3HOYG

Complete rna polymerase ii elongation complex vi
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoyG01
4P72A 4YHHQ 4DR1L 3S24A 4DV1L 4GNXC 2KHJA 3A5UA 4C2MH 4JI7Q 1CKOA 5C3EG 1HR0W 1MJCA 1VQKA 2LXKA 4A3FG 4YWLA 2Q2UA 1AE2A 5M5XH 3H0GG 1I94L 3UDIA 4OO1G 1CKNB 5LMNQ 4HJAA 1XMQQ 4LUVA 5IYBG 3F2BA 4LF4L 4NXNQ 4DAMA 4A93H 3NEMA 1NMFA 4JOIA 2IX1A 3KDFA 5EAYA 2E2JH 3RZDH 2UXBQ 4LUZA 3STBC 4DR3Q 1NJIC 5FJ8G 3RLNA 4A3BH 1KRTA 1VQNA 3E9HA 1LYLA 1SLJA 3CXCA 3PF4A 2Z6KA 3H15A 3AYHB 4KHPL 1FL0A 4BY1G 4HJ8A 2JK8A 3CD6A 3CCSA 4DR6L 3OYYA 1GVPA 4GLVB 3G71A 3GTMH 1MJEA 4BBSG 5JJKA 4R4QA 2N78A 1Z9FA 3HOZG 1NY4A 1K0RA 3A5ZB 2EXDA 4PZ8A 4GLXA 3U4VA 3PUYA 4LF9L 5JEAJ 1VQ9A 1GM5A 3W1BA 2VY3A 2A19A 1X65A 2FXQA 2JQOA 2R7ZG 2VW9A 4JI4Q 3SGIA 2WB1E 1VQ7A 4DR4Q 3E0EA 3S1NH 3Q8DA 4XIGS 1PH2A 1WOCA 4L5QA 1TWAH 2EQSA 1N34Q 4JBMA 1N33L 2BA1A 3KF8B 4DR5Q 1X55A 4R4OA 1Z47A 4QGUA 1PH6A 4AYBG 3I4MH 5M5YH 5C44H 4JBKA 4A3GG 1YZ6A 2HQLA 4YCUA 1LUZA 4YCVA 2YTYA 4DV6L 4LF8L 2K5VA 4DR1Q 1Y14B 3FKIG 2YYZA 3L0OA 1KL9A 4IJHA 3CC2A 1QVCA 1XPOA 3PF5A 3GTKH 2MO0A 1KHIA 1K3RA 1I94Q 1SRUA 2ZJQA 3ZJYC 4OWTB 3HOWG 4LF4Q 4B3ML 3S1QH 1QUQB 2NZHA 1HR0Q 4LF7L 4A3LH 3BZKA 1XNQL 3U50C 1OXTA 4JOIC 2RCNA 4JCVE 3RLFA 2ZJRA 4JI3L 4KHPQ 1SE8A 2E5LL 2N3SA 2NVQH 4DR6Q 3MXNB 1YEZA 2D62A 3A0JA 1EUJA 3PV0A 1J5EL 1CKNA 1UE7A 3NENA 3J80i 1E3PA 4LFBL 3HOUH 5J3BA 4K0KL 1YJNA 4LF9Q 2UUBL 1IBML 1HNWQ 4OO1I 3F2DA 2R93H 4BY7H 3CF5A 5IYDG 1L1OB 2GVBA 1A63A 1V43A 3HOXG 1VQOA 4H02A 2LSSA 4R1JA 1IXRA 1BKBA 2R6GA 2UU9L 1IZ6A 2DGYA 4OWXB 1VQ5A 2PNHA 2JA6G 4A4IA 3W1GA 4MNOA 3J80c 1N33Q 2CFMA 1WI5A 4RMFA 2HT1A 5ELNA 1VQPA 4DR7Q 1UWVA 3KYHC 2VUMH 1IYJB 4IOCA 4IOAA 3I2ZA 3GTJH 4GN3B 4LF8Q 1Q46A 4BXXG 4DV6Q 1YI2A 3GD7A 3T1HL 1R9TH 3H3VI 3CPWA 3S2DH 4GOPC 2R7FA 3NBHB 5E7NA 4UP7A 4JBJA 1PH7A 4JYAL 5FLMG 3J81j 4YWMA 3HOVG 5GROA 4TVAB 5K36G 3F2CA 4DR4L 2K75A 4A3IG 2JA5G 2I5HA 4KI0A 4Y7NH 2XTIA 1I6HH 2OTLA 1JB7A 3MEFA 4WJ4A 1XNQQ 2ASBA 1AE3A 3F1ZA 1W3SA 5DLQE 2VQEL 2YTVA 4AQYQ 4NXML 2UXDL 4LFCL 1S40A 4MZ9A 1VQ8A 2KCTA 1WYDA 5IP9G 4JI3Q 1Y1WG 3IRBA 2A1AA 2E5LQ 3K0XA 1RL2A 3M7NA 4DV4L 3KJPA 3HOXH 1QZGA 2GVAA 3G48A 1JJGA 4APVA 1J5EQ 4DV3L 1VQ6A 2R92G 4X64L 3HOYH 3FP9A 3E9IA 1B70B 2MFIA 1Q1BA 5C4JH 4LFBQ 1A62A 4K0KQ 1QUQA 1OXSC 2UUBQ 2CWAA 1IBMQ 1HR0L 4A3DG 3GTQH 2JE6I 2VNUD 1X9NA 1SMXA 1PFSA 1S3OA 5M3MG 3OW2A 4A3MG 3GTOH 2UU9Q 4IFDI 1A8VA 4GNXB 1X56A 5IE8A 2F4VQ 4GKJL 2JA8H 5FLXc 2YTXA 1Q82C 1PH5A 1PH4A 3AEVA 5JJLA 1HNZL 4B3SL 4A75A 1KD1C 3BJUA 3RN2A 2JEBI 1B8AA 4JI8L 1SROA 1DGSA 1RIPA 2VZAA 2WAQE 4P73A 1CUKA 1EQRA 1V9PA 3LGJA 4IPGA 1OXXK 3T1HQ 4LF5Q 1XNRL 4DV0L 2AHOB 3D0FA 1PYSB 2QA4A 4JYAQ 3RNUA 1HNWL 1SR3A 4C3HH 1L1OA 4YWKA 5AJ3L 4YCWA 2OCEA 4A3EG 1G291 1Q81C 2I5MX 1QZHA 1KQSA 1E22A 1X6OA 3CP0A 5GADC 1WCMG 2N8NA 1TWFH 4TQUS 4UP8A 1PH9A 2KHIA 5M3FG 4L5SA 2I0QA 2I5LX 1Q12A 5C3EH 1L0WA 4A3FH 3CQZH 2VQEQ 3H0GH 1OTCA 3PUWA 2E8GA 2A8VA 4NXMQ 2UXDQ 4HIOA 4LFCQ 1YHAA 2NN6I 2OQKA 5IYBH 4A3JG 3TS0A 3F8TA 3PO3G 3AFPA 3S1RH 1HZAA 2Q2HA 2IX0A 5IYCG 5C4XG 2VQFL 4DV4Q 3KF6B 5C0XJ 2OWOA 1FJGQ 1E1TA 4DV3Q 3BZCA 1SN8A 1YNXA 4PMWA 5FJ8H 4X64Q 1K8AC 1E1OA 4WJ3M 1P16A 3CCVA 2JJQA 3FHWA 3STBD 1MIUA 4X65L 3U58A 2XGTA 4FDBA 1UEBA 3I55A 5GAEC 4UY8C 4DKAC 4LUOA 4POFA 3CCJA 4BBRG 2MNAA 4BY1H 4IFDG 1U5KA 3H3VH 4A3KG 4BBSH 1LM0A 3RN5A 3JAMi 1C9OA 1CSQA 1YITA 4AIMA 2H5XA 3OTOL 4AQYL 1JMCA 3HOZH 4DK3C 4A3CG 4GKJQ 3D31A 3CCMA 2UXCL 3TS2A 3PO2G 1XPUA 1VQGA 1EWIA 1HNZQ 4B3SQ 1I5FA 3M9BA 3T1YL 1E7ZA 4O0AA 1G6PA 4JI8Q 2AWOA 3PUXA 2R7ZH 1Y1VG 5JJIA 4IPDA 2Z6KC 2B63G 1NE3A 1SFOH 1X3EA 4EX5A 3JAMc 3GTPH 3KOJA 4DV0Q 2RHSB 3PUVA 5AJ3Q 4POGA 2ZTEA 2YU9H 1X54A 1M1KC 4JI0Q 3I4NG 3ICEA 3KDFB 3GTLH 4A3GH 2OTJA 1KXLA 3HKZG 4YY3L 2QEXA 1B7YB 4GNXA 1KC8C 1FGUA 3M4PA 3G6EA 4B3RL 2K4KA 2AKWB 4DAYB 2F4VL 2JA7G 3EN2A 5LMNW 1VQLA 2K52A 3PCOB 3FKIH 4J15A 1YJWA 2NN6G 3K7AH 1W2BA 3S15H 4AYBE 3EIVA 4A76A 3TRZA 2Q2TA 5LMUL 1C0AA 3W5OA 2ZM6L 3M85A 4JI1L 2ES2A 5IP7G 3BU2A 5BR8L 3HOWH 4DR7L 4EQ5A 4JI2L 2HIXA 2E2IH 4B3TL 4LF5L 2VQFQ 4UP9A 1ASZA 1YVCA 2V1CC 5JEAG 4JG2A 2CCZA 3GTGH 4PZ6A 3UE1A 3PIPA 1TWHH 3CAMA 4HJ9A 4X65Q 4BA2I 2ZTDA 1PHJA 4O2DA 4HIKA 3S1MH 2BH8A 3PIOA 1UE5A 2GN5A 4DPGA 4DV7L 1VQAA 4A93G 1TWGH 1NTGA 1VQFA 1X3GA 4NPSA 2NVXH 4C3IH 1K83H 1WFQA 4IJLA 1E24A 3OTOQ 5HGQA 4GOPB 3RLOA 3CCRA 3UE0A 4A3BG 2UXCQ 1EOVA 2D0PA 3CCQA 4IO9A 3ERSX 3T1YQ 2IHEA 1N8RC 4KLKA 3CPFA 4LW1A 1HJPA 1LTLA 5IYDH 1ASYA 1FJGL 1D8LA 4IPHA 2IT1A 2HIVA 2R7DA 1VCIA 3CW2C 2JA6H 3HFZB 4R4TA 2WB1G 1J6QA 3WWVA 4L5RC 1V1QA 2YV5A 1TXYA 1EQQA 2LXJA 4RG1A 3U4ZA 1YIJA 3RR5A 4YY3Q 4BXXH 2N49A 1UE6A 4B3RQ 4GN5A 4DR2L 3K81C 4JI5L 1N36L 3J7A5 1CSPA 4QJFA 1GO3E 3KJOA 5FLMH 2PQAB 1EIFA 4MTNA 3TQYA 1YJ9A 4DUZL 2Q2IA 1XMOL 1L2FA 5LMUQ 3HOVH 2ZM6Q 4LF6Q 3M4QA 1OXUA 2AMCB 4JI1Q 3NELA 5BR8Q 3HKSA 5C44G 4IPCA 3I4MG 3M4OH 4JI2Q 3VDYA 4A3IH 3PUZA 2JA5H 4B3TQ 4JV5L 2IY5B 2JA9A 1PH8A 4HIMA 1C7YA 4OONA 2HHHL 4HIDA 1MKHA 2BA0A 2PMZE 3AQQA 3DM3A 4OWWB 1NBWA 5M5WH 1GD7A 4JI0L 1H95A 1VQMA 1Q86C 2Y0SG 4JI6L 2UUAL 3DLLA 3CCLA 5IP9H 1Y1WH 1FVIA 4DV7Q 3ULJA 3M3YH 1VQHA 2F3IA 1Q8KA 1KRSA 4AH6A 2MO1A 4A3LG 4DNIA 1PH3A 1IBLL 2R92H 3CC7A 2ALYB 3ULPA 4LNQA 3TREA 4OX9L 1YBYA 2AWNA 3L2PA 1XJVA 1HNXL 3KFUA 1PV4A 1BBUA 1KIXA 4A3DH 2MQHA 3B6YA 1KAWA 2WFWA 4PG3A 4X66L 5M3MH 3A74A 3UDFA 4A3MH 1YHBA 5HY6A 4X62Q 4GS3A 2OQ0A 1HZ9A 2WP8J 3J81i 3HOUG 4XTCS 3ULLA 1OXVA 5GAGC 3CMAA 4DV2L 1QVGA 2UUCL 2K50A 4P71A 4GLAC 1I3QH 4DK6C 1N32L 5ELOA 2ZTCA 4BY7G 2R93G 3GDEA 4Y52H 2KCMA 1VQIA 4GOPA 4GN4B 1XPRA 4JC0A 4P74A 1XNRQ 1AH9A 4DR2Q 1N36Q 4JI5Q 2L15A 4JBWA 2VS1A 4DV1Q 2B29A 1K9MC 1UE1A 2Z0SA 1VS0A 3K80C 4DUZQ 2VL6A 2NZOA 3JC66 4P75A 3J81c 2K5HA 4A3EH 1XMOQ 1S72A 1EYGA 2EIFA 3CMEA 4BA1I 1JJ2A 1PA6A 2VUMG 1WCMH 2CWPA 2CKZB 3L7ZC 1K73C 4JV5Q 1CKMA 2NVYH 1Q7YC 4LWCA 5C0XI 5M3FH 2HHHQ 1JT8A 5H1SE 4LFAL 5IWAL 3CCEA 1VQEA 2PI2A 3I7FA 1VQ4A 3TEHB 5IT9c 2JEAI 4GKKL 4R4CA 2IHFA 3I56A 3UDGA 2Y0SE 3CCUA 4JI6Q 1G51A 1IBKL 2CQOA 4DV5L 2UUAQ 1HZBA 2RHQB 1L1OC 4DUYL 4A3JH 1XTDA 1T9HA 3PO3H 1VQBA 2DUDA 4YHHL 3PSIA 5C4XH 5IYCH 2PQAA 1YHQA 2KBNA 3K8AA 1IBLQ 1I50H 4JI7L 1N9WA 2K5NA 3S17H 1HH2P 4LF6L 2QGQA 4OX9Q 1PH1A 4QL5A 4R4IA 4UPAA 1HNXQ 3AFQA 5LMNL 4X6AH 1XMQL 1EIYB 4ME3A 2K14A 4BBRH 4NXNL 2E2HH 4A3KH 3K7UC 4X66Q 2UXBL 1HZCA 2C35B 2KENA 1EFWA 3CC4A 4A3CH 4DR3L 3HOYG 3EBEA 4HJ7A 3PO2H 2BH2A 1BVSA 4DV2Q 2NVTH 2UUCQ 1N32Q 2B3GA 2PI2E 1Y1VH 4QIWE 2ZJPA 1D7QA 1TWCH 2B63H 3S2HH 3UDXA 3GO5A 4NB3A 4OXPA 1JJCB 1VQDA 1Q1EA 2ID0A 2WAQG 3KLWA 2D0OA 3I4OA 4ALPA 1QVFA 1BBWA 4QQBX 2RF4A 2JA8G 3S14H 5IY0A 3KF6A 1JE5A 3S16H 2ATWA 3I4NH 3ER0A 1O7IA 4HJ5A 1GKHA 2F52A 1M90C 1X3FA 5C0XG 1NMGA 1VQJA 1IL2A 3G4SA 1PVOA 4PZ7A 1A0IA 5GAHC 4X62L 4JI4L 2JA7H 1VQCA 1PYBA 1WJJA 4B3MQ 4L5TA 4C3JH 4LF7Q 4LFAQ 1U0LA 4KHZA 5IWAQ 1N34L 3RZOH 3PGZA 4IFDJ 1K8GA 4QY7A 4GKKQ 5GQOA 3J7ZC 4DR5L 3HKZE 1IBKQ 4DV5Q 1P8LA 5IP7H 4DUYQ
chains in the Genus database with same CATH superfamily
4P72A 2PBZA 3RUPA 1C3OA 2IW3A 3S24A 4DV1L 4GNXC 3A5UA 5D8DA 4XQNA 4U7CA 1TS3A 1ULZA 1MJCA 4A3FG 5CV7A 2VUMB 1EY8A 4NP5A 1I94L 3JRXA 1SDFA 4Z9CB 2E75C 4DAMA 3X3MA 2IX1A 5KFAA 2NZ1D 4RAUC 1E4EA 1C48A 1I4GA 3GTGB 2J6TA 1NJIC 1SYBA 3K59A 4ECVA 1CQJB 1DZ1A 2JEGA 2UUBH 1VQNA 3CXCA 5KFKA 3PF4A 4JVZA 3S1MB 1W96A 1VMPA 3VYUA 4DR6L 2BCOA 2NVXB 5JJKA 2BQRA 2B2VC 1N56A 2F4VH 4U673 1F9RA 1Z9FA 4CDDC 4A2BA 5L1LA 1F9SA 4YJ2F 4ECZA 5EKKA 3V96A 2AU0A 3U4VA 2F0FA 4ZI7F 3W1BA 1KJJA 1X65A 4J9RA 2C22A 4XYLB 4JI4Q 3SGIA 4FU0A 2WKCA 2TMPA 3E0EA 5KG4A 2Z8LA 1VBGA 1N34Q 1ZKOA 2GPSA 4RGOS 4RCOA 2EYJA 5ELFA 2LY7A 4R8NA 2HQLA 4YCUA 4YCVA 5CV5A 4DV6L 4K5XA 2EZVA 2XGPA 1KAAA 2LS01 3N6XA 3FKIG 4ETSA 1QVCA 2UXDH 1RD9D 3X3NA 3V6JA 4ZCKA 1KHIA 1I94Q 2ZJQA 4WORA 4OWTB 2JA5B 2JSOA 4CDFC 3BVZA 2DNCA 1HR0Q 4LF7L 1HRJA 1M0WA 2R93A 5KEEA 3J7YW 4X64H 3SDZA 1OXTA 3SK6A 5M5WB 2TSSA 1SNCA 1ET6A 3HGBA 2K03A 2ZJRA 2NU6B 1Y1WB 3TIGA 2CVRA 1SE8A 2E5LL 2N3SA 3BZDB 4DR6Q 5BPFA 3M9OB 2IMWP 5BN5A 2VUMA 1YEZA 2D62A 4A3FB 1EUJA 3Q8PB 2R92B 2PYKA 1E3PA 5C6AA 3HOUH 1G8ZD 1HNWQ 4OO1I 2R93H 3GTGA 4XQQA 4C1NK 5JPNC 2GVBA 2NUAB 1V43A 3N8DA 3KUPA 4JV5H 1VQOA 4H02A 2LSSA 4R1JA 5EWFA 1IXRA 3RB4A 2JA6G 1Z2NX 4A2AA 4OWXB 2PW7A 4A4IA 3W1GA 5CV8A 3J80c 3BQ1A 1LTID 4RMFA 4EEYA 4JI0H 5ELNA 1E2ZA 1UWVA 4K2LA 5COYA 3CU7A 3KHLA 2VUMH 1HQRD 4RUAA 2PZTA 3OMGA 4DV6Q 3GD7A 1JKJB 1R9TH 2F0IA 5E7NA 5C5LA 4JYAL 4I7ZC 2A6HD 4A3EB 4RKLA 1JWMD 4KK7A 1WCMB 1HA5A 4DR4L 4A3IG 2VQFH 2I5HA 5I2YA 4PV1C 4I7AA 2R84A 1JB7A 3MEFA 2ZDGA 2LFNA 5CA0F 2ASBA 1ESRA 5J2UF 5KFPA 2VQEL 4RGNA 3IG0A 2Z6BA 4AQYQ 5EOYA 4LFCL 3VYSA 1M8AA 1STNA 1WYDA 4A3JB 3RFCA 4CKEA 4ZK9B 2E5LQ 4J9NA 2VPSA 2AGPA 3K7AB 4DV4L 3G48A 1I4XA 4APVA 1VQ6A 3VA7A 5FO9B 2MFIA 1Y8PB 2JA5A 1A62A 2RKSA 2CWAA 4KD4A 3DHQA 5T1IA 4DK1A 3DWAA 4A3KB 1PFNA 3PR5B 4DNTB 2K1BA 1H9KA 2W7OA 1X9NA 5DG7A 2BQ3A 1S10A 5KFHA 2W8KA 2PN1A 4LH7A 4EFBA 1M0TA 2NTSA 3PO2B 1ZHSA 1HNZL 5CYUA 1D1KA 5E1FA 1B8AA 1U4MA 4JI8L 1Y1VB 5C4ZA 1I7NA 5KFBA 4DUYH 3S2HB 2B63B 3PW7A 4IPGA 2YYAA 4RZQA 1H9SB 4JYAQ 3RNUA 5LMUH 4Q8FA 4XYQA 1KQSA 1E22A 1X6OA 2JA6B 2JA7B 1PH9A 2QDBA 3MFGA 1II3A 5M3FG 4DL3A 1I6UA 4L5SA 1C30A 4A3FH 2VQEQ 4IRKA 1OTCA 5EQ0A 5L37A 4PWQA 4LFCQ 5IGDA 3K5LA 5EPJA 4MHEA 4CC6A 3S1RH 4F50A 3P75A 5C4XG 3PMFA 4DV4Q 3KF6B 2I46A 2OWOA 3C46A 1B04A 3Q1KA 1E1TA 1SN8A 4PMWA 3PIO3 1K8AC 3KLSX 1L0YB 1MIUA 3PW4A 1EEID 1RK6A 4J9KA 5GAEC 3PW2A 3D6CA 5IODA 3CCJA 4R8UB 3J80L 1EY6A 1PZJD 4FXKC 2MNAA 5C3WA 2E2JB 1LM0A 3GTLA 1Q3LA 5E4WC 3JAMi 1M6VA 3OTOL 3DEPA 2X6LA 1VDZA 3FKIA 1HNZQ 1I5FA 3OUZA 1E7ZA 3KTMA 4JI8Q 2AWOA 3PUXA 5JOBA 3GTMB 1NE3A 2WV6D 5KT5A 4PNYA 4DV1H 4GC7A 2MGSA 1I4HA 2C00A 4O4HF 5KFVA 2H4OA 2Z1CA 4HCEA 1TY2A 1X54A 2OTJA 3GTLH 5A2QE 1PMRA 4YY3L 3H91A 4IZOA 2HHHH 1STEA 5IGFA 3FKIH 3H6MA 2K04A 5TSSA 2HVRA 3K7AH 3S15H 1Y1VA 2UUAH 1I3QB 2B63A 3R2TA 5KNDA 1C0AA 4TV8F 3M85A 1Z2PX 5C44B 4JI2L 2DN8A 3MXUA 1H9SA 4LF5L 3T5HA 3P1HA 5KFMA 3IFDA 4UP9A 2F0JA 3C3LA 1YVCA 5JEAG 1SYFA 5I9OA 5I6YA 3UE1A 3PIPA 3GTKB 3QFFA 3CAMA 4QB4A 2JA6A 3BQ0A 2BH8A 5KFNA 1UE5A 2GN5A 4G7ZC 1JCKB 2KOLA 4Q5VA 1EIHA 1U9RA 4OGQC 2X69A 1EUCB 1WFQA 3OTOQ 2B39A 4YIJA 5HGQA 3QB3A 1SAPA 1YNJD 4DK0A 1EOVA 2D0PA 3AB9A 3A56A 2F0DA 4IO9A 3ERSX 1U4PA 2UUCH 1N8RC 2E2DC 2KECA 1QNKA 2A6ED 1ASYA 2FPIB 2C2DA 2FB9A 2EYLA 1VCIA 3CW2C 2JA6H 3HFZB 1AN8A 3U9OA 2ASDA 1M4VA 1G2TA 4ECUA 3WWVA 1V1QA 2I07B 2F3VA 2CH4W 2LXJA 3U4ZA 4O2BF 1YIJA 1B33N 5KT6A 2XIGA 4YY3Q 4UCRA 1UE6A 1PRTB 4LF7H 3FEWX 4RH6A 3J7A5 3D8GA 1EYCA 2OF1A 1CHPD 4XDXA 2C2RA 4DUZL 3GTMA 5LL6X 1L2FA 3OIQA 4HCSA 1H9JA 3E6ZX 4QW9A 1OXUA 3I4MG 3NELA 3PVXA 3GTJB 4JI2Q 4CDEC 3VDYA 4A3IH 4C5BA 2JA9A 1PH8A 5KFDA 4F4WA 1D2BA 2VR1A 4NKLA 3S14B 2M2LA 2BA0A 4J9MA 4ABNA 3PW5A 5JQWA 2BR0A 1EY9A 2Y0SG 4O4IF 5JVH3 1Z6HA 4ZQ3A 1KJQA 1DV1A 3ULJA 2L1BA 5IIFA 1PRTF 1I6HB 1LTRD 1Q8KA 4AH6A 4A3LG 4XYMB 1I3QA 1BOSA 1IBLL 3TQTA 1SYXB 3AU7A 3FPPA 3H94A 3C2PA 4K5WA 1SSOA 4IUNA 1RJPA 4ZQIA 4ED2A 1UAPA 1YBYA 3SK8A 1HNXL 4EGQA 1PTOH 3NBHA 1BBUA 