3HOZG

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hozG01
1N36L 1Q86C 1QVGA 4TQUS 1MJEA 3AQQA 5C0XI 1QVCA 2I5MX 3I56A 4JI3L 3PO3G 2MO0A 1IL2A 2IX1A 3M4QA 4JI8L 1K9MC 4IOAA 2MNAA 3RNUA 2CFMA 1IYJB 3DLLA 2QA4A 4LF8Q 2EQSA 1EFWA 3KF6B 5JJLA 4ME3A 4LF7L 4JI7L 1H95A 1N34L 2UXBQ 1FGUA 4Y52H 3UDXA 3A5UA 3KOJA 4DNIA 2UUAQ 4TVAB 3D31A 2VQEL 2NVTH 4LF9L 4A3IH 3PCOB 1WYDA 4DUZQ 4JI1Q 2WFWA 2ZTDA 1KAWA 1VQIA 2YU9H 2D62A 3S1QH 2Q2TA 2N49A 1K8GA 4LF4Q 4NXNL 4GOPB 2ALYB 4X64Q 2R7ZH 4UPAA 1XMOQ 3TS0A 4UY8C 1VQOA 1EIYB 4BY1G 2JA7G 1G291 4H02A 3CMEA 4IO9A 4DR1L 4IPGA 4AYBE 3K7UC 1A63A 2UUCL 3AFQA 2WP8J 3HOYH 4BBSG 2JA6H 1QUQB 4YHHQ 2RHSB 2NZOA 3G6EA 1K73C 1U0LA 3J81c 2R7ZG 4DV6Q 2JA8H 2F4VL 1N32L 2WAQE 1YEZA 2H5XA 2JJQA 1IBML 1HNXQ 1RIPA 1V9PA 2K52A 4DV1Q 1IBLQ 4BA1I 4GNXA 4R4CA 1CKOA 5C4XH 2ATWA 2UXDQ 2NN6I 1UE7A 4BBSH 3JAMi 5JEAG 4GS3A 3FKIG 2HIVA 3RN5A 2JEAI 3A0JA 1E1OA 1VQKA 1MIUA 4X62L 4POFA 2K5HA 2UXCL 1NTGA 3RLOA 2F52A 3KLWA 1X56A 1GVPA 3S1NH 1PYSB 4LFCL 3K81C 3OTOL 1YJNA 4B3TL 2N78A 4BXXG 3CD6A 3CCUA 1S40A 1J6QA 5GROA 1I94Q 3J80c 4DR3L 2IY5B 2A19A 1PH9A 4L5QA 1VQ6A 5IYCG 3KDFA 1X3FA 2GN5A 5LMNQ 4GKKQ 2KENA 4GOPA 1K0RA 4J15A 1EQRA 3U4VA 4L5RC 1JJ2A 5AJ3Q 3W5OA 1Q1BA 3CCLA 4A3LH 1VQGA 1XMQQ 2E5LQ 3AFPA 3EN2A 4DK3C 1VQ9A 5M3FH 5IYCH 1N33Q 1S72A 1HJPA 3JC66 4OXPA 3H3VI 4HIOA 1GKHA 4B3MQ 3L2PA 1JT8A 2BA0A 2EXDA 4YCWA 1Q1EA 1VQEA 2YTXA 3AYHB 4YHHL 4DV3Q 1WJJA 4JI0Q 4DV4L 4A3CG 2R7FA 3H0GG 3J81j 3HOUH 5IYBH 5IP9H 1YI2A 1IZ6A 1L1OC 4A3DH 2R93G 3ER0A 3RZOH 4DR2Q 1ASYA 4FDBA 5GQOA 4X64L 4JBJA 2ID0A 4A3KG 3I2ZA 4NXNQ 1QVFA 1VQ7A 4WJ4A 2VUMH 1CKNB 1EWIA 2QEXA 2OQ0A 4DR2L 2NVXH 2JA8G 1EIFA 4IPCA 3HOVG 4C3IH 1C0AA 3E9IA 3PIOA 4LF9Q 1WCMH 1KD1C 3G4SA 1SMXA 4JBKA 2CCZA 4A3GG 4C2MH 4DV4Q 3U4ZA 1PVOA 4JI2Q 3CQZH 2ZJQA 3A74A 5JJKA 4Y7NH 4LF7Q 3GTPH 3HOWG 2R6GA 2Z0SA 3K0XA 3KYHC 3EBEA 4BBRG 3G71A 4A3EH 2ES2A 4LF8L 1B7YB 1VQ4A 2I0QA 3HKZG 1X54A 2D0OA 2VY3A 2OQKA 5HY6A 1OTCA 2JA6G 5IYDG 4MZ9A 4A93G 3CCQA 2R7DA 3I7FA 3FKIH 2JK8A 5IWAQ 4C3HH 1IBLL 2I5LX 1CKMA 2E2HH 2K14A 3SGIA 1PFSA 1OXXK 4OWTB 4B3SL 4A3MG 5IT9c 3CP0A 1XNQL 2HIXA 2MQHA 5FJ8G 1V43A 1PH2A 5IYDH 4A93H 3GTLH 4LUOA 1B8AA 1HZAA 1SR3A 2HQLA 4QIWE 2XTIA 4DKAC 2VQFQ 4OO1G 3LGJA 3NELA 3M7NA 2LXKA 3OTOQ 4LF5Q 4B3TQ 4JG2A 2JA9A 4BBRH 3WWVA 4A3EG 1E7ZA 1VCIA 2ZTEA 3PGZA 5IP7G 2MO1A 3PF5A 4EX5A 1VQJA 4NXMQ 1JJGA 1E22A 1N8RC 4GN4B 1Q81C 3CMAA 3ULPA 1PH1A 1IBKL 4A3DG 2E2IH 5C3EG 3RR5A 4JOIC 4YCVA 4JBWA 1P16A 4OWWB 4GLVB 1YBYA 2UXDL 1WFQA 1E1TA 1Q12A 1L1OA 4DV1L 1SN8A 1T9HA 2DUDA 1PH7A 1HNXL 1CSPA 3F1ZA 1YNXA 1X3EA 5LMUQ 1VQHA 2GVBA 3MXNB 2AHOB 4JI4L 4K0KQ 5DLQE 4DV6L 1PH6A 3M4PA 1XPOA 1QZGA 1XNRQ 1K3RA 4R4QA 1OXTA 1VQ8A 4DV2Q 1VQ5A 1TWHH 4DV5L 4DR7Q 1SROA 4GN3B 4IFDJ 1LUZA 3CPFA 4A3LG 1OXSC 1VQAA 4C3JH 4AIMA 2B63G 2UUCQ 1HZCA 4IJLA 4HIKA 4DR1Q 3BU2A 5E7NA 1VS0A 3TRZA 5LMUL 1XMOL 2RF4A 1WOCA 2CWPA 3UDIA 4BXXH 1HZ9A 4YWKA 4YY3Q 2LXJA 1K8AC 4QJFA 1EYGA 3GDEA 1HNWQ 4A3BH 3K7AH 4BY7H 3F2CA 4DUYQ 4R4OA 3TEHB 1FJGL 1Z47A 5JEAJ 3PO2G 4MTNA 1N9WA 4NXML 4DAMA 5C44G 1Q8KA 3I4OA 1SFOH 3GD7A 4LF4L 4B3RL 4LF5L 4R1JA 2I5HA 1Q7YC 4KHPL 1YHAA 4A3FG 1B70B 1XPRA 1HH2P 4JI7Q 2UUBL 4IJHA 3I4NH 4HJ8A 4NPSA 3S14H 1NMFA 1U5KA 4RMFA 4HIDA 2LSSA 2CKZB 3K80C 5ELNA 1PA6A 1BBWA 2E8GA 4QL5A 4A3CH 1RL2A 3L0OA 3RLFA 5IWAL 1A0IA 2IHEA 4JC0A 1X3GA 3A5ZB 2Q2HA 2B3GA 2N3SA 2VS1A 3F8TA 4PZ6A 4DK6C 3H15A 4R4IA 1YITA 1JMCA 3ICEA 3I4MH 1KHIA 5BR8Q 1M90C 1PYBA 4JI5L 4JOIA 4IOCA 1NE3A 2EIFA 2KHJA 4AH6A 3HOXG 2Q2IA 1YJ9A 2UUBQ 3U58A 2VNUD 2PQAB 1P8LA 1JE5A 4XTCS 1K83H 5EAYA 3F2BA 1KXLA 4IPDA 4JI2L 4A4IA 1O7IA 4GLAC 5C4JH 4B3RQ 4KHPQ 3CC4A 1BBUA 3PUZA 3T1YQ 1QUQA 3G48A 4A3IG 4WJ3M 2PNHA 2VL6A 3HOYG 5HGQA 2PI2E 5M3MH 2Y0SE 3J80i 3PV0A 3CAMA 3J81i 5GAHC 3KJPA 2Y0SG 3KDFB 2JE6I 1HNZQ 4YY3L 1XPUA 3CW2C 1SE8A 4GKJL 2KBNA 4A3MH 1D8LA 2ZM6Q 4AQYQ 2HHHQ 1YHQA 3RN2A 2BH8A 1Y1VH 4PMWA 3NENA 2KCTA 4DR6Q 1FVIA 3STBC 1LTLA 3ULJA 3W1BA 3NEMA 1ASZA 3CCJA 1G51A 4YCUA 1PH3A 2HT1A 5FLMG 1PV4A 2UU9Q 3S17H 5IP7H 4X6AH 4DV5Q 3GTOH 2K5VA 1R9TH 4JBMA 5K36G 3B6YA 3IRBA 3ZJYC 1BKBA 1Q82C 4K0KL 4HJ9A 1KL9A 3T1HQ 4LF6L 3CXCA 4OO1I 3U50C 4LNQA 1VQCA 1PH5A 4X65L 1N33L 2VW9A 1J5EL 3W1GA 2AKWB 4KI0A 2GVAA 5M5YH 3OW2A 5GAGC 2R92G 1PH4A 1XMQL 3KJOA 4LUZA 2E5LL 3I4MG 5JJIA 3CCRA 2OCEA 1L1OB 1HR0W 2ASBA 3UE1A 1IBKQ 5IYBG 5H1SE 3HOZH 1WI5A 4KLKA 3UE0A 4JI6Q 2NN6G 3J7ZC 4IFDI 1YJWA 4O0AA 4DR3Q 3UDGA 1I94L 2RHQB 1LM0A 2IX0A 4DV0Q 4OWXB 4LFBQ 3GTQH 1TWFH 3HKSA 2WB1E 2DGYA 2JEBI 1GO3E 4LFCQ 2VQFL 3PO3H 4LW1A 4P72A 2IT1A 1JB7A 2JA5H 4YWLA 4X62Q 1KRTA 3RZDH 4JI6L 3OYYA 2NVYH 1I5FA 3PUWA 4B3SQ 1A62A 5IY0A 5C44H 1YIJA 2K50A 1EQQA 2OTLA 2MFIA 3UDFA 2E2JH 2OWOA 3PO2H 3S2DH 3RLNA 3S1RH 2AWNA 3CCEA 3H0GH 4X66L 1W3SA 3S15H 4DR5L 4OX9L 3PUXA 1YHBA 4A3BG 4BY7G 1VQPA 1IBMQ 3CPWA 2KHIA 2JA5G 4JCVE 2F4VQ 1N32Q 4L5SA 1CUKA 2BH2A 1IXRA 1Y1WH 4A3JH 5J3BA 2D0PA 2Z6KC 3PUVA 4DPGA 2UU9L 3HOUG 3CCVA 1W2BA 3M4OH 3CC2A 5M5WH 3M9BA 4HJAA 2YTVA 4L5TA 4QY7A 1KQSA 3TS2A 3BZKA 5ELOA 4AYBG 4A3JG 3PF4A 1OXVA 3ULLA 4YWMA 2PMZE 1NY4A 4AQYL 4UP7A 1HR0L 4GKJQ 2OTJA 1AE3A 3E9HA 1EUJA 4LWCA 1HZBA 1Y14B 2R92H 1E3PA 5LMNW 1HNZL 2NZHA 3KF8B 4MNOA 2K5NA 3D0FA 2XGTA 2B29A 3GO5A 2YTYA 4GN5A 1HR0Q 4LUVA 3GTGH 2B63H 1I6HH 5FJ8H 4GNXB 1XJVA 4QQBX 2WAQG 3E0EA 3K8AA 3GTMH 3KF6A 2VQEQ 3JAMc 1AE2A 1SRUA 1S3OA 1UE1A 2PQAA 4OONA 1L0WA 2A1AA 4GOPC 2UUAL 1PH8A 1QZHA 2CWAA 2YYZA 5IE8A 1X6OA 4JI0L 4POGA 4IFDG 1X9NA 4DV3L 1I3QH 3S1MH 2KCMA 1N34Q 2UXBL 2YV5A 1OXUA 1TWGH 1PHJA 1Y1VG 1YVCA 4B3ML 2NVQH 4JI8Q 2L15A 4JI5Q 3GTKH 5BR8L 3L7ZC 5GAEC 1NMGA 1C7YA 4PZ7A 5FLMH 4DR5Q 4OX9Q 1UEBA 1X65A 3CCSA 2PI2A 4X66Q 3S24A 4A76A 4A3GH 3STBD 3PIPA 1N36Q 5AJ3L 4BY1H 2VZAA 3PSIA 3BJUA 5LMNL 1VQNA 4GKKL 4O2DA 1GD7A 2JA7H 1EOVA 3FP9A 1MKHA 2JQOA 2VUMG 1CSQA 1UE5A 4BA2I 1KIXA 2WB1G 4LFAQ 4P71A 4DV0L 3S16H 3KFUA 1A8VA 1NJIC 4JYAL 4LFBL 1JJCB 4DV7L 1VQLA 4DR4L 1LYLA 1Q46A 3HOZG 5C3EH 2UXCQ 1TWCH 5FLXc 1FJGQ 1UWVA 4DUYL 2CQOA 2Z6KA 4GLXA 4IPHA 3CCMA 1HNWL 1FL0A 4ALPA 1Z9FA 2V1CC 4HIMA 3M85A 4JV5L 4P74A 2A8VA 1VQBA 4NB3A 1VQMA 1J5EQ 3S2HH 4X65Q 2FXQA 3HOWH 3TQYA 1YZ6A 1KRSA 3MEFA 5C0XG 3T1HL 1GM5A 4LF6Q 4QGUA 5M3MG 4A75A 4XIGS 4HJ7A 2QGQA 3HKZE 3ERSX 1XTDA 2AWOA 4PZ8A 2Q2UA 3H3VH 4DR7L 4HJ5A 4DV2L 5IP9G 1NBWA 4PG3A 2ZTCA 1G6PA 5C0XJ 1XNRL 4DR6L 4JI4Q 3M3YH 2N8NA 5GADC 2AMCB 1AH9A 3Q8DA 4P75A 3HOXH 2ZM6L 2HHHL 2C35B 4A3KH 1C9OA 1Y1WG 1DGSA 1V1QA 3DM3A 3NBHB 4P73A 4UP8A 1SLJA 5M5XH 2ZJPA 2K4KA 3I4NG 4JV5Q 4R4TA 3EIVA 3I55A 2IHFA 2K75A 1VQDA 4JI1L 3AEVA 1VQFA 4DUZL 5M3FG 4UP9A 1M1KC 1WCMG 1CKNA 4DAYB 3HOVH 4DR4Q 4DV7Q 3T1YL 2BA1A 1I50H 1BVSA 4APVA 1KC8C 3J7A5 4RG1A 3GTJH 4JYAQ 4LFAL 3FHWA 5C4XG 1L2FA 1MJCA 1TWAH 3HFZB 4GNXC 1E24A 2F3IA 2RCNA 3BZCA 3PUYA 4A3FH 4KHZA 4EQ5A 1UE6A 3F2DA 1XNQQ 3CF5A 3TREA 3CC7A 4JI3Q 2R93H 1X55A 1D7QA 1TXYA 2ZJRA 3VDYA
chains in the Genus database with same CATH superfamily
3DUZA 5DLFA 4IR1A 3H0GB 1I3QB 4CHTB 1M4VA 4EQPA 3AQQA 3HG9A 5CV8A 4LH7A 4N9PA 2W6OA 3PO3G 3D4DA 3MVVA 1IL2A 2R84A 2K1BA 3M4QA 5KT6A 2MNAA 1EFWA 3KF6B 3H3VC 3R5HA 4JI7L 1H95A 2GPSA 5KFQA 2ZDGA 2B2YC 2NTSA 1JE4A 2LY7A 1RCVD 1SJHD 2UXBQ 3HBLA 5D14A 2UUAQ 2IL8A 2EY5A 4HEDA 2NVTH 2J6UA 3R8BA 3OIQA 3PCOB 1S5DD 1KAWA 2YU9H 5T14A 2D62A 1ZHSA 2QW7A 1FNWA 2ALYB 4GOPB 1WTVA 1DONA 5JUMA 4UPAA 2VA3A 1XMOQ 3TS0A 3DEPA 1RODA 2E2IB 1W93A 1UUPA 3OUZA 2M00A 4RWSC 4ZKBB 2QKIC 2F0PA 3DMUA 4IPGA 1A63A 1KC7A 2UUCL 2JYOA 4G4KA 1EOTA 3JSNA 2ASDA 2XRQD 3LMLA 2F0QA 5JVG3 4KKSA 4Y7NB 3EYYA 4DV6Q 2F4VL 2ALZA 2WAQE 4GC6A 4A3JB 1IBML 4H13C 3GTJA 4YBZB 1V9PA 1WCMA 4DA2A 2K52A 4KN7C 4DV1Q 3JAME 5C4XH 1CKOA 1G8ZD 4GNXA 2ATWA 2NN6I 1UE7A 2MHVA 4X62H 5KFTA 2C2EA 4JI0H 5DGAA 3V96A 4X62L 2K5HA 1HA5A 3NTKA 5JPNC 2UXCL 3OHXC 1NTGA 1GHJA 3KLWA 2VOBA 1GVPA 1II3A 5EOYA 3S1NH 1PYSB 3FDTA 3K81C 4LFCL 1Z2PX 2DPJA 4BXXG 3CD6A 4DK0A 4O4LF 1JOOA 2VPSA 2R7ZB 5IYCG 4X65H 4QWDA 4GKKQ 4FS2A 4GOPA 4J15A 1EQRA 5BN4A 1BCPC 2NU7B 3IL8A 3NBHA 4L5RC 5KG2A 2DY8A 3N6RA 1VQGA 1XMQQ 2E5LQ 5H80A 1B50A 2KSWA 4UCOA 3V4ZA 1SEBD 4Q5VA 1STYA 2FJZA 1S72A 4OXPA 3H3VI 1GKHA 3NXWA 4KV6A 4YQWA 2AQ2B 4TQSA 2PN1A 2N88A 1HTPA 4ZAIA 5IYBH 4C3JG 3I72A 4Z9CB 4A3DH 2R93G 3ER0A 1WTHA 3CU7A 3KUPA 5I9PA 2JN4A 4DR2Q 3A56A 2Y0SB 4JBJA 1B44D 3RZOB 4AYBA 2J4XA 2WAQA 2VUMH 4O3NA 2OQ0A 4DR2L 2NVXH 2JA8G 2VQFH 3N8DA 3R23A 1DCZA 2JA5A 1M7JA 2NVYB 5FOBB 4JBKA 3IN5A 4YP3A 3E3XA 3QOLA 3OSPA 2DJFC 3BA9A 4C1NK 4LF7Q 3GTPH 2R6GA 4DU9A 3MFIA 4MA0A 1VQ4A 4ED3A 4QUCA 2I0QA 3NWTA 2D0OA 2ZJTA 3F8NA 4A93G 4JI5H 2KCNA 3NP8A 3WO1A 4ZQIA 4RGTA 1STAA 1CKMA 3J81L 4BY1B 5IGDA 3SGIA 1PFSA 3OOCA 3MWMA 1BDOA 1V43A 5J39A 2NVTB 4DKAC 1HZAA 2HQLA 4QIWE 1W96A 3RJ0A 3CQZB 3NELA 4LF7H 2Z9HA 3KHGA 3GILA 1Y1VA 1E7ZA 1VCIA 2ZTEA 3PGZA 3C2PA 5C4HA 4NXMQ 1VQJA 3V05A 1EUDB 3HS0C 1JJGA 1PK8A 1Q81C 3CMAA 4A3DG 3NQTA 1PH1A 2PVPA 2E2IH 4Q44A 3RR5A 5CA1F 2AGPA 1P16A 1SNPA 4GLVB 3R2TA 1E1TA 4RZQA 2A6HC 4DV1L 2XWBB 4C56C 3RB6A 5J22A 5LMUQ 1VQHA 5KFDA 1DM0B 3VR2A 2W8KA 1EIGA 4DV6L 1CT1D 1PH6A 1OXTA 1S0MA 1PFNA 4DR7Q 1TWHH 1SROA 4GN3B 3QFFA 2RVLA 3I4MB 4AIMA 2UUCQ 1DOMA 1PRTD 2DY7A 2JA8B 4IALA 1VS0A 3TRZA 2HVQA 4LMYA 1DJRD 5LMUL 1XMOL 5KT3A 3T13A 4FF1A 4BXXH 1HZ9A 2YS7A 5I47A 3T5JA 3QG1A 4I50F 1ONLA 3LX0A 2Z1CA 3X3NA 5KFRA 1HNWQ 1J8IA 2BQUA 4BY7H 3TP7A 2FP4B 1XMQH 4HR7A 2E5LH 1F2LA 2A6HD 1GUTA 4JV2A 1EU3A 1SE2A 4K2LA 4Q0YA 5KKNB 4KMUC 4DR3H 3PO2G 4UCVA 4MTNA 4ED7A 4NXML 3FVQA 1SFOA 1Q8KA 2I5HA 1JORA 4DAPA 1YHAA 4KHVA 2B63A 1V1PA 4JI7Q 1N34H 3M9MB 2XN9C 3QWNA 2L9HA 1NCVA 5FPRA 1SNCA 1U5KA 3Q6SA 5J1ZA 2CQYA 2CKZB 3H91A 2NTTA 1KAAA 4DAVA 4RB1A 1BBWA 3M7GA 4JC0A 3MA2B 4PZ6A 1U9RA 1YITA 5J2UF 4QWCA 1M6VA 4LH6A 5EWGA 2AGQA 1ZEQX 1M90C 4ECUA 4JOIA 2HQEA 3VMMA 1LT5D 4RKBA 1F9PA 4XTCS 3F2BA 4ECQA 4IPDA 2SDFA 1CM9A 5FLXE 4KHPQ 4MA5A 2A74C 2OLSA 4F50A 1FNVA 5FO7B 1QUQA 3PW2A 2UXDH 1D2BA 1NUCA 1XYIA 4IZOA 2W8LA 5IOCA 5IWAH 5DM63 2FK3A 3J81i 5ISRA 5GAHC 3KJPA 4A3KB 1VDZA 3LWEA 3KDFB 3LWUA 1HNZQ 5CV5A 1SE8A 2WIIB 3KBGA 2HHHQ 1SCUB 2BH8A 3GTQA 3NE5B 3NENA 1STGA 1B1ZA 1XXGA 3STBC 1LT4D 4UDUC 5CV6A 3K59A 1RJQA 3CCJA 1PX2A 4MV6A 5FLMG 2UU9Q 3S17H 5IP7H 3S1RB 2C9OA 1XMOH 4ME5A 3T1HQ 3SK8A 3HOXB 3GIMA 3HKZB 4R8IA 1PH5A 4ODGA 1BBXC 2AKWB 1I4XA 1EWCA 2QCPX 1E0BA 3N42B 1TWFB 1CI3M 1N32H 3EPGA 3GTGA 1XMQL 2E5LL 4LUZA 1SMYD 4J9SA 3TZDA 