3HOYH

Complete rna polymerase ii elongation complex vi
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyH00
1L1OC 2EXDA 1PH3A 4HJ9A 1G6PA 2CWAA 4IPHA 4B3MQ 1HZBA 1OXSC 4IJHA 3CC4A 1KXLA 1Q81C 3PO3H 2UU9L 1B7YB 5M5WH 2LXJA 4GOPA 4JBWA 3RLFA 3HOUH 2F52A 5C44G 1PH5A 5DLQE 1IBML 4R4OA 3BU2A 4LFAQ 3ULJA 4DAMA 1JJ2A 3I4NG 2EIFA 2Q2IA 4JI1L 2ZM6Q 4DR3L 1NJIC 1XMQQ 4A3CH 2HT1A 3A5UA 4DUZQ 1AE2A 5IYBH 1EQRA 1V1QA 3ERSX 1C7YA 2HIVA 2F4VL 4A3DH 1Q7YC 1N32L 1KRSA 1P16A 4AYBE 2AWNA 3K7AH 3W1GA 3ULPA 1KIXA 2B63G 1VQFA 3NENA 1VQPA 2GVBA 1E1TA 2IHEA 4UPAA 4GOPB 3HKZE 1N36L 4C2MH 3S1NH 1PV4A 2AWOA 3IRBA 2JA6H 4X62Q 1H95A 1GKHA 4NPSA 2E8GA 3RLOA 1VQLA 2JK8A 4GS3A 1VQ6A 1IZ6A 4L5TA 3I55A 4B3TL 3S2HH 2JJQA 3LGJA 3PUVA 1VQNA 1CSQA 1VQ4A 4WJ3M 3PGZA 3PO2H 3MEFA 1TWGH 4DV6L 2LXKA 3G4SA 3RNUA 3T1HL 1S40A 1K8AC 1IBMQ 1YJ9A 4A3GG 3HOUG 3L2PA 4DV0L 1N9WA 4AQYQ 2L15A 4DV4Q 1VQBA 4DR3Q 5IYCG 1GO3E 1K83H 1HJPA 4LUOA 2JE6I 4DR2Q 2UUBL 1WI5A 2K50A 4JOIA 4GNXB 2VZAA 4BY7H 1EIFA 5FLMG 3Q8DA 4UP9A 4BY1G 3J81j 2GVAA 4R4CA 2F4VQ 3M7NA 3J81i 1UE7A 3H3VI 4AYBG 3HOVG 4A3JH 2GN5A 2E2JH 1E22A 2YYZA 1N36Q 2AHOB 1Q1EA 3HKZG 4NB3A 2JA6G 3UE1A 1GD7A 3EN2A 1Y1VH 3GTJH 3HOXG 4B3TQ 4LF8Q 4GN4B 1EIYB 4LF6L 1A62A 1G51A 4YHHL 1EUJA 1M1KC 3KJOA 2WB1G 4JBKA 1HZ9A 1KAWA 4DR1L 1EFWA 1IBLL 2VUMH 4KLKA 2ZTCA 4DR6L 1L2FA 1G291 4JYAQ 3M3YH 1QZHA 4B3RL 5ELNA 5GADC 1MIUA 4JG2A 3S16H 1CSPA 4HJ5A 4R4TA 2JQOA 2NVTH 3HOWH 3KDFA 4DK6C 1VQJA 4A3EG 1KL9A 1PH9A 4UP7A 2VQFQ 1UEBA 3KF6B 2KENA 4BBRH 4RG1A 1YIJA 1EQQA 1ASZA 3K81C 2ZTDA 1PH8A 4P72A 2WAQE 4GLAC 4HIOA 4C3JH 2N49A 4DV1L 4DR4Q 2QA4A 3S1QH 4JI0Q 1N33Q 4EX5A 3W5OA 1OXXK 2UXCQ 1E1OA 1EOVA 1CKNA 1QUQA 2PMZE 3F8TA 3G48A 5AJ3L 2QEXA 2VNUD 1FGUA 1S72A 5C4XH 1N34L 2R92G 4GLVB 4AIMA 3S2DH 2Z6KA 1W3SA 2DUDA 1RL2A 3WWVA 1S3OA 2UUCL 5IYDH 4JI6Q 1Q86C 3JAMi 1HNWL 4A3MH 3E9HA 2JA5H 2BA1A 4JI5L 5JJKA 5M5XH 1PYSB 1LYLA 3NELA 4HJ7A 3GTGH 3HOZG 1IBKQ 1X3EA 5M3FH 2K5VA 1LTLA 1KQSA 3FKIG 3OTOQ 4BBRG 5IP9G 1I50H 4LFAL 1JE5A 1OXTA 2YTXA 2ZM6L 1NE3A 4L5SA 2WAQG 2OQ0A 5C3EH 4DPGA 2ZJQA 4DUZL 1XPUA 1I3QH 1SROA 1BBWA 4OO1I 1WJJA 3JC66 2F3IA 4KHPQ 1PYBA 4YWMA 2IX0A 2JEBI 5AJ3Q 3CPWA 3J81c 3I4MG 2IT1A 3CCSA 4A3BH 1FL0A 1L1OB 4GN3B 1N34Q 2CKZB 4OO1G 1X3FA 3PUYA 4X62L 4BXXH 1SRUA 3T1YL 1PVOA 2ES2A 2UUCQ 1HNWQ 2I5LX 2K52A 4HIDA 4LF7Q 2DGYA 4JI5Q 3A0JA 3CMAA 1K3RA 4A3MG 2NZOA 4JV5Q 2Y0SE 4K0KL 4QL5A 2IX1A 4GN5A 3PF4A 1SN8A 4AQYL 4DV4L 5FJ8G 2K14A 4DR2L 5J3BA 4A3FH 4A3IH 2I5MX 4POGA 3UDFA 4A76A 1KHIA 5LMUQ 3GTLH 1HH2P 2MQHA 3UDIA 1PH2A 1C9OA 2PI2E 2KHIA 3F1ZA 1HNXL 2ATWA 4BA1I 4B3SQ 3PUXA 1SE8A 4IPDA 4LUVA 3CCUA 4DR7L 5C4JH 5K36G 1QVGA 3S15H 2LSSA 3B6YA 3PUZA 1YJNA 1JB7A 2VQEQ 2YTVA 3T1YQ 3CCLA 4XTCS 2UXBL 1XMOL 4GNXA 4LF8L 4DAYB 2WB1E 3I56A 2E2IH 5JJIA 2CQOA 5ELOA 3PO3G 3M9BA 1VQAA 3TS0A 4TQUS 2CWPA 4K0KQ 4JYAL 2A19A 2HQLA 2UXDQ 2Y0SG 4A4IA 3GTKH 1TWAH 1OTCA 2ZTEA 3D0FA 4QGUA 4LF4L 3FHWA 1BBUA 4L5QA 3M85A 2OTLA 3K8AA 4A3CG 2VQFL 2JA7H 4A3DG 2N3SA 1D8LA 5IYBG 3L7ZC 4DV3Q 1XNRL 2R93G 1XTDA 1X55A 1E3PA 1IXRA 4A75A 1HNXQ 3CCRA 1XJVA 1KD1C 3S24A 5JEAG 4DR7Q 4QJFA 5IT9c 1UE5A 4IOAA 1AH9A 5GROA 1OXUA 1P8LA 1UE6A 4BA2I 1JT8A 1TWCH 3KYHC 3TEHB 2WP8J 3VDYA 4JI0L 1N33L 4QQBX 2UXBQ 3STBC 2NN6I 4C3HH 4O0AA 1XMOQ 2UXCL 4H02A 2AMCB 3KF6A 1EYGA 4PMWA 2HIXA 4GKJQ 1K8GA 2R93H 4KI0A 3CCQA 3MXNB 1VQ7A 1B70B 1XPOA 2H5XA 3GTPH 3E0EA 4JI3L 3PO2G 3GTOH 2NN6G 1VQ9A 2ID0A 2MO0A 3I4OA 3AEVA 3KLWA 1EWIA 2N8NA 3DLLA 1KC8C 4JI6L 1D7QA 3HKSA 2BH2A 4JI4L 3S1RH 4JBMA 3A5ZB 3H15A 4LF4Q 1R9TH 2Q2TA 1FVIA 4A3LH 3PF5A 1FJGQ 1XNRQ 1IBKL 4BY7G 1Y1WH 1VQOA 2JA7G 5JEAJ 3OTOL 2OTJA 2N78A 4RMFA 3M4QA 5H1SE 3CCMA 3H0GH 4A3JG 4DUYQ 1WCMH 4JI2Q 4JOIC 1I5FA 3PSIA 4JI8Q 4POFA 1E7ZA 4GKKQ 4LFBL 3UDXA 4JI7L 2PI2A 5M3MH 5BR8Q 2UUAQ 4A3KH 1NMFA 1YHAA 2VL6A 1XPRA 2MO1A 4KHPL 1Y1VG 3ER0A 1VQEA 4NXNQ 4LF9Q 1A8VA 2HHHQ 1BKBA 2OCEA 1J5EL 1I6HH 4JI3Q 4UP8A 4IFDI 3TREA 2Z0SA 4MZ9A 2VUMG 4MNOA 3EBEA 1Q82C 3GDEA 2XTIA 4PZ8A 4LF7L 4JI4Q 1XNQL 1VQ8A 4IFDG 3HOWG 4BBSH 1J6QA 1M90C 2D0PA 4A3LG 1PFSA 4JV5L 2KBNA 1L1OA 1LM0A 1VQHA 3CQZH 3K7UC 2MNAA 2R6GA 4KHZA 1YBYA 5GQOA 2E5LL 2RHQB 4DKAC 3ICEA 4OXPA 3CF5A 3KF8B 3CCEA 4IPCA 5LMUL 4DV7Q 3RZOH 3OYYA 1HNZQ 1UE1A 4LFBQ 4JI7Q 3GD7A 1N8RC 3RZDH 3NEMA 2R7ZH 2I0QA 3CCJA 1HZCA 4PG3A 4R4IA 2AKWB 4FDBA 4R1JA 4B3SL 1YVCA 1NTGA 1MKHA 1J5EQ 2PQAB 3TS2A 5C4XG 2ALYB 4IO9A 1K9MC 2VQEL 1GM5A 2PNHA 2R7DA 5C44H 1LUZA 1Q1BA 1C0AA 4OX9L 1KRTA 3I4NH 5IYDG 3AFPA 2B3GA 4YWLA 2NVXH 2ZJRA 1XNQQ 3RLNA 1CKMA 4X64Q 3CD6A 1VS0A 5E7NA 1VQ5A 2JA5G 1OXVA 2FXQA 2Z6KC 1JJCB 3RN2A 2B63H 4NXMQ 3L0OA 2K5NA 4O2DA 3CCVA 5M3FG 1PH4A 3S17H 2UXDL 2E5LQ 5IWAL 3OW2A 4JCVE 4AH6A 3GO5A 4Y7NH 3CC2A 4GLXA 5C3EG 1X9NA 2WFWA 3E9IA 4HIKA 4DV3L 2JA8H 1YI2A 2A8VA 4X6AH 2R7ZG 1JJGA 2NVYH 1SLJA 1AE3A 1U5KA 1VQMA 1U0LA 2K5HA 4J15A 4X66L 1GVPA 1HZAA 1IL2A 1V9PA 1CUKA 1TXYA 3GTQH 4A3BG 4YY3Q 1I94Q 2D0OA 1YHQA 1K73C 4A3GH 2RHSB 4BXXG 4OX9Q 4LFCL 4A93H 2VS1A 4YCUA 5IYCH 2JEAI 4GKJL 4DNIA 5HGQA 2E2HH 3U4ZA 4X65L 3PUWA 5FLMH 4BY1H 5FLXc 4L5RC 4DR5Q 4OONA 3DM3A 1X6OA 1X3GA 2A1AA 4LF5L 4WJ4A 1ASYA 1VQCA 2V1CC 5IWAQ 3JAMc 3HOVH 1WFQA 3I2ZA 4OWXB 1NMGA 3J7A5 2IY5B 4EQ5A 4A3FG 1NY4A 3F2DA 4A3IG 1PHJA 1FJGL 2RF4A 1PA6A 1HR0W 3G6EA 1VQGA 4ALPA 1Q12A 4GOPC 4LWCA 4P73A 1TWFH 3HOXH 1BVSA 4LNQA 2JA8G 3H3VH 4PZ7A 1T9HA 1QVCA 1V43A 4X66Q 1IYJB 5IP7H 1VQKA 2YU9H 3PV0A 4DUYL 3UDGA 4JI2L 2NZHA 4JI8L 4IOCA 2UU9Q 4GKKL 1NBWA 4QY7A 1YEZA 1A0IA 3EIVA 4OWTB 1PH6A 5BR8L 2UUAL 3ZJYC 4LFCQ 4JC0A 4PZ6A 5C0XI 5GAHC 5EAYA 3PIPA 4APVA 4NXNL 4A93G 4LF9L 1Q8KA 3AQQA 4JI1Q 2HHHL 4A3EH 2D62A 3J80i 4X65Q 5LMNW 1W2BA 2KHJA 4HJAA 1N32Q 1SFOH 4IJLA 4QIWE 4LF5Q 4IPGA 2EQSA 5C0XG 1PH1A 1HR0L 4GNXC 4MTNA 1CKOA 1WYDA 1QZGA 2NVQH 3KJPA 3G71A 3F2BA 1DGSA 3D31A 2CCZA 3U4VA 4P71A 4HJ8A 3AYHB 2I5HA 3STBD 2ZJPA 5GAGC 3M4OH 3CAMA 1MJEA 2Q2UA 4XIGS 1Q46A 3CPFA 3U58A 2R92H 5IP7G 3CMEA 2RCNA 2YV5A 4DV7L 1HNZL 3K0XA 3CP0A 4DV6Q 3T1HQ 3S14H 4DV5L 5LMNL 5M5YH 3KFUA 1L0WA 1E24A 2VY3A 4DV0Q 1YZ6A 1X65A 1YJWA 2UUBQ 3BJUA 3BZCA 4DV2L 2OWOA 3HOZH 1SMXA 5C0XJ 3I7FA 1YHBA 2BH8A 3FKIH 5IP9H 1A63A 1HR0Q 3PCOB 2KCMA 2XGTA 4UY8C 1UWVA 1VCIA 4P75A 4C3IH 4X64L 1WOCA 2Q2HA 1RIPA 1PH7A 1VQIA 3HOYH 3W1BA 3TQYA 1K0RA 1Y14B 2PQAA 2K75A 5IE8A 2IHFA 1Y1WG 4NXML 1SR3A 3KDFB 3I4MH 5HY6A 3GTMH 4LF6Q 2R7FA 4LW1A 3K80C 4LUZA 4YHHQ 2CFMA 3HFZB 3H0GG 3NBHB 2VW9A 1WCMG 3BZKA 4ME3A 4DR1Q 1YITA 4DR4L 1Z47A 4P74A 4DV5Q 1IBLQ 5LMNQ 4DR6Q 3CXCA 5M3MG 4OWWB 3ULLA 4A3KG 4B3RQ 3AFQA 4B3ML 1MJCA 3U50C 3KOJA 4TVAB 1X56A 2K4KA 3CC7A 4YCVA 4DV2Q 1QUQB 3FP9A 1CKNB 3CW2C 3RR5A 3SGIA 2B29A 4YY3L 1I94L 1JMCA 4Y52H 3UE0A 2JA9A 2C35B 4DK3C 3F2CA 5FJ8H 1YNXA 3M4PA 5IY0A 4IFDJ 2BA0A 2KCTA 2QGQA 3RN5A 5JJLA 4DV1Q 1TWHH 2MFIA 1XMQL 2OQKA 3J80c 3PIOA 4JBJA 4BBSG 4DR5L 3HOYG 2ASBA 4YCWA 4HIMA 1QVFA 3S1MH 1VQDA 1X54A 1O7IA 2YTYA 4R4QA 5GAEC 1Z9FA 3TRZA 3A74A 3J7ZC 1B8AA 4YWKA
chains in the Genus database with same CATH superfamily
2EY1A 4HJ9A 1RKNA 4S3SA 2CWAA 4RWSC 1HZBA 2F0EA 1SJHD 2H4OA 1B7YB 2HD3A 3BDOA 4JBWA 2F52A 5C44G 5DLQE 1LV9A 1JJ2A 3BU2A 3ULJA 4DAMA 4FYDA 3VR2A 2KCCA 4JI1L 2SOBA 4J6HA 2LKVA 3SK8A 2R93H 5IYBH 3H0GB 2B63G 2E74C 3ULPA 3GQBA 3URYA 1IYUA 1E2ZA 2IHEA 4GOPB 4C2MH 1BF4A 4FF4A 3A7AB 2AWOA 3IRBA 5T1IA 1GKHA 4NPSA 3SXHA 3I55A 1SNMA 2JJQA 4DGZA 2RKSA 1VQNA 4K6LA 1M8AA 4WJ3M 3PO2H 3TZUA 4ILWA 1EFID 3MEFA 3RNUA 4K2KA 5JPMC 3HOUG 3L2PA 4DV0L 1AEXA 4HMJA 2L15A 5KGUA 1VQBA 3L3OC 5FO9B 1HJPA 4LUOA 4DR2Q 2JE6I 1HA6A 2UUBL 4ID6A 4JOIA 2WKCA 4B9WA 4BY7H 4OELB 5FLMG 3J81j 2GVAA 3I70A 2L12A 2VB3X 3D4DA 3HOVG 3VA7A 2YYZA 1QNKA 3Q23A 1Q1EA 4NB3A 3UE1A 4KMUC 4KD4A 1EIYB 1HTLD 2F0LA 1PMRA 1G51A 4JBKA 4K14A 1KAWA 4BS9A 5TSSA 1EFWA 2ZXOA 1IBLL 1G291 5KYIA 3M3YH 5ELNA 1A3UA 1MIUA 5JOBA 1CSPA 3S16H 1DZ1A 2JQOA 3HOWH 4K5WA 1VQJA 3TZDA 1PH9A 4B9XA 4UP7A 4Y7NB 4RA8A 1SSOA 1DCZA 1IW7D 1F2YA 1H9KA 2G9DA 4K5VA 4DV1L 5JPNC 1TU2B 3W5OA 4C1NK 1QUQA 1EOVA 2PMZE 3F8TA 2OEOA 1PRTD 5KEEA 3T16A 3D6CA 1U4RA 2DUDA 1RTOA 3MHBA 2F3VA 1S3OA 2B2TC 2UUCL 2R93B 1JOKA 4A3MH 2JA5H 5JJKA 1SNOA 5M5XH 1UAPA 1LTBD 3GTGH 1STBA 1IBKQ 1X3EA 2K5VA 4C2MB 4BBRG 1I50H 2FJ2A 2LFNA 2OQ0A 3E6ZX 1XPUA 1I3QH 3PO2B 1PYBA 1A2TA 3CCSA 1FL0A 3JAML 1M4VA 1IHZA 4UHVA 3T1YL 2QF7A 2V4DA 2UUCQ 2HCCA 4H13C 2K52A 4HIDA 4LF7Q 3W2DA 3H6MA 5CBAE 1SE4A 2NZOA 5IT9L 4BWGB 2F0JA 4DV4L 1GOZA 3EJIA 2I5MX 3MXUA 4A3IH 3DHQA 4KY5A 1EOTA 3R8BA 3GTLH 2FMCA 2F1MA 2R92B 4NKLA 4RCOA 3F1ZA 1KDBA 4B3SQ 5C5LA 4DR7L 2NTTA 2F0GA 3NXWA 1YJNA 1YNNC 2VQEQ 3T1YQ 5A2QE 3HOZB 3SK4A 4LF8L 2JN4A 1JQYD 3CU7A 2CQOA 5ELOA 5LHY1 3PO3G 3M9BA 2CWPA 3GV6A 4JYAL 1BOSA 2M2LA 1H9MA 2WV6D 3KBXA 3MZ5A 2KEEA 4L5QA 4A3CG 2VQFL 2JA7H 3GTMB 1XNRL 1E3PA 1IXRA 5CMDA 1KD1C 4DR7Q 5IT9c 2D2CC 1ESFA 1UE6A 3NQTA 1EU3A 4A3MB 2NN6I 2K04A 4QB4A 2F3WA 4XYOA 4GKJQ 1VQ7A 1I50B 1XPOA 2NN6G 4N8FA 2D9UA 1EWIA 1CK1A 3DLLA 1I3QB 1TS4A 3S1RH 2Z8LA 1WTQA 1XNRQ 2BDOA 1Y1WH 1VQOA 1JCKB 1F9SA 2N78A 4RMFA 1V1PA 4A3JG 4G7ZC 1I5FA 3PSIA 1E7ZA 5M3MH 3J80L 2MO1A 1O80A 5M5WB 4NXNQ 1PRTC 4HTHA 4IZ8A 4R8IA 1A8VA 1GJXA 2M9VA 1QILA 3MTSA 1I6HH 3TREA 5ISRA 4MNOA 1SNQA 3HEJA 5CC4A 1PTOB 1M90C 4A3LG 1CA5A 1LM0A 2JSOA 2R6GA 2E5LL 4XQQA 4V0BA 3ICEA 4OXPA 3QO2A 2AUKA 1HNZQ 