2K05A 2DLNA 4PQXA 2GPWA 2MQHA 4HN7A 2C2EA 2WFWA 2J0TD 2R3ZA 1QILA 1ILPA 3HOYB 4EBDA 1O7ZA 3J81i 4JYAH 4XTCS 4QUCA 4DV2L 1QVGA 3KXYT 1FYCA 1N32L 1I3QH 5ELOA 1ENCA 4WD3A 4DR4H 4ZHQF 1LACA 3EJIA 1KBLA 4HR7B 2EDGA 5ISRA 2ZDQA 4DR5H 2VQEH 3TP5A 2FKLA 3K80C 4DUZQ 2VL6A 4RNMA 2R87A 3OHXC 1MI2A 1UC8A 4UCUA 3CMEA 4FS1A 4BA1I 1JJ2A 4IRCA 1A15A 4RNOA 2KJXA 1STAA 4DR1H 2VXWA 1B9NA 2W71A 4DXGA 4XYOA 5M3FH 1JT8A 1CZGA 1A2TA 1VQEA 2PI2A 3P20A 2HVSA 1PTOC 4R4CA 4ZUIA 5DM63 3I56A 2EE1A 2V9WA 1IBKL 1JOQA 2CQOA 4HEDA 2L11A 1MSHA 4YHHL 2QK4A 1IKLA 5C4XH 5NUCA 3LX0A 5CA1F 1RDPD 1IBLQ 5FOBB 5C3EB 1I50H 5KYIA 2JEFA 5KNCA 3S17H 4DAPA 3BJYA 3GTJA 4LF6L 1GOZA 4UPAA 1HNXQ 1B6SA 1HNZH 2BOSA 4FXGC 1ML0D 1XMQL 4KHPH 4ME3A 5DNFA 3RJ0A 1QJOA 3UI2A 2EXZA 2K01A 4CC5A 2OLSA 2C35B 2KENA 5KT3A 1TS2A 1IKMA 2HJWA 3EYYA 4HJ7A 4YQWA 3HS0C 3ONAB 5KT4A 5FLXL 3RMHA 4DV2Q 4LMQD 1N32Q 2ZJPA 4KTAA 1ET9A 1D7QA 1GUSA 5L1KA 2CQYA 5D1OB 4NB3A 3KHGA 5GONF 2W8LA 2D0OA 4ALPA 4DGZA 4QQBX 1OWTA 4IUQA 3S14H 4HMJA 3AMUA 4C1NI 4C2MA 4MA5A 3GV6A 4RAZA 1M90C 2F52A 1CE8A 3T51B 1NMGA 3FDSA 5GAHC 4X62L 1LTBD 1PYBA 3IFTA 3FMCA 3URYA 4N8X1 5C3XA 1K1SA 4QY7A 1EQTA 4Q0YA 2JEIA 5GQOA 3WOEA 3HKZE 1IBKQ 2ZJTA 3OHAA 1B44D 4HR7A 1XNRL 4J9LA 1J9OA 3R5XA 4YHHQ 5EPKA 5CMDA 5JEAH 4C2MH 2YS7A 4TKOB 1PYWD 2Q2UA 3H0GG 2OH2A 1S0OA 4CKCA 1XMQQ 4LUVA 3F2BA 3V2TA 5EBCA 2E2IB 3S2DB 5KFRA 1NMFA 1QE6A 5CB4F 1J5EH 5HBRB 1H9MA 3RZDH 4LUZA 3G6XA 4LFBH 5KFIA 1KRTA 1RJQA 1IBMH 1S03G 1LYLA 4DU9A 4KMUC 1TWAA 3H15A 1SNDA 1AP0A 2J9GA 3CD6A 2JK8A 2PZWA 3OYYA 1GVPA 4GLVB 3G71A 2JYOA 1MJEA 4BBSG 4Q44A 5DQHA 1I4RA 5DLGA 3HOZG 2V4RA 1K0RA 3BG5A 4ECRA 2EXDA 3BYYB 3T5JA 4GLXA 2XRSD 3RUZA 5JEAJ 2FK1A 3TBIB 2VY3A 2B2YA 3JZIA 1CQIB 3HOXB 4FF2A 3KHHA 3DWQA 1VKZA 2WB1E 4LF5H 2MCTA 1ZXTA 4XIGS 4QWAA 1WOCA 4L5QA 1TWAH 2EQSA 4KKTA 5C8YF 4JBMA 3HXLA 3KF8B 1O80A 1X55A 4JPBW 1PH6A 5D1OA 3I4MH 1ZETA 3K5NA 3GTOB 4IR9A 4C56C 5H80A 3R23A 2K5VA 2L9HA 3PIP3 1F2MA 3SHLA 4O3QA 3QWNA 1EY0A 2YYZA 3CC2A 1HXYD 4IJHA 3J80W 5I6WA 3PF5A 3CHBD 1K3RA 5F9LA 3MFHA 3NBIA 2I8CA 4V0BA 2F0QA 3M4OB 1XXGA 5LL6S 1QUQB 2NZHA 4A3LH 1S5BD 4RB0A 1RYRA 3K0YA 2CHBD 3U50C 2J4XA 3PR4A 4GZYC 3DF7A 2RCNA 2F0TA 2NBFA 4ECQA 3RLFA 2HDMA 1FKAH 4JI3L 3R5FA 4IN3A 4G3IA 2HGSA 4TQSA 3ND8A 3A0JA 1C4QA 4P2CB 3PV0A 2B2TA 4UAIA 5FK9C 1SNOA 1UE7A 4ECSA 1KABA 5DG8A 2E2IA 4K0KL 1CT1D 2F0WA 4KN7C 3F2DA 1QB5D 4A3DB 1ENFA 2C9OA 5IYDG 1L1OB 4O3SA 3S9WA 1DOMA 2UU9L 3M4YA 4MNOA 5I9PA 2PNRC 1WI5A 1VQPA 1ENAA 1HPCA 4IOCA 3HG9A 1CS0A 4GN3B 3TQ1A 3V6KA 1EYDA 2FLLA 1CK1A 3BYTB 3S2DH 4GOPC 5AFWA 3MA2B 2IBKA 1PH7A 4JBJA 5FLMG 3J81j 3T5KA 1IYUA 4WRDA 2F3WA 1HNXH 2OT2A 3BDCA 1PTOD 5K36G 4TVAB 2B2UA 2FJZA 3F2CA 2CW0D 2K75A 3Q8QB 2JA5G 4KI0A 3GTPB 4N8FA 3KF8A 3M4IA 3GILA 2MHVA 3F1ZA 2C5CA 2YTVA 4NXML 2ASJA 3GTOA 3JAME 3D6WA 2R61A 2O4XA 3NK9A 2KCTA 4JI3Q 3PO3B 1S5FD 1Y1WG 2YW2A 3VPCA 4ECTA 3T5LA 1N32H 2XSCA 4XQJA 3M7NA 3HOXH 3NHHA 5FPOA 4M8AA 3ETJA 2R92G 3E9IA 2EY2A 3OOCA 4HSVA 2J7ZA 4CGYB 4K0KQ 1T36A 3NQIA 1QUQA 2UVRA 1OXSC 1JE4A 2AQ1B 1EHIA 5KFTA 1FR3A 4M1UB 4BBRB 1HR0L 1RJRA 3D3RA 3MR5A 1DOKA 1PFSA 2MUYA 5M3MG 4A3MG 3GTOH 1JXLA 1DYQA 1SMYD 1A8VA 2UU9Q 1I4PA 1X56A 4GKJL 2W6NA 3GV8B 5LP6F 4KY5A 1PZKD 3GQBA 4B3SL 1UC9A 4A75A 1KD1C 1IBKH 1SROA 4HNUA 3WOFA 3H0GA 4B3RH 2WAQE 1CUKA 5EJWA 4MV4A 1U4LA 1EQRA 1V9PA 2M00A 3LGJA 3MXPA 1TQOA 1T94A 4QWEA 2QA4A 1HNWL 1MHWC 3D4RA 3IL8A 1L1OA 1Q90A 4LF6H 3I4NB 2OCEA 4A3EG 1K0SA 4K6DA 5C1PA 3CP0A 2CZGA 1WCMG 2N8NA 4TQUS 2CQAA 4JV0A 4FS2A 5KRUA 2ZXRA 1JICA 2F0HA 1BGWA 1Q12A 1L0WA 3A7AB 3H0GH 4CHTB 5KKNB 4NXMQ 1KNEA 1BBXC 1D1IA 1B2TA 4DL7A 4A3JG 1S68A 3OSNA 4ZRZA 1HZAA 1GUGA 2AQ3B 4R9WA 2PMZB 2K33A 1FJGQ 1JDBB 1KNAA 1RTNA 3BZCA 3VMMA 3EPGA 3H09A 1P16A 1WTRA 5BPHA 1SFOA 1BCPC 2SDFA 1DM0B 3A55A 1IL8A 2FE3A 3I55A 3GTPA 1W6JA 2UVUA 3VYRA 4F87A 2KEDA 4IUPA 5C1OA 2E74C 3H3VH 4BBSH 4A3KG 4X62H 1EYAA 1K3BC 3TP7A 3SXHA 2YZMA 3HOZH 4FM9A 4AQYL 2X6GA 4GKJQ 4A3BB 3CCMA 1NR2A 1CA6A 3TS2A 1XPUA 3PO2G 4KY6A 4B3SQ 3M9BA 3T1YL 1G6PA 3W3AA 1AUXA 4KY7A 1Y1VG 5JJIA 2IP4A 4XT3B 4IPDA 2J6UA 1YNJC 1XNRH 2B63G 1N36H 1WTVA 3J7AF 3QOJA 1SFOH 1X3EA 4EX5A 1BF4A 3GTPH 3KOJA 2A6EC 1DOLA 5KFJA 2RHSB 1XMOH 1ZYRD 3ERQA 3M7GA 2RCFA 3KDFB 5M3MB 3IN5A 4A3MB 1B7YB 5E4XA 1KC8C 3E3XA 1FGUA 5JH7F 2W6ZA 2JA7G 2AKWB 4DAYB 2F0GA 1DIKA 2R7KA 2K52A 4J15A 3SE0A 1E4GT 3R5HA 5T14A 1W2BA 2NVXA 2HUGA 3D4WA 4AYBE 2PQEA 4FF4A 3TRZA 3H4BA 2F0MA 1W6KA 3W5OA 4JI1L 2ZM6L 4I55F 3BU2A 4EQ5A 1GGOA 2HIXA 3CRKC 4B3TL 1WR2A 3GIPA 3QG1A 5FLXW 1ASZA 4YJ3F 3GTGH 2V1CC 4JG2A 2WINB 3ORQA 2FP4B 3FDTA 3NSWA 3RD4A 1JIHA 2MJ8A 2ZTDA 4HIKA 2WTFA 2NVYB 3S1MH 4GC6A 4DV7L 4DPGA 5BN3A 3J81E 3S1QB 1VQAA 5IGGA 4A93G 5FD6A 2RVLA 2AQ2B 4X66H 3MR3A 4NPSA 2NVXH 3CKIB 5KFLA 3CVZA 2P0AA 2WYOA 2DY7A 2M9VA 2FK2A 3CCRA 1XTCD 3OIPA 1QWYA 3T1YQ 3WNZA 1V8QA 3CPFA 2EY6A 4KLKA 2PMZA 1HJPA 1LTLA 5IYDH 1EUDB 3WDNA 4ULLA 4ECYA 4R8IA 1WTQA 2VA3A 4ODGA 3RBDA 2RDGA 3Q8SB 3EROA 1LLRD 3I8ZA 2RGVA 3BVMA 5IGEA 4L5RC 1TU2B 2YV5A 2YCHA 1EQQA 1RF2D 2ICEC 4ED0A 5DAUA 2N49A 1Y1WA 5CBAE 3OW7A 3HRZC 4QJFA 3SE7A 3BQ2A 4KD3A 5FLMH 4YBZB 2NVTB 3PQIA 3ITPA 2Q2IA 2R92A 2BQUA 2ZM6Q 5K36H 2K5DA 3M4QA 3NWSA 4JI1Q 4JI3H 5C44G 2DWCA 2JA5H 4B3TQ 2IY5B 5C4HA 1C7YA 4OONA 4F4YA 2EJMA 5M5WH 1HHVA 1H95A 4QWCA 3T16A 1Q86C 4JI6L 4K0KH 3CCLA 4DAYA 1Y1WH 1BQQT 1PLFA 1ZHQA 4FXDA 1A3VA 4DV7Q 3J7AK 2F1MA 1VQHA 2F3IA 1WD0A 3RZOB 2A69D 1PH3A 2R92H 3CC7A 2ALYB 2ASLA 3ULPA 4OX9L 3MWMA 5FKAC 1G6ZA 4EBEA 2PW5A 1PV4A 1KIXA 1HA6A 1WTWA 3B6YA 5I4DA 4PG3A 5M3MH 3A74A 4A3MH 1WCMA 1DD2A 2EJFC 4GS3A 3JSNA 2IJ0A 2NVYA 5C4JB 2FINB 1V1OA 2CH4A 2EY1A 1TVXA 5A35A 1S0MA 1OXVA 1SXTA 5GAGC 3CMAA 4A93B 4ED8A 2K50A 4DK6C 2VB3X 4FBTA 3GTQB 4JI4H 1I7LA 1IW7D 1EEFD 1VQIA 4F7XA 1XPRA 5KG5A 1CQFA 4XZ3B 1KJ8A 4RB1A 1AH9A 1N34H 4ILWA 4JBWA 2VS1A 2JA8B 2B29A 2Z0SA 1HTLD 3I3CA 4A3EH 3JC66 2K5HA 4O3PA 3GIKA 1PA6A 2W6QA 5EDWA 1WCMH 2CWPA 2CKZB 4UCOA 2W9AA 2NVYH 1Q7YC 4LWCA 3L4KA 5H1SE 4LFAL 3N42B 4UFZA 5IWAL 5HGTA 1ESFA 5IT9c 2DJFC 1I94H 2R85A 2IHFA 2Y0SE 4IUTA 3CCUA 1G51A 4JI6Q 4DV5L 4DF7A 4A3JH 5D1PA 1B9MA 1HR0H 1VQBA 1K1QA 2CW7A 4FF3A 3S1NB 1RODA 1LTTD 3BA9A 2KBNA 4JI7L 5KIXA 1N9WA 3CQZB 2FLPA 4ZLTF 4GKJH 1A6XA 2QGQA 3LWEA 3Q6SA 4OX9Q 5M5YB 3ND9A 5LMNL 1WH2A 4DR6H 3I72A 1F2YA 4NXNL 1BCPD 4O42A 4ZKBB 3E0JA 4A3KH 4I7HA 2UXBL 1EFWA 2F0PA 3CC4A 1MZBA 2ALZA 2EOTA 4DR3L 3N43B 3HOYG 2XWJB 1X3PA 2JA7A 3PN1A 4RHRA 3PO2H 1HNWH 1NNXA 3VPBA 3BABA 2W6PA 3RAXA 2NVTH 1NCVA 2B3GA 1Y1VH 2D5DA 4CJ1B 3V4SA 3S2HH 2B63H 3UDXA 3GO5A 4BWSC 1L0XB 1SYGA 1KC7A 1S5ED 3H4DA 2ID0A 1DJRD 3DMUA 2R82A 1BBWA 4RB3C 2QILA 5IT9E 1FD7D 5IY0A 1UUPA 4EVOA 3KF6A 2NVQB 4IZ8A 4HJ5A 1GKHA 3ETHA 2R7ZB 1V1PB 4ZOLF 4DV6H 1SJED 1X32A 1PVOA 4PZ7A 1A0IA 3KALA 2JA7H 4EQPA 1VQCA 4EQOA 2SCUB 2A74C 4B3MQ 4R8UA 5EPLA 4LFAQ 4KHZA 5CORA 5IWAQ 3RZOH 3TP6A 2IX3A 4O1NA 1JORA 4Q45A 4JK1C 3Q22A 2XC9A 3GTQA 2YU9B 3J7ZC 1YNND 4AYBB 4DV5Q 2B8FA 1BDOA 1BXTA 5A2QL 1BNCA 5DGAA 3J7AV 4IUUA 4NDXA 2KHJA 1XDNA 4JI7Q 1CKOA 5C3EG 2SOBA 1HR0W 4AQYH 2LXKA 3PW0A 1AE2A 1PFBA 4G7OC 3UDIA 4QF4A 1CKNB 4J0MA 5LMNQ 3HOWB 2E5LH 5IYBG 4NXNQ 2H1EA 4A93H 3NEMA 1EL0A 4JOIA 3MWDA 5KG1A 3RB6A 3QZ8A 2E2JH 2UXBQ 1STHA 2W70A 3BDOA 4RGTA 1HFGA 2DIKA 4DR3Q 5FJ8G 2FLNA 3RLNA 3E9HA 1SLJA 3IKJA 3RTXA 4FF1A 2XIWA 2VPQA 3HEJA 1PK8A 3Q2OA 2Z6KA 5C5MA 4DL6A 5DLFA 3AYHB 1FL0A 2FPGB 1TWGB 4IURA 3Q0AA 3GTMH 2NTTA 4C3IB 4EGJA 2R7NA 1K83B 2B8GA 2Q8TA 2YL2A 1KLUD 3A5ZB 4PZ8A 2BDNA 1FNUA 4LF9L 1G91A 5J22A 1JB3A 5IT9L 3GTKA 1EY5A 1CFMA 2JQOA 2B2WA 4ED7A 1VQ7A 1TY0A 2F0OA 1WTXA 3S1NH 4V190 3Q8DA 1PH2A 5FO8B 1N33L 4R4OA 1Z47A 4QGUA 5M5YH 5C44H 4JBKA 4DV7H 1LUZA 2HCCA 2YTYA 4LF8L 1SYDA 1SCUB 1TS4A 1BR9A 3L0OA 2XNAC 3TZDA 1V1PA 2R7ZA 1IOWA 3GTKH 4I50F 4LFCH 3V05A 2KHSA 3HOVB 3DWPA 4MV9A 1EFID 1XX8A 3ZJYC 2CW8A 1E2WA 2W6OA 4DV4H 4E6IA 2G5DA 4C3HB 3RBEA 1KDCA 5FD5A 4JOIC 2CW0C 3KBGA 4ECWA 2IL8A 2LMCB 2OXPA 4B08A 3M3YB 2NVQH 3MXNB 4WFN3 1CKNA 3NENA 3J80i 4DFAA 4EYIB 4ECXA 3NPPA 5J3BA 4M9UA 4LF9Q 2UUBL 1GHKA 4JI8H 1GUTA 1TT2A 3VR3A 5KG6A 3R3OA 3CF5A 3HOXG 1JDEA 3GLKA 3K58A 2KVMA 4TSSA 2Z4IA 2YZGA 2R6GA 1IZ6A 2DGYA 3DM1A 4KJNA 2PNHA 1N33Q 2CFMA 4EEQA 3KYHC 2R6FA 5ELEA 1SMYC 3MR2A 3GTJH 1BJTA 4LF8Q 1PZID 3ZYYX 1YI2A 3SEBA 3H3VI 3CPWA 2R7FA 4UP7A 5EBDA 3QZ7A 3Q23A 1TAEA 1DCZA 5I2XA 2QW7A 1KJIA 2QCPX 1EU3A 4F8MA 2Z4HA 1I6HH 1STGA 3NXWA 4WJ4A 4DL2A 4JW0A 1AE3A 3MC0B 1PFMA 4HNVA 1K8OA 2UXDL 2SNSA 1S40A 4MZ9A 5IP9G 3IRBA 1M7JA 3G8CA 5ELBA 1PX2A 4YP3A 3OTOH 1JJGA 4X64L 3HOYH 1S97A 1B70B 4J6HA 5LYJF 4DN4M 1HUMA 2UUBQ 3KLSA 1VBHA 4A3DG 5T1GA 3QOLA 2VNUD 1SMXA 2NWGA 1TWHB 3OW2A 3TP8A 3H20A 1STYA 4IFDI 4O3OA 4GNXB 2F4VQ 5IE8A 4X3UA 1Z2OX 2DJGC 4J8QA 1Q82C 2YTXA 1PH5A 4JV1A 3MXNA 3RN2A 2JEBI 4YY3H 2L0CA 3VR4A 1RIPA 2VZAA 4NMZA 2VOBA 3T13A 5EZYF 4F88A 2DNEA 4DV0L 4JI7H 3D0FA 4ED3A 4C3HH 1STBA 2RDFA 4YCWA 3VR5A 1Q81C 1G291 1QZHA 5IGBA 5LMNH 4JI2H 2PO4A 5J1ZA 4NXNH 4MTEA 2ATLA 2XRQD 3W2DA 4MV3A 2RSNA 1LT5D 2RA4A 1ZYRC 3VR2A 4ED1A 5DGBA 1TIID 2I5LX 4K8JA 5C3EH 4RA8A 4DR3H 3PUWA 2E8GA 3TMEA 2A8VA 4R7RA 2UXDQ 4HIOA 1L2ZA 2NN6I 5IYBH 3MJFA 2P5ZX 2XCLA 3PO3G 3F8TA 3AFPA 3RGZA 5KG2A 4YAKB 2EYHA 2VQFL 3TIIA 4X64Q 5FJ8H 5JUMA 2EY5A 2JJQA 4OHJA 4X65L 2SEBD 3HB9A 3K3VA 2XGTA 1UEBA 3K5OA 4POFA 2AGOA 4BBRG 4IFDG 1MBYA 3HBLA 3RN5A 2G9DA 1C9OA 2DPJA 1B4OA 3EFXD 1YITA 2H5XA 4A3CG 1JMCA 1LV9A 4HSPA 5K2MA 3D31A 2UXCL 2O5IC 1H9RA 1JQYD 1V4YA 4J1MA 4O0AA 4I65A 1D5XC 4UHVA 3I90A 2FHTA 2V58A 1NR4A 1KDBA 2W9BB 2HVQA 3OSOA 1K28A 5LA6F 4L8JA 3F8NA 3JAMc 4DV0Q 4DUZH 1MGSA 3QR8A 4UCVA 3HP3A 4POGA 3R8BA 4U6PA 2ZTEA 2K7VA 4JI0Q 1M1KC 3I4NG 3ICEA 1E4EB 1TWHA 1LTGD 1A2UA 3HKZG 5CC4A 2QEXA 4GNXA 1RHPA 3EVQA 2B2YC 3M4PA 1A63A 4RHSA 3U9SA 5CR3A 5LMNW 2QF7A 1VQLA 1YJWA 4IUVA 2RDHA 3RGXA 2KUMA 5L1JA 5IOCA 2NN6G 5FPRA 2D9UA 3N41B 2XCPA 5F2DA 3EIVA 5CV4A 3T56B 2Q2TA 5LMUL 3M9NB 2ES2A 2QDLA 2K28A 5BR8L 4DR7L 1R4PB 1RTOA 2UXCH 4O2AF 2E2IH 3H40A 3A7LA 1IBLH 4TQRA 2VQFQ 2CCZA 3NTIA 3MZ5A 1TWHH 2AGQA 1KTKA 4HJ9A 4X65Q 4Q43A 5FO7B 1PHJA 1X3QA 2YZNA 4O2DA 3VPDA 3PIOA 2W57A 1HTPA 2B2VA 4Q0FA 4ME5A 1NTGA 2A68C 1NUCA 4IJLA 3BG3A 2F0SA 3NTHA 4CBVA 3UE0A 4DV2H 4A3BG 2UXCQ 1R4QB 2A69C 4X3TA 2KA7A 4YR0A 2IHEA 3MVVA 2EYOA 3BDLA 4PMCA 2JP1A 1FJGL 3MXGA 4LF8H 1D8LA 3SK5A 1I4QA 1QCBD 2ZXPA 2IT1A 1BO0A 2HIVA 2R7DA 4LJZC 4R4TA 3OSPA 2WB1G 4C5AA 2E76C 3HOUB 5A2QW 2B2TC 1J6QA 1HFNA 3N6RA 1GYFA 1B3AA 1ICWA 4ZKCB 2E2HB 4KKUA 1T5EA 3NWTA 4NW2A 3RR5A 4FYDA 2LKVA 4HQ6A 1WTHA 4DR2L 3K81C 4JI5L 3MWEA 1F2ZA 4APMA 1GO3E 3KJOA 5CV9A 2PQAB 1IW7C 1YJ9A 1T5XD 3N40P 2W9BA 1I6VC 5HURA 5LMUQ 1SNQA 2A5HA 5J2TF 5BR8Q 3M4OH 3HKSA 4DR7Q 4IPCA 5DQIA 4YHHH 2K6AA 1TR5A 1R9TB 4HIMA 2FMCA 1B53A 2HHHL 2ZT9C 5CGKA 4CJ0B 3G6JB 4HIDA 5JAVA 2O5JC 2NUCA 2O03A 3AQQA 4MV8A 1E2VA 5JVLA 3DM3A 4O4LF 4OWWB 2RSOA 1FGBD 1NBWA 3G6YA 3BS1A 3U9TA 5EKLA 3HKZB 1XMQH 2UUAL 1F2LA 1Y69U 5IP9H 4YR3A 3M9MB 3FMAA 1FVIA 1KRSA 2KCCA 3MAQA 2B2UC 2L5TA 5JPMC 1PRTD 2NU8B 5IT9W 1NAPA 3TREA 1B3QA 4OL7A 3L2PA 1LTSD 1SE2A 4XXEA 