3HOYG

Complete rna polymerase ii elongation complex vi
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hoyG01
1QZGA 4LFBQ 1JJCB 1E1TA 1HJPA 1FVIA 2PQAB 5IP9H 4A3MG 3UE1A 1QZHA 1B8AA 1YHBA 5IT9c 1G51A 1VQMA 1LUZA 2VQFL 5C3EH 4NPSA 2NVQH 4R4IA 4A93G 1VQ5A 4DR6L 3HOWH 4JV5L 3EIVA 4IJHA 4BY1G 4XIGS 4LF7Q 3F2CA 1UWVA 1OXXK 2WP8J 5M3FH 3CCEA 3KF6B 2R7ZH 4IOCA 2F4VL 3G71A 4JYAL 2ZTCA 4JOIC 3HKZG 3CCVA 4YWMA 1EYGA 4DR2L 1FL0A 2Z6KC 3I4NG 3A0JA 3J7ZC 4JI0Q 2R92H 5C0XG 1CKMA 2VQFQ 4B3RQ 1NMGA 4JBJA 1XPRA 1Z47A 3J80c 4DR6Q 4LFBL 1HNXL 1V1QA 2ZTEA 2EXDA 4DV6Q 1I6HH 3K7AH 5LMUL 3PUWA 5IE8A 1YIJA 2E2JH 4KHPL 4DV2L 1NTGA 2R7DA 1SLJA 3KJPA 1G291 2LXJA 3CMAA 4OX9Q 3CXCA 2WAQE 2F4VQ 4LF5Q 1X6OA 1BBUA 3PV0A 5JEAJ 3G4SA 2MNAA 2YTXA 2CWAA 1X3FA 1PHJA 3U4VA 2JA5G 4B3MQ 1LTLA 2VZAA 1YJWA 4GKKQ 4HIMA 4DR5L 2UXCQ 1TWFH 2LSSA 1VCIA 3CCUA 4UP9A 3W1BA 2WFWA 1AH9A 4XTCS 2NVTH 4JI5L 3U50C 1E22A 1L1OB 5DLQE 1C0AA 3KDFA 2UXDQ 2ZTDA 3CCRA 2RF4A 1U5KA 1HZCA 3A5ZB 3STBC 1MJEA 2NZHA 3HOYH 1DGSA 4P73A 2UU9L 1VQNA 2MQHA 4POGA 4GN4B 3AFPA 4NB3A 1OXTA 1Q81C 4YCVA 5K36G 1Y1VH 3CD6A 1YEZA 2Y0SE 3PSIA 4IPDA 2WAQG 1PV4A 3GTKH 2I5LX 4LFCQ 3M4PA 1YHAA 1UE1A 1VQEA 3PUZA 1SE8A 1VQDA 2OWOA 1RL2A 4JI5Q 4YCUA 4DV4Q 3DLLA 2RHSB 1K8GA 1UE6A 3UDGA 1EWIA 4A3DG 1PH2A 2UU9Q 4JG2A 4A3KG 4DV5Q 1LYLA 2ID0A 5C4XG 5C0XJ 1TWCH 5IYBH 2BA0A 2D62A 2KHIA 3GDEA 1JMCA 2WB1G 4YHHQ 4OWXB 1XPUA 2PNHA 1KD1C 2JA7H 1XNRQ 4MTNA 2HQLA 3K7UC 2KCMA 4PZ8A 4DV7Q 4A3FG 2YU9H 1PYBA 1PVOA 2VY3A 5J3BA 1PH9A 1GO3E 3D0FA 3KF8B 4A3GH 3ERSX 5AJ3Q 4YY3L 5LMNQ 3PIPA 1HH2P 1WFQA 3KJOA 1PH3A 2N49A 3S16H 3I55A 3M4OH 3ULLA 4EX5A 2JE6I 4KLKA 3T1YL 4DUZL 4OO1I 5C3EG 1EOVA 2K5NA 2I5HA 4X62Q 4YHHL 4AQYQ 3GTOH 5JJLA 3GTQH 3UDFA 2VL6A 5M5XH 4BA2I 4JI1L 4JI8L 2N3SA 1XNQQ 4DV7L 3DM3A 3G6EA 5IYCG 3RN5A 2UUCL 4NXNQ 3CPFA 4R4OA 1P16A 3PO3G 5AJ3L 5IWAL 2R7FA 1K73C 1KC8C 4A3CG 3B6YA 2VUMG 2E2HH 4HIOA 1JJ2A 2F3IA 2R92G 1D8LA 3T1YQ 5LMNL 1Z9FA 4GS3A 5IP7G 3HOXH 3CC4A 1FGUA 5M3MG 3HKZE 4GN3B 3RZOH 2C35B 4RMFA 1YJNA 5FLMG 3J80i 4JI1Q 1VQKA 1N34Q 3HOVH 1M1KC 1E3PA 2IX1A 1JE5A 2BA1A 2UUCQ 1EUJA 1CSPA 3OYYA 5JEAG 4BA1I 1P8LA 2KBNA 1VQ4A 5C4XH 1N32Q 5FJ8H 1GM5A 1I3QH 2XGTA 4RG1A 3K0XA 3PCOB 4TQUS 1B7YB 1HNWL 4L5SA 1YITA 2OQ0A 5H1SE 5GQOA 4BY7H 2UUAL 4EQ5A 2K4KA 1Q7YC 1EIFA 1I94Q 4R4CA 3TS0A 5LMNW 3S1RH 1HR0Q 2UXBL 1X55A 2QGQA 1LM0A 2PI2E 2PMZE 4X64Q 5HGQA 3JAMi 4IO9A 3ULPA 2B29A 1YNXA 3KOJA 1XJVA 1S72A 1N34L 4A3LH 1YBYA 3ZJYC 1N32L 4X6AH 1OXSC 3F2BA 1SFOH 4GLVB 4GNXB 4DV0Q 1XPOA 1FJGL 2D0PA 1VQAA 1KAWA 1HZBA 3LGJA 1KL9A 1PFSA 4B3TQ 4LF4Q 1TWGH 3WWVA 2Z0SA 4A3JH 3PF5A 4JCVE 4LF7L 1VQJA 2E5LL 3AEVA 2Q2TA 1NE3A 4JYAQ 1YZ6A 3E9IA 2ALYB 1BVSA 4GOPB 4A3IH 2IHFA 1PH4A 1V9PA 2JA8H 2JJQA 1WI5A 2AKWB 2F52A 3K80C 1KHIA 1XTDA 4X66Q 2CKZB 3HOXG 1KRTA 2IHEA 3BZKA 1X3EA 4LF4L 1QVGA 1HNXQ 3E0EA 3H0GH 2E8GA 2OQKA 5LMUQ 4B3SL 2R7ZG 1X3GA 3HOZG 3GTLH 4LF6L 2JA6H 1EFWA 2IY5B 4R1JA 3L7ZC 3OW2A 4WJ4A 1IL2A 1PH8A 1Y1WG 1EIYB 2A1AA 4HJ9A 5EAYA 4X66L 1CSQA 4BBRG 3A74A 1X56A 1CUKA 4BXXG 1UE5A 3A5UA 3CCQA 4BY7G 4B3ML 2JQOA 1A0IA 4GKKL 2R93H 1SN8A 4AYBG 4C3JH 4B3SQ 3EBEA 3W1GA 3BZCA 5GROA 2NN6I 1EQRA 5GAHC 3GTMH 4K0KQ 1TWAH 1VQBA 3H15A 1KIXA 3TREA 2KHJA 1E1OA 1WCMG 3M4QA 4A3EH 2Q2UA 2AMCB 1AE3A 2VNUD 1KRSA 4Y52H 2HHHL 4A3CH 2HIXA 4DR2Q 3T1HQ 4YWKA 2ZJRA 3K81C 4LF8L 3GTGH 4DR7L 1O7IA 5HY6A 1VQPA 1YJ9A 2B3GA 1EQQA 5M5WH 3M3YH 3CCLA 2DUDA 4PZ7A 3ULJA 3KFUA 4OO1G 3I7FA 4R4QA 4IJLA 4DK3C 4A3BH 1VS0A 3MXNB 2OTJA 1OXUA 4DV6L 4NXML 3RLOA 4Y7NH 4H02A 1B70B 3FHWA 5ELNA 4DV2Q 4JBMA 2QEXA 3HOYG 1CKNA 4K0KL 4OX9L 1BKBA 5JJIA 4DV1L 5C4JH 1YI2A 3PO2H 1S40A 3HOUG 1VQGA 1SROA 4QY7A 2N8NA 4YWLA 5IY0A 3H0GG 1HR0W 2HHHQ 3E9HA 4GOPC 3T1HL 3NELA 1A63A 3H3VH 1HZAA 5ELOA 1G6PA 2UUBQ 1X54A 3HKSA 3UDXA 5BR8Q 3JAMc 3OTOQ 4JI4Q 3TEHB 3I4MG 1QVCA 2GN5A 4A3MH 3BU2A 2GVBA 1PH7A 1I5FA 3NEMA 4O0AA 4P72A 2AWOA 4HIKA 4MZ9A 1Q1EA 1HNZQ 3PF4A 4DV1Q 4OWTB 1QUQA 1IXRA 1Q82C 3PO3H 3PUVA 5IYDH 4DUYQ 4POFA 5IP9G 2VS1A 3D31A 2EIFA 2QA4A 1Q8KA 4JI8Q 5BR8L 3J7A5 5M3MH 1K8AC 2B63H 2PQAA 2NVYH 2UUBL 4YCWA 1YHQA 4PZ6A 5IWAQ 4JI4L 2CCZA 1L0WA 2VW9A 2JA8G 2YYZA 1S3OA 4R4TA 3ER0A 4QL5A 3F2DA 4LUOA 3S1MH 3J81i 1E7ZA 1VQCA 1HNZL 2K50A 4DV5L 3TQYA 3KF6A 3GD7A 1M90C 4A93H 1Q12A 3S2HH 2AHOB 4GNXA 4A76A 1IBLQ 3IRBA 4BBSG 4C2MH 1VQ8A 1XNRL 2ATWA 4IOAA 2V1CC 3I2ZA 3F1ZA 2NVXH 1K83H 2FXQA 3HFZB 1R9TH 2Q2HA 2JA5H 4JI6L 4A3KH 3FKIG 4JBWA 2IX0A 3S14H 1W2BA 4DK6C 5FLMH 1N8RC 1KQSA 4X65L 1HR0L 2L15A 1W3SA 3NBHB 4X62L 3KYHC 3CMEA 4A75A 4AQYL 2JA7G 3CCMA 4ALPA 1K9MC 1OXVA 1XNQL 3STBD 5IP7H 1IBLL 3CC2A 3F8TA 1TWHH 1VQIA 1GD7A 4P75A 2ES2A 4LUZA 3G48A 1V43A 4MNOA 5IYDG 1OTCA 4JBKA 3S1QH 4B3TL 4LNQA 1N9WA 2DGYA 3CP0A 3PGZA 4JV5Q 3VDYA 2JK8A 2UXDL 4DKAC 1L1OA 1UEBA 1GVPA 4JI3Q 1UE7A 3S24A 2UXCL 4X65Q 2IT1A 2VQEQ 3PUYA 2EQSA 4A4IA 3HOZH 5C44G 5GADC 1Y14B 3RLNA 2YV5A 1NBWA 3M85A 5JJKA 1A8VA 2KENA 2XTIA 5E7NA 4LFCL 4B3RL 4DPGA 3CCJA 3Q8DA 3U4ZA 1PH1A 4KHPQ 1T9HA 3MEFA 1QVFA 3I4OA 4IPGA 4QIWE 4L5RC 3I4NH 4GLAC 1SMXA 3KLWA 2UUAQ 3S1NH 1ASZA 2JEAI 2UXBQ 2VQEL 1VQOA 2E2IH 4LF5L 1NY4A 2OTLA 3CAMA 1VQ9A 4JI3L 4WJ3M 4DV3Q 2JEBI 4O2DA 4PMWA 2KCTA 3PUXA 1PH5A 4JOIA 4IFDG 2MFIA 1Q1BA 2K75A 2K14A 4A3DH 4LFAQ 4DR4Q 3I56A 3K8AA 1K3RA 4ME3A 2HIVA 1CKNB 2Z6KA 1HZ9A 1L2FA 1MKHA 3SGIA 3L2PA 4DR5Q 4A3EG 1VQ7A 4OWWB 4A3LG 2Q2IA 1NMFA 4JI2Q 3CC7A 2CFMA 2MO1A 5IYBG 4IFDJ 4L5TA 4DAYB 1WOCA 3JC66 4APVA 4LF9L 2BH8A 2ZJQA 1N33Q 2VUMH 4P71A 1YVCA 1Q86C 4A3BG 4DV3L 2B63G 4GOPA 4BBRH 1NJIC 4A3FH 3ICEA 4AYBE 2I0QA 3PIOA 4LFAL 1IBKL 1WCMH 4LF8Q 1SR3A 4LWCA 4DR4L 2NN6G 4UY8C 4DR7Q 1PYSB 4KHZA 3AQQA 1X65A 2R6GA 5FLXc 2HT1A 2D0OA 4JI2L 4NXNL 4KI0A 1QUQB 1GKHA 4GLXA 4HJ7A 3M9BA 4DR1L 2K52A 3J81j 1E24A 4DV4L 1VQ6A 4UP7A 3RR5A 1VQLA 1N33L 1WYDA 1Y1VG 5C44H 4A3GG 1PH6A 1MIUA 2RHQB 3W5OA 2A8VA 4LF9Q 1N36Q 4QQBX 5GAGC 4C3IH 1IBKQ 1X9NA 2LXKA 3GO5A 3U58A 3KDFB 1KXLA 1XMQL 1IBML 2GVAA 1BBWA 5FJ8G 5GAEC 1Y1WH 4DNIA 3HOUH 1SRUA 4HJ5A 4TVAB 1I50H 1Q46A 3M7NA 1JJGA 3CCSA 4QGUA 4LUVA 5IYCH 4UPAA 4BXXH 1H95A 4FDBA 2K5VA 1HNWQ 3HOVG 3RLFA 1IZ6A 4YY3Q 4GN5A 4DR1Q 1J5EL 1K0RA 1IYJB 3I4MH 4AIMA 1N36L 3TRZA 2CQOA 2NZOA 1AE2A 1XMOQ 1JT8A 3L0OA 4DUZQ 4GNXC 2ZM6Q 3RNUA 1ASYA 2I5MX 3AFQA 3RN2A 1PA6A 3HOWG 4HJAA 2Y0SG 3CW2C 4X64L 4BY1H 1MJCA 5M3FG 1XMQQ 1IBMQ 4A3IG 4AH6A 4HIDA 2JA9A 1U0LA 2YTYA 5C0XI 3AYHB 3J81c 4A3JG 2ASBA 4DR3L 4NXMQ 3S15H 3PO2G 4DV0L 1FJGQ 2H5XA 2MO0A 4PG3A 4JI7Q 4L5QA 1VQFA 3TS2A 3FP9A 3GTPH 2YTVA 3CPWA 1XMOL 1CKOA 2E5LQ 1J5EQ 2ZM6L 2WB1E 2RCNA 4HJ8A 4J15A 5M5YH 2K5HA 2AWNA 4OONA 2JA6G 4QJFA 1J6QA 3CF5A 1VQHA 4P74A 1JB7A 3FKIH 3GTJH 1A62A 4UP8A 4IPHA 1RIPA 4DAMA 3EN2A 3OTOL 4GKJL 4JI7L 2N78A 3UE0A 1D7QA 2OCEA 4BBSH 3RZDH 2PI2A 4DR3Q 1L1OC 4JI6Q 4IFDI 3UDIA 3S17H 3S2DH 3CQZH 2CWPA 2ZJPA 4LF6Q 1WJJA 4IPCA 1C7YA 1I94L 1TXYA 4LW1A 4DUYL 4JC0A 1C9OA 2BH2A 4JI0L 3NENA 3H3VI 2R93G 4OXPA 2A19A 4C3HH 3BJUA 4GKJQ
chains in the Genus database with same CATH superfamily
2ZM6H 1YHBA 2FE3A 1VQMA 2JEJA 1K83B 2WB1B 3PW4A 3MHBA 4DR6L 1S97A 4IJHA 4BY1G 3PW0A 3F2CA 5JVDF 1OXXK 4CDFC 3CCEA 4IOCA 3KLRA 4JYAL 3K3PA 2ZTCA 3KBGA 2CH4A 4X62H 5ELDA 4B9WA 3MWDA 1DYQA 1ONLA 3SVMA 1QG7A 4RGNA 1LTTD 2V5AA 4X66H 1TWCB 4JI0Q 3KUPA 1FGBD 3I90A 5I2YA 4QB4A 1RTOA 1NMGA 3BDCA 4JBJA 4DR6Q 5EZYF 4X3TA 1V1QA 4EEYA 3CKIB 1F9PA 2ASJA 1PTOF 1UNSA 4KHPL 3GTGA 1SLJA 2LXJA 4I4TF 3CXCA 1PTOH 2WAQE 4MHEA 3ZYYX 4LF5Q 3DEOA 1HTPA 2W6MA 5JEAJ 1GUTA 3T5KA 1TR5A 1PHJA 5LOVF 1LTLA 2UXCQ 1Z6HA 3P75A 3T13A 1TWFH 2BDNA 2F0HA 2LSSA 1WSCA 3T5JA 4UP9A 1QNUA 3W1BA 3PIO3 5CB4F 4JK1C 2CW0C 4ECYA 1XWEA 1EUDB 2ZTDA 3CCRA 3A5ZB 1HZCA 3A54A 5C4JB 3CRLC 2VQEH 1DGSA 1IYUA 2NB0A 3MXGA 1D1IA 3VPCA 2Z8LA 4KKSA 4KD3A 5E4XA 4HNVA 5KG7A 4IPDA 1I7LA 2NVXB 2Z1CA 1YHAA 2FK3A 4C3IG 4APMA 3BZDB 1RL2A 1SEBD 1SSOA 1SJED 4YCUA 3DLLA 1K8GA 4G3IA 3UDGA 1PH2A 3TQ1A 4YQWA 4A3KG 4XYOA 3RIZA 1O7ZA 5CA1F 1EYDA 3H94A 5BPFA 2E74C 1GLVA 1TWCH 5IYBH 3ITPA 1TS2A 3J80E 5C5LA 3GDEA 2EYFA 1JMCA 2PQEA 4GZYC 4K6LA 2EYPA 1W93A 4O3PA 3BDLA 1GUWA 1PVOA 2VY3A 3S2DB 1LTRD 4DAYA 5KG6A 1SNOA 1HH2P 1WFQA 4RAYA 3M9OB 2E2DC 4EX5A 1HNZH 4KLKA 3V4SA 4DUZL 1I6VC 2FPIB 2HUGA 1EOVA 2K5NA 1SE4A 5JJLA 4QUFA 5M5XH 1O80A 3NQTA 1EYZA 2SOBA 3DM3A 5IYCG 3RN5A 2ZDQA 4HSPA 2PCFB 1Y1WB 2UUCL 4NW2A 5FD5A 2DJGC 5C3WA 4KN7C 1YNND 5IWAL 1KC8C 3ETJA 3B6YA 1UNNC 4EEQA 2F0OA 5D65A 1N36H 5IP7G 4EBEA 3HOXH 3CC4A 3SR1A 3RB4A 2JA6A 3LNNA 1MI2A 4EVOA 2W9CB 2BOSA 4U673 2P0AA 1VQKA 1N34Q 5T1IA 1M1KC 2ZXPA 1EZ8A 1ESFA 5KG3A 1JE5A 2QDBA 2UUCQ 3C46A 1SYDA 1V51A 2O03A 1EUJA 4MV7A 1S5FD 5JEAG 4BA1I 1K1SA 2YS6A 1RK6A 1N32Q 3OPOA 1I3QH 4RG1A 4TQUS 3K0XA 3PCOB 1TS3A 1S0OA 3P7JA 1B7YB 1HNWL 4YHHH 4PMCA 3J81L 1ZQ7A 5H1SE 5GQOA 5JVG3 3GTMB 4XQNA 4I50F 4DV7H 1I94Q 4R4CA 3TS0A 1HR0Q 2UXBL 3WOEA 4C5BA 3ORQA 5JAVA 4EQNA 1AP0A 2A6HC 2PI2E 3JAMi 3ULPA 1XJVA 3GTPA 2R3ZA 2WKCA 4RFBA 5IGBA 4A3LH 2KVMA 4NKLA 1N32L 2VPSA 4B3RH 1SFOH 4Q0FA 4GNXB 5FLXE 3N43B 2D0PA 1PFSA 2D9UA 3MFIA 4LK1C 3RZDB 3OSNA 4A3JH 5ELEA 4DN4M 4JCVE 1VQJA 4QF4A 4JYAQ 5HGTA 5CV7A 4LF5H 5KFWA 1PH4A 4JI0H 2IHFA 3QOJA 1Z2PX 4Q45A 4TQRA 2CW7A 3S9WA 3H4BA 1E0BA 3C2PA 1DJRD 4FF1A 2UXCH 1DCZA 2N88A 4ME6A 3CRKC 1X3EA 3JRWA 1ZHQA 1T94A 5KFZA 3H0GH 3G6YA 4B3SL 4JV5H 1IOVA 4KJOA 1LT5D 1B1ZA 1PTOD 1BR9A 1I4RA 3NXWA 5EKKA 4C5CA 1A15A 4BBRB 2R7ZB 3OW2A 4DV3H 1PH8A 5C5JA 4YR3A 1M4VA 1EIYB 3EROA 4HJ9A 1SCUB 2K1BA 1CSQA 2X69A 1WTWA 3A74A 2TMPA 1X56A 3EPGA 4EBDA 2XNAC 5DG7A 3NHHA 4FU0A 5DQHA 2J9GA 4O3RA 3IAYA 1HNXH 4B3SQ 3W1GA 5GAHC 3GTMH 2L0CA 3L3OC 5FPOA 1TWAH 1N33H 2AQ3B 3PIP3 3DMUA 1IW7D 2KHJA 1WCMG 4A3EH 2Q2UA 4Y8VB 2B63A 4Y52H 2HHHL 2HIXA 3Q6SA 3OUUA 2J7ZA 1JDEA 2ZJRA 4LF8L 3GTGH 2VUGA 5HY6A 2L1BA 3MA2B 1EQQA 3X3MA 1TVXA 2B2WA 3I7FA 2SNMA 2X6LA 1GOZA 4DV6L 2R8IA 3TN2A 4Y7NH 3FHWA 5IGDA 2UVUA 1J5EH 4H0LC 1Z2OX 4HR7A 4OX9L 5LXTF 4B3MH 4DV1L 4EQPA 1S40A 2PN1A 2R7MA 1I6UA 4YWLA 2K5WA 4KY7A 1HR0W 1S5BD 2L11A 1B2TA 3T1HL 3NELA 4MTKA 3H3VH 1A9XA 1EY5A 4DXFA 2UUBQ 1X54A 1WTPA 3OTOQ 3UDXA 5C6AA 3TEHB 1IKMA 4G7OC 3SK4A 1I7NA 3NEMA 4P72A 4HIKA 1HNZQ 2PVPA 2YW2A 2ATLA 2EJFC 2R92A 4DV1Q 4FBUA 3JAMW 5FLXW 1IXRA 3E6ZX 4KV6A 1QNKA 2EY1A 4C1NI 5IGFA 5EPKA 5F9NA 2JXMB 2F0QA 5IP9G 1DONA 2MCTA 2K5QA 3H20A 4EYHB 2VS1A 4J9NA 1KJJA 4ED7A 2HDLA 3HOZB 1DIKA 4KJNA 5FO7B 4MV1A 1C3OA 2C2EA 3SE0A 5IWAQ 1YHQA 2BQUA 2CCZA 2DPIA 4RUCA 1K83A 4RB0A 1XNQH 4QL5A 5KFAA 3CU7A 3F2DA 2R8HA 4TSSA 4A3EB 1PK8A 4NLGA 1VQCA 1TS4A 4OO1H 3TQYA 3H3VC 3SK5A 5C0XH 3PR4A 3GV7B 1PFBA 4F88A 3JSNA 2AHOB 4A76A 4J1MA 4JI1H 3IRBA 1Y1VB 2ATWA 1TWCA 3I3CA 2NVXH 5C3EB 4Y7NB 4JI6L 3FKIG 3VA7A 4RAUC 5FO8B 1KQSA 1HR0L 2RKSA 5JVLA 3NBHB 5CV4A 4CKCA 3CCMA 5JEAH 4ALPA 1IBLL 2JA7B 4EFEA 1GD7A 2ES2A 4LUZA 3A8IE 5CGKA 4MNOA 2OLSA 1WVLA 5D1PA 4JBKA 4V190 4LNQA 3PGZA 3CP0A 4Q44A 2FK1A 3Q8QB 5KFLA 2NN6H 3NSWA 1KLUD 3O13A 5DM73 4C3HG 3S16B 4DKAC 2J6TA 4RUAA 2PMZB 4PMBA 4XXEA 3S24A 2B2UC 4X65Q 1KJ9A 4UCVA 2PZWA 4IAJA 2EQSA 3HOZH 5C44G 5D8DA 4YP3A 3RLNA 3VMMA 2YV5A 2A6HD 1NBWA 1A8VA 3PQIA 