3RZDH 2R7ZH 5J39A 1IKMA 3CCJA 1PYWD 1TWGB 1YVCA 2NBFA 3TS2A 5C4XG 2ALYB 4IO9A 4QMGA 1K9MC 3IFTA 2R7DA 1HCZA 5C44H 1LUZA 4IALA 1KRTA 1FD7D 3DWQA 2EJGC 2JA7B 2X6LA 2B3GA 3CD6A 3SR1A 3KBGA 2F0DA 3WDNA 3RN2A 2B63H 3H3VC 4O2DA 1WVLA 1B50A 2E5LQ 1PFMA 5IWAL 3GV3A 2L0CA 4AH6A 1PZID 4G4KA 4GLXA 5C3EG 2B2UC 4ULLA 4JVZA 2JA8H 4NMZA 1YI2A 1D5XC 4X6AH 4V190 1JJGA 1I4PA 4ZKCB 1AE3A 5J22A 1GVPA 1IL2A 1CUKA 1V1OA 5C3XA 1I94Q 1YHQA 3S1RB 4A93H 4YCUA 3OIPA 4CKCA 1LABA 3NQIA 1LTAD 1SYEA 3A8KE 3MC0B 4X65L 4TKOB 3PUWA 5FLMH 1DOLA 1CZWA 4WJ4A 2A1AA 1ASYA 1J8IA 5IWAQ 3HOVH 4IURA 2KECA 3J7A5 4RAUC 1PHJA 2RF4A 1HR0W 3G6EA 4DK0A 1LTSD 4LWCA 1I6HB 1B4OA 1NUCA 4DF7A 4FF2A 3ERQA 1T9HA 2EYLA 1AZQA 3FMCA 3PV0A 3OPOA 4DUYL 4JI2L 4IOCA 2UU9Q 1NBWA 1YEZA 1A0IA 5BR8L 2MUYA 3ZJYC 5GAHC 3AQQA 4QCLA 4IQZA 3J80i 4X65Q 4J8QA 2EYPA 3UI2A 1N32Q 2XIWA 1PH1A 1STEA 2PCFB 1CKOA 1QZGA 5IGBA 3RZDB 2R7ZB 4C56C 3TN2A 1EU4A 1DGSA 2K05A 5GAGC 2Q2UA 5DEHA 3U58A 4Z9CB 5IP7G 3PQIA 2F0MA 3A54A 1BNZA 1GUOA 3T1HQ 3S14H 4DV5L 1HUMA 2PQEA 3RUZA 1L0WA 2VY3A 1CQFA 1LO5D 1YZ6A 3BJUA 2OWOA 5IIFA 1SMXA 4A3FB 5E1FA 1A63A 4HN7A 2KCMA 5G3LF 2JA8B 4P75A 4C3IH 4X64L 1PH7A 3OWFA 2HQEA 5IE8A 2K75A 2L5TA 3D6WA 4DXGA 3KDFB 1EIGA 3CRKC 5HY6A 4YHHQ 3C1FA 1L0XB 2CFMA 4A93B 3J7AV 5EJWA 1WCMG 4WFN3 4DV5Q 3K5OA 1TVXA 3CXCA 3ULLA 4B3RQ 4B3ML 1MJCA 3KOJA 4TVAB 3CC7A 5CV4A 1QOHA 4YY3L 3FP9A 3RR5A 3UE0A 2JA9A 3IKJA 5EGTA 4MTKA 2C35B 3F2CA 3M4PA 5IY0A 4O1NA 2TMPA 3LWUA 1TWHH 1GUGA 2OQKA 3T13A 4DR5L 1F9RA 1K0SA 3H91A 3HOYG 2JP1A 5D14A 1BCPC 3IFDA 1QVFA 2YTYA 3HS0C 1B8AA 5I6YA 1PXUA 1MD2D 1F2LA 1PH3A 2CW0D 4DAPA 4IN3A 1SYFA 1LTID 3A8JE 2BE5D 4B3MQ 2K7VA 1Q81C 2BCOA 3ND8A 3PO3H 4MIUA 4HSVA 1HQRD 3HZXA 1R9TB 1LTRD 1IBML 4JK1C 4R4OA 1UNSA 2EIFA 1NJIC 4A3CH 5F2DA 3A5UA 1AE2A 2B2WC 2EYJA 2L9HA 1Q7YC 1KRSA 2EVBA 3K7AH 3HP3A 1E1TA 4UPAA 4IUPA 4CGYB 5CV8A 2JA6H 2RSOA 1H95A 2E8GA 3RLOA 5EKLA 1VQ6A 1IZ6A 4L5TA 4F8MA 3S2HH 1AN8A 1PFBA 2PZUA 3DEPA 1CSQA 2A6HD 1VQ4A 2NN6H 4KHVA 4LMQD 4DV6L 1EL0A 2LXKA 4C3IB 1IBMQ 4BBSB 4QUCA 3OHXC 4AQYQ 3CQZB 1K83H 3BYYB 1TT2A 1WI5A 3WOFA 2PMZB 3Q8DA 4R4CA 3LWEA 3J81i 1UE7A 3H3VI 3Q6SA 4FP5D 2A5HA 4A3JH 2CH4A 1E22A 5DM63 2AHOB 3EN2A 3GTJH 3C2PA 4LF6L 1A62A 4L6TB 1EUJA 1ZYRC 2WB1G 1HZ9A 4DR1L 3TDQA 2D5DA 2FHTA 4HCEA 1VF7A 4DR6L 4KLKA 2ZTCA 1L2FA 1EY7A 4XT3B 5GADC 1ICFB 2NVTH 3S17B 3KDFA 1A6XA 4A3EG 5C4HA 2TSSA 1UEBA 2XNAC 3KF6B 4RG1A 1K8OA 3K81C 2ZTDA 3RD4A 4P72A 2WAQE 2N49A 4B08A 1CA6A 2QA4A 2EOTA 3S1QH 2NTSA 2PW7A 2IPKD 1JWSD 4DK1A 2B8GA 1E1OA 4YIJA 3Q0AA 5E4XA 5C4XH 4XQJA 2L11A 3S2DH 3VR5A 1RL2A 4FXKC 4BY1B 1TQOA 4WJWA 3K7AB 1HRJA 3NELA 4R8NA 2F4IA 1DOKA 4F88A 2KHSA 2QDLA 1KQSA 3OTOQ 1ILPA 2JA6B 5NUCA 3HOXB 1FNUA 2WAQG 5C3EH 2K32A 4OO1I 2EJMA 3JC66 2LS01 5FLXL 3CPWA 2CKZB 3MWYW 3BZDB 2CH4W 4OO1G 1SRUA 3VYTA 2CW0C 1O78A 2I5LX 2DGYA 3A0JA 3V2TA 1STHA 4JV5Q 4K0KL 2DNEA 2PO4A 5FJ8G 2K14A 4DR2L 3M4OB 4PV1C 4FNFA 1KHIA 3UDIA 2MQHA 1C9OA 4EQNA 1R4QB 1HNXL 1YNJC 1KABA 4BA1I 2FMMA 5ELBA 2H1EA 2ICIA 3KLSX 1PFNA 2PYKA 2YTVA 1E2VA 2NVTB 2EPBA 2C9OA 1XMOL 3QOJA 4GZYC 3FKIB 5CYUA 1H9RA 1LT4D 3X3MA 5JJIA 1VQAA 3MEHA 4K0KQ 1OO9B 3FPPA 2A19A 2HQLA 4KD3A 3D4RA 1TWAH 4A4IA 5IGDA 3GTKH 1KTKA 4EQPA 3F2UA 1I4RA 3D0FA 4LF4L 3I4MB 1BBUA 3G6JB 5LL6S 2N3SA 1Z7TA 2G9HD 2SNMA 5IGCA 1HNXQ 3S2DB 3TP6A 1TS2A 3S24A 1K3BC 3T56B 1HPCA 4CDFC 1AH9A 1SBBB 1OXUA 1P8LA 1JT8A 4BA2I 1WTXA 1CTMA 1XMOQ 3A7LA 3U9OA 1MHWC 3KF6A 1FR3A 2HIXA 3BG3A 1K8GA 3GTPH 2H5XA 3E0EA 5COYA 3GTOH 1VQ9A 2ID0A 3AEVA 1C4QA 5IGFA 3H15A 4LF4Q 3S1MB 3PF5A 2EJFC 1IBKL 5JEAJ 4PQXA 5KIXA 2BDNA 1DONA 1E2WA 2KUMA 1SYDA 2SEBD 4H44C 1WCMH 4JI8Q 1ZEQX 4LFBL 3UDXA 3OW7A 5CR3A 1YHAA 4K8IA 4N8X1 1Y1VG 1VQEA 4LF9Q 2Y0SB 2JYOA 2HHHQ 1BKBA 1Y8OB 2PZWA 2OCEA 4RKBA 5A35A 2Z0SA 3K57A 1V1PB 4KY7A 2VUMG 4N9TA 4LF7L 1AFPA 3QWNA 1RDPD 1SEBD 3I4LA 3EFXD 5AFWA 1VQHA 3K7UC 3G7LA 2B2VC 1YBYA 5GQOA 4HAEA 4C3JG 3CF5A 4DAVA 2B2YC 2CVRA 3AB9A 3CCEA 4IPCA 5DM73 4RCNA 3OYYA 4LFBQ 3GD7A 1N8RC 3NEMA 4JPBW 2I0QA 4B3SL 4FDBA 2RDFA 1MKHA 1C48A 3DMUA 2VQEL 1GM5A 1O7YA 5JVG3 1PTOD 4LK1C 4ZK9B 4OX9L 2RDHA 1HFGA 4BY7B 1AP0A 1S5CD 1CKMA 5E7NA 3E3XA 5T1GA 2Z6KC 1JJCB 1H9SB 4DFAA 3L0OA 4DXFA 5M3FG 1PH4A 2ZT9C 1PDQA 3GO5A 4MHEA 1X9NA 1EYDA 1F9PA 1IL8A 3E9IA 4HIKA 1G6ZA 2F0HA 1WD1A 1EY9A 3GTPB 2A8VA 1B3QA 3S9WA 5G3LD 1ET6A 4J15A 3M3YB 1V9PA 4A3BG 2EYMA 3GTQH 3S16B 5CV5A 3HOWB 2RHSB 4OX9Q 2Q8IB 3NPPA 2JEAI 4GKJL 1PLFA 5HGQA 2A6ED 3U4ZA 1LT5D 1TS3A 2KA7A 1JOOA 4KV6A 2E2DC 1VQCA 3JAMc 1WFQA 1UUPA 2IY5B 4EQ5A 5ELFA 4LNQA 3H3VH 2F03A 3R2IA 4QUFA 1V43A 1VQKA 2NZHA 4XXEA 1JE4A 3EIVA 4DA2A 2JA5B 1HFNA 2QILA 4OWTB 5M5XB 1PH6A 4JC0A 2F0FA 3GTGB 1I4HA 5EAYA 3V96A 4APVA 4NXNL 3K58A 4A3EH 2D62A 4FF3A 1T5XD 1EZ8A 4HJAA 1SFOH 4IJLA 4QIWE 5J1ZA 3QR8A 4GNXC 1HR0L 1WYDA 2MJ8A 1Q90A 2NVQH 3D31A 3U4VA 4XDXA 3AYHB 3STBD 2B2TA 4XIGS 1IW7C 2F0NA 1DM0B 2OT2A 3CMEA 2CHBD 1HNZL 2X6GA 2WINB 5M5YH 3KFUA 1PRTB 2WIIB 5EKKA 2E76C 2MHVA 4CHTB 5C0XJ 4RFBA 1GUTA 3I7FA 4A3IB 1X3PA 3GTLB 1HR0Q 3PCOB 1JOQA 4UY8C 3SVMA 1VCIA 2Q2HA 3DXJC 4IOAA 1Y14B 5I9PA 3JAME 2HDLA 1SE3A 4LW1A 3K80C 4LUZA 4OO1H 3HFZB 3H0GG 3BZKA 3IAYA 1Z47A 4I7AA 2QCPX 4OWWB 2DJGC 1RJTA 5IT9E 1H9SA 1WD0A 4HSPA 3AFQA 1G91A 5D3IB 5BN3A 4J1MA 4XYQA 3P7JA 3SGIA 1I94L 1CKNB 3CW2C 1V8QA 2B29A 3N52A 3SDZA 3DEOA 1ET9A 1NCVA 2EE1A 5FJ8H 1K8MA 2N55A 2QGQA 1CHPD 2KCTA 5JJLA 1HTPA 4KN4C 3J80c 3PIOA 4IUNA 4JBJA 2LY7A 4KKSA 5FOBB 3PMFA 2QDBA 4ZYSA 1U4MA 4HIMA 2K01A 1VQDA 3Q22A 1Z9FA 5K5PA 1BR9A 1L1OC 2EXDA 1G8ZD 1NSNS 1G6PA 4FXGC 1SFOB 1OXSC 4IJHA 2Z9HA 5CV6A 2UU9L 5JAVA 2KOLA 1G2TA 3HOUH 3R3OA 2GA4B 4LFAQ 3I4NG 1Y1WB 2Q2IA 2EYOA 4DR3L 2ZM6Q 4OIJA 1ENCA 2A6EC 2HT1A 4DUZQ 3ERSX 1V1QA 1N32L 2F4VL 2K5QA 1P16A 4K5XA 1CT1D 1F2ZA 4AYBE 1S5BD 2GVBA 5M3MB 1U4PA 5M5YB 1W6JA 1N36L 3S1NH 4X62Q 2DN8A 4L8JA 2DNCA 2K1BA 4GS3A 4B3TL 3LGJA 3PUVA 3BDCA 4ABNA 4IUVA 2HUGA 3VA5A 3PGZA 4DNTB 3T1HL 1S40A 4HCSA 4A3GG 4ZAIA 1FYCA 4M1UB 5I4DA 4DR3Q 3K5LA 1QWYA 1EIFA 2F4VQ 2MGSA 1NNXA 4KJNA 3NP8A 1SYBA 1QB5D 4AYBG 1N36Q 1C8CA 3J80E 1U4LA 4I65A 2F0WA 1D5ZC 3R93A 1PTOF 1GD7A 2P5ZX 2Z6BA 1Y1VH 4B3TQ 3VR6A 2NUCA 4KY6A 2M00A 5C44B 3QIAA 4ZKBB 3VR4A 4YHHL 1X3QA 1QCBD 1SDFA 5BN5A 1EYCA 2VUMH 5EQ0A 1SMYD 1BQQT 3P1HA 1VF5C 4B3RL 1STAA 4JG2A 2B63B 3K6OA 4HJ5A 4R4TA 2A74C 4DK6C 3J81L 1YIJA 4BBRH 1ASZA 4XQNA 4HIOA 4C3JH 3BVMA 1ML0D 5FK9C 1Q3LA 1F77A 4JI0Q 3L9AX 3IL8A 3HRZC 1N33Q 4EX5A 2UXCQ 1B9NA 1CKNA 3G48A 5EPLA 5AJ3L 2QEXA 1RD9D 3HOUB 1S72A 2R92G 2A69D 2B39A 4RH6A 3WWVA 3OMGA 4JI6Q 1HNWL 4TRDA 4JI5L 3D8GA 4HJ7A 1LYLA 1CM9A 3HOVB 2IJ0A 2B2UA 1KAAA 3HOZG 5M3FH 1LTLA 2KQ3A 5IP9G 1OXTA 2YTXA 1NE3A 4EVOA 3VYUA 2DY8A 4OHJA 3ND9A 3T4AC 1BCPB 1XWEA 5ELEA 4KHPQ 5AJ3Q 1D5MC 2JEBI 3J81c 1ZKOA 2IT1A 2IWHA 3NE5B 4A3BH 1CQVA 1X3FA 2HDMA 4FO2A 4EGVA 4PNYA 1PVOA 2L4NA 2EY6A 2ES2A 2RBMA 1HNWQ 2F0IA 4ZUJA 4JI5Q 4CJ0B 4A3MG 1K3RA 1HQMC 2ENBA 1BBXC 4NP5A 1LTTD 2R61A 3LNNA 1WTOA 2Q8TA 1SN8A 3EROA 3FDTA 4AQYL 5J3BA 4ZRZA 1CZGA 4POGA 4F87A 5LMUQ 3FVQA 1HH2P 2PI2E 3H94A 2J7ZA 1WTRA 3DUZA 4K2LA 5I9OA 4QF4A 3S14B 2K03A 3GP7A 4IPDA 3CCUA 3BVZA 1ICWA 5C4JH 3NUCA 3S15H 5K36G 2LSSA 3B6YA 1SJED 3PUZA 4M8AA 4EQOA 2F0OA 1JB7A 1BUVT 1DXMA 3C46A 2O5IC 2UXBL 4X3TA 4Q5VA 4DAYB 4K6DA 2WB1E 1GUWA 3MAQA 4BBRB 4CDEC 3A56A 1R4PB 2F0KA 4TQUS 2KCNA 3P20A 2UXDQ 1OTCA 4CJ2C 2ZTEA 3FHWA 4A3DG 1D8LA 4DV3Q 2XN9C 1QNUA 1X55A 4A75A 4R9WA 3AMUA 1XJVA 3R2TA 5JEAG 4QJFA 3MFYA 4KKUA 5GROA 3WOEA 3I8ZA 1TWCH 2WP8J 3VDYA 2UXBQ 1TS5A 2AMCB 2L1BA 1EYGA 4PMWA 2Z1CA 4KI0A 2WKDA 3MXNB 3CCQA 4JI3L 1D2BA 1TWHB 3TP5A 3KLWA 1SNPA 2N8NA 3HKSA 1TY2A 1RTNA 3A5ZB 2Q2TA 1FVIA 4A3LH 1FJGQ 2L55A 4A3BB 2JA7G 3OTOL 1W6KA 4IUTA 4L63B 3H0GH 5JVH3 4JOIC 4GKKQ 4POFA 4JI7L 2PNRC 3O13A 2UUAQ 3PO3B 2VL6A 1RODA 4WORA 3BDLA 1RF2D 4OL7A 1J5EL 4JI3Q 4IFDI 2A69C 3TMEA 4PMCA 2K5DA 1Q82C 2XTIA 4PZ8A 4RGMA 1XNQL 3MA2B 4IFDG 4WRDA 4JV5L 1PFSA 4DNRB 2KBNA 2MNAA 3I3CA 2I46A 1FNVA 3P75A 4P2CB 5EKIA 3KF8B 3S2HB 4DV7Q 4JI7Q 1A15A 3PIO3 4PG3A 3X3NA 4R4IA 2OF1A 4R1JA 4OEMB 2EDGA 5D3DA 3LX0A 3VR3A 1J5EQ 1K83B 2B2WA 2CQAA 2PNHA 2G5DA 1EY4A 1Q1BA 3QB3A 2F0VA 2NZ1D 3I4NH 4RHRA 5IYDG 2NVXH 4FVMA 2ZJRA 1XNQQ 3RLNA 2BE5C 1VQ5A 1KNAA 2A73B 2EYFA 1OXVA 4ZCKA 2FXQA 4A3JB 2EY5A 2DY7A 2RA4A 3EQLC 4NXMQ 2K5NA 3KLRA 1IKLA 4JCVE 3BS1A 3OMCA 4DAYA 4Y7NH 3CC2A 3GTJB 4ZLTF 2K33A 2R7ZG 2NVYH 1SLJA 4CKEA 1HZAA 1LTGD 5E4WC 1TXYA 4QIWB 2XWBB 4HMIA 2D0OA 3I91A 1K73C 4A3GH 4BXXG 2IW3A 4K8JA 2VS1A 4KN7C 5KNDA 2E2HH 1GUSA 3T51B 1SNDA 2A6HC 3NTIA 5FLXc 4OONA 1X3GA 4LF5L 4C1NI 1SE2A 1PZKD 4CJ1B 3TP8A 3S1QB 2RCFA 4G7HC 1SYCA 3I2ZA 4OWXB 1J9OA 4A3FG 4HEDA 1YNND 1VQGA 4ALPA 1Q12A 1XXGA 3MXNA 4GOPC 4P73A 5C4XB 1TWFH 4NDXA 2JA8G 4PZ7A 1QVCA 1DJRD 1IYJB 5IP7H 3M4YA 4JI8L 4QY7A 4UAIA 4HR7B 1T5EA 4PZ6A 5C0XI 3PIPA 2Q8RE 4A93G 4LF9L 2PW5A 4JI1Q 2HHHL 5A2QL 5CV9A 5LMNW 1ILQA 1W2BA 4LF5Q 5C3EB 2R3ZA 1FGBD 5C0XG 3NSWA 1I4XA 4MTNA 3G71A 3CRLC 3FEWX 4ZQ3A 5HGTA 3T53B 4UDUC 1SXTA 2I5HA 2ZJPA 1MJEA 1SNCA 2Z4IA 1II3A 3CPFA 1KLUD 2R92H 1EY6A 3I4NB 2RCNA 2YV5A 5CBEE 1B44D 3K0XA 2NVXB 2MP1A 5CGKA 4C3HG 2KEDA 2RVLA 1E24A 4DV0Q 1HHVA 1X65A 1YJWA 2UUBQ 1DYQA 3KLSA 3BZCA 4DV2L 3HOZH 1EY8A 3KUPA 1B3AA 1YHBA 1A2UA 1FNWA 1EY5A 3KF8A 5IP9H 5EBDA 2XGTA 1GUNA 