3HOYH

Complete rna polymerase ii elongation complex vi
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoyH00
1OTCA 5LMNL 3S1RH 2K52A 2Q2TA 2WFWA 2K5VA 5C4XG 1CSQA 4JBKA 3KYHC 4QL5A 1D8LA 3CCUA 1J5EQ 4P71A 3HOZH 3DLLA 3K80C 4DUZQ 3HOYG 2JA8G 3PO2G 1Y1VH 3J7ZC 1QVCA 3U4VA 1EQQA 1S72A 1B70B 3DM3A 4BA2I 4IFDJ 1XPRA 3Q8DA 5IY0A 2JA7G 5IYBG 5M3MG 4A3JH 3M7NA 4IO9A 4HIOA 2CCZA 3A74A 1I6HH 4NXNQ 1E7ZA 1EIFA 4GS3A 3PO3G 1CKOA 2MFIA 1PH3A 1KL9A 3GTOH 3CCQA 4JOIA 2JEBI 4A3DH 4JI5Q 2LSSA 4DV5L 1NJIC 1X56A 4HJ7A 2R7ZH 4A93H 1YI2A 4JI4L 1YBYA 1L2FA 1PH5A 2KENA 2WB1E 3ULJA 3H0GG 3GTJH 4DV1L 1XJVA 1WFQA 2OTLA 4BY7H 1E24A 2KCTA 4YWLA 1PHJA 4Y52H 2DUDA 4A3EH 1AH9A 1VQ7A 2A19A 4DR4Q 3T1YQ 4A76A 2JA7H 4GLAC 4AYBE 5IYCH 1XPUA 5HY6A 1Q86C 4HIMA 1EWIA 2UXCL 1HNWQ 1UE1A 4DKAC 1Q1EA 4X66L 1VQKA 1WCMG 2NVTH 3G71A 2I5HA 2QGQA 4BY1G 5ELNA 4K0KQ 4PZ6A 4DV2L 2B29A 1NE3A 1Q1BA 4JV5L 4EQ5A 3CCRA 1C7YA 1E3PA 4B3ML 4BXXH 3STBC 3JAMc 4NXML 3A5UA 5GADC 2YTYA 4JYAQ 2GVBA 3HKSA 3NELA 1YJWA 4IFDG 1W2BA 1N32Q 2R7DA 3A0JA 1VQLA 1KD1C 5LMNW 2B63G 3F1ZA 4B3TQ 4B3SL 3WWVA 2YU9H 4NPSA 5IWAL 2UUAL 1YJ9A 3STBD 4OWWB 3PV0A 1FJGQ 2VS1A 3CCJA 4JI2L 1KIXA 3D0FA 1DGSA 2E2JH 3KJPA 1SR3A 1I5FA 5IYBH 3HKZE 1K3RA 5HGQA 3PF4A 1JB7A 1V9PA 3S17H 2VZAA 3F2DA 4KHPL 1KXLA 3GTKH 3S1NH 3AFPA 3S2HH 1T9HA 2AMCB 1OXUA 1PV4A 4PMWA 3M4OH 1SFOH 3KOJA 4DPGA 3LGJA 1SN8A 4GOPC 4XIGS 1HH2P 5C4XH 2R92H 4UP8A 2ZTDA 5M3FH 2IX1A 4JI1L 4DV3L 4JI0L 2CFMA 4IPDA 4YHHQ 1HNXL 1R9TH 4A3LH 3GD7A 3UDXA 3TS0A 4LF5L 1VQ6A 1SLJA 3K7UC 3GTMH 4LUOA 5M5YH 4JI7L 2KBNA 5JJKA 3TS2A 1B8AA 1KAWA 1WOCA 4A3CH 3J81j 5FJ8G 2I5LX 1YIJA 3UE0A 3H0GH 4JC0A 1N36Q 2UUBQ 4AQYQ 2ID0A 1IYJB 1IBKQ 1KRSA 4DNIA 4A3MH 2HHHL 4EX5A 4UPAA 1TWHH 4JBMA 1VQDA 1L1OC 2WP8J 4QY7A 4L5TA 3RN2A 2NN6I 1LTLA 2YTVA 1G291 3D31A 3K7AH 1VS0A 2MO0A 2NZOA 4R4CA 4JI3Q 2UXDQ 2VQEL 5M3MH 4A3JG 2N49A 2HHHQ 1IBKL 2CWAA 4AQYL 1U5KA 2K75A 2R6GA 1N36L 2Y0SE 5M5WH 4UP9A 4C3IH 2ZTCA 1NTGA 1QZGA 2R7ZG 1K9MC 4LF5Q 1CUKA 1IBLQ 2B3GA 1X3EA 3GTQH 2Q2HA 1HNXQ 2F52A 4DV3Q 4A3CG 2YV5A 4IJLA 4JBWA 1VQIA 4LUVA 4LNQA 4QJFA 4HJ8A 3EBEA 1MJEA 3I2ZA 2L15A 2RHQB 4JOIC 1K8AC 3J80i 4IPGA 5IT9c 4DV6Q 3U58A 4QGUA 4APVA 4KHPQ 1RL2A 1JJCB 3S14H 1JT8A 1VQ4A 3CP0A 2IHEA 1Q8KA 3I4MH 3L2PA 4R1JA 3JC66 4L5RC 3BZCA 1E1OA 4A3GG 2JE6I 3AYHB 4JI2Q 1MIUA 2OTJA 2HIVA 2E8GA 3M3YH 1EIYB 5C44G 3KLWA 2K50A 2ZTEA 3K8AA 1XPOA 1N33Q 1NMFA 1YVCA 1K0RA 2UUAQ 4DR2L 1HR0L 1G6PA 5C44H 1NMGA 4B3SQ 1HZCA 5C0XG 2R7FA 1VQJA 4YCWA 2I0QA 3GTLH 2LXKA 4IPHA 3TEHB 1VQCA 2ZM6L 3S16H 4YWMA 5BR8L 2PI2A 1RIPA 2PNHA 4C3JH 4A3IG 4NXMQ 1VQ9A 3HOXH 4LF9Q 2VNUD 2IT1A 3PUVA 4B3MQ 4XTCS 1UE7A 3GTGH 1VQOA 3T1HL 1VQEA 3AQQA 3CMAA 4DUYL 4JV5Q 2D0PA 3E9HA 1FGUA 2MO1A 4BBRG 4X64L 3CCVA 4DV2Q 4A75A 4A3EG 4PZ8A 1I94L 1TXYA 1J6QA 1VQNA 2ZJQA 1JE5A 1I94Q 2D62A 4H02A 2PQAA 1Q46A 1HNWL 2D0OA 4X64Q 4MZ9A 3W1GA 3CCSA 1Q82C 4DUYQ 5FLMG 3IRBA 4A93G 3T1HQ 3T1YL 3CMEA 4GN4B 3L7ZC 4DR4L 5IP7H 5C3EG 2V1CC 3HFZB 3PUWA 4LF9L 3S24A 3CF5A 3CCMA 5BR8Q 4GOPA 1X9NA 1QZHA 2ZM6Q 3I4NG 1YHBA 4IFDI 4BBRH 4KLKA 1V1QA 3TQYA 3W5OA 5JEAJ 4JI4Q 1LUZA 3CPWA 1YHAA 4JI5L 5JJIA 3PGZA 4R4TA 2PMZE 3KF6B 4R4OA 1CKNA 2JA9A 5M5XH 4DR2Q 3L0OA 1FVIA 1HR0Q 3GTPH 1C0AA 1OXXK 1N33L 1WCMH 2HIXA 3PIOA 2OQKA 1OXSC 2B63H 4IJHA 4GLVB 3CD6A 1UE5A 1ASYA 1X65A 3PO3H 1AE3A 2AHOB 4POFA 1BKBA 2RCNA 4A3FH 3PUXA 1NY4A 4DUZL 2Y0SG 2ALYB 2GVAA 4DV6L 2Q2IA 2JK8A 3UE1A 3BZKA 4A3GH 4ALPA 1PH8A 4JCVE 4HIKA 3E0EA 3CXCA 4YWKA 3B6YA 5IYDG 1GVPA 2AWNA 1IBLL 1C9OA 4JI8Q 4YY3L 4LFAL 3NBHB 3H3VH 3J81i 4BBSG 1UEBA 3SGIA 1GKHA 1A62A 2XGTA 4QQBX 4NB3A 3J80c 1XNQL 3RLNA 4DR7Q 4DR1Q 2AWOA 5IP9H 2OCEA 1EOVA 5JJLA 1E22A 4IPCA 3RZOH 1X55A 3I4OA 3S1QH 1D7QA 1OXVA 2Z6KC 3FKIG 4YCUA 1K73C 1AE2A 2VQEQ 4HJAA 2UXDL 3M9BA 4L5QA 1L1OA 3HOYH 1PYSB 2NVYH 1VQGA 4JI3L 3UDGA 2KHIA 2K4KA 3U50C 2Z6KA 4GN3B 1M1KC 3KFUA 2MQHA 4DV0Q 3G6EA 4BA1I 3PIPA 2VW9A 1KC8C 1PYBA 4LF6Q 3CC7A 2ASBA 2BH8A 4LUZA 3PUYA 3HOVH 3S15H 2XTIA 4A3BG 1PFSA 1TWGH 2UUBL 3CC4A 4JBJA 3F2BA 4LF4L 3J7A5 1YITA 4JI7Q 5M3FG 1HR0W 1A8VA 3HOXG 1N8RC 3KF6A 2R92G 1YZ6A 1VQ8A 3ULLA 4B3RL 4YHHL 1Y1WG 2JA8H 3PO2H 4JI0Q 4JI1Q 1IXRA 2EQSA 4A3MG 5DLQE 4DK6C 2HQLA 2A1AA 2VQFL 2F4VQ 2JEAI 4WJ3M 3E9IA 3M85A 4C3HH 1G51A 2JA5G 1BBUA 1I3QH 1VQPA 3W1BA 1E1TA 4X6AH 4P75A 4RG1A 4POGA 1WJJA 3GO5A 4A3LG 3NEMA 4A3FG 2K5HA 3K81C 2IHFA 2VL6A 3OTOL 1FL0A 4QIWE 3KJOA 1TWAH 2H5XA 1LM0A 2FXQA 4TVAB 3ER0A 1KQSA 4LF8Q 2WAQG 4AH6A 1FJGL 4KI0A 2GN5A 1CKNB 3U4ZA 1X54A 3S2DH 2IX0A 1HJPA 4OX9Q 5IWAQ 4PG3A 2N3SA 4DAMA 1TWCH 2JQOA 4GLXA 3G48A 4L5SA 4B3TL 3HOUG 1EFWA 2Q2UA 1QUQA 5GAEC 1XTDA 1Z9FA 4BXXG 1GD7A 3KF8B 3I55A 4DV7Q 3I4NH 4ME3A 3HOUH 1GO3E 1N32L 1BBWA 4MTNA 4RMFA 2NVQH 3S1MH 3GDEA 5IYDH 3TRZA 4JYAL 3ERSX 5IE8A 3ICEA 4DV4L 4A3IH 4HJ5A 1B7YB 2JA6H 1QUQB 1TWFH 3M4PA 1CKMA 5C0XI 3KDFB 1A0IA 4LWCA 5E7NA 2PQAB 3CCLA 5AJ3Q 1I50H 2AKWB 1VQFA 3ULPA 4K0KL 1SRUA 1M90C 3CAMA 1L1OB 1MKHA 2RHSB 4MNOA 4OO1I 1P8LA 1YEZA 4X66Q 4LFCL 1IBMQ 4X65L 1JJ2A 3HOVG 1Q81C 4A3BH 5GROA 2UXCQ 2IY5B 3G4SA 4BY7G 1WYDA 4BBSH 2JA5H 5LMUQ 3RNUA 5H1SE 4DR5L 3JAMi 3H15A 2UUCQ 4LFBQ 4DR3L 2BA1A 1XNRQ 4P73A 2UU9Q 1KHIA 5J3BA 2HT1A 2QEXA 4GNXA 3ZJYC 1Y1WH 4AIMA 4IOCA 5EAYA 1PH6A 2E5LL 1HZBA 2N8NA 4DV1Q 3FKIH 1XMOL 3OW2A 3RLOA 4R4QA 2R93G 1NBWA 1XMOQ 2BA0A 1L0WA 4DV5Q 3H3VI 3F2CA 1P16A 2YTXA 2E5LQ 2VY3A 2K5NA 3HKZG 3K0XA 1SROA 2CKZB 2LXJA 4UP7A 2UU9L 1XNRL 4DR3Q 4NXNL 3RLFA 3FP9A 4LFBL 1YNXA 4FDBA 4P72A 3PSIA 1VQAA 4GNXC 4DR5Q 2NVXH 5LMUL 2UUCL 2ZJPA 3HOZG 1JJGA 3AFQA 4JG2A 2Z0SA 2MNAA 4X65Q 1Q12A 1Q7YC 2I5MX 1IBML 4LFCQ 4P74A 3BU2A 1VQHA 1QVGA 1QVFA 1O7IA 1J5EL 1K83H 1ASZA 4OO1G 5AJ3L 4UY8C 4LW1A 3RR5A 1VCIA 2C35B 1X6OA 1PA6A 1EQRA 3PF5A 2OWOA 1BVSA 3I7FA 4GNXB 2ZJRA 1VQBA 5LMNQ 2R93H 2YYZA 4DV4Q 4OXPA 4OWXB 1YHQA 2VUMG 2A8VA 4R4IA 3AEVA 2E2HH 3F8TA 1PH9A 1LYLA 3RN5A 4DV7L 1Y14B 2DGYA 3MEFA 2JA6G 3MXNB 5FLXc 3VDYA 3CC2A 3HOWG 3EIVA 1N9WA 5FJ8H 1U0LA 1HNZQ 3A5ZB 3UDIA 4OX9L 1W3SA 1N34L 4JI6L 3M4QA 1IL2A 4WJ4A 4A3KH 4LF8L 3HOWH 2F3IA 1JMCA 3I4MG 4GKKL 1UWVA 4AYBG 5IP7G 5GAGC 1PH4A 5K36G 3PCOB 3OTOQ 3UDFA 4HJ9A 1PH7A 4DR6L 1VQ5A 4GKJL 2ATWA 2QA4A 2N78A 1XMQQ 2PI2E 4O0AA 4OONA 4KHZA 1X3FA 3NENA 4X62L 2E2IH 2NN6G 1K8GA 3EN2A 2NZHA 2VQFQ 4PZ7A 4LF7Q 2F4VL 2UXBL 1KRTA 1S40A 4DK3C 4B3RQ 1CSPA 3RZDH 2UXBQ 3OYYA 1HZ9A 1V43A 5GAHC 4LF7L 4IOAA 3KDFA 1VQMA 1WI5A 1PH1A 1OXTA 2KHJA 1UE6A 1X3GA 5C3EH 1PH2A 4LF4Q 4X62Q 4A3DG 1PVOA 4GOPB 5FLMH 1GM5A 4DAYB 1XMQL 2VUMH 2ES2A 3BJUA 2K14A 2WAQE 5JEAG 4DR6Q 4J15A 4GKJQ 3I56A 5IP9G 3TREA 4A3KG 4LF6L 1S3OA 1EUJA 3J81c 5C0XJ 2EIFA 1MJCA 1SE8A 2EXDA 4DV0L 4GKKQ 1H95A 3CCEA 5GQOA 4HIDA 1EYGA 2CQOA 4Y7NH 5ELOA 3CQZH 4OWTB 4A4IA 1Y1VG 3FHWA 4JI6Q 1N34Q 4BY1H 5C4JH 4TQUS 4GN5A 2RF4A 4DR1L 1HNZL 1IZ6A 1XNQQ 4DR7L 2KCMA 4O2DA 1A63A 2WB1G 2OQ0A 2JJQA 3CW2C 3PUZA 3CPFA 5IYCG 4LFAQ 1SMXA 4JI8L 4YY3Q 2BH2A 1HZAA 4YCVA 1YJNA 4C2MH 2CWPA 1Z47A
chains in the Genus database with same CATH superfamily
3S1RH 3RUZA 2Q2TA 2K5VA 5C4XG 4A3DB 1NAPA 1SYFA 4JBKA 5IT9E 5I9OA 5I4DA 1J5EQ 3GTLB 2K6AA 1EQQA 1S72A 5IGCA 1XPRA 4IUPA 2X69A 3M7NA 3J80L 2CCZA 3K57A 1S5ED 3A74A 1EIFA 1JICA 2MFIA 2P5ZX 2IPKD 5ELCA 1CQFA 3CQZB 4JI5Q 4A3DH 4BY7B 5C3XA 3K5MA 1YBYA 4KV6A 4DU9A 1L2FA 3TP6A 1PH5A 2KENA 3GTJH 1LT6D 2M2LA 1ENFA 1TS2A 3HP3A 1PMRA 2DUDA 1VQ7A 4KKUA 1EEFD 3MVVA 4A76A 2JA7H 1U4LA 1Q86C 4HIMA 1EWIA 1HNWQ 2JA6B 3PIO3 5EKLA 2F0HA 2EY2A 3G71A 4K0KQ 3A7LA 3PO3B 1E3PA 4BXXH 4QIWB 3STBC 2YTYA 4G7OC 2X6GA 1YJWA 2YU9B 1HFGA 3A0JA 1BBXC 2M00A 3MA2B 5C4ZA 1SE2A 5C5MA 4K14A 2B63G 3F1ZA 2HDLA 4KK7A 3PO2B 1WTVA 1AN8A 2UUAL 3J80E 1SNDA 1YJ9A 3STBD 3PV0A 3MXPA 5DM63 2B2VA 2L0CA 2E2JH 1RTOA 1I5FA 2F0OA 5IYBH 2JYOA 5M3FB 3S17H 2VZAA 4KHPL 2CQAA 3S1NH 4KHVA 3AFPA 3S2HH 1T9HA 2AMCB 5IGDA 4E6IA 2L4NA 5I9PA 2XRSD 3KOJA 3LGJA 4HMJA 1SN8A 1HH2P 3K0YA 3VR5A 4DV3L 1HNXL 4GZYC 3GD7A 3UDXA 1VQ6A 1SAPA 3Q23A 4FXGC 5CR3A 1YNJC 3J81j 5FJ8G 3UE0A 4ZUJA 4X3TA 3NHHA 1GUOA 1W6JA 4EX5A 1TWHH 2SDFA 1L1OC 4RGNA 3H6MA 4PQXA 1PTOF 3VA5A 3RN2A 4K6DA 4HN7A 2ENBA 1LT5D 4JI3Q 3K7AH 2K28A 5HURA 1K8MA 2R6GA 1N36L 1SYGA 4WJWA 2KA7A 4DF7A 4CDDC 3KF8A 4LF5Q 1ZYRD 2PZWA 1CFMA 1H9MA 2WIIB 3MXGA 4ZCKA 4MHEA 1MHWC 1LACA 3EBEA 1MJEA 5E4WC 3CU7A 4PNYA 4MN3A 4HMIA 4IPGA 3J80i 5IT9c 4YIJA 1JJCB 3SE0A 4RH6A 2RKSA 3T51B 1KNEA 1DJRD 1VF5C 3L2PA 4R1JA 3JC66 3DHQA 1PFBA 2OTJA 3WOFA 3M3YH 1EIYB 3K5OA 2ZTEA 3K8AA 4RAUC 1XPOA 1CA5A 1YVCA 1JWSD 4DR2L 1HR0L 1SNCA 5CV7A 5E1FA 1NMGA 3LWUA 2R7FA 1VQJA 4N9PA 4OELB 2LXKA 4IPHA 1XXGA 5JOBA 4YWMA 4FF3A 4NXMQ 4LF9Q 5BN3A 2QKIC 4PMCA 5DEHA 1VQOA 4O1NA 3E9HA 4DV2Q 3CCVA 2A68D 5G3LF 2NN6H 4DXFA 4PZ8A 4A75A 1J6QA 1VQNA 1I94Q 2XWJB 1Q46A 1OO9B 4CJ1B 4FYDA 3DWAA 2HD3A 3IRBA 3T1HQ 2NYZD 1DYQA 1WTQA 1JOKA 2V4DA 3EA6A 4K5VA 3CF5A 2A68C 1XTCD 2OT2A 4KLKA 4JI4Q 4X3UA 2B2UA 3KF6B 3VR2A 1CKNA 1C0AA 3ZYYX 3GTPH 1FVIA 3L3OC 1OXXK 5K36H 2B63H 2CHBD 3HZXA 2HUGA 5KYIA 2AHOB 3NXWA 4POFA 5ISRA 4ABNA 4DUZL 2GVAA 4ZQ3A 1ONLA 2NZ1D 3A7AB 1WVLA 2F0QA 2PYKA 4JCVE 2JA7B 4Q5VA 1PRTD 1VF7A 1ENCA 3B6YA 4Y7NB 3K58A 3H3VH 2F0GA 3NBHB 3ONAB 1UEBA 2EYJA 1A62A 2XGTA 4QQBX 4DR7Q 2JA5B 1DM0B 3WOEA 3TZUA 4C2MB 1EOVA 2LFNA 3RZOH 3I4OA 1OXVA 3AU7A 1TWGB 1PRTC 4FNFA 1PYWD 1FNUA 2NVYH 