3HOYG

Complete rna polymerase ii elongation complex vi
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoyG01
3CCMA 1FJGQ 4GN4B 1OXXK 1WOCA 2KCMA 2RF4A 3CF5A 1K8AC 2JA5G 4NXMQ 1HNWQ 1CKOA 1I50H 1Q81C 1JE5A 1EIYB 1Z47A 4R4IA 2YTXA 4JBMA 4YCUA 4EQ5A 4LF4Q 4DR3Q 5ELOA 2FXQA 4DPGA 1G291 1SE8A 3CCEA 4DAMA 3HKZG 1OXSC 2Q2HA 3PUXA 1HNXL 4MTNA 1LTLA 1NBWA 2N78A 1YHAA 2ZJRA 2BA1A 1Q46A 3NEMA 3CPWA 2UUCQ 3UDIA 4QQBX 1X55A 4X66L 2VNUD 3PUVA 1SRUA 3D0FA 2NN6I 1YZ6A 4R1JA 3TREA 5FLMH 1YVCA 5LMNL 1YITA 4DUZQ 2GVBA 1L1OC 2NZOA 4JI8L 2WB1E 1PH7A 4IFDI 1DGSA 1XNRQ 2B3GA 2WP8J 4R4OA 5M3MG 1K9MC 1IBML 2UXCL 5GAHC 4UP7A 2JA8G 1VQ7A 3T1YL 2EQSA 2OQ0A 3KFUA 4JOIC 4C2MH 2K5VA 5JEAJ 1VQKA 4A3KH 2ATWA 2R7ZG 3CP0A 3S1RH 4LF9Q 3GTMH 1GVPA 4A3GG 5GAEC 2Q2UA 4DK3C 1V9PA 4GOPB 2UU9L 3S17H 3K80C 4BBSH 1GO3E 2CKZB 2NN6G 2YYZA 4A3JH 3FKIG 2VL6A 1KQSA 4JI6L 3J81i 4AYBG 1GM5A 4JG2A 1U5KA 3G4SA 1X54A 4JI1L 4HIKA 4BY7G 4LUOA 2ZTDA 4P73A 2IX1A 1EWIA 4IFDG 4X6AH 3H0GG 2HIXA 2L15A 1GD7A 1QUQB 3CXCA 4QL5A 2C35B 1VCIA 4X64Q 1KC8C 4BA2I 1D8LA 1L1OB 2KBNA 1Q82C 4DR7Q 5AJ3L 3CQZH 3UDGA 1S40A 3CCQA 3EBEA 4IPDA 1VQFA 1N34Q 3A74A 2CWPA 3GTJH 2KHIA 4KHPL 4DR6L 1UE5A 4BA1I 1Q86C 4DV7L 4BXXG 3RZOH 2H5XA 4O0AA 1LM0A 2Y0SG 1BKBA 3K0XA 5M3FH 4DR2L 4B3TQ 2CQOA 4DUYL 3PO2G 1VS0A 2ZJPA 1XJVA 2E5LQ 4YY3Q 4HJ7A 4A3IG 2VZAA 3CAMA 3J7A5 4JBKA 1M1KC 5C3EG 4A3FH 1EIFA 4IPGA 1UE1A 1AE2A 1VQHA 5C4XG 3F2BA 2A8VA 1KAWA 3CC7A 1TWHH 1PH6A 1PV4A 2PI2A 4DKAC 5FLXc 4NPSA 4JC0A 1E1OA 1UWVA 1PH4A 5EAYA 1N32Q 5JJLA 1KRSA 3B6YA 1X56A 3KDFB 4JI3L 1VQNA 4A3BH 4B3RQ 4TQUS 5LMUQ 2ID0A 4A3LG 2JA9A 1PVOA 4DV0L 1SR3A 5GQOA 4DR5L 3M4QA 4AYBE 2GN5A 3TEHB 3S1NH 4TVAB 1AE3A 3RN5A 2UUBL 4X62Q 4LF6L 1WCMG 3GTOH 3BZCA 4HJAA 1Q1BA 4GNXA 1PH9A 3HOXH 4JYAQ 4JV5L 1K83H 1TWCH 3RNUA 5IYDG 1YIJA 5IWAL 3ICEA 5IYBH 1ASYA 4JI0L 2YTVA 5E7NA 2JJQA 3U4ZA 4DV2Q 3F1ZA 2WAQG 4OONA 2ZM6L 3GTKH 1HJPA 3ERSX 4NB3A 3J7ZC 3G48A 3GTLH 1Z9FA 1Y1VH 1OXUA 2NVQH 1X3EA 5IP9G 4GKKQ 1JJCB 2RCNA 3PO3H 4LF8L 4QY7A 5IP7H 1NJIC 5C44G 2MNAA 2NVXH 3Q8DA 3OW2A 4LFCL 4DV1Q 2UXBQ 1E24A 2R92G 2D0OA 1VQEA 4LF9L 4LFBL 3PF5A 2BH2A 2VS1A 1TWAH 4A3EH 4GOPA 1K73C 2VUMH 1PFSA 1BBWA 1VQ9A 3PIPA 4EX5A 2K4KA 4DR1Q 4DV6Q 1QVGA 1IBLQ 3I4NH 4RMFA 1IBKQ 1TWFH 3K7AH 1E22A 3TQYA 2K50A 3W5OA 4X64L 4APVA 3CC4A 1L2FA 1VQMA 3PO2H 4DR7L 1I94Q 2Q2IA 1C9OA 3ULPA 4LF7L 3HOVG 1C0AA 1MJEA 4DK6C 2AWNA 1EUJA 2JQOA 1J5EQ 1N33Q 3NELA 4GKJL 4YWLA 2HIVA 4C3JH 1N34L 3S14H 1B8AA 1CKNB 1PYSB 2I5MX 5IY0A 1Q7YC 1CSQA 4OWTB 3HOUG 4BBRG 2WAQE 4QIWE 5C4JH 2KCTA 3CCRA 4A3MG 2OTJA 2MO0A 3IRBA 4GLVB 1WJJA 4B3TL 4HJ9A 2LXJA 4KLKA 4X65Q 3ER0A 3BU2A 3STBD 4UP9A 4JI5L 1FGUA 4B3SQ 1YNXA 4L5SA 3J81j 2QEXA 1HNZL 3M7NA 4BY1G 1A63A 1WCMH 3PGZA 5GAGC 1PHJA 2UXDL 5FJ8G 4QJFA 4DV5L 5DLQE 1EFWA 3H15A 2JE6I 2K5HA 3KDFA 3T1HL 2HT1A 1X3FA 4B3RL 3GTGH 4A3DG 2R93G 3DM3A 4LF5Q 1XMOL 2ZJQA 3F8TA 1X9NA 1CKMA 3W1BA 3RN2A 1YBYA 2NZHA 2LSSA 4JI4L 4A3CH 3UDXA 2AWOA 1SROA 2F4VQ 4X62L 1VQ5A 2E2HH 3G71A 2LXKA 1Y14B 3HOWG 3I56A 4L5RC 1I3QH 2VQFL 4FDBA 4A4IA 4AQYL 1YI2A 4PG3A 1D7QA 1TXYA 3PUWA 3CMAA 2QGQA 1VQPA 1PH1A 1C7YA 2R7DA 3HKZE 1XNQQ 3CCVA 5JEAG 3EIVA 3PV0A 5IP9H 4HJ5A 1K8GA 4A93G 3AYHB 3CC2A 2JA7G 2Z6KA 4PZ6A 1QVCA 1X3GA 3L2PA 1VQLA 1ASZA 1E1TA 5C44H 1Y1WH 2UUAQ 4C3IH 5H1SE 2PI2E 5BR8Q 1KL9A 4YHHQ 2VQEL 1QZGA 1HR0Q 1SMXA 3NENA 1X65A 3ULJA 1HH2P 3E9HA 4HIOA 3G6EA 1K3RA 4PZ7A 3F2CA 2R7FA 3UE1A 1A8VA 2CWAA 4LUZA 3W1GA 2B29A 5IT9c 1FVIA 2ES2A 4P71A 4A3IH 2IY5B 2PMZE 4JI7L 2HHHQ 3I4MG 4GKKL 4XIGS 2AHOB 1VQJA 2B63G 2JA6G 2E2IH 2JA5H 1K0RA 4R4CA 1VQBA 1XPUA 4GLXA 4K0KL 4OX9L 2NVTH 3J80c 2I5LX 2N49A 4X66Q 2QA4A 1PH8A 2XGTA 1BBUA 1U0LA 4DV4L 2R6GA 4JI2Q 3KJOA 5LMNQ 2PQAA 4MNOA 1VQAA 1B70B 1MJCA 2WFWA 3UE0A 1FJGL 1LYLA 1NTGA 4J15A 4JI8Q 4DV6L 4IJLA 2IT1A 2BH8A 4LFAQ 1VQIA 1IBMQ 4NXML 1RL2A 1HNWL 2PNHA 4DV3Q 1PH3A 2YU9H 3T1YQ 4LF4L 2IHEA 4DR3L 2XTIA 1JT8A 1JJGA 1I94L 1P8LA 2CFMA 3KYHC 1GKHA 1XMQQ 2RHSB 5M3MH 1HZ9A 3J80i 4Y52H 3BJUA 4OWXB 5FLMG 1QZHA 2JA8H 2IX0A 4WJ4A 3SGIA 2UUCL 4L5QA 3FHWA 2R7ZH 3JAMc 1T9HA 4A3GH 2K14A 2CCZA 2DUDA 3ZJYC 4OO1I 2Y0SE 2HQLA 2V1CC 2VW9A 3OYYA 3LGJA 4RG1A 3RR5A 3EN2A 1UEBA 4DUZL 3FKIH 1MIUA 3L7ZC 3PSIA 4A3KG 3HOYG 1EYGA 1XNRL 1KXLA 5HGQA 3KF6B 5AJ3Q 3H3VI 1XTDA 4BY7H 4BBSG 2GVAA 2AMCB 4A3JG 4OWWB 3H0GH 1PH2A 3S16H 2JEAI 3CCSA 5C0XJ 4KHPQ 2OQKA 2ZTCA 5GROA 1YJWA 4DR6Q 3JAMi 3S1MH 3I55A 3E0EA 1UE6A 1EQRA 2RHQB 1Q8KA 4DR2Q 4OO1G 1AH9A 2BA0A 2A19A 4DUYQ 4LW1A 4GNXC 1A62A 1E7ZA 1WFQA 3M85A 4R4QA 3OTOQ 2F4VL 4KHZA 3KJPA 4BXXH 2VY3A 3F2DA 1QUQA 4KI0A 4A76A 1L1OA 3S15H 5M5WH 3A5ZB 3RLFA 3UDFA 5C3EH 4A75A 1KHIA 4JI3Q 5C4XH 4LNQA 4JOIA 3PCOB 3AEVA 5IE8A 1FL0A 5M5XH 1EOVA 4DV0Q 4DR5Q 5IYCG 5BR8L 4YHHL 1JJ2A 2E8GA 4A3FG 1M90C 1V43A 2YV5A 2UUBQ 3CW2C 2MQHA 4LF6Q 3AFPA 1QVFA 4A3LH 3K7UC 3NBHB 2KHJA 4YY3L 2E5LL 4GNXB 3TS0A 1PH5A 1BVSA 3U50C 1CSPA 4JV5Q 1KD1C 4A3BG 2HHHL 2DGYA 3FP9A 1J6QA 5GADC 4NXNQ 3AFQA 1PA6A 4GOPC 5IWAQ 4B3MQ 4JI0Q 1N32L 3DLLA 4WJ3M 1G51A 3AQQA 4GN5A 4H02A 3D31A 4UY8C 2ZM6Q 1KRTA 5LMUL 3GTPH 1OXTA 3RZDH 5IYDH 3GTQH 1H95A 3K8AA 1N36Q 4JI2L 1WI5A 1CUKA 2K5NA 1VQDA 3ULLA 3HOXG 2Z0SA 1YHQA 1MKHA 3J81c 4IFDJ 5K36G 1NMFA 4DAYB 1VQ6A 3M4PA 3E9IA 3BZKA 4LFAL 4XTCS 2ZTEA 2N8NA 5IYBG 1SFOH 4LF8Q 3STBC 4DV3L 2D62A 4JYAL 1N9WA 4R4TA 1HR0L 4LFCQ 3RLOA 1YJ9A 3M4OH 3HOZG 4IJHA 4Y7NH 3HOYH 3I4OA 4AIMA 1VQ8A 3M3YH 1RIPA 1XMQL 1IZ6A 1VQCA 2I5HA 2OCEA 1XPOA 4DR4Q 4AH6A 1EQQA 4JBWA 3MEFA 2ALYB 2N3SA 1Y1VG 4DV2L 4OXPA 2R92H 3GO5A 3S1QH 2MFIA 4C3HH 3MXNB 3PO3G 4PMWA 1XPRA 5IP7G 1Q1EA 3VDYA 4GN3B 4DNIA 2E2JH 3I2ZA 3KF6A 3GDEA 4YWKA 4A3EG 2I0QA 1L0WA 1HNXQ 4LF7Q 1IL2A 1SLJA 4L5TA 2VUMG 4DV1L 2JK8A 4GKJQ 4HIDA 3H3VH 4IOAA 2UXBL 2F52A 3RLNA 1I5FA 3PF4A 3GD7A 3L0OA 2OWOA 3I4NG 1VQOA 4LFBQ 1NMGA 3HOVH 3M9BA 1IXRA 4YCWA 4DR1L 1IBLL 1HZBA 4BBRH 3OTOL 5IYCH 3K81C 4MZ9A 1IBKL 4A3MH 3HOUH 4JI5Q 2UXCQ 1W2BA 2IHFA 1HR0W 3TS2A 3S24A 4POFA 3U58A 5J3BA 1HNZQ 2Z6KC 2A1AA 4P74A 4P75A 1S72A 4LWCA 4UP8A 3CCJA 1KIXA 2UXDQ 1YEZA 1UE7A 4DV5Q 1J5EL 3CCLA 3T1HQ 2UU9Q 1N33L 5HY6A 4POGA 4P72A 3PIOA 2EXDA 1CKNA 2F3IA 4BY1H 4ME3A 2JEBI 3S2DH 4JI6Q 1XMOQ 2Q2TA 4O2DA 1B7YB 1R9TH 4UPAA 3S2HH 1WYDA 4IPCA 4JI1Q 4JI4Q 5FJ8H 3PUYA 3TRZA 1JB7A 4X65L 1E3PA 3HFZB 2AKWB 2YTYA 3A5UA 4A3DH 2R93H 5JJKA 1G6PA 2VQFQ 1LUZA 5JJIA 4AQYQ 4YWMA 5LMNW 3KOJA 4LUVA 4B3SL 4IPHA 4JCVE 4NXNL 1HZCA 3HOWH 1YJNA 3WWVA 5M5YH 1TWGH 4GLAC 2K75A 4B3ML 4A3CG 3I7FA 3U4VA 3CCUA 1Q12A 3CD6A 3CMEA 5C0XI 3HKSA 2VQEQ 3HOZH 4DV7Q 3CPFA 2KENA 2NVYH 3KLWA 4LF5L 4A93H 1N36L 2JA7H 1VQ4A 3KF8B 4HIMA 1VQGA 1OXVA 2WB1G 1YHBA 1A0IA 1NE3A 1OTCA 4JBJA 4JI7Q 1PYBA 1S3OA 1W3SA 2MO1A 5ELNA 4QGUA 1Y1WG 1N8RC 1I6HH 2OTLA 3JC66 4K0KQ 2ASBA 4OX9Q 1XNQL 1SN8A 3I4MH 2EIFA 4DR4L 1P16A 1V1QA 2K52A 5M3FG 1IYJB 4IO9A 5C0XG 4ALPA 1JMCA 4DV4Q 1HZAA 3PUZA 4IOCA 2B63H 2JA6H 3A0JA 2UUAL 2D0PA 1O7IA 1X6OA 4PZ8A 4HJ8A 1NY4A 2PQAB 4YCVA 4GS3A
chains in the Genus database with same CATH superfamily
3CCMA 1I4GA 2NZ1D 1BQQT 4GN4B 1JWSD 1II3A 2RF4A 3CF5A 2JA5G 1HNWQ 3GV7B 1CKOA 1I50H 1Q81C 1JE5A 1EIYB 4R4IA 3QOLA 4EBCA 4JBMA 4YCUA 4DR3Q 2W70A 2FJZA 4I65A 3GV6A 3V96A 2OLSA 4DAMA 4A3DB 1ICFB 4RGNA 1WVLA 1F2ZA 2Q2HA 4RFBA 4Q5VA 1I7LA 4MTNA 2ZJRA 1NBWA 3TIGA 2BA1A 1Q46A 3JAML 2UUCQ 4IUPA 4QQBX 4Q8EA 4PDBA 3NP8A 2VNUD 3PUVA 1NR4A 1SRUA 1WCMA 2F0GA 4YB8B 3GIIA 4R1JA 5E4XA 2YW2A 2HVRA 2W9BA 2HJWA 2GVBA 1STAA 2BQUA 1GYFA 1B3QA 4JI8L 4IFDI 1DGSA 2B3GA 4R4OA 1K9MC 4A93B 2R8KA 2FLNA 1F2MA 3EPGA 2IBKA 2OQ0A 2GPSA 3KFUA 4KY5A 5C4ZA 1TY0A 4V0BA 4C2MH 1VQKA 2J4XA 4F8MA 5KNDA 4A3KH 2MUYA 3S1RH 3GTMH 2WAQA 1LT6D 3LMLA 2Z6BA 5DM63 4FXDA 3BG3A 3BA8A 4GC6A 3S17H 3K80C 4FP5D 2WKCA 1I7NA 3F8NA 4X64H 5LL6X 4J0MA 1PDQA 2K5QA 4L63B 1GM5A 1U5KA 2C5CA 4BY7G 2YRXA 4RNNA 3SK6A 1B2TA 4IFDG 4X6AH 4BWGB 1KC8C 4OO1H 2B2UA 4QL5A 4X64Q 1VCIA 5KFLA 4DNRB 1S40A 5KG1A 4K8JA 1BBXC 4EEYA 2CWPA 4WD3A 3GTJH 1LTTD 1KC7A 4CJ2C 1AZPA 4BA1I 4DA2A 2W9CA 3K0XA 2Y0SG 1BKBA 1SNDA 4DR2L 2CQOA 3PO2G 5D1OB 4U7CA 1N32H 3FEWX 2VZAA 2FE3A 4A3FH 5LMUH 1UE1A 4CDFC 3RUZA 4CC6A 4DKAC 4HMJA 3BDCA 1UWVA 5CV7A 1PH4A 1N32Q 1LABA 3N40P 2AGOA 4JI3L 1TR5A 5LMUQ 1RK5A 2QDLA 3KTMA 2JA9A 2PQEA 1GSAA 3IG0A 2DY7A 2KQ3A 5KYIA 3H09A 4DR5L 3M4QA 2F0PA 4BBSB 4LF6L 4IUVA 3GTOH 4GNXA 1PH9A 1C48A 1S5CD 1CTMA 1EYCA 5C8YF 1FYCA 2EYOA 2R93A 1HFNA 4FF1A 1I3QB 1K3BC 1ASYA 1AN7A 1TS3A 2JJQA 5JH7F 3F1ZA 3GTKH 4V190 5C1OA 3NWTA 1KNEA 1CQIB 5L9XA 4XXEA 2F0SA 4TQRA 4J9KA 2FMAA 5M3FB 5J2TF 1EU4A 4H13C 1CT1D 5C44G 1YNJD 2R85A 1E24A 4QW9A 4MIUA 1BDOA 1EUDB 4DR1H 4DV6H 3HZXA 4DL7A 2Y0SA 1IBLH 2VS1A 1TWHB 4GOPA 1K73C 1JOOA 2VUMH 3DF7A 1V1OA 3PIPA 4A3BB 3NBIA 4DR1Q 4DV6Q 1IBLQ 3I4NH 2B63A 1UUPA 1S0NA 1PZJD 4N8X1 1TWFH 3K7AH 1E22A 4H7BA 4XX0B 3TQYA 4LSXA 4X64L 1ZQ7A 3CC4A 1L2FA 5I6YA 3ULPA 4E6IA 3VYUA 2WINB 2V4DA 5FO8B 2MCTA 2HIVA 4C3JH 1TAEA 3S14H 4DL6A 1EWHA 2I5MX 2SNMA 1Q7YC 4OWTB 3HOUG 1G2TA 4RZQA 4TUYF 5J39A 2PW7A 2EY5A 1EY6A 4RGOS 1IYUA 1S0MA 1ZYRC 3V6HA 3NGDA 5EJWA 2LXJA 4DN4M 1U4PA 2XVSA 3BU2A 2F0KA 1HFGA 3MWMA 4LF5H 4Z9CB 5DQGA 4BY1G 2BDNA 2NVQB 1WCMH 2X6LA 1PHJA 5EPJA 4MV6A 2F4VH 1X3FA 2OT2A 2SCUB 3GTGH 2R84A 3DM3A 4LF5Q 2AQ3B 1ZHSA 1HXYD 4NMZA 1H9SB 1TWAB 3T51B 4A3EB 2F4VQ 3PR4A 2TSSA 3G71A 1Y14B 3I56A 3BJYA 1I3QH 3LX0A 4AQYL 4PG3A 3PUWA 3MTSA 1WTVA 2QGQA 3C2PA 2ASDA 1BNZA 3RB6A 5D3IB 2PNRC 5ELBA 5IP9H 3D6CA 4HJ5A 1QVCA 1X3GA 3PO2B 4J9RA 1E1TA 1QNKA 3C46A 1S68A 5H1SE 1CS0A 5M5WB 3R93A 2PI2E 3J7YW 2GA4B 1QZGA 2HHHH 1SMXA 1D1KA 3LWBA 3SEBA 3NENA 1RF2D 4R9WA 1HH2P 5C0XH 4HIOA 1Q86C 3OHBA 3KF8A 5IT9c 3W1GA 2F0EA 3MJFA 4EEQA 3FDTA 3G8CA 5HV6A 4X66H 2PMZE 2HHHQ 4J9QA 5BN5A 2XCAA 2JA6G 2JA5H 1K0RA 4R4CA 5LMNH 1AZQA 3DM1A 5KFAA 2I46A 5I47A 1CA6A 4BS9A 4X66Q 1PH8A 1IBMH 2XGTA 1BBUA 3DWAA 4DV4L 4LFAH 2I8CA 2QEJC 4U6PA 4DV3H 3P75A 3T1YH 5LMNQ 5IGFA 4JV2A 1B70B 1MJCA 3Q8RB 2WFWA 2W7PA 1NTGA 3A8IE 4DV6L 1EQTA 4IJLA 1HQMC 1IBMQ 4LFAQ 1VQIA 4MV8A 4NXML 1ENCA 2LMCB 4DV3Q 2EJFC 3T1YQ 4LF4L 1SE4A 3U9OA 1J8IA 1JJGA 2W6PA 2EY1A 4QIWB 2E2HB 1QE6A 2Z9HA 2RHSB 2RDJA 3BJUA 4OWXB 2LY7A 2WKDA 4WJ4A 1K83A 3Q23A 5JJZA 3OSPA 5JPNC 5L1LA 1LTBD 4B9XA 2DUDA 2VW9A 2V1CC 3J81E 2AU0A 1ONLA 5C44B 3LGJA 4RG1A 1UEBA 1XYIA 5FO7B 1EYGA 1Z6HA 3H40A 3KF6B 4BY7H 1XTDA 3RB3A 3GTLA 4F50A 4IFDH 4HCSA 1E2WA 1DIKA 1Y1VA 4C1NI 3S16H 4O2AF 4MTKA 4C3HG 2JEAI 3RV3A 3CCSA 5C0XJ 4IRKA 2KCCA 2ZTCA 4U68A 1B50A 1IBKH 3BQ2A 3JRWA 1MGSA 2KEDA 4NW2A 4K6LA 4O4IF 4DL3A 2BA0A 3TZDA 1E7ZA 1HTPA 3HKZB 4R4QA 2F4VL 4KHZA 1J5EH 1RD9D 3KJPA 3F2DA 3C1FA 3PQIA 2QK4A 5JVG3 5FLXL 5FD6A 1S5BD 3ND9A 3P1HA 5EKLA 5M5WH 3A5ZB 1YNJC 1K1SA 3UDFA 5EWEA 4HR7A 3MFIA 1NSNS 3AEVA 2LS01 1FL0A 1RTNA 5M3MB 1BXRA 2JEJA 3ITPA 1V43A 1QVFA 2MQHA 1TA8A 2ICEC 4YY3L 3LP8A 4YQWA 4B3MH 4IRCA 4JI0H 1BVSA 4IALA 1ICWA 3T5LA 2HHHL 2DGYA 3FP9A 1J6QA 1HCZA 2I87A 5IWAQ 1PXUA 5EKIA 1SAPA 4AYBB 4B3MQ 4JI0Q 4ED7A 1LTID 4P2CB 1QWYA 3AQQA 4UY8C 3Q8PB 2K04A 3JZIA 4FBUA 1WI5A 2K5NA 1I6VC 1VQDA 3NTHA 4LSAA 2EJGC 1MKHA 4IFDJ 5EDWA 1KAAA 3UI2A 3H4DA 4LFAL 