1UWVA 1A3VA 1CFMA 1PZJD 1WOCA 2NVYB 3AU7A 5FLXE 1VQIA 4XT1B 3HOYH 3W1BA 3TQYA 2X69A 4I7ZC 4RHSA 1AZPA 1JICA 1JR0D 3D3RA 1SR3A 4TSSA 4A3GB 3GTMH 1ENAA 2R7FA 3NBHB 2VW9A 4ME3A 4DR4L 2E2HB 1IBLQ 1QG7A 3C3LA 4A3KG 1NAPA 3U50C 3DWPA 5I2YA 3K5NA 3GTKB 1TWAB 1X56A 2AQ3B 4AYBB 5M9OA 4DV2Q 5C6AA 5I2XA 1AW7A 1JMCA 3FRPB 4IFDJ 2K5WA 1TY0A 3RN5A 1TWFB 4KTAA 4DV1Q 1XMQL 1RCVD 4C3IG 1KDAA 3W3AA 4BBSG 2XSCA 5IODA 4YCWA 5C3WA 3SE0A 4R4QA 1I6VC 1TKWB 5K36H 3A74A 1EWCA 1SAPA 1O7ZA 4YWKA 4DR4Q 4MN3A 1MSGA 1BXTA 3GTOB 5D65A 2O5JC 2RDGA 4IPHA 1KXLA 3CC4A 1ONLA 3MVVA 1JWUD 5M5WH 2LXJA 4GOPA 3RLFA 1GHKA 1PH5A 1D1IA 3NWTA 2F0UA 5ELCA 1XMQQ 4A3DH 1EQRA 3OSOA 1C7YA 2HIVA 2EYHA 3I72A 1WCMB 1STGA 2AWNA 3W1GA 1KIXA 1VQFA 3N6RA 3NENA 5JEAH 1VQPA 1PTOH 5C4ZA 1E0BA 3HKZE 1S4ZA 1PV4A 1JB3A 3K5MA 5FO7B 1VQLA 2JK8A 1GXDC 1XTCD 1JORA 2NB0A 5DAUA 1TWGH 3G4SA 1WTWA 1K8AC 1YJ9A 1N9WA 3HOYB 4DV4Q 5IYCG 1GO3E 2O2LD 2K50A 3TP7A 4GNXB 2VZAA 4H0LC 5BN4A 4BY1G 4UP9A 2F0QA 3M7NA 1MBYA 1VMPA 3J7AF 3SK6A 2E2JH 2GN5A 4KJOA 5CORA 4RGTA 4JW0A 3DWAA 3HKZG 2JA6G 3HOXG 4LF8Q 4GN4B 4E6IA 1M1KC 3KJOA 1Z6HA 1LLRD 2J0TD 2EXZA 1VMCA 2VB2X 4JYAQ 1QZHA 2B2VA 4IFDH 2B2YA 1KDCA 1KL9A 4N9PA 1XYIA 2PZTA 2VQFQ 1EWHA 1EQQA 2KENA 2OXPA 3NBHA 1PH8A 4GLAC 1B9MA 1I4GA 4IUUA 5DNFA 4H7BA 5I6WA 3E5SA 4KKTA 4ZUIA 1OXXK 3GTQB 2VNUD 1Y8NB 1FGUA 2C5CA 4IUQA 1N34L 3NHHA 4GLVB 4AIMA 5EPJA 2DJFC 5ELDA 2Z6KA 3CHBD 1W3SA 5IYDH 4A3DB 1Q86C 3JAMi 3E9HA 2BA1A 1PYSB 1WTPA 3EVQA 1PTOC 3FKIG 1TIID 4LFAL 1MGSA 1JE5A 2ZM6L 4L5SA 4DPGA 2ZJQA 4DUZL 1SROA 1BBWA 4LJZC 2WB1B 1WJJA 2AUJD 2F3IA 1ZXTA 4YWMA 2IX0A 3FPUB 3I4MG 4O42A 1S5ED 1L1OB 4GN3B 3VYSA 1WTVA 1N34Q 3PUYA 1LACA 4X62L 4BXXH 4A3EB 1XX8A 1EQTA 2HCIA 5IGEA 2RSNA 3CMAA 2NVQB 2Y0SE 2E2JB 4QL5A 2IX1A 4GN5A 1BCPD 1EYAA 3PF4A 2SNSA 5IOCA 4A3FH 3UDFA 4A76A 4PMBA 2J4XA 1PH2A 3U9SA 1CI3M 5CV7A 2K28A 4CBVA 2KHIA 2ATWA 1S5FD 1ENFA 3PUXA 1SE8A 1Q8IA 2ZXRA 4LUVA 1HXYD 2XVSA 3NTHA 2PPBC 5KNBA 3QG1A 1BO0A 1QVGA 3CCLA 4XTCS 1Y8PB 4GNXA 3K59A 3I56A 2E2IH 1KNEA 1HA5A 2WAQB 1A3TA 3TS0A 5C0XH 3I73A 2FINB 2Y0SG 1PRTF 3E0JA 1GHJA 3PIP3 4QGUA 3M85A 2OTLA 3K8AA 2R93G 5IYBG 3L7ZC 4X3KA 1SYGA 1XTDA 1MSHA 3CCRA 2EY2A 1UE5A 3KYHC 3TEHB 4JI0L 4ODGA 1N33L 3OOCA 4QQBX 3STBC 4C3HH 4O0AA 2UXCL 3OWEB 3K0YA 2KVMA 4H02A 3SK5A 1D7QA 3OIQA 1B70B 4FF1A 3PO2G 2SDFA 2MO0A 3I4OA 5HURA 1EZ6A 1RHPA 3HG9A 1KC8C 4JI6L 4FXDA 2VXWA 2BH2A 3MXGA 4JI4L 4JBMA 1F9QA 3CKIB 1R9TH 2AQ1B 5EBCA 4CDDC 3TSSA 5FO8B 4BY7G 1NR4A 2A68D 1EY0A 2OTJA 1WTHA 3M4QA 5H1SE 1LT6D 3CCMA 1ZYRD 4DUYQ 4JI2Q 2XRSD 2PI2A 5BR8Q 4A3KH 1NMFA 4KHPL 1XPRA 3M7GA 3ER0A 1IYVA 5JJZA 4UP8A 3SEBA 2XRQD 4MZ9A 2LMCB 3EBEA 2ICEC 3GDEA 4JI4Q 4CDCC 1VQ8A 2FFKB 2F0PA 3HOWG 4BBSH 1J6QA 2D0PA 3V05A 1L1OA 3CQZH 2I07B 3S1NB 2ZXPA 4KHZA 2RHQB 4DKAC 1B53A 1EEID 2E75C 4DN4M 5LMUL 3RZOH 3BYTB 1UE1A 2WACA 2E2IB 1HZCA 5EPKA 3EA6A 2AKWB 3NBIA 3SHLA 1NTGA 2BOSA 2PQAB 4U68A 1C0AA 3NWSA 4NW2A 1EIHA 5L37A 3AFPA 4YWLA 4RGOS 4X64Q 1VS0A 4CKBA 2JA5G 1STNA 1QJOA 2UXDL 3CCVA 3S17H 1K28A 2O4XA 3OW2A 4C3HB 1Y1VB 2WFWA 1F2MA 4DV3L 1U5KA 2VUMB 1VQMA 1U0LA 2K5HA 1U9RA 4X66L 3H09A 3MXPA 4YY3Q 5E3FA 2QEJC 2RQXA 1L0YB 4LFCL 5IYCH 4DNIA 2KJXA 4OGQC 4C3JB 4BY1H 1KLGD 4L5RC 4DR5Q 3DM3A 1S5DD 1X6OA 3BVGA 1CHQD 1YNJD 2AQ2B 1EEFD 2IL8A 3ITPA 2V1CC 1DD2A 1NMGA 2EZVA 4A3KB 1NY4A 2K6AA 3F2DA 4A3IG 1FJGL 4KK7A 1PA6A 1MI2A 3J7YW 4X3SA 2F0SA 3HOXH 1BVSA 2B8FA 4F7XA 2NYZD 3VYRA 4X66Q 2YU9H 3UDGA 4GKKL 1BDOA 3QOLA 4Q0FA 2UUAL 4LFCQ 3J81E 5M3FB 1Q8KA 2Z4HA 1UEAB 4DU9A 1HUNA 1NR2A 2KHJA 5KNCA 4IPGA 2EQSA 3TBIB 1SMYC 3RZOB 2N88A 2IX3A 3KJPA 3RMHA 3F2BA 3C1EA 5FKAC 2CCZA 4HJ8A 4P71A 3A55A 3M4OH 3CAMA 2QKIC 2A68C 1B1ZA 1STYA 1Q46A 3KK7A 4DV7L 3NK9A 3CP0A 1H9JA 4DV6Q 5LMNL 1EQVA 1G2SA 3ONAB 1BCPF 2JXMB 3D4WA 1QE6A 1DOMA 3QJYA 2BH8A 3FKIH 3I90A 1ESRA 1RIPA 4G7OC 3ZYYX 3NTKA 5LL6X 2NWGA 1K0RA 2PQAA 4NXML 5C4JB 2IHFA 1LT3D 1Y1WG 1Y69U 3S15B 3I4MH 1I4QA 4LF6Q 4X3UA 4DR1Q 1YITA 4P74A 4DR6Q 5LMNQ 1O7LA 4U673 5M3MG 3MFGA 4LAAA 2K4KA 1VDZA 4YCVA 1QUQB 5IGGA 4Y52H 2XWJB 4RKLA 4DK3C 1JC7A 5KYLA 1YNXA 3HKZB 1TR5A 5C5MA 2BA0A 2F0TA 1D1KA 2MFIA 3A8IE 1B2TA 1JWMD 5KRUA 2YU9B 4OIKA 3Q24A 2ASBA 1D6EC 1TWCB 4ME5A 4RGNA 3S1MH 4G57A 1X54A 1O7IA 3DM1A 3HGBA 1X32A 5GAEC 3TRZA 2MPMA 2QW7A 3J7ZC
chains in the Genus database with same CATH topology
1L1OC 2EXDA 1PH3A 4HJ9A 1G6PA 2CWAA 4IPHA 4B3MQ 1HZBA 1OXSC 4IJHA 3CC4A 1KXLA 1Q81C 3PO3H 2UU9L 1B7YB 5M5WH 2LXJA 4GOPA 4JBWA 3RLFA 3HOUH 2F52A 5C44G 1PH5A 5DLQE 1IBML 4R4OA 3BU2A 4LFAQ 3ULJA 4DAMA 1JJ2A 3I4NG 2EIFA 2Q2IA 4JI1L 2ZM6Q 4DR3L 1NJIC 1XMQQ 4A3CH 2HT1A 3A5UA 4DUZQ 1AE2A 5IYBH 1EQRA 1V1QA 3ERSX 1C7YA 2HIVA 2F4VL 4A3DH 1Q7YC 1N32L 1KRSA 1P16A 4AYBE 2AWNA 3K7AH 3W1GA 3ULPA 1KIXA 2B63G 1VQFA 3NENA 1VQPA 2GVBA 1E1TA 2IHEA 4UPAA 4GOPB 3HKZE 1N36L 4C2MH 3S1NH 1PV4A 2AWOA 3IRBA 2JA6H 4X62Q 1H95A 1GKHA 4NPSA 2E8GA 3RLOA 1VQLA 2JK8A 4GS3A 1VQ6A 1IZ6A 4L5TA 3I55A 4B3TL 3S2HH 2JJQA 3LGJA 3PUVA 1VQNA 1CSQA 1VQ4A 4WJ3M 3PGZA 3PO2H 3MEFA 1TWGH 4DV6L 2LXKA 3G4SA 3RNUA 3T1HL 1S40A 1K8AC 1IBMQ 1YJ9A 4A3GG 3HOUG 3L2PA 4DV0L 1N9WA 4AQYQ 2L15A 4DV4Q 1VQBA 4DR3Q 5IYCG 1GO3E 1K83H 1HJPA 4LUOA 2JE6I 4DR2Q 2UUBL 1WI5A 2K50A 4JOIA 4GNXB 2VZAA 4BY7H 1EIFA 5FLMG 3Q8DA 4UP9A 4BY1G 3J81j 2GVAA 4R4CA 2F4VQ 3M7NA 3J81i 1UE7A 3H3VI 4AYBG 3HOVG 4A3JH 2GN5A 2E2JH 1E22A 2YYZA 1N36Q 2AHOB 1Q1EA 3HKZG 4NB3A 2JA6G 3UE1A 1GD7A 3EN2A 1Y1VH 3GTJH 3HOXG 4B3TQ 4LF8Q 4GN4B 1EIYB 4LF6L 1A62A 1G51A 4YHHL 1EUJA 1M1KC 3KJOA 2WB1G 4JBKA 1HZ9A 1KAWA 4DR1L 1EFWA 1IBLL 2VUMH 4KLKA 2ZTCA 4DR6L 1L2FA 1G291 4JYAQ 3M3YH 1QZHA 4B3RL 5ELNA 5GADC 1MIUA 4JG2A 3S16H 1CSPA 4HJ5A 4R4TA 2JQOA 2NVTH 3HOWH 3KDFA 4DK6C 1VQJA 4A3EG 1KL9A 1PH9A 4UP7A 2VQFQ 1UEBA 3KF6B 2KENA 4BBRH 4RG1A 1YIJA 1EQQA 1ASZA 3K81C 2ZTDA 1PH8A 4P72A 2WAQE 4GLAC 4HIOA 4C3JH 2N49A 4DV1L 4DR4Q 2QA4A 3S1QH 4JI0Q 1N33Q 4EX5A 3W5OA 1OXXK 2UXCQ 1E1OA 1EOVA 1CKNA 1QUQA 2PMZE 3F8TA 3G48A 5AJ3L 2QEXA 2VNUD 1FGUA 1S72A 5C4XH 1N34L 2R92G 4GLVB 4AIMA 3S2DH 2Z6KA 1W3SA 2DUDA 1RL2A 3WWVA 1S3OA 2UUCL 5IYDH 4JI6Q 1Q86C 3JAMi 1HNWL 4A3MH 3E9HA 2JA5H 2BA1A 4JI5L 5JJKA 5M5XH 1PYSB 1LYLA 3NELA 4HJ7A 3GTGH 3HOZG 1IBKQ 1X3EA 5M3FH 2K5VA 1LTLA 1KQSA 3FKIG 3OTOQ 4BBRG 5IP9G 1I50H 4LFAL 1JE5A 1OXTA 2YTXA 2ZM6L 1NE3A 4L5SA 2WAQG 2OQ0A 5C3EH 4DPGA 2ZJQA 4DUZL 1XPUA 1I3QH 1SROA 1BBWA 4OO1I 1WJJA 3JC66 2F3IA 4KHPQ 1PYBA 4YWMA 2IX0A 2JEBI 5AJ3Q 3CPWA 3J81c 3I4MG 2IT1A 3CCSA 4A3BH 1FL0A 1L1OB 4GN3B 1N34Q 2CKZB 4OO1G 1X3FA 3PUYA 4X62L 4BXXH 1SRUA 3T1YL 1PVOA 2ES2A 2UUCQ 1HNWQ 2I5LX 2K52A 4HIDA 4LF7Q 2DGYA 4JI5Q 3A0JA 3CMAA 1K3RA 4A3MG 2NZOA 4JV5Q 2Y0SE 4K0KL 4QL5A 2IX1A 4GN5A 3PF4A 1SN8A 4AQYL 4DV4L 5FJ8G 2K14A 4DR2L 5J3BA 4A3FH 4A3IH 2I5MX 4POGA 3UDFA 4A76A 1KHIA 5LMUQ 3GTLH 1HH2P 2MQHA 3UDIA 1PH2A 1C9OA 2PI2E 2KHIA 3F1ZA 1HNXL 2ATWA 4BA1I 4B3SQ 3PUXA 1SE8A 4IPDA 4LUVA 3CCUA 4DR7L 5C4JH 5K36G 1QVGA 3S15H 2LSSA 3B6YA 3PUZA 1YJNA 1JB7A 2VQEQ 2YTVA 3T1YQ 3CCLA 4XTCS 2UXBL 1XMOL 4GNXA 4LF8L 4DAYB 2WB1E 3I56A 2E2IH 5JJIA 2CQOA 5ELOA 3PO3G 3M9BA 1VQAA 3TS0A 4TQUS 2CWPA 4K0KQ 4JYAL 2A19A 2HQLA 2UXDQ 2Y0SG 4A4IA 3GTKH 1TWAH 1OTCA 2ZTEA 3D0FA 4QGUA 4LF4L 3FHWA 1BBUA 4L5QA 3M85A 2OTLA 3K8AA 4A3CG 2VQFL 2JA7H 4A3DG 2N3SA 1D8LA 5IYBG 3L7ZC 4DV3Q 1XNRL 2R93G 1XTDA 1X55A 1E3PA 1IXRA 4A75A 1HNXQ 3CCRA 1XJVA 1KD1C 3S24A 5JEAG 4DR7Q 4QJFA 5IT9c 1UE5A 4IOAA 1AH9A 5GROA 1OXUA 1P8LA 1UE6A 4BA2I 1JT8A 1TWCH 3KYHC 3TEHB 2WP8J 3VDYA 4JI0L 1N33L 4QQBX 2UXBQ 3STBC 2NN6I 4C3HH 4O0AA 1XMOQ 2UXCL 4H02A 2AMCB 3KF6A 1EYGA 4PMWA 2HIXA 4GKJQ 1K8GA 2R93H 4KI0A 3CCQA 3MXNB 1VQ7A 1B70B 1XPOA 2H5XA 3GTPH 3E0EA 4JI3L 3PO2G 3GTOH 2NN6G 1VQ9A 2ID0A 2MO0A 3I4OA 3AEVA 3KLWA 1EWIA 2N8NA 3DLLA 1KC8C 4JI6L 1D7QA 3HKSA 2BH2A 4JI4L 3S1RH 4JBMA 3A5ZB 3H15A 4LF4Q 1R9TH 2Q2TA 1FVIA 4A3LH 3PF5A 1FJGQ 1XNRQ 1IBKL 4BY7G 1Y1WH 1VQOA 2JA7G 5JEAJ 3OTOL 2OTJA 2N78A 4RMFA 3M4QA 5H1SE 3CCMA 3H0GH 4A3JG 4DUYQ 1WCMH 4JI2Q 4JOIC 1I5FA 3PSIA 4JI8Q 4POFA 1E7ZA 4GKKQ 4LFBL 3UDXA 4JI7L 2PI2A 5M3MH 5BR8Q 2UUAQ 4A3KH 1NMFA 1YHAA 2VL6A 1XPRA 2MO1A 4KHPL 1Y1VG 3ER0A 1VQEA 4NXNQ 4LF9Q 1A8VA 2HHHQ 1BKBA 2OCEA 1J5EL 1I6HH 4JI3Q 4UP8A 4IFDI 3TREA 2Z0SA 4MZ9A 2VUMG 4MNOA 3EBEA 1Q82C 3GDEA 2XTIA 4PZ8A 4LF7L 4JI4Q 1XNQL 1VQ8A 4IFDG 3HOWG 4BBSH 1J6QA 1M90C 2D0PA 4A3LG 1PFSA 4JV5L 2KBNA 1L1OA 1LM0A 1VQHA 3CQZH 3K7UC 2MNAA 2R6GA 4KHZA 1YBYA 5GQOA 2E5LL 2RHQB 4DKAC 3ICEA 4OXPA 3CF5A 3KF8B 3CCEA 4IPCA 5LMUL 4DV7Q 3RZOH 3OYYA 1HNZQ 1UE1A 4LFBQ 4JI7Q 3GD7A 1N8RC 3RZDH 3NEMA 2R7ZH 2I0QA 3CCJA 1HZCA 4PG3A 4R4IA 2AKWB 4FDBA 4R1JA 4B3SL 1YVCA 1NTGA 1MKHA 1J5EQ 2PQAB 3TS2A 5C4XG 2ALYB 4IO9A 1K9MC 2VQEL 1GM5A 2PNHA 2R7DA 5C44H 1LUZA 1Q1BA 1C0AA 4OX9L 1KRTA 3I4NH 5IYDG 3AFPA 2B3GA 4YWLA 2NVXH 2ZJRA 1XNQQ 3RLNA 1CKMA 4X64Q 3CD6A 1VS0A 5E7NA 1VQ5A 2JA5G 1OXVA 2FXQA 2Z6KC 1JJCB 3RN2A 2B63H 4NXMQ 3L0OA 2K5NA 4O2DA 3CCVA 5M3FG 1PH4A 3S17H 2UXDL 2E5LQ 5IWAL 3OW2A 4JCVE 4AH6A 3GO5A 4Y7NH 3CC2A 4GLXA 5C3EG 1X9NA 2WFWA 3E9IA 4HIKA 4DV3L 2JA8H 1YI2A 2A8VA 4X6AH 2R7ZG 1JJGA 2NVYH 1SLJA 1AE3A 1U5KA 1VQMA 1U0LA 2K5HA 4J15A 4X66L 1GVPA 1HZAA 1IL2A 1V9PA 1CUKA 1TXYA 3GTQH 4A3BG 4YY3Q 1I94Q 2D0OA 1YHQA 1K73C 4A3GH 2RHSB 4BXXG 4OX9Q 4LFCL 4A93H 2VS1A 4YCUA 5IYCH 2JEAI 4GKJL 4DNIA 5HGQA 