A3CH 3KYHC 1YJNA 3GO5A 1K9MC 4JI4Q 1VQ9A 5IYBH 3W5OA 2CKZB 2K5HA 3TS2A 4A3FG 2R6GA 5M3MG 1IZ6A 2MQHA 2C35B 3SGIA 4A75A 2CWAA 4HJ5A 2YTVA 3I4OA 1KL9A 1UE5A 4R4QA 3CC7A 1XPRA 3HOZH 3ER0A 2R92G 3ULPA 4DR6L 1XMOL 4GKJQ 5EAYA 2OWOA 3M3YH 2Y0SG 1VQJA 1J6QA 3M4QA 4IJHA 2NZHA 4XIGS 3J7ZC 2E5LL 4B3RL 2UXDQ 3F2DA 5IYCH 4LF7Q 2R7ZG 3J80i 1PV4A 1JJGA 1LYLA 1WFQA 5AJ3Q 3PUYA 4EQ5A 3K0XA 2N49A 1YBYA 3I4NH 4DR7L 3GTQH 2VQEL 1VQOA 3K7UC 5FLMH 3RLNA 1OXVA 5GQOA 4POFA 3S17H 4A3GG 4DV7L 1UE1A 1QVFA 1IBML 3AQQA 1VQEA 4BBRG 3H3VI 2H5XA 1PH3A 3HFZB 2HQLA 3AEVA 3A5UA 3GTMH 1BBWA 1XNQL 1HZBA 1Q86C 4A3LG 1WYDA 3BZCA 3I55A 3ERSX 1VS0A 3BZKA 3K81C 4A3DG 4IPGA 4LF5L 1HH2P 1IXRA 1AE3A 3I4MG 5DLQE 3S15H 2ES2A 2FXQA 1VQNA 4LF6L 2V1CC 2JE6I 2F52A 4QQBX 3PO2H 4GOPC 4ME3A 1PVOA 1N8RC 3CPFA 4OWWB 1Q46A 4DR1L 4OX9L 3HOWH 1NTGA 4B3SQ 4P73A 1EIFA 2I5LX 2Q2IA 3TREA 3W1BA 4HJ9A 1SE8A 2WP8J 1VQFA 3FKIG 4YHHQ 3HOUH 3H3VH 3CMAA 3ICEA 1L1OB 4DV1L 3HOXH 4DR2L 1PA6A 4BY7G 3PO3H 4JCVE 3CCVA 4AQYL 1PH1A 4A3BH 2E5LQ 4B3RQ 5JJLA 3CCUA 3PUXA 5LMNL 1SRUA 2PQAA 5C0XG 4DV5Q 3PV0A 1Q82C 5IP9H 4DR7Q 2I5HA 2VQEQ 4DAMA 3J80c 2VQFL 2JEAI 2UU9L 4UPAA 1EUJA 4KLKA 4DV0Q 2IHFA 2VZAA 3T1HL 4JI7L 2JA7H 3S14H 4GN3B 1PH5A 3CC4A 4LFAL 4GKKL 2ATWA 4LWCA 1HZCA 3TS0A 1EQRA 4DR3Q 2WAQE 1YJ9A 2JA6G 5LMUL 5BR8L 2GVAA 3H15A 1HR0L 4JBMA 4IFDG 1X65A 4ALPA 3UDIA 2B63H 2DUDA 2HIVA 1QZHA 2UUCL 1WOCA 4LUVA 1K83H 5H1SE 4LF6Q 1VCIA 3U4VA 1NY4A 5M5YH 3UDFA 2ZJQA 2KHIA 4UP8A 2I0QA 3OW2A 1E24A 2NZOA 2NVYH 4LFBQ 2LSSA 3KF6B 1A63A 4DR1Q 4OX9Q 3AFPA 1XNRQ 2PI2A 1Z47A 1KHIA 4GNXA 4BA2I 2HIXA 5C4JH 4LNQA 4WJ4A 1I6HH 1YHBA 4A3FH 1VQAA 4DV1Q 3CCSA 4DR2Q 1A62A 1VQIA 2E8GA 5LMNW 1FJGQ 4OO1G 4QGUA 1KXLA 3UE1A 2ID0A 4DV2L 3JC66 4IPHA 4OWXB 3GTOH 2XGTA 2R92H 1VQLA 4A3EG 1V9PA 3ULJA 1J5EL 1EFWA 1TXYA 5LMNQ 4POGA 2NN6I 1UE6A 2JA8H 4J15A 4HJ8A 1PH7A 4B3MQ 2R7ZH 4Y52H 1HJPA 4R4IA 5IWAL 4X62Q 4DV3L 2MFIA 2Q2HA 5JEAJ 2JQOA 3GD7A 4KHZA 1N33L 4JG2A 1ASYA 3PF4A 5IYDG 3GDEA 3HKZE 4QJFA 4XTCS 1I50H 1I5FA 3H0GG 1FGUA 3PUWA 4DUZQ 1EQQA 3J81j 1I94Q 1HNZL 4LFAQ 4JI7Q 4A3GH 4GKKQ 3B6YA 3S24A 1XPUA 5JJIA 5LMUQ 4DK3C 2LXKA 4DAYB 4X65Q 1IBKL 1N32L 4BY1G 3U50C 1GD7A 1WCMH 3S1NH 2B29A 1SFOH 2NVTH 5HY6A 4TQUS 2UXCL 5HGQA 4NXMQ 4QIWE 4K0KL 5ELNA 4JI5Q 1K73C 2K5VA 3EN2A 1NMFA 4DUYL 1LTLA 3HOYG 4R4OA 4QL5A 3NEMA 5C0XI 2CWPA 1ASZA 4P71A 3AFQA 5M5WH 1PHJA 2ZTCA 1U5KA 1CUKA 1NMGA 2EXDA 3G48A 1SLJA 3HKSA 4LUZA 4R1JA 1HNXQ 1VQDA 3UDXA 2ZTEA 2AWNA 4IPCA 3G4SA 4DR5L 1EOVA 1QZGA 4KHPL 3RR5A 1YHAA 4APVA 4DV2Q 1YEZA 3J7A5 3S2DH 5GAHC 4BY7H 5M5XH 4A3JG 1HZ9A 2F3IA 1JT8A 1SROA 4A3MG 2UXBL 4JBWA 4IJLA 4UP9A 1TWHH 3BJUA 4IFDI 2OTLA 2AWOA 1X3FA 4IO9A 4LF8Q 1TWAH 1Q8KA 1L1OA 1P16A 4OWTB 4JYAL 1JE5A 2K75A 2ALYB 4MZ9A 4GS3A 4JI2L 1O7IA 4O0AA 3JAMc 1JMCA 2PMZE 3Q8DA 1HNZQ 4YWMA 3STBC 4IOAA 5GADC 4GOPA 2R93G 1KIXA 2YTYA 1PYBA 4JI8L 1IBKQ 2MO1A 3A5ZB 4JBJA 3T1HQ 1KD1C 3KFUA 1N32Q 3KJOA 1Z9FA 5C4XH 3HOVH 3J81i 5C44G 3OTOL 4A3IG 4OO1I 2VS1A 2UXCQ 1L2FA 5C3EH 3S1QH 3KJPA 4A93H 4BXXH 2HHHL 1W2BA 1YITA 1FVIA 3L7ZC 3E0EA 3F1ZA 5M3FG 3GTGH 4YCUA 1X54A 3KLWA 1OXSC 1N9WA 4A3CG 2K5NA 2RHSB 4YCVA 3ZJYC 4DR6Q 2HT1A 1XMOQ 1PH8A 3PGZA 1KQSA 1YZ6A 3S2HH 1OXTA 1CKNB 2CCZA 5IYBG 1UE7A 4L5RC 1VQ7A 2NVQH 2D0OA 4GOPB 3CP0A 1X9NA 2K52A 4KHPQ 4BBSH 4H02A 1X55A 5ELOA 1Y1VG 3NELA 3RLOA 3HOZG 2UXBQ 3KF6A 4X66L 1Y1WH 4A76A 1Q1BA 4LUOA 3RNUA 4A3EH 4A3KG 3ULLA 4DV7Q 2ZJRA 4JI1L 2RCNA 1IBMQ 4JYAQ 2ZTDA 1OXUA 2ZM6L 1HNWL 3G6EA 3E9HA 2BA0A 3I4NG 3RZDH 4HJAA 1XNQQ 5GAGC 1EWIA 5IYDH 2N8NA 4Y7NH 1GO3E 5FLMG 1DGSA 1G51A 1X6OA 2YV5A 3H0GH 4JC0A 4OXPA 4L5SA 4LF5Q 1NJIC 1JB7A 1YI2A 3W1GA 2EIFA 5FJ8G 2IX1A 3OTOQ 2E2JH 1G6PA 4KI0A 5IP7H 2VUMH 4BY1H 3GTKH 1A8VA 4DV6L 1S3OA 2B3GA 1NE3A 2HHHQ 1A0IA 2Z6KC 2E2IH 3J81c 3CCQA 4YY3L 2KCTA 4X64L 4C3JH 4L5TA 1PYSB 4DKAC 3M7NA 2IX0A 5M3MH 2A19A 2R7FA 4GN4B 1PH2A 2XTIA 3OYYA 2AHOB 2A8VA 3K7AH 1V43A 1VQCA 2RHQB 3I56A 4AQYQ 3L2PA 1VQ6A 2UUAL 4JI4L 1LUZA 3S16H 3HOWG 2VNUD 1VQMA 2MNAA 1XMQL 1AE2A 2JA5G 1BVSA 2D0PA 1IYJB 2WFWA 4YCWA 4HIKA 3HOUG 5E7NA 4JOIC 2VQFQ 3HOXG 3I7FA 1CSPA 2K14A 2UU9Q 3CW2C 1S40A 4A3JH 3PO3G 2KCMA 4A3BG 2WAQG 2JK8A 3CQZH 4NB3A 1HR0W 3L0OA 1PFSA 1HNWQ 4NPSA 2KHJA 3I2ZA 2E2HH 4GLXA 3K80C 5IP9G 1PH6A 4BBRH 4GN5A 3D31A 5BR8Q 4P75A 5AJ3L 1HR0Q 3BU2A 2OQKA 1KRSA 4RMFA 4A3LH 4GNXC 3LGJA 3TQYA 3GTLH 1RL2A 4MTNA 3CCLA 4DR4Q 2UUCQ 5J3BA 3PUVA 4A3DH 2VW9A 1N36L 3I4MH 3KOJA 1HZAA 1QVGA 3RZOH 1TWCH 4WJ3M 1BBUA 1Q12A 4B3TL 3FHWA 4DV6Q 3CCJA 1C9OA 3PUZA 3DLLA 4P74A 1FL0A 1NBWA 2PI2E 4YY3Q 3CCRA 2N3SA 3CCMA 4DV4L 4HIMA 2B63G 4X6AH 1B70B 4X64Q 3PCOB 2L15A 3T1YL 2IY5B 2IHEA 3M4OH 3FKIH 1PH9A 4EX5A 4A4IA 1M90C 4QY7A 3IRBA 5JEAG 3M85A 3CXCA 4MNOA 2UUAQ 2Z0SA 4UY8C 4NXNL 1MJEA 1XMQQ 2EQSA 2VL6A 3EBEA 1J5EQ 3NENA 2F4VL 4YWKA 1D8LA 4B3SL 1I3QH 3HKZG 1XJVA 5IY0A 4JI6L 5IWAQ 2AMCB 4YHHL 4DV3Q 3KF8B 4AYBE 1N33Q 1Y1VH 2IT1A 2GN5A 3K8AA 4JI3L 1H95A 1Q1EA 2WB1E 5FLXc 2QEXA 1CKNA 4LFCL 1C7YA 4AH6A 1VQ5A 3TRZA 4R4CA 1Q81C 1VQPA 4O2DA 4A3KH 3CMEA 2JA8G 4R4TA 1QVCA 3KDFB 1W3SA 2CQOA 2QGQA 3CPWA 4DV5L 2NVXH 2OTJA 1GKHA 2RF4A 1B8AA 2JA6H 5IT9c 1QUQA 4JI0L 3E9IA 3G71A 3S1MH 4K0KQ 3U58A 1PH4A 4DV0L 4C2MH 2N78A 1N36Q 1YHQA 4DUYQ 3U4ZA 1EIYB 4B3TQ 3TEHB 1G291 5C0XJ 5FJ8H 4LF9L 2AKWB 1U0LA 1JJCB 4DR3L 1VQKA 3PF5A 5JJKA 1WCMG 1K3RA 1IBLL 4DV4Q 3CCEA 2Q2UA 2NN6G 2YYZA 3T1YQ 2JEBI 1L1OC 5IE8A 4DR5Q 1SN8A 1R9TH 2D62A 4C3IH 2UUBL 4PZ7A 1N34L 3UDGA 4NXNQ 1YIJA 4JBKA 4LFBL 2F4VQ 4P72A 1QUQB 1M1KC 1VQGA 3PSIA 4AYBG 4IFDJ 4FDBA 3F2CA 1CSQA 1SMXA 4C3HH 2JA5H 1OXXK 2WB1G 3CAMA 1XNRL 1D7QA 1MJCA 4JI6Q 3A0JA 5IYCG 1K8AC 1KAWA 4PMWA 2ZJPA 4JI3Q 2QA4A 1XPOA 4JI2Q 1WJJA 1P8LA 3M9BA 4AIMA 4DPGA 3VDYA 4LFCQ 1FJGL 1K0RA 4LF4L 1C0AA 1S72A 3FP9A 2YTXA 4GLVB 1RIPA 3CD6A 4GLAC 2Z6KA 2JJQA 1K8GA 1IL2A 1KRTA 4JI8Q 4RG1A 4PZ8A 4B3ML 3CC2A 1VQ4A 4X62L 1WI5A 1X3EA 4JI0Q 3F8TA 4JV5L 1VQBA 2BA1A 4DR4L 1XTDA 4DUZL 2MO0A 2R7DA 2OCEA 1UEBA 3RN2A 1I94L 1SR3A 1BKBA 2A1AA 1Y14B 4LF9Q 1E22A 4PG3A 1AH9A 1E7ZA 3HOYH 1Q7YC 5C4XG 3GTJH 4JOIA 4X65L 1CKMA 1E1TA 4IOCA 1IBLQ 3HOVG 3M4PA 2BH8A 5C3EG 3PO2G 4A93G 4BXXG 3DM3A 2K50A 3CF5A 4NXML 3RLFA 4DK6C 4JI5L 3D0FA 2JA9A 2UUBQ 1CKOA 1N34Q 2PQAB 1MKHA 2OQ0A 4IPDA 4X66Q 1VQ8A 1E1OA 4L5QA 4A3MH 4PZ6A 4UP7A 4GKJL 3F2BA 4JI1Q 1GM5A 4HIDA 2KENA 2PNHA 5GROA 4YWLA 2GVBA 4BA1I 1V1QA 1TWFH 5GAEC 3PIOA 2ZM6Q 1KC8C 1HNXL 3AYHB 4BBSG 2UXDL 3PIPA 3EIVA 2YU9H 4LF7L 4LF4Q 2Y0SE 3S1RH 3STBD 4OONA 1YVCA 1Y1WG 4HJ7A 3MXNB 1TWGH 2JA7G 3UE0A 2CFMA 2VY3A 2R93H 1YNXA 4LF8L 4TVAB 3JAMi 5K36G 1YJWA 3NBHB 2DGYA 4JV5Q 1VQHA 5C44H 1B7YB 1X56A 4A3IH 1JJ2A 2KBNA 4LW1A 1MIUA 2ASBA 4HIOA 3GTPH 1OTCA 1LM0A 2LXJA 1E3PA 1EYGA 1T9HA 2Q2TA 2BH2A 3KDFA 1L0WA 1GVPA 4GNXB 3RN5A 3WWVA 2I5MX 3MEFA 5M3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3G A;  3A74 A;  2K4K A;  4DNI A;  5IP7 G;  1UWV A;  2VUM G;  4A3C H;  3KYH C;  1YJN A;  3GO5 A;  1K9M C;  4JI4 Q;  1VQ9 A;  5IYB H;  3W5O A;  2CKZ B;  2K5H A;  3TS2 A;  4A3F G;  2R6G A;  5M3M G;  1IZ6 A;  2MQH A;  2C35 B;  3SGI A;  4A75 A;  2CWA A;  4HJ5 A;  2YTV A;  3I4O A;  1KL9 A;  1UE5 A;  4R4Q A;  3CC7 A;  1XPR A;  3HOZ H;  3ER0 A;  2R92 G;  3ULP A;  4DR6 L;  1XMO L;  4GKJ Q;  5EAY A;  2OWO A;  3M3Y H;  2Y0S G;  1VQJ A;  1J6Q A;  3M4Q A;  4IJH A;  2NZH A;  4XIG S;  3J7Z C;  2E5L L;  4B3R L;  2UXD Q;  3F2D A;  5IYC H;  4LF7 Q;  2R7Z G;  3J80 i;  1PV4 A;  1JJG A;  1LYL A;  1WFQ A;  5AJ3 Q;  3PUY