4IN3A 2ZTEA 1PFNA 5IYBG 4DV3L 1DOKA 1SYCA 1HR0H 3OSOA 1YJ9A 4Y7NH 4AIMA 1SNCA 2P0AA 1VQCA 2I5HA 2VB2X 3S9WA 3M9MB 2DZDA 5ISRA 2N3SA 2WIIB 4CKEA 2JEGA 3GO5A 3S1QH 4C5AA 1SNPA 4Q0FA 1Z2PX 4FXGC 1XPRA 4Q44A 3D6WA 5M5XB 2YS7A 5CV9A 3NTIA 5EGTA 3VDYA 3Q8QB 4DNIA 2EE1A 4GZYC 2PCFB 2PYKA 3QFFA 2Z4HA 1Y8NB 1RYRA 3H3VH 1SBBB 4OIJA 2UXCH 2KCNA 2BQRA 2KJXA 3RFCA 2R8JA 1E2ZA 4RUCA 2WE6A 4IZOA 4M9UA 1V4YA 1EFID 1LTRD 4HAEA 4YCWA 3BVGA 1M0WA 3HOUH 4O4LF 2UXCQ 1S97A 1IBKL 2IHFA 3QOJA 3U58A 1BCPD 4J9SA 1S72A 4JI1H 4JI4H 3MWYW 1UE7A 1SFOB 1J5EL 2M05A 3O13A 4P72A 3PIOA 1NUCA 1CKNA 1F9SA 2F3IA 3N6RA 4M1UB 4ME3A 4BY1H 2L55A 4O2DA 1B7YB 4ZAIA 1I6UA 1WYDA 1CE8A 4JI1Q 4JI4Q 4X65L 1E3PA 2EOTA 3HFZB 3A5UA 2JXMB 4JUZA 3BABA 3WO1A 3X3NA 3C3LA 4C3HB 1S5ED 4YWMA 3IN5A 2CVRA 4ME6A 4DV7H 4IPHA 4KN4C 3WWVA 3SVMA 1B3AA 4B3ML 2E2JB 3U4VA 3FPUB 2DNEA 4JI7H 1H9MA 3MEHA 3HOZH 3OHXC 4DV7Q 4L1KA 2KENA 3V4SA 2L4NA 1UC8A 2F0OA 4HIMA 4O2BF 4K8IA 5DLGA 3DMUA 4OX9H 4DAYA 3DEOA 4JI7Q 5FPOA 1T5XD 2XCPA 1S3OA 2MO1A 5DAUA 2FFKB 1RJPA 1JX4A 1E4EB 5EOYA 4A3MB 5KFEA 2ASBA 4OX9Q 1SN8A 1QG7A 2J0TD 1P16A 4ALPA 1JMCA 1JIHA 1CFMA 1CK1A 5KFDA 3PUZA 3OIQA 2JA6H 4L8JA 3A0JA 2EYLA 4JVZA 4XDXA 4PZ8A 1O7IA 2R8HA 4HJ8A 2HCIA 1HR0L 2D9UA 3AMUA 4GS3A 2A6ED 3MAQA 4HCEA 1PYWD 3DUZA 1OXXK 3S2HB 5DQIA 1C4QA 1R9TB 2NU9B 4MA5A 3K5LA 3IAYA 2XC9A 2FXQA 4MTEA 4CHTB 4ZRZA 1SE8A 1G2SA 1CA5A 1LTLA 2N78A 1YHAA 5FKAC 5D1PA 1EZ8A 4DUZH 3CPWA 1EIGA 4RNMA 3TDQA 4C56C 1XNRH 5CMDA 3D3RA 5M5YB 3TREA 1YVCA 2FPPB 2ZDQA 4DUZQ 4J9PA 2EPBA 1L1OC 4LF9H 1GUTA 2XWJB 2WB1E 3J81W 2NVYB 1XNRQ 2UXCL 3E0JA 3GTQA 4FS2A 2JA7B 1BO0A 4UP7A 5AFWA 1VF7A 5JVDF 3RBEA 4JOIC 1H9RA 2K5VA 2R7ZG 1SYBA 4LF9Q 4YIJA 1TT2A 5KGUA 1HTLD 2M2LA 4DK3C 2Q2UA 4G7OC 2IJ0A 1C30A 2CKZB 1VF5C 2YYZA 3R5FA 1KQSA 1ENFA 4RB1A 5CA0F 3JSLA 2N55A 1X54A 4JI1L 3TP7A 4HIKA 2IA6A 4LUOA 1EWIA 3H0GG 5KEEA 2F1MA 2R92A 2C35B 3PZPA 1G8ZD 2KBNA 1DYQA 4ZQ3A 1Q82C 5KFJA 3NQTA 3GQCA 3CCQA 3EBEA 2L12A 1IKMA 3JRXA 1I50B 2CH4W 4MV1A 4XQJA 4ECYA 3G6XA 4KHPL 4DR6L 1Q90A 1RHPA 3VA5A 2E2IA 4DV7L 4BXXG 1WTWA 4NDXA 1IOVA 3A56A 4FBTA 4DUYL 2F0DA 1TS5A 4X3UA 1HRJA 2XN9C 2Z4IA 3CAMA 4JBKA 3J7A5 2KOLA 1EIFA 2K28A 1ZKOA 4IPGA 1VQHA 3MFYA 2A8VA 1PFBA 1PH6A 2PI2A 3GIKA 2ICIA 3RB4A 3SR1A 5FK9C 5EAYA 2C2RA 5KFVA 4X62H 2K33A 3W3AA 5KG2A 1O75A 4C2MB 2CW7A 4K5WA 4A3KB 4CBVA 1SNQA 2A5HA 3S1RB 4CJ1B 4ZOLF 2PMZA 4AYBE 4DAVA 1GUWA 3K3PA 3S17B 2IMWP 2K6AA 4FM9A 1DONA 4X62Q 2VUGA 1CQFA 4RWSC 1GSHA 1WCMG 4HJAA 2EVBA 4ZKBB 4YR3A 1GXDC 2MHVA 4JV5L 2R7NA 1TWCH 3RNUA 1BCPC 1XTCD 3C1EA 2F0UA 5IYBH 1BXTA 2YTVA 1XXGA 5E7NA 5I6WA 3T5KA 2WAQG 2B2TC 4GKKH 4ECVA 2W71A 1B9NA 1ET9A 3G48A 3GTJB 3A54A 4OEMB 2UXBH 5IGGA 2NN6H 2GLTA 5IP9G 4GKKQ 1JJCB 1PTOD 2VPQA 2B8FA 5ELEA 1LT5D 1LTAD 3M9OB 1NJIC 2EYFA 3DWPA 3GQBA 2NVXH 3OW2A 4LFCL 5L1KA 1FKAH 2UXBQ 2D0OA 1VQEA 4A3FB 4LF9L 5IGBA 4LFBL 2FPGB 1STNA 2BH2A 1SEBD 2PO4A 5KFOA 3T56B 2NU6B 4KN7C 2A73B 1PFSA 1EY7A 1BBWA 4ABNA 4EX5A 1OO9B 2K4KA 4QB4A 1BUVT 1QVGA 2BE5D 1SYXB 1L0XB 4RMFA 1N33H 3QB3A 2UUCH 2K50A 3W5OA 2ALZA 1ZETA 4APVA 1VQMA 5A2QL 1C9OA 3RV4A 3H4BA 2FP4B 5F9NA 4LF7L 3HOVG 3GTOB 4A2AA 1EUJA 1N33Q 3NELA 2F0NA 4YWLA 2YZMA 3J80E 3PW7A 2UVRA 2KECA 1CSQA 1E0BA 4PV1C 2KCTA 5J22A 5KFPA 4CC5A 1F77A 3IRBA 4GLVB 2FK1A 1W93A 4MV3A 2A6EC 2MGSA 2CH4A 4KLKA 4HJ9A 4ECZA 3GTKB 3GTPA 1EU3A 2X69A 2NYZD 1B04A 4L5SA 1HUMA 2QEXA 3I12A 1KDAA 1U4RA 1Y8OB 4RAZA 4QUFA 1SYGA 3KALA 2UXDL 2I07B 2F0WA 4QJFA 4EQOA 4DV5L 1KDBA 2JE6I 3T1HL 2R93G 3PW5A 3JAME 3F8TA 1X9NA 1CKMA 3RN2A 1VDZA 1YBYA 5BPHA 4G3IA 1NR2A 3KHGA 2YRWA 4Q43A 5EPLA 2F0IA 3H20A 3L4JA 4X62L 1VQ5A 2VUMB 3HOWG 2VQFL 2UUAH 4FDBA 3I91A 4G4KA 1D7QA 3I4NB 1TXYA 1VQPA 1PH1A 5D14A 1TWFB 3K7AB 2PN1A 5JEAG 3EIVA 4L6TB 1K8GA 5COYA 4MV7A 5J1ZA 4PZ6A 1GOZA 2UUAQ 1KL9A 4K6DA 3J7AF 4B08A 3GLKA 3K5IA 4Y8VB 4C3JB 4HMIA 3S14B 2F0HA 3E9HA 3G6EA 4PZ7A 3F2CA 2R7FA 3UE1A 2QF7A 1D5ZC 4RZRA 1SJHD 3I4MG 4GKKL 4XIGS 2V59A 2AHOB 2RA4A 2B63G 3QJYA 2E2IH 4IUTA 2HDLA 4UCUA 1F2LA 2ZJTA 3NK9A 1A15A 1VAJA 4K0KL 2RDHA 3MXPA 2NVTH 5KT4A 1WTXA 2PZWA 4UCRA 1WCMB 5C6AA 4R8UA 2XGQA 3I73A 1FR3A 4J15A 1HA6A 3GTGB 4EYIB 4ED3A 3V2TA 2HCCA 1HNWL 2PNHA 2YU9H 4FF3A 4DR3L 1JT8A 3MR3A 2F0LA 1TVXA 2CFMA 3GILA 5DEHA 4QWBA 1ZEQX 5KFNA 2UUCL 4L5QA 3V4ZA 2ZXRA 3FHWA 2R7ZH 1RYSA 1T9HA 3CKIB 5IODA 2BDOA 2BOSA 4CGYB 2K14A 2CCZA 1TWGA 2HQLA 3OYYA 4FNFA 2V58A 2XRQD 5CORA 3L7ZC 4RB3C 2AGPA 4DL4A 2NUCA 4FF4A 5LOVF 5AJ3Q 3H3VI 2TMPA 4RHSA 2AMCB 4A3JG 4E4TA 4MHEA 3H0GH 3UFXB 1I4QA 1SEIA 3EJIA 3K5MA 1STGA 1WTRA 2JA5B 2SOBA 4QUCA 2W9CB 1UE6A 3AU7A 1AH9A 2CHBD 1DJRD 1Q8IA 2RGVA 3KXYT 1GGOA 2A74C 3VPDA 4DLKA 5D3DA 1D6EC 1BGWA 2R7MA 4BXXH 4ZUJA 1MD2D 1U4LA 2L5TA 1QUQA 1M8AA 1L1OA 4JV0A 1PTOC 3KK7A 5LYJF 3BA9A 2UUBH 4A75A 4EFEA 3RB0A 4JOIA 4J9MA 1AUXA 1EOVA 4DV0Q 5DGBA 3N43B 5D8DA 3NTKA 1JJ2A 2DIKA 4NXNH 2UUBQ 4X3TA 3AFPA 2KSWA 4XYMB 2BE5C 4GNXB 4KTAA 1CSPA 2ZM6H 1WTPA 4NXNQ 1N36H 3I90A 3GIPA 3PW4A 1LLRD 1X32A 1N32L 4BY7B 3DLLA 1G51A 3NWSA 3D31A 2ZM6Q 4HN7A 5LMUL 3GTPH 1OXTA 4OELB 2V4RA 3BYYB 4TQSA 3S16B 1N36Q 4XZ3B 3ULLA 3OUZA 3J81c 1NMFA 1EYDA 3E9IA 2NTSA 3RF2A 3ERQA 4XTCS 4QWDA 4LF8Q 4ECTA 1XWEA 4R4TA 1AP0A 1EOTA 3M4OH 3HOZG 4IJHA 5KFCA 3HOYH 1VQ8A 3M3YH 2C22A 2Y0SB 2OCEA 1I4RA 3L4KA 4JBWA 5JOBA 3R2IA 3PW2A 5IYZF 3Q8SB 2DWCA 1Y1VG 2WB1A 3CQZA 4RAUC 4DXGA 2HQEA 5EBCA 2IW3A 4CJ0B 4QWAA 2MFIA 2DPIA 4KJOA 4HQ6A 4ED0A 1M7JA 3PO3G 5BPFA 1V1PA 4ULLA 1ZHQA 1SCUB 2UVVA 4GN3B 3I2ZA 3KF6A 4YWKA 2JSOA 4XT1B 2I0QA 1IL2A 5KFUA 1MSGA 1SLJA 4L5TA 4GKJQ 4WJWA 3GV8B 2BQ3A 3X3MA 2F52A 5KIXA 2W6QA 3PF4A 2OWOA 1C8CA 5KG7A 3J80W 1NMGA 3HOVH 4RCOA 1HNZH 5F2DA 1IXRA 2B2TA 4ID6A 4DR1L 1IBLL 1VBGA 2YZGA 3TQTA 4MZ9A 2UU9H 4JI5Q 3EPIA 1JICA 3N52A 5C5MA 1UNNC 2IP4A 5J3BA 1O80A 1HNZQ 1CQJB 4P74A 2XNAC 4P75A 1XMOH 4JI6H 4KKSA 4UP8A 1WTOA 4I7HA 2UVUA 4ZUIA 2Z1CA 1ESFA 1RODA 2UU9Q 4NKLA 1KNAA 1CHQD 3F2UA 4POGA 4X3SA 3E5NA 2K32A 2JYOA 3S2DH 2JEBI 4Y7NB 4JI6Q 1XMOQ 2Q2TA 1UC9A 1DXMA 2W57A 4UPAA 2W7OA 3BVZA 5KT7A 4M8AA 3PUYA 2G9HD 3PMFA 3JAMW 1D2BA 5K2MA 1JCKB 3R5HA 3VPCA 2R93H 2YTYA 3S1QB 1JB3A 2L1BA 3ZYYX 1SYDA 3K5NA 2O4XA 5KFRA 2VQEH 3RBDA 5K36H 4WBNF 4NXNL 2QKIC 3Q2OA 3HOWH 1YJNA 2ZDHA 4O42A 4C5BA 3QZ8A 1TWGH 2F0MA 2K03A 4GLAC 4AYBA 2K75A 4KKUA 4A3CG 3CCUA 4NLGA 4FU0A 4PQXA 2VQEQ 4I50F 5JEAH 3KLWA 3I4LA 5IT9L 4LF5L 1N36L 1DOLA 3I72A 3Q6SA 1GHKA 3KF8B 4PNYA 4EG0A 1WSCA 4O3OA 3T16A 3Q24A 1NE3A 1QJOA 1MZBA 4QGUA 4FYDA 1T3NA 1Y1WG 4EVOA 2R8GA 4C3IG 3HOUB 2F3WA 4ED2A 1I6HH 4DL5A 1MSHA 1T36A 1FJGH 3SHLA 3I4MH 1V1QA 3MXUA 3EVQA 4IO9A 3M4IA 4MA0A 1D1IA 4IOCA 1HZAA 2RDFA 2B63H 4EBEA 2D0PA 1X6OA 3G7LA 4A3IG 5DGAA 1FJGQ 1FGBD 5IWAH 4BY1B 1WR2A 5NUCA 4ETSA 1Z47A 4G57A 5ELOA 1G291 1V51A 2FHTA 1S5FD 4RB2C 4TRDA 5FLXE 3GIJA 3CRKC 1EEID 3UDIA 4IHJF 2J6TA 3KHRA 1X55A 4X66L 4KK7A 2NN6I 5BN3A 5LMNL 2C28A 3HOZB 1MHWC 1MBYA 1AN8A 1LV9A 1SYFA 1IBML 2FLPA 2G5DA 3GTLB 1AEXA 1KTKA 5GAHC 2OF1A 3T1YL 1BCPF 4JW0A 2CW0D 3FMAA 4ILWA 5JEAJ 5HGTA 3CP0A 1GVPA 4J8QA 4A3GG 3L9AX 1OWTA 1V9PA 2UU9L 3K5HA 2NN6G 5TSSA 4A3JH 4MAMA 3FKIG 1TS2A 1B53A 4JI6L 4FS1A 4J9LA 4DR7H 4UCSA 2XRSD 4JG2A 4CKBA 1RJQA 3H94A 3PIP3 3BVMA 2JA6B 2ZTDA 4P73A 4F88A 4XQNA 1K8OA 5LL6b 4DFAA 1Y1WA 1N34H 3TINA 3NHHA 2ZXOA 5ELCA 3TN2A 3K59A 1HPCA 4DR7Q 5DQHA 3CQZH 5KFQA 5CYUA 4B3TH 1VQFA 4RH6A 1N34Q 3A74A 4HR7B 4F4WA 2BCOA 5CV4A 3K3VA 4OL7A 4UHVA 3N42B 3U9TA 1JR0D 1Z2OX 4WFN3 3RZOH 4ME5A 4O0AA 1LM0A 3GIMA 2PZTA 4B3TQ 2F0TA 2SNSA 3E5SA 2R61A 4IQZA 2ZJPA 1XJVA 2E5LQ 2G9DA 3N41B 1M1KC 1UAPA 3GIQA 1AE2A 5KFFA 1O7LA 1KAWA 4HSVA 5KKNB 1E4EA 1A3UA 4NPSA 4JC0A 1E1OA 1BR9A 5JJLA 2W6MA 1X56A 3KDFB 1VQNA 1DV2A 4TQUS 3A55A 2ID0A 4PMBA 1GSOA 1ML0D 2R86A 1SR3A 4C1NK 4JYAH 5KRUA 4N9PA 2JN4A 4DNTB 3S1NH 3NQIA 4ECXA 1AUVA 1Q1BA 1R9TA 1IKLA 4RGTA 4JYAQ 5C1PA 1STBA 1K83H 2B2WC 2F0VA 4QWEA 4J9OA 5IYDG 3FKIA 1BNCA 5IWAL 3ICEA 1SE3A 4JI0L 1B33N 4KV6A 3C0FB 2QW7A 4DV2Q 2QCPX 3PW0A 2D2CC 2ATLA 3ORQA 3MR6A 3ONAB 3QG1A 4HNUA 3ERSX 5J2UF 1M4VA 3KHHA 3GTLH 1Z9FA 4DV1H 1UNSA 3OHAA 1Y1VH 5LXTF 1LT4D 3MC0B 3A7LA 2SDFA 5C5LA 2NVYA 2RCNA 3M9NB 3PO3H 1E4FT 1JE4A 3LNNA 2MNAA 3Q8DA 2NU7B 3TIIA 4DV1Q 2ENBA 2R92G 1M0TA 5CBAE 3PF5A 4N8FA 4I7ZC 5FD5A 4XYQA 3TP5A 2F0QA 1I94H 3MXNA 1W6JA 2EYMA 5I9OA 3MVVA 2CQAA 4HNTA 3EA6A 3OOCA 4RGMA 1SMYD 2QYZA 4LMYA 4DR7L 1MI2A 1I94Q 4EFBA 2FLLA 2EYHA 1V8QA 3G6JB 2AWNA 2JQOA 2E75C 2Z8LA 2K1BA 1N34L 1B8AA 1CKNB 1JWUD 2JP1A 1PYSB 1TWCB 5IY0A 3FVQA 3K5OA 3MWEA 1I4PA 2DJFC 4QIWE 4BBRG 5C4JH 3HB9A 1G91A 4B3SH 5G3LD 1WJJA 4B3TL 1EY9A 2MP1A 2V9WA 1SE2A 5IOCA 1Q3LA 1TU2B 4A3GB 4B3SQ 1GUSA 3J81j 3M7NA 5JPMC 3HS0C 4LJZC 1A63A 4YJ3F 3PGZA 5GAGC 3E3XA 1GUOA 5FJ8G 2R7ZA 5DLQE 1EWCA 3H15A 4N9TA 2NVXB 4O4HF 4A3DG 4C2MA 1HHVA 3W1BA 3GTMA 4QMGA 4A3CH 2LSSA 3K0YA 3P20A 4JI4L 1S9FA 3OW7A 1C3OA 1B9MA 1SROA 1XNQH 2B2YC 3EROA 1G6ZA 2HVSA 4L5RC 2XGPA 4UDUC 4A4IA 5C5JA 5BR8H 3CMAA 2R7KA 1PRTB 3HKZE 3TP6A 1XNQQ 3CCVA 2CW0C 3PV0A 3N6XA 5KFGA 4A93G 3HEJA 4PMCA 4CDDC 2FINB 3K58A 1R4QB 5I2XA 1ASZA 1Y1WH 1KJIA 4C3IH 5BR8Q 1A9XA 1X65A 4IZ8A 5A35A 3GTJA 1K3RA 4UCOA 1A8VA 3SK4A 4DR3H 2B29A 2ES2A 1FVIA 1PX2A 4EGJA 1DZ1A 1Z2NX 2RCFA 4P71A 4A3IH 1AW7A 4O3RA 3NPPA 4JI7L 1PTOF 5FOBB 2HUGA 1VQBA 3VR2A 2C2EA 1GUNA 3QWNA 4OX9L 3BDLA 2YZNA 3J80c 2N88A 2N49A 5FLXW 2QA4A 1CHPD 5KG4A 2WV6D 4RCNA 3KJOA 3HXLA 2FMMA 2OH2A 2PQAA 1VQAA 3UE0A 1LYLA 4ED6A 4JI8Q 3RUPA 1XMQH 5HURA 3RZDB 2IT1A 1SNOA 2BH8A 5CV6A 1JDEA 3VR5A 1RL2A 4U673 3DXJC 1VBHA 3DWQA 1PH3A 1PZKD 2IHEA 4IWYA 2XTIA 5EWGA 1I94L 1K28A 5LP6F 1EY5A 3KYHC 1XMQQ 3J80i 3GTOA 5FLMG 3L3OC 2KVMA 5KYLA 3RAQA 3D4RA 2EY6A 4GC7A 4KY7A 4O3SA 4PWQA 2MJ8A 4MN3A 4F7XA 3JAMc 1IL8A 3PN1A 1EZ1A 4A3GH 4I7AA 3OWEB 3ZJYC 4MTDA 1BJTA 3RR5A 5GONF 4DUZL 3FKIH 1MIUA 4ZYSA 3PSIA 3HOYG 2MPMA 1XNRL 1PTOH 2FKLA 3TBIB 5HGQA 5IGDA 3MFHA 2FMCA 3A8JE 4BBSG 2GVAA 1SSOA 2V5AA 1TQOA 1GLVA 2C00A 4UCTA 3OTOH 3H91A 2OQKA 3SK8A 2J6UA 4K2KA 2E2IB 3JAMi 3I55A 3E0EA 4OIKA 5CV8A 2RHQB 1Q8KA 4DR2Q 3J7AK 2NVTB 2A19A 2K01A 4LW1A 1A62A 1WFQA 2H4OA 3SE0A 3M85A 4FF2A 3OTOQ 3GIDA 5E3FA 4JI3H 2L9HA 2VUMA 3KHLA 2VY3A 4ZQIA 2AQ4A 4A76A 4ECWA 1FNUA 4DR5H 1X3QA 4KJNA 1QB5D 2J7ZA 3S15H 5FPRA 4BBRB 1IHZA 1KJJA 1TWFA 2YU9B 1KHIA 4JI3Q 4LF6H 4LNQA 2IL8A 3PCOB 5DG7A 5EPKA 5IE8A 1B4OA 3PIO3 2YL2A 5LHY1 4DR5Q 5BR8L 2PMZB 1JKJB 4J9NA 3T53B 1L0YB 2PZUA 3CW2C 3HRZC 4LF6Q 3NBHB 1W6KA 2R7ZB 5D1OA 1EUCB 5LA6F 3TS0A 1PRTD 5JVH3 1PH5A 4I4TF 3NSWA 5T14A 2W6ZA 2O2LD 4A3BG 1SMYC 4C5CA 3FMCA 5KT3A 5FO9B 4ECSA 5A2QE 3Q22A 4WJ3M 4K2LA 3IFTA 1PK8A 5IYDH 1U4MA 3H0GB 3RZDH 3GTQH 1H95A 4KD4A 1STHA 1YHQA 1CUKA 3HOXG 1KABA 5K36G 5EQ0A 1TIID 3M4PA 3R2TA 3BZKA 2VB3X 3GTGA 4ECRA 5KT2A 1O7YA 2B2VC 2N8NA 5L1JA 2RGRA 1N9WA 1EY4A 4XQQA 1EYZA 1I4XA 4DU9A 4KD3A 3RTXA 3I4OA 4DXFA 2E76C 1XMQL 5CR3A 1XPOA 1I3QA 4AH6A 1S4ZA 3WOFA 1EQQA 5KFZA 3G6VA 1RKNA 4F4YA 4OXPA 1WTQA 2R92H 4F4XA 1HNXH 1ET6A 5IP7G 3MA2B 3VYSA 3KAKA 4ZCKA 2K05A 1LTGD 4H0LC 2DY8A 4A3EG 1L0WA 1HNXQ 3FPPA 2JK8A 4HIDA 3DEPA 2UXBL 2OEOA 5JVLA 3RLNA 2B2WA 4XYOA 