2E2HH 3U4ZA 4X65L 3PUWA 5FLMH 4BY1H 5FLXc 4L5RC 4DR5Q 4OONA 3DM3A 1X6OA 1X3GA 2A1AA 4LF5L 4WJ4A 1ASYA 1VQCA 2V1CC 5IWAQ 3JAMc 3HOVH 1WFQA 3I2ZA 4OWXB 1NMGA 3J7A5 2IY5B 4EQ5A 4A3FG 1NY4A 3F2DA 4A3IG 1PHJA 1FJGL 2RF4A 1PA6A 1HR0W 3G6EA 1VQGA 4ALPA 1Q12A 4GOPC 4LWCA 4P73A 1TWFH 3HOXH 1BVSA 4LNQA 2JA8G 3H3VH 4PZ7A 1T9HA 1QVCA 1V43A 4X66Q 1IYJB 5IP7H 1VQKA 2YU9H 3PV0A 4DUYL 3UDGA 4JI2L 2NZHA 4JI8L 4IOCA 2UU9Q 4GKKL 1NBWA 4QY7A 1YEZA 1A0IA 3EIVA 4OWTB 1PH6A 5BR8L 2UUAL 3ZJYC 4LFCQ 4JC0A 4PZ6A 5C0XI 5GAHC 5EAYA 3PIPA 4APVA 4NXNL 4A93G 4LF9L 1Q8KA 3AQQA 4JI1Q 2HHHL 4A3EH 2D62A 3J80i 4X65Q 5LMNW 1W2BA 2KHJA 4HJAA 1N32Q 1SFOH 4IJLA 4QIWE 4LF5Q 4IPGA 2EQSA 5C0XG 1PH1A 1HR0L 4GNXC 4MTNA 1CKOA 1WYDA 1QZGA 2NVQH 3KJPA 3G71A 3F2BA 1DGSA 3D31A 2CCZA 3U4VA 4P71A 4HJ8A 3AYHB 2I5HA 3STBD 2ZJPA 5GAGC 3M4OH 3CAMA 1MJEA 2Q2UA 4XIGS 1Q46A 3CPFA 3U58A 2R92H 5IP7G 3CMEA 2RCNA 2YV5A 4DV7L 1HNZL 3K0XA 3CP0A 4DV6Q 3T1HQ 3S14H 4DV5L 5LMNL 5M5YH 3KFUA 1L0WA 1E24A 2VY3A 4DV0Q 1YZ6A 1X65A 1YJWA 2UUBQ 3BJUA 3BZCA 4DV2L 2OWOA 3HOZH 1SMXA 5C0XJ 3I7FA 1YHBA 2BH8A 3FKIH 5IP9H 1A63A 1HR0Q 3PCOB 2KCMA 2XGTA 4UY8C 1UWVA 1VCIA 4P75A 4C3IH 4X64L 1WOCA 2Q2HA 1RIPA 1PH7A 1VQIA 3HOYH 3W1BA 3TQYA 1K0RA 1Y14B 2PQAA 2K75A 5IE8A 2IHFA 1Y1WG 4NXML 1SR3A 3KDFB 3I4MH 5HY6A 3GTMH 4LF6Q 2R7FA 4LW1A 3K80C 4LUZA 4YHHQ 2CFMA 3HFZB 3H0GG 3NBHB 2VW9A 1WCMG 3BZKA 4ME3A 4DR1Q 1YITA 4DR4L 1Z47A 4P74A 4DV5Q 1IBLQ 5LMNQ 4DR6Q 3CXCA 5M3MG 4OWWB 3ULLA 4A3KG 4B3RQ 3AFQA 4B3ML 1MJCA 3U50C 3KOJA 4TVAB 1X56A 2K4KA 3CC7A 4YCVA 4DV2Q 1QUQB 3FP9A 1CKNB 3CW2C 3RR5A 3SGIA 2B29A 4YY3L 1I94L 1JMCA 4Y52H 3UE0A 2JA9A 2C35B 4DK3C 3F2CA 5FJ8H 1YNXA 3M4PA 5IY0A 4IFDJ 2BA0A 2KCTA 2QGQA 3RN5A 5JJLA 4DV1Q 1TWHH 2MFIA 1XMQL 2OQKA 3J80c 3PIOA 4JBJA 4BBSG 4DR5L 3HOYG 2ASBA 4YCWA 4HIMA 1QVFA 3S1MH 1VQDA 1X54A 1O7IA 2YTYA 4R4QA 5GAEC 1Z9FA 3TRZA 3A74A 3J7ZC 1B8AA 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O C;  2EXD A;  1PH3 A;  4HJ9 A;  1G6P A;  2CWA A;  4IPH A;  4B3M Q;  1HZB A;  1OXS C;  4IJH A;  3CC4 A;  1KXL A;  1Q81 C;  3PO3 H;  2UU9 L;  1B7Y B;  5M5W H;  2LXJ A;  4GOP A;  4JBW A;  3RLF A;  3HOU H;  2F52 A;  5C44 G;  1PH5 A;  5DLQ E;  1IBM L;  4R4O A;  3BU2 A;  4LFA Q;  3ULJ A;  4DAM A;  1JJ2 A;  3I4N G;  2EIF A;  2Q2I A;  4JI1 L;  2ZM6 Q;  4DR3 L;  1NJI C;  1XMQ Q;  4A3C H;  2HT1 A;  3A5U A;  4DUZ Q;  1AE2 A;  5IYB H;  1EQR A;  1V1Q A;  3ERS X;  1C7Y A;  2HIV A;  2F4V L;  4A3D H;  1Q7Y C;  1N32 L;  1KRS A;  1P16 A;  4AYB E;  2AWN A;  3K7A H;  3W1G A;  3ULP A;  1KIX A;  2B63 G;  1VQF A;  3NEN A;  1VQP A;  2GVB A;  1E1T A;  2IHE A;  4UPA A;  4GOP B;  3HKZ E;  1N36 L;  4C2M H;  3S1N H;  1PV4 A;  2AWO A;  3IRB A;  2JA6 H;  4X62 Q;  1H95 A;  1GKH A;  4NPS A;  2E8G A;  3RLO A;  1VQL A;  2JK8 A;  4GS3 A;  1VQ6 A;  1IZ6 A;  4L5T A;  3I55 A;  4B3T L;  3S2H H;  2JJQ A;  3LGJ A;  3PUV A;  1VQN A;  1CSQ A;  1VQ4 A;  4WJ3 M;  3PGZ A;  3PO2 H;  3MEF A;  1TWG H;  4DV6 L;  2LXK A;  3G4S A;  3RNU A;  3T1H L;  1S40 A;  1K8A C;  1IBM Q;  1YJ9 A;  4A3G G;  3HOU G;  3L2P A;  4DV0 L;  1N9W A;  4AQY Q;  2L15 A;  4DV4 Q;  1VQB A;  4DR3 Q;  5IYC G;  1GO3 E;  1K83 H;  1HJP A;  4LUO A;  2JE6 I;  4DR2 Q;  2UUB L;  1WI5 A;  2K50 A;  4JOI A;  4GNX B;  2VZA A;  4BY7 H;  1EIF A;  5FLM G;  3Q8D A;  4UP9 A;  4BY1 G;  3J81 j;  2GVA A;  4R4C A;  2F4V Q;  3M7N A;  3J81 i;  1UE7 A;  3H3V I;  4AYB G;  3HOV G;  4A3J H;  2GN5 A;  2E2J H;  1E22 A;  2YYZ A;  1N36 Q;  2AHO B;  1Q1E A;  3HKZ G;  4NB3 A;  2JA6 G;  3UE1 A;  1GD7 A;  3EN2 A;  1Y1V H;  3GTJ H;  3HOX G;  4B3T Q;  4LF8 Q;  4GN4 B;  1EIY B;  4LF6 L;  1A62 A;  1G51 A;  4YHH L;  1EUJ A;  1M1K C;  3KJO A;  2WB1 G;  4JBK A;  1HZ9 A;  1KAW A;  4DR1 L;  1EFW A;  1IBL L;  2VUM H;  4KLK A;  2ZTC A;  4DR6 L;  1L2F A;  1G29 1;  4JYA Q;  3M3Y H;  1QZH A;  4B3R L;  5ELN A;  5GAD C;  1MIU A;  4JG2 A;  3S16 H;  1CSP A;  4HJ5 A;  4R4T A;  2JQO A;  2NVT H;  3HOW H;  3KDF A;  4DK6 C;  1VQJ A;  4A3E G;  1KL9 A;  1PH9 A;  4UP7 A;  2VQF Q;  1UEB A;  3KF6 B;  2KEN A;  4BBR H;  4RG1 A;  1YIJ A;  1EQQ A;  1ASZ A;  3K81 C;  2ZTD A;  1PH8 A;  4P72 A;  2WAQ E;  4GLA C;  4HIO A;  4C3J H;  2N49 A;  4DV1 L;  4DR4 Q;  2QA4 A;  3S1Q H;  4JI0 Q;  1N33 Q;  4EX5 A;  3W5O A;  1OXX K;  2UXC Q;  1E1O A;  1EOV A;  1CKN A;  1QUQ A;  2PMZ E;  3F8T A;  3G48 A;  5AJ3 L;  2QEX A;  2VNU D;  1FGU A;  1S72 A;  5C4X H;  1N34 L;  2R92 G;  4GLV B;  4AIM A;  3S2D H;  2Z6K A;  1W3S A;  2DUD A;  1RL2 A;  3WWV A;  1S3O A;  2UUC L;  5IYD H;  4JI6 Q;  1Q86 C;  3JAM i;  1HNW L;  4A3M H;  3E9H A;  2JA5 H;  2BA1 A;  4JI5 L;  5JJK A;  5M5X H;  1PYS B;  1LYL A;  3NEL A;  4HJ7 A;  3GTG H;  3HOZ G;  1IBK Q;  1X3E A;  5M3F H;  2K5V A;  1LTL A;  1KQS A;  3FKI G;  3OTO Q;  4BBR G;  5IP9 G;  1I50 H;  4LFA L;  1JE5 A;  1OXT A;  2YTX A;  2ZM6 L;  1NE3 A;  4L5S A;  2WAQ G;  2OQ0 A;  5C3E H;  4DPG A;  2ZJQ A;  4DUZ L;  1XPU A;  1I3Q H;  1SRO A;  1BBW A;  4OO1 I;  1WJJ A;  3JC6 6;  2F3I A;  4KHP Q;  1PYB A;  4YWM A;  2IX0 A;  2JEB I;  5AJ3 Q;  3CPW A;  3J81 c;  3I4M G;  2IT1 A;  3CCS A;  4A3B H;  1FL0 A;  1L1O B;  4GN3 B;  1N34 Q;  2CKZ B;  4OO1 G;  1X3F A;  3PUY A;  4X62 L;  4BXX H;  1SRU A;  3T1Y L;  1PVO A;  2ES2 A;  2UUC Q;  1HNW Q;  2I5L X;  2K52 A;  4HID A;  4LF7 Q;  2DGY A;  4JI5 Q;  3A0J A;  3CMA A;  1K3R A;  4A3M G;  2NZO A;  4JV5 Q;  2Y0S E;  4K0K L;  4QL5 A;  2IX1 A;  4GN5 A;  3PF4 A;  1SN8 A;  4AQY L;  4DV4 L;  5FJ8 G;  2K14 A;  4DR2 L;  5J3B A;  4A3F H;  4A3I H;  2I5M X;  4POG A;  3UDF A;  4A76 A;  1KHI A;  5LMU Q;  3GTL H;  1HH2 P;  2MQH A;  3UDI A;  1PH2 A;  1C9O A;  2PI2 E;  2KHI A;  3F1Z A;  1HNX L;  2ATW A;  4BA1 I;  4B3S Q;  3PUX A;  1SE8 A;  4IPD A;  4LUV A;  3CCU A;  4DR7 L;  5C4J H;  5K36 G;  1QVG A;  3S15 H;  2LSS A;  3B6Y A;  3PUZ A;  1YJN A;  1JB7 A;  2VQE Q;  2YTV A;  3T1Y Q;  3CCL A;  4XTC S;  2UXB L;  1XMO L;  4GNX A;  4LF8 L;  4DAY B;  2WB1 E;  3I56 A;  2E2I H;  5JJI A;  2CQO A;  5ELO A;  3PO3 G;  3M9B A;  1VQA A;  3TS0 A;  4TQU S;  2CWP A;  4K0K Q;  4JYA L;  2A19 A;  2HQL A;  2UXD Q;  2Y0S G;  4A4I A;  3GTK H;  1TWA H;  1OTC A;  2ZTE A;  3D0F A;  4QGU A;  4LF4 L;  3FHW A;  1BBU A;  4L5Q A;  3M85 A;  2OTL A;  3K8A A;  4A3C G;  2VQF L;  2JA7 H;  4A3D G;  2N3S A;  1D8L A;  5IYB G;  3L7Z C;  4DV3 Q;  1XNR L;  2R93 G;  1XTD A;  1X55 A;  1E3P A;  1IXR A;  4A75 A;  1HNX Q;  3CCR A;  1XJV A;  1KD1 C;  3S24 A;  5JEA G;  4DR7 Q;  4QJF A;  5IT9 c;  1UE5 A;  4IOA A;  1AH9 A;  5GRO A;  1OXU A;  1P8L A;  1UE6 A;  4BA2 I;  1JT8 A;  1TWC H;  3KYH C;  3TEH B;  2WP8 J;  3VDY A;  4JI0 L;  1N33 L;  4QQB X;  2UXB Q;  3STB C;  2NN6 I;  4C3H H;  4O0A A;  1XMO Q;  2UXC L;  4H02 A;  2AMC B;  3KF6 A;  1EYG A;  4PMW A;  2HIX A;  4GKJ Q;  1K8G A;  2R93 H;  4KI0 A;  3CCQ A;  3MXN B;  1VQ7 A;  1B70 B;  1XPO A;  2H5X A;  3GTP H;  3E0E A;  4JI3 L;  3PO2 G;  3GTO H;  2NN6 G;  1VQ9 A;  2ID0 A;  2MO0 A;  3I4O A;  3AEV A;  3KLW A;  1EWI A;  2N8N A;  3DLL A;  1KC8 C;  4JI6 L;  1D7Q A;  3HKS A;  2BH2 A;  4JI4 L;  3S1R H;  4JBM A;  3A5Z B;  3H15 A;  4LF4 Q;  1R9T H;  2Q2T A;  1FVI A;  4A3L H;  3PF5 A;  1FJG Q;  1XNR Q;  1IBK L;  4BY7 G;  1Y1W H;  1VQO A;  2JA7 G;  5JEA J;  3OTO L;  2OTJ A;  2N78 A;  4RMF A;  3M4Q A;  5H1S E;  3CCM A;  3H0G H;  4A3J G;  4DUY Q;  1WCM H;  4JI2 Q;  4JOI C;  1I5F A;  3PSI A;  4JI8 Q;  4POF A;  1E7Z A;  4GKK Q;  4LFB L;  3UDX A;  4JI7 L;  2PI2 A;  5M3M H;  5BR8 Q;  2UUA Q;  4A3K H;  1NMF A;  1YHA A;  2VL6 A;  1XPR A;  2MO1 A;  4KHP L;  1Y1V G;  3ER0 A;  1VQE A;  4NXN Q;  4LF9 Q;  1A8V A;  2HHH Q;  1BKB A;  2OCE A;  1J5E L;  1I6H H;  4JI3 Q;  4UP8 A;  4IFD I;  3TRE A;  2Z0S A;  4MZ9 A;  2VUM G;  4MNO A;  3EBE A;  1Q82 C;  3GDE A;  2XTI A;  4PZ8 A;  4LF7 L;  4JI4 Q;  1XNQ L;  1VQ8 A;  4IFD G;  3HOW G;  4BBS H;  1J6Q A;  1M90 C;  2D0P A;  4A3L G;  1PFS A;  4JV5 L;  2KBN A;  1L1O A;  1LM0 A;  1VQH A;  3CQZ H;  3K7U C;  2MNA A;  2R6G A;  4KHZ A;  1YBY A;  5GQO A;  2E5L L;  2RHQ B;  4DKA C;  3ICE A;  4OXP A;  3CF5 A;  3KF8 B;  3CCE A;  4IPC A;  5LMU L;  4DV7 Q;  3RZO H;  3OYY A;  1HNZ Q;  1UE1 A;  4LFB Q;  4JI7 Q;  3GD7 A;  1N8R C;  3RZD H;  3NEM A;  2R7Z H;  2I0Q A;  3CCJ A;  1HZC A;  4PG3 A;  4R4I A;  2AKW B;  4FDB A;  4R1J A;  4B3S L;  1YVC A;  1NTG A;  1MKH A;  1J5E Q;  2PQA B;  3TS2 A;  5C4X G;  2ALY B;  4IO9 A;  1K9M C;  2VQE L;  1GM5 A;  2PNH A;  2R7D A;  5C44 H;  1LUZ A;  1Q1B A;  1C0A A;  4OX9 L;  1KRT A;  3I4N H;  5IYD G;  3AFP A;  2B3G A;  4YWL A;  2NVX H;  2ZJR A;  1XNQ Q;  3RLN A;  1CKM A;  4X64 Q;  3CD6 A;  1VS0 A;  5E7N A;  1VQ5 A;  2JA5 G;  1OXV A;  2FXQ A;  2Z6K C;  1JJC B;  3RN2 A;  2B63 H;  4NXM Q;  3L0O A;  2K5N A;  4O2D A;  3CCV A;  5M3F G;  1PH4 A;  3S17 H;  2UXD L;  2E5L Q;  5IWA L;  3OW2 A;  4JCV E;  4AH6 A;  3GO5 A;  4Y7N H;  3CC2 A;  4GLX A;  5C3E G;  1X9N A;  2WFW A;  3E9I A;  4HIK A;  4DV3 L;  2JA8 H;  1YI2 A;  2A8V A;  4X6A H;  2R7Z G;  1JJG A;  2NVY H;  1SLJ A;  1AE3 A;  1U5K A;  1VQM A;  1U0L A;  2K5H A;  4J15 A;  4X66 L;  1GVP A;  1HZA A;  1IL2 A;  1V9P A;  1CUK A;  1TXY A;  3GTQ H;  4A3B G;  4YY3 Q;  1I94 Q;  2D0O A;  1YHQ A;  1K73 C;  4A3G H;  2RHS B;  4BXX G;  4OX9 Q;  4LFC L;  4A93 H;  2VS1 A;  