2GA4B 2Z6KA 4DV0Q 3G6EA 2PW5A 3R2TA 3PIPA 2VW9A 1KC8C 1WTWA 4ODGA 1TIID 2LKVA 2ASBA 4XDXA 3HOVH 3S15H 2UUBL 2C9OA 2ZT9C 3E3XA 4LF4L 4JI7Q 5M3FG 1A8VA 4C1NI 4JK1C 2R92G 1YZ6A 4B3RL 4YHHL 4JI0Q 2EQSA 5DLQE 4DK6C 1SSOA 2A1AA 2VQFL 2F4VQ 4WJ3M 2A69D 1O78A 1RODA 4OGQC 4ZKCB 4P75A 2MGSA 4RG1A 1WJJA 2IX3A 5M5YB 1EU4A 2EYPA 5JPNC 3K81C 3KJOA 4RHSA 1TWAH 3T53B 5FO8B 1F2LA 3ER0A 3GV6A 4LF8Q 4AH6A 2A69C 4XYOA 1FJGL 2GN5A 3E0JA 4LJZC 1X54A 2XWBB 4K8JA 2N3SA 4DAMA 1PXUA 2JQOA 3HOUG 1QUQA 2IW3A 4S3SA 1NCVA 1XTDA 3OHXC 3I55A 1BBWA 3NP8A 4K8IA 4RMFA 3S1MH 3GDEA 3QWNA 3TRZA 1BCPF 3ERSX 4A3IH 2B2UC 1QUQB 1TWFH 3M4PA 1CKMA 4LWCA 3MAQA 1AP0A 2Z4HA 4XQJA 3CCLA 2XRQD 5AJ3Q 5CV4A 3ULPA 2TSSA 1EY4A 1QJOA 1L1OB 3BDCA 4KY5A 1YEZA 1SYCA 5FOBB 4X66Q 4LFCL 1VMCA 4KD4A 1JJ2A 4A3BH 1Q81C 1HUNA 1WYDA 2JA5H 1TU2B 1VDZA 4CJ2C 1SNMA 2UU9Q 2HT1A 2QEXA 1TT2A 4GNXA 1PH6A 4IOCA 1SFOB 2E5LL 4DV1Q 1Y8PB 3OW2A 2EYLA 1XMOQ 1IKLA 2VXWA 3GTQB 1DZ1A 3K0XA 5EPKA 1ICFB 2OF1A 1XNRL 1F9QA 4LFBL 4GNXC 2NVXH 4IUTA 1STBA 1VQAA 4DR5Q 2R3ZA 5LMUL 5HGTA 1JJGA 3AFQA 2Z0SA 2MNAA 3NWTA 1H9SA 1Y1WB 1JWUD 3NE5B 2K01A 2B2WC 1XWEA 4ILWA 4KTAA 3J81L 3DUZA 5M5WB 3PF5A 2JP1A 1PA6A 1BVSA 2OWOA 2R93H 2ZJRA 1ILPA 4DAVA 2YYZA 1YHQA 4KN7C 2VUMG 4R4IA 2E2HH 5A35A 1GUWA 2MHVA 2NBFA 4DV7L 2JA6G 2DGYA 3MXNB 2B2WA 4IFDH 5FJ8H 5I6YA 3DMUA 2DJFC 4OX9L 1SMYD 1W3SA 2RDHA 3DXJC 4Q0FA 1PFNA 3P75A 4AYBG 3OTOQ 1YNJD 5L37A 4GKJL 4FXKC 2F0WA 4KHZA 4OIKA 4X62L 1A3VA 1GUNA 2NN6G 4H44C 4ME5A 2NZHA 3OWEB 1S40A 1CSPA 1HZ9A 1V43A 1B3AA 1PH1A 1OXTA 1UE6A 4X62Q 4A3DG 4DAYB 4RWSC 3BJUA 4DGZA 5JEAG 3NBHA 4KMUC 4GKJQ 4LF6L 3RZDB 3WDNA 3J81c 1ZYRC 2EIFA 4HR7B 2BDOA 4HIDA 2CQOA 3NWSA 4Y7NH 3GTGB 3GTOB 5ELOA 1F9SA 2K7VA 4LK1C 4BY1H 5C4JH 4GN5A 4DR1L 1A63A 1HTPA 2TMPA 4B9WA 2ZXRA 4LFAQ 4YY3Q 1EEID 4V190 2WFWA 1JOOA 5BN5A 4XXEA 5C3WA 3HOZH 2L12A 3K80C 3PO2G 1B4OA 1B70B 3N6RA 4RKLA 2OEOA 4BA2I 2KCNA 3SHLA 3Q0AA 2JA7G 5J1ZA 5M3MG 4IO9A 3QOJA 4HIOA 3M7GA 1SNOA 4GS3A 1CKOA 1KL9A 3W2DA 4JOIA 2JEBI 2FMMA 2R7ZH 4A93H 1YI2A 2H4OA 3CHBD 4DV1L 3VYRA 1S5FD 4J1MA 3LX0A 4YWLA 1SJED 2A19A 2E2IB 1WTXA 3QIAA 2QEJC 1I6VC 3T1YQ 2VB2X 5IYCH 1XPUA 1LTID 1RHPA 4X66L 1UUPA 2DNCA 2B2TC 2NVTH 3TSSA 3OIPA 5ELNA 2AUKA 3KBGA 2B29A 3I4NB 1Q1BA 4JV5L 1C7YA 1PZID 1ICWA 1PLFA 4QCLA 1W2BA 3NSWA 2D2CC 3C2PA 4KKSA 1BCPB 2F0MA 2RVLA 4NPSA 4A3IB 3FRPB 3NTKA 1KLUD 4OWWB 2VS1A 1FJGQ 2A6HC 3CCJA 1TY0A 4K5XA 2F0UA 4JI2L 1DGSA 4BWGB 2EDGA 1JB7A 1V9PA 3F2DA 1TR5A 3BZDB 1D2BA 4NDXA 1CTMA 5JVG3 3GTKH 3SEBA 3X3MA 1PV4A 1IHZA 1SFOH 4XIGS 3LWEA 5C4XH 2A6HD 1STEA 2KEEA 3DM1A 3R93A 2ZTDA 5EKKA 5M3FH 1S5BD 4JI0L 2L9HA 1CZGA 4YHHQ 1Y8OB 2J4XA 1SLJA 3K7UC 4JI7L 4R9WA 1WOCA 3S16B 1A2TA 5JJZA 1YIJA 2UUBQ 3IKJA 4AQYQ 3R3OA 5C5LA 1EY9A 4A3MH 5CV8A 4DK0A 2WP8J 4K2KA 2XSCA 1DXMA 3NQIA 3D31A 2YTVA 4R4CA 2NVXB 1NR4A 1G8ZD 4FF2A 2WACA 4A3JG 1CHPD 2KOLA 2HHHQ 1RD9D 1IBKL 2CWAA 1U5KA 2FMCA 5EPJA 5IGEA 1A6XA 4DAYA 2RDGA 2ICEC 4UP9A 2ZTCA 3S1NB 1NTGA 3S2HB 1G2SA 5EKIA 2KUMA 2B3GA 3D6WA 3FPUB 3MZ5A 3ND9A 4A3FB 3D4WA 4KY7A 5FO7B 4JBWA 1EFID 4QJFA 2RHQB 1RL2A 5CV6A 1YNND 3CP0A 1BCPD 2E74C 4L5RC 3SVMA 3NBIA 3AYHB 1D6EC 2HIVA 2E8GA 2FFKB 4NW2A 5C3EB 1NMFA 1GXDC 1FNWA 1K83B 3VR4A 1G6PA 5C44H 2IWHA 3EVQA 3QR8A 4B3SQ 1DOLA 4F88A 4YCWA 5COYA 3GTLH 1I4RA 1BCPC 1JCKB 3S16H 5KYLA 1EZ8A 1RIPA 2PNHA 4C3JH 4BBRB 1BDOA 1BXTA 1VQ9A 2VNUD 4B3MQ 1EWHA 3GTGH 4K6LA 3T1HL 3CRLC 3CMAA 1AZPA 2MO1A 3OWFA 1I94L 3K5NA 1SE4A 2ZJQA 1AFPA 2F0IA 1Q82C 4G4KA 3W1GA 2J0TD 1F9RA 2J7ZA 4DR4L 2V1CC 2XNAC 4RHRA 4LF9L 1GOZA 3S24A 3HOVB 3S15B 4M8AA 1WCMB 2NTSA 4GOPA 1BUVT 3IFTA 3W5OA 2MUYA 3CPWA 1LLRD 3PGZA 4IALA 2JA9A 4CHTB 4DR2Q 1HR0Q 3L0OA 1G91A 1NR2A 4G57A 2HIXA 4CKEA 4GLVB 1ASYA 1ET9A 1UAPA 2R7ZB 1HUMA 4HEDA 1AE3A 3N52A 1BKBA 1KABA 2F0PA 4A3FH 3BDOA 2Y0SG 4TSSA 5KIXA 2Q2IA 3UE1A 3BVGA 1TKWB 1EQVA 2EJMA 1RJTA 1SE3A 3CXCA 2E2HB 2A73B 2WAQB 3P20A 2AWNA 2K5QA 4UAIA 3T4AC 1HCZA 3EROA 4IUNA 3SR1A 1XNQL 1MBYA 3HOYB 5IP9H 3TP5A 5JEAH 3S1QH 1D7QA 1Z6HA 2Z6KC 3FKIG 1AE2A 1STAA 1L1OA 4JI3L 2NB0A 4HTHA 2K4KA 3Q6SA 3U50C 3KFUA 1O80A 2QCPX 3GP7A 2BH8A 4LUZA 2XTIA 1PFSA 1BO0A 1TWGH 2N55A 1R4PB 1HRJA 3J7A5 2EY6A 1YITA 2BCOA 1VQ8A 3C46A 1Y1WG 3PO2H 1IXRA 1HA6A 2JEAI 1Y69U 5CGKA 1WD1A 3RMHA 3E9IA 3FVQA 1BBUA 4KJNA 5C6AA 2PO4A 1HQRD 4A3LG 3NEMA 3V2TA 2VL6A 1ZEQX 4C3HG 2H5XA 3J7AF 4CGYB 5FLXL 3S1QB 4TVAB 5CMDA 1KQSA 1E2ZA 3SK4A 4KI0A 2EYFA 1SBBB 5F2DA 4PG3A 4GLXA 1QCBD 3G48A 4LMQD 1I4XA 5GAEC 1GD7A 5NUCA 3I4NH 4O42A 5CV5A 5ELDA 4JW0A 2NVQH 3MXNA 4B08A 3VYSA 4DV4L 1MSHA 2OXPA 1FGBD 1TWHB 1A0IA 2ZXOA 5E7NA 1WTRA 3MFGA 3NUCA 4I65A 1VQFA 3P7JA 4K0KL 2K04A 4MNOA 2SNSA 1CM9A 3Q22A 4X65L 1GUTA 4ZKBB 3OW7A 2H1EA 3G7LA 5EJWA 5H1SE 3JAMi 2UUCQ 1EIHA 2BA1A 4RFBA 2WKDA 1KHIA 5J3BA 4CDFC 5EAYA 2N8NA 3D8GA 2KCCA 4F8MA 5ELBA 2R93G 2BA0A 1L0WA 3F2CA 2O2LD 1R9TB 4XQQA 2F0JA 1SROA 5LL6X 3EJIA 1LT3D 4G7ZC 2DJGC 2UUCL 2Z9HA 4P72A 3PSIA 2F0VA 3FPPA 2ZJPA 4NP5A 3VYUA 4X65Q 4EGVA 3K59A 1KDCA 1QE6A 3BU2A 3NQTA 3K5LA 1PZJD 1TS5A 4P2CB 1O7IA 1J5EL 1MD2D 2WB1B 5C44B 1VCIA 2C35B 1X6OA 1EQRA 3I7FA 3BS1A 4A3BB 2BE5D 4DV4Q 4BY1B 4WORA 2CH4A 4HSPA 3E6ZX 1SXTA 3I8ZA 4K5WA 3A5ZB 3UDIA 4EVOA 4JI6L 1U4PA 3M4QA 4WJ4A 4A3KH 1STNA 1W6KA 1GUSA 2EYMA 3HOWH 2B8FA 2F3IA 3ND8A 3NTIA 3TZDA 1UWVA 5GAGC 1HTLD 5FO9B 3UDFA 1PH7A 1HQMC 2G9HD 4I7ZC 1VQ5A 5I6WA 4O0AA 4OONA 4RKBA 2IJ0A 3T56B 3TP7A 4AYBB 2E2IH 1I4PA 2F0SA 1KRTA 1B3QA 4L6TB 1EY6A 2PCFB 3OYYA 4LF7L 4IOAA 1EY8A 5FLMH 1GM5A 1XMQL 2VUMH 4TRDA 4DR6Q 4J15A 1S3OA 1EUJA 4DXGA 4OHJA 2EXDA 1H95A 2EJFC 3CCEA 1KTKA 5GQOA 3FDTA 1EZ6A 3TBIB 3HOXB 2X6LA 1N34Q 2EJGC 2IL8A 2QW7A 4C3IG 2O4XA 3H3VC 1XNQQ 2EOTA 2KCMA 4O2DA 4R8NA 2WB1G 2OQ0A 2JJQA 1ZKOA 4IUUA 3I72A 3D3RA 1YNNC 2BH2A 1SYDA 1YJNA 2LY7A 4C2MH 1Z47A 2L11A 1S4ZA 5A2QE 1OTCA 2KJXA 3KUPA 2K52A 1B1ZA 4FXDA 1D8LA 5C4JB 1Y1VH 4RGTA 3UI2A 3U4VA 5FLXE 2SNMA 2RBMA 5IT9L 1JWMD 2PMZB 3Q8DA 5IYBG 4J8QA 3SXHA 4RCOA 1HPCA 1I6HH 1B9NA 1E7ZA 1DONA 2EYOA 3GTOH 3CCQA 2LSSA 3EFXD 4DV5L 1X56A 3I91A 2G9DA 3A8KE 3KLSX 2K33A 3H0GG 3V96A 1XJVA 1J8IA 4BY7H 2KCTA 2JN4A 4Y52H 4A3EH 2BDNA 5J22A 4DR4Q 2NVTB 3H0GB 4AYBE 1LTRD 1IKMA 2PZUA 5C4HA 4DKAC 1Q1EA 1WCMG 2I5HA 2QGQA 4PZ6A 2EVBA 4QB4A 4QUFA 1NE3A 2B2YA 4EQ5A 3CCRA 5J39A 3MFYA 4B3ML 1CHQD 5GADC 4U68A 1STYA 3NELA 4A93B 2EYHA 2MJ8A 1N32Q 1CI3M 4KY6A 4F7XA 1KD1C 1VQLA 1PTOD 3C3LA 2B39A 4B3TQ 4B3SL 2JA8B 2MPMA 1J9OA 5IWAL 3H91A 1E0BA 3S17B 1SDFA 3D0FA 5T1IA 1SR3A 3C1FA 3HKZE 4H0LC 4ZK9B 5HGQA 4G7HC 2B2VC 2XVSA 4EQOA 1HA5A 1M8AA 3HS0C 4C3IB 2F0KA 1OXUA 1V8QA 3D4RA 4GOPC 2R92H 1BOSA 4IZ8A 2IX1A 3BDLA 4JI1L 2K5DA 4N8FA 4IPDA 3FMCA 4A3LH 3TS0A 1II3A 3GTMH 4LUOA 1KAWA 3QG1A 2I5LX 3FKIB 3H0GH 4JC0A 4IUQA 1H9JA 2PZTA 1F2YA 1IBKQ 1KRSA 1D5MC 5JAVA 2HHHL 4UPAA 4R8IA 1EWCA 2FHTA 4QY7A 4H7BA 3JAME 1F2ZA 1V1OA 1S5CD 2Z8LA 2CW0C 2K32A 2L55A 1G291 5KNCA 2UXDQ 2Q8RE 5LHY1 4OO1H 4AQYL 4N9TA 3K7AB 2Y0SE 3A56A 5M5WH 3GTKB 2WV6D 1QZGA 4L8JA 2F52A 1VQIA 4FVMA 4LUVA 3BG3A 3I2ZA 1Z7TA 3ITPA 1HFNA 4DV6Q 5FK9C 5DM73 3S1MB 4C3JG 1JT8A 3D6CA 4X3SA 1VQ4A 1PTOB 3I4LA 1MSGA 4N8X1 4JI2Q 1U4MA 2EZVA 5C44G 2K50A 2I07B 1SEBD 4NMZA 1C8CA 1K0RA 5C0XG 1EU3A 3QJYA 4XYQA 2A74C 2I0QA 3HOZB 2ZM6L 5IGBA 4DAPA 3GQBA 1TS3A 4A3IG 3HOXH 2IT1A 4XTCS 1SMYC 3I3CA 3O13A 4U673 1VQEA 4JV5Q 4DUYL 1FGUA 4BBRG 4H02A 1F77A 2PQAA 2D0OA 4X64Q 4MZ9A 4CKBA 5FLMG 1BNZA 4A93G 3T1YL 5I2XA 3MXUA 2SEBD 3R2IA 1Y8NB 3HFZB 2E75C 2M9VA 5JVH3 5BR8Q 2N88A 1QNKA 1X9NA 1QZHA 1XX8A 3A55A 4IFDI 4BBRH 4C3JB 3TQYA 1B2TA 4DN4M 5JEAJ 1LUZA 3NK9A 1YHAA 2NWGA 5JJIA 4K2LA 2KECA 4R4TA 5M5XH 4IFDG 3S9WA 3BYYB 1N33L 1B53A 2OQKA 1OXSC 2I46A 4IJHA 4XT1B 1A3UA 1X65A 3PO3H 4CDCC 1G6ZA 2RCNA 2KHSA 1NY4A 3PQIA 5K5PA 1UNSA 2JK8A 3BZKA 1PH8A 4HIKA 3E0EA 1RTNA 1QOHA 4C3HB 5IYDG 2AQ3B 1IBLL 4YY3L 4LFAL 5G3LD 4BBSG 5DNFA 1ET6A 1GKHA 4NB3A 3V05A 3TMEA 4HAEA 4DR1Q 2AWOA 2OCEA 1E22A 4IPCA 4RA8A 1LTTD 4YCUA 5IODA 1TVXA 2VQEQ 4HJAA 3HOWB 3M9BA 3UDGA 2KHIA 1I50B 4NKLA 3DEOA 1TWCB 3OMCA 1PYBA 4LF6Q 1H9SB 3CC7A 1LT4D 1A3TA 3PUYA 4A3BG 4DNTB 1KDBA 1EYAA 1O7YA 1Y1VB 1E2VA 5CC4A 2LMCB 1HR0W 3HOXG 3KF6A 2FINB 4A3MG 3KLRA 2HQLA 4IQZA 1WTHA 3M85A 1G51A 1VQPA 3W1BA 1BF4A 4X6AH 4L63B 3JAML 4POGA 4MIUA 3TN2A 1JQYD 3OTOL 2IHFA 1FL0A 4QIWE 1EY5A 2K05A 4ZYSA 2HDMA 1CKNB 4KJOA 3AMUA 4OX9Q 1IYVA 2F4IA 2NVQB 3SDZA 4L5SA 1LTGD 1EFWA 1IW7D 1RF2D 2RSOA 1Z9FA 4OL7A 4DV7Q 4IURA 1GO3E 4MTNA 5IYDH 4JYAL 5ELFA 2RQXA 3ICEA 4HJ5A 2JA6H 5DAUA 2EY1A 3KDFB 1SYBA 2PQAB 1I50H 2AKWB 2RSNA 1SRUA 1MKHA 2RHSB 4OO1I 5EGTA 2PNRC 3HOVG 2UXCQ 2IY5B 5GROA 2EY5A 5LMUQ 3RNUA 4DR5L 3H15A 4LFBQ 1XNRQ 5D65A 4AIMA 4KN4C 3MHBA 2PQEA 5M3MB 3FKIH 3M3YB 1XMOL 1JB3A 5IIFA 3RLOA 4R4QA 1NBWA 3H3VI 2YTXA 2E5LQ 1K28A 2WKCA 4UP7A 2UU9L 3HEJA 2Z6BA 4ZUIA 4NXNL 4CDEC 3DEPA 4HCSA 2A6ED 1Q8IA 1PRTF 5EBCA 4JG2A 1Q12A 4LFCQ 2I5MX 1PTOC 1PDQA 1SNQA 2EE1A 1VQHA 3DWPA 4CKCA 1A2UA 1QVGA 3CKIB 1G2TA 1K83H 2WINB 4OO1G 1O7LA 5AJ3L 4UY8C 4LW1A 1K0SA 4CJ0B 4GNXB 4B9XA 5LMNQ 4WFN3 4A3GB 1MI2A 4OXPA 3J7YW 4QF4A 3P1HA 1PH9A 2PPBC 3RN5A 1Q90A 5CBEE 5FLXc 3VR3A 1D1KA 3OOCA 2G5DA 3EIVA 1U0LA 1HNZQ 1B9MA 1EY7A 2O5IC 1ENAA 4XT3B 1IL2A 4LF8L 5EBDA 3NPPA 3C1EA 4ID6A 1JMCA 5K36G 4GKKL 1EIGA 3X3NA 2F03A 3PCOB 3H94A 5IGFA 2O5JC 1ML0D 2PI2E 