3BQ1A 3L0OA 1VQOA 1TWHA 2JA5A 2VPSA 5CV5A 2W9BB 3RMHA 3KUPA 3A7AB 3WDNA 3GTPB 2ZXPA 1HZBA 3T13A 4BBRH 5IYCH 3K81C 3OTOL 3G6YA 3IKJA 2KUMA 2A6HD 1HR0W 3TS2A 3S24A 1D5XC 2Z6KC 2A1AA 2WAQB 3TZUA 4LWCA 2ASLA 2I80A 3V6KA 4G7ZC 3N44B 2NWGA 3VR3A 1YEZA 1N33L 3CCLA 5HY6A 4FXKC 1A3TA 3Q0AA 4EYHB 1QCBD 1NNXA 3M4OB 4TKOB 3HOYB 4AQYH 3KLRA 3M3YB 2FPIB 4ED1A 5FJ8H 3TRZA 3V05A 1JB7A 2NBFA 1IW7D 1ILQA 5JJKA 4A3DH 1EIHA 2B8GA 4AQYQ 3GV5B 4EBDA 3KOJA 4IUUA 5IGCA 1TKWB 4LUVA 1JDBB 2R82A 3OPOA 1PFMA 1HZCA 3GV3A 1PZID 1I4HA 1Z7TA 3CD6A 4RKBA 3BAAA 3VA7A 4A93H 2UVWA 3KBGA 2RBMA 1VQ4A 1RK6A 1GUGA 4IAJA 1VQGA 2VQDA 2ZDGA 1H9SA 1OXVA 2WB1G 1DV1A 1TWAA 3BG5A 3HOVB 3MXGA 5CGKA 3A8KE 4F87A 5LL6S 1A0IA 1OTCA 3R5XA 3ND8A 4JBJA 1KJ9A 4DV4H 1PYBA 4K5XA 1E2VA 5KFSA 2K7VA 5ELNA 4DV0H 1FNWA 1N8RC 3JC66 2EIFA 2K52A 3TP8A 2O5IC 3I3CA 2NU8B 4DV4Q 4NXMH 2UUAL 1RJTA 4R8UB 1NY4A 4LF4H 4YAJB 4RKLA 5KFTA 2HDMA 1K8MA 4BWSC 3S2DB 1WOCA 2KCMA 4RHRA 1K8AC 3VMMA 4NXMQ 1B6SA 2L0CA 2F4IA 2YTXA 2V4QA 4EQ5A 4LF4Q 5L1IA 4DPGA 4YP3A 2B2YA 3CCEA 2P5ZX 3HKZG 2OXPA 1OXSC 3I8ZA 4KKTA 3PUXA 1HNXL 2R93B 2WTFA 4R8NA 1RTOA 1GHJA 3HOXB 3NEMA 4Q45A 3HBLA 5DM73 3JSNA 2RDGA 3D0FA 3NXWA 3E6ZX 5IGEA 3HOWB 4QCLA 3EYYA 4LF8H 1TWGB 1YZ6A 5FLMH 5EZYF 1NCVA 2XIWA 1TY2A 1YITA 2LKVA 5CA1F 1T5EA 2NZOA 1PH7A 5H80A 2JEIA 2WP8J 1R4PB 5M3MG 5EKKA 2R3ZA 1PRTC 3ETJA 2JA8G 2K5DA 4UAIA 1VQ7A 2EQSA 3KLSA 1S5DD 4QIWA 2ATWA 2E2HA 1KLGD 4ECUA 2EXZA 5GAEC 1TS4A 5L37A 4GOPB 4OHJA 1GO3E 4BBSH 2DLNA 1I6HB 4J1MA 2VL6A 1U9RA 5KG6A 4ECQA 3VPBA 3J81i 4AYBG 3I4MB 3G4SA 1EZ6A 4DK1A 5KFBA 2B63B 4GKJH 4WRDA 2IX1A 4DGZA 4QF4A 2HIXA 2L15A 1GD7A 1QUQB 3CXCA 3OMGA 1F9PA 3BYTB 2VR1A 3Q1KA 4DF7A 1L1OB 1D8LA 3OSNA 5AJ3L 3UDGA 3FRPB 1LTSD 1Y69U 4IPDA 5K5PA 1ENAA 1ILPA 4NP5A 4YY3H 3SK5A 2O03A 2KHIA 5BN4A 4JI5H 1UE5A 1WTHA 3LWEA 4M7EA 2H1EA 3BS1A 4O3PA 4J6HA 3MR5A 4RAYA 2H5XA 5M3FH 1SXTA 2M9VA 5KFIA 3P7JA 1O78A 5CBEE 1VS0A 5I2YA 2W6NA 4YY3Q 4HJ7A 2DPJA 3HKZA 2J6SA 4B3RH 2C9OA 5C3EG 2F0FA 5C4XG 3F2BA 3CC7A 1TWHH 1PV4A 3T5HA 3QIAA 3WOEA 5FLXc 1IYVA 3D4WA 1LT3D 1KJ8A 4DK0A 1KRSA 3B6YA 3CHBD 4A3BH 4B3RQ 1KBLA 3BQ0A 5A2QW 3J81L 4A3LG 1PVOA 4LK1C 2EJMA 3PVXA 4DV0L 5GQOA 5BMVF 3RJ0A 2GN5A 4KHVA 3TEHB 5DG9A 2W8LA 4TVAB 1AE3A 3KBXA 4KY6A 3RN5A 2UUBL 4A3JB 5D65A 5JQWA 3RAXA 5CC4A 3SXHA 3BZCA 3HOXH 1ESRA 5I9PA 2A6HC 1JORA 3PR5B 4CKCA 1YIJA 4HNVA 5CAEB 1PMRA 2E74C 4HSPA 2NB0A 2WB1B 3CQZB 3U4ZA 5KNBA 4OONA 2ZM6L 5EWFA 1HJPA 3N8DA 4NB3A 3J7ZC 1V1PB 4IUNA 4DL2A 1IW7C 1OXUA 2NVQH 2R6FA 1X3EA 3RZOB 4R7RA 2M00A 4LF8L 4QY7A 5IP7H 1S03G 1CZGA 3MWDA 1RDPD 2KHSA 2ZT9C 1BCPB 4CDEC 3FDSA 2RDIA 1TWAH 1A3VA 4A3EH 3K57A 4YR0A 5HBRB 2CQYA 2XIGA 1VQ9A 4K5VA 3K6OA 2JA6A 5IT9E 1IBKQ 5KG3A 4YR2A 5T1GA 2L11A 1H9KA 3S1NB 3PO2H 2Q2IA 1IOWA 2VA3A 1C0AA 2B2VA 1MJEA 4DK6C 4GKJL 4Q0YA 4UFZA 1J5EQ 2RKSA 2WACA 4X65H 1K83B 1JWMD 3GP7A 3SDZA 1JQYD 1N48A 3KAJA 2WAQE 3CCRA 4A3MG 1QILA 2OTJA 2MO0A 2JA8B 1BF4A 1E4GT 4YJ2F 4X65Q 3QO2A 2IPKD 2Q8RE 3ER0A 4JK1C 5ELDA 4UP9A 2A68D 4S3SA 4JI5L 3STBD 2PVPA 1FGUA 3NE5B 1YNXA 2IWHA 3VR4A 1Y1VB 1HNZL 2CZGA 1XX8A 4CDCC 4RUAA 3HGBA 3PO3B 1SFOA 2A69D 2QDBA 2K5HA 5IIFA 3KDFA 1EFWA 2HT1A 4B3RL 2ASJA 2AGQA 1VMCA 4IRDA 1CM9A 1XMOL 1YNND 3MZ5A 2ZJQA 3V6JA 4IR9A 2NZHA 3R3OA 2AWOA 3UDXA 1N56A 2FB9A 3WNZA 4RNOA 3S1MB 2VXWA 2E2HH 5KG5A 1PLFA 2NUAB 2LXKA 3MFGA 5I4DA 1YI2A 1F2YA 2XD4A 5CB4F 2EY2A 4YHHH 4Q8FA 1C7YA 1DD2A 2AUKA 2R7DA 2YS6A 1ZXTA 3AYHB 3CC2A 2JA7G 2Z6KA 3L2PA 1VQLA 2E5LH 5C44H 2DN8A 4YHHQ 2VQEL 1HR0Q 3ETHA 5C3EB 5KX5F 3H6MA 1LO5D 5C4XB 3ULJA 2XCLA 2PBZA 1LACA 2CWAA 4LUZA 1O7ZA 1T94A 1HQRD 2BR0A 4IURA 5C4JB 3T5JA 4ZLTF 1CI3M 1EL0A 2IY5B 1ULZA 1AFPA 4RB0A 4X3KA 3OIPA 4FO2A 1VQJA 2CW8A 4JI2H 5KT5A 2EYJA 1XPUA 1QNUA 4GLXA 1KLUD 2I5LX 1EHIA 3SI8A 1DCZA 3R23A 1U0LA 1SDFA 2R6GA 5ELFA 4JI2Q 2WDTA 2XSCA 5KFKA 2DNCA 3AB9A 4MNOA 2B2UC 1W96A 1WD1A 4HTHA 3R8BA 5DNFA 1FJGL 4JV1A 1L2ZA 4ED8A 4EQPA 4DV2H 4TV8F 1M6VA 4MV4A 1P8LA 1SNMA 2RQXA 1GKHA 4LH6A 4Y52H 5KFWA 5M3MH 1HZ9A 1CZWA 1QZHA 2JA8H 3RGZA 2IX0A 3SGIA 3URYA 1TWCA 2O5JC 4XYLB 5G3LF 4OO1I 2Y0SE 2KA7A 4EGVA 1Y1WB 4O3QA 2SEBD 4C3IB 3EN2A 1DM0B 4LMQD 4A3KG 2AUJD 1DOMA 1CQVA 1KXLA 4DR6H 4KHPH 2YYAA 5JUMA 2JA7A 1A6XA 4OWWB 3TQ1A 4TV9F 4A3IB 1PH2A 4DUYH 5F9LA 1D5MC 2RVLA 2C2DA 4KHPQ 4DR6Q 5GROA 1EQVA 1YJWA 1A2TA 1S10A 3S1MH 2NVXA 4LAAA 1EQRA 4OO1G 4GNXC 4DUYQ 2NTTA 2HD3A 5E4WC 2Q8IB 3I70A 4ODGA 2WYOA 1EEFD 4DAPA 4KI0A 3SE7A 4KMUC 4ZKCB 3J7AV 1SYEA 2RSOA 4HEDA 1X3PA 2AQ1B 3RLFA 5C3EH 1I50A 2X6GA 5C4XH 1JOQA 3LWUA 5M5XH 3RGXA 4JV5H 5IYCG 4YHHL 4G7HC 2E8GA 4A3FG 4HYKA 3ORRA 4K14A 1RCVD 1M90C 2YV5A 4A3LH 1EY8A 3K7UC 2E5LL 2KHJA 3EFXD 4I55F 3U50C 4JV5Q 3D4DA 1KD1C 2AQ2B 4EGQA 4MV9A 5GADC 5JAVA 3AFQA 3FKIB 5T1IA 4OGQC 1PA6A 4GOPC 1KJQA 1PTOB 4A2BA 3TMEA 2EDGA 1QOHA 4GN5A 4H02A 3D8GA 1KRTA 5C3WA 1VKZA 3K8AA 4JI2L 2GPWA 3U9SA 2Z0SA 4LFCH 3M4YA 4DAYB 1VQ6A 4DR4H 4LFBH 2K5WA 1RJRA 1S0OA 2Q8TA 1SFOH 3STBC 2D62A 2A68C 3M7GA 3CU7A 3VYTA 4JYAL 2J9GA 4LFCQ 3RD4A 3RLOA 4YBZB 1VMPA 2FJ2A 2PPBC 4DR4Q 1RIPA 4B9WA 1IZ6A 4LFBQ 4YAKB 1XDNA 2R87A 3MEFA 2ALYB 2A69C 3S15B 4DV2L 4FVMA 1KEEA 3HP3A 4C3HH 4QW8A 3MXNB 1YNNC 4PMWA 4LF7H 2VA2A 2D5DA 4JPBW 1Q1EA 1JOKA 1K0SA 1EY0A 2XWBB 3BDOA 5KFXA 2W8KA 1J9OA 5IT9W 4XT3B 2E2JH 2W9AA 3GDEA 4LF7Q 5KT6A 1H9JA 3TSSA 2VUMG 4DV1L 2W6OA 4UCVA 4RU9A 4IOAA 2FK2A 4JI8H 1I5FA 3MR2A 2F03A 2HVQA 1A2UA 3EQLC 1JC7A 3GD7A 3I4NG 1UEAB 3NUCA 3M9BA 4TSSA 1NAPA 1KDCA 2QILA 4H44C 2UXDH 4IR1A 3GTQB 4DV5H 4A3MH 3CVZA 3T1HH 1W2BA 4C3JG 5KNCA 4POFA 2PW5A 3CRLC 5KFMA 4O1NA 2YCHA 3MHBA 1SJED 3CCJA 1KIXA 2UXDQ 4DV5Q 3T4AC 3T1HQ 1FD7D 3IL8A 4R8IA 2YU9A 1F9RA 3H3VC 2R8IA 2EXDA 2EYPA 2F3VA 2VQFH 4APMA 4EQNA 3S2HH 1R9TH 2JEFA 3GTMB 1EYAA 4IPCA 4IUQA 1JXLA 4QWCA 5EBDA 2AKWB 2R92B 3NBHA 1G6PA 3GTKA 2VQFQ 1LUZA 2RSNA 3OWFA 1PRTF 5JJIA 2R7LA 1B6RA 5KFYA 3QR8A 2LFNA 5LMNW 4IWXA 4B3SL 2B39A 4DR2H 1STYA 4JCVE 2HGSA 5DG8A 5E1FA 4ZK9B 5M5YH 3KLSX 2X0SA 1STEA 3I7FA 3RIZA 1Q12A 5DLFA 3CMEA 3BZDB 2IX3A 5C0XI 1GJXA 2VOBA 3HKSA 3CPFA 2NVYH 3H0GA 5C4HA 5M9OA 2EZVA 4RA8A 1WD0A 1WH2A 3OUUA 2JA7H 4LH7A 3WO0A 1HUNA 1K1QA 3QZ7A 4WORA 1B1ZA 2E2DC 3DHQA 4K0KH 3HG9A 1YHBA 3W2DA 5KFHA 1JLLB 1W3SA 2KEEA 1BOSA 3OMCA 3VR6A 2DJGC 4ZI7F 5KG0A 1Y8PB 3J80L 4F4ZA 3IFDA 2OTLA 3VYRA 4K0KQ 1XNQL 3UQ8A 4DR4L 1B44D 2F0JA 5M3FG 4ZHQF 1IYJB 2FK3A 5C0XG 4O3NA 1HNWH 1F9QA 1FNVA 5C3XA 1HA5A 2PQAB 1ZYRD 4YCVA 4BA2I
chains in the Genus database with same CATH topology
3CCMA 1FJGQ 4GN4B 1OXXK 1WOCA 2KCMA 2RF4A 3CF5A 1K8AC 2JA5G 4NXMQ 1HNWQ 1CKOA 1I50H 1Q81C 1JE5A 1EIYB 1Z47A 4R4IA 2YTXA 4JBMA 4YCUA 4EQ5A 4LF4Q 4DR3Q 5ELOA 2FXQA 4DPGA 1G291 1SE8A 3CCEA 4DAMA 3HKZG 1OXSC 2Q2HA 3PUXA 1HNXL 4MTNA 1LTLA 1NBWA 2N78A 1YHAA 2ZJRA 2BA1A 1Q46A 3NEMA 3CPWA 2UUCQ 3UDIA 4QQBX 1X55A 4X66L 2VNUD 3PUVA 1SRUA 3D0FA 2NN6I 1YZ6A 4R1JA 3TREA 5FLMH 1YVCA 5LMNL 1YITA 4DUZQ 2GVBA 1L1OC 2NZOA 4JI8L 2WB1E 1PH7A 4IFDI 1DGSA 1XNRQ 2B3GA 2WP8J 4R4OA 5M3MG 1K9MC 1IBML 2UXCL 5GAHC 4UP7A 2JA8G 1VQ7A 3T1YL 2EQSA 2OQ0A 3KFUA 4JOIC 4C2MH 2K5VA 5JEAJ 1VQKA 4A3KH 2ATWA 2R7ZG 3CP0A 3S1RH 4LF9Q 3GTMH 1GVPA 4A3GG 5GAEC 2Q2UA 4DK3C 1V9PA 4GOPB 2UU9L 3S17H 3K80C 4BBSH 1GO3E 2CKZB 2NN6G 2YYZA 4A3JH 3FKIG 2VL6A 1KQSA 4JI6L 3J81i 4AYBG 1GM5A 4JG2A 1U5KA 3G4SA 1X54A 4JI1L 4HIKA 4BY7G 4LUOA 2ZTDA 4P73A 2IX1A 1EWIA 4IFDG 4X6AH 3H0GG 2HIXA 2L15A 1GD7A 1QUQB 3CXCA 4QL5A 2C35B 1VCIA 4X64Q 1KC8C 4BA2I 1D8LA 1L1OB 2KBNA 1Q82C 4DR7Q 5AJ3L 3CQZH 3UDGA 1S40A 3CCQA 3EBEA 4IPDA 1VQFA 1N34Q 3A74A 2CWPA 3GTJH 2KHIA 4KHPL 4DR6L 1UE5A 4BA1I 1Q86C 4DV7L 4BXXG 3RZOH 2H5XA 4O0AA 1LM0A 2Y0SG 1BKBA 3K0XA 5M3FH 4DR2L 4B3TQ 2CQOA 4DUYL 3PO2G 1VS0A 2ZJPA 1XJVA 2E5LQ 4YY3Q 4HJ7A 4A3IG 2VZAA 3CAMA 3J7A5 4JBKA 1M1KC 5C3EG 4A3FH 1EIFA 4IPGA 1UE1A 1AE2A 1VQHA 5C4XG 3F2BA 2A8VA 1KAWA 3CC7A 1TWHH 1PH6A 1PV4A 2PI2A 4DKAC 5FLXc 4NPSA 4JC0A 1E1OA 1UWVA 1PH4A 5EAYA 1N32Q 5JJLA 1KRSA 3B6YA 1X56A 3KDFB 4JI3L 1VQNA 4A3BH 4B3RQ 4TQUS 5LMUQ 2ID0A 4A3LG 2JA9A 1PVOA 4DV0L 1SR3A 5GQOA 4DR5L 3M4QA 4AYBE 2GN5A 3TEHB 3S1NH 4TVAB 1AE3A 3RN5A 2UUBL 4X62Q 4LF6L 1WCMG 3GTOH 3BZCA 4HJAA 1Q1BA 4GNXA 1PH9A 3HOXH 4JYAQ 4JV5L 1K83H 1TWCH 3RNUA 5IYDG 1YIJA 5IWAL 3ICEA 5IYBH 1ASYA 4JI0L 2YTVA 5E7NA 2JJQA 3U4ZA 4DV2Q 3F1ZA 2WAQG 4OONA 2ZM6L 3GTKH 1HJPA 3ERSX 4NB3A 3J7ZC 3G48A 3GTLH 1Z9FA 1Y1VH 1OXUA 2NVQH 1X3EA 5IP9G 4GKKQ 1JJCB 2RCNA 3PO3H 4LF8L 4QY7A 5IP7H 1NJIC 5C44G 2MNAA 2NVXH 3Q8DA 3OW2A 4LFCL 4DV1Q 2UXBQ 1E24A 2R92G 2D0OA 1VQEA 4LF9L 4LFBL 3PF5A 2BH2A 2VS1A 1TWAH 4A3EH 4GOPA 1K73C 2VUMH 1PFSA 1BBWA 1VQ9A 3PIPA 4EX5A 2K4KA 4DR1Q 4DV6Q 1QVGA 1IBLQ 3I4NH 4RMFA 1IBKQ 1TWFH 3K7AH 1E22A 3TQYA 2K50A 3W5OA 4X64L 4APVA 3CC4A 1L2FA 1VQMA 3PO2H 4DR7L 1I94Q 2Q2IA 1C9OA 3ULPA 4LF7L 3HOVG 1C0AA 1MJEA 4DK6C 2AWNA 1EUJA 2JQOA 1J5EQ 1N33Q 3NELA 4GKJL 4YWLA 2HIVA 4C3JH 1N34L 3S14H 1B8AA 1CKNB 1PYSB 2I5MX 5IY0A 1Q7YC 1CSQA 4OWTB 3HOUG 4BBRG 2WAQE 4QIWE 5C4JH 2KCTA 3CCRA 4A3MG 2OTJA 2MO0A 3IRBA 4GLVB 1WJJA 4B3TL 4HJ9A 2LXJA 4KLKA 4X65Q 3ER0A 3BU2A 3STBD 4UP9A 4JI5L 1FGUA 4B3SQ 1YNXA 4L5SA 3J81j 2QEXA 1HNZL 3M7NA 4BY1G 1A63A 1WCMH 3PGZA 5GAGC 1PHJA 2UXDL 5FJ8G 4QJFA 4DV5L 5DLQE 1EFWA 3H15A 2JE6I 2K5HA 3KDFA 3T1HL 2HT1A 1X3FA 4B3RL 3GTGH 4A3DG 2R93G 3DM3A 4LF5Q 1XMOL 2ZJQA 3F8TA 1X9NA 1CKMA 3W1BA 3RN2A 1YBYA 2NZHA 2LSSA 4JI4L 4A3CH 3UDXA 2AWOA 1SROA 2F4VQ 4X62L 1VQ5A 2E2HH 3G71A 2LXKA 1Y14B 3HOWG 3I56A 4L5RC 1I3QH 2VQFL 4FDBA 4A4IA 4AQYL 1YI2A 4PG3A 1D7QA 1TXYA 3PUWA 3CMAA 2QGQA 1VQPA 1PH1A 1C7YA 2R7DA 3HKZE 1XNQQ 3CCVA 5JEAG 3EIVA 3PV0A 5IP9H 4HJ5A 1K8GA 4A93G 3AYHB 3CC2A 2JA7G 2Z6KA 4PZ6A 1QVCA 1X3GA 3L2PA 1VQLA 1ASZA 1E1TA 5C44H 1Y1WH 2UUAQ 4C3IH 5H1SE 2PI2E 5BR8Q 1KL9A 4YHHQ 2VQEL 1QZGA 1HR0Q 1SMXA 3NENA 1X65A 3ULJA 1HH2P 3E9HA 4HIOA 3G6EA 1K3RA 4PZ7A 3F2CA 2R7FA 3UE1A 1A8VA 2CWAA 4LUZA 3W1GA 2B29A 5IT9c 1FVIA 2ES2A 4P71A 4A3IH 2IY5B 2PMZE 4JI7L 2HHHQ 3I4MG 4GKKL 4XIGS 2AHOB 1VQJA 2B63G 2JA6G 2E2IH 2JA5H 1K0RA 4R4CA 1VQBA 1XPUA 4GLXA 4K0KL 4OX9L 2NVTH 3J80c 2I5LX 2N49A 4X66Q 2QA4A 1PH8A 2XGTA 1BBUA 1U0LA 4DV4L 2R6GA 4JI2Q 3KJOA 5LMNQ 2PQAA 4MNOA 1VQAA 1B70B 1MJCA 2WFWA 3UE0A 1FJGL 1LYLA 1NTGA 4J15A 4JI8Q 4DV6L 4IJLA 2IT1A 2BH8A 4LFAQ 1VQIA 1IBMQ 4NXML 1RL2A 1HNWL 2PNHA 4DV3Q 1PH3A 2YU9H 3T1YQ 4LF4L 2IHEA 4DR3L 2XTIA 1JT8A 1JJGA 1I94L 1P8LA 2CFMA 3KYHC 1GKHA 1XMQQ 2RHSB 5M3MH 1HZ9A 3J80i 4Y52H 3BJUA 4OWXB 5FLMG 1QZHA 2JA8H 2IX0A 4WJ4A 3SGIA 2UUCL 4L5QA 3FHWA 2R7ZH 3JAMc 1T9HA 4A3GH 2K14A 2CCZA 2DUDA 3ZJYC 4OO1I 2Y0SE 2HQLA 2V1CC 2VW9A 3OYYA 3LGJA 4RG1A 3RR5A 3EN2A 1UEBA 4DUZL 3FKIH 1MIUA 3L7ZC 3PSIA 4A3KG 3HOYG 1EYGA 1XNRL 1KXLA 5HGQA 3KF6B 5AJ3Q 3H3VI 1XTDA 4BY7H 4BBSG 2GVAA 2AMCB 4A3JG 4OWWB 3H0GH 1PH2A 3S16H 2JEAI 3CCSA 5C0XJ 4KHPQ 2OQKA 2ZTCA 5GROA 1YJWA 4DR6Q 3JAMi 3S1MH 3I55A 3E0EA 1UE6A 1EQRA 2RHQB 1Q8KA 4DR2Q 4OO1G 1AH9A 2BA0A 2A19A 4DUYQ 4LW1A 4GNXC 1A62A 1E7ZA 1WFQA 3M85A 4R4QA 3OTOQ 2F4VL 4KHZA 3KJPA 4BXXH 2VY3A 3F2DA 1QUQA 4KI0A 4A76A 1L1OA 3S15H 5M5WH 3A5ZB 3RLFA 3UDFA 5C3EH 4A75A 1KHIA 4JI3Q 5C4XH 4LNQA 