4YCU A;  5IYC H;  2JEA I;  4GKJ L;  4DNI A;  5HGQ A;  2E2H H;  3U4Z A;  4X65 L;  3PUW A;  5FLM H;  4BY1 H;  5FLX c;  4L5R C;  4DR5 Q;  4OON A;  3DM3 A;  1X6O A;  1X3G A;  2A1A A;  4LF5 L;  4WJ4 A;  1ASY A;  1VQC A;  2V1C C;  5IWA Q;  3JAM c;  3HOV H;  1WFQ A;  3I2Z A;  4OWX B;  1NMG A;  3J7A 5;  2IY5 B;  4EQ5 A;  4A3F G;  1NY4 A;  3F2D A;  4A3I G;  1PHJ A;  1FJG L;  2RF4 A;  1PA6 A;  1HR0 W;  3G6E A;  1VQG A;  4ALP A;  1Q12 A;  4GOP C;  4LWC A;  4P73 A;  1TWF H;  3HOX H;  1BVS A;  4LNQ A;  2JA8 G;  3H3V H;  4PZ7 A;  1T9H A;  1QVC A;  1V43 A;  4X66 Q;  1IYJ B;  5IP7 H;  1VQK A;  2YU9 H;  3PV0 A;  4DUY L;  3UDG A;  4JI2 L;  2NZH A;  4JI8 L;  4IOC A;  2UU9 Q;  4GKK L;  1NBW A;  4QY7 A;  1YEZ A;  1A0I A;  3EIV A;  4OWT B;  1PH6 A;  5BR8 L;  2UUA L;  3ZJY C;  4LFC Q;  4JC0 A;  4PZ6 A;  5C0X I;  5GAH C;  5EAY A;  3PIP A;  4APV A;  4NXN L;  4A93 G;  4LF9 L;  1Q8K A;  3AQQ A;  4JI1 Q;  2HHH L;  4A3E H;  2D62 A;  3J80 i;  4X65 Q;  5LMN W;  1W2B A;  2KHJ A;  4HJA A;  1N32 Q;  1SFO H;  4IJL A;  4QIW E;  4LF5 Q;  4IPG A;  2EQS A;  5C0X G;  1PH1 A;  1HR0 L;  4GNX C;  4MTN A;  1CKO A;  1WYD A;  1QZG A;  2NVQ H;  3KJP A;  3G71 A;  3F2B A;  1DGS A;  3D31 A;  2CCZ A;  3U4V A;  4P71 A;  4HJ8 A;  3AYH B;  2I5H A;  3STB D;  2ZJP A;  5GAG C;  3M4O H;  3CAM A;  1MJE A;  2Q2U A;  4XIG S;  1Q46 A;  3CPF A;  3U58 A;  2R92 H;  5IP7 G;  3CME A;  2RCN A;  2YV5 A;  4DV7 L;  1HNZ L;  3K0X A;  3CP0 A;  4DV6 Q;  3T1H Q;  3S14 H;  4DV5 L;  5LMN L;  5M5Y H;  3KFU A;  1L0W A;  1E24 A;  2VY3 A;  4DV0 Q;  1YZ6 A;  1X65 A;  1YJW A;  2UUB Q;  3BJU A;  3BZC A;  4DV2 L;  2OWO A;  3HOZ H;  1SMX A;  5C0X J;  3I7F A;  1YHB A;  2BH8 A;  3FKI H;  5IP9 H;  1A63 A;  1HR0 Q;  3PCO B;  2KCM A;  2XGT A;  4UY8 C;  1UWV A;  1VCI A;  4P75 A;  4C3I H;  4X64 L;  1WOC A;  2Q2H A;  1RIP A;  1PH7 A;  1VQI A;  3HOY H;  3W1B A;  3TQY A;  1K0R A;  1Y14 B;  2PQA A;  2K75 A;  5IE8 A;  2IHF A;  1Y1W G;  4NXM L;  1SR3 A;  3KDF B;  3I4M H;  5HY6 A;  3GTM H;  4LF6 Q;  2R7F A;  4LW1 A;  3K80 C;  4LUZ A;  4YHH Q;  2CFM A;  3HFZ B;  3H0G G;  3NBH B;  2VW9 A;  1WCM G;  3BZK A;  4ME3 A;  4DR1 Q;  1YIT A;  4DR4 L;  1Z47 A;  4P74 A;  4DV5 Q;  1IBL Q;  5LMN Q;  4DR6 Q;  3CXC A;  5M3M G;  4OWW B;  3ULL A;  4A3K G;  4B3R Q;  3AFQ A;  4B3M L;  1MJC A;  3U50 C;  3KOJ A;  4TVA B;  1X56 A;  2K4K A;  3CC7 A;  4YCV A;  4DV2 Q;  1QUQ B;  3FP9 A;  1CKN B;  3CW2 C;  3RR5 A;  3SGI A;  2B29 A;  4YY3 L;  1I94 L;  1JMC A;  4Y52 H;  3UE0 A;  2JA9 A;  2C35 B;  4DK3 C;  3F2C A;  5FJ8 H;  1YNX A;  3M4P A;  5IY0 A;  4IFD J;  2BA0 A;  2KCT A;  2QGQ A;  3RN5 A;  5JJL A;  4DV1 Q;  1TWH H;  2MFI A;  1XMQ L;  2OQK A;  3J80 c;  3PIO A;  4JBJ A;  4BBS G;  4DR5 L;  3HOY G;  2ASB A;  4YCW A;  4HIM A;  1QVF A;  3S1M H;  1VQD A;  1X54 A;  1O7I A;  2YTY A;  4R4Q A;  5GAE C;  1Z9F A;  3TRZ A;  3A74 A;  3J7Z C;  1B8A A;  4YWK A; 
#chains in the Genus database with same CATH topology
 2EY1 A;  4HJ9 A;  1RKN A;  4S3S A;  2CWA A;  4RWS C;  1HZB A;  2F0E A;  1SJH D;  2H4O A;  1B7Y B;  2HD3 A;  3BDO A;  4JBW A;  2F52 A;  5C44 G;  5DLQ E;  1LV9 A;  1JJ2 A;  3BU2 A;  3ULJ A;  4DAM A;  4FYD A;  3VR2 A;  2KCC A;  4JI1 L;  2SOB A;  4J6H A;  2LKV A;  3SK8 A;  2R93 H;  5IYB H;  3H0G B;  2B63 G;  2E74 C;  3ULP A;  3GQB A;  3URY A;  1IYU A;  1E2Z A;  2IHE A;  4GOP B;  4C2M H;  1BF4 A;  4FF4 A;  3A7A B;  2AWO A;  3IRB A;  5T1I A;  1GKH A;  4NPS A;  3SXH A;  3I55 A;  1SNM A;  2JJQ A;  4DGZ A;  2RKS A;  1VQN A;  4K6L A;  1M8A A;  4WJ3 M;  3PO2 H;  3TZU A;  4ILW A;  1EFI D;  3MEF A;  3RNU A;  4K2K A;  5JPM C;  3HOU G;  3L2P A;  4DV0 L;  1AEX A;  4HMJ A;  2L15 A;  5KGU A;  1VQB A;  3L3O C;  5FO9 B;  1HJP A;  4LUO A;  4DR2 Q;  2JE6 I;  1HA6 A;  2UUB L;  4ID6 A;  4JOI A;  2WKC A;  4B9W A;  4BY7 H;  4OEL B;  5FLM G;  3J81 j;  2GVA A;  3I70 A;  2L12 A;  2VB3 X;  3D4D A;  3HOV G;  3VA7 A;  2YYZ A;  1QNK A;  3Q23 A;  1Q1E A;  4NB3 A;  3UE1 A;  4KMU C;  4KD4 A;  1EIY B;  1HTL D;  2F0L A;  1PMR A;  1G51 A;  4JBK A;  4K14 A;  1KAW A;  4BS9 A;  5TSS A;  1EFW A;  2ZXO A;  1IBL L;  1G29 1;  5KYI A;  3M3Y H;  5ELN A;  1A3U A;  1MIU A;  5JOB A;  1CSP A;  3S16 H;  1DZ1 A;  2JQO A;  3HOW H;  4K5W A;  1VQJ A;  3TZD A;  1PH9 A;  4B9X A;  4UP7 A;  4Y7N B;  4RA8 A;  1SSO A;  1DCZ A;  1IW7 D;  1F2Y A;  1H9K A;  2G9D A;  4K5V A;  4DV1 L;  5JPN C;  1TU2 B;  3W5O A;  4C1N K;  1QUQ A;  1EOV A;  2PMZ E;  3F8T A;  2OEO A;  1PRT D;  5KEE A;  3T16 A;  3D6C A;  1U4R A;  2DUD A;  1RTO A;  3MHB A;  2F3V A;  1S3O A;  2B2T C;  2UUC L;  2R93 B;  1JOK A;  4A3M H;  2JA5 H;  5JJK A;  1SNO A;  5M5X H;  1UAP A;  1LTB D;  3GTG H;  1STB A;  1IBK Q;  1X3E A;  2K5V A;  4C2M B;  4BBR G;  1I50 H;  2FJ2 A;  2LFN A;  2OQ0 A;  3E6Z X;  1XPU A;  1I3Q H;  3PO2 B;  1PYB A;  1A2T A;  3CCS A;  1FL0 A;  3JAM L;  1M4V A;  1IHZ A;  4UHV A;  3T1Y L;  2QF7 A;  2V4D A;  2UUC Q;  2HCC A;  4H13 C;  2K52 A;  4HID A;  4LF7 Q;  3W2D A;  3H6M A;  5CBA E;  1SE4 A;  2NZO A;  5IT9 L;  4BWG B;  2F0J A;  4DV4 L;  1GOZ A;  3EJI A;  2I5M X;  3MXU A;  4A3I H;  3DHQ A;  4KY5 A;  1EOT A;  3R8B A;  3GTL H;  2FMC A;  2F1M A;  2R92 B;  4NKL A;  4RCO A;  3F1Z A;  1KDB A;  4B3S Q;  5C5L A;  4DR7 L;  2NTT A;  2F0G A;  3NXW A;  1YJN A;  1YNN C;  2VQE Q;  3T1Y Q;  5A2Q E;  3HOZ B;  3SK4 A;  4LF8 L;  2JN4 A;  1JQY D;  3CU7 A;  2CQO A;  5ELO A;  5LHY 1;  3PO3 G;  3M9B A;  2CWP A;  3GV6 A;  4JYA L;  1BOS A;  2M2L A;  1H9M A;  2WV6 D;  3KBX A;  3MZ5 A;  2KEE A;  4L5Q A;  4A3C G;  2VQF L;  2JA7 H;  3GTM B;  1XNR L;  1E3P A;  1IXR A;  5CMD A;  1KD1 C;  4DR7 Q;  5IT9 c;  2D2C C;  1ESF A;  1UE6 A;  3NQT A;  1EU3 A;  4A3M B;  2NN6 I;  2K04 A;  4QB4 A;  2F3W A;  4XYO A;  4GKJ Q;  1VQ7 A;  1I50 B;  1XPO A;  2NN6 G;  4N8F A;  2D9U A;  1EWI A;  1CK1 A;  3DLL A;  1I3Q B;  1TS4 A;  3S1R H;  2Z8L A;  1WTQ A;  1XNR Q;  2BDO A;  1Y1W H;  1VQO A;  1JCK B;  1F9S A;  2N78 A;  4RMF A;  1V1P A;  4A3J G;  4G7Z C;  1I5F A;  3PSI A;  1E7Z A;  5M3M H;  3J80 L;  2MO1 A;  1O80 A;  5M5W B;  4NXN Q;  1PRT C;  4HTH A;  4IZ8 A;  4R8I A;  1A8V A;  1GJX A;  2M9V A;  1QIL A;  3MTS A;  1I6H H;  3TRE A;  5ISR A;  4MNO A;  1SNQ A;  3HEJ A;  5CC4 A;  1PTO B;  1M90 C;  4A3L G;  1CA5 A;  1LM0 A;  2JSO A;  2R6G A;  2E5L L;  4XQQ A;  4V0B A;  3ICE A;  4OXP A;  3QO2 A;  2AUK A;  1HNZ Q;  3RZD H;  2R7Z H;  5J39 A;  1IKM A;  3CCJ A;  1PYW D;  1TWG B;  1YVC A;  2NBF A;  3TS2 A;  5C4X G;  2ALY B;  4IO9 A;  4QMG A;  1K9M C;  3IFT A;  2R7D A;  1HCZ A;  5C44 H;  1LUZ A;  4IAL A;  1KRT A;  1FD7 D;  3DWQ A;  2EJG C;  2JA7 B;  2X6L A;  2B3G A;  3CD6 A;  3SR1 A;  3KBG A;  2F0D A;  3WDN A;  3RN2 A;  2B63 H;  3H3V C;  4O2D A;  1WVL A;  1B50 A;  2E5L Q;  1PFM A;  5IWA L;  3GV3 A;  2L0C A;  4AH6 A;  1PZI D;  4G4K A;  4GLX A;  5C3E G;  2B2U C;  4ULL A;  4JVZ A;  2JA8 H;  4NMZ A;  1YI2 A;  1D5X C;  4X6A H;  4V19 0;  1JJG A;  1I4P A;  4ZKC B;  1AE3 A;  5J22 A;  1GVP A;  1IL2 A;  1CUK A;  1V1O A;  5C3X A;  1I94 Q;  1YHQ A;  3S1R B;  4A93 H;  4YCU A;  3OIP A;  4CKC A;  1LAB A;  3NQI A;  1LTA D;  1SYE A;  3A8K E;  3MC0 B;  4X65 L;  4TKO B;  3PUW A;  5FLM H;  1DOL A;  1CZW A;  4WJ4 A;  2A1A A;  1ASY A;  1J8I A;  5IWA Q;  3HOV H;  4IUR A;  2KEC A;  3J7A 5;  4RAU C;  1PHJ A;  2RF4 A;  1HR0 W;  3G6E A;  4DK0 A;  1LTS D;  4LWC A;  1I6H B;  1B4O A;  1NUC A;  4DF7 A;  4FF2 A;  3ERQ A;  1T9H A;  2EYL A;  1AZQ A;  3FMC A;  3PV0 A;  3OPO A;  4DUY L;  4JI2 L;  4IOC A;  2UU9 Q;  1NBW A;  1YEZ A;  1A0I A;  5BR8 L;  2MUY A;  3ZJY C;  5GAH C;  3AQQ A;  4QCL A;  4IQZ A;  3J80 i;  4X65 Q;  4J8Q A;  2EYP A;  3UI2 A;  1N32 Q;  2XIW A;  1PH1 A;  1STE A;  2PCF B;  1CKO A;  1QZG A;  5IGB A;  3RZD B;  2R7Z B;  4C56 C;  3TN2 A;  1EU4 A;  1DGS A;  2K05 A;  5GAG C;  2Q2U A;  5DEH A;  3U58 A;  4Z9C B;  5IP7 G;  3PQI A;  2F0M A;  3A54 A;  1BNZ A;  1GUO A;  3T1H Q;  3S14 H;  4DV5 L;  1HUM A;  2PQE A;  3RUZ A;  1L0W A;  2VY3 A;  1CQF A;  1LO5 D;  1YZ6 A;  3BJU A;  2OWO A;  5IIF A;  1SMX A;  4A3F B;  5E1F A;  1A63 A;  4HN7 A;  2KCM A;  5G3L F;  2JA8 B;  4P75 A;  4C3I H;  4X64 L;  1PH7 A;  3OWF A;  2HQE A;  5IE8 A;  2K75 A;  2L5T A;  3D6W A;  4DXG A;  3KDF B;  1EIG A;  3CRK C;  5HY6 A;  4YHH Q;  3C1F A;  1L0X B;  2CFM A;  4A93 B;  3J7A V;  5EJW A;  1WCM G;  4WFN 3;  4DV5 Q;  3K5O A;  1TVX A;  3CXC A;  3ULL A;  4B3R Q;  4B3M L;  1MJC A;  3KOJ A;  4TVA B;  3CC7 A;  5CV4 A;  1QOH A;  4YY3 L;  3FP9 A;  3RR5 A;  3UE0 A;  2JA9 A;  3IKJ A;  5EGT A;  4MTK A;  2C35 B;  3F2C A;  3M4P A;  5IY0 A;  4O1N A;  2TMP A;  3LWU A;  1TWH H;  1GUG A;  2OQK A;  3T13 A;  4DR5 L;  1F9R A;  1K0S A;  3H91 A;  3HOY G;  2JP1 A;  5D14 A;  1BCP C;  3IFD A;  1QVF A;  2YTY A;  3HS0 C;  1B8A A;  5I6Y A;  1PXU A;  1MD2 D;  1F2L A;  1PH3 A;  2CW0 D;  4DAP A;  4IN3 A;  1SYF A;  1LTI D;  3A8J E;  2BE5 D;  4B3M Q;  2K7V A;  1Q81 C;  2BCO A;  3ND8 A;  3PO3 H;  4MIU A;  4HSV A;  1HQR D;  3HZX A;  1R9T B;  1LTR D;  1IBM L;  4JK1 C;  4R4O A;  1UNS A;  2EIF A;  1NJI C;  4A3C H;  5F2D A;  3A5U A;  1AE2 A;  2B2W C;  2EYJ A;  2L9H A;  1Q7Y C;  1KRS A;  2EVB A;  3K7A H;  3HP3 A;  1E1T A;  4UPA A;  4IUP A;  4CGY B;  5CV8 A;  2JA6 H;  2RSO A;  1H95 A;  2E8G A;  3RLO A;  