3QR8A 3CCRA 4JW0A 1I4PA 1IBKQ 5IYBG 5E3FA 5KIXA 4IR9A 3MWYW 3UE0A 2NN6G 2BCOA 1YJWA 3DWQA 1PRTC 1LT6D 5JAVA 4DV0Q 5A2QE 3GTQH 1TWFH 3HKSA 4MHEA 1A15A 4LFBQ 4ME6A 4LFCQ 5LMNH 4HSPA 4LW1A 4P72A 3TN2A 4CKBA 1LTBD 1Z6HA 4YWLA 2J0TD 1KRTA 4X62Q 1C8CA 2SNSA 4JI6L 3Q8SB 2BE5D 2RCFA 1V1PB 4B3SQ 5IY0A 5C44H 5KFWA 2WTFA 1KABA 2MFIA 1G2SA 2E2JH 5D1OB 4LF9H 3S1RH 1B9MA 4X66L 5EWFA 2F0GA 4OEMB 4MTEA 1HCZA 3ERQA 1X32A 4B3MH 4HCEA 1IBMQ 4KTAA 2JA5G 4A93B 2F4VQ 5HBRB 1ESFA 4L5SA 1IXRA 5FO9B 5C5JA 1RK5A 2F0FA 1QJOA 2JEIA 5KFFA 4DPGA 5BN3A 3HOUG 3CCVA 1W2BA 2L0CA 1KLGD 1R9TB 4OHJA 5M5WH 4CDEC 4O3QA 1EY5A 1KQSA 3TS2A 2UVUA 2E74C 1AE3A 4QW9A 3FMAA 1K83B 4RB3C 1Q90A 4MNOA 1DXMA 3H20A 1BF4A 2K5NA 1GJXA 4GN5A 1N33H 2EYPA 3S2HB 5M5WB 2K05A 4LUVA 1WH2A 2B63H 3GIPA 1I6UA 2WAQG 3E0EA 3K8AA 3GTGB 2I8CA 2AGOA 3NUCA 3JAMc 1AP0A 2UUAL 1QNUA 1V4YA 4C3JB 5IE8A 2L1BA 2UXBL 4DV3L 3S1MH 1VMCA 2KCMA 1HNXH 1IHZA 3GTPB 4LFAH 2ZM6H 1Y1VG 2A6ED 2W6NA 5KFZA 3OPOA 4EGQA 2NVQH 4KN4C 2L15A 1Y1VB 1O80A 1HA6A 5FPOA 4H44C 5LA6F 5JQWA 1RD9D 4OX9Q 2DNEA 4ZOLF 5KX5F 1STHA 3S24A 3K5NA 4A76A 5D65A 2FB9A 5AJ3L 4UHVA 1MBYA 5IT9L 2B2UC 4O2DA 1EZ1A 4YAKB 3FP9A 2HDMA 1CQIB 1I4HA 2AUKA 2F0NA 2JQOA 3WOFA 3PIO3 5C1PA 1CSQA 1RJTA 1UE5A 4MTDA 4BA2I 2WB1G 4XYOA 1PVOA 3S16H 3KFUA 1A8VA 5M5XB 1NJIC 1HNZH 1X3QA 3K58A 5FK9C 1TWCH 5LL6S 2W70A 4PNYA 3VYRA 3SVMA 2F0TA 4IPHA 4DL4A 2RGRA 1I4RA 3H94A 2KHSA 5DEHA 1CA6A 4CC6A 1O7LA 4HIMA 4JV5L 5JH7F 5HGTA 4ECZA 1VQBA 4X65Q 2PZWA 5C0XG 4PQXA 3HOWB 1MGSA 1O7ZA 3V2TA 4C3HG 3MXUA 1KJIA 3HZXA 4APMA 4L1KA 4DV2L 1NBWA 1JICA 2XGPA 2B2WA 4FXGC 5T1IA 1CQJB 4LAAA 1GUOA 1TKWB 2EY6A 1C30A 1V1QA 4UP8A 1HFNA 2DLNA 5M5XH 2L11A 3I55A 4K5VA 4IFDH 4B9WA 2EYLA 3ETJA 3K5HA 4HR7B 4JI1L 3AEVA 4DUZL 3J80L 3D6CA 5M3FG 3C46A 5ELBA 1M1KC 4Q8EA 1WCMG 4DAYB 2ZXRA 5LOVF 2NUCA 4DR4Q 4UCTA 1EYAA 4N8X1 2LS01 4RG1A 4JYAQ 4LFAL 1H9KA 1DZ1A 1L2FA 2E75C 5CC4A 3S1QB 1E24A 3PUYA 5ELDA 1E4GT 4UCSA 1FNUA 4EQ5A 1UE6A 4ZYSA 1RYSA 2F0VA 4E4TA 3CC7A 1WD1A 1D7QA 2UUBH 4TUYF 2K01A 5CORA 4DR4H 1WTWA 1Q86C 3V4SA 1TY0A 2Z4IA 1S5FD 2KQ3A 2XIWA 1EY0A 5C0XI 2W6QA 5EKLA 4JI3L 1K9MC 2R82A 4IOAA 2QA4A 2IWHA 4LF8Q 4ME3A 1SYDA 5K5PA 4RKLA 3TP6A 1N34L 2HVSA 1QILA 3UDXA 3A5UA 2CH4W 1BQQT 5F2DA 2J9GA 1O78A 1K0SA 1LTAD 4LF9L 2L12A 3K3PA 2OT2A 1GSAA 1HXYD 3GV8B 5KFJA 1GOZA 1JDEA 3P75A 3RB0A 4IWYA 1VQIA 3S1QH 1BXRA 1ZYRD 2Q2TA 2HJWA 3A8KE 2RSOA 4FXDA 4CDCC 3M4IA 1WSCA 4NMZA 2WACA 1Y1WB 5F9LA 4XYQA 3SHLA 3CMEA 4DR1L 3P7JA 5KG1A 3AFQA 2R93B 3HOYH 4X3UA 4BBSG 1LLRD 2NZOA 1QB5D 5C5MA 3G6EA 3WNZA 2R7ZG 4C2MA 4MN3A 2B2TA 1YEZA 2H5XA 5KG0A 2D2CC 5C4XB 2B2VA 3P20A 1RIPA 3E5SA 2ICEC 4BA1I 4YR3A 2UXDQ 2WDTA 1GUWA 3JRXA 3JAMi 3OUUA 4GS3A 1PZID 2NVXB 3FKIG 1BCPF 1B33N 5CBAE 2HIVA 3KBXA 4ECSA 5EKKA 5EJWA 5LXTF 1N48A 1VQKA 2HGSA 1I3QA 5E4XA 5KFVA 4C3IG 3RLOA 3MAQA 3BQ0A 3OTOL 5C1OA 2PW7A 4PMCA 1EY8A 3J80c 5KFLA 4A3MB 2IY5B 2A19A 2FK1A 1CHPD 4L5QA 3BABA 3KDFA 1MSGA 1X3FA 5LMNQ 2YU9A 1NR2A 1D1IA 3U4VA 2B2YA 1YNJC 3CCLA 3Q24A 2R3ZA 2K5QA 3EN2A 4DK3C 3IFTA 3VR3A 4IUQA 5M3FH 3HOUB 5BMVF 1N33Q 4JI2H 1NAPA 2DIKA 5L1IA 3H09A 4HIOA 3R5FA 1KJJA 3L2PA 3LWBA 3TINA 4RUAA 4MTKA 1JT8A 5EPLA 1FGBD 4X3KA 2EXDA 1HTLD 1Q1EA 2YTXA 1AZPA 3AYHB 5ELCA 3BQ1A 3U9OA 2TMPA 3HOUH 4A3IB 1IZ6A 5KFXA 2BOSA 4DNRB 3RZOH 4IRDA 3J81E 4YY3H 1H9JA 4FDBA 4A3KG 2EJGC 3I2ZA 1QVFA 3PW5A 1VQ7A 2W7PA 1CKNB 1EWIA 2QEXA 1EIFA 1ICWA 3SEBA 4DL7A 1IYUA 5KYLA 4C3IH 3E9IA 3PIOA 4LF9Q 3M9NB 4DK1A 3KK7A 5KFCA 4GKJH 2CQAA 4C2MH 3U4ZA 3CQZH 1TA8A 1ILPA 1HRJA 3R5XA 5IIFA 3HOWG 2Z0SA 1SBBB 2WKDA 5DQHA 4BBRG 4LF8L 4OL7A 5K36H 1LV9A 1X54A 3HKZG 1WR2A 2AQ4A 1AW7A 2VB2X 2MGSA 2XCLA 1B53A 4B9XA 1OTCA 2JA6G 2R7DA 3BVGA 3VPCA 1YNND 1CA5A 1KNEA 3VR5A 1IBLL 2E2HH 4DR6H 5KFIA 2V9WA 5BPHA 1S10A 1OXXK 1ET6A 4A3MG 1AFPA 2MQHA 1RK6A 3L9AX 5IYDH 3GTLH 3OTOH 3HRZC 2XTIA 2QDLA 4JI4H 1DV1A 3K3VA 3LGJA 1HUMA 2OF1A 4DAYA 3MEHA 4JG2A 4B3TQ 1GYFA 4A3EG 4LF4Q 5IP7G 1Z2OX 3T5KA 1F9SA 3PF5A 1JKJB 2HVRA 4CKEA 1WTQA 1GXDC 4K8JA 5IODA 1B4OA 3O13A 2FJ2A 4NXMH 1PTOD 4YCVA 3BDCA 1SYFA 4IUTA 1M8AA 2I46A 1SN8A 1T9HA 2DUDA 3E6ZX 2FE3A 1HNXL 2KA7A 2DNCA 3AMUA 4K6DA 3KAJA 2CVRA 2KVMA 3H0GA 3PO2B 2YW2A 2EVBA 1FJGH 1K3RA 3DHQA 4R4QA 4DN4M 5KFYA 4ECWA 4DV2Q 4IFDJ 4KY5A 1A3VA 4CDFC 1HZCA 4HIKA 5EWEA 2K5DA 5KFPA 1CTMA 2F0JA 5E7NA 2M9VA 5KT5A 2MJ8A 1GUSA 2RF4A 1WOCA 4LK1C 1JWSD 3LNNA 4ZQ3A 2LXJA 3OWFA 1AEXA 1EYGA 1EQTA 1TWGA 2RDHA 3F2CA 2C2DA 1PFMA 1LTID 3AU7A 5NUCA 4MV3A 3IG0A 1I4QA 5KFNA 1RYRA 3TMEA 5I2XA 1WVLA 5C44G 3NK9A 3I4OA 1Q7YC 4A3FG 1B70B 2HD3A 2V4DA 1HH2P 3D8GA 1CFMA 4EEQA 2XCAA 5C6AA 3JRWA 4NPSA 2NBFA 4X66H 3S14H 1NMFA 3CRKC 4TQRA 2K5WA 3K6OA 2AQ1B 3K80C 3VYTA 4J9LA 1K8OA 3MWEA 1RHPA 2E8GA 2WV6D 4QL5A 2EE1A 4A3CH 4DK6C 3ICEA 4HMIA 2G5DA 1PYBA 2KJXA 4LF4H 3T5HA 3VA7A 2KHJA 1AZQA 4G57A 5C5LA 3PW4A 5HV6A 5EAYA 1TWCA 2W6PA 3MXNA 2YL2A 1W6KA 5KG3A 3CC4A 3T5LA 2FKLA 2FLPA 3G48A 4JI1H 2J7ZA 4ZKCB 1K83A 2PI2E 3EQLC 2Y0SE 4TKOB 3PV0A 4ID6A 3J80W 2Y0SG 1B2TA 2RKSA 1XPUA 3ETHA 1AN7A 1YNJD 1BOSA 4A3MH 3X3MA 2FMAA 1GSOA 2VXWA 5A2QL 4PMWA 4UCRA 4DL3A 3RBDA 5C3EB 2ATLA 3ULJA 3K0YA 3T51B 1C4QA 2M2LA 2B8GA 1G51A 1SYCA 5C4ZA 4G7ZC 1PH3A 1PV4A 4L6TB 4FYDA 4X6AH 2PYKA 3GTOH 3T1HH 3T1YH 1R9TH 3RAQA 5K36G 1TWAB 1E4EA 1BKBA 4HN7A 4HJ9A 1KL9A 4JPBW 1DYQA 3U50C 4IRCA 2BQRA 5KEEA 1J5EL 4KI0A 5DG7A 3OW2A 2VUMB 4FXKC 2F4VH 5GAGC 2BR0A 4IUUA 1U4PA 1PH4A 1EUCB 3K5MA 4Q0FA 4X3TA 3HXLA 1HR0W 1ZYRC 3HP3A 2Q8RE 3UE1A 3OSOA 5D8DA 5H1SE 1WI5A 4JI6Q 3J7ZC 1UNNC 1ET9A 2F0MA 2WYOA 1D5MC 2IX0A 1EQVA 5AFWA 4RB2C 3S1MB 2WB1E 2DGYA 1GO3E 3Q8RB 1CZGA 3PO3H 4GKKH 5FD5A 2UXCH 3TIGA 2IT1A 1JB7A 3RZDH 3U9TA 3GV3A 3OYYA 3RFCA 2NVYH 1I5FA 4C3IB 4O3OA 4DV7H 1I6HB 1L0YB 1A62A 1VF5C 1YIJA 3IKJA 2WB1A 3I73A 3PO2H 4DV3H 2GPWA 3UFXB 3S2DH 3RLNA 2AWNA 4OIJA 1W3SA 3J7AV 3S15H 4BY7G 1UC8A 1YHBA 4G7HC 3RD4A 4FF3A 3I4NB 4DV4H 2JSOA 4EGJA 3L4KA 1DIKA 1N32Q 2FINB 4M1UB 4NW2A 2VQEH 3E0JA 2ASJA 2Z6KC 3E5NA 3PUVA 4O2AF 4HAEA 2UU9L 2FLLA 3BS1A 2JEGA 1LTRD 5FKAC 3CC2A 1XDNA 2QEJC 4L5TA 1TWFA 3BDOA 1W6JA 3SK4A 5CBEE 2NVQB 5ELOA 4A3JG 4ECRA 2K33A 3PF4A 3HOZH 4FNFA 4YWMA 2PMZE 1A3UA 4OGQC 1HR0L 3GTLB 4K2KA 5D1OA 4LWCA 2R8HA 3NTIA 3EROA 1HNZL 2NZHA 4ETSA 2W6MA 1JR0D 1MZBA 3D0FA 2XGTA 2B29A 3GV6A 2YTYA 3GTGH 1I6HH 1XJVA 4TV8F 4AQYH 3VPBA 1RJPA 2VQEQ 4KKUA 4PWQA 1AE2A 2Z6BA 2X0SA 3ITPA 4POGA 1PH8A 2B8FA 2YYZA 3URYA 2WKCA 5I9OA 1X9NA 3BAAA 1I3QH 4O3SA 2YV5A 4L8JA 1PHJA 3H4DA 2A69C 1YVCA 1SYBA 5CR3A 3GTKH 4M8AA 4XZ3B 5EQ0A 2VB3X 4AYBB 4PZ7A 4ECYA 4DR5Q 3CCSA 1UAPA 3HKZA 3ND9A 3GIQA 4F4XA 3PVXA 5KFOA 4CJ2C 3N41B 3Q8QB 4RAYA 5CA0F 5LMNL 1H9MA 1WTOA 1GD7A 2JA7H 3NPPA 5DGBA 4JI6H 5LYJF 3I12A 3QJYA 2VUMG 3S16B 3C0FB 2FLNA 4RB0A 1KIXA 3GP7A 1PLFA 2L5TA 3M4OB 2R8JA 4JV5H 1VQLA 1EWHA 4DV7L 1LYLA 1Q46A 3A55A 1IKMA 3NBIA 5CAEB 3V6KA 5FLXc 2C2RA 1K1QA 2GLTA 1HNWL 3J80E 1FL0A 1E2VA 1Z9FA 1S68A 4XYMB 3K5LA 3IAYA 3HOWH 3TQYA 3MEFA 1KRSA 1R4QB 4LF6Q 1GUGA 4F4YA 4QGUA 5M3MG 5IGCA 3CHBD 4O1NA 3ERSX 4N8FA 4PZ8A 2RDFA 4PMBA 4EYIB 3ND8A 5IT9E 1RDPD 5M9OA 4DR7L 3N52A 4Q43A 4PG3A 4KD4A 1G6PA 2FMCA 4DR6L 4R8UB 3M3YH 2N8NA 3Q8DA 3HOXH 4XX0B 2ZM6L 4QW8A 4A3KH 1C9OA 1HFGA 1TR5A 3KLSX 4P73A 2AUJD 2EYHA 4P2CB 1G2TA 5DQIA 2K75A 1UEAB 2RQXA 1VQDA 3MC0B 4RUCA 2Z8LA 1RTOA 5L37A 1CKNA 3T16A 3M3YB 3PN1A 1B3QA 3A7AB 2YRWA 5DG9A 3RZDB 4I55F 4DL6A 3T1YL 2BA1A 2PCFB 1BVSA 4QB4A 3I3CA 4APVA 1KC8C 1K1SA 4YAJB 4DUYH 4PV1C 3MR6A 5C4XG 3A7LA 4WORA 2RCNA 3BZCA 5CV9A 1B3AA 4KHZA 3S15B 1TWHA 4OIKA 2W6ZA 4JI3Q 4NDXA 1FKAH 1N36L 2EYMA 1ULZA 4IHJF 1QVGA 2KECA 1MJEA 4MIUA 2I5MX 4J9QA 3I56A 1KTKA 4B3TH 2IX1A 4JI8L 3RNUA 2CFMA 1IYJB 3N43B 2EQSA 4KKTA 1UNSA 3BG5A 4LF7L 1EYCA 1Y8PB 3V6HA 4FBTA 1HPCA 1TQOA 3KOJA 2R87A 1CHQD 1SNMA 5EPJA 3NQIA 3JAML 1IW7D 4CJ0B 2CW7A 4A3IH 3NSWA 1DV2A 1NNXA 1WYDA 2UVRA 4DUZQ 4JI1Q 4I65A 4RHSA 2WFWA 1DD2A 4ED8A 1BCPD 4EBCA 4X3SA 4C1NI 2MP1A 3MWDA 1QOHA 2R7ZH 4DLKA 5DAUA 1Q8IA 2LMCB 1VQOA 1EIYB 1G291 4H02A 3HOYB 4FVMA 4IO9A 4K8IA 4AYBE 3K7UC 1PMRA 4YR0A 3T53B 2WP8J 1IL8A 4ZUIA 4DR5H 1QUQB 4QMGA 2RHSB 3GTPA 4JK1C 3J81c 3W3AA 3SI8A 4LSXA 4TV9F 2IPKD 1JLLB 3V6JA 2JJQA 1T3NA 2VR1A 1JWUD 3EVQA 2W7OA 4UCUA 1JWMD 3JAMW 4BBSH 2NVXA 4N9TA 1PTOC 1TU2B 1B9NA 2G9DA 4MV8A 3RN5A 2JEAI 3A0JA 3HB9A 1TT2A 3DEOA 1MHWC 5JPMC 2FMMA 2FFKB 1Q3LA 1G91A 3QOJA 3GIJA 1YJNA 4RH6A 3QB3A 4QWAA 1S40A 5C8YF 1DOLA 1XTCD 4DR3L 1I94Q 2W57A 2IW3A 2TSSA 2YZNA 4ZK9B 3AB9A 1K0RA 2W9CA 2XD4A 5AJ3Q 3W5OA 4HNVA 4EYHB 1MD2D 4A3LH 3AFPA 5KFAA 2RA4A 2R61A 2SNMA 1I7NA 2QF7A 3QZ8A 2A68D 4ZRZA 1HJPA 5EBCA 4J1MA 2F0LA 3VYSA 2CHBD 4JUZA 2BA0A 3G6XA 3KALA 5I2YA 2DJGC 4DV3Q 4ZCKA 1WJJA 2X69A 4K5WA 4DV4L 1IYVA 2R7FA 3H0GG 5IP9H 4ULLA 1L1OC 3CVZA 1L0XB 4QIWB 4FF2A 3BZDB 2ZDQA 1YNNC 4KY6A 4IRKA 2WB1B 2JA7B 5I4DA 1ASYA 5IYZF 1S0OA 2JA7A 2UVWA 1RTNA 2B2TC 1KBLA 1C0AA 1Z7TA 4ILWA 1WCMH 1KD1C 4FO2A 3VPDA 1I50A 1BCPB 4TSSA 3FRPB 5LHY1 2CCZA 1QE6A 4DV4Q 4JI2Q 3I4LA 2ZJQA 4KJOA 4JV1A 4LF5H 4A3EH 3EBEA 2UXBH 1HR0H 2Z4HA 1S4ZA 2K32A 3KF8A 2QK4A 2VY3A 2OQKA 5IYDG 4MZ9A 4XDXA 1F2YA 3I7FA 5IWAQ 4QCLA 4C3HH 4RGOS 1MSHA 3QIAA 4OWTB 4B3SL 3D6WA 5IT9c 5FJ8G 5KG5A 1PH2A 2JXMB 4LUOA 1PFBA 1B8AA 1SR3A 4F8MA 4ZUJA 1CQVA 1F2MA 5DM73 5C4JB 3M7NA 2SOBA 4LF5Q 1PTOH 2JA9A 3UI2A 4K6LA 4BBRH 2VUGA 4H0LC 2MO1A 4EX5A 2M05A 2XIGA 1E22A 4GN4B 1SMYC 1IBKL 2MCTA 5KT7A 4EFBA 1TVXA 3OMCA 1F9RA 4RGMA 4NKLA 4OWWB 4J9NA 3PR4A 3FKIB 1ENCA 1WFQA 3ONAB 1Q12A 4JI8H 4JVZA 2N55A 3GTQB 4DXFA 3VA5A 1CSPA 3F1ZA 1C48A 1YNXA 1DOKA 2F1MA 5COYA 4QWEA 3MXNB 4M7EA 2K6AA 3M4PA 3TZUA 1XPOA 1O75A 4I4TF 1B6SA 3DF7A 2O03A 1VQ5A 3SK5A 1LUZA 3CPFA 4A3LG 2NVYA 4YB8B 2B63G 1V51A 4IJLA 4ZI7F 3BU2A 2EXZA 4CC5A 3IFDA 4DL2A 2BQ3A 1XNQH 2CWPA 4BBRB 1U4MA 1PRTB 1C3OA 2XC9A 2KUMA 3BG3A 1T5XD 3I90A 1LTSD 4O4IF 5L9XA 4KHPH 3PMFA 1Z47A 1MI2A 1STBA 2L55A 1SFOH 4KHPL 4LF5L 4R1JA 1HQMC 3PQIA 1VMPA 1QG7A 4IJHA 4MAMA 2QDBA 3PO3B 1R9TA 2SCUB 4RMFA 5JVDF 3PW7A 1PYWD 2BDOA 1R4PB 5ELNA 3GQCA 1RL2A 5IWAL 3WWVA 1ZHQA 1X3GA 3A5ZB 2Q2HA 1JIHA 2VS1A 3F8TA 1JMCA 1EZ8A 4A3DB 4IUVA 4BWGB 3I4MH 1KHIA 5BR8Q 2P5ZX 2NWGA 4IOCA 1NE3A 4AH6A 2IP4A 3RF2A 5M3MB 2ZDHA 3HOXG 1YJ9A 3OHAA 3BVZA 3KAKA 3U58A 1P8LA 4GC7A 1K83H 1KXLA 4XT3B 4JI2L 4A4IA 2V4QA 1O7IA 2XNAC 3PUZA 3T1YQ 2QYZA 4RGNA 5JEAH 5D1PA 4WJ3M 4A3IG 2PNHA 4S3SA 1PTOF 2VL6A 1RF2D 1KJ8A 2PMZB 3HOYG 4U6PA 3I91A 5M3MH 4RU9A 