3I90A 3I4MB 3EN2A 1LO5D 1X3PA 2VQFQ 2F4VL 3A54A 1ILQA 2UXBL 3PMFA 2CW0D 3S1RB 1SYEA 4DK3C 4B3RQ 3RZDH 3IFDA 2K1BA 2UXBQ 2F0NA 5GAHC 1WI5A 2KHJA 1X3GA 1KNAA 4LF4Q 1AEXA 2PW7A 2K14A 2WAQE 1FNVA 5TSSA 3URYA 3BVZA 2NUCA 1E2WA 1S5DD 1B44D 4HCEA 4A3KG 5C0XJ 4GKKQ 1SE8A 4DV0L 4DK1A 4FP5D 3HG9A 1SNPA 4RGMA 2KVMA 3RZOB 4RCNA 4OWTB 1Y1VG 3FHWA 1HNZL 2KQ3A 4DR7L 2RDFA 4JVZA 3CW2C 3PUZA 3T13A 2F0EA 5E4XA 1WD0A 4F87A 3MTSA 5D3DA 2Q8IB 4JPBW 5LMNL 4ULLA 4DA2A 4QMGA 1CSQA 3KYHC 4QL5A 1TS4A 3CCUA 4P71A 3DLLA 4DUZQ 3HOYG 2JA8G 3J7ZC 1QVCA 2B63B 3DM3A 2C5CA 5BN4A 5IY0A 4M1UB 4A3JH 4NXNQ 5KGUA 1CQVA 3PO3G 1PH3A 1RCVD 4DFAA 1NJIC 4HJ7A 3ERQA 4JI4L 2WB1E 3LNNA 3ULJA 1JORA 1WFQA 2D9UA 3M4YA 2OTLA 1E24A 1AZQA 1NUCA 1PHJA 2ICIA 1AH9A 5D14A 4IUVA 1HHVA 5CORA 4GLAC 5HY6A 2UXCL 1UE1A 2AUJD 2DY8A 1VQKA 3FEWX 4BY1G 2K03A 4DV2L 1T5EA 4ZAIA 3JAMc 4NXML 3A5UA 1QWYA 4JYAQ 1X32A 2GVBA 3HKSA 2F0FA 2R7DA 4EQPA 5LMNW 3WWVA 3H09A 2Z4IA 2YU9H 1QB5D 1ESRA 3VR6A 1EYDA 3TP8A 1PZKD 1KIXA 2A5HA 1A15A 3KJPA 5M9OA 1Q3LA 1K3RA 4A3MB 2DN8A 1EYCA 3PF4A 2DNEA 5ELEA 2R92B 2RA4A 1C48A 3KLSA 1KXLA 1PFMA 3R8BA 4PMWA 3M4OH 1KLGD 4DPGA 1X3QA 2QDLA 4UP8A 2L1BA 2CFMA 1KAAA 1R9TH 4A3KB 4LF5L 5JJKA 5M5YH 2KBNA 3TS2A 1B8AA 1ESFA 4A3CH 1D5ZC 5LL6S 2B8GA 3VYTA 1N36Q 5CYUA 2ID0A 1IYJB 2QILA 4DNIA 2K5WA 3QOLA 4JBMA 1VQDA 3D4DA 4L5TA 4H13C 4BBSB 4EQNA 2NN6I 1LTLA 1VS0A 2MO0A 2NZOA 3HGBA 2Q8TA 2VQEL 5M3MH 2N49A 2K75A 1K8OA 1AW7A 2CH4W 4C3IH 1IYUA 2R7ZG 1K9MC 1CUKA 1IBLQ 1JR0D 1X3EA 3GTQH 2Q2HA 1HNXQ 4DV3Q 1EY0A 4A3CG 2YV5A 3TDQA 4IJLA 1TY2A 3L9AX 4LNQA 4HJ8A 3IL8A 2L15A 4JOIC 5CV9A 2B2TA 1F9PA 3BVMA 3G6JB 1K8AC 3U58A 1IW7C 4QGUA 4APVA 4KHPQ 3S14H 1LTAD 2JSOA 3I4MH 2IHEA 1Q8KA 2VUMB 4ZLTF 3BZCA 1E1OA 4A3GG 2JE6I 1GHJA 1MIUA 4I7AA 3KLWA 1N33Q 2UUAQ 1HZCA 3OSOA 2QDBA 3GTPB 1H9RA 2HCIA 2HQEA 4FO2A 3TEHB 4FF1A 1VQCA 1L0XB 5BR8L 2PI2A 4UDUC 3PUVA 1B50A 1EL0A 1UE7A 4MTKA 2F1MA 3AQQA 3T16A 2D0PA 4A3EG 4X64L 1TXYA 5KRUA 1F2MA 1JE5A 2D62A 1IL8A 3MC0B 1HNWL 1LTSD 3CCSA 4DUYQ 3EQLC 1SJHD 3CMEA 4GN4B 3L7ZC 5IP7H 2BOSA 5C3EG 1WTPA 1QILA 3PUWA 2E2DC 2A6EC 3CCMA 3J81E 2HCCA 1RDPD 3E5SA 4UHVA 1YHBA 2ZM6Q 3I4NG 1V1QA 4JI5L 2PMZE 1I4GA 4R4OA 2FJ2A 3U9OA 4IN3A 1WCMH 3PIOA 3DWQA 3KK7A 3CD6A 1UE5A 4C56C 2EPBA 2Z1CA 3HOUB 3PUXA 2ALYB 1EQTA 4DV6L 1I4QA 3GTJB 4A3JB 4A3GH 4ALPA 5KNDA 4PV1C 4YWKA 5KEEA 4WRDA 1GVPA 4HSVA 1C9OA 4JI8Q 3J81i 3SGIA 3J80c 3RLNA 2R61A 5JJLA 4CBVA 1XYIA 1X55A 1K73C 2UXDL 1STHA 4L5QA 5M5XB 3HOYH 1PYSB 1VQGA 1LV9A 1BQQT 1QG7A 4GN3B 1R4QB 3SK8A 1M1KC 2MQHA 5E3FA 4BA1I 1VMPA 1MGSA 1GHKA 3SK5A 2NVYB 5EQ0A 3CC4A 4JBJA 3F2BA 1FD7D 5IOCA 1CT1D 3W3AA 1N8RC 1FR3A 1FYCA 1JOQA 2CVRA 3ULLA 2MP1A 2JA8H 4JI1Q 1DCZA 5IGGA 4FF4A 3S2DB 1TWAB 3RD4A 4C3HH 5KNBA 2JA5G 2D5DA 1I3QH 2SOBA 1D1IA 1E1TA 1TWFB 3GO5A 4IFDJ 4A3FG 2F0TA 2K5HA 4Z9CB 5JPMC 1LABA 3VA7A 3A8JE 1I4HA 5D3IB 1LM0A 1CZWA 2FXQA 2DY7A 2WAQG 3U4ZA 5I2YA 2E2JB 1NSNS 3S2DH 3OMGA 2IX0A 1HJPA 1L0YB 5IWAQ 1TWCH 5A2QL 3OIQA 1WTOA 4BS9A 4B3TL 3OPOA 2Q2UA 2Y0SB 4BXXG 3KF8B 4ME3A 4V0BA 3MEHA 3HOUH 1N32L 1HXYD 5EPLA 5IE8A 1B7YB 2E76C 3CRKC 5C0XI 1M90C 1DD2A 1QNUA 3CAMA 3M4OB 1V1PB 1EOTA 1P8LA 1ZXTA 2QF7A 3QB3A 1IBMQ 1DOKA 3G4SA 4BY7G 4BBSH 1C4QA 4DR3L 3K6OA 4P73A 3ZJYC 1Y1WH 3KBXA 1V1PA 1HZBA 3IAYA 1K3BC 4PMBA 3S14B 4C1NK 2NTTA 4DV5Q 1CA6A 1I3QB 1P16A 2VY3A 2K5NA 3HKZG 4X3KA 3HRZC 2CKZB 2LXJA 4A3EB 2XN9C 4DR3Q 3RLFA 3FP9A 4FDBA 1YNXA 4OIJA 3HKZB 3SK6A 5C4XB 4OEMB 2R93B 3HOZG 3AB9A 1Q7YC 1IBML 1RKNA 1UEAB 4P74A 1TQOA 1QVFA 1PTOH 3Q24A 1STGA 1ASZA 5AFWA 2EXZA 1NNXA 2F3VA 3RR5A 5FKAC 2KEDA 2XIWA 1VQBA 2AQ2B 4OWXB 2A8VA 3NTHA 3AEVA 3F8TA 2RCFA 1LYLA 4QUCA 4TKOB 1Y14B 5T1GA 3MEFA 3VDYA 2JXMB 3CC2A 3HOWG 1JE4A 1N9WA 5C0XH 2AQ1B 1N34L 2F0DA 3F2UA 2F0LA 1O7ZA 3QO2A 3I4MG 3U9SA 1PH4A 5IP7G 2VB3X 4HJ9A 1JC7A 4DR6L 1BR9A 2ATWA 2QA4A 2N78A 1XMQQ 1X3FA 3NENA 3GV3A 4ZRZA 1K8GA 4LF7Q 4PZ7A 4XQNA 1CK1A 3I70A 3GTMB 3I73A 4LAAA 3KDFA 1VQMA 1D5XC 5C3EH 1PH2A 1KDAA 1PVOA 4GOPB 2F3WA 1T5XD 3MWYW 2ES2A 1H9KA 3A8IE 3I56A 1DOMA 2LS01 3TREA 5IP9G 1MJCA 2B2YC 1M4VA 1PRTB 5CBAE 1EYGA 2L5TA 1U4RA 3CQZH 4A4IA 4KKTA 4JI6Q 4TQUS 2BE5C 4KD3A 1GUGA 2RF4A 4DNRB 1IZ6A 3PIP3 3J7AV 1LTBD 4RGOS 1I6HB 3BYTB 4J6HA 3CPFA 5IYCG 4JI8L 1SMXA 1HZAA 4YCVA 2ZXPA 1GJXA 1U9RA 2CWPA
chains in the Genus database with same CATH topology
1OTCA 5LMNL 3S1RH 2K52A 2Q2TA 2WFWA 2K5VA 5C4XG 1CSQA 4JBKA 3KYHC 4QL5A 1D8LA 3CCUA 1J5EQ 4P71A 3HOZH 3DLLA 3K80C 4DUZQ 3HOYG 2JA8G 3PO2G 1Y1VH 3J7ZC 1QVCA 3U4VA 1EQQA 1S72A 1B70B 3DM3A 4BA2I 4IFDJ 1XPRA 3Q8DA 5IY0A 2JA7G 5IYBG 5M3MG 4A3JH 3M7NA 4IO9A 4HIOA 2CCZA 3A74A 1I6HH 4NXNQ 1E7ZA 1EIFA 4GS3A 3PO3G 1CKOA 2MFIA 1PH3A 1KL9A 3GTOH 3CCQA 4JOIA 2JEBI 4A3DH 4JI5Q 2LSSA 4DV5L 1NJIC 1X56A 4HJ7A 2R7ZH 4A93H 1YI2A 4JI4L 1YBYA 1L2FA 1PH5A 2KENA 2WB1E 3ULJA 3H0GG 3GTJH 4DV1L 1XJVA 1WFQA 2OTLA 4BY7H 1E24A 2KCTA 4YWLA 1PHJA 4Y52H 2DUDA 4A3EH 1AH9A 1VQ7A 2A19A 4DR4Q 3T1YQ 4A76A 2JA7H 4GLAC 4AYBE 5IYCH 1XPUA 5HY6A 1Q86C 4HIMA 1EWIA 2UXCL 1HNWQ 1UE1A 4DKAC 1Q1EA 4X66L 1VQKA 1WCMG 2NVTH 3G71A 2I5HA 2QGQA 4BY1G 5ELNA 4K0KQ 4PZ6A 4DV2L 2B29A 1NE3A 1Q1BA 4JV5L 4EQ5A 3CCRA 1C7YA 1E3PA 4B3ML 4BXXH 3STBC 3JAMc 4NXML 3A5UA 5GADC 2YTYA 4JYAQ 2GVBA 3HKSA 3NELA 1YJWA 4IFDG 1W2BA 1N32Q 2R7DA 3A0JA 1VQLA 1KD1C 5LMNW 2B63G 3F1ZA 4B3TQ 4B3SL 3WWVA 2YU9H 4NPSA 5IWAL 2UUAL 1YJ9A 3STBD 4OWWB 3PV0A 1FJGQ 2VS1A 3CCJA 4JI2L 1KIXA 3D0FA 1DGSA 2E2JH 3KJPA 1SR3A 1I5FA 5IYBH 3HKZE 1K3RA 5HGQA 3PF4A 1JB7A 1V9PA 3S17H 2VZAA 3F2DA 4KHPL 1KXLA 3GTKH 3S1NH 3AFPA 3S2HH 1T9HA 2AMCB 1OXUA 1PV4A 4PMWA 3M4OH 1SFOH 3KOJA 4DPGA 3LGJA 1SN8A 4GOPC 4XIGS 1HH2P 5C4XH 2R92H 4UP8A 2ZTDA 5M3FH 2IX1A 4JI1L 4DV3L 4JI0L 2CFMA 4IPDA 4YHHQ 1HNXL 1R9TH 4A3LH 3GD7A 3UDXA 3TS0A 4LF5L 1VQ6A 1SLJA 3K7UC 3GTMH 4LUOA 5M5YH 4JI7L 2KBNA 5JJKA 3TS2A 1B8AA 1KAWA 1WOCA 4A3CH 3J81j 5FJ8G 2I5LX 1YIJA 3UE0A 3H0GH 4JC0A 1N36Q 2UUBQ 4AQYQ 2ID0A 1IYJB 1IBKQ 1KRSA 4DNIA 4A3MH 2HHHL 4EX5A 4UPAA 1TWHH 4JBMA 1VQDA 1L1OC 2WP8J 4QY7A 4L5TA 3RN2A 2NN6I 1LTLA 2YTVA 1G291 3D31A 3K7AH 1VS0A 2MO0A 2NZOA 4R4CA 4JI3Q 2UXDQ 2VQEL 5M3MH 4A3JG 2N49A 2HHHQ 1IBKL 2CWAA 4AQYL 1U5KA 2K75A 2R6GA 1N36L 2Y0SE 5M5WH 4UP9A 4C3IH 2ZTCA 1NTGA 1QZGA 2R7ZG 1K9MC 4LF5Q 1CUKA 1IBLQ 2B3GA 1X3EA 3GTQH 2Q2HA 1HNXQ 2F52A 4DV3Q 4A3CG 2YV5A 4IJLA 4JBWA 1VQIA 4LUVA 4LNQA 4QJFA 4HJ8A 3EBEA 1MJEA 3I2ZA 2L15A 2RHQB 4JOIC 1K8AC 3J80i 4IPGA 5IT9c 4DV6Q 3U58A 4QGUA 4APVA 4KHPQ 1RL2A 1JJCB 3S14H 1JT8A 1VQ4A 3CP0A 2IHEA 1Q8KA 3I4MH 3L2PA 4R1JA 3JC66 4L5RC 3BZCA 1E1OA 4A3GG 2JE6I 3AYHB 4JI2Q 1MIUA 2OTJA 2HIVA 2E8GA 3M3YH 1EIYB 5C44G 3KLWA 2K50A 2ZTEA 3K8AA 1XPOA 1N33Q 1NMFA 1YVCA 1K0RA 2UUAQ 4DR2L 1HR0L 1G6PA 5C44H 1NMGA 4B3SQ 1HZCA 5C0XG 2R7FA 1VQJA 4YCWA 2I0QA 3GTLH 2LXKA 4IPHA 3TEHB 1VQCA 2ZM6L 3S16H 4YWMA 5BR8L 2PI2A 1RIPA 2PNHA 4C3JH 4A3IG 4NXMQ 1VQ9A 3HOXH 4LF9Q 2VNUD 2IT1A 3PUVA 4B3MQ 4XTCS 1UE7A 3GTGH 1VQOA 3T1HL 1VQEA 3AQQA 3CMAA 4DUYL 4JV5Q 2D0PA 3E9HA 1FGUA 2MO1A 4BBRG 4X64L 3CCVA 4DV2Q 4A75A 4A3EG 4PZ8A 1I94L 1TXYA 1J6QA 1VQNA 2ZJQA 1JE5A 1I94Q 2D62A 4H02A 2PQAA 1Q46A 1HNWL 2D0OA 4X64Q 4MZ9A 3W1GA 3CCSA 1Q82C 4DUYQ 5FLMG 3IRBA 4A93G 3T1HQ 3T1YL 3CMEA 4GN4B 3L7ZC 4DR4L 5IP7H 5C3EG 2V1CC 3HFZB 3PUWA 4LF9L 3S24A 3CF5A 3CCMA 5BR8Q 4GOPA 1X9NA 1QZHA 2ZM6Q 3I4NG 1YHBA 4IFDI 4BBRH 4KLKA 1V1QA 3TQYA 3W5OA 5JEAJ 4JI4Q 1LUZA 3CPWA 1YHAA 4JI5L 5JJIA 3PGZA 4R4TA 2PMZE 3KF6B 4R4OA 1CKNA 2JA9A 5M5XH 4DR2Q 3L0OA 1FVIA 1HR0Q 3GTPH 1C0AA 1OXXK 1N33L 1WCMH 2HIXA 3PIOA 2OQKA 1OXSC 2B63H 4IJHA 4GLVB 3CD6A 1UE5A 1ASYA 1X65A 3PO3H 1AE3A 2AHOB 4POFA 1BKBA 2RCNA 4A3FH 3PUXA 1NY4A 4DUZL 2Y0SG 2ALYB 2GVAA 4DV6L 2Q2IA 2JK8A 3UE1A 3BZKA 4A3GH 4ALPA 1PH8A 4JCVE 4HIKA 3E0EA 3CXCA 4YWKA 3B6YA 5IYDG 1GVPA 2AWNA 1IBLL 1C9OA 4JI8Q 4YY3L 4LFAL 3NBHB 3H3VH 3J81i 4BBSG 1UEBA 3SGIA 1GKHA 1A62A 2XGTA 4QQBX 4NB3A 3J80c 1XNQL 3RLNA 4DR7Q 4DR1Q 2AWOA 5IP9H 2OCEA 1EOVA 5JJLA 1E22A 4IPCA 3RZOH 1X55A 3I4OA 3S1QH 1D7QA 1OXVA 2Z6KC 3FKIG 4YCUA 1K73C 1AE2A 2VQEQ 4HJAA 2UXDL 3M9BA 4L5QA 1L1OA 3HOYH 1PYSB 2NVYH 1VQGA 4JI3L 3UDGA 2KHIA 2K4KA 3U50C 2Z6KA 4GN3B 1M1KC 3KFUA 2MQHA 4DV0Q 3G6EA 4BA1I 3PIPA 2VW9A 1KC8C 1PYBA 4LF6Q 3CC7A 2ASBA 2BH8A 4LUZA 3PUYA 3HOVH 3S15H 2XTIA 4A3BG 1PFSA 1TWGH 2UUBL 3CC4A 4JBJA 3F2BA 4LF4L 3J7A5 1YITA 4JI7Q 5M3FG 1HR0W 1A8VA 3HOXG 1N8RC 3KF6A 2R92G 1YZ6A 1VQ8A 3ULLA 4B3RL 4YHHL 1Y1WG 2JA8H 3PO2H 4JI0Q 4JI1Q 1IXRA 2EQSA 4A3MG 5DLQE 4DK6C 2HQLA 2A1AA 2VQFL 2F4VQ 2JEAI 4WJ3M 3E9IA 3M85A 4C3HH 1G51A 2JA5G 1BBUA 1I3QH 1VQPA 3W1BA 1E1TA 4X6AH 4P75A 4RG1A 4POGA 1WJJA 3GO5A 4A3LG 3NEMA 4A3FG 2K5HA 3K81C 2IHFA 2VL6A 3OTOL 1FL0A 4QIWE 3KJOA 1TWAH 2H5XA 1LM0A 2FXQA 4TVAB 3ER0A 1KQSA 4LF8Q 2WAQG 4AH6A 1FJGL 4KI0A 2GN5A 1CKNB 3U4ZA 1X54A 3S2DH 2IX0A 1HJPA 4OX9Q 5IWAQ 4PG3A 2N3SA 4DAMA 1TWCH 2JQOA 4GLXA 3G48A 4L5SA 4B3TL 3HOUG 1EFWA 2Q2UA 1QUQA 5GAEC 1XTDA 1Z9FA 4BXXG 1GD7A 3KF8B 3I55A 4DV7Q 3I4NH 4ME3A 3HOUH 1GO3E 1N32L 1BBWA 4MTNA 4RMFA 2NVQH 3S1MH 3GDEA 5IYDH 3TRZA 4JYAL 3ERSX 5IE8A 3ICEA 4DV4L 4A3IH 4HJ5A 1B7YB 2JA6H 1QUQB 1TWFH 3M4PA 1CKMA 5C0XI 3KDFB 1A0IA 4LWCA 5E7NA 2PQAB 3CCLA 5AJ3Q 1I50H 2AKWB 1VQFA 3ULPA 4K0KL 1SRUA 1M90C 3CAMA 1L1OB 1MKHA 2RHSB 4MNOA 4OO1I 1P8LA 1YEZA 4X66Q 4LFCL 1IBMQ 4X65L 1JJ2A 3HOVG 