5EKL A;  1VQ6 A;  1IZ6 A;  4L5T A;  4F8M A;  3S2H H;  1AN8 A;  1PFB A;  2PZU A;  3DEP A;  1CSQ A;  2A6H D;  1VQ4 A;  2NN6 H;  4KHV A;  4LMQ D;  4DV6 L;  1EL0 A;  2LXK A;  4C3I B;  1IBM Q;  4BBS B;  4QUC A;  3OHX C;  4AQY Q;  3CQZ B;  1K83 H;  3BYY B;  1TT2 A;  1WI5 A;  3WOF A;  2PMZ B;  3Q8D A;  4R4C A;  3LWE A;  3J81 i;  1UE7 A;  3H3V I;  3Q6S A;  4FP5 D;  2A5H A;  4A3J H;  2CH4 A;  1E22 A;  5DM6 3;  2AHO B;  3EN2 A;  3GTJ H;  3C2P A;  4LF6 L;  1A62 A;  4L6T B;  1EUJ A;  1ZYR C;  2WB1 G;  1HZ9 A;  4DR1 L;  3TDQ A;  2D5D A;  2FHT A;  4HCE A;  1VF7 A;  4DR6 L;  4KLK A;  2ZTC A;  1L2F A;  1EY7 A;  4XT3 B;  5GAD C;  1ICF B;  2NVT H;  3S17 B;  3KDF A;  1A6X A;  4A3E G;  5C4H A;  2TSS A;  1UEB A;  2XNA C;  3KF6 B;  4RG1 A;  1K8O A;  3K81 C;  2ZTD A;  3RD4 A;  4P72 A;  2WAQ E;  2N49 A;  4B08 A;  1CA6 A;  2QA4 A;  2EOT A;  3S1Q H;  2NTS A;  2PW7 A;  2IPK D;  1JWS D;  4DK1 A;  2B8G A;  1E1O A;  4YIJ A;  3Q0A A;  5E4X A;  5C4X H;  4XQJ A;  2L11 A;  3S2D H;  3VR5 A;  1RL2 A;  4FXK C;  4BY1 B;  1TQO A;  4WJW A;  3K7A B;  1HRJ A;  3NEL A;  4R8N A;  2F4I A;  1DOK A;  4F88 A;  2KHS A;  2QDL A;  1KQS A;  3OTO Q;  1ILP A;  2JA6 B;  5NUC A;  3HOX B;  1FNU A;  2WAQ G;  5C3E H;  2K32 A;  4OO1 I;  2EJM A;  3JC6 6;  2LS0 1;  5FLX L;  3CPW A;  2CKZ B;  3MWY W;  3BZD B;  2CH4 W;  4OO1 G;  1SRU A;  3VYT A;  2CW0 C;  1O78 A;  2I5L X;  2DGY A;  3A0J A;  3V2T A;  1STH A;  4JV5 Q;  4K0K L;  2DNE A;  2PO4 A;  5FJ8 G;  2K14 A;  4DR2 L;  3M4O B;  4PV1 C;  4FNF A;  1KHI A;  3UDI A;  2MQH A;  1C9O A;  4EQN A;  1R4Q B;  1HNX L;  1YNJ C;  1KAB A;  4BA1 I;  2FMM A;  5ELB A;  2H1E A;  2ICI A;  3KLS X;  1PFN A;  2PYK A;  2YTV A;  1E2V A;  2NVT B;  2EPB A;  2C9O A;  1XMO L;  3QOJ A;  4GZY C;  3FKI B;  5CYU A;  1H9R A;  1LT4 D;  3X3M A;  5JJI A;  1VQA A;  3MEH A;  4K0K Q;  1OO9 B;  3FPP A;  2A19 A;  2HQL A;  4KD3 A;  3D4R A;  1TWA H;  4A4I A;  5IGD A;  3GTK H;  1KTK A;  4EQP A;  3F2U A;  1I4R A;  3D0F A;  4LF4 L;  3I4M B;  1BBU A;  3G6J B;  5LL6 S;  2N3S A;  1Z7T A;  2G9H D;  2SNM A;  5IGC A;  1HNX Q;  3S2D B;  3TP6 A;  1TS2 A;  3S24 A;  1K3B C;  3T56 B;  1HPC A;  4CDF C;  1AH9 A;  1SBB B;  1OXU A;  1P8L A;  1JT8 A;  4BA2 I;  1WTX A;  1CTM A;  1XMO Q;  3A7L A;  3U9O A;  1MHW C;  3KF6 A;  1FR3 A;  2HIX A;  3BG3 A;  1K8G A;  3GTP H;  2H5X A;  3E0E A;  5COY A;  3GTO H;  1VQ9 A;  2ID0 A;  3AEV A;  1C4Q A;  5IGF A;  3H15 A;  4LF4 Q;  3S1M B;  3PF5 A;  2EJF C;  1IBK L;  5JEA J;  4PQX A;  5KIX A;  2BDN A;  1DON A;  1E2W A;  2KUM A;  1SYD A;  2SEB D;  4H44 C;  1WCM H;  4JI8 Q;  1ZEQ X;  4LFB L;  3UDX A;  3OW7 A;  5CR3 A;  1YHA A;  4K8I A;  4N8X 1;  1Y1V G;  1VQE A;  4LF9 Q;  2Y0S B;  2JYO A;  2HHH Q;  1BKB A;  1Y8O B;  2PZW A;  2OCE A;  4RKB A;  5A35 A;  2Z0S A;  3K57 A;  1V1P B;  4KY7 A;  2VUM G;  4N9T A;  4LF7 L;  1AFP A;  3QWN A;  1RDP D;  1SEB D;  3I4L A;  3EFX D;  5AFW A;  1VQH A;  3K7U C;  3G7L A;  2B2V C;  1YBY A;  5GQO A;  4HAE A;  4C3J G;  3CF5 A;  4DAV A;  2B2Y C;  2CVR A;  3AB9 A;  3CCE A;  4IPC A;  5DM7 3;  4RCN A;  3OYY A;  4LFB Q;  3GD7 A;  1N8R C;  3NEM A;  4JPB W;  2I0Q A;  4B3S L;  4FDB A;  2RDF A;  1MKH A;  1C48 A;  3DMU A;  2VQE L;  1GM5 A;  1O7Y A;  5JVG 3;  1PTO D;  4LK1 C;  4ZK9 B;  4OX9 L;  2RDH A;  1HFG A;  4BY7 B;  1AP0 A;  1S5C D;  1CKM A;  5E7N A;  3E3X A;  5T1G A;  2Z6K C;  1JJC B;  1H9S B;  4DFA A;  3L0O A;  4DXF A;  5M3F G;  1PH4 A;  2ZT9 C;  1PDQ A;  3GO5 A;  4MHE A;  1X9N A;  1EYD A;  1F9P A;  1IL8 A;  3E9I A;  4HIK A;  1G6Z A;  2F0H A;  1WD1 A;  1EY9 A;  3GTP B;  2A8V A;  1B3Q A;  3S9W A;  5G3L D;  1ET6 A;  4J15 A;  3M3Y B;  1V9P A;  4A3B G;  2EYM A;  3GTQ H;  3S16 B;  5CV5 A;  3HOW B;  2RHS B;  4OX9 Q;  2Q8I B;  3NPP A;  2JEA I;  4GKJ L;  1PLF A;  5HGQ A;  2A6E D;  3U4Z A;  1LT5 D;  1TS3 A;  2KA7 A;  1JOO A;  4KV6 A;  2E2D C;  1VQC A;  3JAM c;  1WFQ A;  1UUP A;  2IY5 B;  4EQ5 A;  5ELF A;  4LNQ A;  3H3V H;  2F03 A;  3R2I A;  4QUF A;  1V43 A;  1VQK A;  2NZH A;  4XXE A;  1JE4 A;  3EIV A;  4DA2 A;  2JA5 B;  1HFN A;  2QIL A;  4OWT B;  5M5X B;  1PH6 A;  4JC0 A;  2F0F A;  3GTG B;  1I4H A;  5EAY A;  3V96 A;  4APV A;  4NXN L;  3K58 A;  4A3E H;  2D62 A;  4FF3 A;  1T5X D;  1EZ8 A;  4HJA A;  1SFO H;  4IJL A;  4QIW E;  5J1Z A;  3QR8 A;  4GNX C;  1HR0 L;  1WYD A;  2MJ8 A;  1Q90 A;  2NVQ H;  3D31 A;  3U4V A;  4XDX A;  3AYH B;  3STB D;  2B2T A;  4XIG S;  1IW7 C;  2F0N A;  1DM0 B;  2OT2 A;  3CME A;  2CHB D;  1HNZ L;  2X6G A;  2WIN B;  5M5Y H;  3KFU A;  1PRT B;  2WII B;  5EKK A;  2E76 C;  2MHV A;  4CHT B;  5C0X J;  4RFB A;  1GUT A;  3I7F A;  4A3I B;  1X3P A;  3GTL B;  1HR0 Q;  3PCO B;  1JOQ A;  4UY8 C;  3SVM A;  1VCI A;  2Q2H A;  3DXJ C;  4IOA A;  1Y14 B;  5I9P A;  3JAM E;  2HDL A;  1SE3 A;  4LW1 A;  3K80 C;  4LUZ A;  4OO1 H;  3HFZ B;  3H0G G;  3BZK A;  3IAY A;  1Z47 A;  4I7A A;  2QCP X;  4OWW B;  2DJG C;  1RJT A;  5IT9 E;  1H9S A;  1WD0 A;  4HSP A;  3AFQ A;  1G91 A;  5D3I B;  5BN3 A;  4J1M A;  4XYQ A;  3P7J A;  3SGI A;  1I94 L;  1CKN B;  3CW2 C;  1V8Q A;  2B29 A;  3N52 A;  3SDZ A;  3DEO A;  1ET9 A;  1NCV A;  2EE1 A;  5FJ8 H;  1K8M A;  2N55 A;  2QGQ A;  1CHP D;  2KCT A;  5JJL A;  1HTP A;  4KN4 C;  3J80 c;  3PIO A;  4IUN A;  4JBJ A;  2LY7 A;  4KKS A;  5FOB B;  3PMF A;  2QDB A;  4ZYS A;  1U4M A;  4HIM A;  2K01 A;  1VQD A;  3Q22 A;  1Z9F A;  5K5P A;  1BR9 A;  1L1O C;  2EXD A;  1G8Z D;  1NSN S;  1G6P A;  4FXG C;  1SFO B;  1OXS C;  4IJH A;  2Z9H A;  5CV6 A;  2UU9 L;  5JAV A;  2KOL A;  1G2T A;  3HOU H;  3R3O A;  2GA4 B;  4LFA Q;  3I4N G;  1Y1W B;  2Q2I A;  2EYO A;  4DR3 L;  2ZM6 Q;  4OIJ A;  1ENC A;  2A6E C;  2HT1 A;  4DUZ Q;  3ERS X;  1V1Q A;  1N32 L;  2F4V L;  2K5Q A;  1P16 A;  4K5X A;  1CT1 D;  1F2Z A;  4AYB E;  1S5B D;  2GVB A;  5M3M B;  1U4P A;  5M5Y B;  1W6J A;  1N36 L;  3S1N H;  4X62 Q;  2DN8 A;  4L8J A;  2DNC A;  2K1B A;  4GS3 A;  4B3T L;  3LGJ A;  3PUV A;  3BDC A;  4ABN A;  4IUV A;  2HUG A;  3VA5 A;  3PGZ A;  4DNT B;  3T1H L;  1S40 A;  4HCS A;  4A3G G;  4ZAI A;  1FYC A;  4M1U B;  5I4D A;  4DR3 Q;  3K5L A;  1QWY A;  1EIF A;  2F4V Q;  2MGS A;  1NNX A;  4KJN A;  3NP8 A;  1SYB A;  1QB5 D;  4AYB G;  1N36 Q;  1C8C A;  3J80 E;  1U4L A;  4I65 A;  2F0W A;  1D5Z C;  3R93 A;  1PTO F;  1GD7 A;  2P5Z X;  2Z6B A;  1Y1V H;  4B3T Q;  3VR6 A;  2NUC A;  4KY6 A;  2M00 A;  5C44 B;  3QIA A;  4ZKB B;  3VR4 A;  4YHH L;  1X3Q A;  1QCB D;  1SDF A;  5BN5 A;  1EYC A;  2VUM H;  5EQ0 A;  1SMY D;  1BQQ T;  3P1H A;  1VF5 C;  4B3R L;  1STA A;  4JG2 A;  2B63 B;  3K6O A;  4HJ5 A;  4R4T A;  2A74 C;  4DK6 C;  3J81 L;  1YIJ A;  4BBR H;  1ASZ A;  4XQN A;  4HIO A;  4C3J H;  3BVM A;  1ML0 D;  5FK9 C;  1Q3L A;  1F77 A;  4JI0 Q;  3L9A X;  3IL8 A;  3HRZ C;  1N33 Q;  4EX5 A;  2UXC Q;  1B9N A;  1CKN A;  3G48 A;  5EPL A;  5AJ3 L;  2QEX A;  1RD9 D;  3HOU B;  1S72 A;  2R92 G;  2A69 D;  2B39 A;  4RH6 A;  3WWV A;  3OMG A;  4JI6 Q;  1HNW L;  4TRD A;  4JI5 L;  3D8G A;  4HJ7 A;  1LYL A;  1CM9 A;  3HOV B;  2IJ0 A;  2B2U A;  1KAA A;  3HOZ G;  5M3F H;  1LTL A;  2KQ3 A;  5IP9 G;  1OXT A;  2YTX A;  1NE3 A;  4EVO A;  3VYU A;  2DY8 A;  4OHJ A;  3ND9 A;  3T4A C;  1BCP B;  1XWE A;  5ELE A;  4KHP Q;  5AJ3 Q;  1D5M C;  2JEB I;  3J81 c;  1ZKO A;  2IT1 A;  2IWH A;  3NE5 B;  4A3B H;  1CQV A;  1X3F A;  2HDM A;  4FO2 A;  4EGV A;  4PNY A;  1PVO A;  2L4N A;  2EY6 A;  2ES2 A;  2RBM A;  1HNW Q;  2F0I A;  4ZUJ A;  4JI5 Q;  4CJ0 B;  4A3M G;  1K3R A;  1HQM C;  2ENB A;  1BBX C;  4NP5 A;  1LTT D;  2R61 A;  3LNN A;  1WTO A;  2Q8T A;  1SN8 A;  3ERO A;  3FDT A;  4AQY L;  5J3B A;  4ZRZ A;  1CZG A;  4POG A;  4F87 A;  5LMU Q;  3FVQ A;  1HH2 P;  2PI2 E;  3H94 A;  2J7Z A;  1WTR A;  3DUZ A;  4K2L A;  5I9O A;  4QF4 A;  3S14 B;  2K03 A;  3GP7 A;  4IPD A;  3CCU A;  3BVZ A;  1ICW A;  5C4J H;  3NUC A;  3S15 H;  5K36 G;  2LSS A;  3B6Y A;  1SJE D;  3PUZ A;  4M8A A;  4EQO A;  2F0O A;  1JB7 A;  1BUV T;  1DXM A;  3C46 A;  2O5I C;  2UXB L;  4X3T A;  4Q5V A;  4DAY B;  4K6D A;  2WB1 E;  1GUW A;  3MAQ A;  4BBR B;  4CDE C;  3A56 A;  1R4P B;  2F0K A;  4TQU S;  2KCN A;  3P20 A;  2UXD Q;  1OTC A;  4CJ2 C;  2ZTE A;  3FHW A;  4A3D G;  1D8L A;  4DV3 Q;  2XN9 C;  1QNU A;  1X55 A;  4A75 A;  4R9W A;  3AMU A;  1XJV A;  3R2T A;  5JEA G;  4QJF A;  3MFY A;  4KKU A;  5GRO A;  3WOE A;  3I8Z A;  1TWC H;  2WP8 J;  3VDY A;  2UXB Q;  1TS5 A;  2AMC B;  2L1B A;  1EYG A;  4PMW A;  2Z1C A;  4KI0 A;  2WKD A;  3MXN B;  3CCQ A;  4JI3 L;  1D2B A;  1TWH B;  3TP5 A;  3KLW A;  1SNP A;  2N8N A;  3HKS A;  1TY2 A;  1RTN A;  3A5Z B;  2Q2T A;  1FVI A;  4A3L H;  1FJG Q;  2L55 A;  4A3B B;  2JA7 G;  3OTO L;  1W6K A;  4IUT A;  4L63 B;  3H0G H;  5JVH 3;  4JOI C;  4GKK Q;  4POF A;  4JI7 L;  2PNR C;  3O13 A;  2UUA Q;  3PO3 B;  2VL6 A;  1ROD A;  4WOR A;  3BDL A;  1RF2 D;  4OL7 A;  1J5E L;  4JI3 Q;  4IFD I;  2A69 C;  3TME A;  4PMC A;  2K5D A;  1Q82 C;  2XTI A;  4PZ8 A;  4RGM A;  1XNQ L;  3MA2 B;  4IFD G;  4WRD A;  4JV5 L;  1PFS A;  4DNR B;  2KBN A;  2MNA A;  3I3C A;  2I46 A;  1FNV A;  3P75 A;  4P2C B;  5EKI A;  3KF8 B;  3S2H B;  4DV7 Q;  4JI7 Q;  1A15 A;  3PIO 3;  4PG3 A;  3X3N A;  4R4I A;  2OF1 A;  4R1J A;  4OEM B;  2EDG A;  5D3D A;  3LX0 A;  3VR3 A;  1J5E Q;  1K83 B;  2B2W A;  2CQA A;  