3J80i 1WCMB 4F4ZA 3CAMA 3G6YA 2F0SA 1S0NA 1A2UA 1JC7A 4PDBA 2FPPB 4BWSC 2KBNA 4FU0A 2ZM6Q 2NN6H 1YHQA 3RN2A 1Y1VH 2KCTA 4DR6Q 1FVIA 1GSHA 3NEMA 4F88A 4MV1A 1SDFA 3MFGA 4YCUA 2PZUA 4ABNA 2HT1A 2NZ1D 2W9BA 2LKVA 2K5VA 1KDCA 3IRBA 2W9BB 4J9PA 5F9NA 4LF6L 4OO1I 3CXCA 3PZPA 1PXUA 2VW9A 5GONF 3KJOA 3Q23A 4A3BB 3NHHA 3L4JA 1ZKOA 2OCEA 1EY6A 1LTGD 2R8KA 1SJED 2F0HA 1PDQA 5D3IB 2PBZA 4DR3Q 1I94L 2RHQB 1LM0A 4R8NA 3MR3A 4OWXB 1KEEA 3QZ7A 5EGTA 3BVMA 2JEBI 4YIJA 2P0AA 4RAUC 3J7YW 1HNWH 3KHHA 2JA5H 4V190 1SYXB 3ZYYX 4OELB 4EQNA 2VUMA 4J9KA 4HMJA 4UFZA 2K50A 4JYAH 3BYYB 3H6MA 2PPBC 2YZMA 4HTHA 2OWOA 4XT1B 2JA6B 4O4HF 3CCEA 3H0GH 4B3SH 2EZVA 4DR5L 4A3BG 1JOQA 3OIPA 1VQPA 5JVLA 3EA6A 2UVVA 4EGVA 3CPWA 4JCVE 3HGBA 3TP8A 1AUXA 3MXGA 2BH2A 3J81W 4A3JH 4A2AA 5J3BA 2C00A 3DM1A 4MV4A 5LMUH 5I6WA 2FK2A 3NWSA 3M4OH 3Q2OA 3C3LA 4HJAA 2YTVA 4FP5D 5IGFA 2F0IA 1XX8A 3BZKA 4CKCA 2AU0A 1OXVA 3ULLA 3TBIB 4AQYL 2DZDA 2OTJA 4GKJQ 1QWYA 2H1EA 3E9HA 2V5AA 1HZBA 2JEJA 3GTLA 1E3PA 5LMNW 2R85A 3T56B 2WE6A 1J9OA 3WO0A 2QILA 4UAIA 4OO1H 3GO5A 3J7AF 1HR0Q 1BJTA 5KNBA 1QCBD 1UC9A 4GNXB 3RBEA 5KFHA 2CW8A 2RDJA 4IQZA 2PQAA 1L0WA 4OONA 5HURA 3K5OA 1QZHA 2W71A 2ZT9C 2LFNA 1A6XA 3S1NB 1OXUA 1B6RA 2HHHH 4MV7A 1PZJD 2F3WA 4JI8Q 4CJ1B 4XQNA 1TIID 4JI5Q 1JXLA 1C7YA 1EIHA 1S5CD 2XGQA 3JZIA 1UEBA 1X65A 2KCCA 2PI2A 3J7AK 2C5CA 3S9WA 2F0EA 4A3GH 1D5ZC 5CB4F 1N36Q 1SSOA 2HDLA 2A5HA 5CYUA 1KNAA 4GKKL 1VQNA 2R86A 3TQTA 1IBLH 1IKLA 1AN8A 1MKHA 2RGVA 5KNDA 2HUGA 2G9HD 4P71A 5G3LD 3DWPA 3GV5B 5CV4A 5KG6A 1JJCB 1TS2A 2UXCQ 2F0UA 3HOZG 5DG8A 3TP5A 4YHHH 2DN8A 1UWVA 4DUYL 2Z6KA 1FJGQ 2B63B 3KTMA 2EY1A 3CCMA 1I7LA 3N6XA 3C1FA 1OO9B 5KRUA 4ALPA 2V1CC 4LSAA 4HYKA 5BN5A 2A8VA 4NB3A 2IMWP 1J5EQ 1WD0A 2FXQA 4K5XA 4K14A 1YZ6A 5JOBA 1GM5A 4XIGS 2QGQA 3GIKA 3HKZE 1K28A 1XTDA 2AWOA 1VF7A 4RAZA 2OEOA 3H3VH 2K28A 2EYOA 2ZTCA 5C0XJ 1XNRL 4GZYC 4KJNA 4JI4Q 5GADC 2AMCB 1AH9A 4P75A 2NU6B 4Q8FA 2CZGA 1XNRH 3DM3A 2ZJPA 5ELEA 2K4KA 2F0DA 3I4NG 3EIVA 5IGBA 2IHFA 1A2TA 3BQ2A 2B39A 1ENFA 1VQFA 4A3FB 4BBSB 4UP9A 2UUCH 3N40P 1STEA 2PQEA 1FYCA 1GUNA 4DV7Q 2A73B 4FBUA 4DL5A 1I50H 2K03A 2HCCA 1IW7C 2RDIA 1WTRA 1T36A 3OSNA 1TWAH 1MJCA 4XXEA 4GNXC 3U9SA 2F3IA 4A3FH 2FHTA 1XNQQ 4G3IA 2O4XA 1V8QA 2R93H 2FPIB 1X55A 3FPPA 1SXTA 3VDYA 4ED1A 5BPFA 4J9MA 2F0WA 1LACA 4TQUS 2WAQB 1QVCA 2MO0A 2E2DC 3RB4A 3OMGA 4U673 3DLLA 4FF4A 5JJLA 3TQ1A 4O3PA 3EJIA 2VPQA 3RTXA 1KDAA 1E2WA 1IOWA 2D5DA 3MJFA 1FGUA 4Y52H 1TWHB 1RKNA 2NU9B 1BXTA 4DNIA 4HNUA 5I6YA 3K7AB 4TVAB 3D31A 4RHRA 2VQEL 4WBNF 1SNOA 1JQYD 3L3OC 1H9RA 3S2DB 3TIIA 5LL6b 2ZTDA 2N49A 2PNRC 1K8GA 2BDNA 4NXNL 4X64Q 1SNQA 1KLUD 1TAEA 2JA5B 3FKIA 5KFUA 5KG4A 4UY8C 3EPIA 4BY1G 5CGKA 2JA7G 1Z2NX 4G7OC 4NXNH 3BDLA 2YCHA 5KFSA 1S5ED 2ZXPA 5M3FB 3D4RA 3A8IE 2JA6H 4YHHQ 4OX9H 1PZKD 3GV7B 3SE0A 1JB3A 1U0LA 1K73C 2MUYA 1XWEA 2JA8H 2R6FA 1N32L 1LO5D 3DWAA 1FD7D 2FPGB 1HNXQ 5M5YB 4R4CA 1STNA 3P1HA 3R93A 5JEAG 3H40A 1GLVA 1OWTA 4IN3A 3SK6A 2RDGA 2R7MA 3KHLA 1SAPA 4RNNA 1E1OA 1JX4A 1MIUA 4POFA 1F2ZA 1SE3A 2VA2A 2F52A 3N44B 1X56A 4B3TL 4IWXA 3A54A 2N78A 3GTMA 3SE7A 3CCUA 1J6QA 5GROA 4EEYA 2R7ZA 3PW0A 1SYEA 3C1EA 1PH9A 1VQ6A 4H7BA 2GN5A 5E1FA 2KENA 1I94H 1JJ2A 1Q1BA 2R92A 1E2ZA 2XRSD 1EHIA 4YJ2F 2CH4A 2YYAA 3UQ8A 1I4GA 2X6GA 1VQ9A 3W2DA 4V0BA 1BUVT 5IYCH 4IUPA 4EQOA 3JC66 1ML0D 1E4FT 4B3MQ 3S14B 2OH2A 1EL0A 1ZETA 2R8IA 4YCWA 1VQEA 4YHHL 1Y1WA 4U68A 4JI0Q 2IA6A 4A3CG 2R7KA 3OWEB 1RJRA 1S9FA 3J81j 2KEDA 1YI2A 4NP5A 2RSNA 2XVSA 1PRTF 2EJMA 4LF8H 2O5JC 2C22A 1EYZA 2R92B 5GQOA 4X64L 4WD3A 2ID0A 4NXNQ 3RUPA 4WJ4A 2F0KA 1JCKB 2E76C 1Y69U 2I87A 4X64H 4ZHQF 4IPCA 2NUAB 1I6VC 3HOVG 2SEBD 3RIZA 3NTHA 3GTMB 1CK1A 3G4SA 1SMXA 3QO2A 5BR8H 1BNZA 4A3GG 3S17B 3A74A 4A3EB 5JJKA 3MFHA 4Y7NH 2V4RA 3K0XA 3KYHC 5T1GA 2ES2A 3G71A 2JA6A 2I07B 1B7YB 3MFYA 4WRDA 5KYIA 2EPBA 5HY6A 3CCQA 4DNTB 3FKIH 2JK8A 4J0MA 2I5LX 1Y8NB 2F03A 1IOVA 3RGZA 4DV0H 3T4AC 2K14A 3GTOB 1J5EH 1CZWA 3CP0A 1XNQL 1B04A 1NSNS 2HIXA 4RZRA 2D9UA 2OXPA 4A93H 3I8ZA 4R7RA 1HHVA 1F9QA 1PTOB 1ILQA 2VQFQ 2KOLA 4OO1G 5L1KA 1KJQA 2LXKA 3OTOQ 2O5IC 3NGDA 5L1LA 3Q22A 1X3PA 2EYJA 2MPMA 1N8RC 2GA4B 1SYGA 1SE4A 3ULPA 5C3EG 1A3TA 2PW5A 1EYDA 2F3VA 4JOIC 4JBWA 4ED0A 1YBYA 2UXDL 1CQFA 2PZTA 3KLRA 2I80A 1L1OA 2NB0A 1CE8A 4J8QA 1PH7A 5C3WA 5LP6F 3G6JB 4HQ6A 1X3EA 2GVBA 2AHOB 4JI4L 4K0KQ 5DLQE 2Q8TA 1QZGA 2IX3A 1XNRQ 1JOKA 2R93A 3Q0AA 1VQ8A 4LF6H 4DV5L 4DR1H 4DV1H 4DFAA 1OXSC 1VQAA 3VR4A 4C3JH 4WJWA 2J6SA 1TWAA 4YJ3F 4DR1Q 1VKZA 1FR3A 2E2HB 4EG0A 2UU9H 4K0KH 4O42A 3G7LA 2RBMA 3UDIA 4HNTA 4YWKA 4YY3Q 3GTKA 2BE5C 1O7YA 1K8AC 4KY7A 4QJFA 1CS0A 3GDEA 2ZXOA 4A3BH 3K7AH 4RCOA 2XCPA 4DUYQ 2WINB 4R4OA 3TEHB 1FJGL 4B3RH 1H9SB 1NR4A 5JEAJ 1SFOB 4QWBA 1LABA 1I50B 1N9WA 1M0TA 4DAMA 4LF4L 4O3RA 1ENAA 3GD7A 3GQBA 4B3RL 4F4WA 5IGGA 3M4YA 1XPRA 4ED2A 2UUBL 3I4NH 4HJ8A 2IJ0A 4QF4A 4ECVA 1EU4A 4HIDA 4LFBH 2LSSA 5DQGA 3D4WA 2E2JB 5A35A 5LL6X 4E6IA 1PA6A 2JP1A 5KFKA 3A8JE 4EBEA 2XSCA 3L0OA 5EBDA 3RLFA 1A0IA 2IHEA 1IBLQ 3GIIA 2C28A 3M9OB 2B3GA 2N3SA 3H15A 2O2LD 1H9SA 4R4IA 5KGUA 3DXJC 1N36H 4C3HB 4A2BA 2F0OA 3CRLC 5EDWA 2NYZD 5E4WC 4JI5L 3K5IA 2EIFA 3R2IA 1A9XA 3BA8A 2Q2IA 2UUBQ 2VNUD 2PQAB 1ZQ7A 1JE5A 4R8UA 1WTXA 4I7AA 3D3RA 4GLAC 5C4JH 4B3RQ 2R7NA 1BBUA 1GGOA 4I7ZC 1E4EB 3MR5A 5C3XA 2Y0SA 1EZ6A 1TS4A 4ED6A 5HGQA 2DWCA 5KFGA 4CGYB 4EFEA 3SDZA 5TSSA 2JE6I 4WFN3 4YY3L 3CW2C 4GKJL 3RAXA 4R9WA 1D8LA 4AQYQ 1G6ZA 3GTKB 5J2TF 3MXPA 1LTLA 1TS5A 3W1BA 1ASZA 1SNDA 1BGWA 4EBDA 4C5CA 3MR2A 5D3DA 2K7VA 3RB3A 3KHRA 5KNCA 4DV5Q 3Q8PB 4LFCH 4JBMA 3B6YA 3ZJYC 1ESRA 3VR6A 1Q82C 1K8MA 4K0KL 2YS6A 5FLXL 2KEEA 5FO8B 4DUZH 4LNQA 1VQCA 3SXHA 1S03G 4X65L 1N33L 1V1OA 3W1GA 3OHBA 5M5YH 2GVAA 2A68C 2DPIA 4DR7H 4MV9A 2R92G 4XQQA 4BY7B 3Q1KA 3I4MG 3HEJA 2PO4A 1Y8OB 1U4LA 4RA8A 5JJIA 1L1OB 3GTOA 2ASBA 3HOZB 2CW0D 4KLKA 4HCSA 4CDDC 5KFBA 4IFDI 4O0AA 3UDGA 5EZYF 4EVOA 3PR5B 4RCNA 2VQFL 4DR2H 3FDSA 4F87A 5CV7A 3RV4A 5KFEA 1ICFB 4JI7H 3CKIB 1TY2A 4IUNA 3PUWA 5KT2A 3GTJB 3GIDA 2A69D 4FS1A 4JI3H 1EQQA 2OTLA 3UDFA 1SEIA 2B2UA 5A2QW 3K57A 1VAJA 2V58A 4CBVA 3KXYT 1BNCA 4OX9L 5FLXW 3PUXA 2W9AA 1EEFD 1EY9A 1TWGB 2KHIA 3F2UA 1F77A 2H4OA 1CUKA 1Y1WH 3JSLA 3GLKA 4ECTA 3TSSA 3RV3A 2D0PA 1S97A 3FPUB 2E2IA 3VYUA 5DLGA 3OW7A 4L63B 1AUVA 4QUFA 3M9BA 4F7XA 2EYFA 4QY7A 3ORQA 3G8CA 4AYBG 2ASLA 1D6EC 1NY4A 3I70A 4UP7A 3FEWX 1EUJA 2R92H 4YR2A 1Y14B 5L1JA 2PMZA 3KF8B 4U7CA 3WOEA 4DXGA 1VBGA 2K04A 2XWJB 2HCIA 4RNMA 5FJ8H 4QQBX 4ZLTF 3GTMH 5IGEA 3KF6A 4FM9A 1T94A 2YRXA 1SRUA 1S3OA 1UE1A 4J9OA 2B2WC 2Q8IB 2A1AA 4GOPC 4I7HA 2CWAA 4JI0L 4IFDG 1X6OA 2EJFC 2R8GA 2EOTA 1N34Q 2EDGA 4O2BF 5EKIA 1EFID 1TWGH 3G6VA 4IAJA 3LP8A 4B3ML 4TRDA 1QNKA 3RMHA 4HSVA 3R3OA 5BR8L 3L7ZC 5GAEC 5ELFA 1NMGA 3RUZA 5FLMH 4KD3A 4A3GB 5DNFA 1ZXTA 4IZ8A 4X66Q 3STBD 3PIPA 2YZGA 1S5BD 1LTTD 4BY1H 3MTSA 4LJZC 2VZAA 2V59A 3PSIA 3BJUA 1LT3D 4Y8VB 5KFMA 5C0XH 3MHBA 2JEFA 1EOVA 1JDBB 2IBKA 1K3BC 1T5EA 3PIP3 2J6TA 1VBHA 1TS3A 2AQ3B 4NLGA 2ENBA 4LFAQ 4LFBL 4DV0L 4JYAL 4DR4L 5C3EH 5C44B 4IURA 4Q45A 4GLXA 2CQOA 5K2MA 1D1KA 1KDBA 1KJ9A 2EY2A 4DV6H 3HOVB 3SR1A 4C5BA 4DF7A 1L2ZA 4ECXA 4QIWA 1IBKH 5CMDA 3M85A 4P74A 5FD6A 1VQMA 3S2HH 3TDQA 3T1HL 2X6LA 4A75A 4HJ7A 1HUNA 4LMQD 1EY7A 2Q2UA 4XYLB 3WDNA 2A6EC 2F4IA 3H4BA 2CW0C 4RFBA 2VQDA 3BJYA 4C2MB 4HJ5A 5IT9W 5IP9G 2ICIA 2E2HA 4JV0A 4DGZA 3FMCA 1TWCB 1BO0A 2HHHL 2C35B 4DV5H 2W9CB 1Y1WG 1DGSA 1EY4A 3NBHB 4B08A 1D5XC 1SLJA 4JV5Q 3ORRA 4DV2H 1IBMH 4R4TA 3RGXA 1WTPA 5KT4A 4J6HA 3KLSA 3CQZA 3EFXD 2NU8B 2R7LA 5JVH3 3HOVH 3MZ5A 3BYTB 1EEID 1U4RA 3J7A5 4J9RA 4BS9A 3GTJH 2B2VC 5G3LF 2L4NA 3FHWA 3HFZB 5JJZA 2YU9B 1BR9A 4M9UA 5EPKA 4KK7A 2UUAH 4XQJA 1HQRD 3F2DA 3CF5A 1M0WA 3TREA 1GHKA 4RNOA 1TXYA 2ZJRA 4C5AA 5KG7A 1N56A
chains in the Genus database with same CATH topology
1N36L 1Q86C 1QVGA 4TQUS 1MJEA 3AQQA 5C0XI 1QVCA 2I5MX 3I56A 4JI3L 3PO3G 2MO0A 1IL2A 2IX1A 3M4QA 4JI8L 1K9MC 4IOAA 2MNAA 3RNUA 2CFMA 1IYJB 3DLLA 2QA4A 4LF8Q 2EQSA 1EFWA 3KF6B 5JJLA 4ME3A 4LF7L 4JI7L 1H95A 1N34L 2UXBQ 1FGUA 4Y52H 3UDXA 3A5UA 3KOJA 4DNIA 2UUAQ 4TVAB 3D31A 2VQEL 2NVTH 4LF9L 4A3IH 3PCOB 1WYDA 4DUZQ 4JI1Q 2WFWA 2ZTDA 1KAWA 1VQIA 2YU9H 2D62A 3S1QH 2Q2TA 2N49A 1K8GA 4LF4Q 4NXNL 4GOPB 2ALYB 4X64Q 2R7ZH 4UPAA 1XMOQ 3TS0A 4UY8C 1VQOA 1EIYB 4BY1G 2JA7G 1G291 4H02A 3CMEA 4IO9A 4DR1L 4IPGA 4AYBE 3K7UC 1A63A 2UUCL 3AFQA 2WP8J 3HOYH 4BBSG 2JA6H 1QUQB 4YHHQ 2RHSB 2NZOA 3G6EA 1K73C 1U0LA 3J81c 2R7ZG 4DV6Q 2JA8H 2F4VL 1N32L 2WAQE 1YEZA 2H5XA 2JJQA 1IBML 1HNXQ 1RIPA 1V9PA 2K52A 4DV1Q 1IBLQ 4BA1I 4GNXA 4R4CA 1CKOA 5C4XH 2ATWA 2UXDQ 2NN6I 1UE7A 4BBSH 3JAMi 5JEAG 4GS3A 3FKIG 2HIVA 3RN5A 2JEAI 3A0JA 1E1OA 1VQKA 1MIUA 4X62L 4POFA 2K5HA 2UXCL 1NTGA 3RLOA 2F52A 3KLWA 1X56A 1GVPA 3S1NH 1PYSB 4LFCL 3K81C 3OTOL 1YJNA 4B3TL 2N78A 4BXXG 3CD6A 3CCUA 1S40A 1J6QA 5GROA 1I94Q 3J80c 4DR3L 2IY5B 2A19A 1PH9A 4L5QA 1VQ6A 5IYCG 3KDFA 1X3FA 2GN5A 5LMNQ 4GKKQ 2KENA 4GOPA 1K0RA 4J15A 1EQRA 3U4VA 4L5RC 1JJ2A 5AJ3Q 3W5OA 1Q1BA 3CCLA 4A3LH 1VQGA 1XMQQ 2E5LQ 3AFPA 3EN2A 4DK3C 1VQ9A 5M3FH 5IYCH 1N33Q 1S72A 1HJPA 3JC66 4OXPA 3H3VI 4HIOA 1GKHA 4B3MQ 3L2PA 1JT8A 2BA0A 2EXDA 4YCWA 1Q1EA 1VQEA 2YTXA 3AYHB 4YHHL 4DV3Q 1WJJA 4JI0Q 4DV4L 4A3CG 2R7FA 3H0GG 3J81j 3HOUH 5IYBH 5IP9H 1YI2A 1IZ6A 1L1OC 4A3DH 2R93G 3ER0A 3RZOH 4DR2Q 1ASYA 4FDBA 5GQOA 4X64L 4JBJA 2ID0A 4A3KG 3I2ZA 4NXNQ 1QVFA 1VQ7A 4WJ4A 2VUMH 1CKNB 1EWIA 2QEXA 2OQ0A 4DR2L 2NVXH 2JA8G 1EIFA 4IPCA 3HOVG 4C3IH 1C0AA 3E9IA 3PIOA 4LF9Q 1WCMH 1KD1C 3G4SA 1SMXA 4JBKA 2CCZA 4A3GG 4C2MH 4DV4Q 3U4ZA 1PVOA 4JI2Q 3CQZH 2ZJQA 3A74A 5JJKA 4Y7NH 4LF7Q 3GTPH 3HOWG 2R6GA 2Z0SA 3K0XA 3KYHC 3EBEA 4BBRG 3G71A 4A3EH 2ES2A 4LF8L 1B7YB 1VQ4A 2I0QA 3HKZG 1X54A 2D0OA 2VY3A 2OQKA 5HY6A 1OTCA 2JA6G 5IYDG 4MZ9A 4A93G 3CCQA 2R7DA 3I7FA 3FKIH 2JK8A 5IWAQ 4C3HH 1IBLL 2I5LX 1CKMA 2E2HH 2K14A 3SGIA 1PFSA 1OXXK 4OWTB 4B3SL 4A3MG 5IT9c 3CP0A 1XNQL 2HIXA 2MQHA 5FJ8G 1V43A 1PH2A 5IYDH 4A93H 3GTLH 4LUOA 1B8AA 1HZAA 1SR3A 2HQLA 4QIWE 2XTIA 4DKAC 2VQFQ 4OO1G 3LGJA 3NELA 3M7NA 2LXKA 3OTOQ 4LF5Q 4B3TQ 4JG2A 2JA9A 4BBRH 3WWVA 4A3EG 1E7ZA 1VCIA 2ZTEA 3PGZA 5IP7G 2MO1A 3PF5A 4EX5A 1VQJA 4NXMQ 1JJGA 1E22A 1N8RC 4GN4B 1Q81C 3CMAA 3ULPA 1PH1A 1IBKL 4A3DG 2E2IH 5C3EG 3RR5A 4JOIC 4YCVA 4JBWA 1P16A 4OWWB 4GLVB 1YBYA 2UXDL 1WFQA 1E1TA 1Q12A 1L1OA 4DV1L 1SN8A 1T9HA 2DUDA 1PH7A 1HNXL 1CSPA 3F1ZA 1YNXA 1X3EA 5LMUQ 1VQHA 2GVBA 3MXNB 