1CM9A 2KENA 2KSWA 4UCUA 3PR5B 3CCJA 5CV8A 4J0MA 1LTSD 1PH1A 3MEFA 1S0MA 4ZHQF 4GLAC 1SMXA 2E5LH 3RB0A 2AQ4A 1ASZA 3SK6A 4NXNH 2KCNA 2B2YC 2KQ3A 3CAMA 3RMHA 4JI3L 1TA8A 2JEBI 4RB3C 1CE8A 2R6FA 1CZWA 1PH5A 3N6RA 5KFDA 5KFEA 2K75A 4FXDA 3QOLA 4LFAQ 3F2UA 1K3RA 4EGVA 3V6HA 1M8AA 3MJFA 5C4XB 3RUZA 1RJRA 2W9BA 4QWAA 2CFMA 2MO1A 4NMZA 4L5TA 4DAYB 1FNVA 4CJ2C 2R84A 3LMLA 1NCVA 5J2UF 4UFZA 5EWFA 3RZOB 3GIMA 4P71A 5K36H 1STNA 2TSSA 2FMMA 3BG3A 3K5NA 2RDGA 3LWUA 4A3BG 3V6JA 5L1JA 5ELBA 3ICEA 3L4JA 3J7AF 4LFAL 4LF8Q 1SR3A 4ED0A 4MTDA 4KHZA 1STAA 2R6GA 1C8CA 4UCRA 5CMDA 1AN7A 3FPUB 4LH7A 3M9BA 4DR1L 2K52A 4DV4L 3QIAA 3R2IA 4ED1A 4BY7B 3N8DA 4K8IA 4K6DA 2E2JB 1SYXB 2ZT9C 2BE5D 4A93B 4LF9Q 5KNBA 3NTKA 1EQVA 1N36Q 5BMVF 5EWGA 3WO1A 4C3IH 2W71A 1Q8IA 1STBA 2LXKA 3KDFB 3FDTA 3GO5A 1SNCA 2O5IC 2A6EC 2W6QA 2LY7A 4ECXA 1BBWA 1XMOH 5FJ8G 2CZGA 4JI8H 1GJXA 4CDDC 1Y1WH 1ICWA 1I50H 4B9XA 2NWGA 2RA4A 5KFPA 4LUVA 2W6NA 2K5VA 1HNWQ 4YY3Q 4NDXA 5FOBB 4RWSC 4RZRA 1E4EA 1N36L 1AE2A 2ZM6Q 5KNCA 4JI2H 3AFQA 2EJGC 1PA6A 2KOLA 3HOWG 4HJAA 3BQ0A 2BQRA 5C5MA 3RBDA 4ZQ3A 1V1OA 4C2MA 1T5XD 1BGWA 1U0LA 2BCOA 3J81c 1I3QB 3AYHB 2ASBA 2E2HA 4DR3L 2H5XA 4JI7Q 1VF7A 1IBMH 2NU9B 1RJTA 1EYAA 3K59A 2ZM6L 1NUCA 2WB1E 5LA6F 2VQFH 2AWNA 1E2VA 4P74A 1A6XA 4CDCC 3GTJH 1TWAA 2BQ3A 4ECSA 2PZTA 2IA6A 4DAMA 4JI7L 3UE0A 1B9NA 2F3VA 3WO0A 2NVYB 3JZIA 4RNNA 4EFBA 3RZDH 4ED3A 2WYOA 4JI6Q 2GLTA 2EYJA 1L0XB 3UDIA 1M6VA 3S2DH 2B2UA 3CQZH 4LH6A 2CWPA 1J9OA 2F0GA 3VYSA 4IPCA 4C3IB 1F9RA 3L9AX 3R8BA 5D14A 1S03G 4LW1A 3MWYW 4JI0L 5CC4A 3NENA 2A19A 4QWDA 3GTLA 2HJWA 1I50A 5M5WB 4HMJA 1QZGA 1HJPA 2PQAB 1FVIA 4A3MG 5M5XB 1JLLB 1TT2A 1RCVD 3T4AC 1Y69U 3N41B 2NVQH 1HCZA 3CQZA 3V4ZA 5GONF 2B2YA 4XIGS 1UWVA 4ZCKA 3G71A 4RKLA 2H1EA 4JOIC 4WORA 2L55A 4AQYH 1SYCA 5I6YA 3CCVA 3LWEA 3N44B 1PMRA 4L8JA 2XSCA 5IYZF 1KNAA 1XPRA 1Z47A 5DG9A 2HVRA 1B04A 2ZTEA 4DV6Q 3R5HA 1GUNA 1I6HH 1TWFA 3PUWA 3GILA 1SJHD 1YIJA 1MSGA 2DJFC 5E1FA 4MV9A 1JICA 3KJPA 4OX9Q 4RKBA 3JSLA 2R7KA 3T51B 1A2TA 2HGSA 3U9TA 4DL3A 3PV0A 2KEDA 4KHVA 2MNAA 1VDZA 2R93A 2WTFA 4YJ3F 4B3MQ 4C5AA 2VZAA 4DLKA 2XRQD 1SNMA 2B2TC 3NK9A 1PRTB 1VCIA 1U4PA 2XCAA 1AH9A 4JI5L 3ND8A 1AW7A 1E22A 5DLQE 1BXTA 1U5KA 4OX9H 4A3JB 2NZHA 3HOYH 4DV1H 1B33N 1RHPA 1D2BA 1VKZA 1A3VA 4CGYB 1O78A 3PSIA 2I5LX 4LFCQ 3M4PA 3PUZA 2L9HA 2FP4B 2GPSA 1VQDA 2VQDA 3NGDA 4JI5Q 4H13C 5IOCA 4DV4Q 2A5HA 4IFDH 1UE6A 2RDIA 1EWIA 4A3DG 2R61A 1ENCA 4JG2A 2VA2A 1LYLA 2ID0A 5C4XG 4RNMA 3PZPA 5IWAH 1C48A 5C0XJ 3RB3A 4J8QA 1B3AA 2BA0A 2D62A 2KHIA 1EUCB 4O3OA 2WB1G 1XPUA 3KHGA 4FS2A 4IR1A 3J81E 3TP5A 1I6HB 4PZ8A 4DV7Q 4A3FG 2F0EA 2WV6D 3D0FA 2V4DA 3FDSA 2KUMA 4YY3L 1PH3A 3M4OH 2GPWA 3NBIA 3MXNA 1DD2A 1TAEA 1GXDC 3E0JA 2K7VA 3J7YW 3T1YL 2ZJTA 4OO1I 3NPPA 1MGSA 2B2VC 2I5HA 3GTOH 3NBHA 3WNZA 2VL6A 3MFHA 3MR6A 3BYYB 4DV7L 5FKAC 3G6EA 3GP7A 1BXRA 2NTTA 2QW7A 4NXNQ 4R4OA 2NBFA 1K73C 4A3CG 4CC6A 2X6GA 5JPMC 1JJ2A 4MV3A 1IHZA 3T1YQ 5LMNL 1Z9FA 2ZXRA 1FGUA 1CHPD 4GN3B 2KJXA 5CORA 5FLMG 3GV3A 3J80i 3PW5A 4HNUA 1K28A 4ECZA 3OYYA 3D6WA 2KBNA 4DV0H 3OWEB 1X3QA 2EYLA 4ME5A 1YITA 3BG5A 2K28A 2OQ0A 4JW0A 4BY7H 4QW8A 2MPMA 1Q7YC 4LF4H 2UUCH 1NR4A 1SNDA 5M5YB 5CV9A 2QGQA 4B3SH 1RJQA 2PMZE 4IO9A 4O3NA 3I70A 5HGQA 1I4QA 3KOJA 1YNJD 2HQEA 1ICFB 1OXSC 2JP1A 3F2BA 2VB3X 2JN4A 4F7XA 1H9SA 4IR9A 1RK5A 1PXUA 1VQAA 2Z9HA 1BCPD 1HZBA 1TWGH 3G8CA 2Z0SA 1SYGA 2IW3A 2E5LL 3S17B 1BDOA 4A2AA 3G6XA 1AZQA 2Q2TA 1I94H 3GTOB 4XZ3B 4UCOA 2B8GA 1LTGD 2Z4IA 4H44C 4A3IH 4CC5A 1E2ZA 2JA8H 2B2TA 1WI5A 1RYSA 2F52A 2K32A 1B4OA 3K80C 3PW2A 3TP7A 4IRKA 3VR2A 3HOXG 2KA7A 2FPPB 2IHEA 3BZKA 1TIID 1QVGA 4DR6H 2E8GA 1X3GA 3HOZG 3GTLH 1EZ1A 4LF6L 2IY5B 4DL4A 4XQJA 3BJYA 4HYKA 2C00A 1SMYC 1XTCD 4J9MA 2AQ2B 4BXXG 1UE5A 2EOTA 4B3ML 5T14A 2JQOA 1BCPB 1A0IA 4O2BF 3HG9A 3NWTA 1BNCA 1ML0D 5EQ0A 1EQRA 4DV4H 4KHPH 3T1HH 4S3SA 4XX0B 1FYCA 1DV2A 3H15A 3UQ8A 5IT9W 1GUOA 3TREA 4H7BA 3MWMA 2A68C 1ILQA 4ECRA 2WKDA 3A55A 4A3CH 3T1HQ 1PYWD 1VQPA 3M4YA 1YJ9A 3W3AA 2IBKA 4ID6A 2R85A 4PZ7A 3ULJA 2QK4A 4C2MB 4A3BH 1VS0A 5C1OA 1N56A 1EIGA 1AN8A 4H02A 1U9RA 4DV2Q 2M05A 4U68A 3HOYG 1CKNA 3D8GA 3E3XA 5KGUA 3PN1A 3J80W 4A3IB 5JJIA 1S5DD 3KK7A 1M0WA 5C4JH 1YI2A 3C0FB 3PO2H 4XYMB 3N42B 3KHRA 2N8NA 3VPDA 4QIWB 3H0GG 3E9HA 5G3LF 1KDCA 3RTXA 3I4MG 2Y0SA 2EY5A 2IX3A 2JA5A 4NP5A 2R87A 4A3MH 1PFMA 2VA3A 3BDOA 3FKIA 1I5FA 3Q8PB 3PF4A 2XCPA 4LF8H 2SCUB 1QUQA 4O1NA 2F0VA 2MGSA 1Q82C 3HXLA 3PO3H 4ZRZA 5IYDH 4POFA 3U9SA 1PRTD 2EVBA 2QA4A 1Q8KA 3NTIA 4ECTA 1LT4D 5M3MH 2B63H 2PQAA 2NVYH 1GHJA 3RF2A 5L1LA 2AUJD 1H9MA 3DHQA 2JA8G 3CQZB 2YYZA 4DAVA 1S3OA 1KJQA 3ER0A 1BCPF 3RBEA 4LUOA 4RB1A 1ZKOA 4YAKB 4I65A 3K5MA 1ULZA 3K6OA 1GYFA 1Q12A 2E2IB 1IBLQ 4F4YA 3T5LA 4BBSG 3KHLA 2UXDH 1JKJB 3TBIB 2V1CC 3F1ZA 1JR0D 4DA2A 2FXQA 2Q2HA 4TV9F 4PQXA 4KY5A 1LV9A 2NTSA 5DQIA 2J6UA 3PMFA 2YCHA 5BR8H 3H0GA 5FLMH 2K04A 2Q8IB 4X65L 2MP1A 4R8NA 4AQYL 3KYHC 3CMEA 2JA7G 5J39A 1ENAA 1BF4A 3HOVB 1OXVA 1XNQL 4DAPA 2L12A 2R8KA 3CC2A 5LL6b 3MR3A 5EKIA 2NU7B 1JORA 1WTXA 3G48A 4I7HA 1LTBD 2GA4B 1DM0B 3DM1A 3QJYA 3VDYA 1CA5A 4XT1B 4XYQA 4PWQA 2UUAH 1EU3A 3VR5A 4KD4A 2A69D 2CH4W 4JI3Q 4ZUIA 2LS01 1IOWA 3ONAB 2FK2A 4G4KA 4JI6H 2I46A 5LP6F 3GTQB 4JVZA 1JCKB 2M9VA 1GSAA 5JJKA 3T53B 2XTIA 4B3RL 5KFSA 4LFCL 4P2CB 1FJGH 3Q8DA 2ASLA 2C2RA 1T9HA 1IBKH 1QVFA 4IPGA 1ET9A 2UUAQ 4ZK9B 1IBLH 3S1NH 2V4QA 2JEAI 2WB1A 4BWGB 3I4MB 3T56B 2K6AA 2E76C 4B3TH 4Z9CB 1BOSA 1U4LA 4IUVA 4ECQA 1Z7TA 3K8AA 1GSHA 4CDEC 2Z6KA 4DR5Q 2RDHA 4A3KB 1MKHA 3L2PA 1RODA 3E5NA 1N48A 4A3LG 1DV1A 1RDPD 4JI2Q 1NMFA 2A73B 1STYA 5IYBG 2RDJA 1WOCA 5FK9C 2FPGB 4N8X1 4APVA 5IT9E 4LF9L 1J8IA 2ASDA 2FLNA 1Q86C 2B63G 1NJIC 1QOHA 1FNWA 1KDBA 3PW7A 3N52A 3OW7A 2I0QA 2F0MA 2NN6G 2OT2A 5FLXc 2WAQA 4JI2L 4NXNL 4CKEA 3D4DA 3J81j 1EY0A 1EY9A 4UP7A 3K0YA 1GGOA 1E2WA 2XVSA 4BBSB 5C44H 5KFOA 3L4KA 3W5OA 2A8VA 3RAQA 5KFIA 5BN4A 2A68D 4IQZA 1STGA 4IN3A 1W6JA 5DQGA 5KG0A 1EWCA 3HOUH 1JE4A 1SRUA 2M2LA 4TVAB 4BS9A 4L1KA 1JJGA 5D1OA 4UPAA 1LT3D 1M7JA 4FDBA 4K8JA 3G6VA 2ALZA 3HBLA 3FPPA 4GN5A 3SE7A 1IYJB 4K0KH 4LAAA 2CQOA 1B6RA 1XMOQ 4FM9A 3RNUA 3F8NA 3RN2A 2Y0SG 1LT6D 1VBGA 4IALA 1MJCA 5M3FG 1XMQQ 4MA5A 4A3IG 2W8KA 3S1QB 2JA9A 5I47A 1WTRA 1CZGA 3VR6A 1PZID 2K03A 3VR4A 3GTPH 2VUMA 1XMQH 1XMOL 2E5LQ 5KFXA 1IYVA 3H09A 3T16A 4HJ8A 1K3BC 3DWPA 3EQLC 3N6XA 5FO9B 1B9MA 3TIIA 1D1KA 4QJFA 4E6IA 5I9OA 1PDQA 3A7LA 4FNFA 2NU8B 3GIKA 2EDGA 2UVRA 1PTOC 3R3OA 4UP8A 1F9QA 4N8FA 3EN2A 4OHJA 4C3JB 4GKJL 3BQ2A 2N78A 2OCEA 2PI2A 5A2QE 1UC9A 1WTOA 4KN4C 3I8ZA 2ZJPA 5DAUA 5JUMA 4LF6Q 3S1MB 4EYIB 5KFHA 4DUYL 4YB8B 2BH2A 2R93G 1HFNA 2D5DA 4GKJQ 1EOTA 2W6PA 1E1TA 2CHBD 4UAIA 5IP9H 1TWGA 3RV4A 1B8AA 1LO5D 1LUZA 4HAEA 2VQFL 5C3EH 3RJ0A 2PYKA 3OMCA 3FMCA 1HUMA 4R4IA 1VQ5A 4A93G 3HOWH 5JPNC 3JRXA 3U9OA 2WP8J 4EG0A 2W57A 2B8FA 2CW0D 3PO3B 3HKZG 4LJZC 2RCFA 5EPJA 1EY7A 3NTHA 2Z6KC 1VBHA 2R8GA 3I4NG 2PZUA 3A0JA 3J7ZC 2QKIC 5C0XG 2FLLA 2IPKD 2VQFQ 1XDNA 4B3RQ 3KAKA 3TSSA 4LFBL 5BN5A 4OIKA 2IWHA 1DZ1A 3GTPB 1EY8A 3SK8A 2E2JH 4DV2L 1NTGA 2H4OA 4LSXA 1HXYD 4N9TA 1HRJA 1CK1A 1G291 1LTID 1SXTA 5C3XA 3CHBD 3CMAA 4FF4A 2F4VQ 4HQ6A 1VMPA 1BBUA 3GIDA 3G4SA 2KHSA 4M7EA 2G9DA 4KKTA 1TKWB 1W96A 2YTXA 2CWAA 1X3FA 1WCMA 4KK7A 3U4VA 5JH7F 4GKKQ 5JVH3 4HIMA 4DR5L 1CQIB 2XRSD 2WFWA 2Y0SB 2JA5B 5FLXL 4DR2H 2Z6BA 4ZLTF 3U50C 4RCNA 3W2DA 1L1OB 1C0AA 2UXDQ 1EY6A 1HA5A 1IKLA 4RCOA 3STBC 1KNEA 4P73A 1VQNA 1A3TA 2D2CC 4JI3H 3V96A 4PDBA 4NB3A 3AFPA 3QZ8A 1OXTA 1Q81C 5JOBA 4YY3H 4YCVA 3R2TA 1NR2A 1Y1VH 4F4XA 3CD6A 2XGQA 2R7ZA 4I55F 1CHQD 4WJWA 1PV4A 3GTKH 2EYOA 1WTVA 1VQEA 4M8AA 2CVRA 3DXJC 1SE8A 4R7RA 5KFQA 2W7OA 5I9PA 1K8MA 3KTMA 1G8ZD 1EL0A 5KT5A 3QWNA 4Q8FA 3ERQA 1EIHA 4WD3A 5KT2A 3RGZA 2HCIA 1ZYRD 4LFAH 5KFJA 4LMQD 1R9TA 1SYEA 3D6CA 4OWXB 5LL6X 1F2MA 2JA7H 2HDMA 2B63B 3BQ1A 4MTNA 2AGOA 2W6ZA 3J7AK 1PYBA 1PH9A 3BA8A 4DR1H 3BVMA 1Q90A 4RA8A 3ERSX 4QUCA 5AJ3Q 5LMNQ 3KJOA 3S16H 2N49A 3QO2A 3I55A 4GC7A 3ULLA 2HCCA 2JE6I 5C3EG 2DNEA 4AQYQ 2P5ZX 1AUXA 1UC8A 1ZEQX 4HR7B 3UDFA 4BA2I 3OWFA 4JI8L 2N3SA 5KYLA 1XNQQ 1JWUD 2NVQB 3DEPA 2YU9A 1SEIA 3GV6A 1S10A 1P16A 3PO3G 4O4IF 2PW7A 5AJ3L 3CVZA 2R7FA 3NUCA 3KXYT 2UVWA 5D3DA 4HIOA 2K05A 2R82A 1LABA 2F3IA 1D8LA 2VXWA 4QMGA 1V8QA 5M3MG 3HKZE 3IL8A 3EPIA 1YJNA 1C30A 1BJTA 2R92B 4EBCA 1SE3A 3HOVH 1OO9B 3A8KE 2AUKA 4HMIA 3MC0B 1CSPA 5KFYA 1EWHA 1P8LA 4DR3H 4DL2A 5C4XH 2FMAA 5FJ8H 3LP8A 4ED8A 3EFXD 2ZXOA 1VMCA 4UHVA 3PVXA 2UUAL 4EQ5A 5CBEE 1Y8PB 1GUSA 3S1RH 4K5WA 2ENBA 2DY7A 1I4GA 1JOQA 3GTJB 4EGJA 1YNNC 3ZJYC 4OELB 2VR1A 3GTGB 2ICEC 4LFCH 5E3FA 4JI7H 3GTKA 1SAPA 3JAME 1FJGL 1XPOA 3LGJA 1KAWA 5ELFA 4B3TQ 4LF4Q 1Y1VA 3WWVA 5LHY1 3K5HA 2YZMA 5KNDA 4JPBW 3AEVA 4UCTA 2K33A 5CYUA 3R23A 3J81W 1NSNS 2JJQA 2LKVA 4IUPA 2AKWB 2YRWA 5EKLA 1CI3M 2DY8A 2BE5C 1EYCA 2O4XA 2A74C 3TZDA 4LF4L 3Q2OA 3E0EA 4XT3B 2JA7A 3HOXB 5IT9L 1VAJA 3VYRA 3HRZC 2JA6H 1EFWA 4MV4A 4R1JA 3L7ZC 2F4VH 2K01A 3K3VA 3H6MA 1IL2A 2DZDA 4I7AA 2PBZA 1S9FA 1S0NA 4NXMH 2NVXA 1HQMC 2Q8RE 4BY1B 2A1AA 4XYLB 2DPJA 1KBLA 4LF7H 4R8IA 3A5UA 3CCQA 4BY7G 4RGTA 4GKKL 1SN8A 4C3JH 4QW9A 5KFCA 3BZCA 5GROA 3MR5A 5D1OB 5KFUA 5KRUA 1SBBB 4DNTB 2W6OA 2XWJB 1VQBA 4L63B 4B08A 1R4PB 2A69C 3NWSA 2AMCB 1AE3A 4TUYF 4J9OA 3URYA 4DR2Q 5DLFA 4YWKA 1O7IA 4XDXA 2B3GA 5IIFA 3M3YH 1R4QB 3CCLA 2F0KA 4R4QA 4DK3C 3RLOA 5ELNA 5CBAE 4DK1A 4K0KL 2EY2A 3OHXC 1BKBA 2WE6A 3C1EA 2DWCA 4I7ZC 1JOKA 3HOYB 3QB3A 1SROA 5IY0A 1V4YA 2FMCA 4WFN3 4O42A 4GOPC 3D4RA 1WR2A 5D3IB 1QJOA 3AMUA 3S15B 1G6PA 3OHBA 5KG2A 3HKSA 5BR8Q 2YZNA 1QVCA 2XD4A 2JA6B 3BU2A 2GVBA 1PH7A 3HGBA 2W9CA 4O0AA 4MZ9A 1Q1EA 4DR7H 1JIHA 3TZUA 1DOLA 2OF1A 4OWTB 3R5XA 5EBCA 2C28A 2R8JA 1JC7A 1V1PB 2WDTA 1ILPA 1ET6A 3PUVA 4DUYQ 1GSOA 4KMUC 5EDWA 5KFTA 3IN5A 5KFBA 2EIFA 2BR0A 4OEMB 4JI8Q 4U6PA 5DGAA 5BR8L 3P20A 2V4RA 4ZI7F 4ECVA 1X32A 4GKJH 1TWGB 4YCWA 1H9KA 3MZ5A 5J2TF 4JI4L 5KG1A 1L0WA 2HD3A 1AUVA 2W8LA 4R4TA 4TRDA 3S1MH 1D5XC 1E7ZA 3J81i 1JDBB 2K50A 4DV5L 1FR3A 3GD7A 3IG0A 3M9MB 1AEXA 4DUYH 1M90C 5L37A 1E4EB 4L6TB 2V58A 4G57A 3S2HH 3M3YB 4GNXA 1Y8OB 3VA5A 1XNRL 4IOAA 3GQCA 2WINB 1EZ6A 4KKUA 4J9SA 1K83H 4DXGA 2EXZA 2KECA 2XWBB 3HFZB 3KF8A 1R9TH 5KFKA 4F4ZA 3QFFA 3K58A 5L9XA 2NVTB 5F9LA 2E2HB 2IX0A 1I3QA 5JQWA 5LMNH 1I4XA 4ED2A 1W2BA 1N8RC 4AYBA 4JYAH 2F4IA 1W3SA 1BO0A 1KEEA 4X62L 4A75A 2AU0A 1SNQA 4O4LF 4O3SA 4X3UA 5IP7H 1VQIA 1JQYD 1WCMB 4P75A 2NUAB 4LFBH 3V6KA 4IWYA 1V43A 1WTHA 5IYDG 1OTCA 3S1QH 4B3TL 4JV5Q 1ZHSA 2UVVA 1NNXA 4Q0YA 2JK8A 4ABNA 2UXDL 3ND9A 1L1OA 1RD9D 2QDLA 5FD6A 1RJPA 1UEBA 1GVPA 4FF3A 4IWXA 1UE7A 4HTHA 1I4HA 2VQEQ 3OOCA 3PUYA 4JV1A 4A4IA 4A2BA 1N34H 1Y14B 3G6JB 1KABA 4UCSA 4DR5H 4GC6A 4X65H 4DFAA 3G7LA 1KLGD 1I50B 3QG1A 3U4ZA 2YL2A 3VPBA 1GHKA 3MFGA 3I4OA 3I4NH 4L5RC 1W6KA 3PO2B 2E75C 4PNYA 2K5DA 4RHRA 2VQEL 1VQOA 2OTLA 1VQ9A 4HNTA 5KKNB 1ENFA 2NUCA 4K2LA 1ESRA 2J0TD 4XQQA 2KCTA 3PUXA 3J80L 4IFDG 2F0FA 2MFIA 2ZDHA 2B39A 1R9TB 4A3DH 4OIJA 3I56A 1ZETA 2HIVA 1BNZA 4ETSA 1L2FA 2A6ED 3M7GA 4ZQIA 2Q2IA 2EE1A 5E4WC 5C1PA 2F0SA 1UEAB 1G2SA 4LF6H 1F2ZA 2ZJQA 3RD4A 2J6SA 1YVCA 