1Q81C 4A3BH 5GROA 2UXCQ 2IY5B 3G4SA 4BY7G 1WYDA 4BBSH 2JA5H 5LMUQ 3RNUA 5H1SE 4DR5L 3JAMi 3H15A 2UUCQ 4LFBQ 4DR3L 2BA1A 1XNRQ 4P73A 2UU9Q 1KHIA 5J3BA 2HT1A 2QEXA 4GNXA 3ZJYC 1Y1WH 4AIMA 4IOCA 5EAYA 1PH6A 2E5LL 1HZBA 2N8NA 4DV1Q 3FKIH 1XMOL 3OW2A 3RLOA 4R4QA 2R93G 1NBWA 1XMOQ 2BA0A 1L0WA 4DV5Q 3H3VI 3F2CA 1P16A 2YTXA 2E5LQ 2VY3A 2K5NA 3HKZG 3K0XA 1SROA 2CKZB 2LXJA 4UP7A 2UU9L 1XNRL 4DR3Q 4NXNL 3RLFA 3FP9A 4LFBL 1YNXA 4FDBA 4P72A 3PSIA 1VQAA 4GNXC 4DR5Q 2NVXH 5LMUL 2UUCL 2ZJPA 3HOZG 1JJGA 3AFQA 4JG2A 2Z0SA 2MNAA 4X65Q 1Q12A 1Q7YC 2I5MX 1IBML 4LFCQ 4P74A 3BU2A 1VQHA 1QVGA 1QVFA 1O7IA 1J5EL 1K83H 1ASZA 4OO1G 5AJ3L 4UY8C 4LW1A 3RR5A 1VCIA 2C35B 1X6OA 1PA6A 1EQRA 3PF5A 2OWOA 1BVSA 3I7FA 4GNXB 2ZJRA 1VQBA 5LMNQ 2R93H 2YYZA 4DV4Q 4OXPA 4OWXB 1YHQA 2VUMG 2A8VA 4R4IA 3AEVA 2E2HH 3F8TA 1PH9A 1LYLA 3RN5A 4DV7L 1Y14B 2DGYA 3MEFA 2JA6G 3MXNB 5FLXc 3VDYA 3CC2A 3HOWG 3EIVA 1N9WA 5FJ8H 1U0LA 1HNZQ 3A5ZB 3UDIA 4OX9L 1W3SA 1N34L 4JI6L 3M4QA 1IL2A 4WJ4A 4A3KH 4LF8L 3HOWH 2F3IA 1JMCA 3I4MG 4GKKL 1UWVA 4AYBG 5IP7G 5GAGC 1PH4A 5K36G 3PCOB 3OTOQ 3UDFA 4HJ9A 1PH7A 4DR6L 1VQ5A 4GKJL 2ATWA 2QA4A 2N78A 1XMQQ 2PI2E 4O0AA 4OONA 4KHZA 1X3FA 3NENA 4X62L 2E2IH 2NN6G 1K8GA 3EN2A 2NZHA 2VQFQ 4PZ7A 4LF7Q 2F4VL 2UXBL 1KRTA 1S40A 4DK3C 4B3RQ 1CSPA 3RZDH 2UXBQ 3OYYA 1HZ9A 1V43A 5GAHC 4LF7L 4IOAA 3KDFA 1VQMA 1WI5A 1PH1A 1OXTA 2KHJA 1UE6A 1X3GA 5C3EH 1PH2A 4LF4Q 4X62Q 4A3DG 1PVOA 4GOPB 5FLMH 1GM5A 4DAYB 1XMQL 2VUMH 2ES2A 3BJUA 2K14A 2WAQE 5JEAG 4DR6Q 4J15A 4GKJQ 3I56A 5IP9G 3TREA 4A3KG 4LF6L 1S3OA 1EUJA 3J81c 5C0XJ 2EIFA 1MJCA 1SE8A 2EXDA 4DV0L 4GKKQ 1H95A 3CCEA 5GQOA 4HIDA 1EYGA 2CQOA 4Y7NH 5ELOA 3CQZH 4OWTB 4A4IA 1Y1VG 3FHWA 4JI6Q 1N34Q 4BY1H 5C4JH 4TQUS 4GN5A 2RF4A 4DR1L 1HNZL 1IZ6A 1XNQQ 4DR7L 2KCMA 4O2DA 1A63A 2WB1G 2OQ0A 2JJQA 3CW2C 3PUZA 3CPFA 5IYCG 4LFAQ 1SMXA 4JI8L 4YY3Q 2BH2A 1HZAA 4YCVA 1YJNA 4C2MH 2CWPA 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTC A;  5LMN L;  3S1R H;  2K52 A;  2Q2T A;  2WFW A;  2K5V A;  5C4X G;  1CSQ A;  4JBK A;  3KYH C;  4QL5 A;  1D8L A;  3CCU A;  1J5E Q;  4P71 A;  3HOZ H;  3DLL A;  3K80 C;  4DUZ Q;  3HOY G;  2JA8 G;  3PO2 G;  1Y1V H;  3J7Z C;  1QVC A;  3U4V A;  1EQQ A;  1S72 A;  1B70 B;  3DM3 A;  4BA2 I;  4IFD J;  1XPR A;  3Q8D A;  5IY0 A;  2JA7 G;  5IYB G;  5M3M G;  4A3J H;  3M7N A;  4IO9 A;  4HIO A;  2CCZ A;  3A74 A;  1I6H H;  4NXN Q;  1E7Z A;  1EIF A;  4GS3 A;  3PO3 G;  1CKO A;  2MFI A;  1PH3 A;  1KL9 A;  3GTO H;  3CCQ A;  4JOI A;  2JEB I;  4A3D H;  4JI5 Q;  2LSS A;  4DV5 L;  1NJI C;  1X56 A;  4HJ7 A;  2R7Z H;  4A93 H;  1YI2 A;  4JI4 L;  1YBY A;  1L2F A;  1PH5 A;  2KEN A;  2WB1 E;  3ULJ A;  3H0G G;  3GTJ H;  4DV1 L;  1XJV A;  1WFQ A;  2OTL A;  4BY7 H;  1E24 A;  2KCT A;  4YWL A;  1PHJ A;  4Y52 H;  2DUD A;  4A3E H;  1AH9 A;  1VQ7 A;  2A19 A;  4DR4 Q;  3T1Y Q;  4A76 A;  2JA7 H;  4GLA C;  4AYB E;  5IYC H;  1XPU A;  5HY6 A;  1Q86 C;  4HIM A;  1EWI A;  2UXC L;  1HNW Q;  1UE1 A;  4DKA C;  1Q1E A;  4X66 L;  1VQK A;  1WCM G;  2NVT H;  3G71 A;  2I5H A;  2QGQ A;  4BY1 G;  5ELN A;  4K0K Q;  4PZ6 A;  4DV2 L;  2B29 A;  1NE3 A;  1Q1B A;  4JV5 L;  4EQ5 A;  3CCR A;  1C7Y A;  1E3P A;  4B3M L;  4BXX H;  3STB C;  3JAM c;  4NXM L;  3A5U A;  5GAD C;  2YTY A;  4JYA Q;  2GVB A;  3HKS A;  3NEL A;  1YJW A;  4IFD G;  1W2B A;  1N32 Q;  2R7D A;  3A0J A;  1VQL A;  1KD1 C;  5LMN W;  2B63 G;  3F1Z A;  4B3T Q;  4B3S L;  3WWV A;  2YU9 H;  4NPS A;  5IWA L;  2UUA L;  1YJ9 A;  3STB D;  4OWW B;  3PV0 A;  1FJG Q;  2VS1 A;  3CCJ A;  4JI2 L;  1KIX A;  3D0F A;  1DGS A;  2E2J H;  3KJP A;  1SR3 A;  1I5F A;  5IYB H;  3HKZ E;  1K3R A;  5HGQ A;  3PF4 A;  1JB7 A;  1V9P A;  3S17 H;  2VZA A;  3F2D A;  4KHP L;  1KXL A;  3GTK H;  3S1N H;  3AFP A;  3S2H H;  1T9H A;  2AMC B;  1OXU A;  1PV4 A;  4PMW A;  3M4O H;  1SFO H;  3KOJ A;  4DPG A;  3LGJ A;  1SN8 A;  4GOP C;  4XIG S;  1HH2 P;  5C4X H;  2R92 H;  4UP8 A;  2ZTD A;  5M3F H;  2IX1 A;  4JI1 L;  4DV3 L;  4JI0 L;  2CFM A;  4IPD A;  4YHH Q;  1HNX L;  1R9T H;  4A3L H;  3GD7 A;  3UDX A;  3TS0 A;  4LF5 L;  1VQ6 A;  1SLJ A;  3K7U C;  3GTM H;  4LUO A;  5M5Y H;  4JI7 L;  2KBN A;  5JJK A;  3TS2 A;  1B8A A;  1KAW A;  1WOC A;  4A3C H;  3J81 j;  5FJ8 G;  2I5L X;  1YIJ A;  3UE0 A;  3H0G H;  4JC0 A;  1N36 Q;  2UUB Q;  4AQY Q;  2ID0 A;  1IYJ B;  1IBK Q;  1KRS A;  4DNI A;  4A3M H;  2HHH L;  4EX5 A;  4UPA A;  1TWH H;  4JBM A;  1VQD A;  1L1O C;  2WP8 J;  4QY7 A;  4L5T A;  3RN2 A;  2NN6 I;  1LTL A;  2YTV A;  1G29 1;  3D31 A;  3K7A H;  1VS0 A;  2MO0 A;  2NZO A;  4R4C A;  4JI3 Q;  2UXD Q;  2VQE L;  5M3M H;  4A3J G;  2N49 A;  2HHH Q;  1IBK L;  2CWA A;  4AQY L;  1U5K A;  2K75 A;  2R6G A;  1N36 L;  2Y0S E;  5M5W H;  4UP9 A;  4C3I H;  2ZTC A;  1NTG A;  1QZG A;  2R7Z G;  1K9M C;  4LF5 Q;  1CUK A;  1IBL Q;  2B3G A;  1X3E A;  3GTQ H;  2Q2H A;  1HNX Q;  2F52 A;  4DV3 Q;  4A3C G;  2YV5 A;  4IJL A;  4JBW A;  1VQI A;  4LUV A;  4LNQ A;  4QJF A;  4HJ8 A;  3EBE A;  1MJE A;  3I2Z A;  2L15 A;  2RHQ B;  4JOI C;  1K8A C;  3J80 i;  4IPG A;  5IT9 c;  4DV6 Q;  3U58 A;  4QGU A;  4APV A;  4KHP Q;  1RL2 A;  1JJC B;  3S14 H;  1JT8 A;  1VQ4 A;  3CP0 A;  2IHE A;  1Q8K A;  3I4M H;  3L2P A;  4R1J A;  3JC6 6;  4L5R C;  3BZC A;  1E1O A;  4A3G G;  2JE6 I;  3AYH B;  4JI2 Q;  1MIU A;  2OTJ A;  2HIV A;  2E8G A;  3M3Y H;  1EIY B;  5C44 G;  3KLW A;  2K50 A;  2ZTE A;  3K8A A;  1XPO A;  1N33 Q;  1NMF A;  1YVC A;  1K0R A;  2UUA Q;  4DR2 L;  1HR0 L;  1G6P A;  5C44 H;  1NMG A;  4B3S Q;  1HZC A;  5C0X G;  2R7F A;  1VQJ A;  4YCW A;  2I0Q A;  3GTL H;  2LXK A;  4IPH A;  3TEH B;  1VQC A;  2ZM6 L;  3S16 H;  4YWM A;  5BR8 L;  2PI2 A;  1RIP A;  2PNH A;  4C3J H;  4A3I G;  4NXM Q;  1VQ9 A;  3HOX H;  4LF9 Q;  2VNU D;  2IT1 A;  3PUV A;  4B3M Q;  4XTC S;  1UE7 A;  3GTG H;  1VQO A;  3T1H L;  1VQE A;  3AQQ A;  3CMA A;  4DUY L;  4JV5 Q;  2D0P A;  3E9H A;  1FGU A;  2MO1 A;  4BBR G;  4X64 L;  3CCV A;  4DV2 Q;  4A75 A;  4A3E G;  4PZ8 A;  1I94 L;  1TXY A;  1J6Q A;  1VQN A;  2ZJQ A;  1JE5 A;  1I94 Q;  2D62 A;  4H02 A;  2PQA A;  1Q46 A;  1HNW L;  2D0O A;  4X64 Q;  4MZ9 A;  3W1G A;  3CCS A;  1Q82 C;  4DUY Q;  5FLM G;  3IRB A;  4A93 G;  3T1H Q;  3T1Y L;  3CME A;  4GN4 B;  3L7Z C;  4DR4 L;  5IP7 H;  5C3E G;  2V1C C;  3HFZ B;  3PUW A;  4LF9 L;  3S24 A;  3CF5 A;  3CCM A;  5BR8 Q;  4GOP A;  1X9N A;  1QZH A;  2ZM6 Q;  3I4N G;  1YHB A;  4IFD I;  4BBR H;  4KLK A;  1V1Q A;  3TQY A;  3W5O A;  5JEA J;  4JI4 Q;  1LUZ A;  3CPW A;  1YHA A;  4JI5 L;  5JJI A;  3PGZ A;  4R4T A;  2PMZ E;  3KF6 B;  4R4O A;  1CKN A;  2JA9 A;  5M5X H;  4DR2 Q;  3L0O A;  1FVI A;  1HR0 Q;  3GTP H;  1C0A A;  1OXX K;  1N33 L;  1WCM H;  2HIX A;  3PIO A;  2OQK A;  1OXS C;  2B63 H;  4IJH A;  4GLV B;  3CD6 A;  1UE5 A;  1ASY A;  1X65 A;  3PO3 H;  1AE3 A;  2AHO B;  4POF A;  1BKB A;  2RCN A;  4A3F H;  3PUX A;  1NY4 A;  4DUZ L;  2Y0S G;  2ALY B;  2GVA A;  4DV6 L;  2Q2I A;  2JK8 A;  3UE1 A;  3BZK A;  4A3G H;  4ALP A;  1PH8 A;  4JCV E;  4HIK A;  3E0E A;  3CXC A;  4YWK A;  3B6Y A;  5IYD G;  1GVP A;  2AWN A;  1IBL L;  1C9O A;  4JI8 Q;  4YY3 L;  4LFA L;  3NBH B;  3H3V H;  3J81 i;  4BBS G;  1UEB A;  3SGI A;  1GKH A;  1A62 A;  2XGT A;  4QQB X;  4NB3 A;  3J80 c;  1XNQ L;  3RLN A;  4DR7 Q;  4DR1 Q;  2AWO A;  5IP9 H;  2OCE A;  1EOV A;  5JJL A;  1E22 A;  4IPC A;  3RZO H;  1X55 A;  3I4O A;  3S1Q H;  1D7Q A;  1OXV A;  2Z6K C;  3FKI G;  4YCU A;  1K73 C;  1AE2 A;  2VQE Q;  4HJA A;  2UXD L;  3M9B A;  4L5Q A;  1L1O A;  3HOY H;  1PYS B;  2NVY H;  1VQG A;  4JI3 L;  3UDG A;  2KHI A;  2K4K A;  3U50 C;  2Z6K A;  4GN3 B;  1M1K C;  3KFU A;  2MQH A;  4DV0 Q;  3G6E A;  4BA1 I;  3PIP A;  2VW9 A;  1KC8 C;  1PYB A;  4LF6 Q;  3CC7 A;  2ASB A;  2BH8 A;  4LUZ A;  3PUY A;  3HOV H;  3S15 H;  2XTI A;  4A3B G;  1PFS A;  1TWG H;  2UUB L;  3CC4 A;  4JBJ A;  3F2B A;  4LF4 L;  3J7A 5;  1YIT A;  4JI7 Q;  5M3F G;  1HR0 W;  1A8V A;  3HOX G;  1N8R C;  3KF6 A;  2R92 G;  1YZ6 A;  1VQ8 A;  3ULL A;  4B3R L;  4YHH L;  1Y1W G;  2JA8 H;  3PO2 H;  4JI0 Q;  4JI1 Q;  1IXR A;  2EQS A;  4A3M G;  5DLQ E;  4DK6 C;  2HQL A;  2A1A A;  2VQF L;  2F4V Q;  2JEA I;  4WJ3 M;  3E9I A;  3M85 A;  4C3H H;  1G51 A;  2JA5 G;  1BBU A;  1I3Q H;  1VQP A;  3W1B A;  1E1T A;  4X6A H;  4P75 A;  4RG1 A;  4POG A;  1WJJ A;  3GO5 A;  4A3L G;  3NEM A;  4A3F G;  2K5H A;  3K81 C;  2IHF A;  2VL6 A;  3OTO L;  1FL0 A;  4QIW E;  3KJO A;  1TWA H;  2H5X A;  1LM0 A;  2FXQ A;  4TVA B;  3ER0 A;  1KQS A;  4LF8 Q;  2WAQ G;  4AH6 A;  1FJG L;  4KI0 A;  2GN5 A;  1CKN B;  3U4Z A;  1X54 A;  3S2D H;  2IX0 A;  1HJP A;  4OX9 Q;  5IWA Q;  4PG3 A;  2N3S A;  4DAM A;  1TWC H;  2JQO A;  4GLX A;  3G48 A;  4L5S A;  4B3T L;  3HOU G;  1EFW A;  2Q2U A;  1QUQ A;  5GAE C;  1XTD A;  1Z9F A;  4BXX G;  1GD7 A;  3KF8 B;  3I55 A;  4DV7 Q;  3I4N H;  4ME3 A;  3HOU H;  1GO3 E;  1N32 L;  1BBW A;  4MTN A;  4RMF A;  2NVQ H;  3S1M H;  3GDE A;  5IYD H;  3TRZ A;  4JYA L;  3ERS X;  5IE8 A;  3ICE A;  4DV4 L;  4A3I H;  4HJ5 A;  1B7Y B;  2JA6 H;  1QUQ B;  1TWF H;  3M4P A;  1CKM A;  5C0X I;  3KDF B;  1A0I A;  4LWC A;  5E7N A;  2PQA B;  3CCL A;  5AJ3 Q;  1I50 H;  2AKW B;  1VQF A;  3ULP A;  4K0K L;  1SRU A;  1M90 C;  3CAM A;  1L1O B;  1MKH A;  2RHS B;  4MNO A;  4OO1 I;  1P8L A;  1YEZ A;  