4JOIA 3PCOB 3AEVA 5IE8A 1FL0A 5M5XH 1EOVA 4DV0Q 4DR5Q 5IYCG 5BR8L 4YHHL 1JJ2A 2E8GA 4A3FG 1M90C 1V43A 2YV5A 2UUBQ 3CW2C 2MQHA 4LF6Q 3AFPA 1QVFA 4A3LH 3K7UC 3NBHB 2KHJA 4YY3L 2E5LL 4GNXB 3TS0A 1PH5A 1BVSA 3U50C 1CSPA 4JV5Q 1KD1C 4A3BG 2HHHL 2DGYA 3FP9A 1J6QA 5GADC 4NXNQ 3AFQA 1PA6A 4GOPC 5IWAQ 4B3MQ 4JI0Q 1N32L 3DLLA 4WJ3M 1G51A 3AQQA 4GN5A 4H02A 3D31A 4UY8C 2ZM6Q 1KRTA 5LMUL 3GTPH 1OXTA 3RZDH 5IYDH 3GTQH 1H95A 3K8AA 1N36Q 4JI2L 1WI5A 1CUKA 2K5NA 1VQDA 3ULLA 3HOXG 2Z0SA 1YHQA 1MKHA 3J81c 4IFDJ 5K36G 1NMFA 4DAYB 1VQ6A 3M4PA 3E9IA 3BZKA 4LFAL 4XTCS 2ZTEA 2N8NA 5IYBG 1SFOH 4LF8Q 3STBC 4DV3L 2D62A 4JYAL 1N9WA 4R4TA 1HR0L 4LFCQ 3RLOA 1YJ9A 3M4OH 3HOZG 4IJHA 4Y7NH 3HOYH 3I4OA 4AIMA 1VQ8A 3M3YH 1RIPA 1XMQL 1IZ6A 1VQCA 2I5HA 2OCEA 1XPOA 4DR4Q 4AH6A 1EQQA 4JBWA 3MEFA 2ALYB 2N3SA 1Y1VG 4DV2L 4OXPA 2R92H 3GO5A 3S1QH 2MFIA 4C3HH 3MXNB 3PO3G 4PMWA 1XPRA 5IP7G 1Q1EA 3VDYA 4GN3B 4DNIA 2E2JH 3I2ZA 3KF6A 3GDEA 4YWKA 4A3EG 2I0QA 1L0WA 1HNXQ 4LF7Q 1IL2A 1SLJA 4L5TA 2VUMG 4DV1L 2JK8A 4GKJQ 4HIDA 3H3VH 4IOAA 2UXBL 2F52A 3RLNA 1I5FA 3PF4A 3GD7A 3L0OA 2OWOA 3I4NG 1VQOA 4LFBQ 1NMGA 3HOVH 3M9BA 1IXRA 4YCWA 4DR1L 1IBLL 1HZBA 4BBRH 3OTOL 5IYCH 3K81C 4MZ9A 1IBKL 4A3MH 3HOUH 4JI5Q 2UXCQ 1W2BA 2IHFA 1HR0W 3TS2A 3S24A 4POFA 3U58A 5J3BA 1HNZQ 2Z6KC 2A1AA 4P74A 4P75A 1S72A 4LWCA 4UP8A 3CCJA 1KIXA 2UXDQ 1YEZA 1UE7A 4DV5Q 1J5EL 3CCLA 3T1HQ 2UU9Q 1N33L 5HY6A 4POGA 4P72A 3PIOA 2EXDA 1CKNA 2F3IA 4BY1H 4ME3A 2JEBI 3S2DH 4JI6Q 1XMOQ 2Q2TA 4O2DA 1B7YB 1R9TH 4UPAA 3S2HH 1WYDA 4IPCA 4JI1Q 4JI4Q 5FJ8H 3PUYA 3TRZA 1JB7A 4X65L 1E3PA 3HFZB 2AKWB 2YTYA 3A5UA 4A3DH 2R93H 5JJKA 1G6PA 2VQFQ 1LUZA 5JJIA 4AQYQ 4YWMA 5LMNW 3KOJA 4LUVA 4B3SL 4IPHA 4JCVE 4NXNL 1HZCA 3HOWH 1YJNA 3WWVA 5M5YH 1TWGH 4GLAC 2K75A 4B3ML 4A3CG 3I7FA 3U4VA 3CCUA 1Q12A 3CD6A 3CMEA 5C0XI 3HKSA 2VQEQ 3HOZH 4DV7Q 3CPFA 2KENA 2NVYH 3KLWA 4LF5L 4A93H 1N36L 2JA7H 1VQ4A 3KF8B 4HIMA 1VQGA 1OXVA 2WB1G 1YHBA 1A0IA 1NE3A 1OTCA 4JBJA 4JI7Q 1PYBA 1S3OA 1W3SA 2MO1A 5ELNA 4QGUA 1Y1WG 1N8RC 1I6HH 2OTLA 3JC66 4K0KQ 2ASBA 4OX9Q 1XNQL 1SN8A 3I4MH 2EIFA 4DR4L 1P16A 1V1QA 2K52A 5M3FG 1IYJB 4IO9A 5C0XG 4ALPA 1JMCA 4DV4Q 1HZAA 3PUZA 4IOCA 2B63H 2JA6H 3A0JA 2UUAL 2D0PA 1O7IA 1X6OA 4PZ8A 4HJ8A 1NY4A 2PQAB 4YCVA 4GS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM A;  1FJG Q;  4GN4 B;  1OXX K;  1WOC A;  2KCM A;  2RF4 A;  3CF5 A;  1K8A C;  2JA5 G;  4NXM Q;  1HNW Q;  1CKO A;  1I50 H;  1Q81 C;  1JE5 A;  1EIY B;  1Z47 A;  4R4I A;  2YTX A;  4JBM A;  4YCU A;  4EQ5 A;  4LF4 Q;  4DR3 Q;  5ELO A;  2FXQ A;  4DPG A;  1G29 1;  1SE8 A;  3CCE A;  4DAM A;  3HKZ G;  1OXS C;  2Q2H A;  3PUX A;  1HNX L;  4MTN A;  1LTL A;  1NBW A;  2N78 A;  1YHA A;  2ZJR A;  2BA1 A;  1Q46 A;  3NEM A;  3CPW A;  2UUC Q;  3UDI A;  4QQB X;  1X55 A;  4X66 L;  2VNU D;  3PUV A;  1SRU A;  3D0F A;  2NN6 I;  1YZ6 A;  4R1J A;  3TRE A;  5FLM H;  1YVC A;  5LMN L;  1YIT A;  4DUZ Q;  2GVB A;  1L1O C;  2NZO A;  4JI8 L;  2WB1 E;  1PH7 A;  4IFD I;  1DGS A;  1XNR Q;  2B3G A;  2WP8 J;  4R4O A;  5M3M G;  1K9M C;  1IBM L;  2UXC L;  5GAH C;  4UP7 A;  2JA8 G;  1VQ7 A;  3T1Y L;  2EQS A;  2OQ0 A;  3KFU A;  4JOI C;  4C2M H;  2K5V A;  5JEA J;  1VQK A;  4A3K H;  2ATW A;  2R7Z G;  3CP0 A;  3S1R H;  4LF9 Q;  3GTM H;  1GVP A;  4A3G G;  5GAE C;  2Q2U A;  4DK3 C;  1V9P A;  4GOP B;  2UU9 L;  3S17 H;  3K80 C;  4BBS H;  1GO3 E;  2CKZ B;  2NN6 G;  2YYZ A;  4A3J H;  3FKI G;  2VL6 A;  1KQS A;  4JI6 L;  3J81 i;  4AYB G;  1GM5 A;  4JG2 A;  1U5K A;  3G4S A;  1X54 A;  4JI1 L;  4HIK A;  4BY7 G;  4LUO A;  2ZTD A;  4P73 A;  2IX1 A;  1EWI A;  4IFD G;  4X6A H;  3H0G G;  2HIX A;  2L15 A;  1GD7 A;  1QUQ B;  3CXC A;  4QL5 A;  2C35 B;  1VCI A;  4X64 Q;  1KC8 C;  4BA2 I;  1D8L A;  1L1O B;  2KBN A;  1Q82 C;  4DR7 Q;  5AJ3 L;  3CQZ H;  3UDG A;  1S40 A;  3CCQ A;  3EBE A;  4IPD A;  1VQF A;  1N34 Q;  3A74 A;  2CWP A;  3GTJ H;  2KHI A;  4KHP L;  4DR6 L;  1UE5 A;  4BA1 I;  1Q86 C;  4DV7 L;  4BXX G;  3RZO H;  2H5X A;  4O0A A;  1LM0 A;  2Y0S G;  1BKB A;  3K0X A;  5M3F H;  4DR2 L;  4B3T Q;  2CQO A;  4DUY L;  3PO2 G;  1VS0 A;  2ZJP A;  1XJV A;  2E5L Q;  4YY3 Q;  4HJ7 A;  4A3I G;  2VZA A;  3CAM A;  3J7A 5;  4JBK A;  1M1K C;  5C3E G;  4A3F H;  1EIF A;  4IPG A;  1UE1 A;  1AE2 A;  1VQH A;  5C4X G;  3F2B A;  2A8V A;  1KAW A;  3CC7 A;  1TWH H;  1PH6 A;  1PV4 A;  2PI2 A;  4DKA C;  5FLX c;  4NPS A;  4JC0 A;  1E1O A;  1UWV A;  1PH4 A;  5EAY A;  1N32 Q;  5JJL A;  1KRS A;  3B6Y A;  1X56 A;  3KDF B;  4JI3 L;  1VQN A;  4A3B H;  4B3R Q;  4TQU S;  5LMU Q;  2ID0 A;  4A3L G;  2JA9 A;  1PVO A;  4DV0 L;  1SR3 A;  5GQO A;  4DR5 L;  3M4Q A;  4AYB E;  2GN5 A;  3TEH B;  3S1N H;  4TVA B;  1AE3 A;  3RN5 A;  2UUB L;  4X62 Q;  4LF6 L;  1WCM G;  3GTO H;  3BZC A;  4HJA A;  1Q1B A;  4GNX A;  1PH9 A;  3HOX H;  4JYA Q;  4JV5 L;  1K83 H;  1TWC H;  3RNU A;  5IYD G;  1YIJ A;  5IWA L;  3ICE A;  5IYB H;  1ASY A;  4JI0 L;  2YTV A;  5E7N A;  2JJQ A;  3U4Z A;  4DV2 Q;  3F1Z A;  2WAQ G;  4OON A;  2ZM6 L;  3GTK H;  1HJP A;  3ERS X;  4NB3 A;  3J7Z C;  3G48 A;  3GTL H;  1Z9F A;  1Y1V H;  1OXU A;  2NVQ H;  1X3E A;  5IP9 G;  4GKK Q;  1JJC B;  2RCN A;  3PO3 H;  4LF8 L;  4QY7 A;  5IP7 H;  1NJI C;  5C44 G;  2MNA A;  2NVX H;  3Q8D A;  3OW2 A;  4LFC L;  4DV1 Q;  2UXB Q;  1E24 A;  2R92 G;  2D0O A;  1VQE A;  4LF9 L;  4LFB L;  3PF5 A;  2BH2 A;  2VS1 A;  1TWA H;  4A3E H;  4GOP A;  1K73 C;  2VUM H;  1PFS A;  1BBW A;  1VQ9 A;  3PIP A;  4EX5 A;  2K4K A;  4DR1 Q;  4DV6 Q;  1QVG A;  1IBL Q;  3I4N H;  4RMF A;  1IBK Q;  1TWF H;  3K7A H;  1E22 A;  3TQY A;  2K50 A;  3W5O A;  4X64 L;  4APV A;  3CC4 A;  1L2F A;  1VQM A;  3PO2 H;  4DR7 L;  1I94 Q;  2Q2I A;  1C9O A;  3ULP A;  4LF7 L;  3HOV G;  1C0A A;  1MJE A;  4DK6 C;  2AWN A;  1EUJ A;  2JQO A;  1J5E Q;  1N33 Q;  3NEL A;  4GKJ L;  4YWL A;  2HIV A;  4C3J H;  1N34 L;  3S14 H;  1B8A A;  1CKN B;  1PYS B;  2I5M X;  5IY0 A;  1Q7Y C;  1CSQ A;  4OWT B;  3HOU G;  4BBR G;  2WAQ E;  4QIW E;  5C4J H;  2KCT A;  3CCR A;  4A3M G;  2OTJ A;  2MO0 A;  3IRB A;  4GLV B;  1WJJ A;  4B3T L;  4HJ9 A;  2LXJ A;  4KLK A;  4X65 Q;  3ER0 A;  3BU2 A;  3STB D;  4UP9 A;  4JI5 L;  1FGU A;  4B3S Q;  1YNX A;  4L5S A;  3J81 j;  2QEX A;  1HNZ L;  3M7N A;  4BY1 G;  1A63 A;  1WCM H;  3PGZ A;  5GAG C;  1PHJ A;  2UXD L;  5FJ8 G;  4QJF A;  4DV5 L;  5DLQ E;  1EFW A;  3H15 A;  2JE6 I;  2K5H A;  3KDF A;  3T1H L;  2HT1 A;  1X3F A;  4B3R L;  3GTG H;  4A3D G;  2R93 G;  3DM3 A;  4LF5 Q;  1XMO L;  2ZJQ A;  3F8T A;  1X9N A;  1CKM A;  3W1B A;  3RN2 A;  1YBY A;  2NZH A;  2LSS A;  4JI4 L;  4A3C H;  3UDX A;  2AWO A;  1SRO A;  2F4V Q;  4X62 L;  1VQ5 A;  2E2H H;  3G71 A;  2LXK A;  1Y14 B;  3HOW G;  3I56 A;  4L5R C;  1I3Q H;  2VQF L;  4FDB A;  4A4I A;  4AQY L;  1YI2 A;  4PG3 A;  1D7Q A;  1TXY A;  3PUW A;  3CMA A;  2QGQ A;  1VQP A;  1PH1 A;  1C7Y A;  2R7D A;  3HKZ E;  1XNQ Q;  3CCV A;  5JEA G;  3EIV A;  3PV0 A;  5IP9 H;  4HJ5 A;  1K8G A;  4A93 G;  3AYH B;  3CC2 A;  2JA7 G;  2Z6K A;  4PZ6 A;  1QVC A;  1X3G A;  3L2P A;  1VQL A;  1ASZ A;  1E1T A;  5C44 H;  1Y1W H;  2UUA Q;  4C3I H;  5H1S E;  2PI2 E;  5BR8 Q;  1KL9 A;  4YHH Q;  2VQE L;  1QZG A;  1HR0 Q;  1SMX A;  3NEN A;  1X65 A;  3ULJ A;  1HH2 P;  3E9H A;  4HIO A;  3G6E A;  1K3R A;  4PZ7 A;  3F2C A;  2R7F A;  3UE1 A;  1A8V A;  2CWA A;  4LUZ A;  3W1G A;  2B29 A;  5IT9 c;  1FVI A;  2ES2 A;  4P71 A;  4A3I H;  2IY5 B;  2PMZ E;  4JI7 L;  2HHH Q;  3I4M G;  4GKK L;  4XIG S;  2AHO B;  1VQJ A;  2B63 G;  2JA6 G;  2E2I H;  2JA5 H;  1K0R A;  4R4C A;  1VQB A;  1XPU A;  4GLX A;  4K0K L;  4OX9 L;  2NVT H;  3J80 c;  2I5L X;  2N49 A;  4X66 Q;  2QA4 A;  1PH8 A;  2XGT A;  1BBU A;  1U0L A;  4DV4 L;  2R6G A;  4JI2 Q;  3KJO A;  5LMN Q;  2PQA A;  4MNO A;  1VQA A;  1B70 B;  1MJC A;  2WFW A;  3UE0 A;  1FJG L;  1LYL A;  1NTG A;  4J15 A;  4JI8 Q;  4DV6 L;  4IJL A;  2IT1 A;  2BH8 A;  4LFA Q;  1VQI A;  1IBM Q;  4NXM L;  1RL2 A;  1HNW L;  2PNH A;  4DV3 Q;  1PH3 A;  2YU9 H;  3T1Y Q;  4LF4 L;  2IHE A;  4DR3 L;  2XTI A;  1JT8 A;  1JJG A;  1I94 L;  1P8L A;  2CFM A;  3KYH C;  1GKH A;  1XMQ Q;  2RHS B;  5M3M H;  1HZ9 A;  3J80 i;  4Y52 H;  3BJU A;  4OWX B;  5FLM G;  1QZH A;  2JA8 H;  2IX0 A;  4WJ4 A;  3SGI A;  2UUC L;  4L5Q A;  3FHW A;  2R7Z H;  3JAM c;  1T9H A;  4A3G H;  2K14 A;  2CCZ A;  2DUD A;  3ZJY C;  4OO1 I;  2Y0S E;  2HQL A;  2V1C C;  2VW9 A;  3OYY A;  3LGJ A;  4RG1 A;  3RR5 A;  3EN2 A;  1UEB A;  4DUZ L;  3FKI H;  1MIU A;  3L7Z C;  3PSI A;  4A3K G;  3HOY G;  1EYG A;  1XNR L;  1KXL A;  5HGQ A;  3KF6 B;  5AJ3 Q;  3H3V I;  1XTD A;  4BY7 H;  4BBS G;  2GVA A;  2AMC B;  4A3J G;  4OWW B;  3H0G H;  1PH2 A;  3S16 H;  2JEA I;  3CCS A;  5C0X J;  4KHP Q;  2OQK A;  2ZTC A;  5GRO A;  1YJW A;  4DR6 Q;  3JAM i;  3S1M H;  3I55 A;  3E0E A;  1UE6 A;  1EQR A;  2RHQ B;  1Q8K A;  4DR2 Q;  4OO1 G;  1AH9 A;  2BA0 A;  2A19 A;  4DUY Q;  4LW1 A;  4GNX C;  1A62 A;  1E7Z A;  1WFQ A;  3M85 A;  4R4Q A;  3OTO Q;  2F4V L;  4KHZ A;  3KJP A;  4BXX H;  2VY3 A;  3F2D A;  1QUQ A;  4KI0 A;  4A76 A;  1L1O A;  3S15 H;  5M5W H;  3A5Z B;  3RLF A;  3UDF A;  5C3E H;  4A75 A;  1KHI A;  4JI3 Q;  5C4X H;  4LNQ A;  4JOI A;  3PCO B;  3AEV A;  5IE8 A;  1FL0 A;  5M5X H;  1EOV A;  4DV0 Q;  4DR5 Q;  5IYC G;  5BR8 L;  4YHH L;  1JJ2 A;  2E8G A;  4A3F G;  1M90 C;  1V43 A;  2YV5 A;  2UUB Q;  3CW2 C;  2MQH A;  4LF6 Q;  3AFP A;  1QVF A;  4A3L H;  3K7U C;  3NBH B;  2KHJ A;  4YY3 L;  2E5L L;  4GNX B;  3TS0 A;  1PH5 A;  1BVS A;  3U50 C;  1CSP A;  4JV5 Q;  1KD1 C;  4A3B G;  2HHH L;  2DGY A;  3FP9 A;  1J6Q A;  5GAD C;  4NXN Q;  3AFQ A;  1PA6 A;  4GOP C;  5IWA Q;  4B3M Q;  4JI0 Q;  1N32 L;  3DLL A;  4WJ3 M;  1G51 A;  3AQQ A;  4GN5 A;  4H02 A;  3D31 A;  4UY8 C;  2ZM6 Q;  1KRT A;  5LMU L;  3GTP H;  1OXT A;  3RZD H;  5IYD H;  3GTQ H;  1H95 A;  3K8A A;  1N36 Q;  4JI2 L;  1WI5 A;  1CUK A;  2K5N A;  1VQD A;  3ULL A;  3HOX G;  2Z0S A;  1YHQ A;  1MKH A;  3J81 c;  4IFD J;  5K36 G;  1NMF A;  4DAY B;  1VQ6 A;  3M4P A;  3E9I A;  3BZK A;  4LFA L;  4XTC S;  2ZTE A;  2N8N A;  5IYB G;  1SFO H;  4LF8 Q;  3STB C;  4DV3 L;  2D62 A;  4JYA L;  1N9W A;  4R4T A;  1HR0 L;  4LFC Q;  3RLO A;  1YJ9 A;  3M4O H;  3HOZ G;  4IJH A;  4Y7N H;  3HOY H;  3I4O A;  4AIM A;  1VQ8 A;  3M3Y H;  1RIP A;  1XMQ L;  1IZ6 A;  1VQC A;  2I5H A;  2OCE A;  1XPO A;  4DR4 Q;  4AH6 A;  1EQQ A;  4JBW A;  3MEF A;  2ALY B;  2N3S A;  1Y1V G;  4DV2 L;  4OXP A;  2R92 H;  3GO5 A;  3S1Q H;  2MFI A;  4C3H H;  3MXN B;  3PO3 G;  4PMW A;  1XPR A;  5IP7 G;  1Q1E A;  3VDY A;  4GN3 B;  4DNI A;  2E2J H;  3I2Z A;  3KF6 A;  3GDE A;  4YWK A;  4A3E G;  2I0Q A;  1L0W A;  1HNX Q;  4LF7 Q;  1IL2 A;  1SLJ A;  4L5T A;  2VUM G;  4DV1 L;  2JK8 A;  4GKJ Q;  4HID A;  3H3V H;  4IOA A;  2UXB L;  2F52 A;  3RLN A;  1I5F A;  3PF4 A;  3GD7 A;  3L0O A;  2OWO A;  3I4N G;  1VQO A;  4LFB Q;  1NMG A;  3HOV H;  3M9B A;  1IXR A;  4YCW A;  4DR1 L;  1IBL L;  1HZB A;  4BBR H;  3OTO L;  5IYC H;  3K81 C;  4MZ9 A;  1IBK L;  4A3M H;  3HOU H;  4JI5 Q;  2UXC Q;  1W2B A;  2IHF A;  1HR0 W;  3TS2 A;  3S24 A;  4POF A;  3U58 A;  5J3B A;  1HNZ Q;  2Z6K C;  2A1A A;  4P74 A;  4P75 A;  1S72 A;  4LWC A;  4UP8 A;  3CCJ A;  1KIX A;  2UXD Q;  1YEZ A;  1UE7 A;  4DV5 Q;  1J5E L;  3CCL A;  3T1H Q;  2UU9 Q;  1N33 L;  5HY6 A;  4POG A;  4P72 A;  3PIO A;  2EXD A;  1CKN A;  2F3I A;  4BY1 H;  4ME3 A;  2JEB I;  3S2D H;  4JI6 Q;  1XMO Q;  2Q2T A;  4O2D A;  1B7Y B;  1R9T H;  4UPA A;  3S2H H;  1WYD A;  4IPC A;  4JI1 Q;  4JI4 Q;  5FJ8 H;  3PUY A;  3TRZ A;  1JB7 A;  4X65 L;  1E3P A;  3HFZ B;  2AKW B;  2YTY A;  3A5U A;  4A3D H;  2R93 H;  5JJK A;  1G6P A;  2VQF Q;  1LUZ A;  5JJI A;  4AQY Q;  4YWM A;  5LMN W;  3KOJ A;  4LUV A;  4B3S L;  4IPH A;  4JCV E;  4NXN L;  1HZC A;  3HOW H;  1YJN A;  3WWV A;  5M5Y H;  1TWG H;  4GLA C;  2K75 A;  4B3M L;  4A3C G;  3I7F A;  3U4V A;  3CCU A;  1Q12 A;  3CD6 A;  3CME A;  5C0X I;  3HKS A;  2VQE Q;  3HOZ H;  4DV7 Q;  3CPF A;  2KEN A;  2NVY H;  3KLW A;  4LF5 L;  4A93 H;  1N36 L;  2JA7 H;  1VQ4 A;  3KF8 B;  4HIM A;  1VQG A;  1OXV A;  2WB1 G;  1YHB A;  1A0I A;  1NE3 A;  1OTC A;  4JBJ A;  4JI7 Q;  1PYB A;  1S3O A;  1W3S A;  2MO1 A;  5ELN A;  4QGU A;  1Y1W G;  1N8R C;  1I6H H;  2OTL A;  3JC6 6;  4K0K Q;  2ASB A;  4OX9 Q;  1XNQ L;  1SN8 A;  3I4M H;  2EIF A;  4DR4 L;  1P16 A;  1V1Q A;  2K52 A;  5M3F G;  1IYJ B;  4IO9 A;  5C0X G;  4ALP A;  1JMC A;  4DV4 Q;  1HZA A;  3PUZ A;  4IOC A;  2B63 H;  2JA6 H;  3A0J A;  2UUA L;  2D0P A;  1O7I A;  1X6O A;  4PZ8 A;  4HJ8 A;  1NY4 A;  2PQA B;  4YCV A;  4GS3 A; 