A;  4EQ5 A;  3K0X A;  2N49 A;  1YBY A;  3I4N H;  4DR7 L;  3GTQ H;  2VQE L;  1VQO A;  3K7U C;  5FLM H;  3RLN A;  1OXV A;  5GQO A;  4POF A;  3S17 H;  4A3G G;  4DV7 L;  1UE1 A;  1QVF A;  1IBM L;  3AQQ A;  1VQE A;  4BBR G;  3H3V I;  2H5X A;  1PH3 A;  3HFZ B;  2HQL A;  3AEV A;  3A5U A;  3GTM H;  1BBW A;  1XNQ L;  1HZB A;  1Q86 C;  4A3L G;  1WYD A;  3BZC A;  3I55 A;  3ERS X;  1VS0 A;  3BZK A;  3K81 C;  4A3D G;  4IPG A;  4LF5 L;  1HH2 P;  1IXR A;  1AE3 A;  3I4M G;  5DLQ E;  3S15 H;  2ES2 A;  2FXQ A;  1VQN A;  4LF6 L;  2V1C C;  2JE6 I;  2F52 A;  4QQB X;  3PO2 H;  4GOP C;  4ME3 A;  1PVO A;  1N8R C;  3CPF A;  4OWW B;  1Q46 A;  4DR1 L;  4OX9 L;  3HOW H;  1NTG A;  4B3S Q;  4P73 A;  1EIF A;  2I5L X;  2Q2I A;  3TRE A;  3W1B A;  4HJ9 A;  1SE8 A;  2WP8 J;  1VQF A;  3FKI G;  4YHH Q;  3HOU H;  3H3V H;  3CMA A;  3ICE A;  1L1O B;  4DV1 L;  3HOX H;  4DR2 L;  1PA6 A;  4BY7 G;  3PO3 H;  4JCV E;  3CCV A;  4AQY L;  1PH1 A;  4A3B H;  2E5L Q;  4B3R Q;  5JJL A;  3CCU A;  3PUX A;  5LMN L;  1SRU A;  2PQA A;  5C0X G;  4DV5 Q;  3PV0 A;  1Q82 C;  5IP9 H;  4DR7 Q;  2I5H A;  2VQE Q;  4DAM A;  3J80 c;  2VQF L;  2JEA I;  2UU9 L;  4UPA A;  1EUJ A;  4KLK A;  4DV0 Q;  2IHF A;  2VZA A;  3T1H L;  4JI7 L;  2JA7 H;  3S14 H;  4GN3 B;  1PH5 A;  3CC4 A;  4LFA L;  4GKK L;  2ATW A;  4LWC A;  1HZC A;  3TS0 A;  1EQR A;  4DR3 Q;  2WAQ E;  1YJ9 A;  2JA6 G;  5LMU L;  5BR8 L;  2GVA A;  3H15 A;  1HR0 L;  4JBM A;  4IFD G;  1X65 A;  4ALP A;  3UDI A;  2B63 H;  2DUD A;  2HIV A;  1QZH A;  2UUC L;  1WOC A;  4LUV A;  1K83 H;  5H1S E;  4LF6 Q;  1VCI A;  3U4V A;  1NY4 A;  5M5Y H;  3UDF A;  2ZJQ A;  2KHI A;  4UP8 A;  2I0Q A;  3OW2 A;  1E24 A;  2NZO A;  2NVY H;  4LFB Q;  2LSS A;  3KF6 B;  1A63 A;  4DR1 Q;  4OX9 Q;  3AFP A;  1XNR Q;  2PI2 A;  1Z47 A;  1KHI A;  4GNX A;  4BA2 I;  2HIX A;  5C4J H;  4LNQ A;  4WJ4 A;  1I6H H;  1YHB A;  4A3F H;  1VQA A;  4DV1 Q;  3CCS A;  4DR2 Q;  1A62 A;  1VQI A;  2E8G A;  5LMN W;  1FJG Q;  4OO1 G;  4QGU A;  1KXL A;  3UE1 A;  2ID0 A;  4DV2 L;  3JC6 6;  4IPH A;  4OWX B;  3GTO H;  2XGT A;  2R92 H;  1VQL A;  4A3E G;  1V9P A;  3ULJ A;  1J5E L;  1EFW A;  1TXY A;  5LMN Q;  4POG A;  2NN6 I;  1UE6 A;  2JA8 H;  4J15 A;  4HJ8 A;  1PH7 A;  4B3M Q;  2R7Z H;  4Y52 H;  1HJP A;  4R4I A;  5IWA L;  4X62 Q;  4DV3 L;  2MFI A;  2Q2H A;  5JEA J;  2JQO A;  3GD7 A;  4KHZ A;  1N33 L;  4JG2 A;  1ASY A;  3PF4 A;  5IYD G;  3GDE A;  3HKZ E;  4QJF A;  4XTC S;  1I50 H;  1I5F A;  3H0G G;  1FGU A;  3PUW A;  4DUZ Q;  1EQQ A;  3J81 j;  1I94 Q;  1HNZ L;  4LFA Q;  4JI7 Q;  4A3G H;  4GKK Q;  3B6Y A;  3S24 A;  1XPU A;  5JJI A;  5LMU Q;  4DK3 C;  2LXK A;  4DAY B;  4X65 Q;  1IBK L;  1N32 L;  4BY1 G;  3U50 C;  1GD7 A;  1WCM H;  3S1N H;  2B29 A;  1SFO H;  2NVT H;  5HY6 A;  4TQU S;  2UXC L;  5HGQ A;  4NXM Q;  4QIW E;  4K0K L;  5ELN A;  4JI5 Q;  1K73 C;  2K5V A;  3EN2 A;  1NMF A;  4DUY L;  1LTL A;  3HOY G;  4R4O A;  4QL5 A;  3NEM A;  5C0X I;  2CWP A;  1ASZ A;  4P71 A;  3AFQ A;  5M5W H;  1PHJ A;  2ZTC A;  1U5K A;  1CUK A;  1NMG A;  2EXD A;  3G48 A;  1SLJ A;  3HKS A;  4LUZ A;  4R1J A;  1HNX Q;  1VQD A;  3UDX A;  2ZTE A;  2AWN A;  4IPC A;  3G4S A;  4DR5 L;  1EOV A;  1QZG A;  4KHP L;  3RR5 A;  1YHA A;  4APV A;  4DV2 Q;  1YEZ A;  3J7A 5;  3S2D H;  5GAH C;  4BY7 H;  5M5X H;  4A3J G;  1HZ9 A;  2F3I A;  1JT8 A;  1SRO A;  4A3M G;  2UXB L;  4JBW A;  4IJL A;  4UP9 A;  1TWH H;  3BJU A;  4IFD I;  2OTL A;  2AWO A;  1X3F A;  4IO9 A;  4LF8 Q;  1TWA H;  1Q8K A;  1L1O A;  1P16 A;  4OWT B;  4JYA L;  1JE5 A;  2K75 A;  2ALY B;  4MZ9 A;  4GS3 A;  4JI2 L;  1O7I A;  4O0A A;  3JAM c;  1JMC A;  2PMZ E;  3Q8D A;  1HNZ Q;  4YWM A;  3STB C;  4IOA A;  5GAD C;  4GOP A;  2R93 G;  1KIX A;  2YTY A;  1PYB A;  4JI8 L;  1IBK Q;  2MO1 A;  3A5Z B;  4JBJ A;  3T1H Q;  1KD1 C;  3KFU A;  1N32 Q;  3KJO A;  1Z9F A;  5C4X H;  3HOV H;  3J81 i;  5C44 G;  3OTO L;  4A3I G;  4OO1 I;  2VS1 A;  2UXC Q;  1L2F A;  5C3E H;  3S1Q H;  3KJP A;  4A93 H;  4BXX H;  2HHH L;  1W2B A;  1YIT A;  1FVI A;  3L7Z C;  3E0E A;  3F1Z A;  5M3F G;  3GTG H;  4YCU A;  1X54 A;  3KLW A;  1OXS C;  1N9W A;  4A3C G;  2K5N A;  2RHS B;  4YCV A;  3ZJY C;  4DR6 Q;  2HT1 A;  1XMO Q;  1PH8 A;  3PGZ A;  1KQS A;  1YZ6 A;  3S2H H;  1OXT A;  1CKN B;  2CCZ A;  5IYB G;  1UE7 A;  4L5R C;  1VQ7 A;  2NVQ H;  2D0O A;  4GOP B;  3CP0 A;  1X9N A;  2K52 A;  4KHP Q;  4BBS H;  4H02 A;  1X55 A;  5ELO A;  1Y1V G;  3NEL A;  3RLO A;  3HOZ G;  2UXB Q;  3KF6 A;  4X66 L;  1Y1W H;  4A76 A;  1Q1B A;  4LUO A;  3RNU A;  4A3E H;  4A3K G;  3ULL A;  4DV7 Q;  2ZJR A;  4JI1 L;  2RCN A;  1IBM Q;  4JYA Q;  2ZTD A;  1OXU A;  2ZM6 L;  1HNW L;  3G6E A;  3E9H A;  2BA0 A;  3I4N G;  3RZD H;  4HJA A;  1XNQ Q;  5GAG C;  1EWI A;  5IYD H;  2N8N A;  4Y7N H;  1GO3 E;  5FLM G;  1DGS A;  1G51 A;  1X6O A;  2YV5 A;  3H0G H;  4JC0 A;  4OXP A;  4L5S A;  4LF5 Q;  1NJI C;  1JB7 A;  1YI2 A;  3W1G A;  2EIF A;  5FJ8 G;  2IX1 A;  3OTO Q;  2E2J H;  1G6P A;  4KI0 A;  5IP7 H;  2VUM H;  4BY1 H;  3GTK H;  1A8V A;  4DV6 L;  1S3O A;  2B3G A;  1NE3 A;  2HHH Q;  1A0I A;  2Z6K C;  2E2I H;  3J81 c;  3CCQ A;  4YY3 L;  2KCT A;  4X64 L;  4C3J H;  4L5T A;  1PYS B;  4DKA C;  3M7N A;  2IX0 A;  5M3M H;  2A19 A;  2R7F A;  4GN4 B;  1PH2 A;  2XTI A;  3OYY A;  2AHO B;  2A8V A;  3K7A H;  1V43 A;  1VQC A;  2RHQ B;  3I56 A;  4AQY Q;  3L2P A;  1VQ6 A;  2UUA L;  4JI4 L;  1LUZ A;  3S16 H;  3HOW G;  2VNU D;  1VQM A;  2MNA A;  1XMQ L;  1AE2 A;  2JA5 G;  1BVS A;  2D0P A;  1IYJ B;  2WFW A;  4YCW A;  4HIK A;  3HOU G;  5E7N A;  4JOI C;  2VQF Q;  3HOX G;  3I7F A;  1CSP A;  2K14 A;  2UU9 Q;  3CW2 C;  1S40 A;  4A3J H;  3PO3 G;  2KCM A;  4A3B G;  2WAQ G;  2JK8 A;  3CQZ H;  4NB3 A;  1HR0 W;  3L0O A;  1PFS A;  1HNW Q;  4NPS A;  2KHJ A;  3I2Z A;  2E2H H;  4GLX A;  3K80 C;  5IP9 G;  1PH6 A;  4BBR H;  4GN5 A;  3D31 A;  5BR8 Q;  4P75 A;  5AJ3 L;  1HR0 Q;  3BU2 A;  2OQK A;  1KRS A;  4RMF A;  4A3L H;  4GNX C;  3LGJ A;  3TQY A;  3GTL H;  1RL2 A;  4MTN A;  3CCL A;  4DR4 Q;  2UUC Q;  5J3B A;  3PUV A;  4A3D H;  2VW9 A;  1N36 L;  3I4M H;  3KOJ A;  1HZA A;  1QVG A;  3RZO H;  1TWC H;  4WJ3 M;  1BBU A;  1Q12 A;  4B3T L;  3FHW A;  4DV6 Q;  3CCJ A;  1C9O A;  3PUZ A;  3DLL A;  4P74 A;  1FL0 A;  1NBW A;  2PI2 E;  4YY3 Q;  3CCR A;  2N3S A;  3CCM A;  4DV4 L;  4HIM A;  2B63 G;  4X6A H;  1B70 B;  4X64 Q;  3PCO B;  2L15 A;  3T1Y L;  2IY5 B;  2IHE A;  3M4O H;  3FKI H;  1PH9 A;  4EX5 A;  4A4I A;  1M90 C;  4QY7 A;  3IRB A;  5JEA G;  3M85 A;  3CXC A;  4MNO A;  2UUA Q;  2Z0S A;  4UY8 C;  4NXN L;  1MJE A;  1XMQ Q;  2EQS A;  2VL6 A;  3EBE A;  1J5E Q;  3NEN A;  2F4V L;  4YWK A;  1D8L A;  4B3S L;  1I3Q H;  3HKZ G;  1XJV A;  5IY0 A;  4JI6 L;  5IWA Q;  2AMC B;  4YHH L;  4DV3 Q;  3KF8 B;  4AYB E;  1N33 Q;  1Y1V H;  2IT1 A;  2GN5 A;  3K8A A;  4JI3 L;  1H95 A;  1Q1E A;  2WB1 E;  5FLX c;  2QEX A;  1CKN A;  4LFC L;  1C7Y A;  4AH6 A;  1VQ5 A;  3TRZ A;  4R4C A;  1Q81 C;  1VQP A;  4O2D A;  4A3K H;  3CME A;  2JA8 G;  4R4T A;  1QVC A;  3KDF B;  1W3S A;  2CQO A;  2QGQ A;  3CPW A;  4DV5 L;  2NVX H;  2OTJ A;  1GKH A;  2RF4 A;  1B8A A;  2JA6 H;  5IT9 c;  1QUQ A;  4JI0 L;  3E9I A;  3G71 A;  3S1M H;  4K0K Q;  3U58 A;  1PH4 A;  4DV0 L;  4C2M H;  2N78 A;  1N36 Q;  1YHQ A;  4DUY Q;  3U4Z A;  1EIY B;  4B3T Q;  3TEH B;  1G29 1;  5C0X J;  5FJ8 H;  4LF9 L;  2AKW B;  1U0L A;  1JJC B;  4DR3 L;  1VQK A;  3PF5 A;  5JJK A;  1WCM G;  1K3R A;  1IBL L;  4DV4 Q;  3CCE A;  