4X66 Q;  4LFC L;  1IBM Q;  4X65 L;  1JJ2 A;  3HOV G;  1Q81 C;  4A3B H;  5GRO A;  2UXC Q;  2IY5 B;  3G4S A;  4BY7 G;  1WYD A;  4BBS H;  2JA5 H;  5LMU Q;  3RNU A;  5H1S E;  4DR5 L;  3JAM i;  3H15 A;  2UUC Q;  4LFB Q;  4DR3 L;  2BA1 A;  1XNR Q;  4P73 A;  2UU9 Q;  1KHI A;  5J3B A;  2HT1 A;  2QEX A;  4GNX A;  3ZJY C;  1Y1W H;  4AIM A;  4IOC A;  5EAY A;  1PH6 A;  2E5L L;  1HZB A;  2N8N A;  4DV1 Q;  3FKI H;  1XMO L;  3OW2 A;  3RLO A;  4R4Q A;  2R93 G;  1NBW A;  1XMO Q;  2BA0 A;  1L0W A;  4DV5 Q;  3H3V I;  3F2C A;  1P16 A;  2YTX A;  2E5L Q;  2VY3 A;  2K5N A;  3HKZ G;  3K0X A;  1SRO A;  2CKZ B;  2LXJ A;  4UP7 A;  2UU9 L;  1XNR L;  4DR3 Q;  4NXN L;  3RLF A;  3FP9 A;  4LFB L;  1YNX A;  4FDB A;  4P72 A;  3PSI A;  1VQA A;  4GNX C;  4DR5 Q;  2NVX H;  5LMU L;  2UUC L;  2ZJP A;  3HOZ G;  1JJG A;  3AFQ A;  4JG2 A;  2Z0S A;  2MNA A;  4X65 Q;  1Q12 A;  1Q7Y C;  2I5M X;  1IBM L;  4LFC Q;  4P74 A;  3BU2 A;  1VQH A;  1QVG A;  1QVF A;  1O7I A;  1J5E L;  1K83 H;  1ASZ A;  4OO1 G;  5AJ3 L;  4UY8 C;  4LW1 A;  3RR5 A;  1VCI A;  2C35 B;  1X6O A;  1PA6 A;  1EQR A;  3PF5 A;  2OWO A;  1BVS A;  3I7F A;  4GNX B;  2ZJR A;  1VQB A;  5LMN Q;  2R93 H;  2YYZ A;  4DV4 Q;  4OXP A;  4OWX B;  1YHQ A;  2VUM G;  2A8V A;  4R4I A;  3AEV A;  2E2H H;  3F8T A;  1PH9 A;  1LYL A;  3RN5 A;  4DV7 L;  1Y14 B;  2DGY A;  3MEF A;  2JA6 G;  3MXN B;  5FLX c;  3VDY A;  3CC2 A;  3HOW G;  3EIV A;  1N9W A;  5FJ8 H;  1U0L A;  1HNZ Q;  3A5Z B;  3UDI A;  4OX9 L;  1W3S A;  1N34 L;  4JI6 L;  3M4Q A;  1IL2 A;  4WJ4 A;  4A3K H;  4LF8 L;  3HOW H;  2F3I A;  1JMC A;  3I4M G;  4GKK L;  1UWV A;  4AYB G;  5IP7 G;  5GAG C;  1PH4 A;  5K36 G;  3PCO B;  3OTO Q;  3UDF A;  4HJ9 A;  1PH7 A;  4DR6 L;  1VQ5 A;  4GKJ L;  2ATW A;  2QA4 A;  2N78 A;  1XMQ Q;  2PI2 E;  4O0A A;  4OON A;  4KHZ A;  1X3F A;  3NEN A;  4X62 L;  2E2I H;  2NN6 G;  1K8G A;  3EN2 A;  2NZH A;  2VQF Q;  4PZ7 A;  4LF7 Q;  2F4V L;  2UXB L;  1KRT A;  1S40 A;  4DK3 C;  4B3R Q;  1CSP A;  3RZD H;  2UXB Q;  3OYY A;  1HZ9 A;  1V43 A;  5GAH C;  4LF7 L;  4IOA A;  3KDF A;  1VQM A;  1WI5 A;  1PH1 A;  1OXT A;  2KHJ A;  1UE6 A;  1X3G A;  5C3E H;  1PH2 A;  4LF4 Q;  4X62 Q;  4A3D G;  1PVO A;  4GOP B;  5FLM H;  1GM5 A;  4DAY B;  1XMQ L;  2VUM H;  2ES2 A;  3BJU A;  2K14 A;  2WAQ E;  5JEA G;  4DR6 Q;  4J15 A;  4GKJ Q;  3I56 A;  5IP9 G;  3TRE A;  4A3K G;  4LF6 L;  1S3O A;  1EUJ A;  3J81 c;  5C0X J;  2EIF A;  1MJC A;  1SE8 A;  2EXD A;  4DV0 L;  4GKK Q;  1H95 A;  3CCE A;  5GQO A;  4HID A;  1EYG A;  2CQO A;  4Y7N H;  5ELO A;  3CQZ H;  4OWT B;  4A4I A;  1Y1V G;  3FHW A;  4JI6 Q;  1N34 Q;  4BY1 H;  5C4J H;  4TQU S;  4GN5 A;  2RF4 A;  4DR1 L;  1HNZ L;  1IZ6 A;  1XNQ Q;  4DR7 L;  2KCM A;  4O2D A;  1A63 A;  2WB1 G;  2OQ0 A;  2JJQ A;  3CW2 C;  3PUZ A;  3CPF A;  5IYC G;  4LFA Q;  1SMX A;  4JI8 L;  4YY3 Q;  2BH2 A;  1HZA A;  4YCV A;  1YJN A;  4C2M H;  2CWP A;  1Z47 A; 
#chains in the Genus database with same CATH topology
 3S1R H;  3RUZ A;  2Q2T A;  2K5V A;  5C4X G;  4A3D B;  1NAP A;  1SYF A;  4JBK A;  5IT9 E;  5I9O A;  5I4D A;  1J5E Q;  3GTL B;  2K6A A;  1EQQ A;  1S72 A;  5IGC A;  1XPR A;  4IUP A;  2X69 A;  3M7N A;  3J80 L;  2CCZ A;  3K57 A;  1S5E D;  3A74 A;  1EIF A;  1JIC A;  2MFI A;  2P5Z X;  2IPK D;  5ELC A;  1CQF A;  3CQZ B;  4JI5 Q;  4A3D H;  4BY7 B;  5C3X A;  3K5M A;  1YBY A;  4KV6 A;  4DU9 A;  1L2F A;  3TP6 A;  1PH5 A;  2KEN A;  3GTJ H;  1LT6 D;  2M2L A;  1ENF A;  1TS2 A;  3HP3 A;  1PMR A;  2DUD A;  1VQ7 A;  4KKU A;  1EEF D;  3MVV A;  4A76 A;  2JA7 H;  1U4L A;  1Q86 C;  4HIM A;  1EWI A;  1HNW Q;  2JA6 B;  3PIO 3;  5EKL A;  2F0H A;  2EY2 A;  3G71 A;  4K0K Q;  3A7L A;  3PO3 B;  1E3P A;  4BXX H;  4QIW B;  3STB C;  2YTY A;  4G7O C;  2X6G A;  1YJW A;  2YU9 B;  1HFG A;  3A0J A;  1BBX C;  2M00 A;  3MA2 B;  5C4Z A;  1SE2 A;  5C5M A;  4K14 A;  2B63 G;  3F1Z A;  2HDL A;  4KK7 A;  3PO2 B;  1WTV A;  1AN8 A;  2UUA L;  3J80 E;  1SND A;  1YJ9 A;  3STB D;  3PV0 A;  3MXP A;  5DM6 3;  2B2V A;  2L0C A;  2E2J H;  1RTO A;  1I5F A;  2F0O A;  5IYB H;  2JYO A;  5M3F B;  3S17 H;  2VZA A;  4KHP L;  2CQA A;  3S1N H;  4KHV A;  3AFP A;  3S2H H;  1T9H A;  2AMC B;  5IGD A;  4E6I A;  2L4N A;  5I9P A;  2XRS D;  3KOJ A;  3LGJ A;  4HMJ A;  1SN8 A;  1HH2 P;  3K0Y A;  3VR5 A;  4DV3 L;  1HNX L;  4GZY C;  3GD7 A;  3UDX A;  1VQ6 A;  1SAP A;  3Q23 A;  4FXG C;  5CR3 A;  1YNJ C;  3J81 j;  5FJ8 G;  3UE0 A;  4ZUJ A;  4X3T A;  3NHH A;  1GUO A;  1W6J A;  4EX5 A;  1TWH H;  2SDF A;  1L1O C;  4RGN A;  3H6M A;  4PQX A;  1PTO F;  3VA5 A;  3RN2 A;  4K6D A;  4HN7 A;  2ENB A;  1LT5 D;  4JI3 Q;  3K7A H;  2K28 A;  5HUR A;  1K8M A;  2R6G A;  1N36 L;  1SYG A;  4WJW A;  2KA7 A;  4DF7 A;  4CDD C;  3KF8 A;  4LF5 Q;  1ZYR D;  2PZW A;  1CFM A;  1H9M A;  2WII B;  3MXG A;  4ZCK A;  4MHE A;  1MHW C;  1LAC A;  3EBE A;  1MJE A;  5E4W C;  3CU7 A;  4PNY A;  4MN3 A;  4HMI A;  4IPG A;  3J80 i;  5IT9 c;  4YIJ A;  1JJC B;  3SE0 A;  4RH6 A;  2RKS A;  3T51 B;  1KNE A;  1DJR D;  1VF5 C;  3L2P A;  4R1J A;  3JC6 6;  3DHQ A;  1PFB A;  2OTJ A;  3WOF A;  3M3Y H;  1EIY B;  3K5O A;  2ZTE A;  3K8A A;  4RAU C;  1XPO A;  1CA5 A;  1YVC A;  1JWS D;  4DR2 L;  1HR0 L;  1SNC A;  5CV7 A;  5E1F A;  1NMG A;  3LWU A;  2R7F A;  1VQJ A;  4N9P A;  4OEL B;  2LXK A;  4IPH A;  1XXG A;  5JOB A;  4YWM A;  4FF3 A;  4NXM Q;  4LF9 Q;  5BN3 A;  2QKI C;  4PMC A;  5DEH A;  1VQO A;  4O1N A;  3E9H A;  4DV2 Q;  3CCV A;  2A68 D;  5G3L F;  2NN6 H;  4DXF A;  4PZ8 A;  4A75 A;  1J6Q A;  1VQN A;  1I94 Q;  2XWJ B;  1Q46 A;  1OO9 B;  4CJ1 B;  4FYD A;  3DWA A;  2HD3 A;  3IRB A;  3T1H Q;  2NYZ D;  1DYQ A;  1WTQ A;  1JOK A;  2V4D A;  3EA6 A;  4K5V A;  3CF5 A;  2A68 C;  1XTC D;  2OT2 A;  4KLK A;  4JI4 Q;  4X3U A;  2B2U A;  3KF6 B;  3VR2 A;  1CKN A;  1C0A A;  3ZYY X;  3GTP H;  1FVI A;  3L3O C;  1OXX K;  5K36 H;  2B63 H;  2CHB D;  3HZX A;  2HUG A;  5KYI A;  2AHO B;  3NXW A;  4POF A;  5ISR A;  4ABN A;  4DUZ L;  2GVA A;  4ZQ3 A;  1ONL A;  2NZ1 D;  3A7A B;  1WVL A;  2F0Q A;  2PYK A;  4JCV E;  2JA7 B;  4Q5V A;  1PRT D;  1VF7 A;  1ENC A;  3B6Y A;  4Y7N B;  3K58 A;  3H3V H;  2F0G A;  3NBH B;  3ONA B;  1UEB A;  2EYJ A;  1A62 A;  2XGT A;  4QQB X;  4DR7 Q;  2JA5 B;  1DM0 B;  3WOE A;  3TZU A;  4C2M B;  1EOV A;  2LFN A;  3RZO H;  3I4O A;  1OXV A;  3AU7 A;  1TWG B;  1PRT C;  4FNF A;  1PYW D;  1FNU A;  2NVY H;  2GA4 B;  2Z6K A;  4DV0 Q;  3G6E A;  2PW5 A;  3R2T A;  3PIP A;  2VW9 A;  1KC8 C;  1WTW A;  4ODG A;  1TII D;  2LKV A;  2ASB A;  4XDX A;  3HOV H;  3S15 H;  2UUB L;  2C9O A;  2ZT9 C;  3E3X A;  4LF4 L;  4JI7 Q;  5M3F G;  1A8V A;  4C1N I;  4JK1 C;  2R92 G;  1YZ6 A;  4B3R L;  4YHH L;  4JI0 Q;  2EQS A;  5DLQ E;  4DK6 C;  1SSO A;  2A1A A;  2VQF L;  2F4V Q;  4WJ3 M;  2A69 D;  1O78 A;  1ROD A;  4OGQ C;  4ZKC B;  4P75 A;  2MGS A;  4RG1 A;  1WJJ A;  2IX3 A;  5M5Y B;  1EU4 A;  2EYP A;  5JPN C;  3K81 C;  3KJO A;  4RHS A;  1TWA H;  3T53 B;  5FO8 B;  1F2L A;  3ER0 A;  3GV6 A;  4LF8 Q;  4AH6 A;  2A69 C;  4XYO A;  1FJG L;  2GN5 A;  3E0J A;  4LJZ C;  1X54 A;  2XWB B;  4K8J A;  2N3S A;  4DAM A;  1PXU A;  2JQO A;  3HOU G;  1QUQ A;  2IW3 A;  4S3S A;  1NCV A;  1XTD A;  3OHX C;  3I55 A;  1BBW A;  3NP8 A;  4K8I A;  4RMF A;  3S1M H;  3GDE A;  3QWN A;  3TRZ A;  1BCP F;  3ERS X;  4A3I H;  2B2U C;  1QUQ B;  1TWF H;  3M4P A;  1CKM A;  4LWC A;  3MAQ A;  1AP0 A;  2Z4H A;  4XQJ A;  3CCL A;  2XRQ D;  5AJ3 Q;  5CV4 A;  3ULP A;  2TSS A;  1EY4 A;  1QJO A;  1L1O B;  3BDC A;  4KY5 A;  1YEZ A;  1SYC A;  5FOB B;  4X66 Q;  4LFC L;  1VMC A;  4KD4 A;  1JJ2 A;  4A3B H;  1Q81 C;  1HUN A;  1WYD A;  2JA5 H;  1TU2 B;  1VDZ A;  4CJ2 C;  1SNM A;  2UU9 Q;  2HT1 A;  2QEX A;  1TT2 A;  4GNX A;  1PH6 A;  4IOC A;  1SFO B;  2E5L L;  4DV1 Q;  1Y8P B;  3OW2 A;  2EYL A;  1XMO Q;  1IKL A;  2VXW A;  3GTQ B;  1DZ1 A;  3K0X A;  5EPK A;  1ICF B;  2OF1 A;  1XNR L;  1F9Q A;  4LFB L;  4GNX C;  2NVX H;  4IUT A;  1STB A;  1VQA A;  4DR5 Q;  2R3Z A;  5LMU L;  5HGT A;  1JJG A;  3AFQ A;  2Z0S A;  2MNA A;  3NWT A;  1H9S A;  1Y1W B;  1JWU D;  3NE5 B;  2K01 A;  2B2W C;  1XWE A;  4ILW A;  4KTA A;  3J81 L;  3DUZ A;  5M5W B;  3PF5 A;  2JP1 A;  1PA6 A;  1BVS A;  2OWO A;  2R93 H;  2ZJR A;  1ILP A;  4DAV A;  2YYZ A;  1YHQ A;  4KN7 C;  2VUM G;  4R4I A;  2E2H H;  5A35 A;  1GUW A;  2MHV A;  2NBF A;  4DV7 L;  2JA6 G;  2DGY A;  3MXN B;  2B2W A;  4IFD H;  5FJ8 H;  5I6Y A;  3DMU A;  2DJF C;  4OX9 L;  1SMY D;  1W3S A;  2RDH A;  3DXJ C;  4Q0F A;  1PFN A;  3P75 A;  4AYB G;  3OTO Q;  1YNJ D;  5L37 A;  4GKJ L;  4FXK C;  2F0W A;  4KHZ A;  4OIK A;  4X62 L;  1A3V A;  1GUN A;  2NN6 G;  4H44 C;  4ME5 A;  2NZH A;  3OWE B;  1S40 A;  1CSP A;  1HZ9 A;  1V43 A;  1B3A A;  1PH1 A;  1OXT A;  1UE6 A;  4X62 Q;  4A3D G;  4DAY B;  4RWS C;  3BJU A;  4DGZ A;  5JEA G;  3NBH A;  4KMU C;  4GKJ Q;  4LF6 L;  3RZD B;  3WDN A;  3J81 c;  1ZYR C;  2EIF A;  4HR7 B;  2BDO A;  4HID A;  2CQO A;  3NWS A;  4Y7N H;  3GTG B;  3GTO B;  5ELO A;  1F9S A;  2K7V A;  4LK1 C;  4BY1 H;  5C4J H;  4GN5 A;  4DR1 L;  1A63 A;  1HTP A;  2TMP A;  4B9W A;  2ZXR A;  4LFA Q;  4YY3 Q;  1EEI D;  4V19 0;  2WFW A;  1JOO A;  5BN5 A;  4XXE A;  5C3W A;  3HOZ H;  2L12 A;  3K80 C;  3PO2 G;  1B4O A;  1B70 B;  3N6R A;  4RKL A;  2OEO A;  4BA2 I;  