#chains in the Genus database with same CATH topology
 3CCM A;  1I4G A;  2NZ1 D;  1BQQ T;  4GN4 B;  1JWS D;  1II3 A;  2RF4 A;  3CF5 A;  2JA5 G;  1HNW Q;  3GV7 B;  1CKO A;  1I50 H;  1Q81 C;  1JE5 A;  1EIY B;  4R4I A;  3QOL A;  4EBC A;  4JBM A;  4YCU A;  4DR3 Q;  2W70 A;  2FJZ A;  4I65 A;  3GV6 A;  3V96 A;  2OLS A;  4DAM A;  4A3D B;  1ICF B;  4RGN A;  1WVL A;  1F2Z A;  2Q2H A;  4RFB A;  4Q5V A;  1I7L A;  4MTN A;  2ZJR A;  1NBW A;  3TIG A;  2BA1 A;  1Q46 A;  3JAM L;  2UUC Q;  4IUP A;  4QQB X;  4Q8E A;  4PDB A;  3NP8 A;  2VNU D;  3PUV A;  1NR4 A;  1SRU A;  1WCM A;  2F0G A;  4YB8 B;  3GII A;  4R1J A;  5E4X A;  2YW2 A;  2HVR A;  2W9B A;  2HJW A;  2GVB A;  1STA A;  2BQU A;  1GYF A;  1B3Q A;  4JI8 L;  4IFD I;  1DGS A;  2B3G A;  4R4O A;  1K9M C;  4A93 B;  2R8K A;  2FLN A;  1F2M A;  3EPG A;  2IBK A;  2OQ0 A;  2GPS A;  3KFU A;  4KY5 A;  5C4Z A;  1TY0 A;  4V0B A;  4C2M H;  1VQK A;  2J4X A;  4F8M A;  5KND A;  4A3K H;  2MUY A;  3S1R H;  3GTM H;  2WAQ A;  1LT6 D;  3LML A;  2Z6B A;  5DM6 3;  4FXD A;  3BG3 A;  3BA8 A;  4GC6 A;  3S17 H;  3K80 C;  4FP5 D;  2WKC A;  1I7N A;  3F8N A;  4X64 H;  5LL6 X;  4J0M A;  1PDQ A;  2K5Q A;  4L63 B;  1GM5 A;  1U5K A;  2C5C A;  4BY7 G;  2YRX A;  4RNN A;  3SK6 A;  1B2T A;  4IFD G;  4X6A H;  4BWG B;  1KC8 C;  4OO1 H;  2B2U A;  4QL5 A;  4X64 Q;  1VCI A;  5KFL A;  4DNR B;  1S40 A;  5KG1 A;  4K8J A;  1BBX C;  4EEY A;  2CWP A;  4WD3 A;  3GTJ H;  1LTT D;  1KC7 A;  4CJ2 C;  1AZP A;  4BA1 I;  4DA2 A;  2W9C A;  3K0X A;  2Y0S G;  1BKB A;  1SND A;  4DR2 L;  2CQO A;  3PO2 G;  5D1O B;  4U7C A;  1N32 H;  3FEW X;  2VZA A;  2FE3 A;  4A3F H;  5LMU H;  1UE1 A;  4CDF C;  3RUZ A;  4CC6 A;  4DKA C;  4HMJ A;  3BDC A;  1UWV A;  5CV7 A;  1PH4 A;  1N32 Q;  1LAB A;  3N40 P;  2AGO A;  4JI3 L;  1TR5 A;  5LMU Q;  1RK5 A;  2QDL A;  3KTM A;  2JA9 A;  2PQE A;  1GSA A;  3IG0 A;  2DY7 A;  2KQ3 A;  5KYI A;  3H09 A;  4DR5 L;  3M4Q A;  2F0P A;  4BBS B;  4LF6 L;  4IUV A;  3GTO H;  4GNX A;  1PH9 A;  1C48 A;  1S5C D;  1CTM A;  1EYC A;  5C8Y F;  1FYC A;  2EYO A;  2R93 A;  1HFN A;  4FF1 A;  1I3Q B;  1K3B C;  1ASY A;  1AN7 A;  1TS3 A;  2JJQ A;  5JH7 F;  3F1Z A;  3GTK H;  4V19 0;  5C1O A;  3NWT A;  1KNE A;  1CQI B;  5L9X A;  4XXE A;  2F0S A;  4TQR A;  4J9K A;  2FMA A;  5M3F B;  5J2T F;  1EU4 A;  4H13 C;  1CT1 D;  5C44 G;  1YNJ D;  2R85 A;  1E24 A;  4QW9 A;  4MIU A;  1BDO A;  1EUD B;  4DR1 H;  4DV6 H;  3HZX A;  4DL7 A;  2Y0S A;  1IBL H;  2VS1 A;  1TWH B;  4GOP A;  1K73 C;  1JOO A;  2VUM H;  3DF7 A;  1V1O A;  3PIP A;  4A3B B;  3NBI A;  4DR1 Q;  4DV6 Q;  1IBL Q;  3I4N H;  2B63 A;  1UUP A;  1S0N A;  1PZJ D;  4N8X 1;  1TWF H;  3K7A H;  1E22 A;  4H7B A;  4XX0 B;  3TQY A;  4LSX A;  4X64 L;  1ZQ7 A;  3CC4 A;  1L2F A;  5I6Y A;  3ULP A;  4E6I A;  3VYU A;  2WIN B;  2V4D A;  5FO8 B;  2MCT A;  2HIV A;  4C3J H;  1TAE A;  3S14 H;  4DL6 A;  1EWH A;  2I5M X;  2SNM A;  1Q7Y C;  4OWT B;  3HOU G;  1G2T A;  4RZQ A;  4TUY F;  5J39 A;  2PW7 A;  2EY5 A;  1EY6 A;  4RGO S;  1IYU A;  1S0M A;  1ZYR C;  3V6H A;  3NGD A;  5EJW A;  2LXJ A;  4DN4 M;  1U4P A;  2XVS A;  3BU2 A;  2F0K A;  1HFG A;  3MWM A;  4LF5 H;  4Z9C B;  5DQG A;  4BY1 G;  2BDN A;  2NVQ B;  1WCM H;  2X6L A;  1PHJ A;  5EPJ A;  4MV6 A;  2F4V H;  1X3F A;  2OT2 A;  2SCU B;  3GTG H;  2R84 A;  3DM3 A;  4LF5 Q;  2AQ3 B;  1ZHS A;  1HXY D;  4NMZ A;  1H9S B;  1TWA B;  3T51 B;  4A3E B;  2F4V Q;  3PR4 A;  2TSS A;  3G71 A;  1Y14 B;  3I56 A;  3BJY A;  1I3Q H;  3LX0 A;  4AQY L;  4PG3 A;  3PUW A;  3MTS A;  1WTV A;  2QGQ A;  3C2P A;  2ASD A;  1BNZ A;  3RB6 A;  5D3I B;  2PNR C;  5ELB A;  5IP9 H;  3D6C A;  4HJ5 A;  1QVC A;  1X3G A;  3PO2 B;  4J9R A;  1E1T A;  1QNK A;  3C46 A;  1S68 A;  5H1S E;  1CS0 A;  5M5W B;  3R93 A;  2PI2 E;  3J7Y W;  2GA4 B;  1QZG A;  2HHH H;  1SMX A;  1D1K A;  3LWB A;  3SEB A;  3NEN A;  1RF2 D;  4R9W A;  1HH2 P;  5C0X H;  4HIO A;  1Q86 C;  3OHB A;  3KF8 A;  5IT9 c;  3W1G A;  2F0E A;  3MJF A;  4EEQ A;  3FDT A;  3G8C A;  5HV6 A;  4X66 H;  2PMZ E;  2HHH Q;  4J9Q A;  5BN5 A;  2XCA A;  2JA6 G;  2JA5 H;  1K0R A;  4R4C A;  5LMN H;  1AZQ A;  3DM1 A;  5KFA A;  2I46 A;  5I47 A;  1CA6 A;  4BS9 A;  4X66 Q;  1PH8 A;  1IBM H;  2XGT A;  1BBU A;  3DWA A;  4DV4 L;  4LFA H;  2I8C A;  2QEJ C;  4U6P A;  4DV3 H;  3P75 A;  3T1Y H;  5LMN Q;  5IGF A;  4JV2 A;  1B70 B;  1MJC A;  3Q8R B;  2WFW A;  2W7P A;  1NTG A;  3A8I E;  4DV6 L;  1EQT A;  4IJL A;  1HQM C;  1IBM Q;  4LFA Q;  1VQI A;  4MV8 A;  4NXM L;  1ENC A;  2LMC B;  4DV3 Q;  2EJF C;  3T1Y Q;  4LF4 L;  1SE4 A;  3U9O A;  1J8I A;  1JJG A;  2W6P A;  2EY1 A;  4QIW B;  2E2H B;  1QE6 A;  2Z9H A;  2RHS B;  2RDJ A;  3BJU A;  4OWX B;  2LY7 A;  2WKD A;  4WJ4 A;  1K83 A;  3Q23 A;  5JJZ A;  3OSP A;  5JPN C;  5L1L A;  1LTB D;  4B9X A;  2DUD A;  2VW9 A;  2V1C C;  3J81 E;  2AU0 A;  1ONL A;  5C44 B;  3LGJ A;  4RG1 A;  1UEB A;  1XYI A;  5FO7 B;  1EYG A;  1Z6H A;  3H40 A;  3KF6 B;  4BY7 H;  1XTD A;  3RB3 A;  3GTL A;  4F50 A;  4IFD H;  4HCS A;  1E2W A;  1DIK A;  1Y1V A;  4C1N I;  3S16 H;  4O2A F;  4MTK A;  4C3H G;  2JEA I;  3RV3 A;  3CCS A;  5C0X J;  4IRK A;  2KCC A;  2ZTC A;  4U68 A;  1B50 A;  1IBK H;  3BQ2 A;  3JRW A;  1MGS A;  2KED A;  4NW2 A;  4K6L A;  4O4I F;  4DL3 A;  2BA0 A;  3TZD A;  1E7Z A;  1HTP A;  3HKZ B;  4R4Q A;  2F4V L;  4KHZ A;  1J5E H;  1RD9 D;  3KJP A;  3F2D A;  3C1F A;  3PQI A;  2QK4 A;  5JVG 3;  5FLX L;  5FD6 A;  1S5B D;  3ND9 A;  3P1H A;  5EKL A;  5M5W H;  3A5Z B;  1YNJ C;  1K1S A;  3UDF A;  5EWE A;  4HR7 A;  3MFI A;  1NSN S;  3AEV A;  2LS0 1;  1FL0 A;  1RTN A;  5M3M B;  1BXR A;  2JEJ A;  3ITP A;  1V43 A;  1QVF A;  2MQH A;  1TA8 A;  2ICE C;  4YY3 L;  3LP8 A;  4YQW A;  4B3M H;  4IRC A;  4JI0 H;  1BVS A;  4IAL A;  1ICW A;  3T5L A;  2HHH L;  2DGY A;  3FP9 A;  1J6Q A;  1HCZ A;  2I87 A;  5IWA Q;  1PXU A;  5EKI A;  1SAP A;  4AYB B;  4B3M Q;  4JI0 Q;  4ED7 A;  1LTI D;  4P2C B;  1QWY A;  3AQQ A;  4UY8 C;  3Q8P B;  2K04 A;  3JZI A;  4FBU A;  1WI5 A;  2K5N A;  1I6V C;  1VQD A;  3NTH A;  4LSA A;  2EJG C;  1MKH A;  4IFD J;  5EDW A;  1KAA A;  3UI2 A;  3H4D A;  4LFA L;  4IN3 A;  2ZTE A;  1PFN A;  5IYB G;  4DV3 L;  1DOK A;  1SYC A;  1HR0 H;  3OSO A;  1YJ9 A;  4Y7N H;  4AIM A;  1SNC A;  2P0A A;  1VQC A;  2I5H A;  2VB2 X;  3S9W A;  3M9M B;  2DZD A;  5ISR A;  2N3S A;  2WII B;  4CKE A;  2JEG A;  3GO5 A;  3S1Q H;  4C5A A;  1SNP A;  4Q0F A;  1Z2P X;  4FXG C;  1XPR A;  4Q44 A;  3D6W A;  5M5X B;  2YS7 A;  5CV9 A;  3NTI A;  5EGT A;  3VDY A;  3Q8Q B;  4DNI A;  2EE1 A;  4GZY C;  2PCF B;  2PYK A;  3QFF A;  2Z4H A;  1Y8N B;  1RYR A;  3H3V H;  1SBB B;  4OIJ A;  2UXC H;  2KCN A;  2BQR A;  2KJX A;  3RFC A;  2R8J A;  1E2Z A;  4RUC A;  2WE6 A;  4IZO A;  4M9U A;  1V4Y A;  1EFI D;  1LTR D;  4HAE A;  4YCW A;  3BVG A;  1M0W A;  3HOU H;  4O4L F;  2UXC Q;  1S97 A;  1IBK L;  2IHF A;  3QOJ A;  3U58 A;  1BCP D;  4J9S A;  1S72 A;  4JI1 H;  4JI4 H;  3MWY W;  1UE7 A;  1SFO B;  1J5E L;  2M05 A;  3O13 A;  4P72 A;  3PIO A;  1NUC A;  1CKN A;  1F9S A;  2F3I A;  3N6R A;  4M1U B;  4ME3 A;  4BY1 H;  2L55 A;  4O2D A;  1B7Y B;  4ZAI A;  1I6U A;  1WYD A;  1CE8 A;  4JI1 Q;  4JI4 Q;  4X65 L;  1E3P A;  2EOT A;  3HFZ B;  3A5U A;  2JXM B;  4JUZ A;  3BAB A;  3WO1 A;  3X3N A;  3C3L A;  4C3H B;  1S5E D;  4YWM A;  3IN5 A;  2CVR A;  4ME6 A;  4DV7 H;  4IPH A;  4KN4 C;  3WWV A;  3SVM A;  1B3A A;  4B3M L;  2E2J B;  3U4V A;  3FPU B;  2DNE A;  4JI7 H;  1H9M A;  3MEH A;  3HOZ H;  3OHX C;  4DV7 Q;  4L1K A;  2KEN A;  3V4S A;  2L4N A;  1UC8 A;  2F0O A;  4HIM A;  4O2B F;  4K8I A;  5DLG A;  3DMU A;  4OX9 H;  4DAY A;  3DEO A;  4JI7 Q;  5FPO A;  1T5X D;  2XCP A;  1S3O A;  2MO1 A;  5DAU A;  2FFK B;  1RJP A;  1JX4 A;  1E4E B;  5EOY A;  4A3M B;  5KFE A;  2ASB A;  4OX9 Q;  1SN8 A;  1QG7 A;  2J0T D;  1P16 A;  4ALP A;  1JMC A;  1JIH A;  1CFM A;  1CK1 A;  5KFD A;  3PUZ A;  3OIQ A;  2JA6 H;  4L8J A;  3A0J A;  2EYL A;  4JVZ A;  4XDX A;  4PZ8 A;  1O7I A;  2R8H A;  4HJ8 A;  2HCI A;  1HR0 L;  2D9U A;  3AMU A;  4GS3 A;  2A6E D;  3MAQ A;  4HCE A;  1PYW D;  3DUZ A;  1OXX K;  3S2H B;  5DQI A;  1C4Q A;  1R9T B;  2NU9 B;  4MA5 A;  3K5L A;  3IAY A;  2XC9 A;  2FXQ A;  4MTE A;  4CHT B;  4ZRZ A;  1SE8 A;  1G2S A;  1CA5 A;  1LTL A;  2N78 A;  1YHA A;  5FKA C;  5D1P A;  1EZ8 A;  4DUZ H;  3CPW A;  1EIG A;  4RNM A;  3TDQ A;  4C56 C;  1XNR H;  5CMD A;  3D3R A;  5M5Y B;  3TRE A;  1YVC A;  2FPP B;  2ZDQ A;  4DUZ Q;  4J9P A;  2EPB A;  1L1O C;  4LF9 H;  1GUT A;  2XWJ B;  2WB1 E;  3J81 W;  2NVY B;  1XNR Q;  2UXC L;  3E0J A;  3GTQ A;  4FS2 A;  2JA7 B;  1BO0 A;  4UP7 A;  5AFW A;  1VF7 A;  5JVD F;  3RBE A;  4JOI C;  1H9R A;  2K5V A;  2R7Z G;  1SYB A;  4LF9 Q;  4YIJ A;  1TT2 A;  5KGU A;  1HTL D;  2M2L A;  4DK3 C;  2Q2U A;  4G7O C;  2IJ0 A;  1C30 A;  2CKZ B;  1VF5 C;  2YYZ A;  3R5F A;  1KQS A;  1ENF A;  4RB1 A;  5CA0 F;  3JSL A;  2N55 A;  1X54 A;  4JI1 L;  3TP7 A;  4HIK A;  2IA6 A;  4LUO A;  1EWI A;  3H0G G;  5KEE A;  2F1M A;  2R92 A;  2C35 B;  3PZP A;  1G8Z D;  2KBN A;  1DYQ A;  4ZQ3 A;  1Q82 C;  5KFJ A;  3NQT A;  3GQC A;  3CCQ A;  3EBE A;  2L12 A;  1IKM A;  3JRX A;  1I50 B;  2CH4 W;  4MV1 A;  4XQJ A;  4ECY A;  3G6X A;  4KHP L;  4DR6 L;  1Q90 A;  1RHP A;  3VA5 A;  2E2I A;  4DV7 L;  4BXX G;  1WTW A;  4NDX A;  1IOV A;  3A56 A;  4FBT A;  4DUY L;  2F0D A;  1TS5 A;  4X3U A;  1HRJ A;  2XN9 C;  2Z4I A;  3CAM A;  4JBK A;  3J7A 5;  2KOL A;  1EIF A;  2K28 A;  1ZKO A;  4IPG A;  1VQH A;  3MFY A;  2A8V A;  1PFB A;  1PH6 A;  2PI2 A;  3GIK A;  2ICI A;  3RB4 A;  3SR1 