2C28A 3JAML 4A3DH 1CTMA 1KAWA 4Y8VB 5DG9A 4MV7A 1YHBA 5HY6A 5M5XB 2JXMB 2OQ0A 1HZ9A 2WP8J 2MPMA 4DXFA 3ULLA 5G3LF 1MD2D 4K8IA 1VMCA 2RDJA 5LXTF 1BUVT 2UUCL 4K5VA 4P71A 4GLAC 4Y52H 4BY7G 4HYKA 3MWYW 2PCFB 1F9QA 3NUCA 4GN4B 4KJOA 2KEEA 3L3OC 4P74A 5JJZA 2JN4A 4DR2Q 4JI5Q 4G7HC 4LK1C 4BS9A 4DV1Q 2HCIA 2D2CC 2XCAA 1SE3A 3QJYA 4FBUA 1VS0A 2EJGC 4H7BA 2NZOA 4P75A 3J81c 5KFEA 1IOVA 4H13C 4EQNA 1Q8IA 1RKNA 1WTPA 5DQGA 1K73C 4F4XA 2WB1B 3OHBA 5C0XI 2HHHQ 2E2HA 3CCEA 3I7FA 4LAAA 3TEHB 2JEAI 4GKKL 4BWGB 3LNNA 3C1EA 2UUAQ 4N9PA 1HZBA 1L1OC 2AQ4A 3L4JA 3PO3H 1T9HA 2DUDA 4RZRA 3PSIA 2PQAA 1YHQA 2F0NA 4EFEA 1YNNC 3K8AA 4J9OA 2F0UA 2HQEA 1EWHA 2K5NA 2HD3A 1EYZA 1PH1A 3H3VC 4X6AH 1R9TA 2K14A 2KCNA 4BBRH 3S1RB 2FMMA 2E2HH 4IFDH 3R93A 2RBMA 3K7UC 1JOOA 3OWFA 3HKZA 4A3CH 2PPBC 1VF7A 4JUZA 1ZQ7A 4DV0H 3EBEA 4O3RA 1BVSA 1GUNA 2NU7B 2QYZA 3RB3A 3EQLC 1BNZA 2UUCQ 2PI2E 4QIWE 1O75A 4MTKA 1SEBD 4DLKA 1U4RA 1WD1A 5KFCA 4OXPA 1JJCB 1VQDA 2WAQG 2MP1A 3KLWA 3UQ8A 2JA8G 1UNSA 1LT4D 5KFFA 4TRDA 1GSOA 2ATWA 3I4NH 3ER0A 3VYTA 5KG3A 1X3FA 5C0XG 3G4SA 1HQMC 1WJJA 3T53B 1RK5A 4LF7Q 2NN6H 1DV2A 3PGZA 1SYEA 4IFDJ 2M05A 1JWSD 1RCVD 1S9FA 4IRDA 3MHBA 4GKKQ 4MA0A 4BY7B 1CM9A 4DR5L 2WIIB 4X65H 1K8MA 2K32A 3GTLB 4DL4A 4IWXA 1XYIA 1G2SA 1T3NA 1HCZA 2R86A 3JRWA 4DR1L 3FKIB 1E4FT 2FMAA 3T4AC 3S15B 4MIUA 1VQKA 2EYMA 4YWLA 3LWBA 5M5XH 3WO1A 4K2KA 1C8CA 4OO1G 3Q24A 2WB1A 5JVG3 3GIQA 5LOVF 3OWEB 3J80E 4HJAA 2PVPA 4L6TB 4LF4L 3KAKA 3FRPB 2DY8A 1O78A 1SJHD 3KDFA 5EAYA 3STBC 3NQTA 4IALA 2A68D 4A3BH 1IYVA 4Y7NB 4KHPL 4K14A 3N44B 1D5MC 4BY1G 1AW7A 4HJ8A 3CCSA 3JSLA 3J81L 2XGQA 4R4QA 2UU9H 2N78A 3V6HA 1LT3D 2EVBA 2BE5D 2ZDHA 1LABA 1A3UA 1NY4A 2KQ3A 5KT7A 2G9HD 2N88A 3PUYA 1VQ9A 4RKBA 1GM5A 3OMCA 2BDOA 2A19A 3HZXA 3TINA 5BR8H 1EY4A 4DR7H 2O2LD 2FXQA 2R7ZG 2VW9A 2SNMA 3TN2A 4DR4Q 3QIAA 4TUYF 2RDIA 5BN4A 1GUOA 2FPPB 2W6MA 2BA1A 1E0BA 4DR5Q 2Z9HA 5L9XA 3GIDA 1DONA 4AYBG 4X3SA 5D3IB 4RWSC 4A3GG 4PMBA 5DM73 1YZ6A 2WAQB 3MTSA 5I47A 3LWUA 4LH6A 3VR6A 1WVLA 4DR1Q 5HV6A 1Y14B 1BXRA 1V51A 1KL9A 4NXMH 2A73B 4B9WA 1XPOA 4N9TA 1CA5A 2MO0A 3NGDA 1CQVA 1SRUA 2GLTA 3HOWG 4LF4Q 4A3IB 4QUFA 4B3ML 3S1QH 4CKBA 1FJGH 3BZKA 2EPBA 3RF2A 1XNQL 5K5PA 4QWBA 4QCLA 1HUNA 2UVVA 1D5ZC 5L1IA 4J9QA 4JCVE 5KG0A 1TWFB 3KHRA 1ONLA 3TDQA 4KHPQ 2QKIC 5E3FA 1TA8A 3MR6A 4C3IG 4DR2H 1J5EL 4JI5H 2NB0A 1EOTA 4LFBL 1S5CD 2IWHA 4B3SH 1YJNA 1KDAA 1PTOB 1SE4A 3TZUA 1IBML 2R7LA 1ICFB 4IQZA 4BY7H 2L12A 3I70A 2WE6A 3QO2A 2F0KA 3LMLA 3DEOA 4QMGA 1Y8NB 3GIMA 4XX0B 1BKBA 2ENBA 2XN9C 3KK7A 1VQ5A 1AEXA 3G7LA 1AZPA 1TKWB 5EGTA 4BY1B 2HT1A 5KFZA 3GIJA 1XWEA 1IYJB 4IOAA 1JR0D 3SI8A 1NSNS 3I2ZA 4BXXG 1Q46A 4RAYA 3T1HL 3NTKA 3NBHB 2Q8IB 4NLGA 5KFYA 2R8HA 3MEHA 1MSGA 1PTOF 1QNUA 4YWMA 1JX4A 1WSCA 3HOVG 5GROA 4WBNF 4Y7NH 2XTIA 5M3FB 2OTLA 1AN7A 4DNRB 1F9PA 1XNQQ 4FO2A 4C3HG 1W93A 5IGCA 1W3SA 5DLQE 5KFOA 2WAQA 4A3GB 4LSAA 3FVQA 4MV1A 1VQ8A 3BA8A 2VA2A 2A1AA 3K0XA 5C4XB 2KSWA 1RL2A 4LSXA 3GIIA 4DA2A 3L9AX 3KJPA 1QZGA 2GVAA 1FNVA 1I50B 1J5EQ 4DV3L 1JWUD 3SK4A 3S17B 3FP9A 2I80A 3TSSA 4RGMA 5C4JH 1Q1BA 2FFKB 4LFBQ 4ZAIA 3RV3A 3T1YH 3E5SA 3UFXB 1IBMQ 4RCNA 2AUKA 3GV7B 4QIWB 2JE6I 3GTQH 1ILQA 1JLLB 1S3OA 1TWFA 2R8JA 3OUUA 2JA8H 5FLXc 3AEVA 4KV6A 1PH4A 5JJLA 4GKKH 3BJUA 3CQZA 5C0XH 4FVMA 4YB8B 2RGRA 1DGSA 4P73A 1FNWA 5KFSA 1OXXK 3T1HQ 3K5HA 4LF5Q 1B50A 2AHOB 3R2IA 1PYSB 4L1KA 3A8IE 1SEIA 2V4QA 1SR3A 4YWKA 5AJ3L 2L55A 2ZM6H 4JI1H 2I5MX 4B3TH 2NYZD 5GADC 4OIJA 4ZUJA 1TWFH 4UP8A 2KHIA 3EA6A 1VF5C 2V4DA 2I0QA 2R7MA 2V5AA 4IWYA 3JAMW 3BVGA 3IAYA 3CQZH 5KFXA 4CDCC 4YAJB 4OO1H 2DPIA 1YHAA 1VAJA 2OQKA 4EYHB 3TS0A 4KHVA 2Q2HA 2IX0A 5IYCG 2XD4A 2FJ2A 2F03A 4C2MB 4HAEA 4CJ2C 5C0XJ 3V4ZA 4DV3Q 1YNXA 4FP5D 4WJ3M 1E1OA 3NP8A 4EG0A 3CCVA 3FHWA 3STBD 5FLXE 5BMVF 3U58A 4FDBA 4O3NA 4MTDA 4UY8C 4DKAC 2Q8RE 1GUWA 4LUOA 4BY1H 2PZUA 5G3LD 2YU9A 1QOHA 1U5KA 4AYBA 3RZDB 1AFPA 1SNPA 1CSQA 1O7YA 4AIMA 3SVMA 4H44C 4DK3C 5EKIA 1VQGA 1EWIA 5CBEE 1CHQD 4UDUC 1I50A 3GV5B 5ELDA 2R7ZH 3I12A 2Z6KC 1LTAD 4HTHA 3RIZA 2R8KA 2HDLA 3PUVA 4QIWA 5AJ3Q 1SNMA 2YU9H 4A3GH 1KXLA 4MAMA 4LF4H 2F0LA 3G6EA 4KKSA 4B3RL 2K4KA 2F4VL 4QWDA 3GV3A 3EN2A 3E5NA 3PCOB 2B2WC 4C3JG 1TWAB 1TWGA 2NU9B 4JI6H 1K83A 4A76A 4G4KA 1EZ8A 3I4MB 3MFYA 5D65A 1EY7A 3P7JA 5IP7G 3HOWH 4UCTA 1S0NA 3D4DA 1N48A 2IPKD 5D3DA 5M9OA 4B9XA 5J39A 5KG7A 5DEHA 4PZ6A 4OX9H 4KN4C 2Y0SB 4BA2I 1JC7A 4E4TA 1PXUA 2EYPA 5KFQA 4MV6A 4J9SA 3ORRA 4UCSA 1TWGH 1AZQA 1SBBB 1VQFA 1X3GA 2EYFA 4C3IH 1F77A 2N55A 3N52A 1K83H 2GA4B 1S4ZA 1E24A 4LMYA 3G6VA 4GOPB 4OIKA 3RLOA 1O7LA 2F4IA 3KBXA 4DAVA 2R8GA 3CCQA 3F2UA 1PRTC 2YRWA 1EZ1A 4LW1A 2JEJA 1GSAA 2ICIA 2DZDA 5KFUA 4IPHA 1A3TA 5ELCA 2K5QA 2F0EA 1B6RA 1WTOA 3CRLC 5D14A 4ED6A 2V59A 4TV9F 1TXYA 4QW8A 3DUZA 2F0VA 4RG1A 1EIGA 2VB2X 4Q8EA 4BXXH 4IHJF 5IYZF 3C0FB 4B3MH 4B3RQ 4GN5A 1KJ9A 4LFAH 1N36L 1Y8OB 3K57A 5IWAH 2VUGA 1CSPA 2YRXA 1XNQH 2QEJC 4RFBA 1EIFA 1IHZA 4MTNA 3TQYA 2WKDA 4DV5H 3K3PA 1XMOL 3HOVH 1TWCB 4LF6Q 1LT6D 2AMCB 3PUZA 2L4NA 4X3KA 4JV5L 4EGVA 1OO9B 4I4TF 3FPUB 2WDTA 1MKHA 2PMZE 4FNFA 3S16B 1GD7A 4JI0L 4IR1A 1VQMA 3J81W 3DLLA 2W9CB 4YR2A 3MFIA 3K5MA 1KLGD 3M3YH 4C3JB 2UXBH 2MO1A 4HMIA 4DNIA 3K6OA 3RAQA 1EWCA 1S5DD 5CV6A 1TS5A 1CZWA 3KLRA 4LNQA 2AWNA 1XJVA 3KFUA 4M7EA 4L63B 4G57A 3DXJC 1D6EC 5KYLA 4EBCA 2Y0SA 4X66L 3A54A 3UDFA 3T1HH 3LP8A 4X62Q 4ZYSA 1ZEQX 3A8JE 3HOUG 4U68A 3A8KE 4PDBA 2W7PA 2R93G 2ZTCA 2FK3A 3GDEA 2KCMA 4GOPA 4MN3A 4JC0A 1XNRQ 3PZPA 1N36Q 2L15A 3VA5A 2I87A 1K9MC 1UE1A 3BAAA 1EYGA 1JOKA 1XMOQ 1S72A 4RB2C 4JV2A 2EIFA 4WJWA 1BCPB 2VUMG 3K5IA 2WACA 5KT2A 5KX5F 3L7ZC 4XT1B 4JV5Q 1EZ6A 1AUVA 1CKMA 3NE5B 1GJXA 1RYSA 2AUJD 3GP7A 2A6HC 1EU4A 2ZXOA 4DV3H 1VQ4A 3I73A 3UDGA 1UNNC 2OEOA 2RHQB 4ID6A 4DUYL 1XTDA 2XVSA 1Z7TA 1PDQA 4RUCA 5IYCH 1GXDC 3RV4A 5CAEB 3WO0A 2IA6A 1TWCA 3GQCA 5KNBA 3H0GB 1HH2P 2XWBB 4QL5A 4R4IA 3AFQA 3I91A 3C1FA 1BCPF 2R8IA 1EIYB 1DXMA 1J8IA 3OPOA 4S3SA 1LO5D 4X66Q 1HZCA 2YS6A 5JVDF 4OELB 1SYCA 2W9CA 2J6SA 4H0LC 3SR1A 5KFGA 4LF9H 5KFWA 4RNNA 4IAJA 5EWEA 2BH2A 5KGUA 5LL6b 3KAJA 1TWCH 4BBSB 4F4ZA 3I4LA 3Q8RB 1UEAB 3HOZB 1Q1EA 3I4OA 1QVFA 4ME6A 2UVWA 1N33H 2RF4A 4DL5A 5EWGA 4K6LA 1JE5A 2K5WA 3S16H 4J9PA 1QG7A 1O7IA 3EPIA 1GHJA 1VQJA 2BE5C 1IL2A 5F9NA 3O13A 4JI4L 1CI3M 1SFOB 4RU9A 5LHY1 4L5TA 2VQDA 4C3JH 1A9XA 4HNTA 1U0LA 1N34L 1B1ZA 4OEMB 1K8GA 1RJTA 4C5CA 5C5JA 1EQVA 2R93B 2RQXA 1GLVA 1GSHA 2X0SA 1P8LA 5IP7H 1KEEA 3RB0A 4DUYQ
chains in the Genus database with same CATH topology
4P72A 4YHHQ 4DR1L 3S24A 4DV1L 4GNXC 2KHJA 3A5UA 4C2MH 4JI7Q 1CKOA 5C3EG 1HR0W 1MJCA 1VQKA 2LXKA 4A3FG 4YWLA 2Q2UA 1AE2A 5M5XH 3H0GG 1I94L 3UDIA 4OO1G 1CKNB 5LMNQ 4HJAA 1XMQQ 4LUVA 5IYBG 3F2BA 4LF4L 4NXNQ 4DAMA 4A93H 3NEMA 1NMFA 4JOIA 2IX1A 3KDFA 5EAYA 2E2JH 3RZDH 2UXBQ 4LUZA 3STBC 4DR3Q 1NJIC 5FJ8G 3RLNA 4A3BH 1KRTA 1VQNA 3E9HA 1LYLA 1SLJA 3CXCA 3PF4A 2Z6KA 3H15A 3AYHB 4KHPL 1FL0A 4BY1G 4HJ8A 2JK8A 3CD6A 3CCSA 4DR6L 3OYYA 1GVPA 4GLVB 3G71A 3GTMH 1MJEA 4BBSG 5JJKA 4R4QA 2N78A 1Z9FA 3HOZG 1NY4A 1K0RA 3A5ZB 2EXDA 4PZ8A 4GLXA 3U4VA 3PUYA 4LF9L 5JEAJ 1VQ9A 1GM5A 3W1BA 2VY3A 2A19A 1X65A 2FXQA 2JQOA 2R7ZG 2VW9A 4JI4Q 3SGIA 2WB1E 1VQ7A 4DR4Q 3E0EA 3S1NH 3Q8DA 4XIGS 1PH2A 1WOCA 4L5QA 1TWAH 2EQSA 1N34Q 4JBMA 1N33L 2BA1A 3KF8B 4DR5Q 1X55A 4R4OA 1Z47A 4QGUA 1PH6A 4AYBG 3I4MH 5M5YH 5C44H 4JBKA 4A3GG 1YZ6A 2HQLA 4YCUA 1LUZA 4YCVA 2YTYA 4DV6L 4LF8L 2K5VA 4DR1Q 1Y14B 3FKIG 2YYZA 3L0OA 1KL9A 4IJHA 3CC2A 1QVCA 1XPOA 3PF5A 3GTKH 2MO0A 1KHIA 1K3RA 1I94Q 1SRUA 2ZJQA 3ZJYC 4OWTB 3HOWG 4LF4Q 4B3ML 3S1QH 1QUQB 2NZHA 1HR0Q 4LF7L 4A3LH 3BZKA 1XNQL 3U50C 1OXTA 4JOIC 2RCNA 4JCVE 3RLFA 2ZJRA 4JI3L 4KHPQ 1SE8A 2E5LL 2N3SA 2NVQH 4DR6Q 3MXNB 1YEZA 2D62A 3A0JA 1EUJA 3PV0A 1J5EL 1CKNA 1UE7A 3NENA 3J80i 1E3PA 4LFBL 3HOUH 5J3BA 4K0KL 1YJNA 4LF9Q 2UUBL 1IBML 1HNWQ 4OO1I 3F2DA 2R93H 4BY7H 3CF5A 5IYDG 1L1OB 2GVBA 1A63A 1V43A 3HOXG 1VQOA 4H02A 2LSSA 4R1JA 1IXRA 1BKBA 2R6GA 2UU9L 1IZ6A 2DGYA 4OWXB 1VQ5A 2PNHA 2JA6G 4A4IA 3W1GA 4MNOA 3J80c 1N33Q 2CFMA 1WI5A 4RMFA 2HT1A 5ELNA 1VQPA 4DR7Q 1UWVA 3KYHC 2VUMH 1IYJB 4IOCA 4IOAA 3I2ZA 3GTJH 4GN3B 4LF8Q 1Q46A 4BXXG 4DV6Q 1YI2A 3GD7A 3T1HL 1R9TH 3H3VI 3CPWA 3S2DH 4GOPC 2R7FA 3NBHB 5E7NA 4UP7A 4JBJA 1PH7A 4JYAL 5FLMG 3J81j 4YWMA 3HOVG 5GROA 4TVAB 5K36G 3F2CA 4DR4L 2K75A 4A3IG 2JA5G 2I5HA 4KI0A 4Y7NH 2XTIA 1I6HH 2OTLA 1JB7A 3MEFA 4WJ4A 1XNQQ 2ASBA 1AE3A 3F1ZA 1W3SA 5DLQE 2VQEL 2YTVA 4AQYQ 4NXML 2UXDL 4LFCL 1S40A 4MZ9A 1VQ8A 2KCTA 1WYDA 5IP9G 4JI3Q 1Y1WG 3IRBA 2A1AA 2E5LQ 3K0XA 1RL2A 3M7NA 4DV4L 3KJPA 3HOXH 1QZGA 2GVAA 3G48A 1JJGA 4APVA 1J5EQ 4DV3L 1VQ6A 2R92G 4X64L 3HOYH 3FP9A 3E9IA 1B70B 2MFIA 1Q1BA 5C4JH 4LFBQ 1A62A 4K0KQ 1QUQA 1OXSC 2UUBQ 2CWAA 1IBMQ 1HR0L 4A3DG 3GTQH 2JE6I 2VNUD 1X9NA 1SMXA 1PFSA 1S3OA 5M3MG 3OW2A 4A3MG 3GTOH 2UU9Q 4IFDI 1A8VA 4GNXB 1X56A 5IE8A 2F4VQ 4GKJL 2JA8H 5FLXc 2YTXA 1Q82C 1PH5A 1PH4A 3AEVA 5JJLA 1HNZL 4B3SL 4A75A 1KD1C 3BJUA 3RN2A 2JEBI 1B8AA 4JI8L 1SROA 1DGSA 1RIPA 2VZAA 2WAQE 4P73A 1CUKA 1EQRA 1V9PA 3LGJA 4IPGA 1OXXK 3T1HQ 4LF5Q 1XNRL 4DV0L 2AHOB 3D0FA 1PYSB 2QA4A 4JYAQ 3RNUA 1HNWL 1SR3A 4C3HH 1L1OA 4YWKA 5AJ3L 4YCWA 2OCEA 4A3EG 1G291 1Q81C 2I5MX 1QZHA 1KQSA 1E22A 1X6OA 3CP0A 5GADC 1WCMG 2N8NA 1TWFH 4TQUS 4UP8A 1PH9A 2KHIA 5M3FG 4L5SA 2I0QA 2I5LX 1Q12A 5C3EH 1L0WA 4A3FH 3CQZH 2VQEQ 3H0GH 1OTCA 3PUWA 2E8GA 2A8VA 4NXMQ 2UXDQ 4HIOA 4LFCQ 1YHAA 2NN6I 2OQKA 5IYBH 4A3JG 3TS0A 3F8TA 3PO3G 3AFPA 3S1RH 1HZAA 2Q2HA 2IX0A 5IYCG 5C4XG 2VQFL 4DV4Q 3KF6B 5C0XJ 2OWOA 1FJGQ 1E1TA 4DV3Q 3BZCA 1SN8A 1YNXA 4PMWA 5FJ8H 4X64Q 1K8AC 1E1OA 4WJ3M 1P16A 3CCVA 2JJQA 3FHWA 3STBD 1MIUA 4X65L 3U58A 2XGTA 4FDBA 1UEBA 3I55A 5GAEC 4UY8C 4DKAC 4LUOA 4POFA 3CCJA 4BBRG 2MNAA 4BY1H 4IFDG 1U5KA 3H3VH 4A3KG 4BBSH 1LM0A 3RN5A 3JAMi 1C9OA 1CSQA 1YITA 4AIMA 2H5XA 3OTOL 4AQYL 1JMCA 3HOZH 4DK3C 4A3CG 4GKJQ 3D31A 3CCMA 2UXCL 3TS2A 3PO2G 1XPUA 1VQGA 1EWIA 1HNZQ 4B3SQ 1I5FA 3M9BA 3T1YL 1E7ZA 4O0AA 1G6PA 4JI8Q 2AWOA 3PUXA 2R7ZH 1Y1VG 5JJIA 4IPDA 2Z6KC 2B63G 1NE3A 1SFOH 1X3EA 4EX5A 3JAMc 3GTPH 3KOJA 4DV0Q 2RHSB 3PUVA 5AJ3Q 4POGA 2ZTEA 2YU9H 1X54A 1M1KC 4JI0Q 3I4NG 3ICEA 3KDFB 3GTLH 4A3GH 2OTJA 1KXLA 3HKZG 4YY3L 2QEXA 1B7YB 4GNXA 1KC8C 1FGUA 3M4PA 3G6EA 4B3RL 2K4KA 2AKWB 4DAYB 2F4VL 2JA7G 3EN2A 5LMNW 1VQLA 2K52A 3PCOB 3FKIH 4J15A 1YJWA 2NN6G 3K7AH 1W2BA 3S15H 4AYBE 3EIVA 4A76A 3TRZA 2Q2TA 5LMUL 1C0AA 3W5OA 2ZM6L 3M85A 4JI1L 2ES2A 5IP7G 3BU2A 5BR8L 3HOWH 4DR7L 4EQ5A 4JI2L 2HIXA 2E2IH 4B3TL 4LF5L 2VQFQ 4UP9A 1ASZA 1YVCA 2V1CC 5JEAG 4JG2A 2CCZA 3GTGH 4PZ6A 3UE1A 3PIPA 1TWHH 3CAMA 4HJ9A 4X65Q 4BA2I 2ZTDA 1PHJA 4O2DA 4HIKA 3S1MH 2BH8A 3PIOA 1UE5A 2GN5A 4DPGA 4DV7L 1VQAA 4A93G 1TWGH 1NTGA 1VQFA 1X3GA 4NPSA 2NVXH 4C3IH 1K83H 1WFQA 4IJLA 1E24A 3OTOQ 5HGQA 4GOPB 3RLOA 3CCRA 3UE0A 4A3BG 2UXCQ 1EOVA 2D0PA 3CCQA 4IO9A 3ERSX 3T1YQ 2IHEA 1N8RC 4KLKA 3CPFA 4LW1A 1HJPA 1LTLA 5IYDH 1ASYA 1FJGL 1D8LA 4IPHA 2IT1A 2HIVA 2R7DA 1VCIA 3CW2C 2JA6H 3HFZB 4R4TA 2WB1G 1J6QA 3WWVA 4L5RC 1V1QA 2YV5A 1TXYA 1EQQA 2LXJA 4RG1A 3U4ZA 1YIJA 3RR5A 4YY3Q 4BXXH 2N49A 1UE6A 4B3RQ 4GN5A 4DR2L 3K81C 4JI5L 