2KCN A;  3SHL A;  3Q0A A;  2JA7 G;  5J1Z A;  5M3M G;  4IO9 A;  3QOJ A;  4HIO A;  3M7G A;  1SNO A;  4GS3 A;  1CKO A;  1KL9 A;  3W2D A;  4JOI A;  2JEB I;  2FMM A;  2R7Z H;  4A93 H;  1YI2 A;  2H4O A;  3CHB D;  4DV1 L;  3VYR A;  1S5F D;  4J1M A;  3LX0 A;  4YWL A;  1SJE D;  2A19 A;  2E2I B;  1WTX A;  3QIA A;  2QEJ C;  1I6V C;  3T1Y Q;  2VB2 X;  5IYC H;  1XPU A;  1LTI D;  1RHP A;  4X66 L;  1UUP A;  2DNC A;  2B2T C;  2NVT H;  3TSS A;  3OIP A;  5ELN A;  2AUK A;  3KBG A;  2B29 A;  3I4N B;  1Q1B A;  4JV5 L;  1C7Y A;  1PZI D;  1ICW A;  1PLF A;  4QCL A;  1W2B A;  3NSW A;  2D2C C;  3C2P A;  4KKS A;  1BCP B;  2F0M A;  2RVL A;  4NPS A;  4A3I B;  3FRP B;  3NTK A;  1KLU D;  4OWW B;  2VS1 A;  1FJG Q;  2A6H C;  3CCJ A;  1TY0 A;  4K5X A;  2F0U A;  4JI2 L;  1DGS A;  4BWG B;  2EDG A;  1JB7 A;  1V9P A;  3F2D A;  1TR5 A;  3BZD B;  1D2B A;  4NDX A;  1CTM A;  5JVG 3;  3GTK H;  3SEB A;  3X3M A;  1PV4 A;  1IHZ A;  1SFO H;  4XIG S;  3LWE A;  5C4X H;  2A6H D;  1STE A;  2KEE A;  3DM1 A;  3R93 A;  2ZTD A;  5EKK A;  5M3F H;  1S5B D;  4JI0 L;  2L9H A;  1CZG A;  4YHH Q;  1Y8O B;  2J4X A;  1SLJ A;  3K7U C;  4JI7 L;  4R9W A;  1WOC A;  3S16 B;  1A2T A;  5JJZ A;  1YIJ A;  2UUB Q;  3IKJ A;  4AQY Q;  3R3O A;  5C5L A;  1EY9 A;  4A3M H;  5CV8 A;  4DK0 A;  2WP8 J;  4K2K A;  2XSC A;  1DXM A;  3NQI A;  3D31 A;  2YTV A;  4R4C A;  2NVX B;  1NR4 A;  1G8Z D;  4FF2 A;  2WAC A;  4A3J G;  1CHP D;  2KOL A;  2HHH Q;  1RD9 D;  1IBK L;  2CWA A;  1U5K A;  2FMC A;  5EPJ A;  5IGE A;  1A6X A;  4DAY A;  2RDG A;  2ICE C;  4UP9 A;  2ZTC A;  3S1N B;  1NTG A;  3S2H B;  1G2S A;  5EKI A;  2KUM A;  2B3G A;  3D6W A;  3FPU B;  3MZ5 A;  3ND9 A;  4A3F B;  3D4W A;  4KY7 A;  5FO7 B;  4JBW A;  1EFI D;  4QJF A;  2RHQ B;  1RL2 A;  5CV6 A;  1YNN D;  3CP0 A;  1BCP D;  2E74 C;  4L5R C;  3SVM A;  3NBI A;  3AYH B;  1D6E C;  2HIV A;  2E8G A;  2FFK B;  4NW2 A;  5C3E B;  1NMF A;  1GXD C;  1FNW A;  1K83 B;  3VR4 A;  1G6P A;  5C44 H;  2IWH A;  3EVQ A;  3QR8 A;  4B3S Q;  1DOL A;  4F88 A;  4YCW A;  5COY A;  3GTL H;  1I4R A;  1BCP C;  1JCK B;  3S16 H;  5KYL A;  1EZ8 A;  1RIP A;  2PNH A;  4C3J H;  4BBR B;  1BDO A;  1BXT A;  1VQ9 A;  2VNU D;  4B3M Q;  1EWH A;  3GTG H;  4K6L A;  3T1H L;  3CRL C;  3CMA A;  1AZP A;  2MO1 A;  3OWF A;  1I94 L;  3K5N A;  1SE4 A;  2ZJQ A;  1AFP A;  2F0I A;  1Q82 C;  4G4K A;  3W1G A;  2J0T D;  1F9R A;  2J7Z A;  4DR4 L;  2V1C C;  2XNA C;  4RHR A;  4LF9 L;  1GOZ A;  3S24 A;  3HOV B;  3S15 B;  4M8A A;  1WCM B;  2NTS A;  4GOP A;  1BUV T;  3IFT A;  3W5O A;  2MUY A;  3CPW A;  1LLR D;  3PGZ A;  4IAL A;  2JA9 A;  4CHT B;  4DR2 Q;  1HR0 Q;  3L0O A;  1G91 A;  1NR2 A;  4G57 A;  2HIX A;  4CKE A;  4GLV B;  1ASY A;  1ET9 A;  1UAP A;  2R7Z B;  1HUM A;  4HED A;  1AE3 A;  3N52 A;  1BKB A;  1KAB A;  2F0P A;  4A3F H;  3BDO A;  2Y0S G;  4TSS A;  5KIX A;  2Q2I A;  3UE1 A;  3BVG A;  1TKW B;  1EQV A;  2EJM A;  1RJT A;  1SE3 A;  3CXC A;  2E2H B;  2A73 B;  2WAQ B;  3P20 A;  2AWN A;  2K5Q A;  4UAI A;  3T4A C;  1HCZ A;  3ERO A;  4IUN A;  3SR1 A;  1XNQ L;  1MBY A;  3HOY B;  5IP9 H;  3TP5 A;  5JEA H;  3S1Q H;  1D7Q A;  1Z6H A;  2Z6K C;  3FKI G;  1AE2 A;  1STA A;  1L1O A;  4JI3 L;  2NB0 A;  4HTH A;  2K4K A;  3Q6S A;  3U50 C;  3KFU A;  1O80 A;  2QCP X;  3GP7 A;  2BH8 A;  4LUZ A;  2XTI A;  1PFS A;  1BO0 A;  1TWG H;  2N55 A;  1R4P B;  1HRJ A;  3J7A 5;  2EY6 A;  1YIT A;  2BCO A;  1VQ8 A;  3C46 A;  1Y1W G;  3PO2 H;  1IXR A;  1HA6 A;  2JEA I;  1Y69 U;  5CGK A;  1WD1 A;  3RMH A;  3E9I A;  3FVQ A;  1BBU A;  4KJN A;  5C6A A;  2PO4 A;  1HQR D;  4A3L G;  3NEM A;  3V2T A;  2VL6 A;  1ZEQ X;  4C3H G;  2H5X A;  3J7A F;  4CGY B;  5FLX L;  3S1Q B;  4TVA B;  5CMD A;  1KQS A;  1E2Z A;  3SK4 A;  4KI0 A;  2EYF A;  1SBB B;  5F2D A;  4PG3 A;  4GLX A;  1QCB D;  3G48 A;  4LMQ D;  1I4X A;  5GAE C;  1GD7 A;  5NUC A;  3I4N H;  4O42 A;  5CV5 A;  5ELD A;  4JW0 A;  2NVQ H;  3MXN A;  4B08 A;  3VYS A;  4DV4 L;  1MSH A;  2OXP A;  1FGB D;  1TWH B;  1A0I A;  2ZXO A;  5E7N A;  1WTR A;  3MFG A;  3NUC A;  4I65 A;  1VQF A;  3P7J A;  4K0K L;  2K04 A;  4MNO A;  2SNS A;  1CM9 A;  3Q22 A;  4X65 L;  1GUT A;  4ZKB B;  3OW7 A;  2H1E A;  3G7L A;  5EJW A;  5H1S E;  3JAM i;  2UUC Q;  1EIH A;  2BA1 A;  4RFB A;  2WKD A;  1KHI A;  5J3B A;  4CDF C;  5EAY A;  2N8N A;  3D8G A;  2KCC A;  4F8M A;  5ELB A;  2R93 G;  2BA0 A;  1L0W A;  3F2C A;  2O2L D;  1R9T B;  4XQQ A;  2F0J A;  1SRO A;  5LL6 X;  3EJI A;  1LT3 D;  4G7Z C;  2DJG C;  2UUC L;  2Z9H A;  4P72 A;  3PSI A;  2F0V A;  3FPP A;  2ZJP A;  4NP5 A;  3VYU A;  4X65 Q;  4EGV A;  3K59 A;  1KDC A;  1QE6 A;  3BU2 A;  3NQT A;  3K5L A;  1PZJ D;  1TS5 A;  4P2C B;  1O7I A;  1J5E L;  1MD2 D;  2WB1 B;  5C44 B;  1VCI A;  2C35 B;  1X6O A;  1EQR A;  3I7F A;  3BS1 A;  4A3B B;  2BE5 D;  4DV4 Q;  4BY1 B;  4WOR A;  2CH4 A;  4HSP A;  3E6Z X;  1SXT A;  3I8Z A;  4K5W A;  3A5Z B;  3UDI A;  4EVO A;  4JI6 L;  1U4P A;  3M4Q A;  4WJ4 A;  4A3K H;  1STN A;  1W6K A;  1GUS A;  2EYM A;  3HOW H;  2B8F A;  2F3I A;  3ND8 A;  3NTI A;  3TZD A;  1UWV A;  5GAG C;  1HTL D;  5FO9 B;  3UDF A;  1PH7 A;  1HQM C;  2G9H D;  4I7Z C;  1VQ5 A;  5I6W A;  4O0A A;  4OON A;  4RKB A;  2IJ0 A;  3T56 B;  3TP7 A;  4AYB B;  2E2I H;  1I4P A;  2F0S A;  1KRT A;  1B3Q A;  4L6T B;  1EY6 A;  2PCF B;  3OYY A;  4LF7 L;  4IOA A;  1EY8 A;  5FLM H;  1GM5 A;  1XMQ L;  2VUM H;  4TRD A;  4DR6 Q;  4J15 A;  1S3O A;  1EUJ A;  4DXG A;  4OHJ A;  2EXD A;  1H95 A;  2EJF C;  3CCE A;  1KTK A;  5GQO A;  3FDT A;  1EZ6 A;  3TBI B;  3HOX B;  2X6L A;  1N34 Q;  2EJG C;  2IL8 A;  2QW7 A;  4C3I G;  2O4X A;  3H3V C;  1XNQ Q;  2EOT A;  2KCM A;  4O2D A;  4R8N A;  2WB1 G;  2OQ0 A;  2JJQ A;  1ZKO A;  4IUU A;  3I72 A;  3D3R A;  1YNN C;  2BH2 A;  1SYD A;  1YJN A;  2LY7 A;  4C2M H;  1Z47 A;  2L11 A;  1S4Z A;  5A2Q E;  1OTC A;  2KJX A;  3KUP A;  2K52 A;  1B1Z A;  4FXD A;  1D8L A;  5C4J B;  1Y1V H;  4RGT A;  3UI2 A;  3U4V A;  5FLX E;  2SNM A;  2RBM A;  5IT9 L;  1JWM D;  2PMZ B;  3Q8D A;  5IYB G;  4J8Q A;  3SXH A;  4RCO A;  1HPC A;  1I6H H;  1B9N A;  1E7Z A;  1DON A;  2EYO A;  3GTO H;  3CCQ A;  2LSS A;  3EFX D;  4DV5 L;  1X56 A;  3I91 A;  2G9D A;  3A8K E;  3KLS X;  2K33 A;  3H0G G;  3V96 A;  1XJV A;  1J8I A;  4BY7 H;  2KCT A;  2JN4 A;  4Y52 H;  4A3E H;  2BDN A;  5J22 A;  4DR4 Q;  2NVT B;  3H0G B;  4AYB E;  1LTR D;  1IKM A;  2PZU A;  5C4H A;  4DKA C;  1Q1E A;  1WCM G;  2I5H A;  2QGQ A;  4PZ6 A;  2EVB A;  4QB4 A;  4QUF A;  1NE3 A;  2B2Y A;  4EQ5 A;  3CCR A;  5J39 A;  3MFY A;  4B3M L;  1CHQ D;  5GAD C;  4U68 A;  1STY A;  3NEL A;  4A93 B;  2EYH A;  2MJ8 A;  1N32 Q;  1CI3 M;  4KY6 A;  4F7X A;  1KD1 C;  1VQL A;  1PTO D;  3C3L A;  2B39 A;  4B3T Q;  4B3S L;  2JA8 B;  2MPM A;  1J9O A;  5IWA L;  3H91 A;  1E0B A;  3S17 B;  1SDF A;  3D0F A;  5T1I A;  1SR3 A;  3C1F A;  3HKZ E;  4H0L C;  4ZK9 B;  5HGQ A;  4G7H C;  2B2V C;  2XVS A;  4EQO A;  1HA5 A;  1M8A A;  3HS0 C;  4C3I B;  2F0K A;  1OXU A;  1V8Q A;  3D4R A;  4GOP C;  2R92 H;  1BOS A;  4IZ8 A;  2IX1 A;  3BDL A;  4JI1 L;  2K5D A;  4N8F A;  4IPD A;  3FMC A;  4A3L H;  3TS0 A;  1II3 A;  3GTM H;  4LUO A;  1KAW A;  3QG1 A;  2I5L X;  3FKI B;  3H0G H;  4JC0 A;  4IUQ A;  1H9J A;  2PZT A;  1F2Y A;  1IBK Q;  1KRS A;  1D5M C;  5JAV A;  2HHH L;  4UPA A;  4R8I A;  1EWC A;  2FHT A;  4QY7 A;  4H7B A;  3JAM E;  1F2Z A;  1V1O A;  1S5C D;  2Z8L A;  2CW0 C;  2K32 A;  2L55 A;  1G29 1;  5KNC A;  2UXD Q;  2Q8R E;  5LHY 1;  4OO1 H;  4AQY L;  4N9T A;  3K7A B;  2Y0S E;  3A56 A;  5M5W H;  3GTK B;  2WV6 D;  1QZG A;  4L8J A;  2F52 A;  1VQI A;  4FVM A;  4LUV A;  3BG3 A;  3I2Z A;  1Z7T A;  3ITP A;  1HFN A;  4DV6 Q;  5FK9 C;  5DM7 3;  3S1M B;  4C3J G;  1JT8 A;  3D6C A;  4X3S A;  1VQ4 A;  1PTO B;  3I4L A;  1MSG A;  4N8X 1;  4JI2 Q;  1U4M A;  2EZV A;  5C44 G;  2K50 A;  2I07 B;  1SEB D;  4NMZ A;  1C8C A;  1K0R A;  5C0X G;  1EU3 A;  3QJY A;  4XYQ A;  2A74 C;  2I0Q A;  3HOZ B;  2ZM6 L;  5IGB A;  4DAP A;  3GQB A;  1TS3 A;  4A3I G;  3HOX H;  2IT1 A;  4XTC S;  1SMY C;  3I3C A;  3O13 A;  4U67 3;  1VQE A;  4JV5 Q;  4DUY L;  1FGU A;  4BBR G;  4H02 A;  1F77 A;  2PQA A;  2D0O A;  4X64 Q;  4MZ9 A;  4CKB A;  5FLM G;  1BNZ A;  4A93 G;  3T1Y L;  5I2X A;  3MXU A;  2SEB D;  3R2I A;  1Y8N B;  3HFZ B;  2E75 C;  2M9V A;  5JVH 3;  5BR8 Q;  2N88 A;  1QNK A;  1X9N A;  1QZH A;  1XX8 A;  3A55 A;  4IFD I;  4BBR H;  4C3J B;  3TQY A;  1B2T A;  4DN4 M;  5JEA J;  1LUZ A;  3NK9 A;  1YHA A;  2NWG A;  5JJI A;  4K2L A;  2KEC A;  4R4T A;  5M5X H;  4IFD G;  3S9W A;  3BYY B;  1N33 L;  1B53 A;  2OQK A;  1OXS C;  2I46 A;  4IJH A;  4XT1 B;  1A3U A;  1X65 A;  3PO3 H;  4CDC C;  1G6Z A;  2RCN A;  2KHS A;  1NY4 A;  3PQI A;  5K5P A;  1UNS A;  2JK8 A;  3BZK A;  1PH8 A;  4HIK A;  3E0E A;  1RTN A;  1QOH A;  4C3H B;  5IYD G;  2AQ3 B;  1IBL L;  4YY3 L;  4LFA L;  5G3L D;  4BBS G;  5DNF A;  1ET6 A;  1GKH A;  4NB3 A;  3V05 A;  3TME A;  4HAE A;  4DR1 Q;  2AWO A;  2OCE A;  1E22 A;  4IPC A;  4RA8 A;  1LTT D;  4YCU A;  5IOD A;  1TVX A;  2VQE Q;  4HJA A;  3HOW B;  3M9B A;  3UDG A;  2KHI A;  1I50 B;  4NKL A;  3DEO A;  1TWC B;  3OMC A;  1PYB A;  4LF6 Q;  1H9S B;  3CC7 A;  1LT4 D;  1A3T A;  3PUY A;  4A3B G;  4DNT B;  1KDB A;  1EYA A;  1O7Y A;  1Y1V B;  1E2V A;  5CC4 A;  