4GOPA 4A3FH 4AYBE 2N55A 4ULLA 2M00A 1IBKL 1WCMH 2RSOA 1PFNA 4HEDA 1PYSB 4PV1C 5NUCA 3AQQA 1X65A 2HT1A 2R93B 1GKHA 3BYTB 1E24A 5HBRB 1VQLA 1WYDA 1Y1VG 4YAJB 5HV6A 4A3GG 1PH6A 1MIUA 1GUGA 1U4RA 2RHQB 3HEJA 3Q22A 1AZPA 4F8MA 4QQBX 2PW5A 5GAGC 2F0TA 1IBKQ 3UFXB 5CV6A 2AQ1B 3IKJA 2MJ8A 5TSSA 1XMQL 1KXLA 3BA9A 4LF9H 4HJ5A 4CBVA 3GIPA 1Q46A 3OSOA 2IMWP 3M7NA 2VB2X 5FPRA 3I4NB 4QGUA 1LLRD 4BXXH 1S4ZA 1H95A 1D5ZC 1DXMA 1NAPA 3RLFA 3GIQA 1K0RA 4IZOA 4F4WA 4AIMA 1TY0A 3TRZA 1JWMD 3QR8A 4OGQC 3OTOH 3L0OA 4ZUJA 2FHTA 4GNXC 1BCPC 4IZ8A 3GV8B 2DN8A 1QB5D 3CW2C 4HCSA 4BY1H 4FS1A 3RAXA 4HCEA 1IBMQ 3SI8A 4AH6A 1E4GT 2X0SA 2XC9A 3GTJA 2F0JA 2YTYA 2F1MA 5C0XI 4A3JG 5A2QW 4NXMQ 5EPLA 1FJGQ 3GTKB 4L5QA 1VQFA 3Q23A 3WDNA 1MBYA 3GV5B 1CKOA 1J5EQ 3BABA 5EBDA 4R8UA 3H91A 2XN9C 2EZVA 4QWEA 4J15A 4UDUC 3K5IA 2K5HA 1TS5A 2JA6G 1X3PA 1J6QA 3MFYA 3GIIA 3AB9A 4IUUA 2L4NA 1A62A 3VYTA 2JSOA 2ZDGA 2KCCA 1STHA 3GQBA 4HSVA 4N9PA 1TWHA 1Z2NX 2UUBH 4LSAA 1EU4A 1D7QA 2PMZA 4X3KA 1BBXC 3S1NB 4IFDI 5CAEB 4X3SA 4MV6A 1WJJA 1TXYA 2Z4HA 4ED6A 4DL5A 3X3NA 4HN7A 5IODA 4DV2H 4K14A 3H3VI 2KEEA 4YR2A 4HJ7A 4Q8EA 3BJUA 4LFBQ 1JJCB 2AGQA 5EOYA 3UE1A 1QZHA 5IT9c 1G51A 2EYHA 1QWYA 4NPSA 4ILWA 1KJ8A 1HFGA 5G3LD 4JV5L 3EIVA 4LF7Q 4MTEA 5M3FH 2R7ZH 3KF6B 4FBTA 2F0NA 2F4VL 3S14B 3KLSX 1MD2D 2VOBA 4YWMA 1EYGA 4DR2L 1FL0A 2MHVA 3OMGA 1A2UA 2R92H 1QE6A 3SXHA 5BN3A 2W9BB 4FXKC 5A2QL 1CKMA 3HKZB 2QCPX 4RNOA 4DK0A 1CTMA 3J80c 4G7ZC 3WOFA 4E4TA 1HNXL 2EXDA 3K7AH 5EGTA 5IE8A 5LMUL 1TU2B 2R7DA 3HP3A 5I2XA 3M4OB 3D4WA 4Q43A 3GIJA 3I72A 4YR0A 4ZKBB 3K5LA 2HHHH 1X6OA 3OHAA 3S1RB 2ICIA 3LX0A 3S2HB 2V59A 2G5DA 3OSPA 2W70A 4RH6A 2JA5G 3I4LA 1YJWA 5A35A 2YRXA 3CCUA 3T5HA 4J6HA 1PRTC 4TQSA 1S5ED 4DGZA 4XTCS 2NVTH 2AGPA 1UAPA 2LFNA 3KDFA 2F0LA 2RF4A 1MSHA 1MJEA 5KFMA 2UU9L 1CQFA 1V1PA 1MZBA 2MQHA 1OWTA 4POGA 5DG8A 4GN4B 1STEA 2C2DA 5K36G 1YEZA 2Y0SE 2WAQG 1QCBD 2V9WA 1O7YA 4CJ0B 3ETHA 1UE1A 2OWOA 1KTKA 2FKLA 3QZ7A 4BWSC 2RHSB 2BDOA 1S5CD 2UU9Q 1U4MA 4DV5Q 1HHVA 2FLPA 5KIXA 4MN3A 2OXPA 4DR4H 4YHHQ 1SYFA 1RKNA 2PNHA 1KD1C 3MWEA 1XNRQ 1MHWC 2NU6B 2HQLA 3K7UC 2KCMA 2YU9H 3VYUA 5J3BA 4MAMA 1GO3E 4A3GH 3KF8B 4FF2A 5T1GA 4YJ2F 4JI4H 2C5CA 2B2WC 1B53A 3PIPA 2HVQA 3SHLA 4DV5H 1TWAB 1C4QA 4AYBB 1KAAA 4X62Q 4YHHL 1HNWH 3K57A 3JAML 1BUVT 1TQOA 3GTQH 2NVYA 4JI1L 3TDQA 3GLKA 3TINA 2UXBH 3CPFA 1YNJC 3DUZA 5K5PA 2VUMG 3TP6A 2E2HH 2F0PA 2R92G 4U7CA 5KX5F 4GS3A 3RZOH 3GTLB 2C35B 3A7AB 4RMFA 2VPQA 4WRDA 1F9SA 4JI1Q 4X64H 1H9RA 1K1QA 1E3PA 2IX1A 4FO2A 2BA1A 1KC7A 1SFOA 5L1KA 5IGCA 5KT6A 1VQ4A 3MR2A 1GM5A 2XGTA 4ZKCB 4K5VA 2IL8A 4L5SA 5C8YF 4EQOA 2K4KA 1EIFA 2I80A 5LMNW 2DLNA 1D5MC 4ODGA 1X55A 2R7NA 1LM0A 4X64Q 1S72A 2B29A 1B44D 1YNXA 1N34L 5CA0F 3NE5B 4J9PA 1TWFB 1YBYA 3NP8A 1O7LA 2LMCB 1BQQT 4M1UB 1QILA 4V0BA 4X6AH 2WACA 3KBXA 4GLVB 2XCLA 2E2IA 2JEGA 4DV0Q 3RV3A 5KT4A 1KL9A 3EJIA 5C4HA 4J9QA 3PF5A 4LF7L 4CKBA 3FMAA 1NE3A 4TV8F 1YZ6A 3E9IA 1E4FT 2ALYB 5DEHA 1BVSA 4GOPB 1V9PA 1KJIA 1D6EC 4K2KA 3TMEA 1KHIA 1XTDA 3VR3A 4X66Q 2DNCA 1SDFA 2CKZB 3MTSA 2R86A 3DWAA 2OH2A 1KRTA 2RSNA 3A56A 1HNXQ 2RDFA 5IGGA 1HA6A 2OQKA 5LMUQ 2R7ZG 4IHJF 1EFID 4A3MB 5DM63 2DIKA 3EVQA 4C56C 1L2ZA 3EYYA 3HB9A 3V2TA 5DLGA 4A3FB 4J9LA 1SYBA 4WJ4A 2C22A 1Y1WG 5EAYA 4X66L 4BBRG 3J7AV 1CUKA 3E5SA 4CJ1B 1F77A 5JJZA 2R93H 4AYBG 3EBEA 3FEWX 5M3MB 1JOOA 2NN6I 1HPCA 4FXGC 2MUYA 4K0KQ 5M9OA 4O2AF 2W7PA 1EEID 2L5TA 1KIXA 5DGBA 3LWBA 1A3UA 1E1OA 2F3WA 2F03A 3M4QA 5KYIA 1Y8NB 2VNUD 1KRSA 1O75A 2F0UA 4G7HC 3BS1A 1M0TA 4MA0A 3K81C 4DR7L 2F0DA 4C1NK 5M5WH 2DUDA 3KFUA 4OO1G 1G91A 2F0WA 1L0YB 4IJLA 2QYZA 4QWCA 3MXNB 2OTJA 1OXUA 4NXML 5C4ZA 1I4PA 1B70B 1Q3LA 4JBMA 5L1IA 1CT1D 2QEXA 1UUPA 1HQRD 4MIUA 2R7LA 1SMYD 5M3FB 4R8UB 5CR3A 3HOUG 1VQGA 1G6ZA 4QY7A 4IRCA 2HHHQ 2CQYA 2IJ0A 1A63A 3RGXA 4DU9A 5KT3A 1DOMA 1HZAA 5ELOA 3JAMc 1PLFA 1T5EA 1EEFD 4JI4Q 1TWHB 3Q24A 2GN5A 2I8CA 3I12A 4JUZA 3K5OA 2PNRC 2AWOA 2WAQB 1XNRH 3M4IA 3KALA 5J1ZA 2YZGA 4C3JG 1B6SA 2EJMA 3D31A 2RGVA 4RAZA 1K8OA 3J7A5 3UI2A 2F0IA 5I4DA 1K8AC 1HR0H 4CHTB 3A8JE 4DF7A 2UUBL 3I73A 4J9KA 2JEIA 4PZ6A 5CV5A 2VW9A 2W9AA 3OIPA 4ZAIA 2FJZA 4J9RA 1VF5C 2RQXA 5KFRA 1HNZL 4IURA 1LACA 4DUZH 1WD1A 3KF6A 3I91A 2XGPA 4A93H 4WBNF 1PX2A 1H9SB 1HUNA 4M9UA 1EY4A 4C2MH 4F87A 1VQ8A 1WD0A 4A3BB 4RZQA 4KTAA 2XIWA 5AFWA 3I2ZA 2Q8TA 3MAQA 4MV8A 1G2TA 3HKZA 2PO4A 2JA5H 3GTOA 4A3KH 1PZJD 3MXPA 1SNPA 4JBWA 5KT7A 2RVLA 4RHSA 3S14H 4DK6C 3RUPA 1EQTA 2SDFA 2L15A 3HS0C 2OEOA 2VUMB 3EA6A 3H4DA 3Q1KA 1CFMA 1K9MC 2J4XA 3STBD 1Y1WA 3F8TA 4LMYA 1TWHH 1TY2A 2EY6A 1JB3A 5LMUH 1N9WA 2DGYA 4ECWA 4O3QA 3D3RA 3R93A 2C9OA 2SNSA 1IW7C 1ZXTA 5KFVA 5COYA 1F2LA 1EHIA 5C44B 3H40A 4IUTA 1F2YA 2IT1A 5BPHA 2FINB 5GADC 4FP5D 1CQJB 3M85A 1RTNA 2EPBA 1N32H 5E7NA 3MXUA 4QWBA 3N40P 4DPGA 1ZYRC 3Q0AA 2IP4A 3HOUB 4R9WA 1H9JA 1KDAA 3RB6A 4KHPQ 3GTMA 2O5JC 4IFDJ 3MVVA 4QIWE 4JI5H 3FVQA 3KLWA 2NZ1D 2UXBQ 2E2IH 4ECUA 4LF5L 1NY4A 2UU9H 4JV0A 4IUNA 5ELCA 4WJ3M 4DV3Q 1S68A 3TP8A 4O2DA 4QCLA 1IL8A 3BVZA 4PMWA 5H80A 4JOIA 5LL6S 1Q1BA 2EYMA 2K14A 4DR4Q 3SGIA 4ME3A 1B3QA 3HZXA 1CKNB 2UXCL 1HZ9A 4A3EG 5F2DA 1VQ7A 3AU7A 2YS7A 4OWWB 1FD7D 3CC7A 2QF7A 1CQVA 2PPBC 4RGOS 1CS0A 1T36A 3P1HA 5ISRA 3JC66 4QIWA 2BH8A 1DOKA 1N33Q 2VUMH 2I87A 4DV3L 3R5FA 4BBRH 3SDZA 2FJ2A 5DNFA 4F50A 3Q8SB 3PIOA 4DR4L 1II3A 4DR7Q 4LWCA 5KFGA 4UY8C 1PRTF 3FKIB 2FB9A 4GKKH 2D0OA 2JEFA 4KI0A 1RF2D 4A3GB 5KFFA 1QUQB 4GLXA 2QILA 3ORRA 1LTAD 2YYAA 3TIGA 4RU9A 4DL7A 1VQ6A 3RR5A 1N33L 3K7AB 5J22A 3KLSA 2O2LD 2SEBD 3BAAA 3NQIA 3T1YH 4JV2A 3MEHA 5EJWA 3SEBA 1X9NA 3U58A 1IBML 1CA6A 2GVAA 4FVMA 4TKOB 1XX8A 5GAEC 4DNIA 3FRPB 1SFOB 4C3HB 2FFKB 4DV6H 4KY6A 3CCSA 1HTLD 5IYCH 2NYZD 4K5XA 1T3NA 3HOVG 1IZ6A 4DR1Q 1J5EL 4Q5VA 3I4MH 4IUQA 3DWQA 3HOWB 5I6WA 2NZOA 4YBZB 1JT8A 4DL6A 1XXGA 4DUZQ 2JYOA 4RGMA 1WTQA 1ASYA 2I5MX 4OL7A 1JXLA 2CQAA 2I07B 5KG4A 4X64L 2WIIB 4FYDA 4ZYSA 5K2MA 4EGQA 3M9NB 5HURA 4DNRB 5EWEA 3Q8RB 3KAJA 4HIDA 4YIJA 1JX4A 3S15H 3PO2G 3OUZA 4IRDA 5KEEA 3H0GB 3C1FA 4DV0L 2MO0A 4PG3A 3DF7A 3TS2A 3FP9A 2YTVA 3CPWA 2RBMA 2HVSA 2RCNA 5M5YH 1B50A 4OONA 3CF5A 5KFNA 1VQHA 4O4HF 1PTOB 1JB7A 3FKIH 1WH2A 5KG5A 4IPHA 2B2VA 1RIPA 1PZKD 3OTOL 3TQTA 2CW8A 4RB2C 4BBSH 4DR3Q 1L1OC 3KHHA 2YU9B 3S17H 2G9HD 4ZOLF 1FNUA 3OIQA 1K0SA 1FKAH 2RGRA 3BVGA 1JWSD 1C7YA 1I94L 1XYIA 5IGEA 5LYJF 3IFTA 3GTQA 2JA8B 4JC0A 1C9OA 1RYRA 1AFPA 2QEJC 3C3LA 4A3DB 3V05A 3IFDA 1SE2A 4OXPA 2XIGA 4C3HH 3RFCA
chains in the Genus database with same CATH topology
1QZGA 4LFBQ 1JJCB 1E1TA 1HJPA 1FVIA 2PQAB 5IP9H 4A3MG 3UE1A 1QZHA 1B8AA 1YHBA 5IT9c 1G51A 1VQMA 1LUZA 2VQFL 5C3EH 4NPSA 2NVQH 4R4IA 4A93G 1VQ5A 4DR6L 3HOWH 4JV5L 3EIVA 4IJHA 4BY1G 4XIGS 4LF7Q 3F2CA 1UWVA 1OXXK 2WP8J 5M3FH 3CCEA 3KF6B 2R7ZH 4IOCA 2F4VL 3G71A 4JYAL 2ZTCA 4JOIC 3HKZG 3CCVA 4YWMA 1EYGA 4DR2L 1FL0A 2Z6KC 3I4NG 3A0JA 3J7ZC 4JI0Q 2R92H 5C0XG 1CKMA 2VQFQ 4B3RQ 1NMGA 4JBJA 1XPRA 1Z47A 3J80c 4DR6Q 4LFBL 1HNXL 1V1QA 2ZTEA 2EXDA 4DV6Q 1I6HH 3K7AH 5LMUL 3PUWA 5IE8A 1YIJA 2E2JH 4KHPL 4DV2L 1NTGA 2R7DA 1SLJA 3KJPA 1G291 2LXJA 3CMAA 4OX9Q 3CXCA 2WAQE 2F4VQ 4LF5Q 1X6OA 1BBUA 3PV0A 5JEAJ 3G4SA 2MNAA 2YTXA 2CWAA 1X3FA 1PHJA 3U4VA 2JA5G 4B3MQ 1LTLA 2VZAA 1YJWA 4GKKQ 4HIMA 4DR5L 2UXCQ 1TWFH 2LSSA 1VCIA 3CCUA 4UP9A 3W1BA 2WFWA 1AH9A 4XTCS 2NVTH 4JI5L 3U50C 1E22A 1L1OB 5DLQE 1C0AA 3KDFA 2UXDQ 2ZTDA 3CCRA 2RF4A 1U5KA 1HZCA 3A5ZB 3STBC 1MJEA 2NZHA 3HOYH 1DGSA 4P73A 2UU9L 1VQNA 2MQHA 4POGA 4GN4B 3AFPA 4NB3A 1OXTA 1Q81C 4YCVA 5K36G 1Y1VH 3CD6A 1YEZA 2Y0SE 3PSIA 4IPDA 2WAQG 1PV4A 3GTKH 2I5LX 4LFCQ 3M4PA 1YHAA 1UE1A 1VQEA 3PUZA 1SE8A 1VQDA 2OWOA 1RL2A 4JI5Q 4YCUA 4DV4Q 3DLLA 2RHSB 1K8GA 1UE6A 3UDGA 1EWIA 4A3DG 1PH2A 2UU9Q 4JG2A 4A3KG 4DV5Q 1LYLA 2ID0A 5C4XG 5C0XJ 1TWCH 5IYBH 2BA0A 2D62A 2KHIA 3GDEA 1JMCA 2WB1G 4YHHQ 4OWXB 1XPUA 2PNHA 1KD1C 2JA7H 1XNRQ 4MTNA 2HQLA 3K7UC 2KCMA 4PZ8A 4DV7Q 4A3FG 2YU9H 1PYBA 1PVOA 2VY3A 5J3BA 1PH9A 1GO3E 3D0FA 3KF8B 4A3GH 3ERSX 5AJ3Q 4YY3L 5LMNQ 3PIPA 1HH2P 1WFQA 3KJOA 1PH3A 2N49A 3S16H 3I55A 3M4OH 3ULLA 4EX5A 2JE6I 4KLKA 3T1YL 4DUZL 4OO1I 5C3EG 1EOVA 2K5NA 2I5HA 4X62Q 4YHHL 4AQYQ 3GTOH 5JJLA 3GTQH 3UDFA 2VL6A 5M5XH 4BA2I 4JI1L 4JI8L 2N3SA 1XNQQ 4DV7L 3DM3A 3G6EA 5IYCG 3RN5A 2UUCL 4NXNQ 3CPFA 4R4OA 1P16A 3PO3G 5AJ3L 5IWAL 2R7FA 1K73C 1KC8C 4A3CG 3B6YA 2VUMG 2E2HH 4HIOA 1JJ2A 2F3IA 2R92G 1D8LA 3T1YQ 5LMNL 1Z9FA 4GS3A 5IP7G 3HOXH 3CC4A 1FGUA 5M3MG 3HKZE 4GN3B 3RZOH 2C35B 4RMFA 1YJNA 5FLMG 3J80i 4JI1Q 1VQKA 1N34Q 3HOVH 1M1KC 1E3PA 2IX1A 1JE5A 2BA1A 2UUCQ 1EUJA 1CSPA 3OYYA 5JEAG 4BA1I 1P8LA 2KBNA 1VQ4A 5C4XH 1N32Q 5FJ8H 1GM5A 1I3QH 2XGTA 4RG1A 3K0XA 3PCOB 4TQUS 1B7YB 1HNWL 4L5SA 1YITA 2OQ0A 5H1SE 5GQOA 4BY7H 2UUAL 4EQ5A 2K4KA 1Q7YC 1EIFA 1I94Q 4R4CA 3TS0A 5LMNW 3S1RH 1HR0Q 2UXBL 1X55A 2QGQA 1LM0A 2PI2E 2PMZE 4X64Q 5HGQA 3JAMi 4IO9A 3ULPA 2B29A 1YNXA 3KOJA 1XJVA 1S72A 1N34L 4A3LH 1YBYA 3ZJYC 1N32L 4X6AH 1OXSC 3F2BA 1SFOH 4GLVB 4GNXB 4DV0Q 1XPOA 1FJGL 2D0PA 1VQAA 1KAWA 1HZBA 3LGJA 1KL9A 1PFSA 4B3TQ 4LF4Q 1TWGH 3WWVA 2Z0SA 4A3JH 3PF5A 4JCVE 4LF7L 1VQJA 2E5LL 3AEVA 2Q2TA 1NE3A 4JYAQ 1YZ6A 3E9IA 2ALYB 1BVSA 4GOPB 4A3IH 2IHFA 1PH4A 1V9PA 2JA8H 2JJQA 1WI5A 2AKWB 2F52A 3K80C 1KHIA 1XTDA 4X66Q 2CKZB 3HOXG 1KRTA 2IHEA 3BZKA 1X3EA 4LF4L 1QVGA 1HNXQ 3E0EA 3H0GH 2E8GA 2OQKA 5LMUQ 4B3SL 2R7ZG 1X3GA 3HOZG 3GTLH 4LF6L 2JA6H 1EFWA 2IY5B 4R1JA 3L7ZC 3OW2A 4WJ4A 1IL2A 1PH8A 1Y1WG 1EIYB 2A1AA 4HJ9A 5EAYA 4X66L 1CSQA 4BBRG 3A74A 1X56A 1CUKA 4BXXG 1UE5A 3A5UA 3CCQA 4BY7G 4B3ML 2JQOA 1A0IA 4GKKL 2R93H 1SN8A 4AYBG 4C3JH 4B3SQ 3EBEA 3W1GA 3BZCA 5GROA 2NN6I 1EQRA 5GAHC 3GTMH 4K0KQ 1TWAH 1VQBA 3H15A 1KIXA 3TREA 2KHJA 1E1OA 1WCMG 3M4QA 4A3EH 2Q2UA 2AMCB 1AE3A 2VNUD 1KRSA 4Y52H 2HHHL 4A3CH 2HIXA 4DR2Q 3T1HQ 4YWKA 2ZJRA 3K81C 4LF8L 3GTGH 4DR7L 1O7IA 5HY6A 1VQPA 1YJ9A 2B3GA 1EQQA 5M5WH 3M3YH 3CCLA 2DUDA 4PZ7A 3ULJA 3KFUA 4OO1G 3I7FA 4R4QA 4IJLA 4DK3C 4A3BH 1VS0A 3MXNB 2OTJA 1OXUA 4DV6L 4NXML 3RLOA 4Y7NH 4H02A 1B70B 3FHWA 5ELNA 4DV2Q 4JBMA 2QEXA 3HOYG 1CKNA 4K0KL 4OX9L 1BKBA 5JJIA 4DV1L 5C4JH 1YI2A 3PO2H 1S40A 3HOUG 1VQGA 1SROA 4QY7A 2N8NA 4YWLA 5IY0A 3H0GG 1HR0W 2HHHQ 3E9HA 4GOPC 3T1HL 3NELA 1A63A 3H3VH 1HZAA 5ELOA 1G6PA 2UUBQ 1X54A 3HKSA 3UDXA 5BR8Q 3JAMc 3OTOQ 4JI4Q 3TEHB 3I4MG 1QVCA 2GN5A 4A3MH 3BU2A 2GVBA 1PH7A 1I5FA 3NEMA 4O0AA 4P72A 2AWOA 4HIKA 4MZ9A 1Q1EA 1HNZQ 3PF4A 4DV1Q 4OWTB 1QUQA 1IXRA 1Q82C 3PO3H 3PUVA 5IYDH 4DUYQ 4POFA 5IP9G 2VS1A 3D31A 2EIFA 2QA4A 1Q8KA 4JI8Q 5BR8L 3J7A5 5M3MH 1K8AC 2B63H 2PQAA 2NVYH 2UUBL 4YCWA 1YHQA 4PZ6A 5IWAQ 4JI4L 2CCZA 1L0WA 2VW9A 2JA8G 2YYZA 1S3OA 4R4TA 3ER0A 4QL5A 3F2DA 4LUOA 3S1MH 3J81i 1E7ZA 1VQCA 1HNZL 2K50A 4DV5L 3TQYA 3KF6A 3GD7A 1M90C 4A93H 1Q12A 3S2HH 2AHOB 4GNXA 4A76A 1IBLQ 3IRBA 4BBSG 4C2MH 1VQ8A 1XNRL 2ATWA 4IOAA 2V1CC 3I2ZA 3F1ZA 2NVXH 1K83H 2FXQA 3HFZB 1R9TH 2Q2HA 2JA5H 4JI6L 4A3KH 3FKIG 4JBWA 2IX0A 3S14H 1W2BA 4DK6C 5FLMH 1N8RC 1KQSA 4X65L 1HR0L 2L15A 1W3SA 3NBHB 4X62L 3KYHC 3CMEA 4A75A 4AQYL 2JA7G 3CCMA 4ALPA 1K9MC 1OXVA 1XNQL 3STBD 5IP7H 1IBLL 3CC2A 3F8TA 1TWHH 1VQIA 1GD7A 4P75A 2ES2A 4LUZA 3G48A 1V43A 