1N36L 3J7A5 1CSPA 4QJFA 1GO3E 3KJOA 5FLMH 2PQAB 1EIFA 4MTNA 3TQYA 1YJ9A 4DUZL 2Q2IA 1XMOL 1L2FA 5LMUQ 3HOVH 2ZM6Q 4LF6Q 3M4QA 1OXUA 2AMCB 4JI1Q 3NELA 5BR8Q 3HKSA 5C44G 4IPCA 3I4MG 3M4OH 4JI2Q 3VDYA 4A3IH 3PUZA 2JA5H 4B3TQ 4JV5L 2IY5B 2JA9A 1PH8A 4HIMA 1C7YA 4OONA 2HHHL 4HIDA 1MKHA 2BA0A 2PMZE 3AQQA 3DM3A 4OWWB 1NBWA 5M5WH 1GD7A 4JI0L 1H95A 1VQMA 1Q86C 2Y0SG 4JI6L 2UUAL 3DLLA 3CCLA 5IP9H 1Y1WH 1FVIA 4DV7Q 3ULJA 3M3YH 1VQHA 2F3IA 1Q8KA 1KRSA 4AH6A 2MO1A 4A3LG 4DNIA 1PH3A 1IBLL 2R92H 3CC7A 2ALYB 3ULPA 4LNQA 3TREA 4OX9L 1YBYA 2AWNA 3L2PA 1XJVA 1HNXL 3KFUA 1PV4A 1BBUA 1KIXA 4A3DH 2MQHA 3B6YA 1KAWA 2WFWA 4PG3A 4X66L 5M3MH 3A74A 3UDFA 4A3MH 1YHBA 5HY6A 4X62Q 4GS3A 2OQ0A 1HZ9A 2WP8J 3J81i 3HOUG 4XTCS 3ULLA 1OXVA 5GAGC 3CMAA 4DV2L 1QVGA 2UUCL 2K50A 4P71A 4GLAC 1I3QH 4DK6C 1N32L 5ELOA 2ZTCA 4BY7G 2R93G 3GDEA 4Y52H 2KCMA 1VQIA 4GOPA 4GN4B 1XPRA 4JC0A 4P74A 1XNRQ 1AH9A 4DR2Q 1N36Q 4JI5Q 2L15A 4JBWA 2VS1A 4DV1Q 2B29A 1K9MC 1UE1A 2Z0SA 1VS0A 3K80C 4DUZQ 2VL6A 2NZOA 3JC66 4P75A 3J81c 2K5HA 4A3EH 1XMOQ 1S72A 1EYGA 2EIFA 3CMEA 4BA1I 1JJ2A 1PA6A 2VUMG 1WCMH 2CWPA 2CKZB 3L7ZC 1K73C 4JV5Q 1CKMA 2NVYH 1Q7YC 4LWCA 5C0XI 5M3FH 2HHHQ 1JT8A 5H1SE 4LFAL 5IWAL 3CCEA 1VQEA 2PI2A 3I7FA 1VQ4A 3TEHB 5IT9c 2JEAI 4GKKL 4R4CA 2IHFA 3I56A 3UDGA 2Y0SE 3CCUA 4JI6Q 1G51A 1IBKL 2CQOA 4DV5L 2UUAQ 1HZBA 2RHQB 1L1OC 4DUYL 4A3JH 1XTDA 1T9HA 3PO3H 1VQBA 2DUDA 4YHHL 3PSIA 5C4XH 5IYCH 2PQAA 1YHQA 2KBNA 3K8AA 1IBLQ 1I50H 4JI7L 1N9WA 2K5NA 3S17H 1HH2P 4LF6L 2QGQA 4OX9Q 1PH1A 4QL5A 4R4IA 4UPAA 1HNXQ 3AFQA 5LMNL 4X6AH 1XMQL 1EIYB 4ME3A 2K14A 4BBRH 4NXNL 2E2HH 4A3KH 3K7UC 4X66Q 2UXBL 1HZCA 2C35B 2KENA 1EFWA 3CC4A 4A3CH 4DR3L 3HOYG 3EBEA 4HJ7A 3PO2H 2BH2A 1BVSA 4DV2Q 2NVTH 2UUCQ 1N32Q 2B3GA 2PI2E 1Y1VH 4QIWE 2ZJPA 1D7QA 1TWCH 2B63H 3S2HH 3UDXA 3GO5A 4NB3A 4OXPA 1JJCB 1VQDA 1Q1EA 2ID0A 2WAQG 3KLWA 2D0OA 3I4OA 4ALPA 1QVFA 1BBWA 4QQBX 2RF4A 2JA8G 3S14H 5IY0A 3KF6A 1JE5A 3S16H 2ATWA 3I4NH 3ER0A 1O7IA 4HJ5A 1GKHA 2F52A 1M90C 1X3FA 5C0XG 1NMGA 1VQJA 1IL2A 3G4SA 1PVOA 4PZ7A 1A0IA 5GAHC 4X62L 4JI4L 2JA7H 1VQCA 1PYBA 1WJJA 4B3MQ 4L5TA 4C3JH 4LF7Q 4LFAQ 1U0LA 4KHZA 5IWAQ 1N34L 3RZOH 3PGZA 4IFDJ 1K8GA 4QY7A 4GKKQ 5GQOA 3J7ZC 4DR5L 3HKZE 1IBKQ 4DV5Q 1P8LA 5IP7H 4DUYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P72 A;  4YHH Q;  4DR1 L;  3S24 A;  4DV1 L;  4GNX C;  2KHJ A;  3A5U A;  4C2M H;  4JI7 Q;  1CKO A;  5C3E G;  1HR0 W;  1MJC A;  1VQK A;  2LXK A;  4A3F G;  4YWL A;  2Q2U A;  1AE2 A;  5M5X H;  3H0G G;  1I94 L;  3UDI A;  4OO1 G;  1CKN B;  5LMN Q;  4HJA A;  1XMQ Q;  4LUV A;  5IYB G;  3F2B A;  4LF4 L;  4NXN Q;  4DAM A;  4A93 H;  3NEM A;  1NMF A;  4JOI A;  2IX1 A;  3KDF A;  5EAY A;  2E2J H;  3RZD H;  2UXB Q;  4LUZ A;  3STB C;  4DR3 Q;  1NJI C;  5FJ8 G;  3RLN A;  4A3B H;  1KRT A;  1VQN A;  3E9H A;  1LYL A;  1SLJ A;  3CXC A;  3PF4 A;  2Z6K A;  3H15 A;  3AYH B;  4KHP L;  1FL0 A;  4BY1 G;  4HJ8 A;  2JK8 A;  3CD6 A;  3CCS A;  4DR6 L;  3OYY A;  1GVP A;  4GLV B;  3G71 A;  3GTM H;  1MJE A;  4BBS G;  5JJK A;  4R4Q A;  2N78 A;  1Z9F A;  3HOZ G;  1NY4 A;  1K0R A;  3A5Z B;  2EXD A;  4PZ8 A;  4GLX A;  3U4V A;  3PUY A;  4LF9 L;  5JEA J;  1VQ9 A;  1GM5 A;  3W1B A;  2VY3 A;  2A19 A;  1X65 A;  2FXQ A;  2JQO A;  2R7Z G;  2VW9 A;  4JI4 Q;  3SGI A;  2WB1 E;  1VQ7 A;  4DR4 Q;  3E0E A;  3S1N H;  3Q8D A;  4XIG S;  1PH2 A;  1WOC A;  4L5Q A;  1TWA H;  2EQS A;  1N34 Q;  4JBM A;  1N33 L;  2BA1 A;  3KF8 B;  4DR5 Q;  1X55 A;  4R4O A;  1Z47 A;  4QGU A;  1PH6 A;  4AYB G;  3I4M H;  5M5Y H;  5C44 H;  4JBK A;  4A3G G;  1YZ6 A;  2HQL A;  4YCU A;  1LUZ A;  4YCV A;  2YTY A;  4DV6 L;  4LF8 L;  2K5V A;  4DR1 Q;  1Y14 B;  3FKI G;  2YYZ A;  3L0O A;  1KL9 A;  4IJH A;  3CC2 A;  1QVC A;  1XPO A;  3PF5 A;  3GTK H;  2MO0 A;  1KHI A;  1K3R A;  1I94 Q;  1SRU A;  2ZJQ A;  3ZJY C;  4OWT B;  3HOW G;  4LF4 Q;  4B3M L;  3S1Q H;  1QUQ B;  2NZH A;  1HR0 Q;  4LF7 L;  4A3L H;  3BZK A;  1XNQ L;  3U50 C;  1OXT A;  4JOI C;  2RCN A;  4JCV E;  3RLF A;  2ZJR A;  4JI3 L;  4KHP Q;  1SE8 A;  2E5L L;  2N3S A;  2NVQ H;  4DR6 Q;  3MXN B;  1YEZ A;  2D62 A;  3A0J A;  1EUJ A;  3PV0 A;  1J5E L;  1CKN A;  1UE7 A;  3NEN A;  3J80 i;  1E3P A;  4LFB L;  3HOU H;  5J3B A;  4K0K L;  1YJN A;  4LF9 Q;  2UUB L;  1IBM L;  1HNW Q;  4OO1 I;  3F2D A;  2R93 H;  4BY7 H;  3CF5 A;  5IYD G;  1L1O B;  2GVB A;  1A63 A;  1V43 A;  3HOX G;  1VQO A;  4H02 A;  2LSS A;  4R1J A;  1IXR A;  1BKB A;  2R6G A;  2UU9 L;  1IZ6 A;  2DGY A;  4OWX B;  1VQ5 A;  2PNH A;  2JA6 G;  4A4I A;  3W1G A;  4MNO A;  3J80 c;  1N33 Q;  2CFM A;  1WI5 A;  4RMF A;  2HT1 A;  5ELN A;  1VQP A;  4DR7 Q;  1UWV A;  3KYH C;  2VUM H;  1IYJ B;  4IOC A;  4IOA A;  3I2Z A;  3GTJ H;  4GN3 B;  4LF8 Q;  1Q46 A;  4BXX G;  4DV6 Q;  1YI2 A;  3GD7 A;  3T1H L;  1R9T H;  3H3V I;  3CPW A;  3S2D H;  4GOP C;  2R7F A;  3NBH B;  5E7N A;  4UP7 A;  4JBJ A;  1PH7 A;  4JYA L;  5FLM G;  3J81 j;  4YWM A;  3HOV G;  5GRO A;  4TVA B;  5K36 G;  3F2C A;  4DR4 L;  2K75 A;  4A3I G;  2JA5 G;  2I5H A;  4KI0 A;  4Y7N H;  2XTI A;  1I6H H;  2OTL A;  1JB7 A;  3MEF A;  4WJ4 A;  1XNQ Q;  2ASB A;  1AE3 A;  3F1Z A;  1W3S A;  5DLQ E;  2VQE L;  2YTV A;  4AQY Q;  4NXM L;  2UXD L;  4LFC L;  1S40 A;  4MZ9 A;  1VQ8 A;  2KCT A;  1WYD A;  5IP9 G;  4JI3 Q;  1Y1W G;  3IRB A;  2A1A A;  2E5L Q;  3K0X A;  1RL2 A;  3M7N A;  4DV4 L;  3KJP A;  3HOX H;  1QZG A;  2GVA A;  3G48 A;  1JJG A;  4APV A;  1J5E Q;  4DV3 L;  1VQ6 A;  2R92 G;  4X64 L;  3HOY H;  3FP9 A;  3E9I A;  1B70 B;  2MFI A;  1Q1B A;  5C4J H;  4LFB Q;  1A62 A;  4K0K Q;  1QUQ A;  1OXS C;  2UUB Q;  2CWA A;  1IBM Q;  1HR0 L;  4A3D G;  3GTQ H;  2JE6 I;  2VNU D;  1X9N A;  1SMX A;  1PFS A;  1S3O A;  5M3M G;  3OW2 A;  4A3M G;  3GTO H;  2UU9 Q;  4IFD I;  1A8V A;  4GNX B;  1X56 A;  5IE8 A;  2F4V Q;  4GKJ L;  2JA8 H;  5FLX c;  2YTX A;  1Q82 C;  1PH5 A;  1PH4 A;  3AEV A;  5JJL A;  1HNZ L;  4B3S L;  4A75 A;  1KD1 C;  3BJU A;  3RN2 A;  2JEB I;  1B8A A;  4JI8 L;  1SRO A;  1DGS A;  1RIP A;  2VZA A;  2WAQ E;  4P73 A;  1CUK A;  1EQR A;  1V9P A;  3LGJ A;  4IPG A;  1OXX K;  3T1H Q;  4LF5 Q;  1XNR L;  4DV0 L;  2AHO B;  3D0F A;  1PYS B;  2QA4 A;  4JYA Q;  3RNU A;  1HNW L;  1SR3 A;  4C3H H;  1L1O A;  4YWK A;  5AJ3 L;  4YCW A;  2OCE A;  4A3E G;  1G29 1;  1Q81 C;  2I5M X;  1QZH A;  1KQS A;  1E22 A;  1X6O A;  3CP0 A;  5GAD C;  1WCM G;  2N8N A;  1TWF H;  4TQU S;  4UP8 A;  1PH9 A;  2KHI A;  5M3F G;  4L5S A;  2I0Q A;  2I5L X;  1Q12 A;  5C3E H;  1L0W A;  4A3F H;  3CQZ H;  2VQE Q;  3H0G H;  1OTC A;  3PUW A;  2E8G A;  2A8V A;  4NXM Q;  2UXD Q;  4HIO A;  4LFC Q;  1YHA A;  2NN6 I;  2OQK A;  5IYB H;  4A3J G;  3TS0 A;  3F8T A;  3PO3 G;  3AFP A;  3S1R H;  1HZA A;  2Q2H A;  2IX0 A;  5IYC G;  5C4X G;  2VQF L;  4DV4 Q;  3KF6 B;  5C0X J;  2OWO A;  1FJG Q;  1E1T A;  4DV3 Q;  3BZC A;  1SN8 A;  1YNX A;  4PMW A;  5FJ8 H;  4X64 Q;  1K8A C;  1E1O A;  4WJ3 M;  1P16 A;  3CCV A;  2JJQ A;  3FHW A;  3STB D;  1MIU A;  4X65 L;  3U58 A;  2XGT A;  4FDB A;  1UEB A;  3I55 A;  5GAE C;  4UY8 C;  4DKA C;  4LUO A;  4POF A;  3CCJ A;  4BBR G;  2MNA A;  4BY1 H;  4IFD G;  1U5K A;  3H3V H;  4A3K G;  4BBS H;  1LM0 A;  3RN5 A;  3JAM i;  1C9O A;  1CSQ A;  1YIT A;  4AIM A;  2H5X A;  3OTO L;  4AQY L;  1JMC A;  3HOZ H;  4DK3 C;  4A3C G;  4GKJ Q;  3D31 A;  3CCM A;  2UXC L;  3TS2 A;  3PO2 G;  1XPU A;  1VQG A;  1EWI A;  1HNZ Q;  4B3S Q;  1I5F A;  3M9B A;  3T1Y L;  1E7Z A;  4O0A A;  1G6P A;  4JI8 Q;  2AWO A;  3PUX A;  2R7Z H;  1Y1V G;  5JJI A;  4IPD A;  2Z6K C;  2B63 G;  1NE3 A;  1SFO H;  1X3E A;  4EX5 A;  3JAM c;  3GTP H;  3KOJ A;  4DV0 Q;  2RHS B;  3PUV A;  5AJ3 Q;  4POG A;  2ZTE A;  2YU9 H;  1X54 A;  1M1K C;  4JI0 Q;  3I4N G;  3ICE A;  3KDF B;  3GTL H;  4A3G H;  2OTJ A;  1KXL A;  3HKZ G;  4YY3 L;  2QEX A;  1B7Y B;  4GNX A;  1KC8 C;  1FGU A;  3M4P A;  3G6E A;  4B3R L;  2K4K A;  2AKW B;  4DAY B;  2F4V L;  2JA7 G;  3EN2 A;  5LMN W;  1VQL A;  2K52 A;  3PCO B;  3FKI H;  4J15 A;  1YJW A;  2NN6 G;  3K7A H;  1W2B A;  3S15 H;  4AYB E;  3EIV A;  4A76 A;  3TRZ A;  2Q2T A;  5LMU L;  1C0A A;  3W5O A;  2ZM6 L;  3M85 A;  4JI1 L;  2ES2 A;  5IP7 G;  3BU2 A;  5BR8 L;  3HOW H;  4DR7 L;  4EQ5 A;  4JI2 L;  2HIX A;  2E2I H;  4B3T L;  4LF5 L;  2VQF Q;  4UP9 A;  1ASZ A;  1YVC A;  2V1C C;  5JEA G;  4JG2 A;  2CCZ A;  3GTG H;  4PZ6 A;  3UE1 A;  3PIP A;  1TWH H;  3CAM A;  4HJ9 A;  4X65 Q;  4BA2 I;  2ZTD A;  1PHJ A;  4O2D A;  4HIK A;  3S1M H;  2BH8 A;  3PIO A;  1UE5 A;  2GN5 A;  4DPG A;  4DV7 L;  1VQA A;  4A93 G;  1TWG H;  1NTG A;  1VQF A;  1X3G A;  4NPS A;  2NVX H;  4C3I H;  1K83 H;  1WFQ A;  4IJL A;  1E24 A;  3OTO Q;  5HGQ A;  4GOP B;  3RLO A;  3CCR A;  3UE0 A;  4A3B G;  2UXC Q;  1EOV A;  2D0P A;  3CCQ A;  4IO9 A;  3ERS X;  3T1Y Q;  2IHE A;  1N8R C;  4KLK A;  3CPF A;  4LW1 A;  1HJP A;  1LTL A;  5IYD H;  1ASY A;  1FJG L;  1D8L A;  4IPH A;  2IT1 A;  2HIV A;  2R7D A;  1VCI A;  3CW2 C;  2JA6 H;  3HFZ B;  4R4T A;  2WB1 G;  1J6Q A;  3WWV A;  4L5R C;  1V1Q A;  2YV5 A;  1TXY A;  1EQQ A;  2LXJ A;  4RG1 A;  3U4Z A;  1YIJ A;  3RR5 A;  4YY3 Q;  4BXX H;  2N49 A;  1UE6 A;  4B3R Q;  4GN5 A;  4DR2 L;  3K81 C;  4JI5 L;  1N36 L;  3J7A 5;  1CSP A;  4QJF A;  1GO3 E;  3KJO A;  5FLM H;  2PQA B;  1EIF A;  4MTN A;  3TQY A;  1YJ9 A;  4DUZ L;  2Q2I A;  1XMO L;  1L2F A;  5LMU Q;  3HOV H;  2ZM6 Q;  4LF6 Q;  3M4Q A;  1OXU A;  2AMC B;  4JI1 Q;  3NEL A;  5BR8 Q;  3HKS A;  5C44 G;  4IPC A;  3I4M G;  3M4O H;  4JI2 Q;  3VDY A;  4A3I H;  3PUZ A;  2JA5 H;  4B3T Q;  4JV5 L;  2IY5 B;  2JA9 A;  1PH8 A;  4HIM A;  1C7Y A;  4OON A;  2HHH L;  4HID A;  1MKH A;  2BA0 A;  2PMZ E;  3AQQ A;  3DM3 A;  4OWW B;  1NBW A;  5M5W H;  1GD7 A;  4JI0 L;  1H95 A;  1VQM A;  1Q86 C;  2Y0S G;  4JI6 L;  2UUA L;  3DLL A;  3CCL A;  5IP9 H;  1Y1W H;  1FVI A;  4DV7 Q;  3ULJ A;  3M3Y H;  1VQH A;  2F3I A;  1Q8K A;  1KRS A;  4AH6 A;  2MO1 A;  4A3L G;  4DNI A;  1PH3 A;  1IBL L;  2R92 H;  3CC7 A;  2ALY B;  3ULP A;  4LNQ A;  3TRE A;  4OX9 L;  1YBY A;  2AWN A;  3L2P A;  1XJV A;  1HNX L;  3KFU A;  1PV4 A;  1BBU A;  1KIX A;  4A3D H;  2MQH A;  3B6Y A;  1KAW A;  2WFW A;  4PG3 A;  4X66 L;  5M3M H;  3A74 A;  3UDF A;  4A3M H;  1YHB A;  5HY6 A;  4X62 Q;  4GS3 A;  2OQ0 A;  1HZ9 A;  2WP8 J;  3J81 i;  3HOU G;  4XTC S;  3ULL A;  1OXV A;  5GAG C;  3CMA A;  4DV2 L;  1QVG A;  2UUC L;  2K50 A;  4P71 A;  4GLA C;  1I3Q H;  4DK6 C;  1N32 L;  5ELO A;  2ZTC A;  4BY7 G;  2R93 G;  3GDE A;  4Y52 H;  2KCM A;  1VQI A;  4GOP A;  4GN4 B;  1XPR A;  4JC0 A;  4P74 A;  1XNR Q;  1AH9 A;  4DR2 Q;  1N36 Q;  4JI5 Q;  2L15 A;  4JBW A;  2VS1 A;  4DV1 Q;  2B29 A;  1K9M C;  1UE1 A;  2Z0S A;  1VS0 A;  3K80 C;  4DUZ Q;  2VL6 A;  2NZO A;  3JC6 6;  4P75 A;  3J81 c;  2K5H A;  4A3E H;  1XMO Q;  1S72 A;  1EYG A;  2EIF A;  3CME A;  4BA1 I;  1JJ2 A;  1PA6 A;  2VUM G;  1WCM H;  2CWP A;  2CKZ B;  3L7Z C;  1K73 C;  4JV5 Q;  1CKM A;  2NVY H;  1Q7Y C;  4LWC A;  5C0X I;  5M3F H;  2HHH Q;  1JT8 A;  5H1S E;  4LFA L;  5IWA L;  3CCE A;  1VQE A;  2PI2 A;  3I7F A;  1VQ4 A;  3TEH B;  5IT9 c;  2JEA I;  4GKK L;  4R4C A;  2IHF A;  3I56 A;  3UDG A;  2Y0S E;  3CCU A;  4JI6 Q;  1G51 A;  1IBK L;  2CQO A;  4DV5 L;  2UUA Q;  1HZB A;  2RHQ B;  1L1O C;  4DUY L;  4A3J H;  1XTD A;  1T9H A;  3PO3 H;  1VQB A;  2DUD A;  4YHH L;  3PSI A;  5C4X H;  5IYC H;  2PQA A;  1YHQ A;  2KBN A;  3K8A A;  1IBL Q;  1I50 H;  4JI7 L;  1N9W A;  2K5N A;  3S17 H;  1HH2 P;  4LF6 L;  2QGQ A;  4OX9 Q;  1PH1 A;  4QL5 A;  4R4I A;  4UPA A;  1HNX Q;  3AFQ A;  5LMN L;  4X6A H;  1XMQ L;  1EIY B;  4ME3 A;  2K14 A;  4BBR H;  4NXN L;  2E2H H;  4A3K H;  3K7U C;  4X66 Q;  2UXB L;  1HZC A;  2C35 B;  2KEN A;  1EFW A;  3CC4 A;  4A3C H;  4DR3 L;  3HOY G;  3EBE A;  4HJ7 A;  3PO2 H;  2BH2 A;  1BVS A;  4DV2 Q;  2NVT H;  2UUC Q;  1N32 Q;  2B3G A;  2PI2 E;  1Y1V H;  4QIW E;  2ZJP A;  1D7Q A;  1TWC H;  2B63 H;  3S2H H;  3UDX A;  3GO5 A;  4NB3 A;  4OXP A;  1JJC B;  1VQD A;  1Q1E A;  2ID0 A;  2WAQ G;  3KLW A;  2D0O A;  3I4O A;  4ALP A;  1QVF A;  1BBW A;  4QQB X;  2RF4 A;  2JA8 G;  3S14 H;  5IY0 A;  3KF6 A;  1JE5 A;  3S16 H;  2ATW A;  3I4N H;  3ER0 A;  1O7I A;  4HJ5 A;  1GKH A;  2F52 A;  1M90 C;  1X3F A;  5C0X G;  1NMG A;  1VQJ A;  1IL2 A;  3G4S A;  1PVO A;  4PZ7 A;  1A0I A;  5GAH C;  4X62 L;  4JI4 L;  2JA7 H;  1VQC A;  1PYB A;  1WJJ A;  4B3M Q;  4L5T A;  4C3J H;  4LF7 Q;  4LFA Q;  1U0L A;  4KHZ A;  5IWA Q;  1N34 L;  3RZO H;  3PGZ A;  4IFD J;  1K8G A;  4QY7 A;  4GKK Q;  5GQO A;  3J7Z C;  4DR5 L;  3HKZ E;  1IBK Q;  4DV5 Q;  1P8L A;  5IP7 H;  4DUY Q; 