2AHOB 4JI4L 4K0KQ 5DLQE 4DV6L 1PH6A 3M4PA 1XPOA 1QZGA 1XNRQ 1K3RA 4R4QA 1OXTA 1VQ8A 4DV2Q 1VQ5A 1TWHH 4DV5L 4DR7Q 1SROA 4GN3B 4IFDJ 1LUZA 3CPFA 4A3LG 1OXSC 1VQAA 4C3JH 4AIMA 2B63G 2UUCQ 1HZCA 4IJLA 4HIKA 4DR1Q 3BU2A 5E7NA 1VS0A 3TRZA 5LMUL 1XMOL 2RF4A 1WOCA 2CWPA 3UDIA 4BXXH 1HZ9A 4YWKA 4YY3Q 2LXJA 1K8AC 4QJFA 1EYGA 3GDEA 1HNWQ 4A3BH 3K7AH 4BY7H 3F2CA 4DUYQ 4R4OA 3TEHB 1FJGL 1Z47A 5JEAJ 3PO2G 4MTNA 1N9WA 4NXML 4DAMA 5C44G 1Q8KA 3I4OA 1SFOH 3GD7A 4LF4L 4B3RL 4LF5L 4R1JA 2I5HA 1Q7YC 4KHPL 1YHAA 4A3FG 1B70B 1XPRA 1HH2P 4JI7Q 2UUBL 4IJHA 3I4NH 4HJ8A 4NPSA 3S14H 1NMFA 1U5KA 4RMFA 4HIDA 2LSSA 2CKZB 3K80C 5ELNA 1PA6A 1BBWA 2E8GA 4QL5A 4A3CH 1RL2A 3L0OA 3RLFA 5IWAL 1A0IA 2IHEA 4JC0A 1X3GA 3A5ZB 2Q2HA 2B3GA 2N3SA 2VS1A 3F8TA 4PZ6A 4DK6C 3H15A 4R4IA 1YITA 1JMCA 3ICEA 3I4MH 1KHIA 5BR8Q 1M90C 1PYBA 4JI5L 4JOIA 4IOCA 1NE3A 2EIFA 2KHJA 4AH6A 3HOXG 2Q2IA 1YJ9A 2UUBQ 3U58A 2VNUD 2PQAB 1P8LA 1JE5A 4XTCS 1K83H 5EAYA 3F2BA 1KXLA 4IPDA 4JI2L 4A4IA 1O7IA 4GLAC 5C4JH 4B3RQ 4KHPQ 3CC4A 1BBUA 3PUZA 3T1YQ 1QUQA 3G48A 4A3IG 4WJ3M 2PNHA 2VL6A 3HOYG 5HGQA 2PI2E 5M3MH 2Y0SE 3J80i 3PV0A 3CAMA 3J81i 5GAHC 3KJPA 2Y0SG 3KDFB 2JE6I 1HNZQ 4YY3L 1XPUA 3CW2C 1SE8A 4GKJL 2KBNA 4A3MH 1D8LA 2ZM6Q 4AQYQ 2HHHQ 1YHQA 3RN2A 2BH8A 1Y1VH 4PMWA 3NENA 2KCTA 4DR6Q 1FVIA 3STBC 1LTLA 3ULJA 3W1BA 3NEMA 1ASZA 3CCJA 1G51A 4YCUA 1PH3A 2HT1A 5FLMG 1PV4A 2UU9Q 3S17H 5IP7H 4X6AH 4DV5Q 3GTOH 2K5VA 1R9TH 4JBMA 5K36G 3B6YA 3IRBA 3ZJYC 1BKBA 1Q82C 4K0KL 4HJ9A 1KL9A 3T1HQ 4LF6L 3CXCA 4OO1I 3U50C 4LNQA 1VQCA 1PH5A 4X65L 1N33L 2VW9A 1J5EL 3W1GA 2AKWB 4KI0A 2GVAA 5M5YH 3OW2A 5GAGC 2R92G 1PH4A 1XMQL 3KJOA 4LUZA 2E5LL 3I4MG 5JJIA 3CCRA 2OCEA 1L1OB 1HR0W 2ASBA 3UE1A 1IBKQ 5IYBG 5H1SE 3HOZH 1WI5A 4KLKA 3UE0A 4JI6Q 2NN6G 3J7ZC 4IFDI 1YJWA 4O0AA 4DR3Q 3UDGA 1I94L 2RHQB 1LM0A 2IX0A 4DV0Q 4OWXB 4LFBQ 3GTQH 1TWFH 3HKSA 2WB1E 2DGYA 2JEBI 1GO3E 4LFCQ 2VQFL 3PO3H 4LW1A 4P72A 2IT1A 1JB7A 2JA5H 4YWLA 4X62Q 1KRTA 3RZDH 4JI6L 3OYYA 2NVYH 1I5FA 3PUWA 4B3SQ 1A62A 5IY0A 5C44H 1YIJA 2K50A 1EQQA 2OTLA 2MFIA 3UDFA 2E2JH 2OWOA 3PO2H 3S2DH 3RLNA 3S1RH 2AWNA 3CCEA 3H0GH 4X66L 1W3SA 3S15H 4DR5L 4OX9L 3PUXA 1YHBA 4A3BG 4BY7G 1VQPA 1IBMQ 3CPWA 2KHIA 2JA5G 4JCVE 2F4VQ 1N32Q 4L5SA 1CUKA 2BH2A 1IXRA 1Y1WH 4A3JH 5J3BA 2D0PA 2Z6KC 3PUVA 4DPGA 2UU9L 3HOUG 3CCVA 1W2BA 3M4OH 3CC2A 5M5WH 3M9BA 4HJAA 2YTVA 4L5TA 4QY7A 1KQSA 3TS2A 3BZKA 5ELOA 4AYBG 4A3JG 3PF4A 1OXVA 3ULLA 4YWMA 2PMZE 1NY4A 4AQYL 4UP7A 1HR0L 4GKJQ 2OTJA 1AE3A 3E9HA 1EUJA 4LWCA 1HZBA 1Y14B 2R92H 1E3PA 5LMNW 1HNZL 2NZHA 3KF8B 4MNOA 2K5NA 3D0FA 2XGTA 2B29A 3GO5A 2YTYA 4GN5A 1HR0Q 4LUVA 3GTGH 2B63H 1I6HH 5FJ8H 4GNXB 1XJVA 4QQBX 2WAQG 3E0EA 3K8AA 3GTMH 3KF6A 2VQEQ 3JAMc 1AE2A 1SRUA 1S3OA 1UE1A 2PQAA 4OONA 1L0WA 2A1AA 4GOPC 2UUAL 1PH8A 1QZHA 2CWAA 2YYZA 5IE8A 1X6OA 4JI0L 4POGA 4IFDG 1X9NA 4DV3L 1I3QH 3S1MH 2KCMA 1N34Q 2UXBL 2YV5A 1OXUA 1TWGH 1PHJA 1Y1VG 1YVCA 4B3ML 2NVQH 4JI8Q 2L15A 4JI5Q 3GTKH 5BR8L 3L7ZC 5GAEC 1NMGA 1C7YA 4PZ7A 5FLMH 4DR5Q 4OX9Q 1UEBA 1X65A 3CCSA 2PI2A 4X66Q 3S24A 4A76A 4A3GH 3STBD 3PIPA 1N36Q 5AJ3L 4BY1H 2VZAA 3PSIA 3BJUA 5LMNL 1VQNA 4GKKL 4O2DA 1GD7A 2JA7H 1EOVA 3FP9A 1MKHA 2JQOA 2VUMG 1CSQA 1UE5A 4BA2I 1KIXA 2WB1G 4LFAQ 4P71A 4DV0L 3S16H 3KFUA 1A8VA 1NJIC 4JYAL 4LFBL 1JJCB 4DV7L 1VQLA 4DR4L 1LYLA 1Q46A 3HOZG 5C3EH 2UXCQ 1TWCH 5FLXc 1FJGQ 1UWVA 4DUYL 2CQOA 2Z6KA 4GLXA 4IPHA 3CCMA 1HNWL 1FL0A 4ALPA 1Z9FA 2V1CC 4HIMA 3M85A 4JV5L 4P74A 2A8VA 1VQBA 4NB3A 1VQMA 1J5EQ 3S2HH 4X65Q 2FXQA 3HOWH 3TQYA 1YZ6A 1KRSA 3MEFA 5C0XG 3T1HL 1GM5A 4LF6Q 4QGUA 5M3MG 4A75A 4XIGS 4HJ7A 2QGQA 3HKZE 3ERSX 1XTDA 2AWOA 4PZ8A 2Q2UA 3H3VH 4DR7L 4HJ5A 4DV2L 5IP9G 1NBWA 4PG3A 2ZTCA 1G6PA 5C0XJ 1XNRL 4DR6L 4JI4Q 3M3YH 2N8NA 5GADC 2AMCB 1AH9A 3Q8DA 4P75A 3HOXH 2ZM6L 2HHHL 2C35B 4A3KH 1C9OA 1Y1WG 1DGSA 1V1QA 3DM3A 3NBHB 4P73A 4UP8A 1SLJA 5M5XH 2ZJPA 2K4KA 3I4NG 4JV5Q 4R4TA 3EIVA 3I55A 2IHFA 2K75A 1VQDA 4JI1L 3AEVA 1VQFA 4DUZL 5M3FG 4UP9A 1M1KC 1WCMG 1CKNA 4DAYB 3HOVH 4DR4Q 4DV7Q 3T1YL 2BA1A 1I50H 1BVSA 4APVA 1KC8C 3J7A5 4RG1A 3GTJH 4JYAQ 4LFAL 3FHWA 5C4XG 1L2FA 1MJCA 1TWAH 3HFZB 4GNXC 1E24A 2F3IA 2RCNA 3BZCA 3PUYA 4A3FH 4KHZA 4EQ5A 1UE6A 3F2DA 1XNQQ 3CF5A 3TREA 3CC7A 4JI3Q 2R93H 1X55A 1D7QA 1TXYA 2ZJRA 3VDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 L;  1Q86 C;  1QVG A;  4TQU S;  1MJE A;  3AQQ A;  5C0X I;  1QVC A;  2I5M X;  3I56 A;  4JI3 L;  3PO3 G;  2MO0 A;  1IL2 A;  2IX1 A;  3M4Q A;  4JI8 L;  1K9M C;  4IOA A;  2MNA A;  3RNU A;  2CFM A;  1IYJ B;  3DLL A;  2QA4 A;  4LF8 Q;  2EQS A;  1EFW A;  3KF6 B;  5JJL A;  4ME3 A;  4LF7 L;  4JI7 L;  1H95 A;  1N34 L;  2UXB Q;  1FGU A;  4Y52 H;  3UDX A;  3A5U A;  3KOJ A;  4DNI A;  2UUA Q;  4TVA B;  3D31 A;  2VQE L;  2NVT H;  4LF9 L;  4A3I H;  3PCO B;  1WYD A;  4DUZ Q;  4JI1 Q;  2WFW A;  2ZTD A;  1KAW A;  1VQI A;  2YU9 H;  2D62 A;  3S1Q H;  2Q2T A;  2N49 A;  1K8G A;  4LF4 Q;  4NXN L;  4GOP B;  2ALY B;  4X64 Q;  2R7Z H;  4UPA A;  1XMO Q;  3TS0 A;  4UY8 C;  1VQO A;  1EIY B;  4BY1 G;  2JA7 G;  1G29 1;  4H02 A;  3CME A;  4IO9 A;  4DR1 L;  4IPG A;  4AYB E;  3K7U C;  1A63 A;  2UUC L;  3AFQ A;  2WP8 J;  3HOY H;  4BBS G;  2JA6 H;  1QUQ B;  4YHH Q;  2RHS B;  2NZO A;  3G6E A;  1K73 C;  1U0L A;  3J81 c;  2R7Z G;  4DV6 Q;  2JA8 H;  2F4V L;  1N32 L;  2WAQ E;  1YEZ A;  2H5X A;  2JJQ A;  1IBM L;  1HNX Q;  1RIP A;  1V9P A;  2K52 A;  4DV1 Q;  1IBL Q;  4BA1 I;  4GNX A;  4R4C A;  1CKO A;  5C4X H;  2ATW A;  2UXD Q;  2NN6 I;  1UE7 A;  4BBS H;  3JAM i;  5JEA G;  4GS3 A;  3FKI G;  2HIV A;  3RN5 A;  2JEA I;  3A0J A;  1E1O A;  1VQK A;  1MIU A;  4X62 L;  4POF A;  2K5H A;  2UXC L;  1NTG A;  3RLO A;  2F52 A;  3KLW A;  1X56 A;  1GVP A;  3S1N H;  1PYS B;  4LFC L;  3K81 C;  3OTO L;  1YJN A;  4B3T L;  2N78 A;  4BXX G;  3CD6 A;  3CCU A;  1S40 A;  1J6Q A;  5GRO A;  1I94 Q;  3J80 c;  4DR3 L;  2IY5 B;  2A19 A;  1PH9 A;  4L5Q A;  1VQ6 A;  5IYC G;  3KDF A;  1X3F A;  2GN5 A;  5LMN Q;  4GKK Q;  2KEN A;  4GOP A;  1K0R A;  4J15 A;  1EQR A;  3U4V A;  4L5R C;  1JJ2 A;  5AJ3 Q;  3W5O A;  1Q1B A;  3CCL A;  4A3L H;  1VQG A;  1XMQ Q;  2E5L Q;  3AFP A;  3EN2 A;  4DK3 C;  1VQ9 A;  5M3F H;  5IYC H;  1N33 Q;  1S72 A;  1HJP A;  3JC6 6;  4OXP A;  3H3V I;  4HIO A;  1GKH A;  4B3M Q;  3L2P A;  1JT8 A;  2BA0 A;  2EXD A;  4YCW A;  1Q1E A;  1VQE A;  2YTX A;  3AYH B;  4YHH L;  4DV3 Q;  1WJJ A;  4JI0 Q;  4DV4 L;  4A3C G;  2R7F A;  3H0G G;  3J81 j;  3HOU H;  5IYB H;  5IP9 H;  1YI2 A;  1IZ6 A;  1L1O C;  4A3D H;  2R93 G;  3ER0 A;  3RZO H;  4DR2 Q;  1ASY A;  4FDB A;  5GQO A;  4X64 L;  4JBJ A;  2ID0 A;  4A3K G;  3I2Z A;  4NXN Q;  1QVF A;  1VQ7 A;  4WJ4 A;  2VUM H;  1CKN B;  1EWI A;  2QEX A;  2OQ0 A;  4DR2 L;  2NVX H;  2JA8 G;  1EIF A;  4IPC A;  3HOV G;  4C3I H;  1C0A A;  3E9I A;  3PIO A;  4LF9 Q;  1WCM H;  1KD1 C;  3G4S A;  1SMX A;  4JBK A;  2CCZ A;  4A3G G;  4C2M H;  4DV4 Q;  3U4Z A;  1PVO A;  4JI2 Q;  3CQZ H;  2ZJQ A;  3A74 A;  5JJK A;  4Y7N H;  4LF7 Q;  3GTP H;  3HOW G;  2R6G A;  2Z0S A;  3K0X A;  3KYH C;  3EBE A;  4BBR G;  3G71 A;  4A3E H;  2ES2 A;  4LF8 L;  1B7Y B;  1VQ4 A;  2I0Q A;  3HKZ G;  1X54 A;  2D0O A;  2VY3 A;  2OQK A;  5HY6 A;  1OTC A;  2JA6 G;  5IYD G;  4MZ9 A;  4A93 G;  3CCQ A;  2R7D A;  3I7F A;  3FKI H;  2JK8 A;  5IWA Q;  4C3H H;  1IBL L;  2I5L X;  1CKM A;  2E2H H;  2K14 A;  3SGI A;  1PFS A;  1OXX K;  4OWT B;  4B3S L;  4A3M G;  5IT9 c;  3CP0 A;  1XNQ L;  2HIX A;  2MQH A;  5FJ8 G;  1V43 A;  1PH2 A;  5IYD H;  4A93 H;  3GTL H;  4LUO A;  1B8A A;  1HZA A;  1SR3 A;  2HQL A;  4QIW E;  2XTI A;  4DKA C;  2VQF Q;  4OO1 G;  3LGJ A;  3NEL A;  3M7N A;  2LXK A;  3OTO Q;  4LF5 Q;  4B3T Q;  4JG2 A;  2JA9 A;  4BBR H;  3WWV A;  4A3E G;  1E7Z A;  1VCI A;  2ZTE A;  3PGZ A;  5IP7 G;  2MO1 A;  3PF5 A;  4EX5 A;  1VQJ A;  4NXM Q;  1JJG A;  1E22 A;  1N8R C;  4GN4 B;  1Q81 C;  3CMA A;  3ULP A;  1PH1 A;  1IBK L;  4A3D G;  2E2I H;  5C3E G;  3RR5 A;  4JOI C;  4YCV A;  4JBW A;  1P16 A;  4OWW B;  4GLV B;  1YBY A;  2UXD L;  1WFQ A;  1E1T A;  1Q12 A;  1L1O A;  4DV1 L;  1SN8 A;  1T9H A;  2DUD A;  1PH7 A;  1HNX L;  1CSP A;  3F1Z A;  1YNX A;  1X3E A;  5LMU Q;  1VQH A;  2GVB A;  3MXN B;  2AHO B;  4JI4 L;  4K0K Q;  5DLQ E;  4DV6 L;  1PH6 A;  3M4P A;  1XPO A;  1QZG A;  1XNR Q;  1K3R A;  4R4Q A;  1OXT A;  1VQ8 A;  4DV2 Q;  1VQ5 A;  1TWH H;  4DV5 L;  4DR7 Q;  1SRO A;  4GN3 B;  4IFD J;  1LUZ A;  3CPF A;  4A3L G;  1OXS C;  1VQA A;  4C3J H;  4AIM A;  2B63 G;  2UUC Q;  1HZC A;  4IJL A;  4HIK A;  4DR1 Q;  3BU2 A;  5E7N A;  1VS0 A;  3TRZ A;  5LMU L;  1XMO L;  2RF4 A;  1WOC A;  2CWP A;  3UDI A;  4BXX H;  1HZ9 A;  4YWK A;  4YY3 Q;  2LXJ A;  1K8A C;  4QJF A;  1EYG A;  3GDE A;  1HNW Q;  4A3B H;  3K7A H;  4BY7 H;  3F2C A;  4DUY Q;  4R4O A;  3TEH B;  1FJG L;  1Z47 A;  5JEA J;  3PO2 G;  4MTN A;  1N9W A;  4NXM L;  4DAM A;  5C44 G;  1Q8K A;  3I4O A;  1SFO H;  3GD7 A;  4LF4 L;  4B3R L;  4LF5 L;  4R1J A;  2I5H A;  1Q7Y C;  4KHP L;  1YHA A;  4A3F G;  1B70 B;  1XPR A;  1HH2 P;  4JI7 Q;  2UUB L;  4IJH A;  3I4N H;  4HJ8 A;  4NPS A;  3S14 H;  1NMF A;  1U5K A;  4RMF A;  4HID A;  2LSS A;  2CKZ B;  3K80 C;  5ELN A;  1PA6 A;  1BBW A;  2E8G A;  4QL5 A;  4A3C H;  1RL2 A;  3L0O A;  3RLF A;  5IWA L;  1A0I A;  2IHE A;  4JC0 A;  1X3G A;  3A5Z B;  2Q2H A;  2B3G A;  2N3S A;  2VS1 A;  3F8T A;  4PZ6 A;  4DK6 C;  3H15 A;  4R4I A;  1YIT A;  1JMC A;  3ICE A;  3I4M H;  1KHI A;  5BR8 Q;  1M90 C;  1PYB A;  4JI5 L;  4JOI A;  4IOC A;  1NE3 A;  2EIF A;  2KHJ A;  4AH6 A;  3HOX G;  2Q2I A;  1YJ9 A;  2UUB Q;  3U58 A;  2VNU D;  2PQA B;  1P8L A;  1JE5 A;  4XTC S;  1K83 H;  5EAY A;  3F2B A;  1KXL A;  4IPD A;  4JI2 L;  4A4I A;  1O7I A;  4GLA C;  5C4J H;  4B3R Q;  4KHP Q;  3CC4 A;  1BBU A;  3PUZ A;  3T1Y Q;  1QUQ A;  3G48 A;  4A3I G;  4WJ3 M;  2PNH A;  2VL6 A;  3HOY G;  5HGQ A;  2PI2 E;  5M3M H;  2Y0S E;  3J80 i;  3PV0 A;  3CAM A;  3J81 i;  5GAH C;  3KJP A;  2Y0S G;  3KDF B;  2JE6 I;  1HNZ Q;  4YY3 L;  1XPU A;  3CW2 C;  1SE8 A;  4GKJ L;  2KBN A;  4A3M H;  1D8L A;  2ZM6 Q;  4AQY Q;  2HHH Q;  1YHQ A;  3RN2 A;  2BH8 A;  1Y1V H;  4PMW A;  3NEN A;  2KCT A;  4DR6 Q;  1FVI A;  3STB C;  1LTL A;  3ULJ A;  3W1B A;  3NEM A;  1ASZ A;  3CCJ A;  1G51 A;  4YCU A;  1PH3 A;  2HT1 A;  5FLM G;  1PV4 A;  2UU9 Q;  3S17 H;  5IP7 H;  4X6A H;  4DV5 Q;  3GTO H;  2K5V A;  1R9T H;  4JBM A;  5K36 G;  3B6Y A;  3IRB A;  3ZJY C;  