4MNOA 5IYDG 1OTCA 4JBKA 3S1QH 4B3TL 4LNQA 1N9WA 2DGYA 3CP0A 3PGZA 4JV5Q 3VDYA 2JK8A 2UXDL 4DKAC 1L1OA 1UEBA 1GVPA 4JI3Q 1UE7A 3S24A 2UXCL 4X65Q 2IT1A 2VQEQ 3PUYA 2EQSA 4A4IA 3HOZH 5C44G 5GADC 1Y14B 3RLNA 2YV5A 1NBWA 3M85A 5JJKA 1A8VA 2KENA 2XTIA 5E7NA 4LFCL 4B3RL 4DPGA 3CCJA 3Q8DA 3U4ZA 1PH1A 4KHPQ 1T9HA 3MEFA 1QVFA 3I4OA 4IPGA 4QIWE 4L5RC 3I4NH 4GLAC 1SMXA 3KLWA 2UUAQ 3S1NH 1ASZA 2JEAI 2UXBQ 2VQEL 1VQOA 2E2IH 4LF5L 1NY4A 2OTLA 3CAMA 1VQ9A 4JI3L 4WJ3M 4DV3Q 2JEBI 4O2DA 4PMWA 2KCTA 3PUXA 1PH5A 4JOIA 4IFDG 2MFIA 1Q1BA 2K75A 2K14A 4A3DH 4LFAQ 4DR4Q 3I56A 3K8AA 1K3RA 4ME3A 2HIVA 1CKNB 2Z6KA 1HZ9A 1L2FA 1MKHA 3SGIA 3L2PA 4DR5Q 4A3EG 1VQ7A 4OWWB 4A3LG 2Q2IA 1NMFA 4JI2Q 3CC7A 2CFMA 2MO1A 5IYBG 4IFDJ 4L5TA 4DAYB 1WOCA 3JC66 4APVA 4LF9L 2BH8A 2ZJQA 1N33Q 2VUMH 4P71A 1YVCA 1Q86C 4A3BG 4DV3L 2B63G 4GOPA 4BBRH 1NJIC 4A3FH 3ICEA 4AYBE 2I0QA 3PIOA 4LFAL 1IBKL 1WCMH 4LF8Q 1SR3A 4LWCA 4DR4L 2NN6G 4UY8C 4DR7Q 1PYSB 4KHZA 3AQQA 1X65A 2R6GA 5FLXc 2HT1A 2D0OA 4JI2L 4NXNL 4KI0A 1QUQB 1GKHA 4GLXA 4HJ7A 3M9BA 4DR1L 2K52A 3J81j 1E24A 4DV4L 1VQ6A 4UP7A 3RR5A 1VQLA 1N33L 1WYDA 1Y1VG 5C44H 4A3GG 1PH6A 1MIUA 2RHQB 3W5OA 2A8VA 4LF9Q 1N36Q 4QQBX 5GAGC 4C3IH 1IBKQ 1X9NA 2LXKA 3GO5A 3U58A 3KDFB 1KXLA 1XMQL 1IBML 2GVAA 1BBWA 5FJ8G 5GAEC 1Y1WH 4DNIA 3HOUH 1SRUA 4HJ5A 4TVAB 1I50H 1Q46A 3M7NA 1JJGA 3CCSA 4QGUA 4LUVA 5IYCH 4UPAA 4BXXH 1H95A 4FDBA 2K5VA 1HNWQ 3HOVG 3RLFA 1IZ6A 4YY3Q 4GN5A 4DR1Q 1J5EL 1K0RA 1IYJB 3I4MH 4AIMA 1N36L 3TRZA 2CQOA 2NZOA 1AE2A 1XMOQ 1JT8A 3L0OA 4DUZQ 4GNXC 2ZM6Q 3RNUA 1ASYA 2I5MX 3AFQA 3RN2A 1PA6A 3HOWG 4HJAA 2Y0SG 3CW2C 4X64L 4BY1H 1MJCA 5M3FG 1XMQQ 1IBMQ 4A3IG 4AH6A 4HIDA 2JA9A 1U0LA 2YTYA 5C0XI 3AYHB 3J81c 4A3JG 2ASBA 4DR3L 4NXMQ 3S15H 3PO2G 4DV0L 1FJGQ 2H5XA 2MO0A 4PG3A 4JI7Q 4L5QA 1VQFA 3TS2A 3FP9A 3GTPH 2YTVA 3CPWA 1XMOL 1CKOA 2E5LQ 1J5EQ 2ZM6L 2WB1E 2RCNA 4HJ8A 4J15A 5M5YH 2K5HA 2AWNA 4OONA 2JA6G 4QJFA 1J6QA 3CF5A 1VQHA 4P74A 1JB7A 3FKIH 3GTJH 1A62A 4UP8A 4IPHA 1RIPA 4DAMA 3EN2A 3OTOL 4GKJL 4JI7L 2N78A 3UE0A 1D7QA 2OCEA 4BBSH 3RZDH 2PI2A 4DR3Q 1L1OC 4JI6Q 4IFDI 3UDIA 3S17H 3S2DH 3CQZH 2CWPA 2ZJPA 4LF6Q 1WJJA 4IPCA 1C7YA 1I94L 1TXYA 4LW1A 4DUYL 4JC0A 1C9OA 2BH2A 4JI0L 3NENA 3H3VI 2R93G 4OXPA 2A19A 4C3HH 3BJUA 4GKJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZG A;  4LFB Q;  1JJC B;  1E1T A;  1HJP A;  1FVI A;  2PQA B;  5IP9 H;  4A3M G;  3UE1 A;  1QZH A;  1B8A A;  1YHB A;  5IT9 c;  1G51 A;  1VQM A;  1LUZ A;  2VQF L;  5C3E H;  4NPS A;  2NVQ H;  4R4I A;  4A93 G;  1VQ5 A;  4DR6 L;  3HOW H;  4JV5 L;  3EIV A;  4IJH A;  4BY1 G;  4XIG S;  4LF7 Q;  3F2C A;  1UWV A;  1OXX K;  2WP8 J;  5M3F H;  3CCE A;  3KF6 B;  2R7Z H;  4IOC A;  2F4V L;  3G71 A;  4JYA L;  2ZTC A;  4JOI C;  3HKZ G;  3CCV A;  4YWM A;  1EYG A;  4DR2 L;  1FL0 A;  2Z6K C;  3I4N G;  3A0J A;  3J7Z C;  4JI0 Q;  2R92 H;  5C0X G;  1CKM A;  2VQF Q;  4B3R Q;  1NMG A;  4JBJ A;  1XPR A;  1Z47 A;  3J80 c;  4DR6 Q;  4LFB L;  1HNX L;  1V1Q A;  2ZTE A;  2EXD A;  4DV6 Q;  1I6H H;  3K7A H;  5LMU L;  3PUW A;  5IE8 A;  1YIJ A;  2E2J H;  4KHP L;  4DV2 L;  1NTG A;  2R7D A;  1SLJ A;  3KJP A;  1G29 1;  2LXJ A;  3CMA A;  4OX9 Q;  3CXC A;  2WAQ E;  2F4V Q;  4LF5 Q;  1X6O A;  1BBU A;  3PV0 A;  5JEA J;  3G4S A;  2MNA A;  2YTX A;  2CWA A;  1X3F A;  1PHJ A;  3U4V A;  2JA5 G;  4B3M Q;  1LTL A;  2VZA A;  1YJW A;  4GKK Q;  4HIM A;  4DR5 L;  2UXC Q;  1TWF H;  2LSS A;  1VCI A;  3CCU A;  4UP9 A;  3W1B A;  2WFW A;  1AH9 A;  4XTC S;  2NVT H;  4JI5 L;  3U50 C;  1E22 A;  1L1O B;  5DLQ E;  1C0A A;  3KDF A;  2UXD Q;  2ZTD A;  3CCR A;  2RF4 A;  1U5K A;  1HZC A;  3A5Z B;  3STB C;  1MJE A;  2NZH A;  3HOY H;  1DGS A;  4P73 A;  2UU9 L;  1VQN A;  2MQH A;  4POG A;  4GN4 B;  3AFP A;  4NB3 A;  1OXT A;  1Q81 C;  4YCV A;  5K36 G;  1Y1V H;  3CD6 A;  1YEZ A;  2Y0S E;  3PSI A;  4IPD A;  2WAQ G;  1PV4 A;  3GTK H;  2I5L X;  4LFC Q;  3M4P A;  1YHA A;  1UE1 A;  1VQE A;  3PUZ A;  1SE8 A;  1VQD A;  2OWO A;  1RL2 A;  4JI5 Q;  4YCU A;  4DV4 Q;  3DLL A;  2RHS B;  1K8G A;  1UE6 A;  3UDG A;  1EWI A;  4A3D G;  1PH2 A;  2UU9 Q;  4JG2 A;  4A3K G;  4DV5 Q;  1LYL A;  2ID0 A;  5C4X G;  5C0X J;  1TWC H;  5IYB H;  2BA0 A;  2D62 A;  2KHI A;  3GDE A;  1JMC A;  2WB1 G;  4YHH Q;  4OWX B;  1XPU A;  2PNH A;  1KD1 C;  2JA7 H;  1XNR Q;  4MTN A;  2HQL A;  3K7U C;  2KCM A;  4PZ8 A;  4DV7 Q;  4A3F G;  2YU9 H;  1PYB A;  1PVO A;  2VY3 A;  5J3B A;  1PH9 A;  1GO3 E;  3D0F A;  3KF8 B;  4A3G H;  3ERS X;  5AJ3 Q;  4YY3 L;  5LMN Q;  3PIP A;  1HH2 P;  1WFQ A;  3KJO A;  1PH3 A;  2N49 A;  3S16 H;  3I55 A;  3M4O H;  3ULL A;  4EX5 A;  2JE6 I;  4KLK A;  3T1Y L;  4DUZ L;  4OO1 I;  5C3E G;  1EOV A;  2K5N A;  2I5H A;  4X62 Q;  4YHH L;  4AQY Q;  3GTO H;  5JJL A;  3GTQ H;  3UDF A;  2VL6 A;  5M5X H;  4BA2 I;  4JI1 L;  4JI8 L;  2N3S A;  1XNQ Q;  4DV7 L;  3DM3 A;  3G6E A;  5IYC G;  3RN5 A;  2UUC L;  4NXN Q;  3CPF A;  4R4O A;  1P16 A;  3PO3 G;  5AJ3 L;  5IWA L;  2R7F A;  1K73 C;  1KC8 C;  4A3C G;  3B6Y A;  2VUM G;  2E2H H;  4HIO A;  1JJ2 A;  2F3I A;  2R92 G;  1D8L A;  3T1Y Q;  5LMN L;  1Z9F A;  4GS3 A;  5IP7 G;  3HOX H;  3CC4 A;  1FGU A;  5M3M G;  3HKZ E;  4GN3 B;  3RZO H;  2C35 B;  4RMF A;  1YJN A;  5FLM G;  3J80 i;  4JI1 Q;  1VQK A;  1N34 Q;  3HOV H;  1M1K C;  1E3P A;  2IX1 A;  1JE5 A;  2BA1 A;  2UUC Q;  1EUJ A;  1CSP A;  3OYY A;  5JEA G;  4BA1 I;  1P8L A;  2KBN A;  1VQ4 A;  5C4X H;  1N32 Q;  5FJ8 H;  1GM5 A;  1I3Q H;  2XGT A;  4RG1 A;  3K0X A;  3PCO B;  4TQU S;  1B7Y B;  1HNW L;  4L5S A;  1YIT A;  2OQ0 A;  5H1S E;  5GQO A;  4BY7 H;  2UUA L;  4EQ5 A;  2K4K A;  1Q7Y C;  1EIF A;  1I94 Q;  4R4C A;  3TS0 A;  5LMN W;  3S1R H;  1HR0 Q;  2UXB L;  1X55 A;  2QGQ A;  1LM0 A;  2PI2 E;  2PMZ E;  4X64 Q;  5HGQ A;  3JAM i;  4IO9 A;  3ULP A;  2B29 A;  1YNX A;  3KOJ A;  1XJV A;  1S72 A;  1N34 L;  4A3L H;  1YBY A;  3ZJY C;  1N32 L;  4X6A H;  1OXS C;  3F2B A;  1SFO H;  4GLV B;  4GNX B;  4DV0 Q;  1XPO A;  1FJG L;  2D0P A;  1VQA A;  1KAW A;  1HZB A;  3LGJ A;  1KL9 A;  1PFS A;  4B3T Q;  4LF4 Q;  1TWG H;  3WWV A;  2Z0S A;  4A3J H;  3PF5 A;  4JCV E;  4LF7 L;  1VQJ A;  2E5L L;  3AEV A;  2Q2T A;  1NE3 A;  4JYA Q;  1YZ6 A;  3E9I A;  2ALY B;  1BVS A;  4GOP B;  4A3I H;  2IHF A;  1PH4 A;  1V9P A;  2JA8 H;  2JJQ A;  1WI5 A;  2AKW B;  2F52 A;  3K80 C;  1KHI A;  1XTD A;  4X66 Q;  2CKZ B;  3HOX G;  1KRT A;  2IHE A;  3BZK A;  1X3E A;  4LF4 L;  1QVG A;  1HNX Q;  3E0E A;  3H0G H;  2E8G A;  2OQK A;  5LMU Q;  4B3S L;  2R7Z G;  1X3G A;  3HOZ G;  3GTL H;  4LF6 L;  2JA6 H;  1EFW A;  2IY5 B;  4R1J A;  3L7Z C;  3OW2 A;  4WJ4 A;  1IL2 A;  1PH8 A;  1Y1W G;  1EIY B;  2A1A A;  4HJ9 A;  5EAY A;  4X66 L;  1CSQ A;  4BBR G;  3A74 A;  1X56 A;  1CUK A;  4BXX G;  1UE5 A;  3A5U A;  3CCQ A;  4BY7 G;  4B3M L;  2JQO A;  1A0I A;  4GKK L;  2R93 H;  1SN8 A;  4AYB G;  4C3J H;  4B3S Q;  3EBE A;  3W1G A;  3BZC A;  5GRO A;  2NN6 I;  1EQR A;  5GAH C;  3GTM H;  4K0K Q;  1TWA H;  1VQB A;  3H15 A;  1KIX A;  3TRE A;  2KHJ A;  1E1O A;  1WCM G;  3M4Q A;  4A3E H;  2Q2U A;  2AMC B;  1AE3 A;  2VNU D;  1KRS A;  4Y52 H;  2HHH L;  4A3C H;  2HIX A;  4DR2 Q;  3T1H Q;  4YWK A;  2ZJR A;  3K81 C;  4LF8 L;  3GTG H;  4DR7 L;  1O7I A;  5HY6 A;  1VQP A;  1YJ9 A;  2B3G A;  1EQQ A;  5M5W H;  3M3Y H;  3CCL A;  2DUD A;  4PZ7 A;  3ULJ A;  3KFU A;  4OO1 G;  3I7F A;  4R4Q A;  4IJL A;  4DK3 C;  4A3B H;  1VS0 A;  3MXN B;  2OTJ A;  1OXU A;  4DV6 L;  4NXM L;  3RLO A;  4Y7N H;  4H02 A;  1B70 B;  3FHW A;  5ELN A;  4DV2 Q;  4JBM A;  2QEX A;  3HOY G;  1CKN A;  4K0K L;  4OX9 L;  1BKB A;  5JJI A;  4DV1 L;  5C4J H;  1YI2 A;  3PO2 H;  1S40 A;  3HOU G;  1VQG A;  1SRO A;  4QY7 A;  2N8N A;  4YWL A;  5IY0 A;  3H0G G;  1HR0 W;  2HHH Q;  3E9H A;  4GOP C;  3T1H L;  3NEL A;  1A63 A;  3H3V H;  1HZA A;  5ELO A;  1G6P A;  2UUB Q;  1X54 A;  3HKS A;  3UDX A;  5BR8 Q;  3JAM c;  3OTO Q;  4JI4 Q;  3TEH B;  3I4M G;  1QVC A;  2GN5 A;  4A3M H;  3BU2 A;  2GVB A;  1PH7 A;  1I5F A;  3NEM A;  4O0A A;  4P72 A;  2AWO A;  4HIK A;  4MZ9 A;  1Q1E A;  1HNZ Q;  3PF4 A;  4DV1 Q;  4OWT B;  1QUQ A;  1IXR A;  1Q82 C;  3PO3 H;  3PUV A;  5IYD H;  4DUY Q;  4POF A;  5IP9 G;  2VS1 A;  3D31 A;  2EIF A;  2QA4 A;  1Q8K A;  4JI8 Q;  5BR8 L;  3J7A 5;  5M3M H;  1K8A C;  2B63 H;  2PQA A;  2NVY H;  2UUB L;  4YCW A;  1YHQ A;  4PZ6 A;  5IWA Q;  4JI4 L;  2CCZ A;  1L0W A;  2VW9 A;  2JA8 G;  2YYZ A;  1S3O A;  4R4T A;  3ER0 A;  4QL5 A;  3F2D A;  4LUO A;  3S1M H;  3J81 i;  1E7Z A;  1VQC A;  1HNZ L;  2K50 A;  4DV5 L;  3TQY A;  3KF6 A;  3GD7 A;  1M90 C;  4A93 H;  1Q12 A;  3S2H H;  2AHO B;  4GNX A;  4A76 A;  1IBL Q;  3IRB A;  4BBS G;  4C2M H;  1VQ8 A;  1XNR L;  2ATW A;  4IOA A;  2V1C C;  3I2Z A;  3F1Z A;  2NVX H;  1K83 H;  2FXQ A;  3HFZ B;  1R9T H;  2Q2H A;  2JA5 H;  4JI6 L;  4A3K H;  3FKI G;  4JBW A;  2IX0 A;  3S14 H;  1W2B A;  4DK6 C;  5FLM H;  1N8R C;  1KQS A;  4X65 L;  1HR0 L;  2L15 A;  1W3S A;  3NBH B;  4X62 L;  3KYH C;  3CME A;  4A75 A;  4AQY L;  2JA7 G;  3CCM A;  4ALP A;  1K9M C;  1OXV A;  1XNQ L;  3STB D;  5IP7 H;  1IBL L;  3CC2 A;  3F8T A;  1TWH H;  1VQI A;  1GD7 A;  4P75 A;  2ES2 A;  4LUZ A;  3G48 A;  1V43 A;  4MNO A;  5IYD G;  1OTC A;  4JBK A;  3S1Q H;  4B3T L;  4LNQ A;  1N9W A;  2DGY A;  3CP0 A;  3PGZ A;  4JV5 Q;  3VDY A;  2JK8 A;  2UXD L;  4DKA C;  1L1O A;  1UEB A;  1GVP A;  4JI3 Q;  1UE7 A;  3S24 A;  2UXC L;  4X65 Q;  2IT1 A;  2VQE Q;  3PUY A;  2EQS A;  4A4I A;  3HOZ H;  5C44 G;  5GAD C;  1Y14 B;  3RLN A;  2YV5 A;  1NBW A;  3M85 A;  5JJK A;  1A8V A;  2KEN A;  2XTI A;  5E7N A;  4LFC L;  4B3R L;  4DPG A;  3CCJ A;  3Q8D A;  3U4Z A;  1PH1 A;  4KHP Q;  1T9H A;  3MEF A;  1QVF A;  3I4O A;  4IPG A;  4QIW E;  4L5R C;  3I4N H;  4GLA C;  1SMX A;  3KLW A;  2UUA Q;  3S1N H;  1ASZ A;  2JEA I;  2UXB Q;  2VQE L;  1VQO A;  2E2I H;  4LF5 L;  1NY4 A;  2OTL A;  3CAM A;  1VQ9 A;  4JI3 L;  4WJ3 M;  4DV3 Q;  2JEB I;  4O2D A;  4PMW A;  2KCT A;  3PUX A;  1PH5 A;  4JOI A;  4IFD G;  2MFI A;  1Q1B A;  2K75 A;  2K14 A;  4A3D H;  4LFA Q;  4DR4 Q;  3I56 A;  3K8A A;  1K3R A;  4ME3 A;  2HIV A;  1CKN B;  2Z6K A;  1HZ9 A;  1L2F A;  1MKH A;  3SGI A;  3L2P A;  4DR5 Q;  4A3E G;  1VQ7 A;  4OWW B;  4A3L G;  2Q2I A;  1NMF A;  4JI2 Q;  3CC7 A;  2CFM A;  2MO1 A;  5IYB G;  4IFD J;  4L5T A;  4DAY B;  1WOC A;  3JC6 6;  4APV A;  4LF9 L;  2BH8 A;  2ZJQ A;  1N33 Q;  2VUM H;  4P71 A;  1YVC A;  1Q86 C;  4A3B G;  4DV3 L;  2B63 G;  4GOP A;  4BBR H;  1NJI C;  4A3F H;  3ICE A;  4AYB E;  2I0Q A;  3PIO A;  4LFA L;  1IBK L;  1WCM H;  4LF8 Q;  1SR3 A;  4LWC A;  4DR4 L;  2NN6 G;  4UY8 C;  4DR7 Q;  1PYS B;  4KHZ A;  3AQQ A;  1X65 A;  2R6G A;  5FLX c;  2HT1 A;  2D0O A;  4JI2 L;  4NXN L;  4KI0 A;  1QUQ B;  1GKH A;  4GLX A;  4HJ7 A;  3M9B A;  4DR1 L;  2K52 A;  3J81 j;  1E24 A;  4DV4 L;  1VQ6 A;  4UP7 A;  3RR5 A;  1VQL A;  1N33 L;  1WYD A;  1Y1V G;  5C44 H;  4A3G G;  1PH6 A;  1MIU A;  2RHQ B;  3W5O A;  2A8V A;  4LF9 Q;  1N36 Q;  4QQB X;  5GAG C;  4C3I H;  1IBK Q;  1X9N A;  2LXK A;  3GO5 A;  3U58 A;  3KDF B;  1KXL A;  1XMQ L;  1IBM L;  2GVA A;  1BBW A;  5FJ8 G;  5GAE C;  1Y1W H;  4DNI A;  3HOU H;  1SRU A;  4HJ5 A;  4TVA B;  1I50 H;  1Q46 A;  3M7N A;  1JJG A;  3CCS A;  4QGU A;  4LUV A;  5IYC H;  4UPA A;  4BXX H;  1H95 A;  4FDB A;  2K5V A;  1HNW Q;  3HOV G;  3RLF A;  1IZ6 A;  4YY3 Q;  4GN5 A;  4DR1 Q;  1J5E L;  1K0R A;  1IYJ B;  3I4M H;  4AIM A;  1N36 L;  3TRZ A;  2CQO A;  2NZO A;  1AE2 A;  1XMO Q;  1JT8 A;  3L0O A;  4DUZ Q;  4GNX C;  2ZM6 Q;  3RNU A;  1ASY A;  2I5M X;  3AFQ A;  3RN2 A;  1PA6 A;  3HOW G;  4HJA A;  2Y0S G;  3CW2 C;  4X64 L;  4BY1 H;  1MJC A;  5M3F G;  1XMQ Q;  1IBM Q;  4A3I G;  4AH6 A;  4HID A;  2JA9 A;  1U0L A;  2YTY A;  5C0X I;  3AYH B;  3J81 c;  4A3J G;  2ASB A;  4DR3 L;  4NXM Q;  3S15 H;  3PO2 G;  4DV0 L;  1FJG Q;  2H5X A;  2MO0 A;  4PG3 A;  4JI7 Q;  4L5Q A;  1VQF A;  3TS2 A;  3FP9 A;  3GTP H;  2YTV A;  3CPW A;  1XMO L;  1CKO A;  2E5L Q;  1J5E Q;  2ZM6 L;  2WB1 E;  2RCN A;  4HJ8 A;  4J15 A;  5M5Y H;  2K5H A;  2AWN A;  4OON A;  2JA6 G;  4QJF A;  1J6Q A;  3CF5 A;  1VQH A;  4P74 A;  1JB7 A;  3FKI H;  3GTJ H;  1A62 A;  4UP8 A;  4IPH A;  1RIP A;  4DAM A;  3EN2 A;  3OTO L;  4GKJ L;  4JI7 L;  2N78 A;  3UE0 A;  1D7Q A;  2OCE A;  4BBS H;  3RZD H;  2PI2 A;  4DR3 Q;  1L1O C;  4JI6 Q;  4IFD I;  3UDI A;  3S17 H;  3S2D H;  3CQZ H;  2CWP A;  2ZJP A;  4LF6 Q;  1WJJ A;  4IPC A;  1C7Y A;  1I94 L;  1TXY A;  4LW1 A;  4DUY L;  4JC0 A;  1C9O A;  2BH2 A;  4JI0 L;  3NEN A;  3H3V I;  2R93 G;  4OXP A;  2A19 A;  4C3H H;  3BJU A;  4GKJ Q; 