#chains in the Genus database with same CATH topology
 4P72 A;  2PBZ A;  3RUP A;  1C3O A;  2IW3 A;  3S24 A;  4DV1 L;  4GNX C;  3A5U A;  5D8D A;  4XQN A;  4U7C A;  1TS3 A;  1ULZ A;  1MJC A;  4A3F G;  5CV7 A;  2VUM B;  1EY8 A;  4NP5 A;  1I94 L;  3JRX A;  1SDF A;  4Z9C B;  2E75 C;  4DAM A;  3X3M A;  2IX1 A;  5KFA A;  2NZ1 D;  4RAU C;  1E4E A;  1C48 A;  1I4G A;  3GTG B;  2J6T A;  1NJI C;  1SYB A;  3K59 A;  4ECV A;  1CQJ B;  1DZ1 A;  2JEG A;  2UUB H;  1VQN A;  3CXC A;  5KFK A;  3PF4 A;  4JVZ A;  3S1M B;  1W96 A;  1VMP A;  3VYU A;  4DR6 L;  2BCO A;  2NVX B;  5JJK A;  2BQR A;  2B2V C;  1N56 A;  2F4V H;  4U67 3;  1F9R A;  1Z9F A;  4CDD C;  4A2B A;  5L1L A;  1F9S A;  4YJ2 F;  4ECZ A;  5EKK A;  3V96 A;  2AU0 A;  3U4V A;  2F0F A;  4ZI7 F;  3W1B A;  1KJJ A;  1X65 A;  4J9R A;  2C22 A;  4XYL B;  4JI4 Q;  3SGI A;  4FU0 A;  2WKC A;  2TMP A;  3E0E A;  5KG4 A;  2Z8L A;  1VBG A;  1N34 Q;  1ZKO A;  2GPS A;  4RGO S;  4RCO A;  2EYJ A;  5ELF A;  2LY7 A;  4R8N A;  2HQL A;  4YCU A;  4YCV A;  5CV5 A;  4DV6 L;  4K5X A;  2EZV A;  2XGP A;  1KAA A;  2LS0 1;  3N6X A;  3FKI G;  4ETS A;  1QVC A;  2UXD H;  1RD9 D;  3X3N A;  3V6J A;  4ZCK A;  1KHI A;  1I94 Q;  2ZJQ A;  4WOR A;  4OWT B;  2JA5 B;  2JSO A;  4CDF C;  3BVZ A;  2DNC A;  1HR0 Q;  4LF7 L;  1HRJ A;  1M0W A;  2R93 A;  5KEE A;  3J7Y W;  4X64 H;  3SDZ A;  1OXT A;  3SK6 A;  5M5W B;  2TSS A;  1SNC A;  1ET6 A;  3HGB A;  2K03 A;  2ZJR A;  2NU6 B;  1Y1W B;  3TIG A;  2CVR A;  1SE8 A;  2E5L L;  2N3S A;  3BZD B;  4DR6 Q;  5BPF A;  3M9O B;  2IMW P;  5BN5 A;  2VUM A;  1YEZ A;  2D62 A;  4A3F B;  1EUJ A;  3Q8P B;  2R92 B;  2PYK A;  1E3P A;  5C6A A;  3HOU H;  1G8Z D;  1HNW Q;  4OO1 I;  2R93 H;  3GTG A;  4XQQ A;  4C1N K;  5JPN C;  2GVB A;  2NUA B;  1V43 A;  3N8D A;  3KUP A;  4JV5 H;  1VQO A;  4H02 A;  2LSS A;  4R1J A;  5EWF A;  1IXR A;  3RB4 A;  2JA6 G;  1Z2N X;  4A2A A;  4OWX B;  2PW7 A;  4A4I A;  3W1G A;  5CV8 A;  3J80 c;  3BQ1 A;  1LTI D;  4RMF A;  4EEY A;  4JI0 H;  5ELN A;  1E2Z A;  1UWV A;  4K2L A;  5COY A;  3CU7 A;  3KHL A;  2VUM H;  1HQR D;  4RUA A;  2PZT A;  3OMG A;  4DV6 Q;  3GD7 A;  1JKJ B;  1R9T H;  2F0I A;  5E7N A;  5C5L A;  4JYA L;  4I7Z C;  2A6H D;  4A3E B;  4RKL A;  1JWM D;  4KK7 A;  1WCM B;  1HA5 A;  4DR4 L;  4A3I G;  2VQF H;  2I5H A;  5I2Y A;  4PV1 C;  4I7A A;  2R84 A;  1JB7 A;  3MEF A;  2ZDG A;  2LFN A;  5CA0 F;  2ASB A;  1ESR A;  5J2U F;  5KFP A;  2VQE L;  4RGN A;  3IG0 A;  2Z6B A;  4AQY Q;  5EOY A;  4LFC L;  3VYS A;  1M8A A;  1STN A;  1WYD A;  4A3J B;  3RFC A;  4CKE A;  4ZK9 B;  2E5L Q;  4J9N A;  2VPS A;  2AGP A;  3K7A B;  4DV4 L;  3G48 A;  1I4X A;  4APV A;  1VQ6 A;  3VA7 A;  5FO9 B;  2MFI A;  1Y8P B;  2JA5 A;  1A62 A;  2RKS A;  2CWA A;  4KD4 A;  3DHQ A;  5T1I A;  4DK1 A;  3DWA A;  4A3K B;  1PFN A;  3PR5 B;  4DNT B;  2K1B A;  1H9K A;  2W7O A;  1X9N A;  5DG7 A;  2BQ3 A;  1S10 A;  5KFH A;  2W8K A;  2PN1 A;  4LH7 A;  4EFB A;  1M0T A;  2NTS A;  3PO2 B;  1ZHS A;  1HNZ L;  5CYU A;  1D1K A;  5E1F A;  1B8A A;  1U4M A;  4JI8 L;  1Y1V B;  5C4Z A;  1I7N A;  5KFB A;  4DUY H;  3S2H B;  2B63 B;  3PW7 A;  4IPG A;  2YYA A;  4RZQ A;  1H9S B;  4JYA Q;  3RNU A;  5LMU H;  4Q8F A;  4XYQ A;  1KQS A;  1E22 A;  1X6O A;  2JA6 B;  2JA7 B;  1PH9 A;  2QDB A;  3MFG A;  1II3 A;  5M3F G;  4DL3 A;  1I6U A;  4L5S A;  1C30 A;  4A3F H;  2VQE Q;  4IRK A;  1OTC A;  5EQ0 A;  5L37 A;  4PWQ A;  4LFC Q;  5IGD A;  3K5L A;  5EPJ A;  4MHE A;  4CC6 A;  3S1R H;  4F50 A;  3P75 A;  5C4X G;  3PMF A;  4DV4 Q;  3KF6 B;  2I46 A;  2OWO A;  3C46 A;  1B04 A;  3Q1K A;  1E1T A;  1SN8 A;  4PMW A;  3PIO 3;  1K8A C;  3KLS X;  1L0Y B;  1MIU A;  3PW4 A;  1EEI D;  1RK6 A;  4J9K A;  5GAE C;  3PW2 A;  3D6C A;  5IOD A;  3CCJ A;  4R8U B;  3J80 L;  1EY6 A;  1PZJ D;  4FXK C;  2MNA A;  5C3W A;  2E2J B;  1LM0 A;  3GTL A;  1Q3L A;  5E4W C;  3JAM i;  1M6V A;  3OTO L;  3DEP A;  2X6L A;  1VDZ A;  3FKI A;  1HNZ Q;  1I5F A;  3OUZ A;  1E7Z A;  3KTM A;  4JI8 Q;  2AWO A;  3PUX A;  5JOB A;  3GTM B;  1NE3 A;  2WV6 D;  5KT5 A;  4PNY A;  4DV1 H;  4GC7 A;  2MGS A;  1I4H A;  2C00 A;  4O4H F;  5KFV A;  2H4O A;  2Z1C A;  4HCE A;  1TY2 A;  1X54 A;  2OTJ A;  3GTL H;  5A2Q E;  1PMR A;  4YY3 L;  3H91 A;  4IZO A;  2HHH H;  1STE A;  5IGF A;  3FKI H;  3H6M A;  2K04 A;  5TSS A;  2HVR A;  3K7A H;  3S15 H;  1Y1V A;  2UUA H;  1I3Q B;  2B63 A;  3R2T A;  5KND A;  1C0A A;  4TV8 F;  3M85 A;  1Z2P X;  5C44 B;  4JI2 L;  2DN8 A;  3MXU A;  1H9S A;  4LF5 L;  3T5H A;  3P1H A;  5KFM A;  3IFD A;  4UP9 A;  2F0J A;  3C3L A;  1YVC A;  5JEA G;  1SYF A;  5I9O A;  5I6Y A;  3UE1 A;  3PIP A;  3GTK B;  3QFF A;  3CAM A;  4QB4 A;  2JA6 A;  3BQ0 A;  2BH8 A;  5KFN A;  1UE5 A;  2GN5 A;  4G7Z C;  1JCK B;  2KOL A;  4Q5V A;  1EIH A;  1U9R A;  4OGQ C;  2X69 A;  1EUC B;  1WFQ A;  3OTO Q;  2B39 A;  4YIJ A;  5HGQ A;  3QB3 A;  1SAP A;  1YNJ D;  4DK0 A;  1EOV A;  2D0P A;  3AB9 A;  3A56 A;  2F0D A;  4IO9 A;  3ERS X;  1U4P A;  2UUC H;  1N8R C;  2E2D C;  2KEC A;  1QNK A;  2A6E D;  1ASY A;  2FPI B;  2C2D A;  2FB9 A;  2EYL A;  1VCI A;  3CW2 C;  2JA6 H;  3HFZ B;  1AN8 A;  3U9O A;  2ASD A;  1M4V A;  1G2T A;  4ECU A;  3WWV A;  1V1Q A;  2I07 B;  2F3V A;  2CH4 W;  2LXJ A;  3U4Z A;  4O2B F;  1YIJ A;  1B33 N;  5KT6 A;  2XIG A;  4YY3 Q;  4UCR A;  1UE6 A;  1PRT B;  4LF7 H;  3FEW X;  4RH6 A;  3J7A 5;  3D8G A;  1EYC A;  2OF1 A;  1CHP D;  4XDX A;  2C2R A;  4DUZ L;  3GTM A;  5LL6 X;  1L2F A;  3OIQ A;  4HCS A;  1H9J A;  3E6Z X;  4QW9 A;  1OXU A;  3I4M G;  3NEL A;  3PVX A;  3GTJ B;  4JI2 Q;  4CDE C;  3VDY A;  4A3I H;  4C5B A;  2JA9 A;  1PH8 A;  5KFD A;  4F4W A;  1D2B A;  2VR1 A;  4NKL A;  3S14 B;  2M2L A;  2BA0 A;  4J9M A;  4ABN A;  3PW5 A;  5JQW A;  2BR0 A;  1EY9 A;  2Y0S G;  4O4I F;  5JVH 3;  1Z6H A;  4ZQ3 A;  1KJQ A;  1DV1 A;  3ULJ A;  2L1B A;  5IIF A;  1PRT F;  1I6H B;  1LTR D;  1Q8K A;  4AH6 A;  4A3L G;  4XYM B;  1I3Q A;  1BOS A;  1IBL L;  3TQT A;  1SYX B;  3AU7 A;  3FPP A;  3H94 A;  3C2P A;  4K5W A;  1SSO A;  4IUN A;  1RJP A;  4ZQI A;  4ED2 A;  1UAP A;  1YBY A;  3SK8 A;  1HNX L;  4EGQ A;  1PTO H;  3NBH A;  1BBU A;  2K05 A;  2DLN A;  4PQX A;  2GPW A;  2MQH A;  4HN7 A;  2C2E A;  2WFW A;  2J0T D;  2R3Z A;  1QIL A;  1ILP A;  3HOY B;  4EBD A;  1O7Z A;  3J81 i;  4JYA H;  4XTC S;  4QUC A;  4DV2 L;  1QVG A;  3KXY T;  1FYC A;  1N32 L;  1I3Q H;  5ELO A;  1ENC A;  4WD3 A;  4DR4 H;  4ZHQ F;  1LAC A;  3EJI A;  1KBL A;  4HR7 B;  2EDG A;  5ISR A;  2ZDQ A;  4DR5 H;  2VQE H;  3TP5 A;  2FKL A;  3K80 C;  4DUZ Q;  2VL6 A;  4RNM A;  2R87 A;  3OHX C;  1MI2 A;  1UC8 A;  4UCU A;  3CME A;  4FS1 A;  4BA1 I;  1JJ2 A;  4IRC A;  1A15 A;  4RNO A;  2KJX A;  1STA A;  4DR1 H;  2VXW A;  1B9N A;  2W71 A;  4DXG A;  4XYO A;  5M3F H;  1JT8 A;  1CZG A;  1A2T A;  1VQE A;  2PI2 A;  3P20 A;  2HVS A;  1PTO C;  4R4C A;  4ZUI A;  5DM6 3;  3I56 A;  2EE1 A;  2V9W A;  1IBK L;  1JOQ A;  2CQO A;  4HED A;  2L11 A;  1MSH A;  4YHH L;  2QK4 A;  1IKL A;  5C4X H;  5NUC A;  3LX0 A;  5CA1 F;  1RDP D;  1IBL Q;  5FOB B;  5C3E B;  1I50 H;  5KYI A;  2JEF A;  5KNC A;  3S17 H;  4DAP A;  3BJY A;  3GTJ A;  4LF6 L;  1GOZ A;  4UPA A;  1HNX Q;  1B6S A;  1HNZ H;  2BOS A;  4FXG C;  1ML0 D;  1XMQ L;  4KHP H;  4ME3 A;  5DNF A;  3RJ0 A;  1QJO A;  3UI2 A;  2EXZ A;  2K01 A;  4CC5 A;  2OLS A;  2C35 B;  2KEN A;  5KT3 A;  1TS2 A;  1IKM A;  2HJW A;  3EYY A;  4HJ7 A;  4YQW A;  3HS0 C;  3ONA B;  5KT4 A;  5FLX L;  3RMH A;  4DV2 Q;  4LMQ D;  1N32 Q;  2ZJP A;  4KTA A;  1ET9 A;  1D7Q A;  1GUS A;  5L1K A;  2CQY A;  5D1O B;  4NB3 A;  3KHG A;  5GON F;  2W8L A;  2D0O A;  4ALP A;  4DGZ A;  4QQB X;  1OWT A;  4IUQ A;  3S14 H;  4HMJ A;  3AMU A;  4C1N I;  4C2M A;  4MA5 A;  3GV6 A;  4RAZ A;  1M90 C;  2F52 A;  1CE8 A;  3T51 B;  1NMG A;  3FDS A;  5GAH C;  4X62 L;  1LTB D;  1PYB A;  3IFT A;  3FMC A;  3URY A;  4N8X 1;  5C3X A;  1K1S A;  4QY7 A;  1EQT A;  4Q0Y A;  2JEI A;  5GQO A;  3WOE A;  3HKZ E;  1IBK Q;  2ZJT A;  3OHA A;  1B44 D;  4HR7 A;  1XNR L;  4J9L A;  1J9O A;  3R5X A;  4YHH Q;  5EPK A;  5CMD A;  5JEA H;  4C2M H;  2YS7 A;  4TKO B;  1PYW D;  2Q2U A;  3H0G G;  2OH2 A;  1S0O A;  4CKC A;  1XMQ Q;  4LUV A;  3F2B A;  3V2T A;  5EBC A;  2E2I B;  3S2D B;  5KFR A;  1NMF A;  1QE6 A;  5CB4 F;  1J5E H;  5HBR B;  1H9M A;  3RZD H;  4LUZ A;  3G6X A;  4LFB H;  5KFI A;  1KRT A;  1RJQ A;  1IBM H;  1S03 G;  1LYL A;  4DU9 A;  4KMU C;  1TWA A;  3H15 A;  1SND A;  1AP0 A;  2J9G A;  3CD6 A;  2JK8 A;  2PZW A;  3OYY A;  1GVP A;  4GLV B;  3G71 A;  2JYO A;  1MJE A;  4BBS G;  4Q44 A;  5DQH A;  1I4R A;  5DLG A;  3HOZ G;  2V4R A;  1K0R A;  3BG5 A;  4ECR A;  2EXD A;  3BYY B;  3T5J A;  4GLX A;  2XRS D;  3RUZ A;  5JEA J;  2FK1 A;  3TBI B;  2VY3 A;  2B2Y A;  3JZI A;  1CQI B;  3HOX B;  4FF2 A;  3KHH A;  3DWQ A;  1VKZ A;  2WB1 E;  4LF5 H;  2MCT A;  1ZXT A;  4XIG S;  4QWA A;  1WOC A;  4L5Q A;  1TWA H;  2EQS A;  4KKT A;  5C8Y F;  4JBM A;  3HXL A;  3KF8 B;  1O80 A;  1X55 A;  4JPB W;  1PH6 A;  5D1O A;  3I4M H;  1ZET A;  3K5N A;  3GTO B;  4IR9 A;  4C56 C;  5H80 A;  3R23 A;  2K5V A;  2L9H A;  3PIP 3;  1F2M A;  3SHL A;  4O3Q A;  3QWN A;  1EY0 A;  2YYZ A;  3CC2 A;  1HXY D;  4IJH A;  3J80 W;  5I6W A;  3PF5 A;  3CHB D;  1K3R A;  5F9L A;  3MFH A;  3NBI A;  2I8C A;  4V0B A;  2F0Q A;  3M4O B;  1XXG A;  5LL6 S;  1QUQ B;  2NZH A;  4A3L H;  1S5B D;  4RB0 A;  1RYR A;  3K0Y A;  2CHB D;  3U50 C;  2J4X A;  3PR4 A;  4GZY C;  3DF7 A;  2RCN A;  2F0T A;  2NBF A;  4ECQ A;  3RLF A;  2HDM A;  1FKA H;  4JI3 L;  3R5F A;  4IN3 A;  4G3I A;  2HGS A;  4TQS