1BKB A;  1Q82 C;  4K0K L;  4HJ9 A;  1KL9 A;  3T1H Q;  4LF6 L;  3CXC A;  4OO1 I;  3U50 C;  4LNQ A;  1VQC A;  1PH5 A;  4X65 L;  1N33 L;  2VW9 A;  1J5E L;  3W1G A;  2AKW B;  4KI0 A;  2GVA A;  5M5Y H;  3OW2 A;  5GAG C;  2R92 G;  1PH4 A;  1XMQ L;  3KJO A;  4LUZ A;  2E5L L;  3I4M G;  5JJI A;  3CCR A;  2OCE A;  1L1O B;  1HR0 W;  2ASB A;  3UE1 A;  1IBK Q;  5IYB G;  5H1S E;  3HOZ H;  1WI5 A;  4KLK A;  3UE0 A;  4JI6 Q;  2NN6 G;  3J7Z C;  4IFD I;  1YJW A;  4O0A A;  4DR3 Q;  3UDG A;  1I94 L;  2RHQ B;  1LM0 A;  2IX0 A;  4DV0 Q;  4OWX B;  4LFB Q;  3GTQ H;  1TWF H;  3HKS A;  2WB1 E;  2DGY A;  2JEB I;  1GO3 E;  4LFC Q;  2VQF L;  3PO3 H;  4LW1 A;  4P72 A;  2IT1 A;  1JB7 A;  2JA5 H;  4YWL A;  4X62 Q;  1KRT A;  3RZD H;  4JI6 L;  3OYY A;  2NVY H;  1I5F A;  3PUW A;  4B3S Q;  1A62 A;  5IY0 A;  5C44 H;  1YIJ A;  2K50 A;  1EQQ A;  2OTL A;  2MFI A;  3UDF A;  2E2J H;  2OWO A;  3PO2 H;  3S2D H;  3RLN A;  3S1R H;  2AWN A;  3CCE A;  3H0G H;  4X66 L;  1W3S A;  3S15 H;  4DR5 L;  4OX9 L;  3PUX A;  1YHB A;  4A3B G;  4BY7 G;  1VQP A;  1IBM Q;  3CPW A;  2KHI A;  2JA5 G;  4JCV E;  2F4V Q;  1N32 Q;  4L5S A;  1CUK A;  2BH2 A;  1IXR A;  1Y1W H;  4A3J H;  5J3B A;  2D0P A;  2Z6K C;  3PUV A;  4DPG A;  2UU9 L;  3HOU G;  3CCV A;  1W2B A;  3M4O H;  3CC2 A;  5M5W H;  3M9B A;  4HJA A;  2YTV A;  4L5T A;  4QY7 A;  1KQS A;  3TS2 A;  3BZK A;  5ELO A;  4AYB G;  4A3J G;  3PF4 A;  1OXV A;  3ULL A;  4YWM A;  2PMZ E;  1NY4 A;  4AQY L;  4UP7 A;  1HR0 L;  4GKJ Q;  2OTJ A;  1AE3 A;  3E9H A;  1EUJ A;  4LWC A;  1HZB A;  1Y14 B;  2R92 H;  1E3P A;  5LMN W;  1HNZ L;  2NZH A;  3KF8 B;  4MNO A;  2K5N A;  3D0F A;  2XGT A;  2B29 A;  3GO5 A;  2YTY A;  4GN5 A;  1HR0 Q;  4LUV A;  3GTG H;  2B63 H;  1I6H H;  5FJ8 H;  4GNX B;  1XJV A;  4QQB X;  2WAQ G;  3E0E A;  3K8A A;  3GTM H;  3KF6 A;  2VQE Q;  3JAM c;  1AE2 A;  1SRU A;  1S3O A;  1UE1 A;  2PQA A;  4OON A;  1L0W A;  2A1A A;  4GOP C;  2UUA L;  1PH8 A;  1QZH A;  2CWA A;  2YYZ A;  5IE8 A;  1X6O A;  4JI0 L;  4POG A;  4IFD G;  1X9N A;  4DV3 L;  1I3Q H;  3S1M H;  2KCM A;  1N34 Q;  2UXB L;  2YV5 A;  1OXU A;  1TWG H;  1PHJ A;  1Y1V G;  1YVC A;  4B3M L;  2NVQ H;  4JI8 Q;  2L15 A;  4JI5 Q;  3GTK H;  5BR8 L;  3L7Z C;  5GAE C;  1NMG A;  1C7Y A;  4PZ7 A;  5FLM H;  4DR5 Q;  4OX9 Q;  1UEB A;  1X65 A;  3CCS A;  2PI2 A;  4X66 Q;  3S24 A;  4A76 A;  4A3G H;  3STB D;  3PIP A;  1N36 Q;  5AJ3 L;  4BY1 H;  2VZA A;  3PSI A;  3BJU A;  5LMN L;  1VQN A;  4GKK L;  4O2D A;  1GD7 A;  2JA7 H;  1EOV A;  3FP9 A;  1MKH A;  2JQO A;  2VUM G;  1CSQ A;  1UE5 A;  4BA2 I;  1KIX A;  2WB1 G;  4LFA Q;  4P71 A;  4DV0 L;  3S16 H;  3KFU A;  1A8V A;  1NJI C;  4JYA L;  4LFB L;  1JJC B;  4DV7 L;  1VQL A;  4DR4 L;  1LYL A;  1Q46 A;  3HOZ G;  5C3E H;  2UXC Q;  1TWC H;  5FLX c;  1FJG Q;  1UWV A;  4DUY L;  2CQO A;  2Z6K A;  4GLX A;  4IPH A;  3CCM A;  1HNW L;  1FL0 A;  4ALP A;  1Z9F A;  2V1C C;  4HIM A;  3M85 A;  4JV5 L;  4P74 A;  2A8V A;  1VQB A;  4NB3 A;  1VQM A;  1J5E Q;  3S2H H;  4X65 Q;  2FXQ A;  3HOW H;  3TQY A;  1YZ6 A;  1KRS A;  3MEF A;  5C0X G;  3T1H L;  1GM5 A;  4LF6 Q;  4QGU A;  5M3M G;  4A75 A;  4XIG S;  4HJ7 A;  2QGQ A;  3HKZ E;  3ERS X;  1XTD A;  2AWO A;  4PZ8 A;  2Q2U A;  3H3V H;  4DR7 L;  4HJ5 A;  4DV2 L;  5IP9 G;  1NBW A;  4PG3 A;  2ZTC A;  1G6P A;  5C0X J;  1XNR L;  4DR6 L;  4JI4 Q;  3M3Y H;  2N8N A;  5GAD C;  2AMC B;  1AH9 A;  3Q8D A;  4P75 A;  3HOX H;  2ZM6 L;  2HHH L;  2C35 B;  4A3K H;  1C9O A;  1Y1W G;  1DGS A;  1V1Q A;  3DM3 A;  3NBH B;  4P73 A;  4UP8 A;  1SLJ A;  5M5X H;  2ZJP A;  2K4K A;  3I4N G;  4JV5 Q;  4R4T A;  3EIV A;  3I55 A;  2IHF A;  2K75 A;  1VQD A;  4JI1 L;  3AEV A;  1VQF A;  4DUZ L;  5M3F G;  4UP9 A;  1M1K C;  1WCM G;  1CKN A;  4DAY B;  3HOV H;  4DR4 Q;  4DV7 Q;  3T1Y L;  2BA1 A;  1I50 H;  1BVS A;  4APV A;  1KC8 C;  3J7A 5;  4RG1 A;  3GTJ H;  4JYA Q;  4LFA L;  3FHW A;  5C4X G;  1L2F A;  1MJC A;  1TWA H;  3HFZ B;  4GNX C;  1E24 A;  2F3I A;  2RCN A;  3BZC A;  3PUY A;  4A3F H;  4KHZ A;  4EQ5 A;  1UE6 A;  3F2D A;  1XNQ Q;  3CF5 A;  3TRE A;  3CC7 A;  4JI3 Q;  2R93 H;  1X55 A;  1D7Q A;  1TXY A;  2ZJR A;  3VDY A; 
#chains in the Genus database with same CATH topology
 3DUZ A;  5DLF A;  4IR1 A;  3H0G B;  1I3Q B;  4CHT B;  1M4V A;  4EQP A;  3AQQ A;  3HG9 A;  5CV8 A;  4LH7 A;  4N9P A;  2W6O A;  3PO3 G;  3D4D A;  3MVV A;  1IL2 A;  2R84 A;  2K1B A;  3M4Q A;  5KT6 A;  2MNA A;  1EFW A;  3KF6 B;  3H3V C;  3R5H A;  4JI7 L;  1H95 A;  2GPS A;  5KFQ A;  2ZDG A;  2B2Y C;  2NTS A;  1JE4 A;  2LY7 A;  1RCV D;  1SJH D;  2UXB Q;  3HBL A;  5D14 A;  2UUA Q;  2IL8 A;  2EY5 A;  4HED A;  2NVT H;  2J6U A;  3R8B A;  3OIQ A;  3PCO B;  1S5D D;  1KAW A;  2YU9 H;  5T14 A;  2D62 A;  1ZHS A;  2QW7 A;  1FNW A;  2ALY B;  4GOP B;  1WTV A;  1DON A;  5JUM A;  4UPA A;  2VA3 A;  1XMO Q;  3TS0 A;  3DEP A;  1ROD A;  2E2I B;  1W93 A;  1UUP A;  3OUZ A;  2M00 A;  4RWS C;  4ZKB B;  2QKI C;  2F0P A;  3DMU A;  4IPG A;  1A63 A;  1KC7 A;  2UUC L;  2JYO A;  4G4K A;  1EOT A;  3JSN A;  2ASD A;  2XRQ D;  3LML A;  2F0Q A;  5JVG 3;  4KKS A;  4Y7N B;  3EYY A;  4DV6 Q;  2F4V L;  2ALZ A;  2WAQ E;  4GC6 A;  4A3J B;  1IBM L;  4H13 C;  3GTJ A;  4YBZ B;  1V9P A;  1WCM A;  4DA2 A;  2K52 A;  4KN7 C;  4DV1 Q;  3JAM E;  5C4X H;  1CKO A;  1G8Z D;  4GNX A;  2ATW A;  2NN6 I;  1UE7 A;  2MHV A;  4X62 H;  5KFT A;  2C2E A;  4JI0 H;  5DGA A;  3V96 A;  4X62 L;  2K5H A;  1HA5 A;  3NTK A;  5JPN C;  2UXC L;  3OHX C;  1NTG A;  1GHJ A;  3KLW A;  2VOB A;  1GVP A;  1II3 A;  5EOY A;  3S1N H;  1PYS B;  3FDT A;  3K81 C;  4LFC L;  1Z2P X;  2DPJ A;  4BXX G;  3CD6 A;  4DK0 A;  4O4L F;  1JOO A;  2VPS A;  2R7Z B;  5IYC G;  4X65 H;  4QWD A;  4GKK Q;  4FS2 A;  4GOP A;  4J15 A;  1EQR A;  5BN4 A;  1BCP C;  2NU7 B;  3IL8 A;  3NBH A;  4L5R C;  5KG2 A;  2DY8 A;  3N6R A;  1VQG A;  1XMQ Q;  2E5L Q;  5H80 A;  1B50 A;  2KSW A;  4UCO A;  3V4Z A;  1SEB D;  4Q5V A;  1STY A;  2FJZ A;  1S72 A;  4OXP A;  3H3V I;  1GKH A;  3NXW A;  4KV6 A;  4YQW A;  2AQ2 B;  4TQS A;  2PN1 A;  2N88 A;  1HTP A;  4ZAI A;  5IYB H;  4C3J G;  3I72 A;  4Z9C B;  4A3D H;  2R93 G;  3ER0 A;  1WTH A;  3CU7 A;  3KUP A;  5I9P A;  2JN4 A;  4DR2 Q;  3A56 A;  2Y0S B;  4JBJ A;  1B44 D;  3RZO B;  4AYB A;  2J4X A;  2WAQ A;  2VUM H;  4O3N A;  2OQ0 A;  4DR2 L;  2NVX H;  2JA8 G;  2VQF H;  3N8D A;  3R23 A;  1DCZ A;  2JA5 A;  1M7J A;  2NVY B;  5FOB B;  4JBK A;  3IN5 A;  4YP3 A;  3E3X A;  3QOL A;  3OSP A;  2DJF C;  3BA9 A;  4C1N K;  4LF7 Q;  3GTP H;  2R6G A;  4DU9 A;  3MFI A;  4MA0 A;  1VQ4 A;  4ED3 A;  4QUC A;  2I0Q A;  3NWT A;  2D0O A;  2ZJT A;  3F8N A;  4A93 G;  4JI5 H;  2KCN A;  3NP8 A;  3WO1 A;  4ZQI A;  4RGT A;  1STA A;  1CKM A;  3J81 L;  4BY1 B;  5IGD A;  3SGI A;  1PFS A;  3OOC A;  3MWM A;  1BDO A;  1V43 A;  5J39 A;  2NVT B;  4DKA C;  1HZA A;  2HQL A;  4QIW E;  1W96 A;  3RJ0 A;  3CQZ B;  3NEL A;  4LF7 H;  2Z9H A;  3KHG A;  3GIL A;  1Y1V A;  1E7Z A;  1VCI A;  2ZTE A;  3PGZ A;  3C2P A;  5C4H A;  4NXM Q;  1VQJ A;  3V05 A;  1EUD B;  3HS0 C;  1JJG A;  1PK8 A;  1Q81 C;  3CMA A;  4A3D G;  3NQT A;  1PH1 A;  2PVP A;  2E2I H;  4Q44 A;  3RR5 A;  5CA1 F;  2AGP A;  1P16 A;  1SNP A;  4GLV B;  3R2T A;  1E1T A;  4RZQ A;  2A6H C;  4DV1 L;  2XWB B;  4C56 C;  3RB6 A;  5J22 A;  5LMU Q;  1VQH A;  5KFD A;  1DM0 B;  3VR2 A;  2W8K A;  1EIG A;  4DV6 L;  1CT1 D;  1PH6 A;  1OXT A;  1S0M A;  1PFN A;  4DR7 Q;  1TWH H;  1SRO A;  4GN3 B;  3QFF A;  2RVL A;  3I4M B;  4AIM A;  2UUC Q;  1DOM A;  1PRT D;  2DY7 A;  2JA8 B;  4IAL A;  1VS0 A;  3TRZ A;  2HVQ A;  4LMY A;  1DJR D;  5LMU L;  1XMO L;  5KT3 A;  3T13 A;  4FF1 A;  4BXX H;  1HZ9 A;  2YS7 A;  5I47 A;  3T5J A;  3QG1 A;  4I50 F;  1ONL A;  3LX0 A;  2Z1C A;  3X3N A;  5KFR A;  1HNW Q;  1J8I A;  2BQU A;  4BY7 H;  3TP7 A;  2FP4 B;  1XMQ H;  4HR7 A;  2E5L H;  1F2L A;  2A6H D;  1GUT A;  4JV2 A;  1EU3 A;  1SE2 A;  4K2L A;  4Q0Y A;  5KKN B;  4KMU C;  4DR3 H;  3PO2 G;  4UCV A;  4MTN A;  4ED7 A;  4NXM L;  3FVQ A;  1SFO A;  1Q8K A;  2I5H A;  1JOR A;  4DAP A;  1YHA A;  4KHV A;  2B63 A;  1V1P A;  4JI7 Q;  1N34 H;  3M9M B;  2XN9 C;  3QWN A;  2L9H A;  1NCV A;  5FPR A;  1SNC A;  1U5K A;  3Q6S A;  5J1Z A;  2CQY A;  2CKZ B;  3H91 A;  2NTT A;  1KAA A;  4DAV A;  4RB1 A;  1BBW A;  3M7G A;  4JC0 A;  3MA2 B;  4PZ6 A;  1U9R A;  1YIT A;  5J2U F;  4QWC A;  1M6V A;  4LH6 A;  5EWG A;  2AGQ A;  1ZEQ X;  1M90 C;  4ECU A;  4JOI A;  2HQE A;  3VMM A;  1LT5 D;  4RKB A;  1F9P A;  4XTC S;  3F2B A;  4ECQ A;  4IPD A;  2SDF A;  1CM9 A;  5FLX E;  4KHP Q;  4MA5 A;  2A74 C;  2OLS A;  4F50 A;  1FNV A;  5FO7 B;  1QUQ A;  3PW2 A;  2UXD H;  1D2B A;  1NUC A;  1XYI A;  4IZO A;  2W8L A;  5IOC A;  5IWA H;  5DM6 3;  2FK3 A;  3J81 i;  5ISR A;  5GAH C;  3KJP A;  4A3K B;  1VDZ A;  3LWE A;  3KDF B;  3LWU A;  1HNZ Q;  5CV5 A;  1SE8 A;  2WII B;  3KBG A;  2HHH Q;  1SCU B;  2BH8 A;  3GTQ A;  3NE5 B;  3NEN A;  1STG A;  1B1Z A;  1XXG A;  3STB C;  1LT4 D;  4UDU C;  5CV6 A;  3K59 A;  1RJQ A;  3CCJ A;  1PX2 A;  4MV6 A;  5FLM G;  2UU9 Q;  3S17 H;  5IP7 H;  3S1R B;  2C9O A;  1XMO H;  4ME5 A;  3T1H Q;  3SK8 A;  3HOX B;  3GIM A;  3HKZ B;  4R8I A;  1PH5 A;  4ODG A;  1BBX C;  2AKW B;  1I4X A;  1EWC A;  2QCP X;  1E0B A;  3N42 B;  1TWF B;  1CI3 M;  1N32 H;  3EPG A;  3GTG A;  1XMQ L;  2E5L L;  4LUZ A;  1SMY D;  4J9S A;  3TZD A;  3QR8 A;  3CCR A;  4JW0 A;  1I4P A;  1IBK Q;  5IYB G;  5E3F A;  5KIX A;  4IR9 A;  3MWY W;  3UE0 A;  2NN6 G;  2BCO A;  1YJW A;  3DWQ A;  1PRT C;  1LT6 D;  5JAV A;  4DV0 Q;  5A2Q E;  3GTQ H;  1TWF H;  3HKS A;  4MHE A;  1A15 A;  4LFB Q;  4ME6 A;  4LFC Q;  5LMN H;  4HSP A;  4LW1 A;  4P72 A;  3TN2 A;  4CKB A;  1LTB D;  1Z6H A;  4YWL A;  2J0T D;  1KRT A;  4X62 Q;  1C8C A;  2SNS A;  4JI6 L;  3Q8S B;  2BE5 D;  2RCF A;  1V1P B;  4B3S Q;  5IY0 A;  5C44 H;  5KFW A;  2WTF A;  1KAB A;  2MFI A;  1G2S A;  2E2J H;  5D1O B;  4LF9 H;  3S1R H;  1B9M A;  4X66 L;  5EWF A;  2F0G A;  4OEM B;  4MTE A;  1HCZ A;  3ERQ A;  1X32 A;  4B3M H;  4HCE A;  1IBM Q;  4KTA A;  2JA5 G;  4A93 B;  2F4V Q;  5HBR B;  1ESF A;  4L5S A;  1IXR A;  5FO9 B;  5C5J A;  1RK5 A;  2F0F A;  1QJO A;  2JEI A;  5KFF A;  4DPG A;  5BN3 A;  3HOU G;  3CCV A;  1W2B A;  2L0C A;  1KLG D;  1R9T B;  4OHJ A;  5M5W H;  4CDE C;  4O3Q A;  1EY5 A;  1KQS A;  3TS2 A;  2UVU A;  2E74 C;  1AE3 A;  4QW9 A;  3FMA A;  1K83 B;  4RB3 C;  1Q90 