2PNH A;  2G5D A;  1EY4 A;  1Q1B A;  3QB3 A;  2F0V A;  2NZ1 D;  3I4N H;  4RHR A;  5IYD G;  2NVX H;  4FVM A;  2ZJR A;  1XNQ Q;  3RLN A;  2BE5 C;  1VQ5 A;  1KNA A;  2A73 B;  2EYF A;  1OXV A;  4ZCK A;  2FXQ A;  4A3J B;  2EY5 A;  2DY7 A;  2RA4 A;  3EQL C;  4NXM Q;  2K5N A;  3KLR A;  1IKL A;  4JCV E;  3BS1 A;  3OMC A;  4DAY A;  4Y7N H;  3CC2 A;  3GTJ B;  4ZLT F;  2K33 A;  2R7Z G;  2NVY H;  1SLJ A;  4CKE A;  1HZA A;  1LTG D;  5E4W C;  1TXY A;  4QIW B;  2XWB B;  4HMI A;  2D0O A;  3I91 A;  1K73 C;  4A3G H;  4BXX G;  2IW3 A;  4K8J A;  2VS1 A;  4KN7 C;  5KND A;  2E2H H;  1GUS A;  3T51 B;  1SND A;  2A6H C;  3NTI A;  5FLX c;  4OON A;  1X3G A;  4LF5 L;  4C1N I;  1SE2 A;  1PZK D;  4CJ1 B;  3TP8 A;  3S1Q B;  2RCF A;  4G7H C;  1SYC A;  3I2Z A;  4OWX B;  1J9O A;  4A3F G;  4HED A;  1YNN D;  1VQG A;  4ALP A;  1Q12 A;  1XXG A;  3MXN A;  4GOP C;  4P73 A;  5C4X B;  1TWF H;  4NDX A;  2JA8 G;  4PZ7 A;  1QVC A;  1DJR D;  1IYJ B;  5IP7 H;  3M4Y A;  4JI8 L;  4QY7 A;  4UAI A;  4HR7 B;  1T5E A;  4PZ6 A;  5C0X I;  3PIP A;  2Q8R E;  4A93 G;  4LF9 L;  2PW5 A;  4JI1 Q;  2HHH L;  5A2Q L;  5CV9 A;  5LMN W;  1ILQ A;  1W2B A;  4LF5 Q;  5C3E B;  2R3Z A;  1FGB D;  5C0X G;  3NSW A;  1I4X A;  4MTN A;  3G71 A;  3CRL C;  3FEW X;  4ZQ3 A;  5HGT A;  3T53 B;  4UDU C;  1SXT A;  2I5H A;  2ZJP A;  1MJE A;  1SNC A;  2Z4I A;  1II3 A;  3CPF A;  1KLU D;  2R92 H;  1EY6 A;  3I4N B;  2RCN A;  2YV5 A;  5CBE E;  1B44 D;  3K0X A;  2NVX B;  2MP1 A;  5CGK A;  4C3H G;  2KED A;  2RVL A;  1E24 A;  4DV0 Q;  1HHV A;  1X65 A;  1YJW A;  2UUB Q;  1DYQ A;  3KLS A;  3BZC A;  4DV2 L;  3HOZ H;  1EY8 A;  3KUP A;  1B3A A;  1YHB A;  1A2U A;  1FNW A;  1EY5 A;  3KF8 A;  5IP9 H;  5EBD A;  2XGT A;  1GUN A;  1UWV A;  1A3V A;  1CFM A;  1PZJ D;  1WOC A;  2NVY B;  3AU7 A;  5FLX E;  1VQI A;  4XT1 B;  3HOY H;  3W1B A;  3TQY A;  2X69 A;  4I7Z C;  4RHS A;  1AZP A;  1JIC A;  1JR0 D;  3D3R A;  1SR3 A;  4TSS A;  4A3G B;  3GTM H;  1ENA A;  2R7F A;  3NBH B;  2VW9 A;  4ME3 A;  4DR4 L;  2E2H B;  1IBL Q;  1QG7 A;  3C3L A;  4A3K G;  1NAP A;  3U50 C;  3DWP A;  5I2Y A;  3K5N A;  3GTK B;  1TWA B;  1X56 A;  2AQ3 B;  4AYB B;  5M9O A;  4DV2 Q;  5C6A A;  5I2X A;  1AW7 A;  1JMC A;  3FRP B;  4IFD J;  2K5W A;  1TY0 A;  3RN5 A;  1TWF B;  4KTA A;  4DV1 Q;  1XMQ L;  1RCV D;  4C3I G;  1KDA A;  3W3A A;  4BBS G;  2XSC A;  5IOD A;  4YCW A;  5C3W A;  3SE0 A;  4R4Q A;  1I6V C;  1TKW B;  5K36 H;  3A74 A;  1EWC A;  1SAP A;  1O7Z A;  4YWK A;  4DR4 Q;  4MN3 A;  1MSG A;  1BXT A;  3GTO B;  5D65 A;  2O5J C;  2RDG A;  4IPH A;  1KXL A;  3CC4 A;  1ONL A;  3MVV A;  1JWU D;  5M5W H;  2LXJ A;  4GOP A;  3RLF A;  1GHK A;  1PH5 A;  1D1I A;  3NWT A;  2F0U A;  5ELC A;  1XMQ Q;  4A3D H;  1EQR A;  3OSO A;  1C7Y A;  2HIV A;  2EYH A;  3I72 A;  1WCM B;  1STG A;  2AWN A;  3W1G A;  1KIX A;  1VQF A;  3N6R A;  3NEN A;  5JEA H;  1VQP A;  1PTO H;  5C4Z A;  1E0B A;  3HKZ E;  1S4Z A;  1PV4 A;  1JB3 A;  3K5M A;  5FO7 B;  1VQL A;  2JK8 A;  1GXD C;  1XTC D;  1JOR A;  2NB0 A;  5DAU A;  1TWG H;  3G4S A;  1WTW A;  1K8A C;  1YJ9 A;  1N9W A;  3HOY B;  4DV4 Q;  5IYC G;  1GO3 E;  2O2L D;  2K50 A;  3TP7 A;  4GNX B;  2VZA A;  4H0L C;  5BN4 A;  4BY1 G;  4UP9 A;  2F0Q A;  3M7N A;  1MBY A;  1VMP A;  3J7A F;  3SK6 A;  2E2J H;  2GN5 A;  4KJO A;  5COR A;  4RGT A;  4JW0 A;  3DWA A;  3HKZ G;  2JA6 G;  3HOX G;  4LF8 Q;  4GN4 B;  4E6I A;  1M1K C;  3KJO A;  1Z6H A;  1LLR D;  2J0T D;  2EXZ A;  1VMC A;  2VB2 X;  4JYA Q;  1QZH A;  2B2V A;  4IFD H;  2B2Y A;  1KDC A;  1KL9 A;  4N9P A;  1XYI A;  2PZT A;  2VQF Q;  1EWH A;  1EQQ A;  2KEN A;  2OXP A;  3NBH A;  1PH8 A;  4GLA C;  1B9M A;  1I4G A;  4IUU A;  5DNF A;  4H7B A;  5I6W A;  3E5S A;  4KKT A;  4ZUI A;  1OXX K;  3GTQ B;  2VNU D;  1Y8N B;  1FGU A;  2C5C A;  4IUQ A;  1N34 L;  3NHH A;  4GLV B;  4AIM A;  5EPJ A;  2DJF C;  5ELD A;  2Z6K A;  3CHB D;  1W3S A;  5IYD H;  4A3D B;  1Q86 C;  3JAM i;  3E9H A;  2BA1 A;  1PYS B;  1WTP A;  3EVQ A;  1PTO C;  3FKI G;  1TII D;  4LFA L;  1MGS A;  1JE5 A;  2ZM6 L;  4L5S A;  4DPG A;  2ZJQ A;  4DUZ L;  1SRO A;  1BBW A;  4LJZ C;  2WB1 B;  1WJJ A;  2AUJ D;  2F3I A;  1ZXT A;  4YWM A;  2IX0 A;  3FPU B;  3I4M G;  4O42 A;  1S5E D;  1L1O B;  4GN3 B;  3VYS A;  1WTV A;  1N34 Q;  3PUY A;  1LAC A;  4X62 L;  4BXX H;  4A3E B;  1XX8 A;  1EQT A;  2HCI A;  5IGE A;  2RSN A;  3CMA A;  2NVQ B;  2Y0S E;  2E2J B;  4QL5 A;  2IX1 A;  4GN5 A;  1BCP D;  1EYA A;  3PF4 A;  2SNS A;  5IOC A;  4A3F H;  3UDF A;  4A76 A;  4PMB A;  2J4X A;  1PH2 A;  3U9S A;  1CI3 M;  5CV7 A;  2K28 A;  4CBV A;  2KHI A;  2ATW A;  1S5F D;  1ENF A;  3PUX A;  1SE8 A;  1Q8I A;  2ZXR A;  4LUV A;  1HXY D;  2XVS A;  3NTH A;  2PPB C;  5KNB A;  3QG1 A;  1BO0 A;  1QVG A;  3CCL A;  4XTC S;  1Y8P B;  4GNX A;  3K59 A;  3I56 A;  2E2I H;  1KNE A;  1HA5 A;  2WAQ B;  1A3T A;  3TS0 A;  5C0X H;  3I73 A;  2FIN B;  2Y0S G;  1PRT F;  3E0J A;  1GHJ A;  3PIP 3;  4QGU A;  3M85 A;  2OTL A;  3K8A A;  2R93 G;  5IYB G;  3L7Z C;  4X3K A;  1SYG A;  1XTD A;  1MSH A;  3CCR A;  2EY2 A;  1UE5 A;  3KYH C;  3TEH B;  4JI0 L;  4ODG A;  1N33 L;  3OOC A;  4QQB X;  3STB C;  4C3H H;  4O0A A;  2UXC L;  3OWE B;  3K0Y A;  2KVM A;  4H02 A;  3SK5 A;  1D7Q A;  3OIQ A;  1B70 B;  4FF1 A;  3PO2 G;  2SDF A;  2MO0 A;  3I4O A;  5HUR A;  1EZ6 A;  1RHP A;  3HG9 A;  1KC8 C;  4JI6 L;  4FXD A;  2VXW A;  2BH2 A;  3MXG A;  4JI4 L;  4JBM A;  1F9Q A;  3CKI B;  1R9T H;  2AQ1 B;  5EBC A;  4CDD C;  3TSS A;  5FO8 B;  4BY7 G;  1NR4 A;  2A68 D;  1EY0 A;  2OTJ A;  1WTH A;  3M4Q A;  5H1S E;  1LT6 D;  3CCM A;  1ZYR D;  4DUY Q;  4JI2 Q;  2XRS D;  2PI2 A;  5BR8 Q;  4A3K H;  1NMF A;  4KHP L;  1XPR A;  3M7G A;  3ER0 A;  1IYV A;  5JJZ A;  4UP8 A;  3SEB A;  2XRQ D;  4MZ9 A;  2LMC B;  3EBE A;  2ICE C;  3GDE A;  4JI4 Q;  4CDC C;  1VQ8 A;  2FFK B;  2F0P A;  3HOW G;  4BBS H;  1J6Q A;  2D0P A;  3V05 A;  1L1O A;  3CQZ H;  2I07 B;  3S1N B;  2ZXP A;  4KHZ A;  2RHQ B;  4DKA C;  1B53 A;  1EEI D;  2E75 C;  4DN4 M;  5LMU L;  3RZO H;  3BYT B;  1UE1 A;  2WAC A;  2E2I B;  1HZC A;  5EPK A;  3EA6 A;  2AKW B;  3NBI A;  3SHL A;  1NTG A;  2BOS A;  2PQA B;  4U68 A;  1C0A A;  3NWS A;  4NW2 A;  1EIH A;  5L37 A;  3AFP A;  4YWL A;  4RGO S;  4X64 Q;  1VS0 A;  4CKB A;  2JA5 G;  1STN A;  1QJO A;  2UXD L;  3CCV A;  3S17 H;  1K28 A;  2O4X A;  3OW2 A;  4C3H B;  1Y1V B;  2WFW A;  1F2M A;  4DV3 L;  1U5K A;  2VUM B;  1VQM A;  1U0L A;  2K5H A;  1U9R A;  4X66 L;  3H09 A;  3MXP A;  4YY3 Q;  5E3F A;  2QEJ C;  2RQX A;  1L0Y B;  4LFC L;  5IYC H;  4DNI A;  2KJX A;  4OGQ C;  4C3J B;  4BY1 H;  1KLG D;  4L5R C;  4DR5 Q;  3DM3 A;  1S5D D;  1X6O A;  3BVG A;  1CHQ D;  1YNJ D;  2AQ2 B;  1EEF D;  2IL8 A;  3ITP A;  2V1C C;  1DD2 A;  1NMG A;  2EZV A;  4A3K B;  1NY4 A;  2K6A A;  3F2D A;  4A3I G;  1FJG L;  4KK7 A;  1PA6 A;  1MI2 A;  3J7Y W;  4X3S A;  2F0S A;  3HOX H;  1BVS A;  2B8F A;  4F7X A;  2NYZ D;  3VYR A;  4X66 Q;  2YU9 H;  3UDG A;  4GKK L;  1BDO A;  3QOL A;  4Q0F A;  2UUA L;  4LFC Q;  3J81 E;  5M3F B;  1Q8K A;  2Z4H A;  1UEA B;  4DU9 A;  1HUN A;  1NR2 A;  2KHJ A;  5KNC A;  4IPG A;  2EQS A;  3TBI B;  1SMY C;  3RZO B;  2N88 A;  2IX3 A;  3KJP A;  3RMH A;  3F2B A;  3C1E A;  5FKA C;  2CCZ A;  4HJ8 A;  4P71 A;  3A55 A;  3M4O H;  3CAM A;  2QKI C;  2A68 C;  1B1Z A;  1STY A;  1Q46 A;  3KK7 A;  4DV7 L;  3NK9 A;  3CP0 A;  1H9J A;  4DV6 Q;  5LMN L;  1EQV A;  1G2S A;  3ONA B;  1BCP F;  2JXM B;  3D4W A;  1QE6 A;  1DOM A;  3QJY A;  2BH8 A;  3FKI H;  3I90 A;  1ESR A;  1RIP A;  4G7O C;  3ZYY X;  3NTK A;  5LL6 X;  2NWG A;  1K0R A;  2PQA A;  4NXM L;  5C4J B;  2IHF A;  1LT3 D;  1Y1W G;  1Y69 U;  3S15 B;  3I4M H;  1I4Q A;  4LF6 Q;  4X3U A;  4DR1 Q;  1YIT A;  4P74 A;  4DR6 Q;  5LMN Q;  1O7L A;  4U67 3;  5M3M G;  3MFG A;  4LAA A;  2K4K A;  1VDZ A;  4YCV A;  1QUQ B;  5IGG A;  4Y52 H;  2XWJ B;  4RKL A;  4DK3 C;  1JC7 A;  5KYL A;  1YNX A;  3HKZ B;  1TR5 A;  5C5M A;  2BA0 A;  2F0T A;  1D1K A;  2MFI A;  3A8I E;  1B2T A;  1JWM D;  5KRU A;  2YU9 B;  4OIK A;  3Q24 A;  2ASB A;  1D6E C;  1TWC B;  4ME5 A;  4RGN A;  3S1M H;  4G57 A;  1X54 A;  1O7I A;  3DM1 A;  3HGB A;  1X32 A;  5GAE C;  3TRZ A;  2MPM A;  2QW7 A;  3J7Z C; 
#chains in the Genus database with same CATH homology