#chains in the Genus database with same CATH topology
 2ZM6 H;  1YHB A;  2FE3 A;  1VQM A;  2JEJ A;  1K83 B;  2WB1 B;  3PW4 A;  3MHB A;  4DR6 L;  1S97 A;  4IJH A;  4BY1 G;  3PW0 A;  3F2C A;  5JVD F;  1OXX K;  4CDF C;  3CCE A;  4IOC A;  3KLR A;  4JYA L;  3K3P A;  2ZTC A;  3KBG A;  2CH4 A;  4X62 H;  5ELD A;  4B9W A;  3MWD A;  1DYQ A;  1ONL A;  3SVM A;  1QG7 A;  4RGN A;  1LTT D;  2V5A A;  4X66 H;  1TWC B;  4JI0 Q;  3KUP A;  1FGB D;  3I90 A;  5I2Y A;  4QB4 A;  1RTO A;  1NMG A;  3BDC A;  4JBJ A;  4DR6 Q;  5EZY F;  4X3T A;  1V1Q A;  4EEY A;  3CKI B;  1F9P A;  2ASJ A;  1PTO F;  1UNS A;  4KHP L;  3GTG A;  1SLJ A;  2LXJ A;  4I4T F;  3CXC A;  1PTO H;  2WAQ E;  4MHE A;  3ZYY X;  4LF5 Q;  3DEO A;  1HTP A;  2W6M A;  5JEA J;  1GUT A;  3T5K A;  1TR5 A;  1PHJ A;  5LOV F;  1LTL A;  2UXC Q;  1Z6H A;  3P75 A;  3T13 A;  1TWF H;  2BDN A;  2F0H A;  2LSS A;  1WSC A;  3T5J A;  4UP9 A;  1QNU A;  3W1B A;  3PIO 3;  5CB4 F;  4JK1 C;  2CW0 C;  4ECY A;  1XWE A;  1EUD B;  2ZTD A;  3CCR A;  3A5Z B;  1HZC A;  3A54 A;  5C4J B;  3CRL C;  2VQE H;  1DGS A;  1IYU A;  2NB0 A;  3MXG A;  1D1I A;  3VPC A;  2Z8L A;  4KKS A;  4KD3 A;  5E4X A;  4HNV A;  5KG7 A;  4IPD A;  1I7L A;  2NVX B;  2Z1C A;  1YHA A;  2FK3 A;  4C3I G;  4APM A;  3BZD B;  1RL2 A;  1SEB D;  1SSO A;  1SJE D;  4YCU A;  3DLL A;  1K8G A;  4G3I A;  3UDG A;  1PH2 A;  3TQ1 A;  4YQW A;  4A3K G;  4XYO A;  3RIZ A;  1O7Z A;  5CA1 F;  1EYD A;  3H94 A;  5BPF A;  2E74 C;  1GLV A;  1TWC H;  5IYB H;  3ITP A;  1TS2 A;  3J80 E;  5C5L A;  3GDE A;  2EYF A;  1JMC A;  2PQE A;  4GZY C;  4K6L A;  2EYP A;  1W93 A;  4O3P A;  3BDL A;  1GUW A;  1PVO A;  2VY3 A;  3S2D B;  1LTR D;  4DAY A;  5KG6 A;  1SNO A;  1HH2 P;  1WFQ A;  4RAY A;  3M9O B;  2E2D C;  4EX5 A;  1HNZ H;  4KLK A;  3V4S A;  4DUZ L;  1I6V C;  2FPI B;  2HUG A;  1EOV A;  2K5N A;  1SE4 A;  5JJL A;  4QUF A;  5M5X H;  1O80 A;  3NQT A;  1EYZ A;  2SOB A;  3DM3 A;  5IYC G;  3RN5 A;  2ZDQ A;  4HSP A;  2PCF B;  1Y1W B;  2UUC L;  4NW2 A;  5FD5 A;  2DJG C;  5C3W A;  4KN7 C;  1YNN D;  5IWA L;  1KC8 C;  3ETJ A;  3B6Y A;  1UNN C;  4EEQ A;  2F0O A;  5D65 A;  1N36 H;  5IP7 G;  4EBE A;  3HOX H;  3CC4 A;  3SR1 A;  3RB4 A;  2JA6 A;  3LNN A;  1MI2 A;  4EVO A;  2W9C B;  2BOS A;  4U67 3;  2P0A A;  1VQK A;  1N34 Q;  5T1I A;  1M1K C;  2ZXP A;  1EZ8 A;  1ESF A;  5KG3 A;  1JE5 A;  2QDB A;  2UUC Q;  3C46 A;  1SYD A;  1V51 A;  2O03 A;  1EUJ A;  4MV7 A;  1S5F D;  5JEA G;  4BA1 I;  1K1S A;  2YS6 A;  1RK6 A;  1N32 Q;  3OPO A;  1I3Q H;  4RG1 A;  4TQU S;  3K0X A;  3PCO B;  1TS3 A;  1S0O A;  3P7J A;  1B7Y B;  1HNW L;  4YHH H;  4PMC A;  3J81 L;  1ZQ7 A;  5H1S E;  5GQO A;  5JVG 3;  3GTM B;  4XQN A;  4I50 F;  4DV7 H;  1I94 Q;  4R4C A;  3TS0 A;  1HR0 Q;  2UXB L;  3WOE A;  4C5B A;  3ORQ A;  5JAV A;  4EQN A;  1AP0 A;  2A6H C;  2PI2 E;  3JAM i;  3ULP A;  1XJV A;  3GTP A;  2R3Z A;  2WKC A;  4RFB A;  5IGB A;  4A3L H;  2KVM A;  4NKL A;  1N32 L;  2VPS A;  4B3R H;  1SFO H;  4Q0F A;  4GNX B;  5FLX E;  3N43 B;  2D0P A;  1PFS A;  2D9U A;  3MFI A;  4LK1 C;  3RZD B;  3OSN A;  4A3J H;  5ELE A;  4DN4 M;  4JCV E;  1VQJ A;  4QF4 A;  4JYA Q;  5HGT A;  5CV7 A;  4LF5 H;  5KFW A;  1PH4 A;  4JI0 H;  2IHF A;  3QOJ A;  1Z2P X;  4Q45 A;  4TQR A;  2CW7 A;  3S9W A;  3H4B A;  1E0B A;  3C2P A;  1DJR D;  4FF1 A;  2UXC H;  1DCZ A;  2N88 A;  4ME6 A;  3CRK C;  1X3E A;  3JRW A;  1ZHQ A;  1T94 A;  5KFZ A;  3H0G H;  3G6Y A;  4B3S L;  4JV5 H;  1IOV A;  4KJO A;  1LT5 D;  1B1Z A;  1PTO D;  1BR9 A;  1I4R A;  3NXW A;  5EKK A;  4C5C A;  1A15 A;  4BBR B;  2R7Z B;  3OW2 A;  4DV3 H;  1PH8 A;  5C5J A;  4YR3 A;  1M4V A;  1EIY B;  3ERO A;  4HJ9 A;  1SCU B;  2K1B A;  1CSQ A;  2X69 A;  1WTW A;  3A74 A;  2TMP A;  1X56 A;  3EPG A;  4EBD A;  2XNA C;  5DG7 A;  3NHH A;  4FU0 A;  5DQH A;  2J9G A;  4O3R A;  3IAY A;  1HNX H;  4B3S Q;  3W1G A;  5GAH C;  3GTM H;  2L0C A;  3L3O C;  5FPO A;  1TWA H;  1N33 H;  2AQ3 B;  3PIP 3;  3DMU A;  1IW7 D;  2KHJ A;  1WCM G;  4A3E H;  2Q2U A;  4Y8V B;  2B63 A;  4Y52 H;  2HHH L;  2HIX A;  3Q6S A;  3OUU A;  2J7Z A;  1JDE A;  2ZJR A;  4LF8 L;  3GTG H;  2VUG A;  5HY6 A;  2L1B A;  3MA2 B;  1EQQ A;  3X3M A;  1TVX A;  2B2W A;  3I7F A;  2SNM A;  2X6L A;  1GOZ A;  4DV6 L;  2R8I A;  3TN2 A;  4Y7N H;  3FHW A;  5IGD A;  2UVU A;  1J5E H;  4H0L C;  1Z2O X;  4HR7 A;  4OX9 L;  5LXT F;  4B3M H;  4DV1 L;  4EQP A;  1S40 A;  2PN1 A;  2R7M A;  1I6U A;  4YWL A;  2K5W A;  4KY7 A;  1HR0 W;  1S5B D;  2L11 A;  1B2T A;  3T1H L;  3NEL A;  4MTK A;  3H3V H;  1A9X A;  1EY5 A;  4DXF A;  2UUB Q;  1X54 A;  1WTP A;  3OTO Q;  3UDX A;  5C6A A;  3TEH B;  1IKM A;  4G7O C;  3SK4 A;  1I7N A;  3NEM A;  4P72 A;  4HIK A;  1HNZ Q;  2PVP A;  2YW2 A;  2ATL A;  2EJF C;  2R92 A;  4DV1 Q;  4FBU A;  3JAM W;  5FLX W;  1IXR A;  3E6Z X;  4KV6 A;  1QNK A;  2EY1 A;  4C1N I;  5IGF A;  5EPK A;  5F9N A;  2JXM B;  2F0Q A;  5IP9 G;  1DON A;  2MCT A;  2K5Q A;  3H20 A;  4EYH B;  2VS1 A;  4J9N A;  1KJJ A;  4ED7 A;  2HDL A;  3HOZ B;  1DIK A;  4KJN A;  5FO7 B;  4MV1 A;  1C3O A;  2C2E A;  3SE0 A;  5IWA Q;  1YHQ A;  2BQU A;  2CCZ A;  2DPI A;  4RUC A;  1K83 A;  4RB0 A;  1XNQ H;  4QL5 A;  5KFA A;  3CU7 A;  3F2D A;  2R8H A;  4TSS A;  4A3E B;  1PK8 A;  4NLG A;  1VQC A;  1TS4 A;  4OO1 H;  3TQY A;  3H3V C;  3SK5 A;  5C0X H;  3PR4 A;  3GV7 B;  1PFB A;  4F88 A;  3JSN A;  2AHO B;  4A76 A;  4J1M A;  4JI1 H;  3IRB A;  1Y1V B;  2ATW A;  1TWC A;  3I3C A;  2NVX H;  5C3E B;  4Y7N B;  4JI6 L;  3FKI G;  3VA7 A;  4RAU C;  5FO8 B;  1KQS A;  1HR0 L;  2RKS A;  5JVL A;  3NBH B;  5CV4 A;  4CKC A;  3CCM A;  5JEA H;  4ALP A;  1IBL L;  2JA7 B;  4EFE A;  1GD7 A;  2ES2 A;  4LUZ A;  3A8I E;  5CGK A;  4MNO A;  2OLS A;  1WVL A;  5D1P A;  4JBK A;  4V19 0;  4LNQ A;  3PGZ A;  3CP0 A;  4Q44 A;  2FK1 A;  3Q8Q B;  5KFL A;  2NN6 H;  3NSW A;  1KLU D;  3O13 A;  5DM7 3;  4C3H G;  3S16 B;  4DKA C;  2J6T A;  4RUA A;  2PMZ B;  4PMB A;  4XXE A;  3S24 A;  2B2U C;  4X65 Q;  1KJ9 A;  4UCV A;  2PZW A;  4IAJ A;  2EQS A;  3HOZ H;  5C44 G;  5D8D A;  4YP3 A;  3RLN A;  3VMM A;  2YV5 A;  2A6H D;  1NBW A;  1A8V A;  3PQI A;  1CM9 A;  2KEN A;  2KSW A;  4UCU A;  3PR5 B;  3CCJ A;  5CV8 A;  4J0M A;  1LTS D;  1PH1 A;  3MEF A;  1S0M A;  4ZHQ F;  4GLA C;  1SMX A;  2E5L H;  3RB0 A;  2AQ4 A;  1ASZ A;  3SK6 A;  4NXN H;  2KCN A;  2B2Y C;  2KQ3 A;  3CAM A;  3RMH A;  4JI3 L;  1TA8 A;  2JEB I;  4RB3 C;  1CE8 A;  2R6F A;  1CZW A;  1PH5 A;  3N6R A;  5KFD A;  5KFE A;  2K75 A;  4FXD A;  3QOL A;  4LFA Q;  3F2U A;  1K3R A;  4EGV A;  3V6H A;  1M8A A;  3MJF A;  5C4X B;  3RUZ A;  1RJR A;  2W9B A;  4QWA A;  2CFM A;  2MO1 A;  4NMZ A;  4L5T A;  4DAY B;  1FNV A;  4CJ2 C;  2R84 A;  3LML A;  1NCV A;  5J2U F;  4UFZ A;  5EWF A;  3RZO B;  3GIM A;  4P71 A;  5K36 H;  1STN A;  2TSS A;  2FMM A;  3BG3 A;  3K5N A;  2RDG A;  3LWU A;  4A3B G;  3V6J A;  5L1J A;  5ELB A;  3ICE A;  3L4J A;  3J7A F;  4LFA L;  4LF8 Q;  1SR3 A;  4ED0 A;  4MTD A;  4KHZ A;  1STA A;  2R6G A;  1C8C A;  4UCR A;  5CMD A;  1AN7 A;  3FPU B;  4LH7 A;  3M9B A;  4DR1 L;  2K52 A;  4DV4 L;  3QIA A;  3R2I A;  4ED1 A;  4BY7 B;  3N8D A;  4K8I A;  4K6D A;  2E2J B;  1SYX B;  2ZT9 C;  2BE5 D;  4A93 B;  4LF9 Q;  5KNB A;  3NTK A;  1EQV A;  1N36 Q;  5BMV F;  5EWG A;  3WO1 A;  4C3I H;  2W71 A;  1Q8I A;  1STB A;  2LXK A;  3KDF B;  3FDT A;  3GO5 A;  1SNC A;  2O5I C;  2A6E C;  2W6Q A;  2LY7 A;  4ECX A;  1BBW A;  1XMO H;  5FJ8 G;  2CZG A;  4JI8 H;  1GJX A;  4CDD C;  1Y1W H;  1ICW A;  1I50 H;  4B9X A;  2NWG A;  2RA4 A;  5KFP A;  4LUV A;  2W6N A;  2K5V A;  1HNW Q;  4YY3 Q;  4NDX A;  5FOB B;  4RWS C;  4RZR A;  1E4E A;  1N36 L;  1AE2 A;  2ZM6 Q;  5KNC A;  4JI2 H;  3AFQ A;  2EJG C;  1PA6 A;  2KOL A;  3HOW G;  4HJA A;  3BQ0 A;  2BQR A;  5C5M A;  3RBD A;  4ZQ3 A;  1V1O A;  4C2M A;  1T5X D;  1BGW A;  1U0L A;  2BCO A;  3J81 c;  1I3Q B;  3AYH B;  2ASB A;  2E2H A;  4DR3 L;  2H5X A;  4JI7 Q;  1VF7 A;  1IBM H;  2NU9 B;  1RJT A;  1EYA A;  3K59 A;  2ZM6 L;  1NUC A;  2WB1 E;  5LA6 F;  2VQF H;  2AWN A;  1E2V A;  4P74 A;  1A6X A;  4CDC C;  3GTJ H;  1TWA A;  2BQ3 A;  4ECS A;  2PZT A;  2IA6 A;  4DAM A;  4JI7 L;  3UE0 A;  1B9N A;  2F3V A;  3WO0 A;  2NVY B;  3JZI A;  4RNN A;  4EFB A;  3RZD H;  4ED3 A;  2WYO A;  4JI6 Q;  2GLT A;  2EYJ A;  1L0X B;  3UDI A;  1M6V A;  3S2D H;  2B2U A;  3CQZ H;  4LH6 A;  2CWP A;  1J9O A;  2F0G A;  3VYS A;  4IPC A;  4C3I B;  1F9R A;  3L9A X;  3R8B A;  5D14 A;  1S03 G;  4LW1 A;  3MWY W;  4JI0 L;  5CC4 A;  3NEN A;  2A19 A;  4QWD A;  3GTL A;  2HJW A;  1I50 A;  5M5W B;  4HMJ A;  1QZG A;  1HJP A;  2PQA B;  1FVI A;  4A3M G;  5M5X B;  1JLL B;  1TT2 A;  1RCV D;  3T4A C;  1Y69 U;  3N41 B;  2NVQ H;  1HCZ A;  3CQZ A;  3V4Z A;  5GON F;  2B2Y A;  4XIG S;  1UWV A;  4ZCK A;  3G71 A;  4RKL A;  2H1E A;  4JOI C;  4WOR A;  2L55 A;  4AQY H;  1SYC A;  5I6Y A;  3CCV A;  3LWE A;  3N44 B;  1PMR A;  4L8J A;  2XSC A;  5IYZ F;  1KNA A;  1XPR A;  1Z47 A;  5DG9 A;  2HVR A;  1B04 A;  2ZTE A;  4DV6 Q;  3R5H A;  1GUN A;  1I6H H;  1TWF A;  3PUW A;  3GIL A;  1SJH D;  1YIJ A;  1MSG A;  2DJF C;  5E1F A;  4MV9 A;  1JIC A;  3KJP A;  4OX9 Q;  4RKB A;  3JSL A;  2R7K A;  3T51 B;  1A2T A;  2HGS A;  3U9T A;  4DL3 A;  3PV0 A;  2KED A;  4KHV A;  2MNA A;  1VDZ A;  2R93 A;  2WTF A;  4YJ3 F;  4B3M Q;  4C5A A;  2VZA A;  4DLK A;  2XRQ D;  1SNM A;  2B2T C;  3NK9 A;  1PRT B;  1VCI A;  1U4P A;  2XCA A;  1AH9 A;  4JI5 L;  3ND8 A;  1AW7 A;  1E22 A;  5DLQ E;  1BXT A;  1U5K A;  4OX9 H;  4A3J B;  2NZH A;  3HOY H;  4DV1 H;  1B33 N;  1RHP A;  1D2B