2Q2U A;  2NN6 G;  2YYZ A;  3T1Y Q;  2JEB I;  1L1O C;  5IE8 A;  4DR5 Q;  1SN8 A;  1R9T H;  2D62 A;  4C3I H;  2UUB L;  4PZ7 A;  1N34 L;  3UDG A;  4NXN Q;  1YIJ A;  4JBK A;  4LFB L;  2F4V Q;  4P72 A;  1QUQ B;  1M1K C;  1VQG A;  3PSI A;  4AYB G;  4IFD J;  4FDB A;  3F2C A;  1CSQ A;  1SMX A;  4C3H H;  2JA5 H;  1OXX K;  2WB1 G;  3CAM A;  1XNR L;  1D7Q A;  1MJC A;  4JI6 Q;  3A0J A;  5IYC G;  1K8A C;  1KAW A;  4PMW A;  2ZJP A;  4JI3 Q;  2QA4 A;  1XPO A;  4JI2 Q;  1WJJ A;  1P8L A;  3M9B A;  4AIM A;  4DPG A;  3VDY A;  4LFC Q;  1FJG L;  1K0R A;  4LF4 L;  1C0A A;  1S72 A;  3FP9 A;  2YTX A;  4GLV B;  1RIP A;  3CD6 A;  4GLA C;  2Z6K A;  2JJQ A;  1K8G A;  1IL2 A;  1KRT A;  4JI8 Q;  4RG1 A;  4PZ8 A;  4B3M L;  3CC2 A;  1VQ4 A;  4X62 L;  1WI5 A;  1X3E A;  4JI0 Q;  3F8T A;  4JV5 L;  1VQB A;  2BA1 A;  4DR4 L;  1XTD A;  4DUZ L;  2MO0 A;  2R7D A;  2OCE A;  1UEB A;  3RN2 A;  1I94 L;  1SR3 A;  1BKB A;  2A1A A;  1Y14 B;  4LF9 Q;  1E22 A;  4PG3 A;  1AH9 A;  1E7Z A;  3HOY H;  1Q7Y C;  5C4X G;  3GTJ H;  4JOI A;  4X65 L;  1CKM A;  1E1T A;  4IOC A;  1IBL Q;  3HOV G;  3M4P A;  2BH8 A;  5C3E G;  3PO2 G;  4A93 G;  4BXX G;  3DM3 A;  2K50 A;  3CF5 A;  4NXM L;  3RLF A;  4DK6 C;  4JI5 L;  3D0F A;  2JA9 A;  2UUB Q;  1CKO A;  1N34 Q;  2PQA B;  1MKH A;  2OQ0 A;  4IPD A;  4X66 Q;  1VQ8 A;  1E1O A;  4L5Q A;  4A3M H;  4PZ6 A;  4UP7 A;  4GKJ L;  3F2B A;  4JI1 Q;  1GM5 A;  4HID A;  2KEN A;  2PNH A;  5GRO A;  4YWL A;  2GVB A;  4BA1 I;  1V1Q A;  1TWF H;  5GAE C;  3PIO A;  2ZM6 Q;  1KC8 C;  1HNX L;  3AYH B;  4BBS G;  2UXD L;  3PIP A;  3EIV A;  2YU9 H;  4LF7 L;  4LF4 Q;  2Y0S E;  3S1R H;  3STB D;  4OON A;  1YVC A;  1Y1W G;  4HJ7 A;  3MXN B;  1TWG H;  2JA7 G;  3UE0 A;  2CFM A;  2VY3 A;  2R93 H;  1YNX A;  4LF8 L;  4TVA B;  3JAM i;  5K36 G;  1YJW A;  3NBH B;  2DGY A;  4JV5 Q;  1VQH A;  5C44 H;  1B7Y B;  1X56 A;  4A3I H;  1JJ2 A;  2KBN A;  4LW1 A;  1MIU A;  2ASB A;  4HIO A;  3GTP H;  1OTC A;  1LM0 A;  2LXJ A;  1E3P A;  1EYG A;  1T9H A;  2Q2T A;  2BH2 A;  3KDF A;  1L0W A;  1GVP A;  4GNX B;  3RN5 A;  3WWV A;  2I5M X;  3MEF A;  5M3F H; 
#chains in the Genus database with same CATH topology
 1X3G A;  1X3Q A;  2F0L A;  3A74 A;  3BVG A;  4HED A;  1WCM B;  4DNI A;  2NVT B;  1TWH A;  4LF5 H;  5DGA A;  3DUZ A;  1YJN A;  1WTW A;  4ED1 A;  2QYZ A;  4ECV A;  2CKZ B;  4RNM A;  1E4E A;  3WDN A;  4XQN A;  5KKN B;  4IUU A;  2KCC A;  1IZ6 A;  3QB3 A;  2EXZ A;  4PMB A;  4RB3 C;  3SGI A;  5JVG 3;  4DR1 H;  3EPG A;  2PBZ A;  4GKJ Q;  1XPR A;  3ER0 A;  3GQC A;  1XMO L;  2OWO A;  2C28 A;  1VF7 A;  4P2C B;  1V4Y A;  2PMZ B;  1L0X B;  1SNC A;  4IJH A;  2NZH A;  4OEM B;  4XIG S;  3J7Z C;  2UXD Q;  4DV1 H;  5IYC H;  1PV4 A;  1LYL A;  3S2D B;  2OXP A;  1LTG D;  1Q8I A;  4EQ5 A;  4BY7 B;  3KUP A;  4H44 C;  4DR7 L;  2VQE L;  1VQO A;  3RLN A;  5GQO A;  3S17 H;  3IKJ A;  1PK8 A;  3A8J E;  2CQY A;  2RDH A;  1OO9 B;  1TS3 A;  3BQ1 A;  1UEA B;  1VQE A;  2HCC A;  4V0B A;  3QOL A;  2I80 A;  3NP8 A;  2ASJ A;  1B44 D;  1QNU A;  3HFZ B;  5FK9 C;  1PH3 A;  3AEV A;  1XNQ L;  4A3L G;  1HZB A;  1FNV A;  4LH6 A;  4GKK H;  4I4T F;  3BZK A;  1X32 A;  4IAJ A;  1EZ6 A;  1AE3 A;  1HR0 H;  3RB0 A;  2ES2 A;  3O13 A;  4TQS A;  2V1C C;  5CBE E;  3WO1 A;  1D6E C;  3BDL A;  2B2U C;  3JAM L;  2NU7 B;  5KFE A;  1STN A;  4F50 A;  1RDP D;  4OWW B;  4Y8V B;  1XX8 A;  1MBY A;  1EWH A;  4B3S Q;  2F0S A;  2M00 A;  1RTO A;  4YHH Q;  1PX2 A;  3ICE A;  2ZDH A;  2FPI B;  4KN7 C;  1PA6 A;  4O4H F;  4J9R A;  2KCN A;  2R87 A;  1PTO C;  4AQY L;  4LMY A;  2NVQ B;  1PTO F;  1K83 A;  5FLX W;  3WOF A;  5I6W A;  4RHR A;  2KHS A;  5JJL A;  2Q8I B;  5LMN L;  5L1L A;  2XCA A;  2VQF L;  1O78 A;  1Y1W B;  2F0V A;  4DV0 Q;  3V2T A;  2IHF A;  2VZA A;  3S14 H;  3CC4 A;  1TQO A;  2XN9 C;  4LWC A;  4DR3 Q;  2WAQ E;  2GVA A;  3MXN A;  3H15 A;  4TQR A;  4TV8 F;  4IFD G;  2W6Z A;  1X65 A;  4ALP A;  1EEI D;  4MTE A;  3JRX A;  2V9W A;  4RKL A;  5H1S E;  1CQV A;  1NY4 A;  1GUS A;  2VUM B;  3UDF A;  3VA7 A;  4IWY A;  4UP8 A;  3TIN A;  2UVW A;  4LFB Q;  2LSS A;  5C5J A;  3D6W A;  3SVM A;  1WH2 A;  1I4Q A;  1Z47 A;  1KHI A;  3TBI B;  4GNX A;  3LML A;  5M3M B;  4A3F H;  4U6P A;  4C3I G;  1WCM A;  3MJF A;  4DV4 H;  5LMN W;  3KLS X;  3T5J A;  4QGU A;  1O80 A;  2FLN A;  3GTO H;  2R92 H;  1VQL A;  4OL7 A;  4PNY A;  3RJ0 A;  4C3H G;  1EFW A;  2FE3 A;  1TXY A;  4POG A;  4E4T A;  3IN5 A;  1VAJ A;  1KNA A;  4C1N K;  4B3M Q;  4CGY B;  4UAI A;  4R4I A;  4TV9 F;  1EY5 A;  1LO5 D;  1IOW A;  5CC4 A;  1FKA H;  3Q2O A;  1ASY A;  1RD9 D;  3GDE A;  1WD0 A;  1I50 H;  3CQZ B;  3D3R A;  4IUR A;  4DUZ Q;  3K57 A;  1I94 Q;  1SND A;  4LFA Q;  2L55 A;  2E2H B;  5BMV F;  4JI2 H;  3B6Y A;  2OEO A;  3FDS A;  3E5S A;  2OH2 A;  1IBK L;  1N32 L;  1J8I A;  1EY6 A;  5HY6 A;  4K0K L;  5ELN A;  2A69 D;  5CGK A;  5I6Y A;  1K73 C;  1O7Y A;  3I4M B;  4WJW A;  2LKV A;  1NMF A;  1JQY D;  1LTL A;  3HOY G;  3RFC A;  4YAJ B;  4S3S A;  5KG4 A;  4KY7 A;  5ELC A;  2R7N A;  2ZTC A;  1CUK A;  4LUZ A;  1SJE D;  3I4L A;  3M4O B;  3PIO 3;  2HDM A;  5A2Q E;  2JA6 A;  2AWN A;  4IPC A;  3G4S A;  2E76 C;  1EOV A;  5T1G A;  4KHP L;  4QCL A;  1A15 A;  3U9O A;  1YHA A;  3LWE A;  1GSH A;  4DV2 Q;  4C5C A;  1TII D;  5GAH C;  1BDO A;  3H91 A;  3V96 A;  4C2M A;  3S9W A;  3VPD A;  1FD7 D;  4UP9 A;  2FLP A;  2UUB H;  4EQN A;  2OTL A;  1X3F A;  4CHT B;  4I7Z C;  1TWA H;  5C0X H;  1P16 A;  3K59 A;  3NBI A;  2IA6 A;  1CE8 A;  2K75 A;  2YRX A;  2K1B A;  5FO7 B;  2R82 A;  1S9F A;  1JWS D;  1XTC D;  3NPP A;  4YIJ A;  3P20 A;  1JMC A;  4JI1 H;  3ERQ A;  1JKJ B;  4R8U B;  1SYD A;  5KFA A;  1HNW H;  5EPJ A;  3JSL A;  4FBT A;  5KFD A;  1EIG A;  2KSW A;  1S5D D;  4PMC A;  1D1K A;  2K28 A;  3DMU A;  4CDC C;  1KAB A;  4JI8 L;  1LT6 D;  5IIF A;  4EQP A;  1B3Q A;  3KJO A;  1Y1W A;  3HOV H;  4G3I A;  4A3I G;  1L2F A;  3J7A K;  1BNC A;  3KJP A;  4ED3 A;  4A93 H;  1BCP D;  1S5E D;  3I72 A;  4RKB A;  2D5D A;  1NR4 A;  1FVI A;  4KY5 A;  2EOT A;  3E0E A;  3GTG H;  4YCU A;  5KT4 A;  1X54 A;  2R85 A;  4FM9 A;  3T51 B;  4A3C G;  3FDT A;  3H0G A;  1XMO Q;  4HYK A;  3G6J B;  3NXW A;  1OXT A;  1CKN B;  4EEY A;  4L5R C;  4Q45 A;  3HGB A;  4RU9 A;  1K3B C;  2B2Y C;  2IX3 A;  4TRD A;  1X9N A;  4RAZ A;  5DLF A;  3Q22 A;  4CKE A;  3K5L A;  2VUM A;  4BBS H;  5D14 A;  3X3N A;  3M9M B;  2UUA H;  4A2B A;  1Y1V G;  3NEL A;  2DY7 A;  4OHJ A;  4A3E B;  1Q1B A;  3ULL A;  2ZJR A;  2RCN A;  3K0Y A;  2CW8 A;  2ZM6 L;  2FMA A;  3OOC A;  3I4N G;  1XNQ Q;  1EWI A;  3IL8 A;  1ENC A;  2LFN A;  5EPL A;  4YP3 A;  1JB7 A;  4IR9 A;  4FXG C;  1QOH A;  5FJ8 G;  2FP4 B;  3TSS A;  2E2J H;  4BY1 B;  1G6P A;  4Q0Y A;  4NLG A;  3FMC A;  1N36 H;  1JWU D;  2DZD A;  1KLG D;  2G9H D;  4YY3 L;  3OWE B;  2YU9 A;  5BN4 A;  4CDE C;  3C2P A;  4DKA C;  1MSG A;  2A19 A;  1KLU D;  4DL7 A;  3PVX A;  1VQC A;  4G7Z C;  4AQY Q;  4C5B A;  3L2P A;  1VQ6 A;  2EYO A;  3S16 H;  3A7L A;  4O1N A;  2JN4 A;  2RVL A;  1SNM A;  2VB2 X;  1XMQ L;  1SCU B;  4HIK A;  3KHR A;  3BDO A;  2A5H A;  2VQF Q;  4NXN H;  3OPO A;  2DIK A;  4A3J H;  3CVZ A;  3PO3 G;  1SYE A;  1CZG A;  1ML0 D;  4ECY A;  3J80 W;  4JI6 H;  3RUP A;  1PFS A;  2KHJ A;  3HP3 A;  5IP9 G;  2ICE C;  5IGF A;  1RJR A;  3K3P A;  4RGN A;  1TWG B;  4U7C A;  1KRS A;  4A3L H;  3PR4 A;  2AQ4 A;  4FXD A;  3GTL H;  1RK5 A;  4DV5 H;  1RKN A;  1C3O A;  3SE0 A;  4HMJ A;  3KOJ A;  1HZA A;  4WJ3 M;  