 1L1O C;  2EXD A;  1PH3 A;  4HJ9 A;  1G6P A;  2CWA A;  4IPH A;  4B3M Q;  1HZB A;  1OXS C;  4IJH A;  3CC4 A;  1KXL A;  1Q81 C;  3PO3 H;  2UU9 L;  1B7Y B;  5M5W H;  2LXJ A;  4GOP A;  4JBW A;  3RLF A;  3HOU H;  2F52 A;  5C44 G;  1PH5 A;  5DLQ E;  1IBM L;  4R4O A;  3BU2 A;  4LFA Q;  3ULJ A;  4DAM A;  1JJ2 A;  3I4N G;  2EIF A;  2Q2I A;  4JI1 L;  2ZM6 Q;  4DR3 L;  1NJI C;  1XMQ Q;  4A3C H;  2HT1 A;  3A5U A;  4DUZ Q;  1AE2 A;  5IYB H;  1EQR A;  1V1Q A;  3ERS X;  1C7Y A;  2HIV A;  2F4V L;  4A3D H;  1Q7Y C;  1N32 L;  1KRS A;  1P16 A;  4AYB E;  2AWN A;  3K7A H;  3W1G A;  3ULP A;  1KIX A;  2B63 G;  1VQF A;  3NEN A;  1VQP A;  2GVB A;  1E1T A;  2IHE A;  4UPA A;  4GOP B;  3HKZ E;  1N36 L;  4C2M H;  3S1N H;  1PV4 A;  2AWO A;  3IRB A;  2JA6 H;  4X62 Q;  1H95 A;  1GKH A;  4NPS A;  2E8G A;  3RLO A;  1VQL A;  2JK8 A;  4GS3 A;  1VQ6 A;  1IZ6 A;  4L5T A;  3I55 A;  4B3T L;  3S2H H;  2JJQ A;  3LGJ A;  3PUV A;  1VQN A;  1CSQ A;  1VQ4 A;  4WJ3 M;  3PGZ A;  3PO2 H;  3MEF A;  1TWG H;  4DV6 L;  2LXK A;  3G4S A;  3RNU A;  3T1H L;  1S40 A;  1K8A C;  1IBM Q;  1YJ9 A;  4A3G G;  3HOU G;  3L2P A;  4DV0 L;  1N9W A;  4AQY Q;  2L15 A;  4DV4 Q;  1VQB A;  4DR3 Q;  5IYC G;  1GO3 E;  1K83 H;  1HJP A;  4LUO A;  2JE6 I;  4DR2 Q;  2UUB L;  1WI5 A;  2K50 A;  4JOI A;  4GNX B;  2VZA A;  4BY7 H;  1EIF A;  5FLM G;  3Q8D A;  4UP9 A;  4BY1 G;  3J81 j;  2GVA A;  4R4C A;  2F4V Q;  3M7N A;  3J81 i;  1UE7 A;  3H3V I;  4AYB G;  3HOV G;  4A3J H;  2GN5 A;  2E2J H;  1E22 A;  2YYZ A;  1N36 Q;  2AHO B;  1Q1E A;  3HKZ G;  4NB3 A;  2JA6 G;  3UE1 A;  1GD7 A;  3EN2 A;  1Y1V H;  3GTJ H;  3HOX G;  4B3T Q;  4LF8 Q;  4GN4 B;  1EIY B;  4LF6 L;  1A62 A;  1G51 A;  4YHH L;  1EUJ A;  1M1K C;  3KJO A;  2WB1 G;  4JBK A;  1HZ9 A;  1KAW A;  4DR1 L;  1EFW A;  1IBL L;  2VUM H;  4KLK A;  2ZTC A;  4DR6 L;  1L2F A;  1G29 1;  4JYA Q;  3M3Y H;  1QZH A;  4B3R L;  5ELN A;  5GAD C;  1MIU A;  4JG2 A;  3S16 H;  1CSP A;  4HJ5 A;  4R4T A;  2JQO A;  2NVT H;  3HOW H;  3KDF A;  4DK6 C;  1VQJ A;  4A3E G;  1KL9 A;  1PH9 A;  4UP7 A;  2VQF Q;  1UEB A;  3KF6 B;  2KEN A;  4BBR H;  4RG1 A;  1YIJ A;  1EQQ A;  1ASZ A;  3K81 C;  2ZTD A;  1PH8 A;  4P72 A;  2WAQ E;  4GLA C;  4HIO A;  4C3J H;  2N49 A;  4DV1 L;  4DR4 Q;  2QA4 A;  3S1Q H;  4JI0 Q;  1N33 Q;  4EX5 A;  3W5O A;  1OXX K;  2UXC Q;  1E1O A;  1EOV A;  1CKN A;  1QUQ A;  2PMZ E;  3F8T A;  3G48 A;  5AJ3 L;  2QEX A;  2VNU D;  1FGU A;  1S72 A;  5C4X H;  1N34 L;  2R92 G;  4GLV B;  4AIM A;  3S2D H;  2Z6K A;  1W3S A;  2DUD A;  1RL2 A;  3WWV A;  1S3O A;  2UUC L;  5IYD H;  4JI6 Q;  1Q86 C;  3JAM i;  1HNW L;  4A3M H;  3E9H A;  2JA5 H;  2BA1 A;  4JI5 L;  5JJK A;  5M5X H;  1PYS B;  1LYL A;  3NEL A;  4HJ7 A;  3GTG H;  3HOZ G;  1IBK Q;  1X3E A;  5M3F H;  2K5V A;  1LTL A;  1KQS A;  3FKI G;  3OTO Q;  4BBR G;  5IP9 G;  1I50 H;  4LFA L;  1JE5 A;  1OXT A;  2YTX A;  2ZM6 L;  1NE3 A;  4L5S A;  2WAQ G;  2OQ0 A;  5C3E H;  4DPG A;  2ZJQ A;  4DUZ L;  1XPU A;  1I3Q H;  1SRO A;  1BBW A;  4OO1 I;  1WJJ A;  3JC6 6;  2F3I A;  4KHP Q;  1PYB A;  4YWM A;  2IX0 A;  2JEB I;  5AJ3 Q;  3CPW A;  3J81 c;  3I4M G;  2IT1 A;  3CCS A;  4A3B H;  1FL0 A;  1L1O B;  4GN3 B;  1N34 Q;  2CKZ B;  4OO1 G;  1X3F A;  3PUY A;  4X62 L;  4BXX H;  1SRU A;  3T1Y L;  1PVO A;  2ES2 A;  2UUC Q;  1HNW Q;  2I5L X;  2K52 A;  4HID A;  4LF7 Q;  2DGY A;  4JI5 Q;  3A0J A;  3CMA A;  1K3R A;  4A3M G;  2NZO A;  4JV5 Q;  2Y0S E;  4K0K L;  4QL5 A;  2IX1 A;  4GN5 A;  3PF4 A;  1SN8 A;  4AQY L;  4DV4 L;  5FJ8 G;  2K14 A;  4DR2 L;  5J3B A;  4A3F H;  4A3I H;  2I5M X;  4POG A;  3UDF A;  4A76 A;  1KHI A;  5LMU Q;  3GTL H;  1HH2 P;  2MQH A;  3UDI A;  1PH2 A;  1C9O A;  2PI2 E;  2KHI A;  3F1Z A;  1HNX L;  2ATW A;  4BA1 I;  4B3S Q;  3PUX A;  1SE8 A;  4IPD A;  4LUV A;  3CCU A;  4DR7 L;  5C4J H;  5K36 G;  1QVG A;  3S15 H;  2LSS A;  3B6Y A;  3PUZ A;  1YJN A;  1JB7 A;  2VQE Q;  2YTV A;  3T1Y Q;  3CCL A;  4XTC S;  2UXB L;  1XMO L;  4GNX A;  4LF8 L;  4DAY B;  2WB1 E;  3I56 A;  2E2I H;  5JJI A;  2CQO A;  5ELO A;  3PO3 G;  3M9B A;  1VQA A;  3TS0 A;  4TQU S;  2CWP A;  4K0K Q;  4JYA L;  2A19 A;  2HQL A;  2UXD Q;  2Y0S G;  4A4I A;  3GTK H;  1TWA H;  1OTC A;  2ZTE A;  3D0F A;  4QGU A;  4LF4 L;  3FHW A;  1BBU A;  4L5Q A;  3M85 A;  2OTL A;  3K8A A;  4A3C G;  2VQF L;  2JA7 H;  4A3D G;  2N3S A;  1D8L A;  5IYB G;  3L7Z C;  4DV3 Q;  1XNR L;  2R93 G;  1XTD A;  1X55 A;  1E3P A;  1IXR A;  4A75 A;  1HNX Q;  3CCR A;  1XJV A;  1KD1 C;  3S24 A;  5JEA G;  4DR7 Q;  4QJF A;  5IT9 c;  1UE5 A;  4IOA A;  1AH9 A;  5GRO A;  1OXU A;  1P8L A;  1UE6 A;  4BA2 I;  1JT8 A;  1TWC H;  3KYH C;  3TEH B;  2WP8 J;  3VDY A;  4JI0 L;  1N33 L;  4QQB X;  2UXB Q;  3STB C;  2NN6 I;  4C3H H;  4O0A A;  1XMO Q;  2UXC L;  4H02 A;  2AMC B;  3KF6 A;  1EYG A;  4PMW A;  2HIX A;  4GKJ Q;  1K8G A;  2R93 H;  4KI0 A;  3CCQ A;  3MXN B;  1VQ7 A;  1B70 B;  1XPO A;  2H5X A;  3GTP H;  3E0E A;  4JI3 L;  3PO2 G;  3GTO H;  2NN6 G;  1VQ9 A;  2ID0 A;  2MO0 A;  3I4O A;  3AEV A;  3KLW A;  1EWI A;  2N8N A;  3DLL A;  1KC8 C;  4JI6 L;  1D7Q A;  3HKS A;  2BH2 A;  4JI4 L;  3S1R H;  4JBM A;  3A5Z B;  3H15 A;  4LF4 Q;  1R9T H;  2Q2T A;  1FVI A;  4A3L H;  3PF5 A;  1FJG Q;  1XNR Q;  1IBK L;  4BY7 G;  1Y1W H;  1VQO A;  2JA7 G;  5JEA J;  3OTO L;  2OTJ A;  2N78 A;  4RMF A;  3M4Q A;  5H1S E;  3CCM A;  3H0G H;  4A3J G;  4DUY Q;  1WCM H;  4JI2 Q;  4JOI C;  1I5F A;  3PSI A;  4JI8 Q;  4POF A;  1E7Z A;  4GKK Q;  4LFB L;  3UDX A;  4JI7 L;  2PI2 A;  5M3M H;  5BR8 Q;  2UUA Q;  4A3K H;  1NMF A;  1YHA A;  2VL6 A;  1XPR A;  2MO1 A;  4KHP L;  1Y1V G;  3ER0 A;  1VQE A;  4NXN Q;  4LF9 Q;  1A8V A;  2HHH Q;  1BKB A;  2OCE A;  1J5E L;  1I6H H;  4JI3 Q;  4UP8 A;  4IFD I;  3TRE A;  2Z0S A;  4MZ9 A;  2VUM G;  4MNO A;  3EBE A;  1Q82 C;  3GDE A;  2XTI A;  4PZ8 A;  4LF7 L;  4JI4 Q;  1XNQ L;  1VQ8 A;  4IFD G;  3HOW G;  4BBS H;  1J6Q A;  1M90 C;  2D0P A;  4A3L G;  1PFS A;  4JV5 L;  2KBN A;  1L1O A;  1LM0 A;  1VQH A;  3CQZ H;  3K7U C;  2MNA A;  2R6G A;  4KHZ A;  1YBY A;  5GQO A;  2E5L L;  2RHQ B;  4DKA C;  3ICE A;  4OXP A;  3CF5 A;  3KF8 B;  3CCE A;  4IPC A;  5LMU L;  4DV7 Q;  3RZO H;  3OYY A;  1HNZ Q;  1UE1 A;  4LFB Q;  4JI7 Q;  3GD7 A;  1N8R C;  3RZD H;  3NEM A;  2R7Z H;  2I0Q A;  3CCJ A;  1HZC A;  4PG3 A;  4R4I A;  2AKW B;  4FDB A;  4R1J A;  4B3S L;  1YVC A;  1NTG A;  1MKH A;  1J5E Q;  2PQA B;  3TS2 A;  5C4X G;  2ALY B;  4IO9 A;  1K9M C;  2VQE L;  1GM5 A;  2PNH A;  2R7D A;  5C44 H;  1LUZ A;  1Q1B A;  1C0A A;  4OX9 L;  1KRT A;  3I4N H;  5IYD G;  3AFP A;  2B3G A;  4YWL A;  2NVX H;  2ZJR A;  1XNQ Q;  3RLN A;  1CKM A;  4X64 Q;  3CD6 A;  1VS0 A;  5E7N A;  1VQ5 A;  2JA5 G;  1OXV A;  2FXQ A;  2Z6K C;  1JJC B;  3RN2 A;  2B63 H;  4NXM Q;  3L0O A;  2K5N A;  4O2D A;  3CCV A;  5M3F G;  1PH4 A;  3S17 H;  2UXD L;  2E5L Q;  5IWA L;  3OW2 A;  4JCV E;  4AH6 A;  3GO5 A;  4Y7N H;  3CC2 A;  4GLX A;  5C3E G;  1X9N A;  2WFW A;  3E9I A;  4HIK A;  4DV3 L;  2JA8 H;  1YI2 A;  2A8V A;  4X6A H;  2R7Z G;  1JJG A;  2NVY H;  1SLJ A;  1AE3 A;  1U5K A;  1VQM A;  1U0L A;  2K5H A;  4J15 A;  4X66 L;  1GVP A;  1HZA A;  1IL2 A;  1V9P A;  1CUK A;  1TXY A;  3GTQ H;  4A3B G;  4YY3 Q;  1I94 Q;  2D0O A;  1YHQ A;  1K73 C;  4A3G H;  2RHS B;  4BXX G;  4OX9 Q;  4LFC L;  4A93 H;  2VS1 A;  4YCU A;  5IYC H;  2JEA I;  4GKJ L;  4DNI A;  5HGQ A;  2E2H H;  3U4Z A;  4X65 L;  3PUW A;  5FLM H;  4BY1 H;  5FLX c;  4L5R C;  4DR5 Q;  4OON A;  3DM3 A;  1X6O A;  1X3G A;  2A1A A;  4LF5 L;  4WJ4 A;  1ASY A;  1VQC A;  2V1C C;  5IWA Q;  3JAM c;  3HOV H;  1WFQ A;  3I2Z A;  4OWX B;  1NMG A;  3J7A 5;  2IY5 B;  4EQ5 A;  4A3F G;  1NY4 A;  3F2D A;  4A3I G;  1PHJ A;  1FJG L;  2RF4 A;  1PA6 A;  1HR0 W;  3G6E A;  1VQG A;  4ALP A;  1Q12 A;  4GOP C;  4LWC A;  4P73 A;  1TWF H;  3HOX H;  1BVS A;  4LNQ A;  2JA8 G;  3H3V H;  4PZ7 A;  1T9H A;  1QVC A;  1V43 A;  4X66 Q;  1IYJ B;  5IP7 H;  1VQK A;  2YU9 H;  3PV0 A;  4DUY L;  3UDG A;  4JI2 L;  2NZH A;  4JI8 L;  4IOC A;  2UU9 Q;  4GKK L;  1NBW A;  4QY7 A;  1YEZ A;  1A0I A;  3EIV A;  4OWT B;  1PH6 A;  5BR8 L;  2UUA L;  3ZJY C;  4LFC Q;  4JC0 A;  4PZ6 A;  5C0X I;  5GAH C;  5EAY A;  3PIP A;  4APV A;  4NXN L;  4A93 G;  4LF9 L;  1Q8K A;  3AQQ A;  4JI1 Q;  2HHH L;  4A3E H;  2D62 A;  3J80 i;  4X65 Q;  5LMN W;  1W2B A;  2KHJ A;  4HJA A;  1N32 Q;  1SFO H;  4IJL A;  4QIW E;  4LF5 Q;  4IPG A;  2EQS A;  5C0X G;  1PH1 A;  1HR0 L;  4GNX C;  4MTN A;  1CKO A;  1WYD A;  1QZG A;  2NVQ H;  3KJP A;  3G71 A;  3F2B A;  1DGS A;  3D31 A;  2CCZ A;  3U4V A;  4P71 A;  4HJ8 A;  3AYH B;  2I5H A;  3STB D;  2ZJP A;  5GAG C;  3M4O H;  3CAM A;  1MJE A;  2Q2U A;  4XIG S;  1Q46 A;  3CPF A;  3U58 A;  2R92 H;  5IP7 G;  3CME A;  2RCN A;  2YV5 A;  4DV7 L;  1HNZ L;  3K0X A;  3CP0 A;  4DV6 Q;  3T1H Q;  3S14 H;  4DV5 L;  5LMN L;  5M5Y H;  3KFU A;  1L0W A;  1E24 A;  2VY3 A;  4DV0 Q;  1YZ6 A;  1X65 A;  1YJW A;  2UUB Q;  3BJU A;  3BZC A;  4DV2 L;  2OWO A;  3HOZ H;  1SMX A;  5C0X J;  3I7F A;  1YHB A;  2BH8 A;  3FKI H;  5IP9 H;  1A63 A;  1HR0 Q;  3PCO B;  2KCM A;  2XGT A;  4UY8 C;  1UWV A;  1VCI A;  4P75 A;  4C3I H;  4X64 L;  1WOC A;  2Q2H A;  1RIP A;  1PH7 A;  1VQI A;  3HOY H;  3W1B A;  3TQY A;  1K0R A;  1Y14 B;  2PQA A;  2K75 A;  5IE8 A;  2IHF A;  1Y1W G;  4NXM L;  1SR3 A;  3KDF B;  3I4M H;  5HY6 A;  3GTM H;  4LF6 Q;  2R7F A;  4LW1 A;  3K80 C;  4LUZ A;  4YHH Q;  2CFM A;  3HFZ B;  3H0G G;  3NBH B;  2VW9 A;  1WCM G;  3BZK A;  4ME3 A;  4DR1 Q;  1YIT A;  4DR4 L;  1Z47 A;  4P74 A;  4DV5 Q;  1IBL Q;  5LMN Q;  4DR6 Q;  3CXC A;  5M3M G;  4OWW B;  3ULL A;  4A3K G;  4B3R Q;  3AFQ A;  4B3M L;  1MJC A;  3U50 C;  3KOJ A;  4TVA B;  1X56 A;  2K4K A;  3CC7 A;  4YCV A;  4DV2 Q;  1QUQ B;  3FP9 A;  1CKN B;  3CW2 C;  3RR5 A;  3SGI A;  2B29 A;  4YY3 L;  1I94 L;  1JMC A;  4Y52 H;  3UE0 A;  2JA9 A;  2C35 B;  4DK3 C;  3F2C A;  5FJ8 H;  1YNX A;  3M4P A;  5IY0 A;  4IFD J;  2BA0 A;  2KCT A;  2QGQ A;  3RN5 A;  5JJL A;  4DV1 Q;  1TWH H;  2MFI A;  1XMQ L;  2OQK A;  3J80 c;  3PIO A;  4JBJ A;  4BBS G;  4DR5 L;  3HOY G;  2ASB A;  4YCW A;  4HIM A;  1QVF A;  3S1M H;  1VQD A;  1X54 A;  1O7I A;  2YTY A;  4R4Q A;  5GAE C;  1Z9F A;  3TRZ A;  3A74 A;  3J7Z C;  1B8A A;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...