2LMC B;  1HR0 W;  3HOX G;  3KF6 A;  2FIN B;  4A3M G;  3KLR A;  2HQL A;  4IQZ A;  1WTH A;  3M85 A;  1G51 A;  1VQP A;  3W1B A;  1BF4 A;  4X6A H;  4L63 B;  3JAM L;  4POG A;  4MIU A;  3TN2 A;  1JQY D;  3OTO L;  2IHF A;  1FL0 A;  4QIW E;  1EY5 A;  2K05 A;  4ZYS A;  2HDM A;  1CKN B;  4KJO A;  3AMU A;  4OX9 Q;  1IYV A;  2F4I A;  2NVQ B;  3SDZ A;  4L5S A;  1LTG D;  1EFW A;  1IW7 D;  1RF2 D;  2RSO A;  1Z9F A;  4OL7 A;  4DV7 Q;  4IUR A;  1GO3 E;  4MTN A;  5IYD H;  4JYA L;  5ELF A;  2RQX A;  3ICE A;  4HJ5 A;  2JA6 H;  5DAU A;  2EY1 A;  3KDF B;  1SYB A;  2PQA B;  1I50 H;  2AKW B;  2RSN A;  1SRU A;  1MKH A;  2RHS B;  4OO1 I;  5EGT A;  2PNR C;  3HOV G;  2UXC Q;  2IY5 B;  5GRO A;  2EY5 A;  5LMU Q;  3RNU A;  4DR5 L;  3H15 A;  4LFB Q;  1XNR Q;  5D65 A;  4AIM A;  4KN4 C;  3MHB A;  2PQE A;  5M3M B;  3FKI H;  3M3Y B;  1XMO L;  1JB3 A;  5IIF A;  3RLO A;  4R4Q A;  1NBW A;  3H3V I;  2YTX A;  2E5L Q;  1K28 A;  2WKC A;  4UP7 A;  2UU9 L;  3HEJ A;  2Z6B A;  4ZUI A;  4NXN L;  4CDE C;  3DEP A;  4HCS A;  2A6E D;  1Q8I A;  1PRT F;  5EBC A;  4JG2 A;  1Q12 A;  4LFC Q;  2I5M X;  1PTO C;  1PDQ A;  1SNQ A;  2EE1 A;  1VQH A;  3DWP A;  4CKC A;  1A2U A;  1QVG A;  3CKI B;  1G2T A;  1K83 H;  2WIN B;  4OO1 G;  1O7L A;  5AJ3 L;  4UY8 C;  4LW1 A;  1K0S A;  4CJ0 B;  4GNX B;  4B9X A;  5LMN Q;  4WFN 3;  4A3G B;  1MI2 A;  4OXP A;  3J7Y W;  4QF4 A;  3P1H A;  1PH9 A;  2PPB C;  3RN5 A;  1Q90 A;  5CBE E;  5FLX c;  3VR3 A;  1D1K A;  3OOC A;  2G5D A;  3EIV A;  1U0L A;  1HNZ Q;  1B9M A;  1EY7 A;  2O5I C;  1ENA A;  4XT3 B;  1IL2 A;  4LF8 L;  5EBD A;  3NPP A;  3C1E A;  4ID6 A;  1JMC A;  5K36 G;  4GKK L;  1EIG A;  3X3N A;  2F03 A;  3PCO B;  3H94 A;  5IGF A;  2O5J C;  1ML0 D;  2PI2 E;  3I90 A;  3I4M B;  3EN2 A;  1LO5 D;  1X3P A;  2VQF Q;  2F4V L;  3A54 A;  1ILQ A;  2UXB L;  3PMF A;  2CW0 D;  3S1R B;  1SYE A;  4DK3 C;  4B3R Q;  3RZD H;  3IFD A;  2K1B A;  2UXB Q;  2F0N A;  5GAH C;  1WI5 A;  2KHJ A;  1X3G A;  1KNA A;  4LF4 Q;  1AEX A;  2PW7 A;  2K14 A;  2WAQ E;  1FNV A;  5TSS A;  3URY A;  3BVZ A;  2NUC A;  1E2W A;  1S5D D;  1B44 D;  4HCE A;  4A3K G;  5C0X J;  4GKK Q;  1SE8 A;  4DV0 L;  4DK1 A;  4FP5 D;  3HG9 A;  1SNP A;  4RGM A;  2KVM A;  3RZO B;  4RCN A;  4OWT B;  1Y1V G;  3FHW A;  1HNZ L;  2KQ3 A;  4DR7 L;  2RDF A;  4JVZ A;  3CW2 C;  3PUZ A;  3T13 A;  2F0E A;  5E4X A;  1WD0 A;  4F87 A;  3MTS A;  5D3D A;  2Q8I B;  4JPB W;  5LMN L;  4ULL A;  4DA2 A;  4QMG A;  1CSQ A;  3KYH C;  4QL5 A;  1TS4 A;  3CCU A;  4P71 A;  3DLL A;  4DUZ Q;  3HOY G;  2JA8 G;  3J7Z C;  1QVC A;  2B63 B;  3DM3 A;  2C5C A;  5BN4 A;  5IY0 A;  4M1U B;  4A3J H;  4NXN Q;  5KGU A;  1CQV A;  3PO3 G;  1PH3 A;  1RCV D;  4DFA A;  1NJI C;  4HJ7 A;  3ERQ A;  4JI4 L;  2WB1 E;  3LNN A;  3ULJ A;  1JOR A;  1WFQ A;  2D9U A;  3M4Y A;  2OTL A;  1E24 A;  1AZQ A;  1NUC A;  1PHJ A;  2ICI A;  1AH9 A;  5D14 A;  4IUV A;  1HHV A;  5COR A;  4GLA C;  5HY6 A;  2UXC L;  1UE1 A;  2AUJ D;  2DY8 A;  1VQK A;  3FEW X;  4BY1 G;  2K03 A;  4DV2 L;  1T5E A;  4ZAI A;  3JAM c;  4NXM L;  3A5U A;  1QWY A;  4JYA Q;  1X32 A;  2GVB A;  3HKS A;  2F0F A;  2R7D A;  4EQP A;  5LMN W;  3WWV A;  3H09 A;  2Z4I A;  2YU9 H;  1QB5 D;  1ESR A;  3VR6 A;  1EYD A;  3TP8 A;  1PZK D;  1KIX A;  2A5H A;  1A15 A;  3KJP A;  5M9O A;  1Q3L A;  1K3R A;  4A3M B;  2DN8 A;  1EYC A;  3PF4 A;  2DNE A;  5ELE A;  2R92 B;  2RA4 A;  1C48 A;  3KLS A;  1KXL A;  1PFM A;  3R8B A;  4PMW A;  3M4O H;  1KLG D;  4DPG A;  1X3Q A;  2QDL A;  4UP8 A;  2L1B A;  2CFM A;  1KAA A;  1R9T H;  4A3K B;  4LF5 L;  5JJK A;  5M5Y H;  2KBN A;  3TS2 A;  1B8A A;  1ESF A;  4A3C H;  1D5Z C;  5LL6 S;  2B8G A;  3VYT A;  1N36 Q;  5CYU A;  2ID0 A;  1IYJ B;  2QIL A;  4DNI A;  2K5W A;  3QOL A;  4JBM A;  1VQD A;  3D4D A;  4L5T A;  4H13 C;  4BBS B;  4EQN A;  2NN6 I;  1LTL A;  1VS0 A;  2MO0 A;  2NZO A;  3HGB A;  2Q8T A;  2VQE L;  5M3M H;  2N49 A;  2K75 A;  1K8O A;  1AW7 A;  2CH4 W;  4C3I H;  1IYU A;  2R7Z G;  1K9M C;  1CUK A;  1IBL Q;  1JR0 D;  1X3E A;  3GTQ H;  2Q2H A;  1HNX Q;  4DV3 Q;  1EY0 A;  4A3C G;  2YV5 A;  3TDQ A;  4IJL A;  1TY2 A;  3L9A X;  4LNQ A;  4HJ8 A;  3IL8 A;  2L15 A;  4JOI C;  5CV9 A;  2B2T A;  1F9P A;  3BVM A;  3G6J B;  1K8A C;  3U58 A;  1IW7 C;  4QGU A;  4APV A;  4KHP Q;  3S14 H;  1LTA D;  2JSO A;  3I4M H;  2IHE A;  1Q8K A;  2VUM B;  4ZLT F;  3BZC A;  1E1O A;  4A3G G;  2JE6 I;  1GHJ A;  1MIU A;  4I7A A;  3KLW A;  1N33 Q;  2UUA Q;  1HZC A;  3OSO A;  2QDB A;  3GTP B;  1H9R A;  2HCI A;  2HQE A;  4FO2 A;  3TEH B;  4FF1 A;  1VQC A;  1L0X B;  5BR8 L;  2PI2 A;  4UDU C;  3PUV A;  1B50 A;  1EL0 A;  1UE7 A;  4MTK A;  2F1M A;  3AQQ A;  3T16 A;  2D0P A;  4A3E G;  4X64 L;  1TXY A;  5KRU A;  1F2M A;  1JE5 A;  2D62 A;  1IL8 A;  3MC0 B;  1HNW L;  1LTS D;  3CCS A;  4DUY Q;  3EQL C;  1SJH D;  3CME A;  4GN4 B;  3L7Z C;  5IP7 H;  2BOS A;  5C3E G;  1WTP A;  1QIL A;  3PUW A;  2E2D C;  2A6E C;  3CCM A;  3J81 E;  2HCC A;  1RDP D;  3E5S A;  4UHV A;  1YHB A;  2ZM6 Q;  3I4N G;  1V1Q A;  4JI5 L;  2PMZ E;  1I4G A;  4R4O A;  2FJ2 A;  3U9O A;  4IN3 A;  1WCM H;  3PIO A;  3DWQ A;  3KK7 A;  3CD6 A;  1UE5 A;  4C56 C;  2EPB A;  2Z1C A;  3HOU B;  3PUX A;  2ALY B;  1EQT A;  4DV6 L;  1I4Q A;  3GTJ B;  4A3J B;  4A3G H;  4ALP A;  5KND A;  4PV1 C;  4YWK A;  5KEE A;  4WRD A;  1GVP A;  4HSV A;  1C9O A;  4JI8 Q;  3J81 i;  3SGI A;  3J80 c;  3RLN A;  2R61 A;  5JJL A;  4CBV A;  1XYI A;  1X55 A;  1K73 C;  2UXD L;  1STH A;  4L5Q A;  5M5X B;  3HOY H;  1PYS B;  1VQG A;  1LV9 A;  1BQQ T;  1QG7 A;  4GN3 B;  1R4Q B;  3SK8 A;  1M1K C;  2MQH A;  5E3F A;  4BA1 I;  1VMP A;  1MGS A;  1GHK A;  3SK5 A;  2NVY B;  5EQ0 A;  3CC4 A;  4JBJ A;  3F2B A;  1FD7 D;  5IOC A;  1CT1 D;  3W3A A;  1N8R C;  1FR3 A;  1FYC A;  1JOQ A;  2CVR A;  3ULL A;  2MP1 A;  2JA8 H;  4JI1 Q;  1DCZ A;  5IGG A;  4FF4 A;  3S2D B;  1TWA B;  3RD4 A;  4C3H H;  5KNB A;  2JA5 G;  2D5D A;  1I3Q H;  2SOB A;  1D1I A;  1E1T A;  1TWF B;  3GO5 A;  4IFD J;  4A3F G;  2F0T A;  2K5H A;  4Z9C B;  5JPM C;  1LAB A;  3VA7 A;  3A8J E;  1I4H A;  5D3I B;  1LM0 A;  1CZW A;  2FXQ A;  2DY7 A;  2WAQ G;  3U4Z A;  5I2Y A;  2E2J B;  1NSN S;  3S2D H;  3OMG A;  2IX0 A;  1HJP A;  1L0Y B;  5IWA Q;  1TWC H;  5A2Q L;  3OIQ A;  1WTO A;  4BS9 A;  4B3T L;  3OPO A;  2Q2U A;  2Y0S B;  4BXX G;  3KF8 B;  4ME3 A;  4V0B A;  3MEH A;  3HOU H;  1N32 L;  1HXY D;  5EPL A;  5IE8 A;  1B7Y B;  2E76 C;  3CRK C;  5C0X I;  1M90 C;  1DD2 A;  1QNU A;  3CAM A;  3M4O B;  1V1P B;  1EOT A;  1P8L A;  1ZXT A;  2QF7 A;  3QB3 A;  1IBM Q;  1DOK A;  3G4S A;  4BY7 G;  4BBS H;  1C4Q A;  4DR3 L;  3K6O A;  4P73 A;  3ZJY C;  1Y1W H;  3KBX A;  1V1P A;  1HZB A;  3IAY A;  1K3B C;  4PMB A;  3S14 B;  4C1N K;  2NTT A;  4DV5 Q;  1CA6 A;  1I3Q B;  1P16 A;  2VY3 A;  2K5N A;  3HKZ G;  4X3K A;  3HRZ C;  2CKZ B;  2LXJ A;  4A3E B;  2XN9 C;  4DR3 Q;  3RLF A;  3FP9 A;  4FDB A;  1YNX A;  4OIJ A;  3HKZ B;  3SK6 A;  5C4X B;  4OEM B;  2R93 B;  3HOZ G;  3AB9 A;  1Q7Y C;  1IBM L;  1RKN A;  1UEA B;  4P74 A;  1TQO A;  1QVF A;  1PTO H;  3Q24 A;  1STG A;  1ASZ A;  5AFW A;  2EXZ A;  1NNX A;  2F3V A;  3RR5 A;  5FKA C;  2KED A;  2XIW A;  1VQB A;  2AQ2 B;  4OWX B;  2A8V A;  3NTH A;  3AEV A;  3F8T A;  2RCF A;  1LYL A;  4QUC A;  4TKO B;  1Y14 B;  5T1G A;  3MEF A;  3VDY A;  2JXM B;  3CC2 A;  3HOW G;  1JE4 A;  1N9W A;  5C0X H;  2AQ1 B;  1N34 L;  2F0D A;  3F2U A;  2F0L A;  1O7Z A;  3QO2 A;  3I4M G;  3U9S A;  1PH4 A;  5IP7 G;  2VB3 X;  4HJ9 A;  1JC7 A;  4DR6 L;  1BR9 A;  2ATW A;  2QA4 A;  2N78 A;  1XMQ Q;  1X3F A;  3NEN A;  3GV3 A;  4ZRZ A;  1K8G A;  4LF7 Q;  4PZ7 A;  4XQN A;  1CK1 A;  3I70 A;  3GTM B;  3I73 A;  4LAA A;  3KDF A;  1VQM A;  1D5X C;  5C3E H;  1PH2 A;  1KDA A;  1PVO A;  4GOP B;  2F3W A;  1T5X D;  3MWY W;  2ES2 A;  1H9K A;  3A8I E;  3I56 A;  1DOM A;  2LS0 1;  3TRE A;  5IP9 G;  1MJC A;  2B2Y C;  1M4V A;  1PRT B;  5CBA E;  1EYG A;  2L5T A;  1U4R A;  3CQZ H;  4A4I A;  4KKT A;  4JI6 Q;  4TQU S;  2BE5 C;  4KD3 A;  1GUG A;  2RF4 A;  4DNR B;  1IZ6 A;  3PIP 3;  3J7A V;  1LTB D;  4RGO S;  1I6H B;  3BYT B;  4J6H A;  3CPF A;  5IYC G;  4JI8 L;  1SMX A;  1HZA A;  4YCV A;  2ZXP A;  1GJX A;  1U9R A;  2CWP A; 
#chains in the Genus database with same CATH homology