4NMZ A;  1Q12 A;  2MP1 A;  2MCT A;  4BS9 A;  5C44 B;  4ZCK A;  4B9X A;  4R8U A;  2HVS A;  2PI2 E;  1EIH A;  2N3S A;  3ETJ A;  1BXR A;  4IRC A;  4LF9 H;  3N44 B;  4MN3 A;  4X64 Q;  4LMQ D;  2RGR A;  4MV4 A;  5JVH 3;  2IY5 B;  1IBL H;  1GXD C;  3NWT A;  2IL8 A;  4EX5 A;  1WTX A;  1UNS A;  5JEA G;  1PTO D;  3IRB A;  4MNO A;  2Z0S A;  3TQ1 A;  2P0A A;  1Z7T A;  1N34 H;  2R8K A;  1I6U A;  2DPJ A;  1IW7 C;  5KFQ A;  2AMC B;  2ZXR A;  5KG1 A;  3HOZ B;  4JI3 L;  1ZQ7 A;  2A74 C;  2WAC A;  3MAQ A;  1AN7 A;  2DLN A;  5DG9 A;  1C7Y A;  2E74 C;  5FLX c;  1HUM A;  1CKN A;  2X69 A;  2QEX A;  4AH6 A;  3M3Y B;  4MA0 A;  4EG0 A;  1Q81 C;  4O2D A;  3NTI A;  2JA8 G;  4ECT A;  2C9O A;  2XSC A;  1QVC A;  4R4T A;  2QW7 A;  2CQO A;  2K01 A;  5L9X A;  3ETH A;  2GPS A;  3GTQ B;  1BO0 A;  2F0U A;  1QUQ A;  5LMN H;  2JA5 A;  4IFD H;  4K0K Q;  1SEI A;  5I9P A;  2B2Y A;  3RUZ A;  3U4Z A;  4B3T Q;  3TEH B;  5KYI A;  2GPW A;  1U4P A;  3RMH A;  4TUY F;  5JJK A;  3GIK A;  2WAQ A;  1JWM D;  5J39 A;  3LNN A;  2NN6 G;  3JZI A;  3T1Y Q;  2W9C B;  2K05 A;  1L1O C;  4X65 H;  3NUC A;  5IE8 A;  1SN8 A;  3V6J A;  4YAK B;  1R9T H;  4O3O A;  2A6E C;  4C3I H;  3OIP A;  1EEF D;  1SNP A;  3L3O C;  3UDG A;  3U9T A;  4JI5 H;  1HFG A;  1QE6 A;  3HOW B;  1VQG A;  4AYB G;  3C1F A;  4J8Q A;  3F2C A;  1SMX A;  4C3H H;  2O5I C;  2WB1 G;  1XNR L;  4ZK9 B;  4RH6 A;  5IYC G;  3A7A B;  2ZJP A;  3HOX B;  1XPO A;  3F8N A;  1WJJ A;  1P8L A;  1FJG L;  1WTR A;  1K0R A;  1C0A A;  2ENB A;  4FS2 A;  2YTX A;  2QDL A;  1RIP A;  1GGO A;  1HNX H;  3MVV A;  5IGG A;  2JJQ A;  2IMW P;  1EZ8 A;  1IL2 A;  4JI8 Q;  2K7V A;  2J6U A;  1G2T A;  1CFM A;  3CC2 A;  2KQ3 A;  1X3E A;  3BA9 A;  1VQB A;  5D1P A;  5IGE A;  3RGX A;  2EJM A;  4DR4 L;  2XWJ B;  2SOB A;  5COY A;  3RN2 A;  2OCE A;  1UEB A;  2O5J C;  2YW2 A;  3WNZ A;  3QFF A;  4XQJ A;  1SR3 A;  5JQW A;  2A1A A;  1LLR D;  4PG3 A;  2YRW A;  4ECR A;  1E7Z A;  3HOY H;  3M7G A;  1Q7Y C;  3GTO A;  4J9P A;  5C4X G;  3GTJ H;  1I4H A;  5FO9 B;  1SNQ A;  2BH8 A;  5FPO A;  2F0D A;  3G6Y A;  2IPK D;  2B63 B;  4BXX G;  4MA5 A;  4NXM L;  1IBK H;  1N32 H;  2FB9 A;  4QWE A;  2JA9 A;  1GHK A;  4ZI7 F;  1GJX A;  3VR2 A;  4OEL B;  2PN1 A;  4U67 3;  1GUT A;  1EYD A;  4GKJ L;  4UP7 A;  3F2B A;  3KAJ A;  3TP8 A;  1GM5 A;  2F0W A;  2GVB A;  2ZM6 Q;  3FMA A;  3NE5 B;  3AYH B;  2UXD L;  3DHQ A;  2PZT A;  3N43 B;  2Y0S E;  3S1R H;  1HA6 A;  1S5B D;  1TS2 A;  4B3R H;  2C2D A;  5I47 A;  3GIM A;  2HGS A;  3UE0 A;  2QF7 A;  5LA6 F;  1BNZ A;  3I8Z A;  2L0C A;  4LF8 L;  4TVA B;  2R8I A;  4JV5 Q;  1ESR A;  3DWP A;  4A3I H;  3NK9 A;  2ASB A;  4DL5 A;  2KBN A;  4LW1 A;  1FNU A;  4HIO A;  1IBM H;  3VYT A;  3MHB A;  1TY2 A;  2QKI C;  1GVP A;  3QZ7 A;  3RN5 A;  3BU2 A;  1V1P B;  1B1Z A;  3RV4 A;  4R8I A;  4MV7 A;  4PDB A;  2K5Q A;  4A3C H;  3EPI A;  5L1J A;  4DAP A;  3GO5 A;  3MFH A;  1SEB D;  1W96 A;  3MXU A;  1TWA A;  2TSS A;  3W5O A;  2K32 A;  2BOS A;  1O7L A;  3LX0 A;  4XDX A;  3TS2 A;  2W9B B;  3DWQ A;  4A3F G;  5CA0 F;  3T5L A;  1S0M A;  3MFI A;  4HSP A;  3R93 A;  4OX9 H;  3HS0 C;  4FP5 D;  4ULL A;  1KL9 A;  1UE5 A;  4R4Q A;  5F2D A;  3CC7 A;  4HJ5 A;  2NUA B;  2R92 G;  3ULP A;  5KFN A;  5EAY A;  1AZP A;  2W9C A;  5KFX A;  1VQJ A;  2VPQ A;  1PXU A;  5KFV A;  4H13 C;  4LF7 Q;  3J80 i;  1F2Z A;  1SE4 A;  3KK7 A;  1WFQ A;  5M5X B;  2WKC A;  3K0X A;  1XWE A;  2VUG A;  3I4N H;  2YYA A;  4EBE A;  1E4F T;  1TWH B;  2J6S A;  4FF3 A;  5D65 A;  4DV7 L;  5ELB A;  1QVF A;  2V59 A;  2C22 A;  2JEF A;  2UU9 H;  3AQQ A;  4BBR G;  1STA A;  5KFO A;  3NHH A;  3T1H H;  4JI7 H;  3H3V I;  2H5X A;  2CH4 W;  2HQL A;  1JT8 A;  3A5U A;  3GV3 A;  1Q86 C;  1WYD A;  1ZXT A;  2NBF A;  3BZC A;  4O42 A;  1PYW D;  3K81 C;  5A2Q L;  1HH2 P;  2H4O A;  3AMU A;  5BR8 H;  3OMG A;  4RNN A;  3UFX B;  2A69 C;  2KJX A;  2JSO A;  1VQN A;  2PYK A;  1B6S A;  2JE6 I;  4IRK A;  5C3E B;  2JA7 A;  5KGU A;  3PN1 A;  1NNX A;  2YCH A;  1LV9 A;  1CK1 A;  3MXG A;  2EPB A;  4MIU A;  2YS6 A;  1A2T A;  2NU8 B;  1JOK A;  3FKI G;  4KK7 A;  4XYL B;  1C4Q A;  3CMA A;  2BQU A;  1GYF A;  2HVQ A;  3QIA A;  3J80 E;  3S2H B;  3PO3 H;  4JCV E;  4KKU A;  2E5L Q;  3N42 B;  3A8I E;  3CCU A;  2NUC A;  5L1I A;  5C0X G;  4UCS A;  1B53 A;  5IP9 H;  2B2V C;  4ABN A;  4IRD A;  4DAM A;  1DJR D;  3J80 c;  4YR2 A;  1SYG A;  1XMQ H;  1J5E H;  1GUN A;  2PCF B;  2VOB A;  4PQX A;  4UPA A;  1S10 A;  1EUJ A;  4KLK A;  2QEJ C;  4GN3 B;  5IWA H;  4DV3 H;  4LFA L;  1N33 H;  1ZKO A;  2Z8L A;  3VR4 A;  3G6X A;  1TT2 A;  1EQR A;  5K36 H;  3RZD B;  4ECQ A;  1JC7 A;  3HG9 A;  3J7A F;  5JAV A;  2ASD A;  3I90 A;  5GON F;  1QZH A;  4YB8 B;  2UUC L;  4LUV A;  4LF6 Q;  1S5F D;  2PW5 A;  2K04 A;  5JUM A;  5M5Y H;  3GTK B;  2ZJQ A;  1JOO A;  2I0Q A;  2UXC H;  2EYL A;  5JEA H;  2XC9 A;  2NVY H;  2E2I B;  4RWS C;  1A63 A;  4O4I F;  4DR1 Q;  4DUY H;  1EY0 A;  4KKS A;  4QW8 A;  2LS0 1;  1XNR Q;  2EYP A;  2PI2 A;  4C3J B;  1IW7 D;  2HIX A;  5C4J H;  4BA2 I;  1I6H H;  5DNF A;  1V1P A;  1YHB A;  1E4G T;  1VQA A;  4DV1 Q;  2FJZ A;  4FU0 A;  1EYZ A;  1HXY D;  1FJG Q;  1VQI A;  1BCP B;  1V51 A;  4EGJ A;  4OO1 G;  5CV7 A;  2JEJ A;  4LJZ C;  4DV2 L;  3JC6 6;  4IPH A;  4OWX B;  4Q5V A;  2XGT A;  3M9O B;  2YL2 A;  2Y0S B;  4HNU A;  4N8X 1;  2FHT A;  1UE6 A;  2JA8 H;  3OUZ A;  2R7Z H;  3R5F A;  3KBG A;  4Y52 H;  1EQT A;  2UXB H;  2R7M A;  3QO2 A;  2RGV A;  2MFI A;  2Q2H A;  4DR4 Q;  1F9Q A;  1VBG A;  1EQQ A;  1SYX B;  3J81 j;  1IYV A;  4JI7 Q;  4GKK Q;  1XPU A;  2KVM A;  5LMU Q;  1WTQ A;  2LXK A;  3L4K A;  4IAL A;  4O2A F;  4DLK A;  3S1N H;  1R4Q B;  3OSO A;  5COR A;  5JPM C;  3R2T A;  1SFO H;  5E1F A;  2NN6 H;  4NXM Q;  4A3D B;  1JOQ A;  1NCV A;  3A55 A;  3OWF A;  1TWC B;  2A6E D;  3HB9 A;  4J1M A;  2L11 A;  2CWP A;  1DZ1 A;  4P71 A;  5C1P A;  4DAV A;  3KHL A;  2WKD A;  5M5W H;  3H40 A;  2SDF A;  1PHJ A;  1U5K A;  1I4P A;  3HKS A;  3VMM A;  1VQD A;  2W6O A;  1E0B A;  4DR5 L;  1W6K A;  1ZET A;  4H7B A;  3C3L A;  1SJH D;  4A3J G;  4I65 A;  5JJZ A;  4DK1 A;  1STY A;  4JBW A;  4IJL A;  3FVQ A;  3BJU A;  4IFD I;  2ZJT A;  4RUC A;  2EYH A;  4JPB W;  4LF8 Q;  4RGT A;  1DOM A;  1ICF B;  1Q8K A;  3FEW X;  4OWT B;  5IGC A;  4X66 H;  1MGS A;  2W70 A;  5KFT A;  4M7E A;  1O7I A;  3LWU A;  4O0A A;  1STG A;  3Q8D A;  1HNZ Q;  5ELF A;  1H9R A;  5GAD C;  3GQB A;  2R93 G;  1TY0 A;  4LSX A;  1KIX A;  2NVX B;  2YTY A;  4X3K A;  1IL8 A;  5LHY 1;  2MO1 A;  1EYA A;  2IJ0 A;  3A5Z B;  4FNF A;  1KD1 C;  3OW7 A;  2JA6 B;  3V4S A;  1Z9F A;  5C4X H;  5LXT F;  2VS1 A;  2FPP B;  3S1Q H;  4J9K A;  4C2M B;  1EU4 A;  4BXX H;  4KD4 A;  3L7Z C;  1RTN A;  3E6Z X;  3RBD A;  3GV7 B;  1J9O A;  5M3F G;  1HUN A;  4DV6 H;  1E2V A;  1N9W A;  3KBX A;  2K5N A;  2RHS B;  4L63 B;  2F4I A;  3PGZ A;  4ED8 A;  2CHB D;  4B9W A;  3RBE A;  3D4W A;  5CV9 A;  2D0O A;  2WV6 D;  1B33 N;  2K52 A;  1PMR A;  2IBK A;  2FK3 A;  3RAQ A;  3GTK A;  1Y8N B;  4H02 A;  3RLO A;  3CRL C;  2E2I A;  1IKL A;  1M7J A;  1SYB A;  3RV3 A;  4A76 A;  4MV1 A;  3RNU A;  4A3E H;  3NTH A;  4DV7 Q;  2Z1C A;  3SK5 A;  1PTO B;  1HTP A;  3R5X A;  4QWD A;  4ED0 A;  1PFN A;  2DY8 A;  1B9M A;  4GKJ H;  1PRT D;  5KFG A;  1DM0 B;  2BA0 A;  3MFG A;  3TZU A;  1KDC A;  1EOT A;  5GAG C;  1GSO A;  3H0G B;  2N8N A;  5FOB B;  5I9O A;  1GO3 E;  4Y7N H;  1DGS A;  2YV5 A;  2F3W A;  4OXP A;  2Y0S A;  3JAM W;  1NJI