A;  5FK9 C;  5EAY A;  2C2R A;  5KFV A;  4X62 H;  2K33 A;  3W3A A;  5KG2 A;  1O75 A;  4C2M B;  2CW7 A;  4K5W A;  4A3K B;  4CBV A;  1SNQ A;  2A5H A;  3S1R B;  4CJ1 B;  4ZOL F;  2PMZ A;  4AYB E;  4DAV A;  1GUW A;  3K3P A;  3S17 B;  2IMW P;  2K6A A;  4FM9 A;  1DON A;  4X62 Q;  2VUG A;  1CQF A;  4RWS C;  1GSH A;  1WCM G;  4HJA A;  2EVB A;  4ZKB B;  4YR3 A;  1GXD C;  2MHV A;  4JV5 L;  2R7N A;  1TWC H;  3RNU A;  1BCP C;  1XTC D;  3C1E A;  2F0U A;  5IYB H;  1BXT A;  2YTV A;  1XXG A;  5E7N A;  5I6W A;  3T5K A;  2WAQ G;  2B2T C;  4GKK H;  4ECV A;  2W71 A;  1B9N A;  1ET9 A;  3G48 A;  3GTJ B;  3A54 A;  4OEM B;  2UXB H;  5IGG A;  2NN6 H;  2GLT A;  5IP9 G;  4GKK Q;  1JJC B;  1PTO D;  2VPQ A;  2B8F A;  5ELE A;  1LT5 D;  1LTA D;  3M9O B;  1NJI C;  2EYF A;  3DWP A;  3GQB A;  2NVX H;  3OW2 A;  4LFC L;  5L1K A;  1FKA H;  2UXB Q;  2D0O A;  1VQE A;  4A3F B;  4LF9 L;  5IGB A;  4LFB L;  2FPG B;  1STN A;  2BH2 A;  1SEB D;  2PO4 A;  5KFO A;  3T56 B;  2NU6 B;  4KN7 C;  2A73 B;  1PFS A;  1EY7 A;  1BBW A;  4ABN A;  4EX5 A;  1OO9 B;  2K4K A;  4QB4 A;  1BUV T;  1QVG A;  2BE5 D;  1SYX B;  1L0X B;  4RMF A;  1N33 H;  3QB3 A;  2UUC H;  2K50 A;  3W5O A;  2ALZ A;  1ZET A;  4APV A;  1VQM A;  5A2Q L;  1C9O A;  3RV4 A;  3H4B A;  2FP4 B;  5F9N A;  4LF7 L;  3HOV G;  3GTO B;  4A2A A;  1EUJ A;  1N33 Q;  3NEL A;  2F0N A;  4YWL A;  2YZM A;  3J80 E;  3PW7 A;  2UVR A;  2KEC A;  1CSQ A;  1E0B A;  4PV1 C;  2KCT A;  5J22 A;  5KFP A;  4CC5 A;  1F77 A;  3IRB A;  4GLV B;  2FK1 A;  1W93 A;  4MV3 A;  2A6E C;  2MGS A;  2CH4 A;  4KLK A;  4HJ9 A;  4ECZ A;  3GTK B;  3GTP A;  1EU3 A;  2X69 A;  2NYZ D;  1B04 A;  4L5S A;  1HUM A;  2QEX A;  3I12 A;  1KDA A;  1U4R A;  1Y8O B;  4RAZ A;  4QUF A;  1SYG A;  3KAL A;  2UXD L;  2I07 B;  2F0W A;  4QJF A;  4EQO A;  4DV5 L;  1KDB A;  2JE6 I;  3T1H L;  2R93 G;  3PW5 A;  3JAM E;  3F8T A;  1X9N A;  1CKM A;  3RN2 A;  1VDZ A;  1YBY A;  5BPH A;  4G3I A;  1NR2 A;  3KHG A;  2YRW A;  4Q43 A;  5EPL A;  2F0I A;  3H20 A;  3L4J A;  4X62 L;  1VQ5 A;  2VUM B;  3HOW G;  2VQF L;  2UUA H;  4FDB A;  3I91 A;  4G4K A;  1D7Q A;  3I4N B;  1TXY A;  1VQP A;  1PH1 A;  5D14 A;  1TWF B;  3K7A B;  2PN1 A;  5JEA G;  3EIV A;  4L6T B;  1K8G A;  5COY A;  4MV7 A;  5J1Z A;  4PZ6 A;  1GOZ A;  2UUA Q;  1KL9 A;  4K6D A;  3J7A F;  4B08 A;  3GLK A;  3K5I A;  4Y8V B;  4C3J B;  4HMI A;  3S14 B;  2F0H A;  3E9H A;  3G6E A;  4PZ7 A;  3F2C A;  2R7F A;  3UE1 A;  2QF7 A;  1D5Z C;  4RZR A;  1SJH D;  3I4M G;  4GKK L;  4XIG S;  2V59 A;  2AHO B;  2RA4 A;  2B63 G;  3QJY A;  2E2I H;  4IUT A;  2HDL A;  4UCU A;  1F2L A;  2ZJT A;  3NK9 A;  1A15 A;  1VAJ A;  4K0K L;  2RDH A;  3MXP A;  2NVT H;  5KT4 A;  1WTX A;  2PZW A;  4UCR A;  1WCM B;  5C6A A;  4R8U A;  2XGQ A;  3I73 A;  1FR3 A;  4J15 A;  1HA6 A;  3GTG B;  4EYI B;  4ED3 A;  3V2T A;  2HCC A;  1HNW L;  2PNH A;  2YU9 H;  4FF3 A;  4DR3 L;  1JT8 A;  3MR3 A;  2F0L A;  1TVX A;  2CFM A;  3GIL A;  5DEH A;  4QWB A;  1ZEQ X;  5KFN A;  2UUC L;  4L5Q A;  3V4Z A;  2ZXR A;  3FHW A;  2R7Z H;  1RYS A;  1T9H A;  3CKI B;  5IOD A;  2BDO A;  2BOS A;  4CGY B;  2K14 A;  2CCZ A;  1TWG A;  2HQL A;  3OYY A;  4FNF A;  2V58 A;  2XRQ D;  5COR A;  3L7Z C;  4RB3 C;  2AGP A;  4DL4 A;  2NUC A;  4FF4 A;  5LOV F;  5AJ3 Q;  3H3V I;  2TMP A;  4RHS A;  2AMC B;  4A3J G;  4E4T A;  4MHE A;  3H0G H;  3UFX B;  1I4Q A;  1SEI A;  3EJI A;  3K5M A;  1STG A;  1WTR A;  2JA5 B;  2SOB A;  4QUC A;  2W9C B;  1UE6 A;  3AU7 A;  1AH9 A;  2CHB D;  1DJR D;  1Q8I A;  2RGV A;  3KXY T;  1GGO A;  2A74 C;  3VPD A;  4DLK A;  5D3D A;  1D6E C;  1BGW A;  2R7M A;  4BXX H;  4ZUJ A;  1MD2 D;  1U4L A;  2L5T A;  1QUQ A;  1M8A A;  1L1O A;  4JV0 A;  1PTO C;  3KK7 A;  5LYJ F;  3BA9 A;  2UUB H;  4A75 A;  4EFE A;  3RB0 A;  4JOI A;  4J9M A;  1AUX A;  1EOV A;  4DV0 Q;  5DGB A;  3N43 B;  5D8D A;  3NTK A;  1JJ2 A;  2DIK A;  4NXN H;  2UUB Q;  4X3T A;  3AFP A;  2KSW A;  4XYM B;  2BE5 C;  4GNX B;  4KTA A;  1CSP A;  2ZM6 H;  1WTP A;  4NXN Q;  1N36 H;  3I90 A;  3GIP A;  3PW4 A;  1LLR D;  1X32 A;  1N32 L;  4BY7 B;  3DLL A;  1G51 A;  3NWS A;  3D31 A;  2ZM6 Q;  4HN7 A;  5LMU L;  3GTP H;  1OXT A;  4OEL B;  2V4R A;  3BYY B;  4TQS A;  3S16 B;  1N36 Q;  4XZ3 B;  3ULL A;  3OUZ A;  3J81 c;  1NMF A;  1EYD A;  3E9I A;  2NTS A;  3RF2 A;  3ERQ A;  4XTC S;  4QWD A;  4LF8 Q;  4ECT A;  1XWE A;  4R4T A;  1AP0 A;  1EOT A;  3M4O H;  3HOZ G;  4IJH A;  5KFC A;  3HOY H;  1VQ8 A;  3M3Y H;  2C22 A;  2Y0S B;  2OCE A;  1I4R A;  3L4K A;  4JBW A;  5JOB A;  3R2I A;  3PW2 A;  5IYZ F;  3Q8S B;  2DWC A;  1Y1V G;  2WB1 A;  3CQZ A;  4RAU C;  4DXG A;  2HQE A;  5EBC A;  2IW3 A;  4CJ0 B;  4QWA A;  2MFI A;  2DPI A;  4KJO A;  4HQ6 A;  4ED0 A;  1M7J A;  3PO3 G;  5BPF A;  1V1P A;  4ULL A;  1ZHQ A;  1SCU B;  2UVV A;  4GN3 B;  3I2Z A;  3KF6 A;  4YWK A;  2JSO A;  4XT1 B;  2I0Q A;  1IL2 A;  5KFU A;  1MSG A;  1SLJ A;  4L5T A;  4GKJ Q;  4WJW A;  3GV8 B;  2BQ3 A;  3X3M A;  2F52 A;  5KIX A;  2W6Q A;  3PF4 A;  2OWO A;  1C8C A;  5KG7 A;  3J80 W;  1NMG A;  3HOV H;  4RCO A;  1HNZ H;  5F2D A;  1IXR A;  2B2T A;  4ID6 A;  4DR1 L;  1IBL L;  1VBG A;  2YZG A;  3TQT A;  4MZ9 A;  2UU9 H;  4JI5 Q;  3EPI A;  1JIC A;  3N52 A;  5C5M A;  1UNN C;  2IP4 A;  5J3B A;  1O80 A;  1HNZ Q;  1CQJ B;  4P74 A;  2XNA C;  4P75 A;  1XMO H;  4JI6 H;  4KKS A;  4UP8 A;  1WTO A;  4I7H A;  2UVU A;  4ZUI A;  2Z1C A;  1ESF A;  1ROD A;  2UU9 Q;  4NKL A;  1KNA A;  1CHQ D;  3F2U A;  4POG A;  4X3S A;  3E5N A;  2K32 A;  2JYO A;  3S2D H;  2JEB I;  4Y7N B;  4JI6 Q;  1XMO Q;  2Q2T A;  1UC9 A;  1DXM A;  2W57 A;  4UPA A;  2W7O A;  3BVZ A;  5KT7 A;  4M8A A;  3PUY A;  2G9H D;  3PMF A;  3JAM W;  1D2B A;  5K2M A;  1JCK B;  3R5H A;  3VPC A;  2R93 H;  2YTY A;  3S1Q B;  1JB3 A;  2L1B A;  3ZYY X;  1SYD A;  3K5N A;  2O4X A;  5KFR A;  2VQE H;  3RBD A;  5K36 H;  4WBN F;  4NXN L;  2QKI C;  3Q2O A;  3HOW H;  1YJN A;  2ZDH A;  4O42 A;  4C5B A;  3QZ8 A;  1TWG H;  2F0M A;  2K03 A;  4GLA C;  4AYB A;  2K75 A;  4KKU A;  4A3C G;  3CCU A;  4NLG A;  4FU0 A;  4PQX A;  2VQE Q;  4I50 F;  5JEA H;  3KLW A;  3I4L A;  5IT9 L;  4LF5 L;  1N36 L;  1DOL A;  3I72 A;  3Q6S A;  1GHK A;  3KF8 B;  4PNY A;  4EG0 A;  1WSC A;  4O3O A;  3T16 A;  3Q24 A;  1NE3 A;  1QJO A;  1MZB A;  4QGU A;  4FYD A;  1T3N A;  1Y1W G;  4EVO A;  2R8G A;  4C3I G;  3HOU B;  2F3W A;  4ED2 A;  1I6H H;  4DL5 A;  1MSH A;  1T36 A;  1FJG H;  3SHL A;  3I4M H;  1V1Q A;  3MXU A;  3EVQ A;  4IO9 A;  3M4I A;  4MA0 A;  1D1I A;  4IOC A;  1HZA A;  2RDF A;  2B63 H;  4EBE A;  2D0P A;  1X6O A;  3G7L A;  4A3I G;  5DGA A;  1FJG Q;  1FGB D;  5IWA H;  4BY1 B;  1WR2 A;  5NUC A;  4ETS A;  1Z47 A;  4G57 A;  5ELO A;  1G29 1;  1V51 A;  2FHT A;  1S5F D;  4RB2 C;  4TRD A;  5FLX E;  3GIJ A;  3CRK C;  1EEI D;  3UDI A;  4IHJ F;  2J6T A;  3KHR A;  1X55 A;  4X66 L;  4KK7 A;  2NN6 I;  5BN3 A;  5LMN L;  2C28 A;  3HOZ B;  1MHW C;  1MBY A;  1AN8 A;  1LV9 A;  1SYF A;  1IBM L;  2FLP A;  2G5D A;  3GTL B;  1AEX A;  1KTK A;  5GAH C;  2OF1 A;  3T1Y L;  1BCP F;  4JW0 A;  2CW0 D;  3FMA A;  4ILW A;  5JEA J;  5HGT A;  3CP0 A;  1GVP A;  4J8Q A;  4A3G G;  3L9A X;  1OWT A;  1V9P A;  2UU9 L;  3K5H A;  2NN6 G;  5TSS A;  4A3J H;  4MAM A;  3FKI G;  1TS2 A;  1B53 A;  4JI6 L;  4FS1 A;  4J9L A;  4DR7 H;  4UCS A;  2XRS D;  4JG2 A;  4CKB A;  1RJQ A;  3H94 A;  3PIP 3;  3BVM A;  2JA6 B;  2ZTD A;  4P73 A;  4F88 A;  4XQN A;  1K8O A;  5LL6 b;  4DFA A;  1Y1W A;  1N34 H;  3TIN A;  3NHH A;  2ZXO A;  5ELC A;  3TN2 A;  3K59 A;  1HPC A;  4DR7 Q;  5DQH A;  3CQZ H;  5KFQ A;  5CYU A;  4B3T H;  1VQF A;  4RH6 A;  1N34 Q;  3A74 A;  4HR7 B;  4F4W A;  2BCO A;  5CV4 A;  3K3V A;  4OL7 A;  4UHV A;  3N42 B;  3U9T A;  1JR0 D;  1Z2O X;  4WFN 3;  3RZO H;  4ME5 A;  4O0A A;  1LM0 A;  3GIM A;  2PZT A;  4B3T Q;  2F0T A;  2SNS A;  3E5S A;  2R61 A;  4IQZ A;  2ZJP A;  1XJV A;  2E5L Q;  2G9D A;  3N41 B;  1M1K C;  1UAP A;  3GIQ A;  1AE2 A;  5KFF A;  1O7L A;  1KAW A;  4HSV A;  5KKN B;  1E4E A;  1A3U A;  4NPS A;  4JC0 A;  1E1O A;  1BR9 A;  5JJL A;  2W6M A;  1X56 A;  3KDF B;  1VQN A;  1DV2 A;  4TQU S;  3A55 A;  2ID0 A;  4PMB A;  1GSO A;  1ML0 D;  2R86 A;  1SR3 A;  4C1N K;  4JYA H;  5KRU A;  4N9P A;  2JN4 A;  4DNT B;  3S1N H;  3NQI A;  4ECX A;  1AUV A;  1Q1B A;  1R9T A;  1IKL A;  4RGT A;  4JYA Q;  5C1P A;  1STB A;  1K83 H;  2B2W C;  2F0V A;  4QWE A;  4J9O A;  5IYD G;  3FKI A;  1BNC A;  5IWA L;  3ICE A;  1SE3 A;  4JI0 L;  1B33 N;  4KV6 A;  3C0F B;  2QW7 A;  4DV2 Q;  2QCP X;  3PW0 A;  2D2C C;  2ATL A;  3ORQ A;  3MR6 A;  3ONA B;  3QG1 A;  4HNU A;  3ERS X;  5J2U F;  1M4V A;  3KHH A;  3GTL H;  1Z9F A;  4DV1 H;  1UNS A;  3OHA A;  1Y1V H;  5LXT F;  1LT4 D;  3MC0 B;  3A7L A;  2SDF A;  5C5L A;  2NVY A;  2RCN A;  3M9N B;  3PO3 H;  1E4F T;  1JE4 A;  3LNN A;  2MNA A;  3Q8D A;  2NU7 B;  3TII A;  4DV1 Q;  2ENB A;  2R92 G;  1M0T A;  5CBA E;  3PF5 A;  4N8F A;  4I7Z C;  5FD5 A;  4XYQ A;  3TP5 A;  2F0Q A;  1I94 H;  3MXN A;  1W6J A;  2EYM A;  5I9O A;  3MVV A;  2CQA A;  4HNT A;  3EA6 A;  3OOC A;  4RGM A;  1SMY D;  2QYZ A;  4LMY A;  4DR7 L;  1MI2 A;  1I94 Q;  4EFB A;  2FLL A;  2EYH A;  1V8Q A;  3G6J B;  2AWN A;  2JQO A;  2E75 C;  2Z8L A;  2K1B A;  1N34 L;  1B8A A;  1CKN B;  1JWU D;  2JP1 A;  1PYS B;  1TWC B;  5IY0 A;  3FVQ A;  3K5O A;  3MWE A;  1I4P A;  2DJF C;  4QIW E;  4BBR G;  5C4J H;  3HB9 A;  1G91 A;  4B3S H;  5G3L D;  1WJJ A;  4B3T L;  1EY9 A;  2MP1 A;  2V9W A;  1SE2 A;  5IOC A;  1Q3L A;  1TU2 B;  4A3G B;  4B3S Q;  1GUS A;  3J81 j;  3M7N A;  5JPM C;  3HS0 C;  4LJZ C;  1A63 A;  4YJ3 F;  3PGZ A;  5GAG C;  3E3X A;  1GUO A;  5FJ8 G;  2R7Z A;  5DLQ E;  1EWC A;  3H15 A;  4N9T A;  2NVX B;  4O4H F;  4A3D G;  4C2M A;  1HHV A;  3W1B A;  3GTM A;  4QMG A;  4A3C H;  2LSS A;  3K0Y A;  3P20 A;  4JI4 L;  1S9F A;  3OW7 A;  1C3O A;  1B9M A;  1SRO A;  1XNQ H;  2B2Y C;  3ERO A;  1G6Z A;  2HVS A;  4L5R C;  2XGP A;  4UDU C;  4A4I A;  5C5J A;  5BR8 H;  3CMA A;  2R7K A;  1PRT B;  3HKZ E;  3TP6 A;  1XNQ Q;  3CCV A;  2CW0 C;  3PV0 A;  3N6X A;  5KFG A;  4A93 G;  3HEJ A;  4PMC A;  4CDD C;  2FIN B;  3K58 A;  1R4Q B;  5I2X A;  1ASZ A;  1Y1W H;  1KJI A;  4C3I H;  5BR8 Q;  1A9X A;  1X65 A;  4IZ8 A;  5A35 A;  3GTJ A;  1K3R A;  4UCO A;  1A8V A;  3SK4 A;  4DR3 H;  2B29 A;  2ES2 A;  1FVI A;  1PX2 A;  4EGJ A;  1DZ1 A;  1Z2N X;  2RCF A;  4P71 A;  4A3I H;  1AW7 A;  4O3R A;  3NPP A;  4JI7 L;  1PTO F;  5FOB B;  2HUG A;  1VQB A;  3VR2 A;  2C2E A;  1GUN A;  3QWN A;  4OX9 L;  3BDL A;  2YZN A;  3J80 c;  2N88 A;  2N49 A;  5FLX W;  2QA4 A;  1CHP D;  5KG4 A;  2WV6 D;  4RCN A;  3KJO A;  3HXL A;  2FMM A;  2OH2 A;  2PQA A;  1VQA A;  3UE0 A;  1LYL A;  4ED6 A;  4JI8 Q;  3RUP A;  1XMQ H;  5HUR A;  3RZD B;  2IT1 A;  1SNO A;  2BH8 A;  5CV6 A;  1JDE A;  3VR5 A;  1RL2 A;  4U67 3;  3DXJ C;  1VBH A;  3DWQ A;  1PH3 A;  1PZK D;  2IHE A;  4IWY A;  2XTI A;  5EWG A;  1I94 L;  1K28 A;  5LP6 F;  1EY5 A;  3KYH C;  1XMQ Q;  3J80 i;  3GTO A;  5FLM G;  3L3O C;  2KVM A;  5KYL A;  3RAQ A;  3D4R A;  2EY6 A;  4GC7 A;  4KY7 A;  