A;  4MNO A;  1DXM A;  3H20 A;  1BF4 A;  2K5N A;  1GJX A;  4GN5 A;  1N33 H;  2EYP A;  3S2H B;  5M5W B;  2K05 A;  4LUV A;  1WH2 A;  2B63 H;  3GIP A;  1I6U A;  2WAQ G;  3E0E A;  3K8A A;  3GTG B;  2I8C A;  2AGO A;  3NUC A;  3JAM c;  1AP0 A;  2UUA L;  1QNU A;  1V4Y A;  4C3J B;  5IE8 A;  2L1B A;  2UXB L;  4DV3 L;  3S1M H;  1VMC A;  2KCM A;  1HNX H;  1IHZ A;  3GTP B;  4LFA H;  2ZM6 H;  1Y1V G;  2A6E D;  2W6N A;  5KFZ A;  3OPO A;  4EGQ A;  2NVQ H;  4KN4 C;  2L15 A;  1Y1V B;  1O80 A;  1HA6 A;  5FPO A;  4H44 C;  5LA6 F;  5JQW A;  1RD9 D;  4OX9 Q;  2DNE A;  4ZOL F;  5KX5 F;  1STH A;  3S24 A;  3K5N A;  4A76 A;  5D65 A;  2FB9 A;  5AJ3 L;  4UHV A;  1MBY A;  5IT9 L;  2B2U C;  4O2D A;  1EZ1 A;  4YAK B;  3FP9 A;  2HDM A;  1CQI B;  1I4H A;  2AUK A;  2F0N A;  2JQO A;  3WOF A;  3PIO 3;  5C1P A;  1CSQ A;  1RJT A;  1UE5 A;  4MTD A;  4BA2 I;  2WB1 G;  4XYO A;  1PVO A;  3S16 H;  3KFU A;  1A8V A;  5M5X B;  1NJI C;  1HNZ H;  1X3Q A;  3K58 A;  5FK9 C;  1TWC H;  5LL6 S;  2W70 A;  4PNY A;  3VYR A;  3SVM A;  2F0T A;  4IPH A;  4DL4 A;  2RGR A;  1I4R A;  3H94 A;  2KHS A;  5DEH A;  1CA6 A;  4CC6 A;  1O7L A;  4HIM A;  4JV5 L;  5JH7 F;  5HGT A;  4ECZ A;  1VQB A;  4X65 Q;  2PZW A;  5C0X G;  4PQX A;  3HOW B;  1MGS A;  1O7Z A;  3V2T A;  4C3H G;  3MXU A;  1KJI A;  3HZX A;  4APM A;  4L1K A;  4DV2 L;  1NBW A;  1JIC A;  2XGP A;  2B2W A;  4FXG C;  5T1I A;  1CQJ B;  4LAA A;  1GUO A;  1TKW B;  2EY6 A;  1C30 A;  1V1Q A;  4UP8 A;  1HFN A;  2DLN A;  5M5X H;  2L11 A;  3I55 A;  4K5V A;  4IFD H;  4B9W A;  2EYL A;  3ETJ A;  3K5H A;  4HR7 B;  4JI1 L;  3AEV A;  4DUZ L;  3J80 L;  3D6C A;  5M3F G;  3C46 A;  5ELB A;  1M1K C;  4Q8E A;  1WCM G;  4DAY B;  2ZXR A;  5LOV F;  2NUC A;  4DR4 Q;  4UCT A;  1EYA A;  4N8X 1;  2LS0 1;  4RG1 A;  4JYA Q;  4LFA L;  1H9K A;  1DZ1 A;  1L2F A;  2E75 C;  5CC4 A;  3S1Q B;  1E24 A;  3PUY A;  5ELD A;  1E4G T;  4UCS A;  1FNU A;  4EQ5 A;  1UE6 A;  4ZYS A;  1RYS A;  2F0V A;  4E4T A;  3CC7 A;  1WD1 A;  1D7Q A;  2UUB H;  4TUY F;  2K01 A;  5COR A;  4DR4 H;  1WTW A;  1Q86 C;  3V4S A;  1TY0 A;  2Z4I A;  1S5F D;  2KQ3 A;  2XIW A;  1EY0 A;  5C0X I;  2W6Q A;  5EKL A;  4JI3 L;  1K9M C;  2R82 A;  4IOA A;  2QA4 A;  2IWH A;  4LF8 Q;  4ME3 A;  1SYD A;  5K5P A;  4RKL A;  3TP6 A;  1N34 L;  2HVS A;  1QIL A;  3UDX A;  3A5U A;  2CH4 W;  1BQQ T;  5F2D A;  2J9G A;  1O78 A;  1K0S A;  1LTA D;  4LF9 L;  2L12 A;  3K3P A;  2OT2 A;  1GSA A;  1HXY D;  3GV8 B;  5KFJ A;  1GOZ A;  1JDE A;  3P75 A;  3RB0 A;  4IWY A;  1VQI A;  3S1Q H;  1BXR A;  1ZYR D;  2Q2T A;  2HJW A;  3A8K E;  2RSO A;  4FXD A;  4CDC C;  3M4I A;  1WSC A;  4NMZ A;  2WAC A;  1Y1W B;  5F9L A;  4XYQ A;  3SHL A;  3CME A;  4DR1 L;  3P7J A;  5KG1 A;  3AFQ A;  2R93 B;  3HOY H;  4X3U A;  4BBS G;  1LLR D;  2NZO A;  1QB5 D;  5C5M A;  3G6E A;  3WNZ A;  2R7Z G;  4C2M A;  4MN3 A;  2B2T A;  1YEZ A;  2H5X A;  5KG0 A;  2D2C C;  5C4X B;  2B2V A;  3P20 A;  1RIP A;  3E5S A;  2ICE C;  4BA1 I;  4YR3 A;  2UXD Q;  2WDT A;  1GUW A;  3JRX A;  3JAM i;  3OUU A;  4GS3 A;  1PZI D;  2NVX B;  3FKI G;  1BCP F;  1B33 N;  5CBA E;  2HIV A;  3KBX A;  4ECS A;  5EKK A;  5EJW A;  5LXT F;  1N48 A;  1VQK A;  2HGS A;  1I3Q A;  5E4X A;  5KFV A;  4C3I G;  3RLO A;  3MAQ A;  3BQ0 A;  3OTO L;  5C1O A;  2PW7 A;  4PMC A;  1EY8 A;  3J80 c;  5KFL A;  4A3M B;  2IY5 B;  2A19 A;  2FK1 A;  1CHP D;  4L5Q A;  3BAB A;  3KDF A;  1MSG A;  1X3F A;  5LMN Q;  2YU9 A;  1NR2 A;  1D1I A;  3U4V A;  2B2Y A;  1YNJ C;  3CCL A;  3Q24 A;  2R3Z A;  2K5Q A;  3EN2 A;  4DK3 C;  3IFT A;  3VR3 A;  4IUQ A;  5M3F H;  3HOU B;  5BMV F;  1N33 Q;  4JI2 H;  1NAP A;  2DIK A;  5L1I A;  3H09 A;  4HIO A;  3R5F A;  1KJJ A;  3L2P A;  3LWB A;  3TIN A;  4RUA A;  4MTK A;  1JT8 A;  5EPL A;  1FGB D;  4X3K A;  2EXD A;  1HTL D;  1Q1E A;  2YTX A;  1AZP A;  3AYH B;  5ELC A;  3BQ1 A;  3U9O A;  2TMP A;  3HOU H;  4A3I B;  1IZ6 A;  5KFX A;  2BOS A;  4DNR B;  3RZO H;  4IRD A;  3J81 E;  4YY3 H;  1H9J A;  4FDB A;  4A3K G;  2EJG C;  3I2Z A;  1QVF A;  3PW5 A;  1VQ7 A;  2W7P A;  1CKN B;  1EWI A;  2QEX A;  1EIF A;  1ICW A;  3SEB A;  4DL7 A;  1IYU A;  5KYL A;  4C3I H;  3E9I A;  3PIO A;  4LF9 Q;  3M9N B;  4DK1 A;  3KK7 A;  5KFC A;  4GKJ H;  2CQA A;  4C2M H;  3U4Z A;  3CQZ H;  1TA8 A;  1ILP A;  1HRJ A;  3R5X A;  5IIF A;  3HOW G;  2Z0S A;  1SBB B;  2WKD A;  5DQH A;  4BBR G;  4LF8 L;  4OL7 A;  5K36 H;  1LV9 A;  1X54 A;  3HKZ G;  1WR2 A;  2AQ4 A;  1AW7 A;  2VB2 X;  2MGS A;  2XCL A;  1B53 A;  4B9X A;  1OTC A;  2JA6 G;  2R7D A;  3BVG A;  3VPC A;  1YNN D;  1CA5 A;  1KNE A;  3VR5 A;  1IBL L;  2E2H H;  4DR6 H;  5KFI A;  2V9W A;  5BPH A;  1S10 A;  1OXX K;  1ET6 A;  4A3M G;  1AFP A;  2MQH A;  1RK6 A;  3L9A X;  5IYD H;  3GTL H;  3OTO H;  3HRZ C;  2XTI A;  2QDL A;  4JI4 H;  1DV1 A;  3K3V A;  3LGJ A;  1HUM A;  2OF1 A;  4DAY A;  3MEH A;  4JG2 A;  4B3T Q;  1GYF A;  4A3E G;  4LF4 Q;  5IP7 G;  1Z2O X;  3T5K A;  1F9S A;  3PF5 A;  1JKJ B;  2HVR A;  4CKE A;  1WTQ A;  1GXD C;  4K8J A;  5IOD A;  1B4O A;  3O13 A;  2FJ2 A;  4NXM H;  1PTO D;  4YCV A;  3BDC A;  1SYF A;  4IUT A;  1M8A A;  2I46 A;  1SN8 A;  1T9H A;  2DUD A;  3E6Z X;  2FE3 A;  1HNX L;  2KA7 A;  2DNC A;  3AMU A;  4K6D A;  3KAJ A;  2CVR A;  2KVM A;  3H0G A;  3PO2 B;  2YW2 A;  2EVB A;  1FJG H;  1K3R A;  3DHQ A;  4R4Q A;  4DN4 M;  5KFY A;  4ECW A;  4DV2 Q;  4IFD J;  4KY5 A;  1A3V A;  4CDF C;  1HZC A;  4HIK A;  5EWE A;  2K5D A;  5KFP A;  1CTM A;  2F0J A;  5E7N A;  2M9V A;  5KT5 A;  2MJ8 A;  1GUS A;  2RF4 A;  1WOC A;  4LK1 C;  1JWS D;  3LNN A;  4ZQ3 A;  2LXJ A;  3OWF A;  1AEX A;  1EYG A;  1EQT A;  1TWG A;  2RDH A;  3F2C A;  2C2D A;  1PFM A;  1LTI D;  3AU7 A;  5NUC A;  4MV3 A;  3IG0 A;  1I4Q A;  5KFN A;  1RYR A;  3TME A;  5I2X A;  1WVL A;  5C44 G;  3NK9 A;  3I4O A;  1Q7Y C;  4A3F G;  1B70 B;  2HD3 A;  2V4D A;  1HH2 P;  3D8G A;  1CFM A;  4EEQ A;  2XCA A;  5C6A A;  3JRW A;  4NPS A;  2NBF A;  4X66 H;  3S14 H;  1NMF A;  3CRK C;  4TQR A;  2K5W A;  3K6O A;  2AQ1 B;  3K80 C;  3VYT A;  4J9L A;  1K8O A;  3MWE A;  1RHP A;  2E8G A;  2WV6 D;  4QL5 A;  2EE1 A;  4A3C H;  4DK6 C;  3ICE A;  4HMI A;  2G5D A;  1PYB A;  2KJX A;  4LF4 H;  3T5H A;  3VA7 A;  2KHJ A;  1AZQ A;  4G57 A;  5C5L A;  3PW4 A;  5HV6 A;  5EAY A;  1TWC A;  2W6P A;  3MXN A;  2YL2 A;  1W6K A;  5KG3 A;  3CC4 A;  3T5L A;  2FKL A;  2FLP A;  3G48 A;  4JI1 H;  2J7Z A;  4ZKC B;  1K83 A;  2PI2 E;  3EQL C;  2Y0S E;  4TKO B;  3PV0 A;  4ID6 A;  3J80 W;  2Y0S G;  1B2T A;  2RKS A;  1XPU A;  3ETH A;  1AN7 A;  1YNJ D;  1BOS A;  4A3M H;  3X3M A;  2FMA A;  1GSO A;  2VXW A;  5A2Q L;  4PMW A;  4UCR A;  4DL3 A;  3RBD A;  5C3E B;  2ATL A;  3ULJ A;  3K0Y A;  3T51 B;  1C4Q A;  2M2L A;  2B8G A;  1G51 A;  1SYC A;  5C4Z A;  4G7Z C;  1PH3 A;  1PV4 A;  4L6T B;  4FYD A;  4X6A H;  2PYK A;  3GTO H;  3T1H H;  3T1Y H;  1R9T H;  3RAQ A;  5K36 G;  1TWA B;  1E4E A;  1BKB A;  4HN7 A;  4HJ9 A;  1KL9 A;  4JPB W;  1DYQ A;  3U50 C;  4IRC A;  2BQR A;  5KEE A;  1J5E L;  4KI0 A;  5DG7 A;  3OW2 A;  2VUM B;  4FXK C;  2F4V H;  5GAG C;  2BR0 A;  4IUU A;  1U4P A;  1PH4 A;  1EUC B;  3K5M A;  4Q0F A;  4X3T A;  3HXL A;  1HR0 W;  1ZYR C;  3HP3 A;  2Q8R E;  3UE1 A;  3OSO A;  5D8D A;  5H1S E;  1WI5 A;  4JI6 Q;  3J7Z C;  1UNN C;  1ET9 A;  2F0M A;  2WYO A;  1D5M C;  2IX0 A;  1EQV A;  5AFW A;  4RB2 C;  3S1M B;  2WB1 E;  2DGY A;  1GO3 E;  3Q8R B;  1CZG A;  3PO3 H;  4GKK H;  5FD5 A;  2UXC H;  3TIG A;  2IT1 A;  1JB7 A;  3RZD H;  3U9T A;  3GV3 A;  3OYY A;  3RFC A;  2NVY H;  1I5F A;  4C3I B;  4O3O A;  4DV7 H;  1I6H B;  1L0Y B;  1A62 A;  1VF5 C;  1YIJ A;  3IKJ A;  2WB1 A;  3I73 A;  3PO2 H;  4DV3 H;  2GPW A;  3UFX B;  3S2D H;  3RLN A;  2AWN A;  4OIJ A;  1W3S A;  3J7A V;  3S15 H;  4BY7 G;  1UC8 A;  1YHB A;  4G7H C;  3RD4 A;  4FF3 A;  3I4N B;  4DV4 H;  2JSO A;  4EGJ A;  3L4K A;  1DIK A;  1N32 Q;  2FIN B;  4M1U B;  4NW2 A;  2VQE H;  3E0J A;  2ASJ A;  2Z6K C;  3E5N A;  3PUV A;  4O2A F;  4HAE A;  2UU9 L;  2FLL A;  3BS1 A;  2JEG A;  1LTR D;  5FKA C;  3CC2 A;  1XDN A;  2QEJ C;  4L5T A;  1TWF A;  3BDO A;  1W6J A;  3SK4 A;  5CBE E;  2NVQ B;  5ELO A;  4A3J G;  4ECR A;  2K33 A;  3PF4 A;  3HOZ H;  4FNF A;  4YWM A;  2PMZ E;  1A3U A;  4OGQ C;  1HR0 L;  3GTL B;  4K2K A;  5D1O A;  4LWC A;  2R8H A;  3NTI A;  3ERO A;  1HNZ L;  2NZH A;  4ETS A;  2W6M A;  1JR0 D;  1MZB A;  3D0F A;  2XGT A;  2B29 A;  3GV6 A;  2YTY A;  3GTG H;  1I6H H;  1XJV A;  4TV8 F;  4AQY H;  3VPB A;  1RJP A;  2VQE Q;  4KKU A;  4PWQ A;  1AE2 A;  2Z6B A;  2X0S A;  3ITP A;  4POG A;  1PH8 A;  2B8F A;  2YYZ A;  3URY A;  2WKC A;  5I9O A;  1X9N A;  3BAA A;  1I3Q H;  4O3S A;  2YV5 A;  4L8J A;  1PHJ A;  3H4D A;  2A69 C;  1YVC A;  1SYB A;  5CR3 A;  3GTK H;  4M8A A;  4XZ3 B;  5EQ0 A;  2VB3 X;  4AYB B;  4PZ7 A;  4ECY A;  4DR5 Q;  3CCS A;  1UAP A;  3HKZ A;  3ND9 A;  3GIQ A;  4F4X A;  3PVX A;  5KFO A;  4CJ2 C;  3N41 B;  3Q8Q B;  4RAY A;  5CA0 F;  5LMN L;  1H9M A;  1WTO A;  1GD7 A;  2JA7 H;  3NPP A;  5DGB A;  4JI6 H;  5LYJ F;  3I12 A;  3QJY A;  2VUM G;  3S16 B;  3C0F B;  2FLN A;  4RB0 A;  1KIX A;  3GP7 A;  1PLF A;  2L5T A;  3M4O B;  2R8J A;  4JV5 H;  1VQL A;  1EWH A;  4DV7 L;  1LYL A;  1Q46 A;  3A55 A;  1IKM A;  3NBI A;  5CAE B;  3V6K A;  5FLX c;  2C2R A;  1K1Q A;  2GLT A;  1HNW L;  3J80 E;  1FL0 A;  1E2V A;  1Z9F A;  1S68 A;  4XYM B;  3K5L A;  3IAY A;  3HOW H;  3TQY A;  3MEF A;  1KRS A;  1R4Q B;  4LF6 Q;  1GUG A;  4F4Y A;  4QGU A;  5M3M G;  5IGC A;  3CHB D;  4O1N A;  3ERS X;  4N8F A;  4PZ8 A;  2RDF A;  4PMB A;  4EYI B;  3ND8 A;  5IT9 E;  1RDP D;  5M9O A;  4DR7 L;  3N52 A;  4Q43 A;  4PG3 A;  4KD4 A;  1G6P A;  2FMC A;  4DR6 L;  4R8U B;  3M3Y H;  2N8N A;  3Q8D A;  3HOX H;  4XX0 B;  2ZM6 L;  4QW8 A;  4A3K H;  1C9O A;  1HFG A;  1TR5 A;  3KLS X;  4P73 A;  2AUJ D;  2EYH A;  4P2C B;  1G2T A;  5DQI A;  2K75 A;  1UEA B;  2RQX A;  1VQD A;  3MC0 B;  4RUC A;  2Z8L A;  1RTO A;  5L37 A;  1CKN A;  3T16 A;  3M3Y B;  3PN1 A;  1B3Q A;  3A7A B;  2YRW A;  5DG9 A;  3RZD B;  4I55 F;  4DL6 A;  3T1Y L;  2BA1 A;  2PCF B;  1BVS A;  4QB4 A;  3I3C A;  4APV A;  1KC8 C;  1K1S A;  4YAJ B;  4DUY H;  4PV1 C;  3MR6 A;  5C4X G;  3A7L A;  4WOR A;  2RCN A;  3BZC A;  5CV9 A;  1B3A A;  4KHZ A;  3S15 B;  1TWH A;  4OIK A;  2W6Z A;  4JI3 Q;  4NDX A;  1FKA H;  1N36 L;  2EYM A;  1ULZ A;  4IHJ F;  1QVG A;  2KEC A;  1MJE A;  4MIU A;  2I5M X;  