C;  4UDU C;  1SBB B;  3W1G A;  2W6N A;  3OTO Q;  4O3N A;  2RBM A;  1HRJ A;  4BY1 H;  1EL0 A;  1A8V A;  1LTI D;  1S3O A;  2HHH Q;  5J1Z A;  3KLS A;  4N9T A;  4YR3 A;  2B2T C;  2NTS A;  2EE1 A;  4Q44 A;  4ZQ3 A;  5IGB A;  4X64 L;  2R8H A;  4G7H C;  4L5T A;  3TP7 A;  2WDT A;  2IX0 A;  5DGB A;  4GN4 B;  2R7F A;  1PH2 A;  1K8O A;  1GHJ A;  2AHO B;  3OYY A;  1WTV A;  1ZHQ A;  3K7A H;  3J81 L;  2FFK B;  3EVQ A;  4JI4 L;  2VNU D;  3RAX A;  4F4Y A;  2RA4 A;  2MNA A;  2F0Q A;  2EYJ A;  1BVS A;  1TWC A;  3P7J A;  3HOU G;  3D8G A;  1UC8 A;  2XCL A;  3CW2 C;  4A3M B;  4JUZ A;  4B3S H;  1QWY A;  4A3B G;  4Q8E A;  4YHH H;  4ZKC B;  4NW2 A;  1HNW Q;  2YU9 B;  3K80 C;  4LFC H;  4DNR B;  4BBR H;  1OWT A;  5AJ3 L;  2B39 A;  4HNV A;  1RL2 A;  1ULZ A;  2J0T D;  2UUC Q;  5J3B A;  1STH A;  4PV1 C;  1Y1V A;  2RCF A;  3KF8 A;  4KN4 C;  3RZO H;  2XWB B;  4B3T L;  1RCV D;  4DV0 H;  3PUZ A;  2G9D A;  4K5W A;  4P74 A;  3UI2 A;  2KOL A;  2PZU A;  3CHB D;  4K2L A;  3CCM A;  3CCR A;  4X6A H;  5HUR A;  2L5T A;  4X3T A;  4DR3 H;  2NVX A;  3T1Y L;  2IHE A;  5ISR A;  3FKI H;  2PQE A;  3CXC A;  1ENA A;  2UUA Q;  1MJE A;  4UCU A;  3NEN A;  1ZEQ X;  2RQX A;  1T5E A;  4KJO A;  1I3Q H;  3HKZ G;  1XJV A;  4LFB H;  3FPU B;  3BAB A;  3K8A A;  1H95 A;  2LY7 A;  2B2U A;  1VQ5 A;  3OSP A;  4A3K B;  4WRD A;  2F0N A;  5D1O B;  2C2R A;  3IAY A;  3GII A;  1W3S A;  4ZRZ A;  2XNA C;  2ZXO A;  2RF4 A;  4KTA A;  5EOY A;  2AUJ D;  4KJN A;  4O2B F;  4F4Z A;  2D9U A;  3E9I A;  3S1M H;  4HQ6 A;  2RDG A;  4B3M H;  3IFT A;  4ME5 A;  1N36 Q;  4EGQ A;  1AUV A;  1YNN C;  4K8J A;  1CZW A;  4KY6 A;  2AKW B;  1JJC B;  4HSV A;  5IT9 L;  3PF5 A;  4DUZ H;  1I94 H;  1WCM G;  2KA7 A;  3RB6 A;  3T16 A;  2Q2U A;  4IHJ F;  5C4Z A;  5KG6 A;  3I91 A;  4R8N A;  4RCN A;  4CKB A;  4DR5 Q;  4LSA A;  3V05 A;  2VA2 A;  2D62 A;  1MSH A;  1Z2O X;  4PZ7 A;  4OO1 H;  3PQI A;  2C5C A;  4NXN Q;  5IGD A;  4JBK A;  5C3X A;  3PMF A;  4YJ2 F;  1T94 A;  1B4O A;  4P72 A;  1QUQ B;  4K5V A;  1M1K C;  2F4V Q;  4TSS A;  5EZY F;  2JA5 B;  2W57 A;  5J2U F;  4UCV A;  4QWB A;  3L9A X;  1D7Q A;  4JI6 Q;  3A0J A;  5D8D A;  4PMW A;  5T14 A;  2QA4 A;  3VDY A;  2FKL A;  4F7X A;  3NTK A;  1S72 A;  4R9W A;  2WAQ B;  4GLV B;  5D3D A;  3T13 A;  3MWE A;  3F2U A;  1KRT A;  4RUA A;  4RG1 A;  4IUQ A;  4PZ8 A;  2NVY A;  1T5X D;  3ZYY X;  1VQ4 A;  4X62 L;  4JI0 Q;  4JV5 L;  3F8T A;  3S14 B;  3DXJ C;  4FF2 A;  2GLT A;  3BA8 A;  3WOE A;  4EEQ A;  2R7D A;  1BKB A;  4LF9 Q;  3MC0 B;  1AH9 A;  2RSN A;  1BJT A;  3RB3 A;  4NKL A;  1QB5 D;  2QK4 A;  4IOC A;  1IBL Q;  1B2T A;  2XIG A;  4J0M A;  3FPP A;  2K50 A;  4WFN 3;  3EFX D;  1O7Z A;  4EFB A;  5CV6 A;  4G4K A;  3RLF A;  4DK6 C;  5KT2 A;  3D0F A;  1CKO A;  1N34 Q;  2PQA B;  1MKH A;  4O4L F;  4K6L A;  3GTP A;  5C3W A;  3M4I A;  3VR6 A;  1U4R A;  4PZ6 A;  5KRU A;  1UNN C;  2EDG A;  2I07 B;  1ZHS A;  3T53 B;  4A3F B;  1B9N A;  5BPH A;  4GC7 A;  1V1Q A;  1TWF H;  4ED7 A;  5FD5 A;  1I4X A;  4KMU C;  4LF7 L;  1JIC A;  5KFR A;  1XMO H;  2SCU B;  4LF4 Q;  2JYO A;  4ZQI A;  3GTO B;  2R92 B;  5KFY A;  1CQJ B;  1Y1W G;  2YZG A;  4ECX A;  1TS5 A;  4DL4 A;  1S0O A;  2SEB D;  4OIJ A;  1CTM A;  2CFM A;  4NDX A;  2VY3 A;  3VR3 A;  2R93 H;  5KFL A;  1YNX A;  4DR7 H;  2B8G A;  4X3U A;  3JAM i;  2VQE H;  5K36 G;  2F0E A;  4J9N A;  3NBH B;  2DGY A;  4DF7 A;  3KAK A;  4J9S A;  1I50 B;  3R3O A;  4FF1 A;  1E2Z A;  4ZUI A;  4RZR A;  1OTC A;  2XCP A;  5D1O A;  4DN4 M;  1EYG A;  2J9G A;  1T9H A;  3W3A A;  3I3C A;  4IUV A;  2OTJ A;  1U4L A;  2IWH A;  5M3F H;  1XNQ H;  1F77 A;  1F9S A;  3OMC A;  5IP7 G;  2VUM G;  1UWV A;  4QB4 A;  4F8M A;  1MZB A;  1W93 A;  5FKA C;  3KYH C;  4JI4 Q;  5FLX E;  1VQ9 A;  5CV5 A;  4ECZ A;  1I4R A;  1C30 A;  2XIW A;  2V58 A;  3A8K E;  2K5H A;  4HR7 A;  5JH7 F;  2FMM A;  5M3M G;  4M8A A;  1S0N A;  3P1H A;  2UVR A;  2MQH A;  3W2D A;  3WO0 A;  2CWA A;  2YTV A;  3I4O A;  4DR6 L;  3DEO A;  2A73 B;  5CR3 A;  5EBC A;  1STB A;  4HNT A;  5CBA E;  1LTA D;  4RCO A;  1J6Q A;  1K8M A;  3QOJ A;  1ILP A;  2E5L L;  2R7Z G;  4EGV A;  1JJG A;  4GZY C;  4AQY H;  5AJ3 Q;  4XQQ A;  1M8A A;  1YBY A;  2OF1 A;  1II3 A;  1HHV A;  3SE7 A;  4Q43 A;  1F9R A;  1U4M A;  2WTF A;  1Z2P X;  4POF A;  4X64 H;  1TWA B;  2VQF H;  3KXY T;  3CRK C;  1G2S A;  3GTM H;  4JW0 A;  2HD3 A;  4C5A A;  3TN2 A;  5BPF A;  2PO4 A;  2B2W C;  3ERS X;  4EFE A;  4IPG A;  4LF5 L;  2ZXP A;  3S15 B;  2HVR A;  3FRP B;  3I4M G;  1KJJ A;  2W8K A;  4LF6 L;  3HOV B;  4Q0F A;  3PO2 H;  4ZAI A;  4GOP C;  4ME3 A;  4A93 B;  3VA5 A;  4JV1 A;  1N8R C;  3CPF A;  1Q46 A;  4DR1 L;  2O03 A;  5LOV F;  4P73 A;  1EIF A;  4K14 A;  5EJW A;  4HJ9 A;  2FIN B;  3GTG B;  2A6H C;  1VQF A;  2WII B;  2WP8 J;  1DD2 A;  2YZM A;  3HOU H;  3PZP A;  1L1O B;  1EU3 A;  4DV1 L;  3DM1 A;  3NSW A;  2ATL A;  2NWG A;  3R5H A;  1PH1 A;  4A3B H;  4IZ8 A;  5JVD F;  3N41 B;  4B3R Q;  3ND8 A;  2MUY A;  2F0T A;  4OGQ C;  4TKO B;  4BBS B;  1SRU A;  2PQA A;  1Q82 C;  5KX5 F;  3PV0 A;  2W6P A;  2J7Z A;  1CS0 A;  2AGO A;  3EQL C;  4IUT A;  1WVL A;  1SSO A;  2VXW A;  5KT3 A;  2JA7 B;  3BDC A;  1D1I A;  2F0P A;  4KHV A;  1I6V C;  1RHP A;  1PH5 A;  1LTS D;  4M9U A;  2AQ3 B;  2XGP A;  4GKK L;  1HZC A;  4XT1 B;  4UCR A;  2HQE A;  2R92 A;  5LMU L;  4IR1 A;  1HR0 L;  4LH7 A;  4JBM A;  1V1O A;  1DOK A;  2HDL A;  1PFM A;  3UDI A;  3TIG A;  2IW3 A;  3MXP A;  3BQ2 A;  2HIV A;  1K83 H;  1KDB A;  3NBH A;  3VYU A;  2E2J B;  1SYC A;  2F1M A;  3QWN A;  1E24 A;  1I50 A;  5KG2 A;  2F0G A;  4L6T B;  4K0K H;  3ORR A;  3N6X A;  1EFI D;  2K33 A;  4OX9 Q;  2W9A A;  1HTL D;  1CT1 D;  2AUK A;  1FYC A;  2M9V A;  3G7L A;  4B3T H;  4WJ4 A;  3T5H A;  4LNQ A;  2V4D A;  4QUF A;  1EQV A;  4DR2 Q;  1EY4 A;  5C5M A;  1QIL A;  1KXL A;  3GIQ A;  2BQR A;  4E6I A;  2VR1 A;  2ID0 A;  4ILW A;  4KKT A;  3S16 B;  3T1Y H;  2TMP A;  1Q3L A;  4O3R A;  2R7L A;  4A3E G;  3ULJ A;  3GIJ A;  4KHP H;  4DA2 A;  4J15 A;  1PH7 A;  1STE A;  1TR5 A;  2I46 A;  4X62 Q;  1EY9 A;  2JQO A;  4JG2 A;  3ORQ A;  1PRT C;  3HKZ E;  2RKS A;  4QJF A;  4XTC S;  1I5F A;  2F0I A;  1FGU A;  4L8J A;  1PRT F;  3TZD A;  1HNZ L;  1A6X A;  1YNN D;  2YS7 A;  5T1I A;  2EY2 A;  4A3G H;  4HAE A;  5FD6 A;  5JJI A;  5LP6 F;  2QDB A;  3R23 A;  4DK3 C;  4BY1 G;  1WCM H;  2NVT H;  3GTL B;  1EY8 A;  1I3Q A;  4JI8 H;  4QIW E;  5KFZ A;  4XXE A;  4HMI A;  2J6T A;  5KFC A;  5C0X I;  5EQ0 A;  1MI2 A;  3GLK A;  1QCB D;  2CZG A;  3H4B A;  3AFQ A;  3TP6 A;  4FF4 A;  3GID A;  1NMG A;  2EXD A;  3G48 A;  2K6A A;  1SLJ A;  3IFD A;  4EYI B;  3ONA B;  3UDX A;  1QZG A;  3RR5 A;  5KEE A;  2XRS D;  3J7A 5;  3S2D H;  3R8B A;  2ASL A;  4BY7 H;  3D4R A;  2W71 A;  2F3I A;  4FS1 A;  3HBL A;  3GTG A;  2AWO A;  2NB0 A;  2B2W A;  4IO9 A;  4DL2 A;  2CQA A;  2R86 A;  1L1O A;  4F4X A;  4MZ9 A;  4JI2 L;  1TU2 B;  4EBC A;  2PMZ E;  1U9R A;  3T5K A;  3STB C;  2ZM6 H;  4GOP A;  2XD4 A;  3Q8P B;  1WTO A;  3OUU A;  5F9L A;  3HXL A;  5DQI A;  2EYM A;  3T1H Q;  3CKI B;  4JBJ A;  3KFU A;  5C5L A;  5C44 G;  3OTO L;  4OO1 I;  2PPB C;  2UXC Q;  2RDI A;  1GUW A;  2HHH L;  5DQH A;  5LYJ F;  3N40 P;  2K03 A;  4H0L C;  4ME6 A;  1VMP A;  5NUC A;  1TKW B;  3KLW A;  1RJP A;  4MTK A;  4YCV A;  4DR6 Q;  3ZJY C;  4YY3 H;  2HT1 A;  5TSS A;  1Z6H A;  5IYB G;  4RFB A;  2F0M A;  2F0K A;  2NVQ H;  3CP0 A;  1R9T B;  4C3I B;  4ZYS A;  2M2L A;  1C48 A;  3HOZ G;  2UXB