4O3S A;  4PWQ A;  2MJ8 A;  4MN3 A;  4F7X A;  3JAM c;  1IL8 A;  3PN1 A;  1EZ1 A;  4A3G H;  4I7A A;  3OWE B;  3ZJY C;  4MTD A;  1BJT A;  3RR5 A;  5GON F;  4DUZ L;  3FKI H;  1MIU A;  4ZYS A;  3PSI A;  3HOY G;  2MPM A;  1XNR L;  1PTO H;  2FKL A;  3TBI B;  5HGQ A;  5IGD A;  3MFH A;  2FMC A;  3A8J E;  4BBS G;  2GVA A;  1SSO A;  2V5A A;  1TQO A;  1GLV A;  2C00 A;  4UCT A;  3OTO H;  3H91 A;  2OQK A;  3SK8 A;  2J6U A;  4K2K A;  2E2I B;  3JAM i;  3I55 A;  3E0E A;  4OIK A;  5CV8 A;  2RHQ B;  1Q8K A;  4DR2 Q;  3J7A K;  2NVT B;  2A19 A;  2K01 A;  4LW1 A;  1A62 A;  1WFQ A;  2H4O A;  3SE0 A;  3M85 A;  4FF2 A;  3OTO Q;  3GID A;  5E3F A;  4JI3 H;  2L9H A;  2VUM A;  3KHL A;  2VY3 A;  4ZQI A;  2AQ4 A;  4A76 A;  4ECW A;  1FNU A;  4DR5 H;  1X3Q A;  4KJN A;  1QB5 D;  2J7Z A;  3S15 H;  5FPR A;  4BBR B;  1IHZ A;  1KJJ A;  1TWF A;  2YU9 B;  1KHI A;  4JI3 Q;  4LF6 H;  4LNQ A;  2IL8 A;  3PCO B;  5DG7 A;  5EPK A;  5IE8 A;  1B4O A;  3PIO 3;  2YL2 A;  5LHY 1;  4DR5 Q;  5BR8 L;  2PMZ B;  1JKJ B;  4J9N A;  3T53 B;  1L0Y B;  2PZU A;  3CW2 C;  3HRZ C;  4LF6 Q;  3NBH B;  1W6K A;  2R7Z B;  5D1O A;  1EUC B;  5LA6 F;  3TS0 A;  1PRT D;  5JVH 3;  1PH5 A;  4I4T F;  3NSW A;  5T14 A;  2W6Z A;  2O2L D;  4A3B G;  1SMY C;  4C5C A;  3FMC A;  5KT3 A;  5FO9 B;  4ECS A;  5A2Q E;  3Q22 A;  4WJ3 M;  4K2L A;  3IFT A;  1PK8 A;  5IYD H;  1U4M A;  3H0G B;  3RZD H;  3GTQ H;  1H95 A;  4KD4 A;  1STH A;  1YHQ A;  1CUK A;  3HOX G;  1KAB A;  5K36 G;  5EQ0 A;  1TII D;  3M4P A;  3R2T A;  3BZK A;  2VB3 X;  3GTG A;  4ECR A;  5KT2 A;  1O7Y A;  2B2V C;  2N8N A;  5L1J A;  2RGR A;  1N9W A;  1EY4 A;  4XQQ A;  1EYZ A;  1I4X A;  4DU9 A;  4KD3 A;  3RTX A;  3I4O A;  4DXF A;  2E76 C;  1XMQ L;  5CR3 A;  1XPO A;  1I3Q A;  4AH6 A;  1S4Z A;  3WOF A;  1EQQ A;  5KFZ A;  3G6V A;  1RKN A;  4F4Y A;  4OXP A;  1WTQ A;  2R92 H;  4F4X A;  1HNX H;  1ET6 A;  5IP7 G;  3MA2 B;  3VYS A;  3KAK A;  4ZCK A;  2K05 A;  1LTG D;  4H0L C;  2DY8 A;  4A3E G;  1L0W A;  1HNX Q;  3FPP A;  2JK8 A;  4HID A;  3DEP A;  2UXB L;  2OEO A;  5JVL A;  3RLN A;  2B2W A;  4XYO A;  3BQ1 A;  3L0O A;  1VQO A;  1TWH A;  2JA5 A;  2VPS A;  5CV5 A;  2W9B B;  3RMH A;  3KUP A;  3A7A B;  3WDN A;  3GTP B;  2ZXP A;  1HZB A;  3T13 A;  4BBR H;  5IYC H;  3K81 C;  3OTO L;  3G6Y A;  3IKJ A;  2KUM A;  2A6H D;  1HR0 W;  3TS2 A;  3S24 A;  1D5X C;  2Z6K C;  2A1A A;  2WAQ B;  3TZU A;  4LWC A;  2ASL A;  2I80 A;  3V6K A;  4G7Z C;  3N44 B;  2NWG A;  3VR3 A;  1YEZ A;  1N33 L;  3CCL A;  5HY6 A;  4FXK C;  1A3T A;  3Q0A A;  4EYH B;  1QCB D;  1NNX A;  3M4O B;  4TKO B;  3HOY B;  4AQY H;  3KLR A;  3M3Y B;  2FPI B;  4ED1 A;  5FJ8 H;  3TRZ A;  3V05 A;  1JB7 A;  2NBF A;  1IW7 D;  1ILQ A;  5JJK A;  4A3D H;  1EIH A;  2B8G A;  4AQY Q;  3GV5 B;  4EBD A;  3KOJ A;  4IUU A;  5IGC A;  1TKW B;  4LUV A;  1JDB B;  2R82 A;  3OPO A;  1PFM A;  1HZC A;  3GV3 A;  1PZI D;  1I4H A;  1Z7T A;  3CD6 A;  4RKB A;  3BAA A;  3VA7 A;  4A93 H;  2UVW A;  3KBG A;  2RBM A;  1VQ4 A;  1RK6 A;  1GUG A;  4IAJ A;  1VQG A;  2VQD A;  2ZDG A;  1H9S A;  1OXV A;  2WB1 G;  1DV1 A;  1TWA A;  3BG5 A;  3HOV B;  3MXG A;  5CGK A;  3A8K E;  4F87 A;  5LL6 S;  1A0I A;  1OTC A;  3R5X A;  3ND8 A;  4JBJ A;  1KJ9 A;  4DV4 H;  1PYB A;  4K5X A;  1E2V A;  5KFS A;  2K7V A;  5ELN A;  4DV0 H;  1FNW A;  1N8R C;  3JC6 6;  2EIF A;  2K52 A;  3TP8 A;  2O5I C;  3I3C A;  2NU8 B;  4DV4 Q;  4NXM H;  2UUA L;  1RJT A;  4R8U B;  1NY4 A;  4LF4 H;  4YAJ B;  4RKL A;  5KFT A;  2HDM A;  1K8M A;  4BWS C;  3S2D B;  1WOC A;  2KCM A;  4RHR A;  1K8A C;  3VMM A;  4NXM Q;  1B6S A;  2L0C A;  2F4I A;  2YTX A;  2V4Q A;  4EQ5 A;  4LF4 Q;  5L1I A;  4DPG A;  4YP3 A;  2B2Y A;  3CCE A;  2P5Z X;  3HKZ G;  2OXP A;  1OXS C;  3I8Z A;  4KKT A;  3PUX A;  1HNX L;  2R93 B;  2WTF A;  4R8N A;  1RTO A;  1GHJ A;  3HOX B;  3NEM A;  4Q45 A;  3HBL A;  5DM7 3;  3JSN A;  2RDG A;  3D0F A;  3NXW A;  3E6Z X;  5IGE A;  3HOW B;  4QCL A;  3EYY A;  4LF8 H;  1TWG B;  1YZ6 A;  5FLM H;  5EZY F;  1NCV A;  2XIW A;  1TY2 A;  1YIT A;  2LKV A;  5CA1 F;  1T5E A;  2NZO A;  1PH7 A;  5H80 A;  2JEI A;  2WP8 J;  1R4P B;  5M3M G;  5EKK A;  2R3Z A;  1PRT C;  3ETJ A;  2JA8 G;  2K5D A;  4UAI A;  1VQ7 A;  2EQS A;  3KLS A;  1S5D D;  4QIW A;  2ATW A;  2E2H A;  1KLG D;  4ECU A;  2EXZ A;  5GAE C;  1TS4 A;  5L37 A;  4GOP B;  4OHJ A;  1GO3 E;  4BBS H;  2DLN A;  1I6H B;  4J1M A;  2VL6 A;  1U9R A;  5KG6 A;  4ECQ A;  3VPB A;  3J81 i;  4AYB G;  3I4M B;  3G4S A;  1EZ6 A;  4DK1 A;  5KFB A;  2B63 B;  4GKJ H;  4WRD A;  2IX1 A;  4DGZ A;  4QF4 A;  2HIX A;  2L15 A;  1GD7 A;  1QUQ B;  3CXC A;  3OMG A;  1F9P A;  3BYT B;  2VR1 A;  3Q1K A;  4DF7 A;  1L1O B;  1D8L A;  3OSN A;  5AJ3 L;  3UDG A;  3FRP B;  1LTS D;  1Y69 U;  4IPD A;  5K5P A;  1ENA A;  1ILP A;  4NP5 A;  4YY3 H;  3SK5 A;  2O03 A;  2KHI A;  5BN4 A;  4JI5 H;  1UE5 A;  1WTH A;  3LWE A;  4M7E A;  2H1E A;  3BS1 A;  4O3P A;  4J6H A;  3MR5 A;  4RAY A;  2H5X A;  5M3F H;  1SXT A;  2M9V A;  5KFI A;  3P7J A;  1O78 A;  5CBE E;  1VS0 A;  5I2Y A;  2W6N A;  4YY3 Q;  4HJ7 A;  2DPJ A;  3HKZ A;  2J6S A;  4B3R H;  2C9O A;  5C3E G;  2F0F A;  5C4X G;  3F2B A;  3CC7 A;  1TWH H;  1PV4 A;  3T5H A;  3QIA A;  3WOE A;  5FLX c;  1IYV A;  3D4W A;  1LT3 D;  1KJ8 A;  4DK0 A;  1KRS A;  3B6Y A;  3CHB D;  4A3B H;  4B3R Q;  1KBL A;  3BQ0 A;  5A2Q W;  3J81 L;  4A3L G;  1PVO A;  4LK1 C;  2EJM A;  3PVX A;  4DV0 L;  5GQO A;  5BMV F;  3RJ0 A;  2GN5 A;  4KHV A;  3TEH B;  5DG9 A;  2W8L A;  4TVA B;  1AE3 A;  3KBX A;  4KY6 A;  3RN5 A;  2UUB L;  4A3J B;  5D65 A;  5JQW A;  3RAX A;  5CC4 A;  3SXH A;  3BZC A;  3HOX H;  1ESR A;  5I9P A;  2A6H C;  1JOR A;  3PR5 B;  4CKC A;  1YIJ A;  4HNV A;  5CAE B;  1PMR A;  2E74 C;  4HSP A;  2NB0 A;  2WB1 B;  3CQZ B;  3U4Z A;  5KNB A;  4OON A;  2ZM6 L;  5EWF A;  1HJP A;  3N8D A;  4NB3 A;  3J7Z C;  1V1P B;  4IUN A;  4DL2 A;  1IW7 C;  1OXU A;  2NVQ H;  2R6F A;  1X3E A;  3RZO B;  4R7R A;  2M00 A;  4LF8 L;  4QY7 A;  5IP7 H;  1S03 G;  1CZG A;  3MWD A;  1RDP D;  2KHS A;  2ZT9 C;  1BCP B;  4CDE C;  3FDS A;  2RDI A;  1TWA H;  1A3V A;  4A3E H;  3K57 A;  4YR0 A;  5HBR B;  2CQY A;  2XIG A;  1VQ9 A;  4K5V A;  3K6O A;  2JA6 A;  5IT9 E;  1IBK Q;  5KG3 A;  4YR2 A;  5T1G A;  2L11 A;  1H9K A;  3S1N B;  3PO2 H;  2Q2I A;  1IOW A;  2VA3 A;  1C0A A;  2B2V A;  1MJE A;  4DK6 C;  4GKJ L;  4Q0Y A;  4UFZ A;  1J5E Q;  2RKS A;  2WAC A;  4X65 H;  1K83 B;  1JWM D;  3GP7 A;  3SDZ A;  1JQY D;  1N48 A;  3KAJ A;  2WAQ E;  3CCR A;  4A3M G;  1QIL A;  2OTJ A;  2MO0 A;  2JA8 B;  1BF4 A;  1E4G T;  4YJ2 F;  4X65 Q;  3QO2 A;  2IPK D;  2Q8R E;  3ER0 A;  4JK1 C;  5ELD A;  4UP9 A;  2A68 D;  4S3S A;  4JI5 L;  3STB D;  2PVP A;  1FGU A;  3NE5 B;  1YNX A;  2IWH A;  3VR4 A;  1Y1V B;  1HNZ L;  2CZG A;  1XX8 A;  4CDC C;  4RUA A;  3HGB A;  3PO3 B;  1SFO A;  2A69 D;  2QDB A;  2K5H A;  5IIF A;  3KDF A;  1EFW A;  2HT1 A;  4B3R L;  2ASJ A;  2AGQ A;  1VMC A;  4IRD A;  1CM9 A;  1XMO L;  1YNN D;  3MZ5 A;  2ZJQ A;  3V6J A;  4IR9 A;  2NZH A;  3R3O A;  2AWO A;  3UDX A;  1N56 A;  2FB9 A;  3WNZ A;  4RNO A;  3S1M B;  2VXW A;  2E2H H;  5KG5 A;  1PLF A;  2NUA B;  2LXK A;  3MFG A;  5I4D A;  1YI2 A;  1F2Y A;  2XD4 A;  5CB4 F;  2EY2 A;  4YHH H;  4Q8F A;  1C7Y A;  1DD2 A;  2AUK A;  2R7D A;  2YS6 A;  1ZXT A;  3AYH B;  3CC2 A;  2JA7 G;  2Z6K A;  3L2P A;  1VQL A;  2E5L H;  5C44 H;  2DN8 A;  4YHH Q;  2VQE L;  1HR0 Q;  3ETH A;  5C3E B;  5KX5 F;  3H6M A;  1LO5 D;  5C4X B;  3ULJ A;  2XCL A;  2PBZ A;  1LAC A;  2CWA A;  4LUZ A;  1O7Z A;  1T94 A;  1HQR D;  2BR0 A;  4IUR A;  5C4J B;  3T5J A;  4ZLT F;  1CI3 M;  1EL0 A;  2IY5 B;  1ULZ A;  1AFP A;  4RB0 A;  4X3K A;  3OIP A;  4FO2 A;  1VQJ A;  2CW8 A;  4JI2 H;  5KT5 A;  2EYJ A;  1XPU A;  1QNU A;  4GLX A;  1KLU D;  2I5L X;  1EHI A;  3SI8 A;  1DCZ A;  3R23 A;  1U0L A;  1SDF A;  2R6G A;  5ELF A;  4JI2 Q;  2WDT A;  2XSC A;  5KFK A;  2DNC A;  3AB9 A;  4MNO A;  2B2U C;  1W96 A;  1WD1 A;  4HTH A;  3R8B A;  5DNF A;  1FJG L;  4JV1 A;  1L2Z A;  4ED8 A;  4EQP A;  4DV2 H;  4TV8 F;  1M6V A;  4MV4 A;  1P8L A;  1SNM A;  2RQX A;  1GKH A;  4LH6 A;  4Y52 H;  5KFW A;  5M3M H;  1HZ9 A;  1CZW A;  1QZH A;  2JA8 H;  3RGZ A;  2IX0 A;  3SGI A;  3URY A;  1TWC A;  2O5J C;  4XYL B;  5G3L F;  4OO1 I;  2Y0S E;  2KA7 A;  4EGV A;  1Y1W B;  4O3Q A;  2SEB D;  4C3I B;  3EN2 A;  1DM0 B;  4LMQ D;  4A3K G;  2AUJ D;  1DOM A;  1CQV A;  1KXL A;  4DR6 H;  4KHP H;  2YYA A;  5JUM A;  2JA7 A;  1A6X A;  4OWW B;  3TQ1 A;  4TV9 F;  4A3I B;  1PH2 A;  4DUY H;  5F9L A;  1D5M C;  2RVL A;  2C2D A;  4KHP Q;  4DR6 Q;  5GRO A;  1EQV A;  1YJW A;  1A2T A;  1S10 A;  3S1M H;  2NVX A;  4LAA A;  1EQR A;  4OO1 G;  4GNX C;  4DUY Q;  2NTT A;  2HD3 A;  5E4W C;  2Q8I B;  3I70 A;  4ODG A;  2WYO A;  1EEF D;  4DAP A;  4KI0 A;  3SE7 A;  4KMU C;  4ZKC B;  3J7A V;  1SYE A;  2RSO A;  4HED A;  1X3P A;  2AQ1 B;  3RLF A;  5C3E H;  1I50 A;  2X6G A;  5C4X H;  1JOQ A;  3LWU A;  5M5X H;  3RGX A;  4JV5 H;  5IYC G;  4YHH L;  4G7H C;  2E8G A;  4A3F G;  4HYK A;  3ORR A;  4K14 A;  1RCV D;  1M90 C;  2YV5 A;  4A3L H;  1EY8 A;  3K7U C;  2E5L L;  2KHJ A;  3EFX D;  4I55 F;  3U50 C;  4JV5 Q;  3D4D A;  1KD1 C;  2AQ2 B;  4EGQ A;  4MV9 A;  5GAD C;  5JAV A;  3AFQ A;  3FKI B;  5T1I A;  4OGQ C;  1PA6 A;  4GOP C;  1KJQ A;  1PTO B;  4A2B A;  3TME A;  2EDG A;  1QOH A;  4GN5 A;  4H02 A;  3D8G A;  1KRT A;  5C3W A;  1VKZ A;  3K8A A;  4JI2 L;  2GPW A;  3U9S A;  2Z0S A;  4LFC H;  3M4Y A;  4DAY B;  1VQ6 A;  4DR4 H;  4LFB H;  2K5W A;  1RJR A;  1S0O A;  2Q8T A;  1SFO H;  3STB C;  2D62 A;  2A68 C;  3M7G A;  3CU7 A;  3VYT A;  4JYA L;  2J9G A;  4LFC Q;  3RD4 A;  3RLO A;  4YBZ B;  1VMP A;  2FJ2 A;  2PPB C;  4DR4 Q;  1RIP A;  4B9W A;  1IZ6 A;  4LFB Q;  4YAK B;  1XDN A;  2R87 A;  3MEF A;  2ALY B;  2A69 C;  3S15 B;  4DV2 L;  4FVM A;  1KEE A;  3HP3 A;  4C3H H;  4QW8 A;  3MXN B;  1YNN C;  4PMW A;  4LF7 H;  2VA2 A;  2D5D A;  4JPB W;  1Q1E A;  1JOK A;  1K0S A;  1EY0 A;  2XWB B;  3BDO A;  5KFX A;  2W8K A;  1J9O A;  5IT9 W;  4XT3 B;  2E2J H;  2W9A A;  3GDE A;  4LF7 Q;  5KT6 A;  1H9J A;  3TSS A;  2VUM G;  4DV1 L;  2W6O A;  4UCV A;  4RU9 A;  4IOA A;  2FK2 A;  4JI8 H;  1I5F A;  3MR2 A;  2F03 A;  2HVQ A;  1A2U A;  3EQL C;  1JC7 A;  3GD7 A;  3I4N G;  1UEA B;  3NUC A;  3M9B A;  4TSS A;  1NAP A;  1KDC A;  2QIL A;  4H44 C;  2UXD H;  4IR1 A;  3GTQ B;  4DV5 H;  4A3M H;  3CVZ A;  3T1H H;  1W2B A;  4C3J G;  5KNC A;  4POF A;  2PW5 A;  3CRL C;  5KFM A;  4O1N A;  2YCH A;  3MHB A;  1SJE D;  3CCJ A;  1KIX A;  2UXD Q;  4DV5 Q;  3T4A C;  3T1H Q;  1FD7 D;  3IL8 A;  4R8I A;  2YU9 A;  1F9R A;  3H3V C;  2R8I A;  2EXD A;  2EYP A;  2F3V A;  2VQF H;  4APM A;  4EQN A;  3S2H H;  1R9T H;  2JEF A;  3GTM B;  1EYA A;  4IPC A;  4IUQ A;  1JXL A;  4QWC A;  5EBD A;  2AKW B;  2R92 B;  3NBH A;  1G6P A;  3GTK A;  2VQF Q;  1LUZ A;  2RSN A;  3OWF A;  1PRT F;  5JJI A;  2R7L A;  1B6R A;  5KFY A;  3QR8 A;  2LFN A;  5LMN W;  4IWX A;  4B3S L;  2B39 A;  4DR2 H;  1STY A;  4JCV E;  2HGS A;  5DG8 A;  5E1F A;  4ZK9 B;  5M5Y H;  3KLS X;  2X0S A;  1STE A;  3I7F A;  3RIZ A;  1Q12 A;  5DLF A;  3CME A;  3BZD B;  2IX3 A;  5C0X I;  1GJX A;  2VOB A;  3HKS A;  3CPF A;  2NVY H;  3H0G A;  5C4H A;  5M9O A;  2EZV A;  4RA8 A;  1WD0 A;  1WH2 A;  3OUU A;  2JA7 H;  4LH7 A;  3WO0 A;  1HUN A;  1K1Q A;  3QZ7 A;  4WOR A;  1B1Z A;  2E2D C;  3DHQ A;  4K0K H;  3HG9 A;  1YHB A;  3W2D A;  5KFH A;  1JLL B;  1W3S A;  2KEE A;  1BOS A;  3OMC A;  3VR6 A;  2DJG C;  4ZI7 F;  5KG0 A;  1Y8P B;  3J80 L;  4F4Z A;  3IFD A;  2OTL A;  3VYR A;  4K0K Q;  1XNQ L;  3UQ8 A;  4DR4 L;  1B44 D;  2F0J A;  5M3F G;  4ZHQ F;  1IYJ B;  2FK3 A;  5C0X G;  4O3N A;  1HNW H;  1F9Q A;  1FNV A;  5C3X A;  1HA5 A;  2PQA B;  1ZYR D;  4YCV A;  4BA2 I; 