4J9Q A;  3I56 A;  1KTK A;  4B3T H;  2IX1 A;  4JI8 L;  3RNU A;  2CFM A;  1IYJ B;  3N43 B;  2EQS A;  4KKT A;  1UNS A;  3BG5 A;  4LF7 L;  1EYC A;  1Y8P B;  3V6H A;  4FBT A;  1HPC A;  1TQO A;  3KOJ A;  2R87 A;  1CHQ D;  1SNM A;  5EPJ A;  3NQI A;  3JAM L;  1IW7 D;  4CJ0 B;  2CW7 A;  4A3I H;  3NSW A;  1DV2 A;  1NNX A;  1WYD A;  2UVR A;  4DUZ Q;  4JI1 Q;  4I65 A;  4RHS A;  2WFW A;  1DD2 A;  4ED8 A;  1BCP D;  4EBC A;  4X3S A;  4C1N I;  2MP1 A;  3MWD A;  1QOH A;  2R7Z H;  4DLK A;  5DAU A;  1Q8I A;  2LMC B;  1VQO A;  1EIY B;  1G29 1;  4H02 A;  3HOY B;  4FVM A;  4IO9 A;  4K8I A;  4AYB E;  3K7U C;  1PMR A;  4YR0 A;  3T53 B;  2WP8 J;  1IL8 A;  4ZUI A;  4DR5 H;  1QUQ B;  4QMG A;  2RHS B;  3GTP A;  4JK1 C;  3J81 c;  3W3A A;  3SI8 A;  4LSX A;  4TV9 F;  2IPK D;  1JLL B;  3V6J A;  2JJQ A;  1T3N A;  2VR1 A;  1JWU D;  3EVQ A;  2W7O A;  4UCU A;  1JWM D;  3JAM W;  4BBS H;  2NVX A;  4N9T A;  1PTO C;  1TU2 B;  1B9N A;  2G9D A;  4MV8 A;  3RN5 A;  2JEA I;  3A0J A;  3HB9 A;  1TT2 A;  3DEO A;  1MHW C;  5JPM C;  2FMM A;  2FFK B;  1Q3L A;  1G91 A;  3QOJ A;  3GIJ A;  1YJN A;  4RH6 A;  3QB3 A;  4QWA A;  1S40 A;  5C8Y F;  1DOL A;  1XTC D;  4DR3 L;  1I94 Q;  2W57 A;  2IW3 A;  2TSS A;  2YZN A;  4ZK9 B;  3AB9 A;  1K0R A;  2W9C A;  2XD4 A;  5AJ3 Q;  3W5O A;  4HNV A;  4EYH B;  1MD2 D;  4A3L H;  3AFP A;  5KFA A;  2RA4 A;  2R61 A;  2SNM A;  1I7N A;  2QF7 A;  3QZ8 A;  2A68 D;  4ZRZ A;  1HJP A;  5EBC A;  4J1M A;  2F0L A;  3VYS A;  2CHB D;  4JUZ A;  2BA0 A;  3G6X A;  3KAL A;  5I2Y A;  2DJG C;  4DV3 Q;  4ZCK A;  1WJJ A;  2X69 A;  4K5W A;  4DV4 L;  1IYV A;  2R7F A;  3H0G G;  5IP9 H;  4ULL A;  1L1O C;  3CVZ A;  1L0X B;  4QIW B;  4FF2 A;  3BZD B;  2ZDQ A;  1YNN C;  4KY6 A;  4IRK A;  2WB1 B;  2JA7 B;  5I4D A;  1ASY A;  5IYZ F;  1S0O A;  2JA7 A;  2UVW A;  1RTN A;  2B2T C;  1KBL A;  1C0A A;  1Z7T A;  4ILW A;  1WCM H;  1KD1 C;  4FO2 A;  3VPD A;  1I50 A;  1BCP B;  4TSS A;  3FRP B;  5LHY 1;  2CCZ A;  1QE6 A;  4DV4 Q;  4JI2 Q;  3I4L A;  2ZJQ A;  4KJO A;  4JV1 A;  4LF5 H;  4A3E H;  3EBE A;  2UXB H;  1HR0 H;  2Z4H A;  1S4Z A;  2K32 A;  3KF8 A;  2QK4 A;  2VY3 A;  2OQK A;  5IYD G;  4MZ9 A;  4XDX A;  1F2Y A;  3I7F A;  5IWA Q;  4QCL A;  4C3H H;  4RGO S;  1MSH A;  3QIA A;  4OWT B;  4B3S L;  3D6W A;  5IT9 c;  5FJ8 G;  5KG5 A;  1PH2 A;  2JXM B;  4LUO A;  1PFB A;  1B8A A;  1SR3 A;  4F8M A;  4ZUJ A;  1CQV A;  1F2M A;  5DM7 3;  5C4J B;  3M7N A;  2SOB A;  4LF5 Q;  1PTO H;  2JA9 A;  3UI2 A;  4K6L A;  4BBR H;  2VUG A;  4H0L C;  2MO1 A;  4EX5 A;  2M05 A;  2XIG A;  1E22 A;  4GN4 B;  1SMY C;  1IBK L;  2MCT A;  5KT7 A;  4EFB A;  1TVX A;  3OMC A;  1F9R A;  4RGM A;  4NKL A;  4OWW B;  4J9N A;  3PR4 A;  3FKI B;  1ENC A;  1WFQ A;  3ONA B;  1Q12 A;  4JI8 H;  4JVZ A;  2N55 A;  3GTQ B;  4DXF A;  3VA5 A;  1CSP A;  3F1Z A;  1C48 A;  1YNX A;  1DOK A;  2F1M A;  5COY A;  4QWE A;  3MXN B;  4M7E A;  2K6A A;  3M4P A;  3TZU A;  1XPO A;  1O75 A;  4I4T F;  1B6S A;  3DF7 A;  2O03 A;  1VQ5 A;  3SK5 A;  1LUZ A;  3CPF A;  4A3L G;  2NVY A;  4YB8 B;  2B63 G;  1V51 A;  4IJL A;  4ZI7 F;  3BU2 A;  2EXZ A;  4CC5 A;  3IFD A;  4DL2 A;  2BQ3 A;  1XNQ H;  2CWP A;  4BBR B;  1U4M A;  1PRT B;  1C3O A;  2XC9 A;  2KUM A;  3BG3 A;  1T5X D;  3I90 A;  1LTS D;  4O4I F;  5L9X A;  4KHP H;  3PMF A;  1Z47 A;  1MI2 A;  1STB A;  2L55 A;  1SFO H;  4KHP L;  4LF5 L;  4R1J A;  1HQM C;  3PQI A;  1VMP A;  1QG7 A;  4IJH A;  4MAM A;  2QDB A;  3PO3 B;  1R9T A;  2SCU B;  4RMF A;  5JVD F;  3PW7 A;  1PYW D;  2BDO A;  1R4P B;  5ELN A;  3GQC A;  1RL2 A;  5IWA L;  3WWV A;  1ZHQ A;  1X3G A;  3A5Z B;  2Q2H A;  1JIH A;  2VS1 A;  3F8T A;  1JMC A;  1EZ8 A;  4A3D B;  4IUV A;  4BWG B;  3I4M H;  1KHI A;  5BR8 Q;  2P5Z X;  2NWG A;  4IOC A;  1NE3 A;  4AH6 A;  2IP4 A;  3RF2 A;  5M3M B;  2ZDH A;  3HOX G;  1YJ9 A;  3OHA A;  3BVZ A;  3KAK A;  3U58 A;  1P8L A;  4GC7 A;  1K83 H;  1KXL A;  4XT3 B;  4JI2 L;  4A4I A;  2V4Q A;  1O7I A;  2XNA C;  3PUZ A;  3T1Y Q;  2QYZ A;  4RGN A;  5JEA H;  5D1P A;  4WJ3 M;  4A3I G;  2PNH A;  4S3S A;  1PTO F;  2VL6 A;  1RF2 D;  1KJ8 A;  2PMZ B;  3HOY G;  4U6P A;  3I91 A;  5M3M H;  4RU9 A;  3J80 i;  1WCM B;  4F4Z A;  3CAM A;  3G6Y A;  2F0S A;  1S0N A;  1A2U A;  1JC7 A;  4PDB A;  2FPP B;  4BWS C;  2KBN A;  4FU0 A;  2ZM6 Q;  2NN6 H;  1YHQ A;  3RN2 A;  1Y1V H;  2KCT A;  4DR6 Q;  1FVI A;  1GSH A;  3NEM A;  4F88 A;  4MV1 A;  1SDF A;  3MFG A;  4YCU A;  2PZU A;  4ABN A;  2HT1 A;  2NZ1 D;  2W9B A;  2LKV A;  2K5V A;  1KDC A;  3IRB A;  2W9B B;  4J9P A;  5F9N A;  4LF6 L;  4OO1 I;  3CXC A;  3PZP A;  1PXU A;  2VW9 A;  5GON F;  3KJO A;  3Q23 A;  4A3B B;  3NHH A;  3L4J A;  1ZKO A;  2OCE A;  1EY6 A;  1LTG D;  2R8K A;  1SJE D;  2F0H A;  1PDQ A;  5D3I B;  2PBZ A;  4DR3 Q;  1I94 L;  2RHQ B;  1LM0 A;  4R8N A;  3MR3 A;  4OWX B;  1KEE A;  3QZ7 A;  5EGT A;  3BVM A;  2JEB I;  4YIJ A;  2P0A A;  4RAU C;  3J7Y W;  1HNW H;  3KHH A;  2JA5 H;  4V19 0;  1SYX B;  3ZYY X;  4OEL B;  4EQN A;  2VUM A;  4J9K A;  4HMJ A;  4UFZ A;  2K50 A;  4JYA H;  3BYY B;  3H6M A;  2PPB C;  2YZM A;  4HTH A;  2OWO A;  4XT1 B;  2JA6 B;  4O4H F;  3CCE A;  3H0G H;  4B3S H;  2EZV A;  4DR5 L;  4A3B G;  1JOQ A;  3OIP A;  1VQP A;  5JVL A;  3EA6 A;  2UVV A;  4EGV A;  3CPW A;  4JCV E;  3HGB A;  3TP8 A;  1AUX A;  3MXG A;  2BH2 A;  3J81 W;  4A3J H;  4A2A A;  5J3B A;  2C00 A;  3DM1 A;  4MV4 A;  5LMU H;  5I6W A;  2FK2 A;  3NWS A;  3M4O H;  3Q2O A;  3C3L A;  4HJA A;  2YTV A;  4FP5 D;  5IGF A;  2F0I A;  1XX8 A;  3BZK A;  4CKC A;  2AU0 A;  1OXV A;  3ULL A;  3TBI B;  4AQY L;  2DZD A;  2OTJ A;  4GKJ Q;  1QWY A;  2H1E A;  3E9H A;  2V5A A;  1HZB A;  2JEJ A;  3GTL A;  1E3P A;  5LMN W;  2R85 A;  3T56 B;  2WE6 A;  1J9O A;  3WO0 A;  2QIL A;  4UAI A;  4OO1 H;  3GO5 A;  3J7A F;  1HR0 Q;  1BJT A;  5KNB A;  1QCB D;  1UC9 A;  4GNX B;  3RBE A;  5KFH A;  2CW8 A;  2RDJ A;  4IQZ A;  2PQA A;  1L0W A;  4OON A;  5HUR A;  3K5O A;  1QZH A;  2W71 A;  2ZT9 C;  2LFN A;  1A6X A;  3S1N B;  1OXU A;  1B6R A;  2HHH H;  4MV7 A;  1PZJ D;  2F3W A;  4JI8 Q;  4CJ1 B;  4XQN A;  1TII D;  4JI5 Q;  1JXL A;  1C7Y A;  1EIH A;  1S5C D;  2XGQ A;  3JZI A;  1UEB A;  1X65 A;  2KCC A;  2PI2 A;  3J7A K;  2C5C A;  3S9W A;  2F0E A;  4A3G H;  1D5Z C;  5CB4 F;  1N36 Q;  1SSO A;  2HDL A;  2A5H A;  5CYU A;  1KNA A;  4GKK L;  1VQN A;  2R86 A;  3TQT A;  1IBL H;  1IKL A;  1AN8 A;  1MKH A;  2RGV A;  5KND A;  2HUG A;  2G9H D;  4P71 A;  5G3L D;  3DWP A;  3GV5 B;  5CV4 A;  5KG6 A;  1JJC B;  1TS2 A;  2UXC Q;  2F0U A;  3HOZ G;  5DG8 A;  3TP5 A;  4YHH H;  2DN8 A;  1UWV A;  4DUY L;  2Z6K A;  1FJG Q;  2B63 B;  3KTM A;  2EY1 A;  3CCM A;  1I7L A;  3N6X A;  3C1F A;  1OO9 B;  5KRU A;  4ALP A;  2V1C C;  4LSA A;  4HYK A;  5BN5 A;  2A8V A;  4NB3 A;  2IMW P;  1J5E Q;  1WD0 A;  2FXQ A;  4K5X A;  4K14 A;  1YZ6 A;  5JOB A;  1GM5 A;  4XIG S;  2QGQ A;  3GIK A;  3HKZ E;  1K28 A;  1XTD A;  2AWO A;  1VF7 A;  4RAZ A;  2OEO A;  3H3V H;  2K28 A;  2EYO A;  2ZTC A;  5C0X J;  1XNR L;  4GZY C;  4KJN A;  4JI4 Q;  5GAD C;  2AMC B;  1AH9 A;  4P75 A;  2NU6 B;  4Q8F A;  2CZG A;  1XNR H;  3DM3 A;  2ZJP A;  5ELE A;  2K4K A;  2F0D A;  3I4N G;  3EIV A;  5IGB A;  2IHF A;  1A2T A;  3BQ2 A;  2B39 A;  1ENF A;  1VQF A;  4A3F B;  4BBS B;  4UP9 A;  2UUC H;  3N40 P;  1STE A;  2PQE A;  1FYC A;  1GUN A;  4DV7 Q;  2A73 B;  4FBU A;  4DL5 A;  1I50 H;  2K03 A;  2HCC A;  1IW7 C;  2RDI A;  1WTR A;  1T36 A;  3OSN A;  1TWA H;  1MJC A;  4XXE A;  4GNX C;  3U9S A;  2F3I A;  4A3F H;  2FHT A;  1XNQ Q;  4G3I A;  2O4X A;  1V8Q A;  2R93 H;  2FPI B;  1X55 A;  3FPP A;  1SXT A;  3VDY A;  4ED1 A;  5BPF A;  4J9M A;  2F0W A;  1LAC A;  4TQU S;  2WAQ B;  1QVC A;  2MO0 A;  2E2D C;  3RB4 A;  3OMG A;  4U67 3;  3DLL A;  4FF4 A;  5JJL A;  3TQ1 A;  4O3P A;  3EJI A;  2VPQ A;  3RTX A;  1KDA A;  1E2W A;  1IOW A;  2D5D A;  3MJF A;  1FGU A;  4Y52 H;  1TWH B;  1RKN A;  2NU9 B;  1BXT A;  4DNI A;  4HNU A;  5I6Y A;  3K7A B;  4TVA B;  3D31 A;  4RHR A;  2VQE L;  4WBN F;  1SNO A;  1JQY D;  3L3O C;  1H9R A;  3S2D B;  3TII A;  5LL6 b;  2ZTD A;  2N49 A;  2PNR C;  1K8G A;  2BDN A;  4NXN L;  4X64 Q;  1SNQ A;  1KLU D;  1TAE A;  2JA5 B;  3FKI A;  5KFU A;  5KG4 A;  4UY8 C;  3EPI A;  4BY1 G;  5CGK A;  2JA7 G;  1Z2N X;  4G7O C;  4NXN H;  3BDL A;  2YCH A;  5KFS A;  1S5E D;  2ZXP A;  5M3F B;  3D4R A;  3A8I E;  2JA6 H;  4YHH Q;  4OX9 H;  1PZK D;  3GV7 B;  3SE0 A;  1JB3 A;  1U0L A;  1K73 C;  2MUY A;  1XWE A;  2JA8 H;  2R6F A;  1N32 L;  1LO5 D;  3DWA A;  1FD7 D;  2FPG B;  1HNX Q;  5M5Y B;  4R4C A;  1STN A;  3P1H A;  3R93 A;  5JEA G;  3H40 A;  1GLV A;  1OWT A;  4IN3 A;  3SK6 A;  2RDG A;  2R7M A;  3KHL A;  1SAP A;  4RNN A;  1E1O A;  1JX4 A;  1MIU A;  4POF A;  1F2Z A;  1SE3 A;  2VA2 A;  2F52 A;  3N44 B;  1X56 A;  4B3T L;  4IWX A;  3A54 A;  2N78 A;  3GTM A;  3SE7 A;  3CCU A;  1J6Q A;  5GRO A;  4EEY A;  2R7Z A;  3PW0 A;  1SYE A;  3C1E A;  1PH9 A;  1VQ6 A;  4H7B A;  2GN5 A;  5E1F A;  2KEN A;  1I94 H;  1JJ2 A;  1Q1B A;  2R92 A;  1E2Z A;  2XRS D;  1EHI A;  4YJ2 F;  2CH4 A;  2YYA A;  3UQ8 A;  1I4G A;  2X6G A;  1VQ9 A;  3W2D A;  4V0B A;  1BUV T;  5IYC H;  4IUP A;  4EQO A;  3JC6 6;  1ML0 D;  1E4F T;  4B3M Q;  3S14 B;  2OH2 A;  1EL0 A;  1ZET A;  2R8I A;  4YCW A;  1VQE A;  4YHH L;  1Y1W A;  4U68 A;  4JI0 Q;  2IA6 A;  4A3C G;  2R7K A;  3OWE B;  1RJR A;  1S9F A;  3J81 j;  2KED A;  1YI2 A;  4NP5 A;  2RSN A;  2XVS A;  1PRT F;  2EJM A;  4LF8 H;  2O5J C;  2C22 A;  1EYZ A;  2R92 B;  5GQO A;  4X64 L;  4WD3 A;  2ID0 A;  4NXN Q;  3RUP A;  4WJ4 A;  2F0K A;  1JCK B;  2E76 C;  1Y69 U;  2I87 A;  4X64 H;  4ZHQ F;  4IPC A;  2NUA B;  1I6V C;  3HOV G;  2SEB D;  3RIZ A;  3NTH A;  3GTM B;  1CK1 A;  3G4S A;  1SMX A;  3QO2 A;  5BR8 H;  1BNZ A;  4A3G G;  3S17 B;  3A74 A;  4A3E B;  5JJK A;  3MFH A;  4Y7N H;  2V4R A;  3K0X A;  3KYH C;  5T1G A;  2ES2 A;  3G71 A;  2JA6 A;  2I07 B;  1B7Y B;  3MFY A;  4WRD A;  5KYI A;  2EPB A;  5HY6 A;  3CCQ A;  4DNT B;  3FKI H;  2JK8 A;  4J0M A;  2I5L X;  1Y8N B;  2F03 A;  1IOV A;  3RGZ A;  4DV0 H;  3T4A C;  2K14 A;  3GTO B;  1J5E H;  1CZW A;  3CP0 A;  1XNQ L;  1B04 A;  1NSN S;  2HIX A;  4RZR A;  2D9U A;  2OXP A;  4A93 H;  3I8Z A;  4R7R A;  1HHV A;  1F9Q A;  1PTO B;  1ILQ A;  2VQF Q;  2KOL A;  4OO1 G;  5L1K A;  1KJQ A;  2LXK A;  3OTO Q;  2O5I C;  3NGD A;  5L1L A;  3Q22 A;  1X3P A;  2EYJ A;  2MPM A;  1N8R