A;  1VKZ A;  1A3V A;  4CGY B;  1O78 A;  3PSI A;  2I5L X;  4LFC Q;  3M4P A;  3PUZ A;  2L9H A;  2FP4 B;  2GPS A;  1VQD A;  2VQD A;  3NGD A;  4JI5 Q;  4H13 C;  5IOC A;  4DV4 Q;  2A5H A;  4IFD H;  1UE6 A;  2RDI A;  1EWI A;  4A3D G;  2R61 A;  1ENC A;  4JG2 A;  2VA2 A;  1LYL A;  2ID0 A;  5C4X G;  4RNM A;  3PZP A;  5IWA H;  1C48 A;  5C0X J;  3RB3 A;  4J8Q A;  1B3A A;  2BA0 A;  2D62 A;  2KHI A;  1EUC B;  4O3O A;  2WB1 G;  1XPU A;  3KHG A;  4FS2 A;  4IR1 A;  3J81 E;  3TP5 A;  1I6H B;  4PZ8 A;  4DV7 Q;  4A3F G;  2F0E A;  2WV6 D;  3D0F A;  2V4D A;  3FDS A;  2KUM A;  4YY3 L;  1PH3 A;  3M4O H;  2GPW A;  3NBI A;  3MXN A;  1DD2 A;  1TAE A;  1GXD C;  3E0J A;  2K7V A;  3J7Y W;  3T1Y L;  2ZJT A;  4OO1 I;  3NPP A;  1MGS A;  2B2V C;  2I5H A;  3GTO H;  3NBH A;  3WNZ A;  2VL6 A;  3MFH A;  3MR6 A;  3BYY B;  4DV7 L;  5FKA C;  3G6E A;  3GP7 A;  1BXR A;  2NTT A;  2QW7 A;  4NXN Q;  4R4O A;  2NBF A;  1K73 C;  4A3C G;  4CC6 A;  2X6G A;  5JPM C;  1JJ2 A;  4MV3 A;  1IHZ A;  3T1Y Q;  5LMN L;  1Z9F A;  2ZXR A;  1FGU A;  1CHP D;  4GN3 B;  2KJX A;  5COR A;  5FLM G;  3GV3 A;  3J80 i;  3PW5 A;  4HNU A;  1K28 A;  4ECZ A;  3OYY A;  3D6W A;  2KBN A;  4DV0 H;  3OWE B;  1X3Q A;  2EYL A;  4ME5 A;  1YIT A;  3BG5 A;  2K28 A;  2OQ0 A;  4JW0 A;  4BY7 H;  4QW8 A;  2MPM A;  1Q7Y C;  4LF4 H;  2UUC H;  1NR4 A;  1SND A;  5M5Y B;  5CV9 A;  2QGQ A;  4B3S H;  1RJQ A;  2PMZ E;  4IO9 A;  4O3N A;  3I70 A;  5HGQ A;  1I4Q A;  3KOJ A;  1YNJ D;  2HQE A;  1ICF B;  1OXS C;  2JP1 A;  3F2B A;  2VB3 X;  2JN4 A;  4F7X A;  1H9S A;  4IR9 A;  1RK5 A;  1PXU A;  1VQA A;  2Z9H A;  1BCP D;  1HZB A;  1TWG H;  3G8C A;  2Z0S A;  1SYG A;  2IW3 A;  2E5L L;  3S17 B;  1BDO A;  4A2A A;  3G6X A;  1AZQ A;  2Q2T A;  1I94 H;  3GTO B;  4XZ3 B;  4UCO A;  2B8G A;  1LTG D;  2Z4I A;  4H44 C;  4A3I H;  4CC5 A;  1E2Z A;  2JA8 H;  2B2T A;  1WI5 A;  1RYS A;  2F52 A;  2K32 A;  1B4O A;  3K80 C;  3PW2 A;  3TP7 A;  4IRK A;  3VR2 A;  3HOX G;  2KA7 A;  2FPP B;  2IHE A;  3BZK A;  1TII D;  1QVG A;  4DR6 H;  2E8G A;  1X3G A;  3HOZ G;  3GTL H;  1EZ1 A;  4LF6 L;  2IY5 B;  4DL4 A;  4XQJ A;  3BJY A;  4HYK A;  2C00 A;  1SMY C;  1XTC D;  4J9M A;  2AQ2 B;  4BXX G;  1UE5 A;  2EOT A;  4B3M L;  5T14 A;  2JQO A;  1BCP B;  1A0I A;  4O2B F;  3HG9 A;  3NWT A;  1BNC A;  1ML0 D;  5EQ0 A;  1EQR A;  4DV4 H;  4KHP H;  3T1H H;  4S3S A;  4XX0 B;  1FYC A;  1DV2 A;  3H15 A;  3UQ8 A;  5IT9 W;  1GUO A;  3TRE A;  4H7B A;  3MWM A;  2A68 C;  1ILQ A;  4ECR A;  2WKD A;  3A55 A;  4A3C H;  3T1H Q;  1PYW D;  1VQP A;  3M4Y A;  1YJ9 A;  3W3A A;  2IBK A;  4ID6 A;  2R85 A;  4PZ7 A;  3ULJ A;  2QK4 A;  4C2M B;  4A3B H;  1VS0 A;  5C1O A;  1N56 A;  1EIG A;  1AN8 A;  4H02 A;  1U9R A;  4DV2 Q;  2M05 A;  4U68 A;  3HOY G;  1CKN A;  3D8G A;  3E3X A;  5KGU A;  3PN1 A;  3J80 W;  4A3I B;  5JJI A;  1S5D D;  3KK7 A;  1M0W A;  5C4J H;  1YI2 A;  3C0F B;  3PO2 H;  4XYM B;  3N42 B;  3KHR A;  2N8N A;  3VPD A;  4QIW B;  3H0G G;  3E9H A;  5G3L F;  1KDC A;  3RTX A;  3I4M G;  2Y0S A;  2EY5 A;  2IX3 A;  2JA5 A;  4NP5 A;  2R87 A;  4A3M H;  1PFM A;  2VA3 A;  3BDO A;  3FKI A;  1I5F A;  3Q8P B;  3PF4 A;  2XCP A;  4LF8 H;  2SCU B;  1QUQ A;  4O1N A;  2F0V A;  2MGS A;  1Q82 C;  3HXL A;  3PO3 H;  4ZRZ A;  5IYD H;  4POF A;  3U9S A;  1PRT D;  2EVB A;  2QA4 A;  1Q8K A;  3NTI A;  4ECT A;  1LT4 D;  5M3M H;  2B63 H;  2PQA A;  2NVY H;  1GHJ A;  3RF2 A;  5L1L A;  2AUJ D;  1H9M A;  3DHQ A;  2JA8 G;  3CQZ B;  2YYZ A;  4DAV A;  1S3O A;  1KJQ A;  3ER0 A;  1BCP F;  3RBE A;  4LUO A;  4RB1 A;  1ZKO A;  4YAK B;  4I65 A;  3K5M A;  1ULZ A;  3K6O A;  1GYF A;  1Q12 A;  2E2I B;  1IBL Q;  4F4Y A;  3T5L A;  4BBS G;  3KHL A;  2UXD H;  1JKJ B;  3TBI B;  2V1C C;  3F1Z A;  1JR0 D;  4DA2 A;  2FXQ A;  2Q2H A;  4TV9 F;  4PQX A;  4KY5 A;  1LV9 A;  2NTS A;  5DQI A;  2J6U A;  3PMF A;  2YCH A;  5BR8 H;  3H0G A;  5FLM H;  2K04 A;  2Q8I B;  4X65 L;  2MP1 A;  4R8N A;  4AQY L;  3KYH C;  3CME A;  2JA7 G;  5J39 A;  1ENA A;  1BF4 A;  3HOV B;  1OXV A;  1XNQ L;  4DAP A;  2L12 A;  2R8K A;  3CC2 A;  5LL6 b;  3MR3 A;  5EKI A;  2NU7 B;  1JOR A;  1WTX A;  3G48 A;  4I7H A;  1LTB D;  2GA4 B;  1DM0 B;  3DM1 A;  3QJY A;  3VDY A;  1CA5 A;  4XT1 B;  4XYQ A;  4PWQ A;  2UUA H;  1EU3 A;  3VR5 A;  4KD4 A;  2A69 D;  2CH4 W;  4JI3 Q;  4ZUI A;  2LS0 1;  1IOW A;  3ONA B;  2FK2 A;  4G4K A;  4JI6 H;  2I46 A;  5LP6 F;  3GTQ B;  4JVZ A;  1JCK B;  2M9V A;  1GSA A;  5JJK A;  3T53 B;  2XTI A;  4B3R L;  5KFS A;  4LFC L;  4P2C B;  1FJG H;  3Q8D A;  2ASL A;  2C2R A;  1T9H A;  1IBK H;  1QVF A;  4IPG A;  1ET9 A;  2UUA Q;  4ZK9 B;  1IBL H;  3S1N H;  2V4Q A;  2JEA I;  2WB1 A;  4BWG B;  3I4M B;  3T56 B;  2K6A A;  2E76 C;  4B3T H;  4Z9C B;  1BOS A;  1U4L A;  4IUV A;  4ECQ A;  1Z7T A;  3K8A A;  1GSH A;  4CDE C;  2Z6K A;  4DR5 Q;  2RDH A;  4A3K B;  1MKH A;  3L2P A;  1ROD A;  3E5N A;  1N48 A;  4A3L G;  1DV1 A;  1RDP D;  4JI2 Q;  1NMF A;  2A73 B;  1STY A;  5IYB G;  2RDJ A;  1WOC A;  5FK9 C;  2FPG B;  4N8X 1;  4APV A;  5IT9 E;  4LF9 L;  1J8I A;  2ASD A;  2FLN A;  1Q86 C;  2B63 G;  1NJI C;  1QOH A;  1FNW A;  1KDB A;  3PW7 A;  3N52 A;  3OW7 A;  2I0Q A;  2F0M A;  2NN6 G;  2OT2 A;  5FLX c;  2WAQ A;  4JI2 L;  4NXN L;  4CKE A;  3D4D A;  3J81 j;  1EY0 A;  1EY9 A;  4UP7 A;  3K0Y A;  1GGO A;  1E2W A;  2XVS A;  4BBS B;  5C44 H;  5KFO A;  3L4K A;  3W5O A;  2A8V A;  3RAQ A;  5KFI A;  5BN4 A;  2A68 D;  4IQZ A;  1STG A;  4IN3 A;  1W6J A;  5DQG A;  5KG0 A;  1EWC A;  3HOU H;  1JE4 A;  1SRU A;  2M2L A;  4TVA B;  4BS9 A;  4L1K A;  1JJG A;  5D1O A;  4UPA A;  1LT3 D;  1M7J A;  4FDB A;  4K8J A;  3G6V A;  2ALZ A;  3HBL A;  3FPP A;  4GN5 A;  3SE7 A;  1IYJ B;  4K0K H;  4LAA A;  2CQO A;  1B6R A;  1XMO Q;  4FM9 A;  3RNU A;  3F8N A;  3RN2 A;  2Y0S G;  1LT6 D;  1VBG A;  4IAL A;  1MJC A;  5M3F G;  1XMQ Q;  4MA5 A;  4A3I G;  2W8K A;  3S1Q B;  2JA9 A;  5I47 A;  1WTR A;  1CZG A;  3VR6 A;  1PZI D;  2K03 A;  3VR4 A;  3GTP H;  2VUM A;  1XMQ H;  1XMO L;  2E5L Q;  5KFX A;  1IYV A;  3H09 A;  3T16 A;  4HJ8 A;  1K3B C;  3DWP A;  3EQL C;  3N6X A;  5FO9 B;  1B9M A;  3TII A;  1D1K A;  4QJF A;  4E6I A;  5I9O A;  1PDQ A;  3A7L A;  4FNF A;  2NU8 B;  3GIK A;  2EDG A;  2UVR A;  1PTO C;  3R3O A;  4UP8 A;  1F9Q A;  4N8F A;  3EN2 A;  4OHJ A;  4C3J B;  4GKJ L;  3BQ2 A;  2N78 A;  2OCE A;  2PI2 A;  5A2Q E;  1UC9 A;  1WTO A;  4KN4 C;  3I8Z A;  2ZJP A;  5DAU A;  5JUM A;  4LF6 Q;  3S1M B;  4EYI B;  5KFH A;  4DUY L;  4YB8 B;  2BH2 A;  2R93 G;  1HFN A;  2D5D A;  4GKJ Q;  1EOT A;  2W6P A;  1E1T A;  2CHB D;  4UAI A;  5IP9 H;  1TWG A;  3RV4 A;  1B8A A;  1LO5 D;  1LUZ A;  4HAE A;  2VQF L;  5C3E H;  3RJ0 A;  2PYK A;  3OMC A;  3FMC A;  1HUM A;  4R4I A;  1VQ5 A;  4A93 G;  3HOW H;  5JPN C;  3JRX A;  3U9O A;  2WP8 J;  4EG0 A;  2W57 A;  2B8F A;  2CW0 D;  3PO3 B;  3HKZ G;  4LJZ C;  2RCF A;  5EPJ A;  1EY7 A;  3NTH A;  2Z6K C;  1VBH A;  2R8G A;  3I4N G;  2PZU A;  3A0J A;  3J7Z C;  2QKI C;  5C0X G;  2FLL A;  2IPK D;  2VQF Q;  1XDN A;  4B3R Q;  3KAK A;  3TSS A;  4LFB L;  5BN5 A;  4OIK A;  2IWH A;  1DZ1 A;  3GTP B;  1EY8 A;  3SK8 A;  2E2J H;  4DV2 L;  1NTG A;  2H4O A;  4LSX A;  1HXY D;  4N9T A;  1HRJ A;  1CK1 A;  1G29 1;  1LTI D;  1SXT A;  5C3X A;  3CHB D;  3CMA A;  4FF4 A;  2F4V Q;  4HQ6 A;  1VMP A;  1BBU A;  3GID A;  3G4S A;  2KHS A;  4M7E A;  2G9D A;  4KKT A;  1TKW B;  1W96 A;  2YTX A;  2CWA A;  1X3F A;  1WCM A;  4KK7 A;  3U4V A;  5JH7 F;  4GKK Q;  5JVH 3;  4HIM A;  4DR5 L;  1CQI B;  2XRS D;  2WFW A;  2Y0S B;  2JA5 B;  5FLX L;  4DR2 H;  2Z6B A;  4ZLT F;  3U50 C;  4RCN A;  3W2D A;  1L1O B;  1C0A A;  2UXD Q;  1EY6 A;  1HA5 A;  1IKL A;  4RCO A;  3STB C;  1KNE A;  4P73 A;  1VQN A;  1A3T A;  2D2C C;  4JI3 H;  3V96 A;  4PDB A;  4NB3 A;  3AFP A;  3QZ8 A;  1OXT A;  1Q81 C;  5JOB A;  4YY3 H;  4YCV A;  3R2T A;  1NR2 A;  1Y1V H;  4F4X A;  3CD6 A;  2XGQ A;  2R7Z A;  4I55 F;  1CHQ D;  4WJW A;  1PV4 A;  3GTK H;  2EYO A;  1WTV A;  1VQE A;  4M8A A;  2CVR A;  3DXJ C;  1SE8 A;  4R7R A;  5KFQ A;  2W7O A;  5I9P A;  1K8M A;  3KTM A;  1G8Z D;  1EL0 A;  5KT5 A;  3QWN A;  4Q8F A;  3ERQ A;  1EIH A;  4WD3 A;  5KT2 A;  3RGZ A;  2HCI A;  1ZYR D;  4LFA H;  5KFJ A;  4LMQ D;  1R9T A;  1SYE A;  3D6C A;  4OWX B;  5LL6 X;  1F2M A;  2JA7 H;  2HDM A;  2B63 B;  3BQ1 A;  4MTN A;  2AGO A;  2W6Z A;  3J7A K;  1PYB A;  1PH9 A;  3BA8 A;  4DR1 H;  3BVM A;  1Q90 A;  4RA8 A;  3ERS X;  4QUC A;  5AJ3 Q;  5LMN Q;  3KJO A;  3S16 H;  2N49 A;  3QO2 A;  3I55 A;  4GC7 A;  3ULL A;  2HCC A;  2JE6 I;  5C3E G;  2DNE A;  4AQY Q;  2P5Z X;  1AUX A;  1UC8 A;  1ZEQ X;  4HR7 B;  3UDF A;  4BA2 I;  3OWF A;  4JI8 L;  2N3S A;  5KYL A;  1XNQ Q;  1JWU D;  2NVQ B;  3DEP A;  2YU9 A;  1SEI A;  3GV6 A;  1S10 A;  1P16 A;  3PO3 G;  4O4I F;  2PW7 A;  5AJ3 L;  3CVZ A;  2R7F A;  3NUC A;  3KXY T;  2UVW A;  5D3D A;  4HIO A;  2K05 A;  2R82 A;  1LAB A;  2F3I A;  1D8L A;  2VXW A;  4QMG A;  1V8Q A;  5M3M G;  3HKZ E;  3IL8 A;  3EPI A;  1YJN A;  1C30 A;  1BJT A;  2R92 B;  4EBC A;  1SE3 A;  3HOV H;  1OO9 B;  3A8K E;  2AUK A;  4HMI A;  3MC0 B;  1CSP A;  5KFY A;  1EWH A;  1P8L A;  4DR3 H;  4DL2 A;  5C4X H;  2FMA A;  5FJ8 H;  3LP8 A;  4ED8 A;  3EFX D;  2ZXO A;  1VMC A;  4UHV A;  3PVX A;  2UUA L;  4EQ5 A;  5CBE E;  1Y8P B;  1GUS A;  3S1R H;  4K5W A;  2ENB A;  2DY7 A;  1I4G A;  1JOQ A;  3GTJ B;  4EGJ A;  1YNN C;  3ZJY C;  4OEL B;  2VR1 A;  3GTG B;  2ICE C;  4LFC H;  5E3F A;  4JI7 H;  3GTK A;  1SAP A;  3JAM E;  1FJG L;  1XPO A;  3LGJ A;  1KAW A;  5ELF A;  4B3T Q;  4LF4 Q;  1Y1V A;  3WWV A;  5LHY 1;  3K5H A;  2YZM A;  5KND A;  4JPB W;  3AEV A;  4UCT A;  2K33 A;  5CYU A;  3R23 A;  3J81 W;  1NSN S;  2JJQ A;  2LKV A;  4IUP A;  2AKW B;  2YRW A;  5EKL A;  1CI3 M;  2DY8 A;  2BE5 C;  1EYC A;  2O4X A;  2A74 C;  3TZD A;  4LF4 L;  3Q2O A;  3E0E A;  4XT3 B;  2JA7 A;  3HOX B;  5IT9 L;  1VAJ A;  3VYR A;  3HRZ C;  2JA6 H;  1EFW A;  4MV4 A;  4R1J A;  3L7Z C;  2F4V H;  2K01 A;  3K3V A;  3H6M A;  1IL2 A;  2DZD A;  4I7A A;  2PBZ A;  1S9F A;  1S0N A;  4NXM H;  2NVX A;  1HQM C;  2Q8R E;  4BY1 B;  2A1A A;  4XYL B;  2DPJ A;  1KBL A;  4LF7 H;  4R8I A;  3A5U A;  3CCQ A;  4BY7 G;  4RGT A;  4GKK L;  1SN8 A;  4C3J H;  4QW9 A;  5KFC A;  3BZC A;  5GRO A;  3MR5 A;  5D1O B;  5KFU A;  5KRU A;  1SBB B;  4DNT B;  2W6O A;  2XWJ B;  1VQB A;  4L63 B;  4B08 A;  1R4P B;  2A69 C;  3NWS A;  2AMC B;  1AE3 A;  4TUY F;  4J9O A;  3URY A;  4DR2 Q;  5DLF A;  4YWK A;  1O7I A;  4XDX A;  2B3G A;  5IIF A;  3M3Y H;  1R4Q B;  3CCL A;  2F0K A;  4R4Q A;  4DK3 C;  3RLO A;  5ELN A;  5CBA E;  4DK1 A;  4K0K L;  2EY2 A;  3OHX C;  1BKB A;  2WE6 A;  3C1E A;  2DWC A;  4I7Z C;  1JOK A;  3HOY B;  3QB3 A;  1SRO A;  5IY0 A;  1V4Y A;  2FMC A;  4WFN 3;  4O42 A;  4GOP C;  3D4R A;  1WR2 A;  5D3I B;  1QJO A;  3AMU A;  3S15 B;  1G6P A;  3OHB A;  5KG2 A;  3HKS A;  5BR8 Q;  2YZN A;  1QVC A;  2XD4 A;  2JA6 B;  3BU2 A;  2GVB A;  1PH7 A;  3HGB A;  2W9C A;  4O0A A;  4MZ9 A;  1Q1E A;  4DR7 H;  1JIH A;  3TZU A;  1DOL A;  2OF1 A;  4OWT B;  3R5X A;  5EBC A;  2C28 A;  