#chains in the Genus database with same CATH homology
 3CCM A;  1FJG Q;  4GN4 B;  1OXX K;  1WOC A;  2KCM A;  2RF4 A;  3CF5 A;  1K8A C;  2JA5 G;  4NXM Q;  1HNW Q;  1CKO A;  1I50 H;  1Q81 C;  1JE5 A;  1EIY B;  1Z47 A;  4R4I A;  2YTX A;  4JBM A;  4YCU A;  4EQ5 A;  4LF4 Q;  4DR3 Q;  5ELO A;  2FXQ A;  4DPG A;  1G29 1;  1SE8 A;  3CCE A;  4DAM A;  3HKZ G;  1OXS C;  2Q2H A;  3PUX A;  1HNX L;  4MTN A;  1LTL A;  1NBW A;  2N78 A;  1YHA A;  2ZJR A;  2BA1 A;  1Q46 A;  3NEM A;  3CPW A;  2UUC Q;  3UDI A;  4QQB X;  1X55 A;  4X66 L;  2VNU D;  3PUV A;  1SRU A;  3D0F A;  2NN6 I;  1YZ6 A;  4R1J A;  3TRE A;  5FLM H;  1YVC A;  5LMN L;  1YIT A;  4DUZ Q;  2GVB A;  1L1O C;  2NZO A;  4JI8 L;  2WB1 E;  1PH7 A;  4IFD I;  1DGS A;  1XNR Q;  2B3G A;  2WP8 J;  4R4O A;  5M3M G;  1K9M C;  1IBM L;  2UXC L;  5GAH C;  4UP7 A;  2JA8 G;  1VQ7 A;  3T1Y L;  2EQS A;  2OQ0 A;  3KFU A;  4JOI C;  4C2M H;  2K5V A;  5JEA J;  1VQK A;  4A3K H;  2ATW A;  2R7Z G;  3CP0 A;  3S1R H;  4LF9 Q;  3GTM H;  1GVP A;  4A3G G;  5GAE C;  2Q2U A;  4DK3 C;  1V9P A;  4GOP B;  2UU9 L;  3S17 H;  3K80 C;  4BBS H;  1GO3 E;  2CKZ B;  2NN6 G;  2YYZ A;  4A3J H;  3FKI G;  2VL6 A;  1KQS A;  4JI6 L;  3J81 i;  4AYB G;  1GM5 A;  4JG2 A;  1U5K A;  3G4S A;  1X54 A;  4JI1 L;  4HIK A;  4BY7 G;  4LUO A;  2ZTD A;  4P73 A;  2IX1 A;  1EWI A;  4IFD G;  4X6A H;  3H0G G;  2HIX A;  2L15 A;  1GD7 A;  1QUQ B;  3CXC A;  4QL5 A;  2C35 B;  1VCI A;  4X64 Q;  1KC8 C;  4BA2 I;  1D8L A;  1L1O B;  2KBN A;  1Q82 C;  4DR7 Q;  5AJ3 L;  3CQZ H;  3UDG A;  1S40 A;  3CCQ A;  3EBE A;  4IPD A;  1VQF A;  1N34 Q;  3A74 A;  2CWP A;  3GTJ H;  2KHI A;  4KHP L;  4DR6 L;  1UE5 A;  4BA1 I;  1Q86 C;  4DV7 L;  4BXX G;  3RZO H;  2H5X A;  4O0A A;  1LM0 A;  2Y0S G;  1BKB A;  3K0X A;  5M3F H;  4DR2 L;  4B3T Q;  2CQO A;  4DUY L;  3PO2 G;  1VS0 A;  2ZJP A;  1XJV A;  2E5L Q;  4YY3 Q;  4HJ7 A;  4A3I G;  2VZA A;  3CAM A;  3J7A 5;  4JBK A;  1M1K C;  5C3E G;  4A3F H;  1EIF A;  4IPG A;  1UE1 A;  1AE2 A;  1VQH A;  5C4X G;  3F2B A;  2A8V A;  1KAW A;  3CC7 A;  1TWH H;  1PH6 A;  1PV4 A;  2PI2 A;  4DKA C;  5FLX c;  4NPS A;  4JC0 A;  1E1O A;  1UWV A;  1PH4 A;  5EAY A;  1N32 Q;  5JJL A;  1KRS A;  3B6Y A;  1X56 A;  3KDF B;  4JI3 L;  1VQN A;  4A3B H;  4B3R Q;  4TQU S;  5LMU Q;  2ID0 A;  4A3L G;  2JA9 A;  1PVO A;  4DV0 L;  1SR3 A;  5GQO A;  4DR5 L;  3M4Q A;  4AYB E;  2GN5 A;  3TEH B;  3S1N H;  4TVA B;  1AE3 A;  3RN5 A;  2UUB L;  4X62 Q;  4LF6 L;  1WCM G;  3GTO H;  3BZC A;  4HJA A;  1Q1B A;  4GNX A;  1PH9 A;  3HOX H;  4JYA Q;  4JV5 L;  1K83 H;  1TWC H;  3RNU A;  5IYD G;  1YIJ A;  5IWA L;  3ICE A;  5IYB H;  1ASY A;  4JI0 L;  2YTV A;  5E7N A;  2JJQ A;  3U4Z A;  4DV2 Q;  3F1Z A;  2WAQ G;  4OON A;  2ZM6 L;  3GTK H;  1HJP A;  3ERS X;  4NB3 A;  3J7Z C;  3G48 A;  3GTL H;  1Z9F A;  1Y1V H;  1OXU A;  2NVQ H;  1X3E A;  5IP9 G;  4GKK Q;  1JJC B;  2RCN A;  3PO3 H;  4LF8 L;  4QY7 A;  5IP7 H;  1NJI C;  5C44 G;  2MNA A;  2NVX H;  3Q8D A;  3OW2 A;  4LFC L;  4DV1 Q;  2UXB Q;  1E24 A;  2R92 G;  2D0O A;  1VQE A;  4LF9 L;  4LFB L;  3PF5 A;  2BH2 A;  2VS1 A;  1TWA H;  4A3E H;  4GOP A;  1K73 C;  2VUM H;  1PFS A;  1BBW A;  1VQ9 A;  3PIP A;  4EX5 A;  2K4K A;  4DR1 Q;  4DV6 Q;  1QVG A;  1IBL Q;  3I4N H;  4RMF A;  1IBK Q;  1TWF H;  3K7A H;  1E22 A;  3TQY A;  2K50 A;  3W5O A;  4X64 L;  4APV A;  3CC4 A;  1L2F A;  1VQM A;  3PO2 H;  4DR7 L;  1I94 Q;  2Q2I A;  1C9O A;  3ULP A;  4LF7 L;  3HOV G;  1C0A A;  1MJE A;  4DK6 C;  2AWN A;  1EUJ A;  2JQO A;  1J5E Q;  1N33 Q;  3NEL A;  4GKJ L;  4YWL A;  2HIV A;  4C3J H;  1N34 L;  3S14 H;  1B8A A;  1CKN B;  1PYS B;  2I5M X;  5IY0 A;  1Q7Y C;  1CSQ A;  4OWT B;  3HOU G;  4BBR G;  2WAQ E;  4QIW E;  5C4J H;  2KCT A;  3CCR A;  4A3M G;  2OTJ A;  2MO0 A;  3IRB A;  4GLV B;  1WJJ A;  4B3T L;  4HJ9 A;  2LXJ A;  4KLK A;  4X65 Q;  3ER0 A;  3BU2 A;  3STB D;  4UP9 A;  4JI5 L;  1FGU A;  4B3S Q;  1YNX A;  4L5S A;  3J81 j;  2QEX A;  1HNZ L;  3M7N A;  4BY1 G;  1A63 A;  1WCM H;  3PGZ A;  5GAG C;  1PHJ A;  2UXD L;  5FJ8 G;  4QJF A;  4DV5 L;  5DLQ E;  1EFW A;  3H15 A;  2JE6 I;  2K5H A;  3KDF A;  3T1H L;  2HT1 A;  1X3F A;  4B3R L;  3GTG H;  4A3D G;  2R93 G;  3DM3 A;  4LF5 Q;  1XMO L;  2ZJQ A;  3F8T A;  1X9N A;  1CKM A;  3W1B A;  3RN2 A;  1YBY A;  2NZH A;  2LSS A;  4JI4 L;  4A3C H;  3UDX A;  2AWO A;  1SRO A;  2F4V Q;  4X62 L;  1VQ5 A;  2E2H H;  3G71 A;  2LXK A;  1Y14 B;  3HOW G;  3I56 A;  4L5R C;  1I3Q H;  2VQF L;  4FDB A;  4A4I A;  4AQY L;  1YI2 A;  4PG3 A;  1D7Q A;  1TXY A;  3PUW A;  3CMA A;  2QGQ A;  1VQP A;  1PH1 A;  1C7Y A;  2R7D A;  3HKZ E;  1XNQ Q;  3CCV A;  5JEA G;  3EIV A;  3PV0 A;  5IP9 H;  4HJ5 A;  1K8G A;  4A93 G;  3AYH B;  3CC2 A;  2JA7 G;  2Z6K A;  4PZ6 A;  1QVC A;  1X3G A;  3L2P A;  1VQL A;  1ASZ A;  1E1T A;  5C44 H;  1Y1W H;  2UUA Q;  4C3I H;  5H1S E;  2PI2 E;  5BR8 Q;  1KL9 A;  4YHH Q;  2VQE L;  1QZG A;  1HR0 Q;  1SMX A;  3NEN A;  1X65 A;  3ULJ A;  1HH2 P;  3E9H A;  4HIO A;  3G6E A;  1K3R A;  4PZ7 A;  3F2C A;  2R7F A;  3UE1 A;  1A8V A;  2CWA A;  4LUZ A;  3W1G A;  2B29 A;  5IT9 c;  1FVI A;  2ES2 A;  4P71 A;  4A3I H;  2IY5 B;  2PMZ E;  4JI7 L;  2HHH Q;  3I4M G;  4GKK L;  4XIG S;  2AHO B;  1VQJ A;  2B63 G;  2JA6 G;  2E2I H;  2JA5 H;  1K0R A;  4R4C A;  1VQB A;  1XPU A;  4GLX A;  4K0K L;  4OX9 L;  2NVT H;  3J80 c;  2I5L X;  2N49 A;  4X66 Q;  2QA4 A;  1PH8 A;  2XGT A;  1BBU A;  1U0L A;  4DV4 L;  2R6G A;  4JI2 Q;  3KJO A;  5LMN Q;  2PQA A;  4MNO A;  1VQA A;  1B70 B;  1MJC A;  2WFW A;  3UE0 A;  1FJG L;  1LYL A;  1NTG A;  4J15 A;  4JI8 Q;  4DV6 L;  4IJL A;  2IT1 A;  2BH8 A;  4LFA Q;  1VQI A;  1IBM Q;  4NXM L;  1RL2 A;  1HNW L;  2PNH A;  4DV3 Q;  1PH3 A;  2YU9 H;  3T1Y Q;  4LF4 L;  2IHE A;  4DR3 L;  2XTI A;  1JT8 A;  1JJG A;  1I94 L;  1P8L A;  2CFM A;  3KYH C;  1GKH A;  1XMQ Q;  2RHS B;  5M3M H;  1HZ9 A;  3J80 i;  4Y52 H;  3BJU A;  4OWX B;  5FLM G;  1QZH A;  2JA8 H;  2IX0 A;  4WJ4 A;  3SGI A;  2UUC L;  4L5Q A;  3FHW A;  2R7Z H;  3JAM c;  1T9H A;  4A3G H;  2K14 A;  2CCZ A;  2DUD A;  3ZJY C;  4OO1 I;  2Y0S E;  2HQL A;  2V1C C;  2VW9 A;  3OYY A;  3LGJ A;  4RG1 A;  3RR5 A;  3EN2 A;  1UEB A;  4DUZ L;  3FKI H;  1MIU A;  3L7Z C;  3PSI A;  4A3K G;  3HOY G;  1EYG A;  1XNR L;  1KXL A;  5HGQ A;  3KF6 B;  5AJ3 Q;  3H3V I;  1XTD A;  4BY7 H;  4BBS G;  2GVA A;  2AMC B;  4A3J G;  4OWW B;  3H0G H;  1PH2 A;  3S16 H;  2JEA I;  3CCS A;  5C0X J;  4KHP Q;  2OQK A;  2ZTC A;  5GRO A;  1YJW A;  4DR6 Q;  3JAM i;  3S1M H;  3I55 A;  3E0E A;  1UE6 A;  1EQR A;  2RHQ B;  1Q8K A;  4DR2 Q;  4OO1 G;  1AH9 A;  2BA0 A;  2A19 A;  4DUY Q;  4LW1 A;  4GNX C;  1A62 A;  1E7Z A;  1WFQ A;  3M85 A;  4R4Q A;  3OTO Q;  2F4V L;  4KHZ A;  3KJP A;  4BXX H;  2VY3 A;  3F2D A;  1QUQ A;  4KI0 A;  4A76 A;  1L1O A;  3S15 H;  5M5W H;  3A5Z B;  3RLF A;  3UDF A;  5C3E H;  4A75 A;  1KHI A;  4JI3 Q;  5C4X H;  4LNQ A;  4JOI A;  3PCO B;  3AEV A;  5IE8 A;  1FL0 A;  5M5X H;  1EOV A;  4DV0 Q;  4DR5 Q;  5IYC G;  5BR8 L;  4YHH L;  1JJ2 A;  2E8G A;  4A3F G;  1M90 C;  1V43 A;  2YV5 A;  2UUB Q;  3CW2 C;  2MQH A;  4LF6 Q;  3AFP A;  1QVF A;  4A3L H;  3K7U C;  3NBH B;  2KHJ A;  4YY3 L;  2E5L L;  4GNX B;  3TS0 A;  1PH5 A;  1BVS A;  3U50 C;  1CSP A;  4JV5 Q;  1KD1 C;  4A3B G;  2HHH L;  2DGY A;  3FP9 A;  1J6Q A;  5GAD C;  4NXN Q;  3AFQ A;  1PA6 A;  4GOP C;  5IWA Q;  4B3M Q;  4JI0 Q;  1N32 L;  3DLL A;  4WJ3 M;  1G51 A;  3AQQ A;  4GN5 A;  4H02 A;  3D31 A;  4UY8 C;  2ZM6 Q;  1KRT A;  5LMU L;  3GTP H;  1OXT A;  3RZD H;  5IYD H;  3GTQ H;  1H95 A;  3K8A A;  1N36 Q;  4JI2 L;  1WI5 A;  1CUK A;  2K5N A;  1VQD A;  3ULL A;  3HOX G;  2Z0S A;  1YHQ A;  1MKH A;  3J81 c;  4IFD J;  5K36 G;  1NMF A;  4DAY B;  1VQ6 A;  3M4P A;  3E9I A;  3BZK A;  4LFA L;  4XTC S;  2ZTE A;  2N8N A;  5IYB G;  1SFO H;  4LF8 Q;  3STB C;  4DV3 L;  2D62 A;  4JYA L;  1N9W A;  4R4T A;  1HR0 L;  4LFC Q;  3RLO A;  1YJ9 A;  3M4O H;  3HOZ G;  4IJH A;  4Y7N H;  3HOY H;  3I4O A;  4AIM A;  1VQ8 A;  3M3Y H;  1RIP A;  1XMQ L;  1IZ6 A;  1VQC A;  2I5H A;  2OCE A;  1XPO A;  4DR4 Q;  4AH6 A;  1EQQ A;  4JBW A;  3MEF A;  2ALY B;  2N3S A;  1Y1V G;  4DV2 L;  4OXP A;  2R92 H;  3GO5 A;  3S1Q H;  2MFI A;  4C3H H;  3MXN B;  3PO3 G;  4PMW A;  1XPR A;  5IP7 G;  1Q1E A;  3VDY A;  4GN3 B;  4DNI A;  2E2J H;  3I2Z A;  3KF6 A;  3GDE A;  4YWK A;  4A3E G;  2I0Q A;  1L0W A;  1HNX Q;  4LF7 Q;  1IL2 A;  1SLJ A;  4L5T A;  2VUM G;  4DV1 L;  2JK8 A;  4GKJ Q;  4HID A;  3H3V H;  4IOA A;  2UXB L;  2F52 A;  3RLN A;  1I5F A;  3PF4 A;  3GD7 A;  3L0O A;  2OWO A;  3I4N G;  1VQO A;  4LFB Q;  1NMG A;  3HOV H;  3M9B A;  1IXR A;  4YCW A;  4DR1 L;  1IBL L;  1HZB A;  4BBR H;  3OTO L;  5IYC H;  3K81 C;  4MZ9 A;  1IBK L;  4A3M H;  3HOU H;  4JI5 Q;  2UXC Q;  1W2B A;  2IHF A;  1HR0 W;  3TS2 A;  3S24 A;  4POF A;  3U58 A;  5J3B A;  1HNZ Q;  2Z6K C;  2A1A A;  4P74 A;  4P75 A;  1S72 A;  4LWC A;  4UP8 A;  3CCJ A;  1KIX A;  2UXD Q;  1YEZ A;  1UE7 A;  4DV5 Q;  1J5E L;  3CCL A;  3T1H Q;  2UU9 Q;  1N33 L;  5HY6 A;  4POG A;  4P72 A;  3PIO A;  2EXD A;  1CKN A;  2F3I A;  4BY1 H;  4ME3 A;  2JEB I;  3S2D H;  4JI6 Q;  1XMO Q;  2Q2T A;  4O2D A;  1B7Y B;  1R9T H;  4UPA A;  3S2H H;  1WYD A;  4IPC A;  4JI1 Q;  4JI4 Q;  5FJ8 H;  3PUY A;  3TRZ A;  1JB7 A;  4X65 L;  1E3P A;  3HFZ B;  2AKW B;  2YTY A;  3A5U A;  4A3D H;  2R93 H;  5JJK A;  1G6P A;  2VQF Q;  1LUZ A;  5JJI A;  4AQY Q;  4YWM A;  5LMN W;  3KOJ A;  4LUV A;  4B3S L;  4IPH A;  4JCV E;  4NXN L;  1HZC A;  3HOW H;  1YJN A;  3WWV A;  5M5Y H;  1TWG H;  4GLA C;  2K75 A;  4B3M L;  4A3C G;  3I7F A;  3U4V A;  3CCU A;  1Q12 A;  3CD6 A;  3CME A;  5C0X I;  3HKS A;  2VQE Q;  3HOZ H;  4DV7 Q;  3CPF A;  2KEN A;  2NVY H;  3KLW A;  4LF5 L;  4A93 H;  1N36 L;  2JA7 H;  1VQ4 A;  3KF8 B;  4HIM A;  1VQG A;  1OXV A;  2WB1 G;  1YHB A;  1A0I A;  1NE3 A;  1OTC A;  4JBJ A;  4JI7 Q;  1PYB A;  1S3O A;  1W3S A;  2MO1 A;  5ELN A;  4QGU A;  1Y1W G;  1N8R C;  1I6H H;  2OTL A;  3JC6 6;  4K0K Q;  2ASB A;  4OX9 Q;  1XNQ L;  1SN8 A;  3I4M H;  2EIF A;  4DR4 L;  1P16 A;  1V1Q A;  2K52 A;  5M3F G;  1IYJ B;  4IO9 A;  5C0X G;  4ALP A;  1JMC A;  4DV4 Q;  1HZA A;  3PUZ A;  4IOC A;  2B63 H;  2JA6 H;  3A0J A;  2UUA L;  2D0P A;  1O7I A;  1X6O A;  4PZ8 A;  4HJ8 A;  1NY4 A;  2PQA B;  4YCV A;  4GS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...