Q;  4CC5 A;  2W7O A;  1G91 A;  1Y1W H;  2IP4 A;  3U9S A;  4J9M A;  4LUO A;  4C3H B;  4JI1 L;  1CHQ D;  1K1Q A;  5DQG A;  4JYA Q;  2ZTD A;  1HNW L;  3JSN A;  4ZLT F;  1LTT D;  5A2Q W;  4CJ1 B;  1VF5 C;  1AUX A;  5IYD H;  1HQM C;  5FLM G;  3H0G H;  4L5S A;  1LTB D;  2AQ1 B;  4JC0 A;  4LF5 Q;  4HCS A;  4U68 A;  1A3U A;  1YI2 A;  2VA3 A;  3PW0 A;  2EIF A;  2DNC A;  1EUC B;  1GSA A;  3C0F B;  1M4V A;  2IX1 A;  2XVS A;  1LAC A;  4KI0 A;  5IP7 H;  2Z4I A;  2VUM H;  2K5W A;  4K2K A;  1CQF A;  1ET9 A;  2B3G A;  1F9P A;  2Z6K C;  2SNS A;  4MV6 A;  3Q23 A;  3HOY B;  1KEE A;  4F4W A;  1PYS B;  2NZ1 D;  2KEC A;  2L12 A;  5M3M H;  3GTJ B;  3M7N A;  2F0J A;  1JOR A;  1CQI B;  3RGZ A;  2CW7 A;  2RHQ B;  3GTL A;  1NR2 A;  2UUA L;  3QR8 A;  1LUZ A;  4FXK C;  3HOW G;  1VQM A;  5CV8 A;  2D0P A;  4EYH B;  4CBV A;  2WFW A;  4I55 F;  4PWQ A;  5E7N A;  4JOI C;  2BDO A;  3HOX G;  4CKC A;  1S03 G;  2JK8 A;  3CQZ H;  4NB3 A;  5KG5 A;  3HKZ B;  3L0O A;  4JI3 H;  4NPS A;  3I2Z A;  2E2H H;  4KD3 A;  3S1R B;  1JLL B;  2H1E A;  3E5N A;  4P75 A;  1H9S B;  1HR0 Q;  1BGW A;  4DL6 A;  2OQK A;  1BQQ T;  4NP5 A;  3LGJ A;  3TQY A;  5C6A A;  4GNX C;  3CCL A;  1PDQ A;  1B50 A;  1N36 L;  4QIW B;  1TVX A;  1QVG A;  3I4M H;  1D5X C;  5DEH A;  1HCZ A;  4C1N I;  3BYY B;  3CCJ A;  4B08 A;  1C9O A;  4DV6 Q;  4A3I B;  5DLG A;  4BWS C;  2CW0 C;  1NSN S;  4HIM A;  2B63 G;  2W8L A;  1B70 B;  1KNE A;  2A6H D;  2L15 A;  1F2M A;  3M4O H;  1K28 A;  4XX0 B;  5K2M A;  4QW9 A;  2LMC B;  4EQO A;  5ELD A;  4QY7 A;  3M85 A;  1M90 C;  4FBU A;  1GUO A;  4UY8 C;  1I4G A;  4NXN L;  2EQS A;  3A54 A;  4LF6 H;  2F4V L;  3AB9 A;  2JEI A;  4YWK A;  2PZW A;  2BDN A;  2E75 C;  4JI6 L;  4ED6 A;  3GTM A;  1Y1V B;  3GV8 B;  3KF8 B;  4AYB E;  1KBL A;  2IT1 A;  2GN5 A;  1SE2 A;  5LL6 b;  2WB1 E;  1XNR H;  1JDE A;  4R4C A;  2D2C C;  5EKL A;  1VQP A;  4A3K H;  1RK6 A;  3CME A;  1R9T A;  1FJG H;  5CMD A;  5KNB A;  1Y8P B;  2X6L A;  3IG0 A;  4DV5 L;  1GKH A;  1ET6 A;  3I4N B;  1HA5 A;  1B8A A;  3RIZ A;  3MZ5 A;  5FLX L;  4JI0 L;  1LT4 D;  1LT5 D;  2N78 A;  5L1K A;  1YHQ A;  4KV6 A;  4ODG A;  4LF9 L;  3BAA A;  5BN3 A;  1U0L A;  4DR4 H;  3Q24 A;  3K5O A;  3G8C A;  4XYM B;  1WD1 A;  1G8Z D;  1IBL L;  2B2V A;  4DV4 Q;  2FPG B;  3TP5 A;  3Q8S B;  2RSO A;  4DNT B;  1KJ9 A;  5LMU H;  2JEB I;  4QWA A;  5DG7 A;  2EZV A;  4RB1 A;  2Q8R E;  1N34 L;  1KC7 A;  4NXM H;  4LAA A;  1YIJ A;  5BN5 A;  2PVP A;  3MWY W;  4IFD J;  1TAE A;  5G3L F;  4GC6 A;  2Z9H A;  2JA5 H;  3D4D A;  1MJC A;  1K8A C;  3GTJ A;  1XXG A;  1SMY C;  4JI2 Q;  3M9B A;  1CA5 A;  1VMC A;  4LFC Q;  4DXG A;  1DYQ A;  3PO3 B;  4LF4 L;  3FP9 A;  3HRZ C;  2UXD H;  4RB2 C;  4IUP A;  2Z6K A;  4RHS A;  1K8G A;  3AU7 A;  5KYL A;  2AU0 A;  3M4Y A;  5J2T F;  3JRW A;  2V4R A;  3E3X A;  1L0Y B;  1TS4 A;  2BA1 A;  4LK1 C;  1GLV A;  2NU9 B;  3MA2 B;  4LF8 H;  3HKZ A;  2MO0 A;  5KT5 A;  1EWC A;  2DJF C;  1E22 A;  1H9S A;  1AEX A;  1HNZ H;  5KT7 A;  3ITP A;  4JOI A;  2KEE A;  1CKM A;  1E1T A;  4X65 L;  3K5M A;  5IOD A;  3M4P A;  5C3E G;  3PO2 G;  3CF5 A;  4IWX A;  1JR0 D;  4IUN A;  2FK1 A;  3T56 B;  4JI5 L;  1KJI A;  4QIW A;  5HGT A;  2DWC A;  4Z9C B;  5M5Y B;  2UUB Q;  4ETS A;  2WE6 A;  4XZ3 B;  3MFY A;  5HBR B;  3RTX A;  2FMC A;  2NVY B;  1S97 A;  3H09 A;  1D5Z C;  3I12 A;  1EUD B;  3N52 A;  3VYR A;  4L5Q A;  2FLL A;  5C4J B;  4JI1 Q;  1I6H B;  2KEN A;  2PNH A;  4BA1 I;  1HNX L;  3MEH A;  3K6O A;  2GA4 B;  3PIP A;  4DFA A;  2BQ3 A;  3J7Y W;  4HN7 A;  4OON A;  3STB D;  1YVC A;  1ROD A;  4HJ7 A;  4DL3 A;  1TWG H;  3X3M A;  5KFW A;  2JA8 B;  2A68 C;  2R7Z B;  2RDJ A;  3BJY A;  2HUG A;  5ELE A;  4C56 C;  1VQH A;  5I4D A;  2HJW A;  5C44 H;  3OHB A;  3OHA A;  4DV7 H;  1ESF A;  3GTP B;  2PMZ A;  3K3V A;  2LXJ A;  2P5Z X;  3KHH A;  2Q2T A;  3J81 W;  1PLF A;  1L0W A;  1WR2 A;  2I5M X;  5CB4 F;  3MEF A;  5KFU A;  4JV0 A;  2K4K A;  3S1N B;  3BVZ A;  5DAU A;  1SFO B;  1HFN A;  3TII A;  1K9M C;  1AW7 A;  1ICW A;  1ENF A;  5IYB H;  1PZI D;  2VB3 X;  4C3J G;  3OTO H;  4IN3 A;  2R6G A;  1NUC A;  3GIL A;  2C35 B;  2HHH H;  4A75 A;  4I50 F;  2N55 A;  3HOZ H;  5E4W C;  5M5W B;  4AYB B;  3M3Y H;  3SK6 A;  2WB1 B;  2Y0S G;  2R8G A;  3M4Q A;  3R2I A;  4B3R L;  3F2D A;  4J9O A;  2ALZ A;  2FK2 A;  3I73 A;  1DV2 A;  3PR5 B;  3PUY A;  2DJG C;  2N49 A;  3TQT A;  5JPN C;  3GTQ H;  5EGT A;  3K7U C;  5FLM H;  3TDQ A;  1JE4 A;  3S17 B;  1DCZ A;  1OXV A;  1M0T A;  4K8I A;  4A3G G;  4ED2 A;  4YJ3 F;  1UE1 A;  3HEJ A;  1IBM L;  4IZO A;  4HR7 B;  4N8F A;  2Z6B A;  3H4D A;  5JOB A;  3BZD B;  1BBX C;  1BBW A;  4LFA H;  3ERO A;  3I55 A;  3V4Z A;  1VS0 A;  4A3D G;  3UQ8 A;  5KT6 A;  1IXR A;  3S15 H;  4N9P A;  5DLQ E;  3MWM A;  4F87 A;  2FXQ A;  3P75 A;  5C4X B;  4R7R A;  3Q8Q B;  1JXL A;  4RAU C;  2F52 A;  3S1Q B;  3PW2 A;  4QQB X;  3H6M A;  2UUC H;  1PVO A;  5AFW A;  4J9L A;  3HOW H;  1DV1 A;  2VPS A;  4OX9 L;  1NTG A;  3PW7 A;  2I5L X;  2Q2I A;  3TRE A;  3W1B A;  1SE8 A;  3J7A V;  2PNR C;  3URY A;  3H3V H;  1VDZ A;  3HOX H;  4DR2 L;  4BY7 G;  3C1E A;  4WOR A;  3CCV A;  1WSC A;  3Q8R B;  4EBD A;  4ECU A;  1S68 A;  1AN8 A;  1KJQ A;  1BR9 A;  2EY1 A;  3PUX A;  1D2B A;  2B2T A;  1AZQ A;  4DV5 Q;  4DV2 H;  3H94 A;  3K5N A;  4A2A A;  5EDW A;  5KFI A;  4DR7 Q;  2ZDQ A;  2I5H A;  2EVB A;  2VQE Q;  2JEA I;  5CA1 F;  2UU9 L;  1RJQ A;  1KDA A;  2DPI A;  3VR5 A;  5IT9 W;  3T1H L;  4JI7 L;  2JA7 H;  4L1K A;  4APM A;  5KFM A;  2W6M A;  2PW7 A;  5C4H A;  1Y8O B;  2ATW A;  3TS0 A;  4ECW A;  4Q8F A;  1YJ9 A;  4M1U B;  3J80 L;  2WIN B;  1A2U A;  3VYS A;  5KIX A;  4XYQ A;  5BR8 L;  4Y7N B;  2CW0 D;  2JA6 G;  2JEG A;  2F3V A;  2B63 H;  2R7Z A;  1KTK A;  1ILQ A;  2DUD A;  1F2Y A;  3A56 A;  2HCI A;  1WOC A;  1VCI A;  1Q90 A;  3U4V A;  1FGB D;  2KHI A;  4F88 A;  3OW2 A;  2NZO A;  1BOS A;  3CQZ A;  3KF6 B;  3M9N B;  3AFP A;  3C46 A;  2E2H A;  1ZYR C;  1EY7 A;  3Q1K A;  2EJG C;  3CCS A;  4QF4 A;  1A62 A;  3K7A B;  2E8G A;  5J22 A;  3L4J A;  3PW5 A;  1SFO A;  3UE1 A;  5JVL A;  2K5D A;  2F0O A;  4O3P A;  4MHE A;  5FPR A;  4DR5 H;  1V9P A;  4MV9 A;  1J5E L;  4O3Q A;  5LMN Q;  2NN6 I;  1FR3 A;  1RF2 D;  2ZT9 C;  5KND A;  4HJ8 A;  1XYI A;  3NQI A;  1LTR D;  3QZ8 A;  2V4Q A;  3GIP A;  1M0W A;  1HJP A;  2V5A A;  3LP8 A;  2F4V H;  5IWA L;  4DV3 L;  1N33 L;  5JEA J;  3GD7 A;  4KHZ A;  3PF4 A;  1AFP A;  4AYB A;  1D5M C;  5IYD G;  1TA8 A;  3H0G G;  3PUW A;  2WB1 A;  3DF7 A;  2Q8T A;  3S24 A;  4BBR B;  2KED A;  1S5C D;  4DK0 A;  2W6Q A;  4JK1 C;  1SNO A;  5LL6 S;  4DAY B;  4X65 Q;  4ZUJ A;  3QJY A;  1GD7 A;  3U50 C;  2L9H A;  4CJ2 C;  2B29 A;  1JDB B;  4TQU S;  1DXM A;  5HGQ A;  2UXC L;  1DON A;  2J4X A;  4JI5 Q;  2BCO A;  2K5V A;  3RZO B;  3EN2 A;  4DUY L;  5DG8 A;  5FO8 B;  4JI0 H;  4R4O A;  4YBZ B;  4QL5 A;  3NEM A;  5G3L D;  4HCE A;  2QCP X;  1ASZ A;  1VKZ A;  1VBH A;  3MTS A;  2EYF A;  1QNK A;  4R1J A;  4WBN F;  1HNX Q;  3FKI B;  2X6G A;  2ZTE A;  1SMY D;  3GV6 A;  5LL6 X;  1W6J A;  4BWG B;  3PIP 3;  4CDD C;  1A3V A;  5H80 A;  4APV A;  1YEZ A;  3JAM E;  5M5X H;  1HZ9 A;  4FVM A;  4RGM A;  2MHV A;  1IYU A;  1SRO A;  5A35 A;  4K5X A;  5IOC A;  4A3M G;  2O4X A;  2UXB L;  2ZDG A;  5DM6 3;  1TWH H;  4ID6 A;  3K58 A;  1I3Q B;  4UCT A;  3HZX A;  5EWG A;  1YNJ C;  4JYA L;  4RZQ A;  1JE5 A;  2ALY B;  2FJ2 A;  4GS3 A;  5KFK A;  3JAM c;  3SR1 A;  4YWM A;  1UC9 A;  