2R8J A;  1JC7 A;  1V1P B;  2WDT A;  1ILP A;  1ET6 A;  3PUV A;  4DUY Q;  1GSO A;  4KMU C;  5EDW A;  5KFT A;  3IN5 A;  5KFB A;  2EIF A;  2BR0 A;  4OEM B;  4JI8 Q;  4U6P A;  5DGA A;  5BR8 L;  3P20 A;  2V4R A;  4ZI7 F;  4ECV A;  1X32 A;  4GKJ H;  1TWG B;  4YCW A;  1H9K A;  3MZ5 A;  5J2T F;  4JI4 L;  5KG1 A;  1L0W A;  2HD3 A;  1AUV A;  2W8L A;  4R4T A;  4TRD A;  3S1M H;  1D5X C;  1E7Z A;  3J81 i;  1JDB B;  2K50 A;  4DV5 L;  1FR3 A;  3GD7 A;  3IG0 A;  3M9M B;  1AEX A;  4DUY H;  1M90 C;  5L37 A;  1E4E B;  4L6T B;  2V58 A;  4G57 A;  3S2H H;  3M3Y B;  4GNX A;  1Y8O B;  3VA5 A;  1XNR L;  4IOA A;  3GQC A;  2WIN B;  1EZ6 A;  4KKU A;  4J9S A;  1K83 H;  4DXG A;  2EXZ A;  2KEC A;  2XWB B;  3HFZ B;  3KF8 A;  1R9T H;  5KFK A;  4F4Z A;  3QFF A;  3K58 A;  5L9X A;  2NVT B;  5F9L A;  2E2H B;  2IX0 A;  1I3Q A;  5JQW A;  5LMN H;  1I4X A;  4ED2 A;  1W2B A;  1N8R C;  4AYB A;  4JYA H;  2F4I A;  1W3S A;  1BO0 A;  1KEE A;  4X62 L;  4A75 A;  2AU0 A;  1SNQ A;  4O4L F;  4O3S A;  4X3U A;  5IP7 H;  1VQI A;  1JQY D;  1WCM B;  4P75 A;  2NUA B;  4LFB H;  3V6K A;  4IWY A;  1V43 A;  1WTH A;  5IYD G;  1OTC A;  3S1Q H;  4B3T L;  4JV5 Q;  1ZHS A;  2UVV A;  1NNX A;  4Q0Y A;  2JK8 A;  4ABN A;  2UXD L;  3ND9 A;  1L1O A;  1RD9 D;  2QDL A;  5FD6 A;  1RJP A;  1UEB A;  1GVP A;  4FF3 A;  4IWX A;  1UE7 A;  4HTH A;  1I4H A;  2VQE Q;  3OOC A;  3PUY A;  4JV1 A;  4A4I A;  4A2B A;  1N34 H;  1Y14 B;  3G6J B;  1KAB A;  4UCS A;  4DR5 H;  4GC6 A;  4X65 H;  4DFA A;  3G7L A;  1KLG D;  1I50 B;  3QG1 A;  3U4Z A;  2YL2 A;  3VPB A;  1GHK A;  3MFG A;  3I4O A;  3I4N H;  4L5R C;  1W6K A;  3PO2 B;  2E75 C;  4PNY A;  2K5D A;  4RHR A;  2VQE L;  1VQO A;  2OTL A;  1VQ9 A;  4HNT A;  5KKN B;  1ENF A;  2NUC A;  4K2L A;  1ESR A;  2J0T D;  4XQQ A;  2KCT A;  3PUX A;  3J80 L;  4IFD G;  2F0F A;  2MFI A;  2ZDH A;  2B39 A;  1R9T B;  4A3D H;  4OIJ A;  3I56 A;  1ZET A;  2HIV A;  1BNZ A;  4ETS A;  1L2F A;  2A6E D;  3M7G A;  4ZQI A;  2Q2I A;  2EE1 A;  5E4W C;  5C1P A;  2F0S A;  1UEA B;  1G2S A;  4LF6 H;  1F2Z A;  2ZJQ A;  3RD4 A;  2J6S A;  1YVC A;  4GOP A;  4A3F H;  4AYB E;  2N55 A;  4ULL A;  2M00 A;  1IBK L;  1WCM H;  2RSO A;  1PFN A;  4HED A;  1PYS B;  4PV1 C;  5NUC A;  3AQQ A;  1X65 A;  2HT1 A;  2R93 B;  1GKH A;  3BYT B;  1E24 A;  5HBR B;  1VQL A;  1WYD A;  1Y1V G;  4YAJ B;  5HV6 A;  4A3G G;  1PH6 A;  1MIU A;  1GUG A;  1U4R A;  2RHQ B;  3HEJ A;  3Q22 A;  1AZP A;  4F8M A;  4QQB X;  2PW5 A;  5GAG C;  2F0T A;  1IBK Q;  3UFX B;  5CV6 A;  2AQ1 B;  3IKJ A;  2MJ8 A;  5TSS A;  1XMQ L;  1KXL A;  3BA9 A;  4LF9 H;  4HJ5 A;  4CBV A;  3GIP A;  1Q46 A;  3OSO A;  2IMW P;  3M7N A;  2VB2 X;  5FPR A;  3I4N B;  4QGU A;  1LLR D;  4BXX H;  1S4Z A;  1H95 A;  1D5Z C;  1DXM A;  1NAP A;  3RLF A;  3GIQ A;  1K0R A;  4IZO A;  4F4W A;  4AIM A;  1TY0 A;  3TRZ A;  1JWM D;  3QR8 A;  4OGQ C;  3OTO H;  3L0O A;  4ZUJ A;  2FHT A;  4GNX C;  1BCP C;  4IZ8 A;  3GV8 B;  2DN8 A;  1QB5 D;  3CW2 C;  4HCS A;  4BY1 H;  4FS1 A;  3RAX A;  4HCE A;  1IBM Q;  3SI8 A;  4AH6 A;  1E4G T;  2X0S A;  2XC9 A;  3GTJ A;  2F0J A;  2YTY A;  2F1M A;  5C0X I;  4A3J G;  5A2Q W;  4NXM Q;  5EPL A;  1FJG Q;  3GTK B;  4L5Q A;  1VQF A;  3Q23 A;  3WDN A;  1MBY A;  3GV5 B;  1CKO A;  1J5E Q;  3BAB A;  5EBD A;  4R8U A;  3H91 A;  2XN9 C;  2EZV A;  4QWE A;  4J15 A;  4UDU C;  3K5I A;  2K5H A;  1TS5 A;  2JA6 G;  1X3P A;  1J6Q A;  3MFY A;  3GII A;  3AB9 A;  4IUU A;  2L4N A;  1A62 A;  3VYT A;  2JSO A;  2ZDG A;  2KCC A;  1STH A;  3GQB A;  4HSV A;  4N9P A;  1TWH A;  1Z2N X;  2UUB H;  4LSA A;  1EU4 A;  1D7Q A;  2PMZ A;  4X3K A;  1BBX C;  3S1N B;  4IFD I;  5CAE B;  4X3S A;  4MV6 A;  1WJJ A;  1TXY A;  2Z4H A;  4ED6 A;  4DL5 A;  3X3N A;  4HN7 A;  5IOD A;  4DV2 H;  4K14 A;  3H3V I;  2KEE A;  4YR2 A;  4HJ7 A;  4Q8E A;  3BJU A;  4LFB Q;  1JJC B;  2AGQ A;  5EOY A;  3UE1 A;  1QZH A;  5IT9 c;  1G51 A;  2EYH A;  1QWY A;  4NPS A;  4ILW A;  1KJ8 A;  1HFG A;  5G3L D;  4JV5 L;  3EIV A;  4LF7 Q;  4MTE A;  5M3F H;  2R7Z H;  3KF6 B;  4FBT A;  2F0N A;  2F4V L;  3S14 B;  3KLS X;  1MD2 D;  2VOB A;  4YWM A;  1EYG A;  4DR2 L;  1FL0 A;  2MHV A;  3OMG A;  1A2U A;  2R92 H;  1QE6 A;  3SXH A;  5BN3 A;  2W9B B;  4FXK C;  5A2Q L;  1CKM A;  3HKZ B;  2QCP X;  4RNO A;  4DK0 A;  1CTM A;  3J80 c;  4G7Z C;  3WOF A;  4E4T A;  1HNX L;  2EXD A;  3K7A H;  5EGT A;  5IE8 A;  5LMU L;  1TU2 B;  2R7D A;  3HP3 A;  5I2X A;  3M4O B;  3D4W A;  4Q43 A;  3GIJ A;  3I72 A;  4YR0 A;  4ZKB B;  3K5L A;  2HHH H;  1X6O A;  3OHA A;  3S1R B;  2ICI A;  3LX0 A;  3S2H B;  2V59 A;  2G5D A;  3OSP A;  2W70 A;  4RH6 A;  2JA5 G;  3I4L A;  1YJW A;  5A35 A;  2YRX A;  3CCU A;  3T5H A;  4J6H A;  1PRT C;  4TQS A;  1S5E D;  4DGZ A;  4XTC S;  2NVT H;  2AGP A;  1UAP A;  2LFN A;  3KDF A;  2F0L A;  2RF4 A;  1MSH A;  1MJE A;  5KFM A;  2UU9 L;  1CQF A;  1V1P A;  1MZB A;  2MQH A;  1OWT A;  4POG A;  5DG8 A;  4GN4 B;  1STE A;  2C2D A;  5K36 G;  1YEZ A;  2Y0S E;  2WAQ G;  1QCB D;  2V9W A;  1O7Y A;  4CJ0 B;  3ETH A;  1UE1 A;  2OWO A;  1KTK A;  2FKL A;  3QZ7 A;  4BWS C;  2RHS B;  2BDO A;  1S5C D;  2UU9 Q;  1U4M A;  4DV5 Q;  1HHV A;  2FLP A;  5KIX A;  4MN3 A;  2OXP A;  4DR4 H;  4YHH Q;  1SYF A;  1RKN A;  2PNH A;  1KD1 C;  3MWE A;  1XNR Q;  1MHW C;  2NU6 B;  2HQL A;  3K7U C;  2KCM A;  2YU9 H;  3VYU A;  5J3B A;  4MAM A;  1GO3 E;  4A3G H;  3KF8 B;  4FF2 A;  5T1G A;  4YJ2 F;  4JI4 H;  2C5C A;  2B2W C;  1B53 A;  3PIP A;  2HVQ A;  3SHL A;  4DV5 H;  1TWA B;  1C4Q A;  4AYB B;  1KAA A;  4X62 Q;  4YHH L;  1HNW H;  3K57 A;  3JAM L;  1BUV T;  1TQO A;  3GTQ H;  2NVY A;  4JI1 L;  3TDQ A;  3GLK A;  3TIN A;  2UXB H;  3CPF A;  1YNJ C;  3DUZ A;  5K5P A;  2VUM G;  3TP6 A;  2E2H H;  2F0P A;  2R92 G;  4U7C A;  5KX5 F;  4GS3 A;  3RZO H;  3GTL B;  2C35 B;  3A7A B;  4RMF A;  2VPQ A;  4WRD A;  1F9S A;  4JI1 Q;  4X64 H;  1H9R A;  1K1Q A;  1E3P A;  2IX1 A;  4FO2 A;  2BA1 A;  1KC7 A;  1SFO A;  5L1K A;  5IGC A;  5KT6 A;  1VQ4 A;  3MR2 A;  1GM5 A;  2XGT A;  4ZKC B;  4K5V A;  2IL8 A;  4L5S A;  5C8Y F;  4EQO A;  2K4K A;  1EIF A;  2I80 A;  5LMN W;  2DLN A;  1D5M C;  4ODG A;  1X55 A;  2R7N A;  1LM0 A;  4X64 Q;  1S72 A;  2B29 A;  1B44 D;  1YNX A;  1N34 L;  5CA0 F;  3NE5 B;  4J9P A;  1TWF B;  1YBY A;  3NP8 A;  1O7L A;  2LMC B;  1BQQ T;  4M1U B;  1QIL A;  4V0B A;  4X6A H;  2WAC A;  3KBX A;  4GLV B;  2XCL A;  2E2I A;  2JEG A;  4DV0 Q;  3RV3 A;  5KT4 A;  1KL9 A;  3EJI A;  5C4H A;  4J9Q A;  3PF5 A;  4LF7 L;  4CKB A;  3FMA A;  1NE3 A;  4TV8 F;  1YZ6 A;  3E9I A;  1E4F T;  2ALY B;  5DEH A;  1BVS A;  4GOP B;  1V9P A;  1KJI A;  1D6E C;  4K2K A;  3TME A;  1KHI A;  1XTD A;  3VR3 A;  4X66 Q;  2DNC A;  1SDF A;  2CKZ B;  3MTS A;  2R86 A;  3DWA A;  2OH2 A;  1KRT A;  2RSN A;  3A56 A;  1HNX Q;  2RDF A;  5IGG A;  1HA6 A;  2OQK A;  5LMU Q;  2R7Z G;  4IHJ F;  1EFI D;  4A3M B;  5DM6 3;  2DIK A;  3EVQ A;  4C56 C;  1L2Z A;  3EYY A;  3HB9 A;  3V2T A;  5DLG A;  4A3F B;  4J9L A;  1SYB A;  4WJ4 A;  2C22 A;  1Y1W G;  5EAY A;  4X66 L;  4BBR G;  3J7A V;  1CUK A;  3E5S A;  4CJ1 B;  1F77 A;  5JJZ A;  2R93 H;  4AYB G;  3EBE A;  3FEW X;  5M3M B;  1JOO A;  2NN6 I;  1HPC A;  4FXG C;  2MUY A;  4K0K Q;  5M9O A;  4O2A F;  2W7P A;  1EEI D;  2L5T A;  1KIX A;  5DGB A;  3LWB A;  1A3U A;  1E1O A;  2F3W A;  2F03 A;  3M4Q A;  5KYI A;  1Y8N B;  2VNU D;  1KRS A;  1O75 A;  2F0U A;  4G7H C;  3BS1 A;  1M0T A;  4MA0 A;  3K81 C;  4DR7 L;  2F0D A;  4C1N K;  5M5W H;  2DUD A;  3KFU A;  4OO1 G;  1G91 A;  2F0W A;  1L0Y B;  4IJL A;  2QYZ A;  4QWC A;  3MXN B;  2OTJ A;  1OXU A;  4NXM L;  5C4Z A;  1I4P A;  1B70 B;  1Q3L A;  4JBM A;  5L1I A;  1CT1 D;  2QEX A;  1UUP A;  1HQR D;  4MIU A;  2R7L A;  1SMY D;  5M3F B;  4R8U B;  5CR3 A;  3HOU G;  1VQG A;  1G6Z A;  4QY7 A;  4IRC A;  2HHH Q;  2CQY A;  2IJ0 A;  1A63 A;  3RGX A;  4DU9 A;  5KT3 A;  1DOM A;  1HZA A;  5ELO A;  3JAM c;  1PLF A;  1T5E A;  1EEF D;  4JI4 Q;  1TWH B;  3Q24 A;  2GN5 A;  2I8C A;  3I12 A;  4JUZ A;  3K5O A;  2PNR C;  2AWO A;  2WAQ B;  1XNR H;  3M4I A;  3KAL A;  5J1Z A;  2YZG A;  4C3J G;  1B6S A;  2EJM A;  3D31 A;  2RGV A;  4RAZ A;  1K8O A;  3J7A 5;  3UI2 A;  2F0I A;  5I4D A;  1K8A C;  1HR0 H;  4CHT B;  3A8J E;  4DF7 A;  2UUB L;  3I73 A;  4J9K A;  2JEI A;  4PZ6 A;  5CV5 A;  2VW9 A;  2W9A A;  3OIP A;  4ZAI A;  2FJZ A;  4J9R A;  1VF5 C;  2RQX A;  5KFR A;  1HNZ L;  4IUR A;  1LAC A;  4DUZ H;  1WD1 A;  3KF6 A;  3I91 A;  2XGP A;  4A93 H;  4WBN F;  1PX2 A;  1H9S B;  1HUN A;  4M9U A;  1EY4 A;  4C2M H;  4F87 A;  1VQ8 A;  1WD0 A;  4A3B B;  4RZQ A;  4KTA A;  2XIW A;  5AFW A;  3I2Z A;  2Q8T A;  3MAQ A;  4MV8 A;  1G2T A;  3HKZ A;  2PO4 A;  2JA5 H;  3GTO A;  4A3K H;  1PZJ D;  3MXP A;  1SNP A;  4JBW A;  5KT7 A;  2RVL A;  4RHS A;  3S14 H;  4DK6 C;  3RUP A;  1EQT A;  2SDF A;  2L15 A;  3HS0 C;  2OEO A;  2VUM B;  3EA6 A;  3H4D A;  3Q1K A;  1CFM A;  1K9M C;  2J4X A;  3STB D;  1Y1W A;  3F8T A;  4LMY A;  1TWH H;  1TY2 A;  2EY6 A;  1JB3 A;  5LMU H;  1N9W A;  2DGY A;  4ECW A;  4O3Q A;  3D3R A;  3R93 A;  2C9O A;  2SNS A;  1IW7 C;  1ZXT A;  5KFV A;  5COY A;  1F2L A;  1EHI A;  5C44 B;  3H40 A;  4IUT A;  1F2Y A;  2IT1 A;  5BPH A;  2FIN B;  5GAD C;  4FP5 D;  1CQJ B;  3M85 A;  1RTN A;  2EPB A;  1N32 H;  5E7N A;  3MXU A;  4QWB A;  3N40 P;  4DPG A;  1ZYR C;  3Q0A A;  2IP4 A;  3HOU B;  4R9W A;  1H9J A;  1KDA A;  3RB6 A;  4KHP Q;  3GTM A;  2O5J C;  4IFD J;  3MVV A;  4QIW E;  4JI5 H;  3FVQ A;  3KLW A;  2NZ1 D;  2UXB Q;  2E2I H;  4ECU A;  4LF5 L;  1NY4 A;  2UU9 H;  4JV0 A;  4IUN A;  5ELC A;  4WJ3 M;  4DV3 Q;  1S68 A;  3TP8 A;  4O2D A;  4QCL A;  1IL8 A;  3BVZ A;  4PMW A;  5H80 A;  4JOI A;  5LL6 S;  1Q1B A;  2EYM A;  2K14 A;  4DR4 Q;  3SGI A;  4ME3 A;  1B3Q A;  3HZX A;  1CKN B;  2UXC L;  1HZ9 A;  4A3E G;  5F2D A;  1VQ7 A;  3AU7 A;  2YS7 A;  4OWW B;  1FD7 D;  3CC7 A;  2QF7 A;  1CQV A;  2PPB C;  4RGO S;  1CS0 A;  1T36 A;  3P1H A;  5ISR A;  3JC6 6;  4QIW A;  2BH8 A;  1DOK A;  1N33 Q;  2VUM H;  2I87 A;  4DV3 L;  3R5F A;  4BBR H;  3SDZ A;  2FJ2 A;  5DNF A;  4F50 A;  3Q8S B;  3PIO A;  4DR4 L;  1II3 A;  4DR7 Q;  4LWC A;  5KFG A;  4UY8 C;  1PRT F;  3FKI B;  2FB9 A;  4GKK H;  2D0O A;  2JEF A;  4KI0 A;  1RF2 D;  4A3G B;  5KFF A;  1QUQ B;  4GLX A;  2QIL A;  3ORR A;  1LTA D;  2YYA A;  3TIG A;  4RU9 A;  4DL7 A;  1VQ6 A;  3RR5 A;  1N33 L;  3K7A B;  5J22 A;  3KLS A;  2O2L D;  2SEB D;  3BAA A;  3NQI A;  3T1Y H;  4JV2 A;  3MEH A;  5EJW A;  3SEB A;  1X9N A;  3U58 A;  1IBM L;  1CA6 A;  2GVA A;  4FVM A;  4TKO B;  1XX8 A;  5GAE C;  4DNI A;  3FRP B;  1SFO B;  4C3H B;  2FFK B;  4DV6 H;  4KY6 A;  3CCS A;  1HTL D;  5IYC H;  2NYZ D;  4K5X A;  1T3N A;  3HOV G;  1IZ6 A;  4DR1 Q;  1J5E L;  4Q5V A;  3I4M H;  4IUQ A;  3DWQ A;  3HOW B;  5I6W A;  2NZO A;  4YBZ B;  1JT8 A;  4DL6 A;  1XXG A;  4DUZ Q;  2JYO A;  4RGM A;  1WTQ A;  1ASY A;  2I5M X;  4OL7 A;  1JXL A;  2CQA A;  2I07 B;  5KG4 A;  4X64 L;  2WII B;  4FYD A;  4ZYS A;  5K2M A;  4EGQ A;  3M9N B;  5HUR A;  4DNR B;  5EWE A;  3Q8R B;  3KAJ A;  4HID A;  4YIJ A;  1JX4 A;  3S15 H;  3PO2 G;  3OUZ A;  4IRD A;  5KEE A;  3H0G B;  3C1F A;  4DV0 L;  2MO0 A;  4PG3 A;  3DF7 A;  3TS2 A;  3FP9 A;  2YTV A;  3CPW A;  2RBM A;  2HVS A;  2RCN A;  5M5Y H;  1B50 A;  4OON A;  3CF5 A;  5KFN A;  1VQH A;  4O4H F;  1PTO B;  1JB7 A;  3FKI H;  1WH2 A;  5KG5 A;  4IPH A;  2B2V A;  1RIP A;  1PZK D;  3OTO L;  3TQT A;  2CW8 A;  4RB2 C;  4BBS H;  4DR3 Q;  1L1O C;  3KHH A;  2YU9 B;  3S17 H;  2G9H D;  4ZOL F;  1FNU A;  3OIQ A;  1K0S A;  1FKA H;  2RGR A;  3BVG A;  1JWS D;  1C7Y A;  1I94 L;  1XYI A;  5IGE A;  5LYJ F;  3IFT A;  3GTQ A;  2JA8 B;  4JC0 A;  1C9O A;  1RYR A;  1AFP A;  2QEJ C;  3C3L A;  4A3D B;  3V05 A;  3IFD A;  1SE2 A;  4OXP A;  2XIG A;  4C3H H;  3RFC A; 