 1OTC A;  5LMN L;  3S1R H;  2K52 A;  2Q2T A;  2WFW A;  2K5V A;  5C4X G;  1CSQ A;  4JBK A;  3KYH C;  4QL5 A;  1D8L A;  3CCU A;  1J5E Q;  4P71 A;  3HOZ H;  3DLL A;  3K80 C;  4DUZ Q;  3HOY G;  2JA8 G;  3PO2 G;  1Y1V H;  3J7Z C;  1QVC A;  3U4V A;  1EQQ A;  1S72 A;  1B70 B;  3DM3 A;  4BA2 I;  4IFD J;  1XPR A;  3Q8D A;  5IY0 A;  2JA7 G;  5IYB G;  5M3M G;  4A3J H;  3M7N A;  4IO9 A;  4HIO A;  2CCZ A;  3A74 A;  1I6H H;  4NXN Q;  1E7Z A;  1EIF A;  4GS3 A;  3PO3 G;  1CKO A;  2MFI A;  1PH3 A;  1KL9 A;  3GTO H;  3CCQ A;  4JOI A;  2JEB I;  4A3D H;  4JI5 Q;  2LSS A;  4DV5 L;  1NJI C;  1X56 A;  4HJ7 A;  2R7Z H;  4A93 H;  1YI2 A;  4JI4 L;  1YBY A;  1L2F A;  1PH5 A;  2KEN A;  2WB1 E;  3ULJ A;  3H0G G;  3GTJ H;  4DV1 L;  1XJV A;  1WFQ A;  2OTL A;  4BY7 H;  1E24 A;  2KCT A;  4YWL A;  1PHJ A;  4Y52 H;  2DUD A;  4A3E H;  1AH9 A;  1VQ7 A;  2A19 A;  4DR4 Q;  3T1Y Q;  4A76 A;  2JA7 H;  4GLA C;  4AYB E;  5IYC H;  1XPU A;  5HY6 A;  1Q86 C;  4HIM A;  1EWI A;  2UXC L;  1HNW Q;  1UE1 A;  4DKA C;  1Q1E A;  4X66 L;  1VQK A;  1WCM G;  2NVT H;  3G71 A;  2I5H A;  2QGQ A;  4BY1 G;  5ELN A;  4K0K Q;  4PZ6 A;  4DV2 L;  2B29 A;  1NE3 A;  1Q1B A;  4JV5 L;  4EQ5 A;  3CCR A;  1C7Y A;  1E3P A;  4B3M L;  4BXX H;  3STB C;  3JAM c;  4NXM L;  3A5U A;  5GAD C;  2YTY A;  4JYA Q;  2GVB A;  3HKS A;  3NEL A;  1YJW A;  4IFD G;  1W2B A;  1N32 Q;  2R7D A;  3A0J A;  1VQL A;  1KD1 C;  5LMN W;  2B63 G;  3F1Z A;  4B3T Q;  4B3S L;  3WWV A;  2YU9 H;  4NPS A;  5IWA L;  2UUA L;  1YJ9 A;  3STB D;  4OWW B;  3PV0 A;  1FJG Q;  2VS1 A;  3CCJ A;  4JI2 L;  1KIX A;  3D0F A;  1DGS A;  2E2J H;  3KJP A;  1SR3 A;  1I5F A;  5IYB H;  3HKZ E;  1K3R A;  5HGQ A;  3PF4 A;  1JB7 A;  1V9P A;  3S17 H;  2VZA A;  3F2D A;  4KHP L;  1KXL A;  3GTK H;  3S1N H;  3AFP A;  3S2H H;  1T9H A;  2AMC B;  1OXU A;  1PV4 A;  4PMW A;  3M4O H;  1SFO H;  3KOJ A;  4DPG A;  3LGJ A;  1SN8 A;  4GOP C;  4XIG S;  1HH2 P;  5C4X H;  2R92 H;  4UP8 A;  2ZTD A;  5M3F H;  2IX1 A;  4JI1 L;  4DV3 L;  4JI0 L;  2CFM A;  4IPD A;  4YHH Q;  1HNX L;  1R9T H;  4A3L H;  3GD7 A;  3UDX A;  3TS0 A;  4LF5 L;  1VQ6 A;  1SLJ A;  3K7U C;  3GTM H;  4LUO A;  5M5Y H;  4JI7 L;  2KBN A;  5JJK A;  3TS2 A;  1B8A A;  1KAW A;  1WOC A;  4A3C H;  3J81 j;  5FJ8 G;  2I5L X;  1YIJ A;  3UE0 A;  3H0G H;  4JC0 A;  1N36 Q;  2UUB Q;  4AQY Q;  2ID0 A;  1IYJ B;  1IBK Q;  1KRS A;  4DNI A;  4A3M H;  2HHH L;  4EX5 A;  4UPA A;  1TWH H;  4JBM A;  1VQD A;  1L1O C;  2WP8 J;  4QY7 A;  4L5T A;  3RN2 A;  2NN6 I;  1LTL A;  2YTV A;  1G29 1;  3D31 A;  3K7A H;  1VS0 A;  2MO0 A;  2NZO A;  4R4C A;  4JI3 Q;  2UXD Q;  2VQE L;  5M3M H;  4A3J G;  2N49 A;  2HHH Q;  1IBK L;  2CWA A;  4AQY L;  1U5K A;  2K75 A;  2R6G A;  1N36 L;  2Y0S E;  5M5W H;  4UP9 A;  4C3I H;  2ZTC A;  1NTG A;  1QZG A;  2R7Z G;  1K9M C;  4LF5 Q;  1CUK A;  1IBL Q;  2B3G A;  1X3E A;  3GTQ H;  2Q2H A;  1HNX Q;  2F52 A;  4DV3 Q;  4A3C G;  2YV5 A;  4IJL A;  4JBW A;  1VQI A;  4LUV A;  4LNQ A;  4QJF A;  4HJ8 A;  3EBE A;  1MJE A;  3I2Z A;  2L15 A;  2RHQ B;  4JOI C;  1K8A C;  3J80 i;  4IPG A;  5IT9 c;  4DV6 Q;  3U58 A;  4QGU A;  4APV A;  4KHP Q;  1RL2 A;  1JJC B;  3S14 H;  1JT8 A;  1VQ4 A;  3CP0 A;  2IHE A;  1Q8K A;  3I4M H;  3L2P A;  4R1J A;  3JC6 6;  4L5R C;  3BZC A;  1E1O A;  4A3G G;  2JE6 I;  3AYH B;  4JI2 Q;  1MIU A;  2OTJ A;  2HIV A;  2E8G A;  3M3Y H;  1EIY B;  5C44 G;  3KLW A;  2K50 A;  2ZTE A;  3K8A A;  1XPO A;  1N33 Q;  1NMF A;  1YVC A;  1K0R A;  2UUA Q;  4DR2 L;  1HR0 L;  1G6P A;  5C44 H;  1NMG A;  4B3S Q;  1HZC A;  5C0X G;  2R7F A;  1VQJ A;  4YCW A;  2I0Q A;  3GTL H;  2LXK A;  4IPH A;  3TEH B;  1VQC A;  2ZM6 L;  3S16 H;  4YWM A;  5BR8 L;  2PI2 A;  1RIP A;  2PNH A;  4C3J H;  4A3I G;  4NXM Q;  1VQ9 A;  3HOX H;  4LF9 Q;  2VNU D;  2IT1 A;  3PUV A;  4B3M Q;  4XTC S;  1UE7 A;  3GTG H;  1VQO A;  3T1H L;  1VQE A;  3AQQ A;  3CMA A;  4DUY L;  4JV5 Q;  2D0P A;  3E9H A;  1FGU A;  2MO1 A;  4BBR G;  4X64 L;  3CCV A;  4DV2 Q;  4A75 A;  4A3E G;  4PZ8 A;  1I94 L;  1TXY A;  1J6Q A;  1VQN A;  2ZJQ A;  1JE5 A;  1I94 Q;  2D62 A;  4H02 A;  2PQA A;  1Q46 A;  1HNW L;  2D0O A;  4X64 Q;  4MZ9 A;  3W1G A;  3CCS A;  1Q82 C;  4DUY Q;  5FLM G;  3IRB A;  4A93 G;  3T1H Q;  3T1Y L;  3CME A;  4GN4 B;  3L7Z C;  4DR4 L;  5IP7 H;  5C3E G;  2V1C C;  3HFZ B;  3PUW A;  4LF9 L;  3S24 A;  3CF5 A;  3CCM A;  5BR8 Q;  4GOP A;  1X9N A;  1QZH A;  2ZM6 Q;  3I4N G;  1YHB A;  4IFD I;  4BBR H;  4KLK A;  1V1Q A;  3TQY A;  3W5O A;  5JEA J;  4JI4 Q;  1LUZ A;  3CPW A;  1YHA A;  4JI5 L;  5JJI A;  3PGZ A;  4R4T A;  2PMZ E;  3KF6 B;  4R4O A;  1CKN A;  2JA9 A;  5M5X H;  4DR2 Q;  3L0O A;  1FVI A;  1HR0 Q;  3GTP H;  1C0A A;  1OXX K;  1N33 L;  1WCM H;  2HIX A;  3PIO A;  2OQK A;  1OXS C;  2B63 H;  4IJH A;  4GLV B;  3CD6 A;  1UE5 A;  1ASY A;  1X65 A;  3PO3 H;  1AE3 A;  2AHO B;  4POF A;  1BKB A;  2RCN A;  4A3F H;  3PUX A;  1NY4 A;  4DUZ L;  2Y0S G;  2ALY B;  2GVA A;  4DV6 L;  2Q2I A;  2JK8 A;  3UE1 A;  3BZK A;  4A3G H;  4ALP A;  1PH8 A;  4JCV E;  4HIK A;  3E0E A;  3CXC A;  4YWK A;  3B6Y A;  5IYD G;  1GVP A;  2AWN A;  1IBL L;  1C9O A;  4JI8 Q;  4YY3 L;  4LFA L;  3NBH B;  3H3V H;  3J81 i;  4BBS G;  1UEB A;  3SGI A;  1GKH A;  1A62 A;  2XGT A;  4QQB X;  4NB3 A;  3J80 c;  1XNQ L;  3RLN A;  4DR7 Q;  4DR1 Q;  2AWO A;  5IP9 H;  2OCE A;  1EOV A;  5JJL A;  1E22 A;  4IPC A;  3RZO H;  1X55 A;  3I4O A;  3S1Q H;  1D7Q A;  1OXV A;  2Z6K C;  3FKI G;  4YCU A;  1K73 C;  1AE2 A;  2VQE Q;  4HJA A;  2UXD L;  3M9B A;  4L5Q A;  1L1O A;  3HOY H;  1PYS B;  2NVY H;  1VQG A;  4JI3 L;  3UDG A;  2KHI A;  2K4K A;  3U50 C;  2Z6K A;  4GN3 B;  1M1K C;  3KFU A;  2MQH A;  4DV0 Q;  3G6E A;  4BA1 I;  3PIP A;  2VW9 A;  1KC8 C;  1PYB A;  4LF6 Q;  3CC7 A;  2ASB A;  2BH8 A;  4LUZ A;  3PUY A;  3HOV H;  3S15 H;  2XTI A;  4A3B G;  1PFS A;  1TWG H;  2UUB L;  3CC4 A;  4JBJ A;  3F2B A;  4LF4 L;  3J7A 5;  1YIT A;  4JI7 Q;  5M3F G;  1HR0 W;  1A8V A;  3HOX G;  1N8R C;  3KF6 A;  2R92 G;  1YZ6 A;  1VQ8 A;  3ULL A;  4B3R L;  4YHH L;  1Y1W G;  2JA8 H;  3PO2 H;  4JI0 Q;  4JI1 Q;  1IXR A;  2EQS A;  4A3M G;  5DLQ E;  4DK6 C;  2HQL A;  2A1A A;  2VQF L;  2F4V Q;  2JEA I;  4WJ3 M;  3E9I A;  3M85 A;  4C3H H;  1G51 A;  2JA5 G;  1BBU A;  1I3Q H;  1VQP A;  3W1B A;  1E1T A;  4X6A H;  4P75 A;  4RG1 A;  4POG A;  1WJJ A;  3GO5 A;  4A3L G;  3NEM A;  4A3F G;  2K5H A;  3K81 C;  2IHF A;  2VL6 A;  3OTO L;  1FL0 A;  4QIW E;  3KJO A;  1TWA H;  2H5X A;  1LM0 A;  2FXQ A;  4TVA B;  3ER0 A;  1KQS A;  4LF8 Q;  2WAQ G;  4AH6 A;  1FJG L;  4KI0 A;  2GN5 A;  1CKN B;  3U4Z A;  1X54 A;  3S2D H;  2IX0 A;  1HJP A;  4OX9 Q;  5IWA Q;  4PG3 A;  2N3S A;  4DAM A;  1TWC H;  2JQO A;  4GLX A;  3G48 A;  4L5S A;  4B3T L;  3HOU G;  1EFW A;  2Q2U A;  1QUQ A;  5GAE C;  1XTD A;  1Z9F A;  4BXX G;  1GD7 A;  3KF8 B;  3I55 A;  4DV7 Q;  3I4N H;  4ME3 A;  3HOU H;  1GO3 E;  1N32 L;  1BBW A;  4MTN A;  4RMF A;  2NVQ H;  3S1M H;  3GDE A;  5IYD H;  3TRZ A;  4JYA L;  3ERS X;  5IE8 A;  3ICE A;  4DV4 L;  4A3I H;  4HJ5 A;  1B7Y B;  2JA6 H;  1QUQ B;  1TWF H;  3M4P A;  1CKM A;  5C0X I;  3KDF B;  1A0I A;  4LWC A;  5E7N A;  2PQA B;  3CCL A;  5AJ3 Q;  1I50 H;  2AKW B;  1VQF A;  3ULP A;  4K0K L;  1SRU A;  1M90 C;  3CAM A;  1L1O B;  1MKH A;  2RHS B;  4MNO A;  4OO1 I;  1P8L A;  1YEZ A;  4X66 Q;  4LFC L;  1IBM Q;  4X65 L;  1JJ2 A;  3HOV G;  1Q81 C;  4A3B H;  5GRO A;  2UXC Q;  2IY5 B;  3G4S A;  4BY7 G;  1WYD A;  4BBS H;  2JA5 H;  5LMU Q;  3RNU A;  5H1S E;  4DR5 L;  3JAM i;  3H15 A;  2UUC Q;  4LFB Q;  4DR3 L;  2BA1 A;  1XNR Q;  4P73 A;  2UU9 Q;  1KHI A;  5J3B A;  2HT1 A;  2QEX A;  4GNX A;  3ZJY C;  1Y1W H;  4AIM A;  4IOC A;  5EAY A;  1PH6 A;  2E5L L;  1HZB A;  2N8N A;  4DV1 Q;  3FKI H;  1XMO L;  3OW2 A;  3RLO A;  4R4Q A;  2R93 G;  1NBW A;  1XMO Q;  2BA0 A;  1L0W A;  4DV5 Q;  3H3V I;  3F2C A;  1P16 A;  2YTX A;  2E5L Q;  2VY3 A;  2K5N A;  3HKZ G;  3K0X A;  1SRO A;  2CKZ B;  2LXJ A;  4UP7 A;  2UU9 L;  1XNR L;  4DR3 Q;  4NXN L;  3RLF A;  3FP9 A;  4LFB L;  1YNX A;  4FDB A;  4P72 A;  3PSI A;  1VQA A;  4GNX C;  4DR5 Q;  2NVX H;  5LMU L;  2UUC L;  2ZJP A;  3HOZ G;  1JJG A;  3AFQ A;  4JG2 A;  2Z0S A;  2MNA A;  4X65 Q;  1Q12 A;  1Q7Y C;  2I5M X;  1IBM L;  4LFC Q;  4P74 A;  3BU2 A;  1VQH A;  1QVG A;  1QVF A;  1O7I A;  1J5E L;  1K83 H;  1ASZ A;  4OO1 G;  5AJ3 L;  4UY8 C;  4LW1 A;  3RR5 A;  1VCI A;  2C35 B;  1X6O A;  1PA6 A;  1EQR A;  3PF5 A;  2OWO A;  1BVS A;  3I7F A;  4GNX B;  2ZJR A;  1VQB A;  5LMN Q;  2R93 H;  2YYZ A;  4DV4 Q;  4OXP A;  4OWX B;  1YHQ A;  2VUM G;  2A8V A;  4R4I A;  3AEV A;  2E2H H;  3F8T A;  1PH9 A;  1LYL A;  3RN5 A;  4DV7 L;  1Y14 B;  2DGY A;  3MEF A;  2JA6 G;  3MXN B;  5FLX c;  3VDY A;  3CC2 A;  3HOW G;  3EIV A;  1N9W A;  5FJ8 H;  1U0L A;  1HNZ Q;  3A5Z B;  3UDI A;  4OX9 L;  1W3S A;  1N34 L;  4JI6 L;  3M4Q A;  1IL2 A;  4WJ4 A;  4A3K H;  4LF8 L;  3HOW H;  2F3I A;  1JMC A;  3I4M G;  4GKK L;  1UWV A;  4AYB G;  5IP7 G;  5GAG C;  1PH4 A;  5K36 G;  3PCO B;  3OTO Q;  3UDF A;  4HJ9 A;  1PH7 A;  4DR6 L;  1VQ5 A;  4GKJ L;  2ATW A;  2QA4 A;  2N78 A;  1XMQ Q;  2PI2 E;  4O0A A;  4OON A;  4KHZ A;  1X3F A;  3NEN A;  4X62 L;  2E2I H;  2NN6 G;  1K8G A;  3EN2 A;  2NZH A;  2VQF Q;  4PZ7 A;  4LF7 Q;  2F4V L;  2UXB L;  1KRT A;  1S40 A;  4DK3 C;  4B3R Q;  1CSP A;  3RZD H;  2UXB Q;  3OYY A;  1HZ9 A;  1V43 A;  5GAH C;  4LF7 L;  4IOA A;  3KDF A;  1VQM A;  1WI5 A;  1PH1 A;  1OXT A;  2KHJ A;  1UE6 A;  1X3G A;  5C3E H;  1PH2 A;  4LF4 Q;  4X62 Q;  4A3D G;  1PVO A;  4GOP B;  5FLM H;  1GM5 A;  4DAY B;  1XMQ L;  2VUM H;  2ES2 A;  3BJU A;  2K14 A;  2WAQ E;  5JEA G;  4DR6 Q;  4J15 A;  4GKJ Q;  3I56 A;  5IP9 G;  3TRE A;  4A3K G;  4LF6 L;  1S3O A;  1EUJ A;  3J81 c;  5C0X J;  2EIF A;  1MJC A;  1SE8 A;  2EXD A;  4DV0 L;  4GKK Q;  1H95 A;  3CCE A;  5GQO A;  4HID A;  1EYG A;  2CQO A;  4Y7N H;  5ELO A;  3CQZ H;  4OWT B;  4A4I A;  1Y1V G;  3FHW A;  4JI6 Q;  1N34 Q;  4BY1 H;  5C4J H;  4TQU S;  4GN5 A;  2RF4 A;  4DR1 L;  1HNZ L;  1IZ6 A;  1XNQ Q;  4DR7 L;  2KCM A;  4O2D A;  1A63 A;  2WB1 G;  2OQ0 A;  2JJQ A;  3CW2 C;  3PUZ A;  3CPF A;  5IYC G;  4LFA Q;  1SMX A;  4JI8 L;  4YY3 Q;  2BH2 A;  1HZA A;  4YCV A;  1YJN A;  4C2M H;  2CWP A;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...