4IOA A;  1RYS A;  2BR0 A;  4YR0 A;  1G6Z A;  4LF4 H;  2B8F A;  5KG3 A;  1PYB A;  1IBK Q;  2I87 A;  1BF4 A;  1WTH A;  1N32 Q;  1B6R A;  4J9Q A;  2C2E A;  1K0S A;  3J81 i;  3S1M B;  4MTD A;  5C3E H;  5EBD A;  3OHX C;  2YZN A;  2BE5 C;  1QG7 A;  1W2B A;  1YIT A;  1E2W A;  1BXT A;  3F1Z A;  2AQ2 B;  1OXS C;  3QG1 A;  5HV6 A;  2MPM A;  3BYT B;  4QWC A;  4XT3 B;  4K6D A;  4CDF C;  1JCK B;  1PH8 A;  1KQS A;  3BG3 A;  1YZ6 A;  2EY6 A;  3S2H H;  1KJ8 A;  2CCZ A;  3H3V C;  5F9N A;  1UE7 A;  3KAL A;  5KFF A;  2MJ8 A;  1VQ7 A;  1RYR A;  4GOP B;  5CV4 A;  4KHP Q;  1BUV T;  1X55 A;  5ELO A;  4JI4 H;  1CM9 A;  3K5I A;  3MR6 A;  1I7L A;  3KF6 A;  4X66 L;  1A9X A;  2A68 D;  3T4A C;  1SDF A;  4A3K G;  2NYZ D;  5KFJ A;  4DXF A;  1IBM Q;  1OXU A;  3NWS A;  3G6E A;  3E9H A;  4MV3 A;  3GV5 B;  3BS1 A;  3RZD H;  4HJA A;  2CH4 A;  5KFB A;  2JXM B;  1C8C A;  4J6H A;  1G51 A;  1X6O A;  1MD2 D;  2Z4H A;  3J81 E;  3SXH A;  4G7O C;  1L2Z A;  3DEP A;  5EWE A;  4RB0 A;  2X0S A;  1H9J A;  3EYY A;  2CVR A;  3GTK H;  1NAP A;  1H9M A;  4DV6 L;  1NE3 A;  4RA8 A;  1A0I A;  3SEB A;  2E2I H;  3J81 c;  2AGP A;  2E2D C;  3V6K A;  3CCQ A;  5KG0 A;  2I8C A;  2F0F A;  3E0J A;  1JX4 A;  3TME A;  2KCT A;  5IYZ F;  4C3J H;  4O3S A;  5KFH A;  4DAY A;  2A8V A;  4I7A A;  2XTI A;  2R84 A;  1TWG A;  1V43 A;  3I56 A;  3RB4 A;  2W7P A;  1GUG A;  1AE2 A;  2OT2 A;  2JA5 G;  4ZHQ F;  2R61 A;  2R8J A;  1IYJ B;  2O2L D;  4YCW A;  1KAA A;  2VQD A;  2ICI A;  3I7F A;  1CSP A;  2K14 A;  1UUP A;  2UU9 Q;  4A3J B;  4MV8 A;  1S40 A;  3SI8 A;  2KCM A;  3CU7 A;  2WAQ G;  4UFZ A;  1HR0 W;  1TWF B;  1A3T A;  3FKI A;  4UCO A;  1SE3 A;  2L4N A;  4WD3 A;  1HQR D;  2RDF A;  4GLX A;  5E3F A;  1PH6 A;  3MR3 A;  1JIH A;  4GN5 A;  3D31 A;  5BR8 Q;  5C8Y F;  1B04 A;  4RMF A;  2C00 A;  3LWB A;  5EKI A;  3Q0A A;  4MTN A;  2R93 B;  3MWD A;  1IOV A;  1T36 A;  1PRT B;  3PUV A;  4A3D H;  3NGD A;  2VW9 A;  3H20 A;  1CHP D;  1TWC H;  1O75 A;  1DIK A;  1BBU A;  3FHW A;  1EHI A;  3DWA A;  1PZK D;  2XRQ D;  3DLL A;  1FL0 A;  2MGS A;  1NBW A;  4YY3 Q;  4DV4 L;  3I70 A;  2AGQ A;  1B3A A;  3PCO B;  5M3F B;  2OLS A;  2R3Z A;  1H9K A;  3GTQ A;  1PH9 A;  4A4I A;  2XGQ A;  1UAP A;  4QMG A;  1XMQ Q;  2VL6 A;  5EKK A;  3EBE A;  1J5E Q;  1IKM A;  1D8L A;  4B3S L;  4ZKB B;  1GOZ A;  3SK8 A;  3ND9 A;  5IY0 A;  5IWA Q;  4YHH L;  4DV3 Q;  3RD4 A;  1N33 Q;  1Y1V H;  4JVZ A;  5IT9 E;  1Q1E A;  4LFC L;  1CI3 M;  3TRZ A;  4DU9 A;  1I7N A;  4DR2 H;  3NQT A;  2UVU A;  3D6C A;  3KDF B;  4ECS A;  2QGQ A;  3CPW A;  1SXT A;  2NVX H;  5EWF A;  2JA6 H;  5IT9 c;  3KHG A;  2M05 A;  4V19 0;  2L1B A;  3G71 A;  3BQ0 A;  3U58 A;  1PH4 A;  4DV0 L;  4C2M H;  4ZOL F;  3PW4 A;  4DUY Q;  4X62 H;  1S4Z A;  1EIY B;  1E4E B;  4JV5 H;  1G29 1;  2DN8 A;  5FJ8 H;  5D3I B;  5C0X J;  1QJO A;  4DR3 L;  1VQK A;  3GTM B;  1K3R A;  1WTP A;  3CCE A;  1PZJ D;  1T3N A;  1ZYR D;  2YYZ A;  1XDN A;  1R4P B;  1F2L A;  2UUB L;  5KNC A;  3PO2 B;  1RJT A;  3G6V A;  4LFB L;  3KTM A;  3BG5 A;  3PSI A;  2R6F A;  4FDB A;  3SHL A;  1CSQ A;  4JV2 A;  1OXX K;  3CAM A;  2WYO A;  3HOU B;  4IQZ A;  4FYD A;  1PTO H;  2JP1 A;  1X3P A;  1KAW A;  4JI3 Q;  3EJI A;  4AIM A;  1SYF A;  4DPG A;  4X3S A;  2B63 A;  3VPC A;  4RNO A;  4A3B B;  3KLR A;  2EJF C;  1Y69 U;  3CD6 A;  1MHW C;  4GLA C;  1Z2N X;  4LF7 H;  1EYC A;  5KFP A;  2UVV A;  1N56 A;  3K5H A;  4B3M L;  1AP0 A;  3OIQ A;  1SAP A;  2N88 A;  2NTT A;  1EZ1 A;  5KFS A;  2QIL A;  4RGO S;  5DM7 3;  1WI5 A;  4QUC A;  1XTD A;  1IHZ A;  1V8Q A;  4DGZ A;  4DUZ L;  1I94 L;  1TWF A;  3BVM A;  3MR2 A;  5CYU A;  2F03 A;  1Y14 B;  2R7K A;  3OSN A;  4UHV A;  4RAY A;  3HOV G;  2R93 A;  4XYO A;  4A93 G;  4CC6 A;  3DM3 A;  3SDZ A;  2EY5 A;  1K83 B;  5I2X A;  1BCP C;  4EVO A;  1JB3 A;  3SK4 A;  1BCP F;  3N8D A;  2OQ0 A;  4IPD A;  2KUM A;  4X66 Q;  1VQ8 A;  4YQW A;  1ONL A;  1E1O A;  4A3M H;  5M9O A;  4HID A;  3GP7 A;  5GRO A;  4YWL A;  5GAE C;  3PIO A;  1YNJ D;  1LAB A;  4OIK A;  1KC8 C;  4DR6 H;  4BBS G;  4CJ0 B;  5I2Y A;  2F0H A;  3EIV A;  2YU9 H;  3VPB A;  1N48 A;  2E5L H;  3MXN B;  1FNW A;  1HPC A;  5E4X A;  3N6R A;  2JA7 G;  5C1O A;  3MR5 A;  3RF2 A;  2W9B A;  3V6H A;  5CAE B;  1K1S A;  4MAM A;  2NU6 B;  3Q6S A;  5EPK A;  2DNE A;  1YJW A;  2G5D A;  4I7H A;  4G57 A;  1B7Y B;  1X56 A;  2SNM A;  2BE5 D;  1JJ2 A;  1CA6 A;  1MIU A;  3GTP H;  3EA6 A;  4A3G B;  1M6V A;  5KG7 A;  1LM0 A;  4JYA H;  1PFB A;  4HTH A;  1E3P A;  5L37 A;  4FO2 A;  2BH2 A;  5K5P A;  3KDF A;  4GNX B;  3WWV A;  1DOL A;  1LT3 D; 
#chains in the Genus database with same CATH homology
 1X3G A;  3A74 A;  2K4K A;  4DNI A;  5IP7 G;  1UWV A;  2VUM G;  4A3C H;  3KYH C;  1YJN A;  3GO5 A;  1K9M C;  4JI4 Q;  1VQ9 A;  5IYB H;  3W5O A;  2CKZ B;  2K5H A;  3TS2 A;  4A3F G;  2R6G A;  5M3M G;  1IZ6 A;  2MQH A;  2C35 B;  3SGI A;  4A75 A;  2CWA A;  4HJ5 A;  2YTV A;  3I4O A;  1KL9 A;  1UE5 A;  4R4Q A;  3CC7 A;  1XPR A;  3HOZ H;  3ER0 A;  2R92 G;  3ULP A;  4DR6 L;  1XMO L;  4GKJ Q;  5EAY A;  2OWO A;  3M3Y H;  2Y0S G;  1VQJ A;  1J6Q A;  3M4Q A;  4IJH A;  2NZH A;  4XIG S;  3J7Z C;  2E5L L;  4B3R L;  2UXD Q;  3F2D A;  5IYC H;  4LF7 Q;  2R7Z G;  3J80 i;  1PV4 A;  1JJG A;  1LYL A;  1WFQ A;  5AJ3 Q;  3PUY A;  4EQ5 A;  3K0X A;  2N49 A;  1YBY A;  3I4N H;  4DR7 L;  3GTQ H;  2VQE L;  1VQO A;  3K7U C;  5FLM H;  3RLN A;  1OXV A;  5GQO A;  4POF A;  3S17 H;  4A3G G;  4DV7 L;  1UE1 A;  1QVF A;  1IBM L;  3AQQ A;  1VQE A;  4BBR G;  3H3V I;  2H5X A;  1PH3 A;  3HFZ B;  2HQL A;  3AEV A;  3A5U A;  3GTM H;  1BBW A;  1XNQ L;  1HZB A;  1Q86 C;  4A3L G;  1WYD A;  3BZC A;  3I55 A;  3ERS X;  1VS0 A;  3BZK A;  3K81 C;  4A3D G;  4IPG A;  4LF5 L;  1HH2 P;  1IXR A;  1AE3 A;  3I4M G;  5DLQ E;  3S15 H;  2ES2 A;  2FXQ A;  1VQN A;  4LF6 L;  2V1C C;  2JE6 I;  2F52 A;  4QQB X;  3PO2 H;  4GOP C;  4ME3 A;  1PVO A;  1N8R C;  3CPF A;  4OWW B;  1Q46 A;  4DR1 L;  4OX9 L;  3HOW H;  1NTG A;  4B3S Q;  4P73 A;  1EIF A;  2I5L X;  2Q2I A;  3TRE A;  3W1B A;  4HJ9 A;  1SE8 A;  2WP8 J;  1VQF A;  3FKI G;  4YHH Q;  3HOU H;  3H3V H;  3CMA A;  3ICE A;  1L1O B;  4DV1 L;  3HOX H;  4DR2 L;  1PA6 A;  4BY7 G;  3PO3 H;  4JCV E;  3CCV A;  4AQY L;  1PH1 A;  4A3B H;  2E5L Q;  4B3R Q;  5JJL A;  3CCU A;  3PUX A;  5LMN L;  1SRU A;  2PQA A;  5C0X G;  4DV5 Q;  3PV0 A;  1Q82 C;  5IP9 H;  4DR7 Q;  2I5H A;  2VQE Q;  4DAM A;  3J80 c;  2VQF L;  2JEA I;  2UU9 L;  4UPA A;  1EUJ A;  4KLK A;  4DV0 Q;  2IHF A;  2VZA A;  3T1H L;  4JI7 L;  2JA7 H;  3S14 H;  4GN3 B;  1PH5 A;  3CC4 A;  4LFA L;  4GKK L;  2ATW A;  4LWC A;  1HZC A;  3TS0 A;  1EQR A;  4DR3 Q;  2WAQ E;  1YJ9 A;  2JA6 G;  5LMU L;  5BR8 L;  2GVA A;  3H15 A;  1HR0 L;  4JBM A;  4IFD G;  1X65 A;  4ALP A;  3UDI A;  2B63 H;  2DUD A;  2HIV A;  1QZH A;  2UUC L;  1WOC A;  4LUV A;  1K83 H;  5H1S E;  4LF6 Q;  1VCI A;  3U4V A;  1NY4 A;  5M5Y H;  3UDF A;  2ZJQ A;  2KHI A;  4UP8 A;  2I0Q A;  3OW2 A;  1E24 A;  2NZO A;  2NVY H;  4LFB Q;  2LSS A;  3KF6 B;  1A63 A;  4DR1 Q;  4OX9 Q;  3AFP A;  1XNR Q;  2PI2 A;  1Z47 A;  1KHI A;  4GNX A;  4BA2 I;  2HIX A;  5C4J H;  4LNQ A;  4WJ4 A;  1I6H H;  1YHB A;  4A3F H;  1VQA A;  4DV1 Q;  3CCS A;  4DR2 Q;  1A62 A;  1VQI A;  2E8G A;  5LMN W;  1FJG Q;  4OO1 G;  4QGU A;  1KXL A;  3UE1 A;  2ID0 A;  4DV2 L;  3JC6 6;  4IPH A;  4OWX B;  3GTO H;  2XGT A;  2R92 H;  1VQL A;  4A3E G;  1V9P A;  3ULJ A;  1J5E L;  1EFW A;  1TXY A;  5LMN Q;  