#chains in the Genus database with same CATH homology
 1QZG A;  4LFB Q;  1JJC B;  1E1T A;  1HJP A;  1FVI A;  2PQA B;  5IP9 H;  4A3M G;  3UE1 A;  1QZH A;  1B8A A;  1YHB A;  5IT9 c;  1G51 A;  1VQM A;  1LUZ A;  2VQF L;  5C3E H;  4NPS A;  2NVQ H;  4R4I A;  4A93 G;  1VQ5 A;  4DR6 L;  3HOW H;  4JV5 L;  3EIV A;  4IJH A;  4BY1 G;  4XIG S;  4LF7 Q;  3F2C A;  1UWV A;  1OXX K;  2WP8 J;  5M3F H;  3CCE A;  3KF6 B;  2R7Z H;  4IOC A;  2F4V L;  3G71 A;  4JYA L;  2ZTC A;  4JOI C;  3HKZ G;  3CCV A;  4YWM A;  1EYG A;  4DR2 L;  1FL0 A;  2Z6K C;  3I4N G;  3A0J A;  3J7Z C;  4JI0 Q;  2R92 H;  5C0X G;  1CKM A;  2VQF Q;  4B3R Q;  1NMG A;  4JBJ A;  1XPR A;  1Z47 A;  3J80 c;  4DR6 Q;  4LFB L;  1HNX L;  1V1Q A;  2ZTE A;  2EXD A;  4DV6 Q;  1I6H H;  3K7A H;  5LMU L;  3PUW A;  5IE8 A;  1YIJ A;  2E2J H;  4KHP L;  4DV2 L;  1NTG A;  2R7D A;  1SLJ A;  3KJP A;  1G29 1;  2LXJ A;  3CMA A;  4OX9 Q;  3CXC A;  2WAQ E;  2F4V Q;  4LF5 Q;  1X6O A;  1BBU A;  3PV0 A;  5JEA J;  3G4S A;  2MNA A;  2YTX A;  2CWA A;  1X3F A;  1PHJ A;  3U4V A;  2JA5 G;  4B3M Q;  1LTL A;  2VZA A;  1YJW A;  4GKK Q;  4HIM A;  4DR5 L;  2UXC Q;  1TWF H;  2LSS A;  1VCI A;  3CCU A;  4UP9 A;  3W1B A;  2WFW A;  1AH9 A;  4XTC S;  2NVT H;  4JI5 L;  3U50 C;  1E22 A;  1L1O B;  5DLQ E;  1C0A A;  3KDF A;  2UXD Q;  2ZTD A;  3CCR A;  2RF4 A;  1U5K A;  1HZC A;  3A5Z B;  3STB C;  1MJE A;  2NZH A;  3HOY H;  1DGS A;  4P73 A;  2UU9 L;  1VQN A;  2MQH A;  4POG A;  4GN4 B;  3AFP A;  4NB3 A;  1OXT A;  1Q81 C;  4YCV A;  5K36 G;  1Y1V H;  3CD6 A;  1YEZ A;  2Y0S E;  3PSI A;  4IPD A;  2WAQ G;  1PV4 A;  3GTK H;  2I5L X;  4LFC Q;  3M4P A;  1YHA A;  1UE1 A;  1VQE A;  3PUZ A;  1SE8 A;  1VQD A;  2OWO A;  1RL2 A;  4JI5 Q;  4YCU A;  4DV4 Q;  3DLL A;  2RHS B;  1K8G A;  1UE6 A;  3UDG A;  1EWI A;  4A3D G;  1PH2 A;  2UU9 Q;  4JG2 A;  4A3K G;  4DV5 Q;  1LYL A;  2ID0 A;  5C4X G;  5C0X J;  1TWC H;  5IYB H;  2BA0 A;  2D62 A;  2KHI A;  3GDE A;  1JMC A;  2WB1 G;  4YHH Q;  4OWX B;  1XPU A;  2PNH A;  1KD1 C;  2JA7 H;  1XNR Q;  4MTN A;  2HQL A;  3K7U C;  2KCM A;  4PZ8 A;  4DV7 Q;  4A3F G;  2YU9 H;  1PYB A;  1PVO A;  2VY3 A;  5J3B A;  1PH9 A;  1GO3 E;  3D0F A;  3KF8 B;  4A3G H;  3ERS X;  5AJ3 Q;  4YY3 L;  5LMN Q;  3PIP A;  1HH2 P;  1WFQ A;  3KJO A;  1PH3 A;  2N49 A;  3S16 H;  3I55 A;  3M4O H;  3ULL A;  4EX5 A;  2JE6 I;  4KLK A;  3T1Y L;  4DUZ L;  4OO1 I;  5C3E G;  1EOV A;  2K5N A;  2I5H A;  4X62 Q;  4YHH L;  4AQY Q;  3GTO H;  5JJL A;  3GTQ H;  3UDF A;  2VL6 A;  5M5X H;  4BA2 I;  4JI1 L;  4JI8 L;  2N3S A;  1XNQ Q;  4DV7 L;  3DM3 A;  3G6E A;  5IYC G;  3RN5 A;  2UUC L;  4NXN Q;  3CPF A;  4R4O A;  1P16 A;  3PO3 G;  5AJ3 L;  5IWA L;  2R7F A;  1K73 C;  1KC8 C;  4A3C G;  3B6Y A;  2VUM G;  2E2H H;  4HIO A;  1JJ2 A;  2F3I A;  2R92 G;  1D8L A;  3T1Y Q;  5LMN L;  1Z9F A;  4GS3 A;  5IP7 G;  3HOX H;  3CC4 A;  1FGU A;  5M3M G;  3HKZ E;  4GN3 B;  3RZO H;  2C35 B;  4RMF A;  1YJN A;  5FLM G;  3J80 i;  4JI1 Q;  1VQK A;  1N34 Q;  3HOV H;  1M1K C;  1E3P A;  2IX1 A;  1JE5 A;  2BA1 A;  2UUC Q;  1EUJ A;  1CSP A;  3OYY A;  5JEA G;  4BA1 I;  1P8L A;  2KBN A;  1VQ4 A;  5C4X H;  1N32 Q;  5FJ8 H;  1GM5 A;  1I3Q H;  2XGT A;  4RG1 A;  3K0X A;  3PCO B;  4TQU S;  1B7Y B;  1HNW L;  4L5S A;  1YIT A;  2OQ0 A;  5H1S E;  5GQO A;  4BY7 H;  2UUA L;  4EQ5 A;  2K4K A;  1Q7Y C;  1EIF A;  1I94 Q;  4R4C A;  3TS0 A;  5LMN W;  3S1R H;  1HR0 Q;  2UXB L;  1X55 A;  2QGQ A;  1LM0 A;  2PI2 E;  2PMZ E;  4X64 Q;  5HGQ A;  3JAM i;  4IO9 A;  3ULP A;  2B29 A;  1YNX A;  3KOJ A;  1XJV A;  1S72 A;  1N34 L;  4A3L H;  1YBY A;  3ZJY C;  1N32 L;  4X6A H;  1OXS C;  3F2B A;  1SFO H;  4GLV B;  4GNX B;  4DV0 Q;  1XPO A;  1FJG L;  2D0P A;  1VQA A;  1KAW A;  1HZB A;  3LGJ A;  1KL9 A;  1PFS A;  4B3T Q;  4LF4 Q;  1TWG H;  3WWV A;  2Z0S A;  4A3J H;  3PF5 A;  4JCV E;  4LF7 L;  1VQJ A;  2E5L L;  3AEV A;  2Q2T A;  1NE3 A;  4JYA Q;  1YZ6 A;  3E9I A;  2ALY B;  1BVS A;  4GOP B;  4A3I H;  2IHF A;  1PH4 A;  1V9P A;  2JA8 H;  2JJQ A;  1WI5 A;  2AKW B;  2F52 A;  3K80 C;  1KHI A;  1XTD A;  4X66 Q;  2CKZ B;  3HOX G;  1KRT A;  2IHE A;  3BZK A;  1X3E A;  4LF4 L;  1QVG A;  1HNX Q;  3E0E A;  3H0G H;  2E8G A;  2OQK A;  5LMU Q;  4B3S L;  2R7Z G;  1X3G A;  3HOZ G;  3GTL H;  4LF6 L;  2JA6 H;  1EFW A;  2IY5 B;  4R1J A;  3L7Z C;  3OW2 A;  4WJ4 A;  1IL2 A;  1PH8 A;  1Y1W G;  1EIY B;  2A1A A;  4HJ9 A;  5EAY A;  4X66 L;  1CSQ A;  4BBR G;  3A74 A;  1X56 A;  1CUK A;  4BXX G;  1UE5 A;  3A5U A;  3CCQ A;  4BY7 G;  4B3M L;  2JQO A;  1A0I A;  4GKK L;  2R93 H;  1SN8 A;  4AYB G;  4C3J H;  4B3S Q;  3EBE A;  3W1G A;  3BZC A;  5GRO A;  2NN6 I;  1EQR A;  5GAH C;  3GTM H;  4K0K Q;  1TWA H;  1VQB A;  3H15 A;  1KIX A;  3TRE A;  2KHJ A;  1E1O A;  1WCM G;  3M4Q A;  4A3E H;  2Q2U A;  2AMC B;  1AE3 A;  2VNU D;  1KRS A;  4Y52 H;  2HHH L;  4A3C H;  2HIX A;  4DR2 Q;  3T1H Q;  4YWK A;  2ZJR A;  3K81 C;  4LF8 L;  3GTG H;  4DR7 L;  1O7I A;  5HY6 A;  1VQP A;  1YJ9 A;  2B3G A;  1EQQ A;  5M5W H;  3M3Y H;  3CCL A;  2DUD A;  4PZ7 A;  3ULJ A;  3KFU A;  4OO1 G;  3I7F A;  4R4Q A;  4IJL A;  4DK3 C;  4A3B H;  1VS0 A;  3MXN B;  2OTJ A;  1OXU A;  4DV6 L;  4NXM L;  3RLO A;  4Y7N H;  4H02 A;  1B70 B;  3FHW A;  5ELN A;  4DV2 Q;  4JBM A;  2QEX A;  3HOY G;  1CKN A;  4K0K L;  4OX9 L;  1BKB A;  5JJI A;  4DV1 L;  5C4J H;  1YI2 A;  3PO2 H;  1S40 A;  3HOU G;  1VQG A;  1SRO A;  4QY7 A;  2N8N A;  4YWL A;  5IY0 A;  3H0G G;  1HR0 W;  2HHH Q;  3E9H A;  4GOP C;  3T1H L;  3NEL A;  1A63 A;  3H3V H;  1HZA A;  5ELO A;  1G6P A;  2UUB Q;  1X54 A;  3HKS A;  3UDX A;  5BR8 Q;  3JAM c;  3OTO Q;  4JI4 Q;  3TEH B;  3I4M G;  1QVC A;  2GN5 A;  4A3M H;  3BU2 A;  2GVB A;  1PH7 A;  1I5F A;  3NEM A;  4O0A A;  4P72 A;  2AWO A;  4HIK A;  4MZ9 A;  1Q1E A;  1HNZ Q;  3PF4 A;  4DV1 Q;  4OWT B;  1QUQ A;  1IXR A;  1Q82 C;  3PO3 H;  3PUV A;  5IYD H;  4DUY Q;  4POF A;  5IP9 G;  2VS1 A;  3D31 A;  2EIF A;  2QA4 A;  1Q8K A;  4JI8 Q;  5BR8 L;  3J7A 5;  5M3M H;  1K8A C;  2B63 H;  2PQA A;  2NVY H;  2UUB L;  4YCW A;  1YHQ A;  4PZ6 A;  5IWA Q;  4JI4 L;  2CCZ A;  1L0W A;  2VW9 A;  2JA8 G;  2YYZ A;  1S3O A;  4R4T A;  3ER0 A;  4QL5 A;  3F2D A;  4LUO A;  3S1M H;  3J81 i;  1E7Z A;  1VQC A;  1HNZ L;  2K50 A;  4DV5 L;  3TQY A;  3KF6 A;  3GD7 A;  1M90 C;  4A93 H;  1Q12 A;  3S2H H;  2AHO B;  4GNX A;  4A76 A;  1IBL Q;  3IRB A;  4BBS G;  4C2M H;  1VQ8 A;  1XNR L;  2ATW A;  4IOA A;  2V1C C;  3I2Z A;  3F1Z A;  2NVX H;  1K83 H;  2FXQ A;  3HFZ B;  1R9T H;  2Q2H A;  2JA5 H;  4JI6 L;  4A3K H;  3FKI G;  4JBW A;  2IX0 A;  3S14 H;  1W2B A;  4DK6 C;  5FLM H;  1N8R C;  1KQS A;  4X65 L;  1HR0 L;  2L15 A;  1W3S A;  3NBH B;  4X62 L;  3KYH C;  3CME A;  4A75 A;  4AQY L;  2JA7 G;  3CCM A;  4ALP A;  1K9M C;  1OXV A;  1XNQ L;  3STB D;  5IP7 H;  1IBL L;  3CC2 A;  3F8T A;  1TWH H;  1VQI A;  1GD7 A;  4P75 A;  2ES2 A;  4LUZ A;  3G48 A;  1V43 A;  4MNO A;  5IYD G;  1OTC A;  4JBK A;  3S1Q H;  4B3T L;  4LNQ A;  1N9W A;  2DGY A;  3CP0 A;  3PGZ A;  4JV5 Q;  3VDY A;  2JK8 A;  2UXD L;  4DKA C;  1L1O A;  1UEB A;  1GVP A;  4JI3 Q;  1UE7 A;  3S24 A;  2UXC L;  4X65 Q;  2IT1 A;  2VQE Q;  3PUY A;  2EQS A;  4A4I A;  3HOZ H;  5C44 G;  5GAD C;  1Y14 B;  3RLN A;  2YV5 A;  1NBW A;  3M85 A;  5JJK A;  1A8V A;  2KEN A;  2XTI A;  5E7N A;  4LFC L;  4B3R L;  4DPG A;  3CCJ A;  3Q8D A;  3U4Z A;  1PH1 A;  4KHP Q;  1T9H A;  3MEF A;  1QVF A;  3I4O A;  4IPG A;  4QIW E;  4L5R C;  3I4N H;  4GLA C;  1SMX A;  3KLW A;  2UUA Q;  3S1N H;  1ASZ A;  2JEA I;  2UXB Q;  2VQE L;  1VQO A;  2E2I H;  4LF5 L;  1NY4 A;  2OTL A;  3CAM A;  1VQ9 A;  4JI3 L;  4WJ3 M;  4DV3 Q;  2JEB I;  4O2D A;  4PMW A;  2KCT A;  3PUX A;  1PH5 A;  4JOI A;  4IFD G;  2MFI A;  1Q1B A;  2K75 A;  2K14 A;  4A3D H;  4LFA Q;  4DR4 Q;  3I56 A;  3K8A A;  1K3R A;  4ME3 A;  2HIV A;  1CKN B;  2Z6K A;  1HZ9 A;  1L2F A;  1MKH A;  3SGI A;  3L2P A;  4DR5 Q;  4A3E G;  1VQ7 A;  4OWW B;  4A3L G;  2Q2I A;  1NMF A;  4JI2 Q;  3CC7 A;  2CFM A;  2MO1 A;  5IYB G;  4IFD J;  4L5T A;  4DAY B;  1WOC A;  3JC6 6;  4APV A;  4LF9 L;  2BH8 A;  2ZJQ A;  1N33 Q;  2VUM H;  4P71 A;  1YVC A;  1Q86 C;  4A3B G;  4DV3 L;  2B63 G;  4GOP A;  4BBR H;  1NJI C;  4A3F H;  3ICE A;  4AYB E;  2I0Q A;  3PIO A;  4LFA L;  1IBK L;  1WCM H;  4LF8 Q;  1SR3 A;  4LWC A;  4DR4 L;  2NN6 G;  4UY8 C;  4DR7 Q;  1PYS B;  4KHZ A;  3AQQ A;  1X65 A;  2R6G A;  5FLX c;  2HT1 A;  2D0O A;  4JI2 L;  4NXN L;  4KI0 A;  1QUQ B;  1GKH A;  4GLX A;  4HJ7 A;  3M9B A;  4DR1 L;  2K52 A;  3J81 j;  1E24 A;  4DV4 L;  1VQ6 A;  4UP7 A;  3RR5 A;  1VQL A;  1N33 L;  1WYD A;  1Y1V G;  5C44 H;  4A3G G;  1PH6 A;  1MIU A;  2RHQ B;  3W5O A;  2A8V A;  4LF9 Q;  1N36 Q;  4QQB X;  5GAG C;  4C3I H;  1IBK Q;  1X9N A;  2LXK A;  3GO5 A;  3U58 A;  3KDF B;  1KXL A;  1XMQ L;  1IBM L;  2GVA A;  1BBW A;  5FJ8 G;  5GAE C;  1Y1W H;  4DNI A;  3HOU H;  1SRU A;  4HJ5 A;  4TVA B;  1I50 H;  1Q46 A;  3M7N A;  1JJG A;  3CCS A;  4QGU A;  4LUV A;  5IYC H;  4UPA A;  4BXX H;  1H95 A;  4FDB A;  2K5V A;  1HNW Q;  3HOV G;  3RLF A;  1IZ6 A;  4YY3 Q;  4GN5 A;  4DR1 Q;  1J5E L;  1K0R A;  1IYJ B;  3I4M H;  4AIM A;  1N36 L;  3TRZ A;  2CQO A;  2NZO A;  1AE2 A;  1XMO Q;  1JT8 A;  3L0O A;  4DUZ Q;  4GNX C;  2ZM6 Q;  3RNU A;  1ASY A;  2I5M X;  3AFQ A;  3RN2 A;  1PA6 A;  3HOW G;  4HJA A;  2Y0S G;  3CW2 C;  4X64 L;  4BY1 H;  1MJC A;  5M3F G;  1XMQ Q;  1IBM Q;  4A3I G;  4AH6 A;  4HID A;  2JA9 A;  1U0L A;  2YTY A;  5C0X I;  3AYH B;  3J81 c;  4A3J G;  2ASB A;  4DR3 L;  4NXM Q;  3S15 H;  3PO2 G;  4DV0 L;  1FJG Q;  2H5X A;  2MO0 A;  4PG3 A;  4JI7 Q;  4L5Q A;  1VQF A;  3TS2 A;  3FP9 A;  3GTP H;  2YTV A;  3CPW A;  1XMO L;  1CKO A;  2E5L Q;  1J5E Q;  2ZM6 L;  2WB1 E;  2RCN A;  4HJ8 A;  4J15 A;  5M5Y H;  2K5H A;  2AWN A;  4OON A;  2JA6 G;  4QJF A;  1J6Q A;  3CF5 A;  1VQH A;  4P74 A;  1JB7 A;  3FKI H;  3GTJ H;  1A62 A;  4UP8 A;  4IPH A;  1RIP A;  4DAM A;  3EN2 A;  3OTO L;  4GKJ L;  4JI7 L;  2N78 A;  3UE0 A;  1D7Q A;  2OCE A;  4BBS H;  3RZD H;  2PI2 A;  4DR3 Q;  1L1O C;  4JI6 Q;  4IFD I;  3UDI A;  3S17 H;  3S2D H;  3CQZ H;  2CWP A;  2ZJP A;  4LF6 Q;  1WJJ A;  4IPC A;  1C7Y A;  1I94 L;  1TXY A;  4LW1 A;  4DUY L;  4JC0 A;  1C9O A;  2BH2 A;  4JI0 L;  3NEN A;  3H3V I;  2R93 G;  4OXP A;  2A19 A;  4C3H H;  3BJU A;  4GKJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...