A;  3ND8 A;  3A0J A;  1C4Q A;  4P2C B;  3PV0 A;  2B2T A;  4UAI A;  5FK9 C;  1SNO A;  1UE7 A;  4ECS A;  1KAB A;  5DG8 A;  2E2I A;  4K0K L;  1CT1 D;  2F0W A;  4KN7 C;  3F2D A;  1QB5 D;  4A3D B;  1ENF A;  2C9O A;  5IYD G;  1L1O B;  4O3S A;  3S9W A;  1DOM A;  2UU9 L;  3M4Y A;  4MNO A;  5I9P A;  2PNR C;  1WI5 A;  1VQP A;  1ENA A;  1HPC A;  4IOC A;  3HG9 A;  1CS0 A;  4GN3 B;  3TQ1 A;  3V6K A;  1EYD A;  2FLL A;  1CK1 A;  3BYT B;  3S2D H;  4GOP C;  5AFW A;  3MA2 B;  2IBK A;  1PH7 A;  4JBJ A;  5FLM G;  3J81 j;  3T5K A;  1IYU A;  4WRD A;  2F3W A;  1HNX H;  2OT2 A;  3BDC A;  1PTO D;  5K36 G;  4TVA B;  2B2U A;  2FJZ A;  3F2C A;  2CW0 D;  2K75 A;  3Q8Q B;  2JA5 G;  4KI0 A;  3GTP B;  4N8F A;  3KF8 A;  3M4I A;  3GIL A;  2MHV A;  3F1Z A;  2C5C A;  2YTV A;  4NXM L;  2ASJ A;  3GTO A;  3JAM E;  3D6W A;  2R61 A;  2O4X A;  3NK9 A;  2KCT A;  4JI3 Q;  3PO3 B;  1S5F D;  1Y1W G;  2YW2 A;  3VPC A;  4ECT A;  3T5L A;  1N32 H;  2XSC A;  4XQJ A;  3M7N A;  3HOX H;  3NHH A;  5FPO A;  4M8A A;  3ETJ A;  2R92 G;  3E9I A;  2EY2 A;  3OOC A;  4HSV A;  2J7Z A;  4CGY B;  4K0K Q;  1T36 A;  3NQI A;  1QUQ A;  2UVR A;  1OXS C;  1JE4 A;  2AQ1 B;  1EHI A;  5KFT A;  1FR3 A;  4M1U B;  4BBR B;  1HR0 L;  1RJR A;  3D3R A;  3MR5 A;  1DOK A;  1PFS A;  2MUY A;  5M3M G;  4A3M G;  3GTO H;  1JXL A;  1DYQ A;  1SMY D;  1A8V A;  2UU9 Q;  1I4P A;  1X56 A;  4GKJ L;  2W6N A;  3GV8 B;  5LP6 F;  4KY5 A;  1PZK D;  3GQB A;  4B3S L;  1UC9 A;  4A75 A;  1KD1 C;  1IBK H;  1SRO A;  4HNU A;  3WOF A;  3H0G A;  4B3R H;  2WAQ E;  1CUK A;  5EJW A;  4MV4 A;  1U4L A;  1EQR A;  1V9P A;  2M00 A;  3LGJ A;  3MXP A;  1TQO A;  1T94 A;  4QWE A;  2QA4 A;  1HNW L;  1MHW C;  3D4R A;  3IL8 A;  1L1O A;  1Q90 A;  4LF6 H;  3I4N B;  2OCE A;  4A3E G;  1K0S A;  4K6D A;  5C1P A;  3CP0 A;  2CZG A;  1WCM G;  2N8N A;  4TQU S;  2CQA A;  4JV0 A;  4FS2 A;  5KRU A;  2ZXR A;  1JIC A;  2F0H A;  1BGW A;  1Q12 A;  1L0W A;  3A7A B;  3H0G H;  4CHT B;  5KKN B;  4NXM Q;  1KNE A;  1BBX C;  1D1I A;  1B2T A;  4DL7 A;  4A3J G;  1S68 A;  3OSN A;  4ZRZ A;  1HZA A;  1GUG A;  2AQ3 B;  4R9W A;  2PMZ B;  2K33 A;  1FJG Q;  1JDB B;  1KNA A;  1RTN A;  3BZC A;  3VMM A;  3EPG A;  3H09 A;  1P16 A;  1WTR A;  5BPH A;  1SFO A;  1BCP C;  2SDF A;  1DM0 B;  3A55 A;  1IL8 A;  2FE3 A;  3I55 A;  3GTP A;  1W6J A;  2UVU A;  3VYR A;  4F87 A;  2KED A;  4IUP A;  5C1O A;  2E74 C;  3H3V H;  4BBS H;  4A3K G;  4X62 H;  1EYA A;  1K3B C;  3TP7 A;  3SXH A;  2YZM A;  3HOZ H;  4FM9 A;  4AQY L;  2X6G A;  4GKJ Q;  4A3B B;  3CCM A;  1NR2 A;  1CA6 A;  3TS2 A;  1XPU A;  3PO2 G;  4KY6 A;  4B3S Q;  3M9B A;  3T1Y L;  1G6P A;  3W3A A;  1AUX A;  4KY7 A;  1Y1V G;  5JJI A;  2IP4 A;  4XT3 B;  4IPD A;  2J6U A;  1YNJ C;  1XNR H;  2B63 G;  1N36 H;  1WTV A;  3J7A F;  3QOJ A;  1SFO H;  1X3E A;  4EX5 A;  1BF4 A;  3GTP H;  3KOJ A;  2A6E C;  1DOL A;  5KFJ A;  2RHS B;  1XMO H;  1ZYR D;  3ERQ A;  3M7G A;  2RCF A;  3KDF B;  5M3M B;  3IN5 A;  4A3M B;  1B7Y B;  5E4X A;  1KC8 C;  3E3X A;  1FGU A;  5JH7 F;  2W6Z A;  2JA7 G;  2AKW B;  4DAY B;  2F0G A;  1DIK A;  2R7K A;  2K52 A;  4J15 A;  3SE0 A;  1E4G T;  3R5H A;  5T14 A;  1W2B A;  2NVX A;  2HUG A;  3D4W A;  4AYB E;  2PQE A;  4FF4 A;  3TRZ A;  3H4B A;  2F0M A;  1W6K A;  3W5O A;  4JI1 L;  2ZM6 L;  4I55 F;  3BU2 A;  4EQ5 A;  1GGO A;  2HIX A;  3CRK C;  4B3T L;  1WR2 A;  3GIP A;  3QG1 A;  5FLX W;  1ASZ A;  4YJ3 F;  3GTG H;  2V1C C;  4JG2 A;  2WIN B;  3ORQ A;  2FP4 B;  3FDT A;  3NSW A;  3RD4 A;  1JIH A;  2MJ8 A;  2ZTD A;  4HIK A;  2WTF A;  2NVY B;  3S1M H;  4GC6 A;  4DV7 L;  4DPG A;  5BN3 A;  3J81 E;  3S1Q B;  1VQA A;  5IGG A;  4A93 G;  5FD6 A;  2RVL A;  2AQ2 B;  4X66 H;  3MR3 A;  4NPS A;  2NVX H;  3CKI B;  5KFL A;  3CVZ A;  2P0A A;  2WYO A;  2DY7 A;  2M9V A;  2FK2 A;  3CCR A;  1XTC D;  3OIP A;  1QWY A;  3T1Y Q;  3WNZ A;  1V8Q A;  3CPF A;  2EY6 A;  4KLK A;  2PMZ A;  1HJP A;  1LTL A;  5IYD H;  1EUD B;  3WDN A;  4ULL A;  4ECY A;  4R8I A;  1WTQ A;  2VA3 A;  4ODG A;  3RBD A;  2RDG A;  3Q8S B;  3ERO A;  1LLR D;  3I8Z A;  2RGV A;  3BVM A;  5IGE A;  4L5R C;  1TU2 B;  2YV5 A;  2YCH A;  1EQQ A;  1RF2 D;  2ICE C;  4ED0 A;  5DAU A;  2N49 A;  1Y1W A;  5CBA E;  3OW7 A;  3HRZ C;  4QJF A;  3SE7 A;  3BQ2 A;  4KD3 A;  5FLM H;  4YBZ B;  2NVT B;  3PQI A;  3ITP A;  2Q2I A;  2R92 A;  2BQU A;  2ZM6 Q;  5K36 H;  2K5D A;  3M4Q A;  3NWS A;  4JI1 Q;  4JI3 H;  5C44 G;  2DWC A;  2JA5 H;  4B3T Q;  2IY5 B;  5C4H A;  1C7Y A;  4OON A;  4F4Y A;  2EJM A;  5M5W H;  1HHV A;  1H95 A;  4QWC A;  3T16 A;  1Q86 C;  4JI6 L;  4K0K H;  3CCL A;  4DAY A;  1Y1W H;  1BQQ T;  1PLF A;  1ZHQ A;  4FXD A;  1A3V A;  4DV7 Q;  3J7A K;  2F1M A;  1VQH A;  2F3I A;  1WD0 A;  3RZO B;  2A69 D;  1PH3 A;  2R92 H;  3CC7 A;  2ALY B;  2ASL A;  3ULP A;  4OX9 L;  3MWM A;  5FKA C;  1G6Z A;  4EBE A;  2PW5 A;  1PV4 A;  1KIX A;  1HA6 A;  1WTW A;  3B6Y A;  5I4D A;  4PG3 A;  5M3M H;  3A74 A;  4A3M H;  1WCM A;  1DD2 A;  2EJF C;  4GS3 A;  3JSN A;  2IJ0 A;  2NVY A;  5C4J B;  2FIN B;  1V1O A;  2CH4 A;  2EY1 A;  1TVX A;  5A35 A;  1S0M A;  1OXV A;  1SXT A;  5GAG C;  3CMA A;  4A93 B;  4ED8 A;  2K50 A;  4DK6 C;  2VB3 X;  4FBT A;  3GTQ B;  4JI4 H;  1I7L A;  1IW7 D;  1EEF D;  1VQI A;  4F7X A;  1XPR A;  5KG5 A;  1CQF A;  4XZ3 B;  1KJ8 A;  4RB1 A;  1AH9 A;  1N34 H;  4ILW A;  4JBW A;  2VS1 A;  2JA8 B;  2B29 A;  2Z0S A;  1HTL D;  3I3C A;  4A3E H;  3JC6 6;  2K5H A;  4O3P A;  3GIK A;  1PA6 A;  2W6Q A;  5EDW A;  1WCM H;  2CWP A;  2CKZ B;  4UCO A;  2W9A A;  2NVY H;  1Q7Y C;  4LWC A;  3L4K A;  5H1S E;  4LFA L;  3N42 B;  4UFZ A;  5IWA L;  5HGT A;  1ESF A;  5IT9 c;  2DJF C;  1I94 H;  2R85 A;  2IHF A;  2Y0S E;  4IUT A;  3CCU A;  1G51 A;  4JI6 Q;  4DV5 L;  4DF7 A;  4A3J H;  5D1P A;  1B9M A;  1HR0 H;  1VQB A;  1K1Q A;  2CW7 A;  4FF3 A;  3S1N B;  1ROD A;  1LTT D;  3BA9 A;  2KBN A;  4JI7 L;  5KIX A;  1N9W A;  3CQZ B;  2FLP A;  4ZLT F;  4GKJ H;  1A6X A;  2QGQ A;  3LWE A;  3Q6S A;  4OX9 Q;  5M5Y B;  3ND9 A;  5LMN L;  1WH2 A;  4DR6 H;  3I72 A;  1F2Y A;  4NXN L;  1BCP D;  4O42 A;  4ZKB B;  3E0J A;  4A3K H;  4I7H A;  2UXB L;  1EFW A;  2F0P A;  3CC4 A;  1MZB A;  2ALZ A;  2EOT A;  4DR3 L;  3N43 B;  3HOY G;  2XWJ B;  1X3P A;  2JA7 A;  3PN1 A;  4RHR A;  3PO2 H;  1HNW H;  1NNX A;  3VPB A;  3BAB A;  2W6P A;  3RAX A;  2NVT H;  1NCV A;  2B3G A;  1Y1V H;  2D5D A;  4CJ1 B;  3V4S A;  3S2H H;  2B63 H;  3UDX A;  3GO5 A;  4BWS C;  1L0X B;  1SYG A;  1KC7 A;  1S5E D;  3H4D A;  2ID0 A;  1DJR D;  3DMU A;  2R82 A;  1BBW A;  4RB3 C;  2QIL A;  5IT9 E;  1FD7 D;  5IY0 A;  1UUP A;  4EVO A;  3KF6 A;  2NVQ B;  4IZ8 A;  4HJ5 A;  1GKH A;  3ETH A;  2R7Z B;  1V1P B;  4ZOL F;  4DV6 H;  1SJE D;  1X32 A;  1PVO A;  4PZ7 A;  1A0I A;  3KAL A;  2JA7 H;  4EQP A;  1VQC A;  4EQO A;  2SCU B;  2A74 C;  4B3M Q;  4R8U A;  5EPL A;  4LFA Q;  4KHZ A;  5COR A;  5IWA Q;  3RZO H;  3TP6 A;  2IX3 A;  4O1N A;  1JOR A;  4Q45 A;  4JK1 C;  3Q22 A;  2XC9 A;  3GTQ A;  2YU9 B;  3J7Z C;  1YNN D;  4AYB B;  4DV5 Q;  2B8F A;  1BDO A;  1BXT A;  5A2Q L;  1BNC A;  5DGA A;  3J7A V;  4IUU A;  4NDX A;  2KHJ A;  1XDN A;  4JI7 Q;  1CKO A;  5C3E G;  2SOB A;  1HR0 W;  4AQY H;  2LXK A;  3PW0 A;  1AE2 A;  1PFB A;  4G7O C;  3UDI A;  4QF4 A;  1CKN B;  4J0M A;  5LMN Q;  3HOW B;  2E5L H;  5IYB G;  4NXN Q;  2H1E A;  4A93 H;  3NEM A;  1EL0 A;  4JOI A;  3MWD A;  5KG1 A;  3RB6 A;  3QZ8 A;  2E2J H;  2UXB Q;  1STH A;  2W70 A;  3BDO A;  4RGT A;  1HFG A;  2DIK A;  4DR3 Q;  5FJ8 G;  2FLN A;  3RLN A;  3E9H A;  1SLJ A;  3IKJ A;  3RTX A;  4FF1 A;  2XIW A;  2VPQ A;  3HEJ A;  1PK8 A;  3Q2O A;  2Z6K A;  5C5M A;  4DL6 A;  5DLF A;  3AYH B;  1FL0 A;  2FPG B;  1TWG B;  4IUR A;  3Q0A A;  3GTM H;  2NTT A;  4C3I B;  4EGJ A;  2R7N A;  1K83 B;  2B8G A;  2Q8T A;  2YL2 A;  1KLU D;  3A5Z B;  4PZ8 A;  2BDN A;  1FNU A;  4LF9 L;  1G91 A;  5J22 A;  1JB3 A;  5IT9 L;  3GTK A;  1EY5 A;  1CFM A;  2JQO A;  2B2W A;  4ED7 A;  1VQ7 A;  1TY0 A;  2F0O A;  1WTX A;  3S1N H;  4V19 0;  3Q8D A;  1PH2 A;  5FO8 B;  1N33 L;  4R4O A;  1Z47 A;  4QGU A;  5M5Y H;  5C44 H;  4JBK A;  4DV7 H;  1LUZ A;  2HCC A;  2YTY A;  4LF8 L;  1SYD A;  1SCU B;  1TS4 A;  1BR9 A;  3L0O A;  2XNA C;  3TZD A;  1V1P A;  2R7Z A;  1IOW A;  3GTK H;  4I50 F;  4LFC H;  3V05 A;  2KHS A;  3HOV B;  3DWP A;  4MV9 A;  1EFI D;  1XX8 A;  3ZJY C;  2CW8 A;  1E2W A;  2W6O A;  4DV4 H;  4E6I A;  2G5D A;  4C3H B;  3RBE A;  1KDC A;  5FD5 A;  4JOI C;  2CW0 C;  3KBG A;  4ECW A;  2IL8 A;  2LMC B;  2OXP A;  4B08 A;  3M3Y B;  2NVQ H;  3MXN B;  4WFN 3;  1CKN A;  3NEN A;  3J80 i;  4DFA A;  4EYI B;  4ECX A;  3NPP A;  5J3B A;  4M9U A;  4LF9 Q;  2UUB L;  1GHK A;  4JI8 H;  1GUT A;  1TT2 A;  3VR3 A;  5KG6 A;  3R3O A;  3CF5 A;  3HOX G;  1JDE A;  3GLK A;  3K58 A;  2KVM A;  4TSS A;  2Z4I A;  2YZG A;  2R6G A;  1IZ6 A;  2DGY A;  3DM1 A;  4KJN A;  2PNH A;  1N33 Q;  2CFM A;  4EEQ A;  3KYH C;  2R6F A;  5ELE A;  1SMY C;  3MR2 A;  3GTJ H;  1BJT A;  4LF8 Q;  1PZI D;  3ZYY X;  1YI2 A;  3SEB A;  3H3V I;  3CPW A;  2R7F A;  4UP7 A;  5EBD A;  3QZ7 A;  3Q23 A;  1TAE A;  1DCZ A;  5I2X A;  2QW7 A;  1KJI A;  2QCP X;  1EU3 A;  4F8M A;  2Z4H A;  1I6H H;  1STG A;  3NXW A;  4WJ4 A;  4DL2 A;  4JW0 A;  1AE3 A;  3MC0 B;  1PFM A;  4HNV A;  1K8O A;  2UXD L;  2SNS A;  1S40 A;  4MZ9 A;  5IP9 G;  3IRB A;  1M7J A;  3G8C A;  5ELB A;  1PX2 A;  4YP3 A;  3OTO H;  1JJG A;  4X64 L;  3HOY H;  1S97 A;  1B70 B;  4J6H A;  5LYJ F;  4DN4 M;  1HUM A;  2UUB Q;  3KLS A;  1VBH A;  4A3D G;  5T1G A;  3QOL A;  2VNU D;  1SMX A;  2NWG A;  1TWH B;  3OW2 A;  3TP8 A;  3H20 A;  1STY A;  4IFD I;  4O3O A;  4GNX B;  2F4V Q;  5IE8 A;  4X3U A;  1Z2O X;  2DJG C;  4J8Q A;  1Q82 C;  2YTX A;  1PH5 A;  4JV1 A;  3MXN A;  3RN2 A;  2JEB I;  4YY3 H;  2L0C A;  3VR4 A;  1RIP A;  2VZA A;  4NMZ A;  2VOB A;  3T13 A;  5EZY F;  4F88 A;  2DNE A;  4DV0 L;  4JI7 H;  3D0F A;  4ED3 A;  4C3H H;  1STB A;  2RDF A;  4YCW A;  3VR5 A;  1Q81 C;  1G29 1;  1QZH A;  5IGB A;  5LMN H;  4JI2 H;  2PO4 A;  5J1Z A;  4NXN H;  4MTE A;  2ATL A;  2XRQ D;  3W2D A;  4MV3 A;  2RSN A;  1LT5 D;  2RA4 A;  1ZYR C;  3VR2 A;  4ED1 A;  5DGB A;  1TII D;  2I5L X;  4K8J A;  5C3E H;  4RA8 A;  4DR3 H;  3PUW A;  2E8G A;  3TME A;  2A8V A;  4R7R A;  2UXD Q;  4HIO A;  1L2Z A;  2NN6 I;  5IYB H;  3MJF A;  2P5Z X;  2XCL A;  3PO3 G;  3F8T A;  3AFP A;  3RGZ A;  5KG2 A;  4YAK B;  2EYH A;  2VQF L;  3TII A;  4X64 Q;  5FJ8 H;  5JUM A;  2EY5 A;  2JJQ A;  4OHJ A;  4X65 L;  2SEB D;  3HB9 A;  3K3V A;  2XGT A;  1UEB A;  3K5O A;  4POF A;  2AGO A;  4BBR G;  4IFD G;  1MBY A;  3HBL A;  3RN5 A;  2G9D A;  1C9O A;  2DPJ A;  1B4O A;  3EFX D;  1YIT A;  2H5X A;  4A3C G;  1JMC A;  1LV9 A;  4HSP A;  5K2M A;  3D31 A;  2UXC L;  2O5I C;  1H9R A;  1JQY D;  1V4Y A;  4J1M A;  4O0A A;  4I65 A;  1D5X C;  4UHV A;  3I90 A;  2FHT A;  2V58 A;  1NR4 A;  1KDB A;  2W9B B;  2HVQ A;  3OSO A;  1K28 A;  5LA6 F;  4L8J A;  3F8N A;  3JAM c;  4DV0 Q;  4DUZ H;  1MGS A;  3QR8 A;  4UCV A;  3HP3 A;  4POG A;  3R8B A;  4U6P A;  2ZTE A;  2K7V A;  4JI0 Q;  1M1K C;  