4POG A;  2NN6 I;  1UE6 A;  2JA8 H;  4J15 A;  4HJ8 A;  1PH7 A;  4B3M Q;  2R7Z H;  4Y52 H;  1HJP A;  4R4I A;  5IWA L;  4X62 Q;  4DV3 L;  2MFI A;  2Q2H A;  5JEA J;  2JQO A;  3GD7 A;  4KHZ A;  1N33 L;  4JG2 A;  1ASY A;  3PF4 A;  5IYD G;  3GDE A;  3HKZ E;  4QJF A;  4XTC S;  1I50 H;  1I5F A;  3H0G G;  1FGU A;  3PUW A;  4DUZ Q;  1EQQ A;  3J81 j;  1I94 Q;  1HNZ L;  4LFA Q;  4JI7 Q;  4A3G H;  4GKK Q;  3B6Y A;  3S24 A;  1XPU A;  5JJI A;  5LMU Q;  4DK3 C;  2LXK A;  4DAY B;  4X65 Q;  1IBK L;  1N32 L;  4BY1 G;  3U50 C;  1GD7 A;  1WCM H;  3S1N H;  2B29 A;  1SFO H;  2NVT H;  5HY6 A;  4TQU S;  2UXC L;  5HGQ A;  4NXM Q;  4QIW E;  4K0K L;  5ELN A;  4JI5 Q;  1K73 C;  2K5V A;  3EN2 A;  1NMF A;  4DUY L;  1LTL A;  3HOY G;  4R4O A;  4QL5 A;  3NEM A;  5C0X I;  2CWP A;  1ASZ A;  4P71 A;  3AFQ A;  5M5W H;  1PHJ A;  2ZTC A;  1U5K A;  1CUK A;  1NMG A;  2EXD A;  3G48 A;  1SLJ A;  3HKS A;  4LUZ A;  4R1J A;  1HNX Q;  1VQD A;  3UDX A;  2ZTE A;  2AWN A;  4IPC A;  3G4S A;  4DR5 L;  1EOV A;  1QZG A;  4KHP L;  3RR5 A;  1YHA A;  4APV A;  4DV2 Q;  1YEZ A;  3J7A 5;  3S2D H;  5GAH C;  4BY7 H;  5M5X H;  4A3J G;  1HZ9 A;  2F3I A;  1JT8 A;  1SRO A;  4A3M G;  2UXB L;  4JBW A;  4IJL A;  4UP9 A;  1TWH H;  3BJU A;  4IFD I;  2OTL A;  2AWO A;  1X3F A;  4IO9 A;  4LF8 Q;  1TWA H;  1Q8K A;  1L1O A;  1P16 A;  4OWT B;  4JYA L;  1JE5 A;  2K75 A;  2ALY B;  4MZ9 A;  4GS3 A;  4JI2 L;  1O7I A;  4O0A A;  3JAM c;  1JMC A;  2PMZ E;  3Q8D A;  1HNZ Q;  4YWM A;  3STB C;  4IOA A;  5GAD C;  4GOP A;  2R93 G;  1KIX A;  2YTY A;  1PYB A;  4JI8 L;  1IBK Q;  2MO1 A;  3A5Z B;  4JBJ A;  3T1H Q;  1KD1 C;  3KFU A;  1N32 Q;  3KJO A;  1Z9F A;  5C4X H;  3HOV H;  3J81 i;  5C44 G;  3OTO L;  4A3I G;  4OO1 I;  2VS1 A;  2UXC Q;  1L2F A;  5C3E H;  3S1Q H;  3KJP A;  4A93 H;  4BXX H;  2HHH L;  1W2B A;  1YIT A;  1FVI A;  3L7Z C;  3E0E A;  3F1Z A;  5M3F G;  3GTG H;  4YCU A;  1X54 A;  3KLW A;  1OXS C;  1N9W A;  4A3C G;  2K5N A;  2RHS B;  4YCV A;  3ZJY C;  4DR6 Q;  2HT1 A;  1XMO Q;  1PH8 A;  3PGZ A;  1KQS A;  1YZ6 A;  3S2H H;  1OXT A;  1CKN B;  2CCZ A;  5IYB G;  1UE7 A;  4L5R C;  1VQ7 A;  2NVQ H;  2D0O A;  4GOP B;  3CP0 A;  1X9N A;  2K52 A;  4KHP Q;  4BBS H;  4H02 A;  1X55 A;  5ELO A;  1Y1V G;  3NEL A;  3RLO A;  3HOZ G;  2UXB Q;  3KF6 A;  4X66 L;  1Y1W H;  4A76 A;  1Q1B A;  4LUO A;  3RNU A;  4A3E H;  4A3K G;  3ULL A;  4DV7 Q;  2ZJR A;  4JI1 L;  2RCN A;  1IBM Q;  4JYA Q;  2ZTD A;  1OXU A;  2ZM6 L;  1HNW L;  3G6E A;  3E9H A;  2BA0 A;  3I4N G;  3RZD H;  4HJA A;  1XNQ Q;  5GAG C;  1EWI A;  5IYD H;  2N8N A;  4Y7N H;  1GO3 E;  5FLM G;  1DGS A;  1G51 A;  1X6O A;  2YV5 A;  3H0G H;  4JC0 A;  4OXP A;  4L5S A;  4LF5 Q;  1NJI C;  1JB7 A;  1YI2 A;  3W1G A;  2EIF A;  5FJ8 G;  2IX1 A;  3OTO Q;  2E2J H;  1G6P A;  4KI0 A;  5IP7 H;  2VUM H;  4BY1 H;  3GTK H;  1A8V A;  4DV6 L;  1S3O A;  2B3G A;  1NE3 A;  2HHH Q;  1A0I A;  2Z6K C;  2E2I H;  3J81 c;  3CCQ A;  4YY3 L;  2KCT A;  4X64 L;  4C3J H;  4L5T A;  1PYS B;  4DKA C;  3M7N A;  2IX0 A;  5M3M H;  2A19 A;  2R7F A;  4GN4 B;  1PH2 A;  2XTI A;  3OYY A;  2AHO B;  2A8V A;  3K7A H;  1V43 A;  1VQC A;  2RHQ B;  3I56 A;  4AQY Q;  3L2P A;  1VQ6 A;  2UUA L;  4JI4 L;  1LUZ A;  3S16 H;  3HOW G;  2VNU D;  1VQM A;  2MNA A;  1XMQ L;  1AE2 A;  2JA5 G;  1BVS A;  2D0P A;  1IYJ B;  2WFW A;  4YCW A;  4HIK A;  3HOU G;  5E7N A;  4JOI C;  2VQF Q;  3HOX G;  3I7F A;  1CSP A;  2K14 A;  2UU9 Q;  3CW2 C;  1S40 A;  4A3J H;  3PO3 G;  2KCM A;  4A3B G;  2WAQ G;  2JK8 A;  3CQZ H;  4NB3 A;  1HR0 W;  3L0O A;  1PFS A;  1HNW Q;  4NPS A;  2KHJ A;  3I2Z A;  2E2H H;  4GLX A;  3K80 C;  5IP9 G;  1PH6 A;  4BBR H;  4GN5 A;  3D31 A;  5BR8 Q;  4P75 A;  5AJ3 L;  1HR0 Q;  3BU2 A;  2OQK A;  1KRS A;  4RMF A;  4A3L H;  4GNX C;  3LGJ A;  3TQY A;  3GTL H;  1RL2 A;  4MTN A;  3CCL A;  4DR4 Q;  2UUC Q;  5J3B A;  3PUV A;  4A3D H;  2VW9 A;  1N36 L;  3I4M H;  3KOJ A;  1HZA A;  1QVG A;  3RZO H;  1TWC H;  4WJ3 M;  1BBU A;  1Q12 A;  4B3T L;  3FHW A;  4DV6 Q;  3CCJ A;  1C9O A;  3PUZ A;  3DLL A;  4P74 A;  1FL0 A;  1NBW A;  2PI2 E;  4YY3 Q;  3CCR A;  2N3S A;  3CCM A;  4DV4 L;  4HIM A;  2B63 G;  4X6A H;  1B70 B;  4X64 Q;  3PCO B;  2L15 A;  3T1Y L;  2IY5 B;  2IHE A;  3M4O H;  3FKI H;  1PH9 A;  4EX5 A;  4A4I A;  1M90 C;  4QY7 A;  3IRB A;  5JEA G;  3M85 A;  3CXC A;  4MNO A;  2UUA Q;  2Z0S A;  4UY8 C;  4NXN L;  1MJE A;  1XMQ Q;  2EQS A;  2VL6 A;  3EBE A;  1J5E Q;  3NEN A;  2F4V L;  4YWK A;  1D8L A;  4B3S L;  1I3Q H;  3HKZ G;  1XJV A;  5IY0 A;  4JI6 L;  5IWA Q;  2AMC B;  4YHH L;  4DV3 Q;  3KF8 B;  4AYB E;  1N33 Q;  1Y1V H;  2IT1 A;  2GN5 A;  3K8A A;  4JI3 L;  1H95 A;  1Q1E A;  2WB1 E;  5FLX c;  2QEX A;  1CKN A;  4LFC L;  1C7Y A;  4AH6 A;  1VQ5 A;  3TRZ A;  4R4C A;  1Q81 C;  1VQP A;  4O2D A;  4A3K H;  3CME A;  2JA8 G;  4R4T A;  1QVC A;  3KDF B;  1W3S A;  2CQO A;  2QGQ A;  3CPW A;  4DV5 L;  2NVX H;  2OTJ A;  1GKH A;  2RF4 A;  1B8A A;  2JA6 H;  5IT9 c;  1QUQ A;  4JI0 L;  3E9I A;  3G71 A;  3S1M H;  4K0K Q;  3U58 A;  1PH4 A;  4DV0 L;  4C2M H;  2N78 A;  1N36 Q;  1YHQ A;  4DUY Q;  3U4Z A;  1EIY B;  4B3T Q;  3TEH B;  1G29 1;  5C0X J;  5FJ8 H;  4LF9 L;  2AKW B;  1U0L A;  1JJC B;  4DR3 L;  1VQK A;  3PF5 A;  5JJK A;  1WCM G;  1K3R A;  1IBL L;  4DV4 Q;  3CCE A;  2Q2U A;  2NN6 G;  2YYZ A;  3T1Y Q;  2JEB I;  1L1O C;  5IE8 A;  4DR5 Q;  1SN8 A;  1R9T H;  2D62 A;  4C3I H;  2UUB L;  4PZ7 A;  1N34 L;  3UDG A;  4NXN Q;  1YIJ A;  4JBK A;  4LFB L;  2F4V Q;  4P72 A;  1QUQ B;  1M1K C;  1VQG A;  3PSI A;  4AYB G;  4IFD J;  4FDB A;  3F2C A;  1CSQ A;  1SMX A;  4C3H H;  2JA5 H;  1OXX K;  2WB1 G;  3CAM A;  1XNR L;  1D7Q A;  1MJC A;  4JI6 Q;  3A0J A;  5IYC G;  1K8A C;  1KAW A;  4PMW A;  2ZJP A;  4JI3 Q;  2QA4 A;  1XPO A;  4JI2 Q;  1WJJ A;  1P8L A;  3M9B A;  4AIM A;  4DPG A;  3VDY A;  4LFC Q;  1FJG L;  1K0R A;  4LF4 L;  1C0A A;  1S72 A;  3FP9 A;  2YTX A;  4GLV B;  1RIP A;  3CD6 A;  4GLA C;  2Z6K A;  2JJQ A;  1K8G A;  1IL2 A;  1KRT A;  4JI8 Q;  4RG1 A;  4PZ8 A;  4B3M L;  3CC2 A;  1VQ4 A;  4X62 L;  1WI5 A;  1X3E A;  4JI0 Q;  3F8T A;  4JV5 L;  1VQB A;  2BA1 A;  4DR4 L;  1XTD A;  4DUZ L;  2MO0 A;  2R7D A;  2OCE A;  1UEB A;  3RN2 A;  1I94 L;  1SR3 A;  1BKB A;  2A1A A;  1Y14 B;  4LF9 Q;  1E22 A;  4PG3 A;  1AH9 A;  1E7Z A;  3HOY H;  1Q7Y C;  5C4X G;  3GTJ H;  4JOI A;  4X65 L;  1CKM A;  1E1T A;  4IOC A;  1IBL Q;  3HOV G;  3M4P A;  2BH8 A;  5C3E G;  3PO2 G;  4A93 G;  4BXX G;  3DM3 A;  2K50 A;  3CF5 A;  4NXM L;  3RLF A;  4DK6 C;  4JI5 L;  3D0F A;  2JA9 A;  2UUB Q;  1CKO A;  1N34 Q;  2PQA B;  1MKH A;  2OQ0 A;  4IPD A;  4X66 Q;  1VQ8 A;  1E1O A;  4L5Q A;  4A3M H;  4PZ6 A;  4UP7 A;  4GKJ L;  3F2B A;  4JI1 Q;  1GM5 A;  4HID A;  2KEN A;  2PNH A;  5GRO A;  4YWL A;  2GVB A;  4BA1 I;  1V1Q A;  1TWF H;  5GAE C;  3PIO A;  2ZM6 Q;  1KC8 C;  1HNX L;  3AYH B;  4BBS G;  2UXD L;  3PIP A;  3EIV A;  2YU9 H;  4LF7 L;  4LF4 Q;  2Y0S E;  3S1R H;  3STB D;  4OON A;  1YVC A;  1Y1W G;  4HJ7 A;  3MXN B;  1TWG H;  2JA7 G;  3UE0 A;  2CFM A;  2VY3 A;  2R93 H;  1YNX A;  4LF8 L;  4TVA B;  3JAM i;  5K36 G;  1YJW A;  3NBH B;  2DGY A;  4JV5 Q;  1VQH A;  5C44 H;  1B7Y B;  1X56 A;  4A3I H;  1JJ2 A;  2KBN A;  4LW1 A;  1MIU A;  2ASB A;  4HIO A;  3GTP H;  1OTC A;  1LM0 A;  2LXJ A;  1E3P A;  1EYG A;  1T9H A;  2Q2T A;  2BH2 A;  3KDF A;  1L0W A;  1GVP A;  4GNX B;  3RN5 A;  3WWV A;  2I5M X;  3MEF A;  5M3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...