3I4N G;  3ICE A;  1E4E B;  1TWH A;  1LTG D;  1A2U A;  3HKZ G;  5CC4 A;  2QEX A;  4GNX A;  1RHP A;  3EVQ A;  2B2Y C;  3M4P A;  1A63 A;  4RHS A;  3U9S A;  5CR3 A;  5LMN W;  2QF7 A;  1VQL A;  1YJW A;  4IUV A;  2RDH A;  3RGX A;  2KUM A;  5L1J A;  5IOC A;  2NN6 G;  5FPR A;  2D9U A;  3N41 B;  2XCP A;  5F2D A;  3EIV A;  5CV4 A;  3T56 B;  2Q2T A;  5LMU L;  3M9N B;  2ES2 A;  2QDL A;  2K28 A;  5BR8 L;  4DR7 L;  1R4P B;  1RTO A;  2UXC H;  4O2A F;  2E2I H;  3H40 A;  3A7L A;  1IBL H;  4TQR A;  2VQF Q;  2CCZ A;  3NTI A;  3MZ5 A;  1TWH H;  2AGQ A;  1KTK A;  4HJ9 A;  4X65 Q;  4Q43 A;  5FO7 B;  1PHJ A;  1X3Q A;  2YZN A;  4O2D A;  3VPD A;  3PIO A;  2W57 A;  1HTP A;  2B2V A;  4Q0F A;  4ME5 A;  1NTG A;  2A68 C;  1NUC A;  4IJL A;  3BG3 A;  2F0S A;  3NTH A;  4CBV A;  3UE0 A;  4DV2 H;  4A3B G;  2UXC Q;  1R4Q B;  2A69 C;  4X3T A;  2KA7 A;  4YR0 A;  2IHE A;  3MVV A;  2EYO A;  3BDL A;  4PMC A;  2JP1 A;  1FJG L;  3MXG A;  4LF8 H;  1D8L A;  3SK5 A;  1I4Q A;  1QCB D;  2ZXP A;  2IT1 A;  1BO0 A;  2HIV A;  2R7D A;  4LJZ C;  4R4T A;  3OSP A;  2WB1 G;  4C5A A;  2E76 C;  3HOU B;  5A2Q W;  2B2T C;  1J6Q A;  1HFN A;  3N6R A;  1GYF A;  1B3A A;  1ICW A;  4ZKC B;  2E2H B;  4KKU A;  1T5E A;  3NWT A;  4NW2 A;  3RR5 A;  4FYD A;  2LKV A;  4HQ6 A;  1WTH A;  4DR2 L;  3K81 C;  4JI5 L;  3MWE A;  1F2Z A;  4APM A;  1GO3 E;  3KJO A;  5CV9 A;  2PQA B;  1IW7 C;  1YJ9 A;  1T5X D;  3N40 P;  2W9B A;  1I6V C;  5HUR A;  5LMU Q;  1SNQ A;  2A5H A;  5J2T F;  5BR8 Q;  3M4O H;  3HKS A;  4DR7 Q;  4IPC A;  5DQI A;  4YHH H;  2K6A A;  1TR5 A;  1R9T B;  4HIM A;  2FMC A;  1B53 A;  2HHH L;  2ZT9 C;  5CGK A;  4CJ0 B;  3G6J B;  4HID A;  5JAV A;  2O5J C;  2NUC A;  2O03 A;  3AQQ A;  4MV8 A;  1E2V A;  5JVL A;  3DM3 A;  4O4L F;  4OWW B;  2RSO A;  1FGB D;  1NBW A;  3G6Y A;  3BS1 A;  3U9T A;  5EKL A;  3HKZ B;  1XMQ H;  2UUA L;  1F2L A;  1Y69 U;  5IP9 H;  4YR3 A;  3M9M B;  3FMA A;  1FVI A;  1KRS A;  2KCC A;  3MAQ A;  2B2U C;  2L5T A;  5JPM C;  1PRT D;  2NU8 B;  5IT9 W;  1NAP A;  3TRE A;  1B3Q A;  4OL7 A;  3L2P A;  1LTS D;  1SE2 A;  4XXE A;  2C28 A;  3JAM L;  4A3D H;  1CTM A;  1KAW A;  4Y8V B;  5DG9 A;  4MV7 A;  1YHB A;  5HY6 A;  5M5X B;  2JXM B;  2OQ0 A;  1HZ9 A;  2WP8 J;  2MPM A;  4DXF A;  3ULL A;  5G3L F;  1MD2 D;  4K8I A;  1VMC A;  2RDJ A;  5LXT F;  1BUV T;  2UUC L;  4K5V A;  4P71 A;  4GLA C;  4Y52 H;  4BY7 G;  4HYK A;  3MWY W;  2PCF B;  1F9Q A;  3NUC A;  4GN4 B;  4KJO A;  2KEE A;  3L3O C;  4P74 A;  5JJZ A;  2JN4 A;  4DR2 Q;  4JI5 Q;  4G7H C;  4LK1 C;  4BS9 A;  4DV1 Q;  2HCI A;  2D2C C;  2XCA A;  1SE3 A;  3QJY A;  4FBU A;  1VS0 A;  2EJG C;  4H7B A;  2NZO A;  4P75 A;  3J81 c;  5KFE A;  1IOV A;  4H13 C;  4EQN A;  1Q8I A;  1RKN A;  1WTP A;  5DQG A;  1K73 C;  4F4X A;  2WB1 B;  3OHB A;  5C0X I;  2HHH Q;  2E2H A;  3CCE A;  3I7F A;  4LAA A;  3TEH B;  2JEA I;  4GKK L;  4BWG B;  3LNN A;  3C1E A;  2UUA Q;  4N9P A;  1HZB A;  1L1O C;  2AQ4 A;  3L4J A;  3PO3 H;  1T9H A;  2DUD A;  4RZR A;  3PSI A;  2PQA A;  1YHQ A;  2F0N A;  4EFE A;  1YNN C;  3K8A A;  4J9O A;  2F0U A;  2HQE A;  1EWH A;  2K5N A;  2HD3 A;  1EYZ A;  1PH1 A;  3H3V C;  4X6A H;  1R9T A;  2K14 A;  2KCN A;  4BBR H;  3S1R B;  2FMM A;  2E2H H;  4IFD H;  3R93 A;  2RBM A;  3K7U C;  1JOO A;  3OWF A;  3HKZ A;  4A3C H;  2PPB C;  1VF7 A;  4JUZ A;  1ZQ7 A;  4DV0 H;  3EBE A;  4O3R A;  1BVS A;  1GUN A;  2NU7 B;  2QYZ A;  3RB3 A;  3EQL C;  1BNZ A;  2UUC Q;  2PI2 E;  4QIW E;  1O75 A;  4MTK A;  1SEB D;  4DLK A;  1U4R A;  1WD1 A;  5KFC A;  4OXP A;  1JJC B;  1VQD A;  2WAQ G;  2MP1 A;  3KLW A;  3UQ8 A;  2JA8 G;  1UNS A;  1LT4 D;  5KFF A;  4TRD A;  1GSO A;  2ATW A;  3I4N H;  3ER0 A;  3VYT A;  5KG3 A;  1X3F A;  5C0X G;  3G4S A;  1HQM C;  1WJJ A;  3T53 B;  1RK5 A;  4LF7 Q;  2NN6 H;  1DV2 A;  3PGZ A;  1SYE A;  4IFD J;  2M05 A;  1JWS D;  1RCV D;  1S9F A;  4IRD A;  3MHB A;  4GKK Q;  4MA0 A;  4BY7 B;  1CM9 A;  4DR5 L;  2WII B;  4X65 H;  1K8M A;  2K32 A;  3GTL B;  4DL4 A;  4IWX A;  1XYI A;  1G2S A;  1T3N A;  1HCZ A;  2R86 A;  3JRW A;  4DR1 L;  3FKI B;  1E4F T;  2FMA A;  3T4A C;  3S15 B;  4MIU A;  1VQK A;  2EYM A;  4YWL A;  3LWB A;  5M5X H;  3WO1 A;  4K2K A;  1C8C A;  4OO1 G;  3Q24 A;  2WB1 A;  5JVG 3;  3GIQ A;  5LOV F;  3OWE B;  3J80 E;  4HJA A;  2PVP A;  4L6T B;  4LF4 L;  3KAK A;  3FRP B;  2DY8 A;  1O78 A;  1SJH D;  3KDF A;  5EAY A;  3STB C;  3NQT A;  4IAL A;  2A68 D;  4A3B H;  1IYV A;  4Y7N B;  4KHP L;  4K14 A;  3N44 B;  1D5M C;  4BY1 G;  1AW7 A;  4HJ8 A;  3CCS A;  3JSL A;  3J81 L;  2XGQ A;  4R4Q A;  2UU9 H;  2N78 A;  3V6H A;  1LT3 D;  2EVB A;  2BE5 D;  2ZDH A;  1LAB A;  1A3U A;  1NY4 A;  2KQ3 A;  5KT7 A;  2G9H D;  2N88 A;  3PUY A;  1VQ9 A;  4RKB A;  1GM5 A;  3OMC A;  2BDO A;  2A19 A;  3HZX A;  3TIN A;  5BR8 H;  1EY4 A;  4DR7 H;  2O2L D;  2FXQ A;  2R7Z G;  2VW9 A;  2SNM A;  3TN2 A;  4DR4 Q;  3QIA A;  4TUY F;  2RDI A;  5BN4 A;  1GUO A;  2FPP B;  2W6M A;  2BA1 A;  1E0B A;  4DR5 Q;  2Z9H A;  5L9X A;  3GID A;  1DON A;  4AYB G;  4X3S A;  5D3I B;  4RWS C;  4A3G G;  4PMB A;  5DM7 3;  1YZ6 A;  2WAQ B;  3MTS A;  5I47 A;  3LWU A;  4LH6 A;  3VR6 A;  1WVL A;  4DR1 Q;  5HV6 A;  1Y14 B;  1BXR A;  1V51 A;  1KL9 A;  4NXM H;  2A73 B;  4B9W A;  1XPO A;  4N9T A;  1CA5 A;  2MO0 A;  3NGD A;  1CQV A;  1SRU A;  2GLT A;  3HOW G;  4LF4 Q;  4A3I B;  4QUF A;  4B3M L;  3S1Q H;  4CKB A;  1FJG H;  3BZK A;  2EPB A;  3RF2 A;  1XNQ L;  5K5P A;  4QWB A;  4QCL A;  1HUN A;  2UVV A;  1D5Z C;  5L1I A;  4J9Q A;  4JCV E;  5KG0 A;  1TWF B;  3KHR A;  1ONL A;  3TDQ A;  4KHP Q;  2QKI C;  5E3F A;  1TA8 A;  3MR6 A;  4C3I G;  4DR2 H;  1J5E L;  4JI5 H;  2NB0 A;  1EOT A;  4LFB L;  1S5C D;  2IWH A;  4B3S H;  1YJN A;  1KDA A;  1PTO B;  1SE4 A;  3TZU A;  1IBM L;  2R7L A;  1ICF B;  4IQZ A;  4BY7 H;  2L12 A;  3I70 A;  2WE6 A;  3QO2 A;  2F0K A;  3LML A;  3DEO A;  4QMG A;  1Y8N B;  3GIM A;  4XX0 B;  1BKB A;  2ENB A;  2XN9 C;  3KK7 A;  1VQ5 A;  1AEX A;  3G7L A;  1AZP A;  1TKW B;  5EGT A;  4BY1 B;  2HT1 A;  5KFZ A;  3GIJ A;  1XWE A;  1IYJ B;  4IOA A;  1JR0 D;  3SI8 A;  1NSN S;  3I2Z A;  4BXX G;  1Q46 A;  4RAY A;  3T1H L;  3NTK A;  3NBH B;  2Q8I B;  4NLG A;  5KFY A;  2R8H A;  3MEH A;  1MSG A;  1PTO F;  1QNU A;  4YWM A;  1JX4 A;  1WSC A;  3HOV G;  5GRO A;  4WBN F;  4Y7N H;  2XTI A;  5M3F B;  2OTL A;  1AN7 A;  4DNR B;  1F9P A;  1XNQ Q;  4FO2 A;  4C3H G;  1W93 A;  5IGC A;  1W3S A;  5DLQ E;  5KFO A;  2WAQ A;  4A3G B;  4LSA A;  3FVQ A;  4MV1 A;  1VQ8 A;  3BA8 A;  2VA2 A;  2A1A A;  3K0X A;  5C4X B;  2KSW A;  1RL2 A;  4LSX A;  3GII A;  4DA2 A;  3L9A X;  3KJP A;  1QZG A;  2GVA A;  1FNV A;  1I50 B;  1J5E Q;  4DV3 L;  1JWU D;  3SK4 A;  3S17 B;  3FP9 A;  2I80 A;  3TSS A;  4RGM A;  5C4J H;  1Q1B A;  2FFK B;  4LFB Q;  4ZAI A;  3RV3 A;  3T1Y H;  3E5S A;  3UFX B;  1IBM Q;  4RCN A;  2AUK A;  3GV7 B;  4QIW B;  2JE6 I;  3GTQ H;  1ILQ A;  1JLL B;  1S3O A;  1TWF A;  2R8J A;  3OUU A;  2JA8 H;  5FLX c;  3AEV A;  4KV6 A;  1PH4 A;  5JJL A;  4GKK H;  3BJU A;  3CQZ A;  5C0X H;  4FVM A;  4YB8 B;  2RGR A;  1DGS A;  4P73 A;  1FNW A;  5KFS A;  1OXX K;  3T1H Q;  3K5H A;  4LF5 Q;  1B50 A;  2AHO B;  3R2I A;  1PYS B;  4L1K A;  3A8I E;  1SEI A;  2V4Q A;  1SR3 A;  4YWK A;  5AJ3 L;  2L55 A;  2ZM6 H;  4JI1 H;  2I5M X;  4B3T H;  2NYZ D;  5GAD C;  4OIJ A;  4ZUJ A;  1TWF H;  4UP8 A;  2KHI A;  3EA6 A;  1VF5 C;  2V4D A;  2I0Q A;  2R7M A;  2V5A A;  4IWY A;  3JAM W;  3BVG A;  3IAY A;  3CQZ H;  5KFX A;  4CDC C;  4YAJ B;  4OO1 H;  2DPI A;  1YHA A;  1VAJ A;  2OQK A;  4EYH B;  3TS0 A;  4KHV A;  2Q2H A;  2IX0 A;  5IYC G;  2XD4 A;  2FJ2 A;  2F03 A;  4C2M B;  4HAE A;  4CJ2 C;  5C0X J;  3V4Z A;  4DV3 Q;  1YNX A;  4FP5 D;  4WJ3 M;  1E1O A;  3NP8 A;  4EG0 A;  3CCV A;  3FHW A;  3STB D;  5FLX E;  5BMV F;  3U58 A;  4FDB A;  4O3N A;  4MTD A;  4UY8 C;  4DKA C;  2Q8R E;  1GUW A;  4LUO A;  4BY1 H;  2PZU A;  5G3L D;  2YU9 A;  1QOH A;  1U5K A;  4AYB A;  3RZD B;  1AFP A;  1SNP A;  1CSQ A;  1O7Y A;  4AIM A;  3SVM A;  4H44 C;  4DK3 C;  5EKI A;  1VQG A;  1EWI A;  5CBE E;  1CHQ D;  4UDU C;  1I50 A;  3GV5 B;  5ELD A;  2R7Z H;  3I12 A;  2Z6K C;  1LTA D;  4HTH A;  3RIZ A;  2R8K A;  2HDL A;  3PUV A;  4QIW A;  5AJ3 Q;  1SNM A;  2YU9 H;  4A3G H;  1KXL A;  4MAM A;  4LF4 H;  2F0L A;  3G6E A;  4KKS A;  4B3R L;  2K4K A;  2F4V L;  4QWD A;  3GV3 A;  3EN2 A;  3E5N A;  3PCO B;  2B2W C;  4C3J G;  1TWA B;  1TWG A;  2NU9 B;  4JI6 H;  1K83 A;  4A76 A;  4G4K A;  1EZ8 A;  3I4M B;  3MFY A;  5D65 A;  1EY7 A;  3P7J A;  5IP7 G;  3HOW H;  4UCT A;  1S0N A;  3D4D A;  1N48 A;  2IPK D;  5D3D A;  5M9O A;  4B9X A;  5J39 A;  5KG7 A;  5DEH A;  4PZ6 A;  4OX9 H;  4KN4 C;  2Y0S B;  4BA2 I;  1JC7 A;  4E4T A;  1PXU A;  2EYP A;  5KFQ A;  4MV6 A;  4J9S A;  3ORR A;  4UCS A;  1TWG H;  1AZQ A;  1SBB B;  1VQF A;  1X3G A;  2EYF A;  4C3I H;  1F77 A;  2N55 A;  3N52 A;  1K83 H;  2GA4 B;  1S4Z A;  1E24 A;  4LMY A;  3G6V A;  4GOP B;  4OIK A;  3RLO A;  1O7L A;  2F4I A;  3KBX A;  4DAV A;  2R8G A;  3CCQ A;  3F2U A;  1PRT C;  2YRW A;  1EZ1 A;  4LW1 A;  2JEJ A;  1GSA A;  2ICI A;  2DZD A;  5KFU A;  4IPH A;  1A3T A;  5ELC A;  2K5Q A;  2F0E A;  1B6R A;  1WTO A;  3CRL C;  5D14 A;  4ED6 A;  2V59 A;  4TV9 F;  1TXY A;  4QW8 A;  3DUZ A;  2F0V A;  4RG1 A;  1EIG A;  2VB2 X;  4Q8E A;  4BXX H;  4IHJ F;  5IYZ F;  3C0F B;  4B3M H;  4B3R Q;  4GN5 A;  1KJ9 A;  4LFA H;  1N36 L;  1Y8O B;  3K57 A;  5IWA H;  2VUG A;  1CSP A;  2YRX A;  1XNQ H;  2QEJ C;  4RFB A;  1EIF A;  1IHZ A;  4MTN A;  3TQY A;  2WKD A;  4DV5 H;  3K3P A;  1XMO L;  3HOV H;  1TWC B;  4LF6 Q;  1LT6 D;  2AMC B;  3PUZ A;  2L4N A;  4X3K A;  4JV5 L;  4EGV A;  1OO9 B;  4I4T F;  3FPU B;  2WDT A;  1MKH A;  2PMZ E;  4FNF A;  3S16 B;  1GD7 A;  4JI0 L;  4IR1 A;  1VQM A;  3J81 W;  3DLL A;  2W9C B;  4YR2 A;  3MFI A;  3K5M A;  1KLG D;  3M3Y H;  4C3J B;  2UXB H;  2MO1 A;  4HMI A;  4DNI A;  3K6O A;  3RAQ A;  1EWC A;  1S5D D;  5CV6 A;  1TS5 A;  1CZW A;  3KLR A;  4LNQ A;  2AWN A;  1XJV A;  3KFU A;  4M7E A;  4L63 B;  4G57 A;  3DXJ C;  1D6E C;  5KYL A;  4EBC A;  2Y0S A;  4X66 L;  3A54 A;  3UDF A;  3T1H H;  3LP8 A;  4X62 Q;  4ZYS A;  1ZEQ X;  3A8J E;  3HOU G;  4U68 A;  3A8K E;  4PDB A;  2W7P A;  2R93 G;  2ZTC A;  2FK3 A;  3GDE A;  2KCM A;  4GOP A;  4MN3 A;  4JC0 A;  1XNR Q;  3PZP A;  1N36 Q;  2L15 A;  3VA5 A;  2I87 A;  1K9M C;  1UE1 A;  3BAA A;  1EYG A;  1JOK A;  1XMO Q;  1S72 A;  4RB2 C;  4JV2 A;  2EIF A;  4WJW A;  1BCP B;  2VUM G;  3K5I A;  2WAC A;  5KT2 A;  5KX5 F;  3L7Z C;  4XT1 B;  4JV5 Q;  1EZ6 A;  1AUV A;  1CKM A;  3NE5 B;  1GJX A;  1RYS A;  2AUJ D;  3GP7 A;  2A6H C;  1EU4 A;  2ZXO A;  4DV3 H;  1VQ4 A;  3I73 A;  3UDG A;  1UNN C;  2OEO A;  2RHQ B;  4ID6 A;  4DUY L;  1XTD A;  2XVS A;  1Z7T A;  1PDQ A;  4RUC A;  5IYC H;  1GXD C;  3RV4 A;  5CAE B;  3WO0 A;  2IA6 A;  1TWC A;  3GQC A;  5KNB A;  3H0G B;  1HH2 P;  2XWB B;  4QL5 A;  4R4I A;  3AFQ A;  3I91 A;  3C1F A;  1BCP F;  2R8I A;  1EIY B;  1DXM A;  1J8I A;  3OPO A;  4S3S A;  1LO5 D;  4X66 Q;  1HZC A;  2YS6 A;  5JVD F;  4OEL B;  1SYC A;  2W9C A;  2J6S A;  4H0L C;  3SR1 A;  5KFG A;  4LF9 H;  5KFW A;  4RNN A;  4IAJ A;  5EWE A;  2BH2 A;  5KGU A;  5LL6 b;  3KAJ A;  1TWC H;  4BBS B;  4F4Z A;  3I4L A;  3Q8R B;  1UEA B;  3HOZ B;  1Q1E A;  3I4O A;  1QVF A;  4ME6 A;  2UVW A;  1N33 H;  2RF4 A;  4DL5 A;  5EWG A;  4K6L A;  1JE5 A;  2K5W A;  3S16 H;  4J9P A;  1QG7 A;  1O7I A;  3EPI A;  1GHJ A;  1VQJ A;  2BE5 C;  1IL2 A;  5F9N A;  3O13 A;  4JI4 L;  1CI3 M;  1SFO B;  4RU9 A;  5LHY 1;  4L5T A;  2VQD A;  4C3J H;  1A9X A;  4HNT A;  1U0L A;  1N34 L;  1B1Z A;  4OEM B;  1K8G A;  1RJT A;  4C5C A;  5C5J A;  1EQV A;  2R93 B;  2RQX A;  1GLV A;  1GSH A;  2X0S A;  1P8L A;  5IP7 H;  1KEE A;  3RB0 A;  4DUY Q; 
#chains in the Genus database with same CATH homology
 4P72 A;  4YHH Q;  4DR1 L;  3S24 A;  4DV1 L;  4GNX C;  2KHJ A;  3A5U A;  4C2M H;  4JI7 Q;  1CKO A;  5C3E G;  1HR0 W;  1MJC A;  1VQK A;  2LXK A;  4A3F G;  4YWL A;  2Q2U A;  1AE2 A;  5M5X H;  3H0G G;  1I94 L;  3UDI A;  4OO1 G;  1CKN B;  5LMN Q;  4HJA A;  1XMQ Q;  4LUV A;  5IYB G;  3F2B A;  4LF4 L;  4NXN Q;  4DAM A;  4A93 H;  3NEM A;  1NMF A;  4JOI A;  2IX1 A;  3KDF A;  5EAY A;  2E2J H;  3RZD H;  2UXB Q;  4LUZ A;  3STB C;  4DR3 Q;  1NJI C;  5FJ8 G;  3RLN A;  4A3B H;  1KRT A;  1VQN A;  3E9H A;  1LYL A;  1SLJ A;  3CXC A;  3PF4 A;  2Z6K A;  3H15 A;  3AYH B;  4KHP L;  1FL0 A;  4BY1 G;  4HJ8 A;  2JK8 A;  3CD6 A;  3CCS A;  4DR6 L;  3OYY A;  1GVP A;  4GLV B;  3G71 A;  3GTM H;  1MJE A;  4BBS G;  5JJK A;  4R4Q A;  2N78 A;  1Z9F A;  3HOZ G;  1NY4 A;  1K0R A;  3A5Z B;  2EXD A;  4PZ8 A;  4GLX A;  3U4V A;  3PUY A;  4LF9 L;  5JEA J;  1VQ9 A;  1GM5 A;  3W1B A;  2VY3 A;  2A19 A;  1X65 A;  2FXQ A;  2JQO A;  2R7Z G;  2VW9 A;  4JI4 Q;  3SGI A;  2WB1 E;  1VQ7 A;  4DR4 Q;  3E0E A;  3S1N H;  3Q8D A;  4XIG S;  1PH2 A;  1WOC A;  4L5Q A;  1TWA H;  2EQS A;  1N34 Q;  4JBM A;  1N33 L;  2BA1 A;  3KF8 B;  4DR5 Q;  1X55 A;  4R4O A;  1Z47 A;  4QGU A;  1PH6 A;  4AYB G;  3I4M H;  5M5Y H;  5C44 H;  4JBK A;  4A3G G;  1YZ6 A;  2HQL A;  4YCU A;  1LUZ A;  4YCV A;  2YTY A;  4DV6 L;  4LF8 L;  2K5V A;  4DR1 Q;  1Y14 B;  3FKI G;  2YYZ A;  3L0O A;  1KL9 A;  4IJH A;  3CC2 A;  1QVC A;  1XPO A;  3PF5 A;  3GTK H;  2MO0 A;  1KHI A;  1K3R A;  1I94 Q;  1SRU A;  2ZJQ A;  3ZJY C;  4OWT B;  3HOW G;  4LF4 Q;  4B3M L;  3S1Q H;  1QUQ B;  2NZH A;  1HR0 Q;  4LF7 L;  4A3L H;  3BZK A;  1XNQ L;  3U50 C;  1OXT A;  4JOI C;  2RCN A;  4JCV E;  3RLF A;  2ZJR A;  4JI3 L;  4KHP Q;  1SE8 A;  2E5L L;  2N3S A;  2NVQ H;  4DR6 Q;  3MXN B;  1YEZ A;  2D62 A;  3A0J A;  1EUJ A;  3PV0 A;  1J5E L;  1CKN A;  1UE7 A;  3NEN A;  3J80 i;  1E3P A;  4LFB L;  3HOU H;  5J3B A;  4K0K L;  1YJN A;  4LF9 Q;  2UUB L;  1IBM L;  1HNW Q;  4OO1 I;  3F2D A;  2R93 H;  4BY7 H;  3CF5 A;  5IYD G;  1L1O B;  2GVB A;  1A63 A;  1V43 A;  3HOX G;  1VQO A;  4H02 A;  2LSS A;  4R1J A;  1IXR A;  1BKB A;  2R6G A;  2UU9 L;  1IZ6 A;  2DGY A;  4OWX B;  1VQ5 A;  2PNH A;  2JA6 G;  4A4I A;  3W1G A;  4MNO A;  3J80 c;  1N33 Q;  2CFM A;  1WI5 A;  4RMF A;  2HT1 A;  5ELN A;  1VQP A;  4DR7 Q;  1UWV A;  3KYH C;  2VUM H;  1IYJ B;  4IOC A;  4IOA A;  3I2Z A;  3GTJ H;  4GN3 B;  4LF8 Q;  1Q46 A;  4BXX G;  4DV6 Q;  1YI2 A;  3GD7 A;  3T1H L;  1R9T H;  3H3V I;  3CPW A;  3S2D H;  4GOP C;  2R7F A;  3NBH B;  5E7N A;  4UP7 A;  4JBJ A;  1PH7 A;  4JYA L;  5FLM G;  3J81 j;  4YWM A;  3HOV G;  5GRO A;  4TVA B;  5K36 G;  3F2C A;  4DR4 L;  2K75 A;  4A3I G;  2JA5 G;  2I5H A;  4KI0 A;  4Y7N H;  2XTI A;  1I6H H;  2OTL A;  1JB7 A;  3MEF A;  4WJ4 A;  1XNQ Q;  2ASB A;  1AE3 A;  3F1Z A;  1W3S A;  5DLQ E;  2VQE L;  2YTV A;  4AQY Q;  4NXM L;  2UXD L;  4LFC L;  1S40 A;  4MZ9 A;  1VQ8 A;  2KCT A;  1WYD A;  5IP9 G;  4JI3 Q;  1Y1W G;  3IRB A;  2A1A A;  2E5L Q;  3K0X A;  1RL2 A;  3M7N A;  4DV4 L;  3KJP A;  3HOX H;  1QZG A;  2GVA A;  3G48 A;  1JJG A;  4APV A;  1J5E Q;  4DV3 L;  1VQ6 A;  2R92 G;  4X64 L;  3HOY H;  3FP9 A;  3E9I A;  1B70 B;  2MFI A;  1Q1B A;  5C4J H;  4LFB Q;  1A62 A;  4K0K Q;  1QUQ A;  1OXS C;  2UUB Q;  2CWA A;  1IBM Q;  1HR0 L;  4A3D G;  3GTQ H;  2JE6 I;  2VNU D;  1X9N A;  1SMX A;  1PFS A;  1S3O A;  5M3M G;  3OW2 A;  4A3M G;  3GTO H;  2UU9 Q;  4IFD I;  1A8V A;  4GNX B;  1X56 A;  5IE8 A;  2F4V Q;  4GKJ L;  2JA8 H;  5FLX c;  2YTX A;  1Q82 C;  1PH5 A;  1PH4 A;  3AEV A;  5JJL A;  1HNZ L;  4B3S L;  4A75 A;  1KD1 C;  3BJU A;  3RN2 A;  2JEB I;  1B8A A;  4JI8 L;  1SRO A;  1DGS A;  1RIP A;  2VZA A;  2WAQ E;  4P73 A;  1CUK A;  1EQR A;  1V9P A;  3LGJ A;  4IPG A;  1OXX K;  3T1H Q;  4LF5 Q;  1XNR L;  4DV0 L;  2AHO B;  3D0F A;  1PYS B;  2QA4 A;  4JYA Q;  3RNU A;  1HNW L;  1SR3 A;  4C3H H;  1L1O A;  4YWK A;  5AJ3 L;  4YCW A;  2OCE A;  4A3E G;  1G29 1;  1Q81 C;  2I5M X;  1QZH A;  1KQS A;  1E22 A;  1X6O A;  3CP0 A;  5GAD C;  1WCM G;  2N8N A;  1TWF H;  4TQU S;  4UP8 A;  1PH9 A;  2KHI A;  5M3F G;  4L5S A;  2I0Q A;  2I5L X;  1Q12 A;  5C3E H;  1L0W A;  4A3F H;  3CQZ H;  2VQE Q;  3H0G H;  1OTC A;  3PUW A;  2E8G A;  2A8V A;  4NXM Q;  2UXD Q;  4HIO A;  4LFC Q;  1YHA A;  2NN6 I;  2OQK A;  5IYB H;  4A3J G;  3TS0 A;  3F8T A;  3PO3 G;  3AFP A;  3S1R H;  1HZA A;  2Q2H A;  2IX0 A;  5IYC G;  5C4X G;  2VQF L;  4DV4 Q;  3KF6 B;  5C0X J;  2OWO A;  1FJG Q;  1E1T A;  4DV3 Q;  3BZC A;  1SN8 A;  1YNX A;  4PMW A;  5FJ8 H;  4X64 Q;  1K8A C;  1E1O A;  4WJ3 M;  1P16 A;  3CCV A;  2JJQ A;  3FHW A;  3STB D;  1MIU A;  4X65 L;  3U58 A;  2XGT A;  4FDB A;  1UEB A;  3I55 A;  5GAE C;  4UY8 C;  4DKA C;  4LUO A;  4POF A;  3CCJ A;  4BBR G;  2MNA A;  4BY1 H;  4IFD G;  1U5K A;  3H3V H;  4A3K G;  4BBS H;  1LM0 A;  3RN5 A;  3JAM i;  1C9O A;  1CSQ A;  1YIT A;  4AIM A;  2H5X A;  3OTO L;  4AQY L;  1JMC A;  3HOZ H;  4DK3 C;  4A3C G;  4GKJ Q;  3D31 A;  3CCM A;  2UXC L;  3TS2 A;  3PO2 G;  1XPU A;  1VQG A;  1EWI A;  1HNZ Q;  4B3S Q;  1I5F A;  3M9B A;  3T1Y L;  1E7Z A;  4O0A A;  1G6P A;  4JI8 Q;  2AWO A;  3PUX A;  2R7Z H;  1Y1V G;  5JJI A;  4IPD A;  2Z6K C;  2B63 G;  1NE3 A;  1SFO H;  1X3E A;  4EX5 A;  3JAM c;  3GTP H;  3KOJ A;  4DV0 Q;  2RHS B;  3PUV A;  5AJ3 Q;  4POG A;  2ZTE A;  2YU9 H;  1X54 A;  1M1K C;  4JI0 Q;  3I4N G;  3ICE A;  3KDF B;  3GTL H;  4A3G H;  2OTJ A;  1KXL A;  3HKZ G;  4YY3 L;  2QEX A;  1B7Y B;  4GNX A;  1KC8 C;  1FGU A;  3M4P A;  3G6E A;  4B3R L;  2K4K A;  2AKW B;  4DAY B;  2F4V L;  2JA7 G;  3EN2 A;  5LMN W;  1VQL A;  2K52 A;  3PCO B;  3FKI H;  4J15 A;  1YJW A;  2NN6 G;  3K7A H;  1W2B A;  3S15 H;  4AYB E;  3EIV A;  4A76 A;  3TRZ A;  2Q2T A;  5LMU L;  1C0A A;  3W5O A;  2ZM6 L;  3M85 A;  4JI1 L;  2ES2 A;  5IP7 G;  3BU2 A;  5BR8 L;  3HOW H;  4DR7 L;  4EQ5 A;  4JI2 L;  2HIX A;  2E2I H;  4B3T L;  4LF5 L;  2VQF Q;  4UP9 A;  1ASZ A;  1YVC A;  2V1C C;  5JEA G;  4JG2 A;  2CCZ A;  3GTG H;  4PZ6 A;  3UE1 A;  3PIP A;  1TWH H;  3CAM A;  4HJ9 A;  4X65 Q;  4BA2 I;  2ZTD A;  1PHJ A;  4O2D A;  4HIK A;  3S1M H;  2BH8 A;  3PIO A;  1UE5 A;  2GN5 A;  4DPG A;  4DV7 L;  1VQA A;  4A93 G;  1TWG H;  1NTG A;  1VQF A;  1X3G A;  4NPS A;  2NVX H;  4C3I H;  1K83 H;  1WFQ A;  4IJL A;  1E24 A;  3OTO Q;  5HGQ A;  4GOP B;  3RLO A;  3CCR A;  3UE0 A;  4A3B G;  2UXC Q;  1EOV A;  2D0P A;  3CCQ A;  4IO9 A;  3ERS X;  3T1Y Q;  2IHE A;  1N8R C;  4KLK A;  3CPF A;  4LW1 A;  1HJP A;  1LTL A;  5IYD H;  1ASY A;  1FJG L;  1D8L A;  4IPH A;  2IT1 A;  2HIV A;  2R7D A;  1VCI A;  3CW2 C;  2JA6 H;  3HFZ B;  4R4T A;  2WB1 G;  1J6Q A;  3WWV A;  4L5R C;  1V1Q A;  2YV5 A;  1TXY A;  1EQQ A;  2LXJ A;  4RG1 A;  3U4Z A;  1YIJ A;  3RR5 A;  4YY3 Q;  4BXX H;  2N49 A;  1UE6 A;  4B3R Q;  4GN5 A;  4DR2 L;  3K81 C;  4JI5 L;  1N36 L;  3J7A 5;  1CSP A;  4QJF A;  1GO3 E;  3KJO A;  5FLM H;  2PQA B;  1EIF A;  4MTN A;  3TQY A;  1YJ9 A;  4DUZ L;  2Q2I A;  1XMO L;  1L2F A;  5LMU Q;  3HOV H;  2ZM6 Q;  4LF6 Q;  3M4Q A;  1OXU A;  2AMC B;  4JI1 Q;  3NEL A;  5BR8 Q;  3HKS A;  5C44 G;  4IPC A;  3I4M G;  3M4O H;  4JI2 Q;  3VDY A;  4A3I H;  3PUZ A;  2JA5 H;  4B3T Q;  4JV5 L;  2IY5 B;  2JA9 A;  1PH8 A;  4HIM A;  1C7Y A;  4OON A;  2HHH L;  4HID A;  1MKH A;  2BA0 A;  2PMZ E;  3AQQ A;  3DM3 A;  4OWW B;  1NBW A;  5M5W H;  1GD7 A;  4JI0 L;  1H95 A;  1VQM A;  1Q86 C;  2Y0S G;  4JI6 L;  2UUA L;  3DLL A;  3CCL A;  5IP9 H;  1Y1W H;  1FVI A;  4DV7 Q;  3ULJ A;  3M3Y H;  1VQH A;  2F3I A;  1Q8K A;  1KRS A;  4AH6 A;  2MO1 A;  4A3L G;  4DNI A;  1PH3 A;  1IBL L;  2R92 H;  3CC7 A;  2ALY B;  3ULP A;  4LNQ A;  3TRE A;  4OX9 L;  1YBY A;  2AWN A;  3L2P A;  1XJV A;  1HNX L;  3KFU A;  1PV4 A;  1BBU A;  1KIX A;  4A3D H;  2MQH A;  3B6Y A;  1KAW A;  2WFW A;  4PG3 A;  4X66 L;  5M3M H;  3A74 A;  3UDF A;  4A3M H;  1YHB A;  5HY6 A;  4X62 Q;  4GS3 A;  2OQ0 A;  1HZ9 A;  2WP8 J;  3J81 i;  3HOU G;  4XTC S;  3ULL A;  1OXV A;  5GAG C;  3CMA A;  4DV2 L;  1QVG A;  2UUC L;  2K50 A;  4P71 A;  4GLA C;  1I3Q H;  4DK6 C;  1N32 L;  5ELO A;  2ZTC A;  4BY7 G;  2R93 G;  3GDE A;  4Y52 H;  2KCM A;  1VQI A;  4GOP A;  4GN4 B;  1XPR A;  4JC0 A;  4P74 A;  1XNR Q;  1AH9 A;  4DR2 Q;  1N36 Q;  4JI5 Q;  2L15 A;  4JBW A;  2VS1 A;  4DV1 Q;  2B29 A;  1K9M C;  1UE1 A;  2Z0S A;  1VS0 A;  3K80 C;  4DUZ Q;  2VL6 A;  2NZO A;  3JC6 6;  4P75 A;  3J81 c;  2K5H A;  4A3E H;  1XMO Q;  1S72 A;  1EYG A;  2EIF A;  3CME A;  4BA1 I;  1JJ2 A;  1PA6 A;  2VUM G;  1WCM H;  2CWP A;  2CKZ B;  3L7Z C;  1K73 C;  4JV5 Q;  1CKM A;  2NVY H;  1Q7Y C;  4LWC A;  5C0X I;  5M3F H;  2HHH Q;  1JT8 A;  5H1S E;  4LFA L;  5IWA L;  3CCE A;  1VQE A;  2PI2 A;  3I7F A;  1VQ4 A;  3TEH B;  5IT9 c;  2JEA I;  4GKK L;  4R4C A;  2IHF A;  3I56 A;  3UDG A;  2Y0S E;  3CCU A;  4JI6 Q;  1G51 A;  1IBK L;  2CQO A;  4DV5 L;  2UUA Q;  1HZB A;  2RHQ B;  1L1O C;  4DUY L;  4A3J H;  1XTD A;  1T9H A;  3PO3 H;  1VQB A;  2DUD A;  4YHH L;  3PSI A;  5C4X H;  5IYC H;  2PQA A;  1YHQ A;  2KBN A;  3K8A A;  1IBL Q;  1I50 H;  4JI7 L;  1N9W A;  2K5N A;  3S17 H;  1HH2 P;  4LF6 L;  2QGQ A;  4OX9 Q;  1PH1 A;  4QL5 A;  4R4I A;  4UPA A;  1HNX Q;  3AFQ A;  5LMN L;  4X6A H;  1XMQ L;  1EIY B;  4ME3 A;  2K14 A;  4BBR H;  4NXN L;  2E2H H;  4A3K H;  3K7U C;  4X66 Q;  2UXB L;  1HZC A;  2C35 B;  2KEN A;  1EFW A;  3CC4 A;  4A3C H;  4DR3 L;  3HOY G;  3EBE A;  4HJ7 A;  3PO2 H;  2BH2 A;  1BVS A;  4DV2 Q;  2NVT H;  2UUC Q;  1N32 Q;  2B3G A;  2PI2 E;  1Y1V H;  4QIW E;  2ZJP A;  1D7Q A;  1TWC H;  2B63 H;  3S2H H;  3UDX A;  3GO5 A;  4NB3 A;  4OXP A;  1JJC B;  1VQD A;  1Q1E A;  2ID0 A;  2WAQ G;  3KLW A;  2D0O A;  3I4O A;  4ALP A;  1QVF A;  1BBW A;  4QQB X;  2RF4 A;  2JA8 G;  3S14 H;  5IY0 A;  3KF6 A;  1JE5 A;  3S16 H;  2ATW A;  3I4N H;  3ER0 A;  1O7I A;  4HJ5 A;  1GKH A;  2F52 A;  1M90 C;  1X3F A;  5C0X G;  1NMG A;  1VQJ A;  1IL2 A;  3G4S A;  1PVO A;  4PZ7 A;  1A0I A;  5GAH C;  4X62 L;  4JI4 L;  2JA7 H;  1VQC A;  1PYB A;  1WJJ A;  4B3M Q;  4L5T A;  4C3J H;  4LF7 Q;  4LFA Q;  1U0L A;  4KHZ A;  5IWA Q;  1N34 L;  3RZO H;  3PGZ A;  4IFD J;  1K8G A;  4QY7 A;  4GKK Q;  5GQO A;  3J7Z C;  4DR5 L;  3HKZ E;  1IBK Q;  4DV5 Q;  1P8L A;  5IP7 H;  4DUY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...