C;  2GA4 B;  1SYG A;  1SE4 A;  3ULP A;  5C3E G;  1A3T A;  2PW5 A;  1EYD A;  2F3V A;  4JOI C;  4JBW A;  4ED0 A;  1YBY A;  2UXD L;  1CQF A;  2PZT A;  3KLR A;  2I80 A;  1L1O A;  2NB0 A;  1CE8 A;  4J8Q A;  1PH7 A;  5C3W A;  5LP6 F;  3G6J B;  4HQ6 A;  1X3E A;  2GVB A;  2AHO B;  4JI4 L;  4K0K Q;  5DLQ E;  2Q8T A;  1QZG A;  2IX3 A;  1XNR Q;  1JOK A;  2R93 A;  3Q0A A;  1VQ8 A;  4LF6 H;  4DV5 L;  4DR1 H;  4DV1 H;  4DFA A;  1OXS C;  1VQA A;  3VR4 A;  4C3J H;  4WJW A;  2J6S A;  1TWA A;  4YJ3 F;  4DR1 Q;  1VKZ A;  1FR3 A;  2E2H B;  4EG0 A;  2UU9 H;  4K0K H;  4O42 A;  3G7L A;  2RBM A;  3UDI A;  4HNT A;  4YWK A;  4YY3 Q;  3GTK A;  2BE5 C;  1O7Y A;  1K8A C;  4KY7 A;  4QJF A;  1CS0 A;  3GDE A;  2ZXO A;  4A3B H;  3K7A H;  4RCO A;  2XCP A;  4DUY Q;  2WIN B;  4R4O A;  3TEH B;  1FJG L;  4B3R H;  1H9S B;  1NR4 A;  5JEA J;  1SFO B;  4QWB A;  1LAB A;  1I50 B;  1N9W A;  1M0T A;  4DAM A;  4LF4 L;  4O3R A;  1ENA A;  3GD7 A;  3GQB A;  4B3R L;  4F4W A;  5IGG A;  3M4Y A;  1XPR A;  4ED2 A;  2UUB L;  3I4N H;  4HJ8 A;  2IJ0 A;  4QF4 A;  4ECV A;  1EU4 A;  4HID A;  4LFB H;  2LSS A;  5DQG A;  3D4W A;  2E2J B;  5A35 A;  5LL6 X;  4E6I A;  1PA6 A;  2JP1 A;  5KFK A;  3A8J E;  4EBE A;  2XSC A;  3L0O A;  5EBD A;  3RLF A;  1A0I A;  2IHE A;  1IBL Q;  3GII A;  2C28 A;  3M9O B;  2B3G A;  2N3S A;  3H15 A;  2O2L D;  1H9S A;  4R4I A;  5KGU A;  3DXJ C;  1N36 H;  4C3H B;  4A2B A;  2F0O A;  3CRL C;  5EDW A;  2NYZ D;  5E4W C;  4JI5 L;  3K5I A;  2EIF A;  3R2I A;  1A9X A;  3BA8 A;  2Q2I A;  2UUB Q;  2VNU D;  2PQA B;  1ZQ7 A;  1JE5 A;  4R8U A;  1WTX A;  4I7A A;  3D3R A;  4GLA C;  5C4J H;  4B3R Q;  2R7N A;  1BBU A;  1GGO A;  4I7Z C;  1E4E B;  3MR5 A;  5C3X A;  2Y0S A;  1EZ6 A;  1TS4 A;  4ED6 A;  5HGQ A;  2DWC A;  5KFG A;  4CGY B;  4EFE A;  3SDZ A;  5TSS A;  2JE6 I;  4WFN 3;  4YY3 L;  3CW2 C;  4GKJ L;  3RAX A;  4R9W A;  1D8L A;  4AQY Q;  1G6Z A;  3GTK B;  5J2T F;  3MXP A;  1LTL A;  1TS5 A;  3W1B A;  1ASZ A;  1SND A;  1BGW A;  4EBD A;  4C5C A;  3MR2 A;  5D3D A;  2K7V A;  3RB3 A;  3KHR A;  5KNC A;  4DV5 Q;  3Q8P B;  4LFC H;  4JBM A;  3B6Y A;  3ZJY C;  1ESR A;  3VR6 A;  1Q82 C;  1K8M A;  4K0K L;  2YS6 A;  5FLX L;  2KEE A;  5FO8 B;  4DUZ H;  4LNQ A;  1VQC A;  3SXH A;  1S03 G;  4X65 L;  1N33 L;  1V1O A;  3W1G A;  3OHB A;  5M5Y H;  2GVA A;  2A68 C;  2DPI A;  4DR7 H;  4MV9 A;  2R92 G;  4XQQ A;  4BY7 B;  3Q1K A;  3I4M G;  3HEJ A;  2PO4 A;  1Y8O B;  1U4L A;  4RA8 A;  5JJI A;  1L1O B;  3GTO A;  2ASB A;  3HOZ B;  2CW0 D;  4KLK A;  4HCS A;  4CDD C;  5KFB A;  4IFD I;  4O0A A;  3UDG A;  5EZY F;  4EVO A;  3PR5 B;  4RCN A;  2VQF L;  4DR2 H;  3FDS A;  4F87 A;  5CV7 A;  3RV4 A;  5KFE A;  1ICF B;  4JI7 H;  3CKI B;  1TY2 A;  4IUN A;  3PUW A;  5KT2 A;  3GTJ B;  3GID A;  2A69 D;  4FS1 A;  4JI3 H;  1EQQ A;  2OTL A;  3UDF A;  1SEI A;  2B2U A;  5A2Q W;  3K57 A;  1VAJ A;  2V58 A;  4CBV A;  3KXY T;  1BNC A;  4OX9 L;  5FLX W;  3PUX A;  2W9A A;  1EEF D;  1EY9 A;  1TWG B;  2KHI A;  3F2U A;  1F77 A;  2H4O A;  1CUK A;  1Y1W H;  3JSL A;  3GLK A;  4ECT A;  3TSS A;  3RV3 A;  2D0P A;  1S97 A;  3FPU B;  2E2I A;  3VYU A;  5DLG A;  3OW7 A;  4L63 B;  1AUV A;  4QUF A;  3M9B A;  4F7X A;  2EYF A;  4QY7 A;  3ORQ A;  3G8C A;  4AYB G;  2ASL A;  1D6E C;  1NY4 A;  3I70 A;  4UP7 A;  3FEW X;  1EUJ A;  2R92 H;  4YR2 A;  1Y14 B;  5L1J A;  2PMZ A;  3KF8 B;  4U7C A;  3WOE A;  4DXG A;  1VBG A;  2K04 A;  2XWJ B;  2HCI A;  4RNM A;  5FJ8 H;  4QQB X;  4ZLT F;  3GTM H;  5IGE A;  3KF6 A;  4FM9 A;  1T94 A;  2YRX A;  1SRU A;  1S3O A;  1UE1 A;  4J9O A;  2B2W C;  2Q8I B;  2A1A A;  4GOP C;  4I7H A;  2CWA A;  4JI0 L;  4IFD G;  1X6O A;  2EJF C;  2R8G A;  2EOT A;  1N34 Q;  2EDG A;  4O2B F;  5EKI A;  1EFI D;  1TWG H;  3G6V A;  4IAJ A;  3LP8 A;  4B3M L;  4TRD A;  1QNK A;  3RMH A;  4HSV A;  3R3O A;  5BR8 L;  3L7Z C;  5GAE C;  5ELF A;  1NMG A;  3RUZ A;  5FLM H;  4KD3 A;  4A3G B;  5DNF A;  1ZXT A;  4IZ8 A;  4X66 Q;  3STB D;  3PIP A;  2YZG A;  1S5B D;  1LTT D;  4BY1 H;  3MTS A;  4LJZ C;  2VZA A;  2V59 A;  3PSI A;  3BJU A;  1LT3 D;  4Y8V B;  5KFM A;  5C0X H;  3MHB A;  2JEF A;  1EOV A;  1JDB B;  2IBK A;  1K3B C;  1T5E A;  3PIP 3;  2J6T A;  1VBH A;  1TS3 A;  2AQ3 B;  4NLG A;  2ENB A;  4LFA Q;  4LFB L;  4DV0 L;  4JYA L;  4DR4 L;  5C3E H;  5C44 B;  4IUR A;  4Q45 A;  4GLX A;  2CQO A;  5K2M A;  1D1K A;  1KDB A;  1KJ9 A;  2EY2 A;  4DV6 H;  3HOV B;  3SR1 A;  4C5B A;  4DF7 A;  1L2Z A;  4ECX A;  4QIW A;  1IBK H;  5CMD A;  3M85 A;  4P74 A;  5FD6 A;  1VQM A;  3S2H H;  3TDQ A;  3T1H L;  2X6L A;  4A75 A;  4HJ7 A;  1HUN A;  4LMQ D;  1EY7 A;  2Q2U A;  4XYL B;  3WDN A;  2A6E C;  2F4I A;  3H4B A;  2CW0 C;  4RFB A;  2VQD A;  3BJY A;  4C2M B;  4HJ5 A;  5IT9 W;  5IP9 G;  2ICI A;  2E2H A;  4JV0 A;  4DGZ A;  3FMC A;  1TWC B;  1BO0 A;  2HHH L;  2C35 B;  4DV5 H;  2W9C B;  1Y1W G;  1DGS A;  1EY4 A;  3NBH B;  4B08 A;  1D5X C;  1SLJ A;  4JV5 Q;  3ORR A;  4DV2 H;  1IBM H;  4R4T A;  3RGX A;  1WTP A;  5KT4 A;  4J6H A;  3KLS A;  3CQZ A;  3EFX D;  2NU8 B;  2R7L A;  5JVH 3;  3HOV H;  3MZ5 A;  3BYT B;  1EEI D;  1U4R A;  3J7A 5;  4J9R A;  4BS9 A;  3GTJ H;  2B2V C;  5G3L F;  2L4N A;  3FHW A;  3HFZ B;  5JJZ A;  2YU9 B;  1BR9 A;  4M9U A;  5EPK A;  4KK7 A;  2UUA H;  4XQJ A;  1HQR D;  3F2D A;  3CF5 A;  1M0W A;  3TRE A;  1GHK A;  4RNO A;  1TXY A;  2ZJR A;  4C5A A;  5KG7 A;  1N56 A; 
#chains in the Genus database with same CATH homology
 1N36 L;  1Q86 C;  1QVG A;  4TQU S;  1MJE A;  3AQQ A;  5C0X I;  1QVC A;  2I5M X;  3I56 A;  4JI3 L;  3PO3 G;  2MO0 A;  1IL2 A;  2IX1 A;  3M4Q A;  4JI8 L;  1K9M C;  4IOA A;  2MNA A;  3RNU A;  2CFM A;  1IYJ B;  3DLL A;  2QA4 A;  4LF8 Q;  2EQS A;  1EFW A;  3KF6 B;  5JJL A;  4ME3 A;  4LF7 L;  4JI7 L;  1H95 A;  1N34 L;  2UXB Q;  1FGU A;  4Y52 H;  3UDX A;  3A5U A;  3KOJ A;  4DNI A;  2UUA Q;  4TVA B;  3D31 A;  2VQE L;  2NVT H;  4LF9 L;  4A3I H;  3PCO B;  1WYD A;  4DUZ Q;  4JI1 Q;  2WFW A;  2ZTD A;  1KAW A;  1VQI A;  2YU9 H;  2D62 A;  3S1Q H;  2Q2T A;  2N49 A;  1K8G A;  4LF4 Q;  4NXN L;  4GOP B;  2ALY B;  4X64 Q;  2R7Z H;  4UPA A;  1XMO Q;  3TS0 A;  4UY8 C;  1VQO A;  1EIY B;  4BY1 G;  2JA7 G;  1G29 1;  4H02 A;  3CME A;  4IO9 A;  4DR1 L;  4IPG A;  4AYB E;  3K7U C;  1A63 A;  2UUC L;  3AFQ A;  2WP8 J;  3HOY H;  4BBS G;  2JA6 H;  1QUQ B;  4YHH Q;  2RHS B;  2NZO A;  3G6E A;  1K73 C;  1U0L A;  3J81 c;  2R7Z G;  4DV6 Q;  2JA8 H;  2F4V L;  1N32 L;  2WAQ E;  1YEZ A;  2H5X A;  2JJQ A;  1IBM L;  1HNX Q;  1RIP A;  1V9P A;  2K52 A;  4DV1 Q;  1IBL Q;  4BA1 I;  4GNX A;  4R4C A;  1CKO A;  5C4X H;  2ATW A;  2UXD Q;  2NN6 I;  1UE7 A;  4BBS H;  3JAM i;  5JEA G;  4GS3 A;  3FKI G;  2HIV A;  3RN5 A;  2JEA I;  3A0J A;  1E1O A;  1VQK A;  1MIU A;  4X62 L;  4POF A;  2K5H A;  2UXC L;  1NTG A;  3RLO A;  2F52 A;  3KLW A;  1X56 A;  1GVP A;  3S1N H;  1PYS B;  4LFC L;  3K81 C;  3OTO L;  1YJN A;  4B3T L;  2N78 A;  4BXX G;  3CD6 A;  3CCU A;  1S40 A;  1J6Q A;  5GRO A;  1I94 Q;  3J80 c;  4DR3 L;  2IY5 B;  2A19 A;  1PH9 A;  4L5Q A;  1VQ6 A;  5IYC G;  3KDF A;  1X3F A;  2GN5 A;  5LMN Q;  4GKK Q;  2KEN A;  4GOP A;  1K0R A;  4J15 A;  1EQR A;  3U4V A;  4L5R C;  1JJ2 A;  5AJ3 Q;  3W5O A;  1Q1B A;  3CCL A;  4A3L H;  1VQG A;  1XMQ Q;  2E5L Q;  3AFP A;  3EN2 A;  4DK3 C;  1VQ9 A;  5M3F H;  5IYC H;  1N33 Q;  1S72 A;  1HJP A;  3JC6 6;  4OXP A;  3H3V I;  4HIO A;  1GKH A;  4B3M Q;  3L2P A;  1JT8 A;  2BA0 A;  2EXD A;  4YCW A;  1Q1E A;  1VQE A;  2YTX A;  3AYH B;  4YHH L;  4DV3 Q;  1WJJ A;  4JI0 Q;  4DV4 L;  4A3C G;  2R7F A;  3H0G G;  3J81 j;  3HOU H;  5IYB H;  5IP9 H;  1YI2 A;  1IZ6 A;  1L1O C;  4A3D H;  2R93 G;  3ER0 A;  3RZO H;  4DR2 Q;  1ASY A;  4FDB A;  5GQO A;  4X64 L;  4JBJ A;  2ID0 A;  4A3K G;  3I2Z A;  4NXN Q;  1QVF A;  1VQ7 A;  4WJ4 A;  2VUM H;  1CKN B;  1EWI A;  2QEX A;  2OQ0 A;  4DR2 L;  2NVX H;  2JA8 G;  1EIF A;  4IPC A;  3HOV G;  4C3I H;  1C0A A;  3E9I A;  3PIO A;  4LF9 Q;  1WCM H;  1KD1 C;  3G4S A;  1SMX A;  4JBK A;  2CCZ A;  4A3G G;  4C2M H;  4DV4 Q;  3U4Z A;  1PVO A;  4JI2 Q;  3CQZ H;  2ZJQ A;  3A74 A;  5JJK A;  4Y7N H;  4LF7 Q;  3GTP H;  3HOW G;  2R6G A;  2Z0S A;  3K0X A;  3KYH C;  3EBE A;  4BBR G;  3G71 A;  4A3E H;  2ES2 A;  4LF8 L;  1B7Y B;  1VQ4 A;  2I0Q A;  3HKZ G;  1X54 A;  2D0O A;  2VY3 A;  2OQK A;  5HY6 A;  1OTC A;  2JA6 G;  5IYD G;  4MZ9 A;  4A93 G;  3CCQ A;  2R7D A;  3I7F A;  3FKI H;  2JK8 A;  5IWA Q;  4C3H H;  1IBL L;  2I5L X;  1CKM A;  2E2H H;  2K14 A;  3SGI A;  1PFS A;  1OXX K;  4OWT B;  4B3S L;  4A3M G;  5IT9 c;  3CP0 A;  1XNQ L;  2HIX A;  2MQH A;  5FJ8 G;  1V43 A;  1PH2 A;  5IYD H;  4A93 H;  3GTL H;  4LUO A;  1B8A A;  1HZA A;  1SR3 A;  2HQL A;  4QIW E;  2XTI A;  4DKA C;  2VQF Q;  4OO1 G;  3LGJ A;  3NEL A;  3M7N A;  2LXK A;  3OTO Q;  4LF5 Q;  4B3T Q;  4JG2 A;  2JA9 A;  4BBR H;  3WWV A;  4A3E G;  1E7Z A;  1VCI A;  2ZTE A;  3PGZ A;  5IP7 G;  2MO1 A;  3PF5 A;  4EX5 A;  1VQJ A;  4NXM Q;  1JJG A;  1E22 A;  1N8R C;  4GN4 B;  1Q81 C;  3CMA A;  3ULP A;  1PH1 A;  1IBK L;  4A3D G;  2E2I H;  5C3E G;  3RR5 A;  4JOI C;  4YCV A;  4JBW A;  1P16 A;  4OWW B;  4GLV B;  1YBY A;  2UXD L;  1WFQ A;  1E1T A;  1Q12 A;  1L1O A;  4DV1 L;  1SN8 A;  1T9H A;  2DUD A;  1PH7 A;  1HNX L;  1CSP A;  3F1Z A;  1YNX A;  1X3E A;  5LMU Q;  1VQH A;  2GVB A;  3MXN B;  2AHO B;  4JI4 L;  4K0K Q;  5DLQ E;  4DV6 L;  1PH6 A;  3M4P A;  1XPO A;  1QZG A;  1XNR Q;  1K3R A;  4R4Q A;  1OXT A;  1VQ8 A;  4DV2 Q;  1VQ5 A;  1TWH H;  4DV5 L;  4DR7 Q;  1SRO A;  4GN3 B;  4IFD J;  1LUZ A;  3CPF A;  4A3L G;  1OXS C;  1VQA A;  4C3J H;  4AIM A;  2B63 G;  2UUC Q;  1HZC A;  4IJL A;  4HIK A;  4DR1 Q;  3BU2 A;  5E7N A;  1VS0 A;  3TRZ A;  5LMU L;  1XMO L;  2RF4 A;  1WOC A;  2CWP A;  3UDI A;  4BXX H;  1HZ9 A;  4YWK A;  4YY3 Q;  2LXJ A;  1K8A C;  4QJF A;  1EYG A;  3GDE A;  1HNW Q;  4A3B H;  3K7A H;  4BY7 H;  3F2C A;  4DUY Q;  4R4O A;  3TEH B;  1FJG L;  1Z47 A;  5JEA J;  3PO2 G;  4MTN A;  1N9W A;  4NXM L;  4DAM A;  5C44 G;  1Q8K A;  3I4O A;  1SFO H;  3GD7 A;  4LF4 L;  4B3R L;  4LF5 L;  4R1J A;  2I5H A;  1Q7Y C;  4KHP L;  1YHA A;  4A3F G;  1B70 B;  1XPR A;  1HH2 P;  4JI7 Q;  2UUB L;  4IJH A;  3I4N H;  4HJ8 A;  4NPS A;  3S14 H;  1NMF A;  1U5K A;  4RMF A;  4HID A;  2LSS A;  2CKZ B;  3K80 C;  5ELN A;  1PA6 A;  1BBW A;  2E8G A;  4QL5 A;  4A3C H;  1RL2 A;  3L0O A;  3RLF A;  5IWA L;  1A0I A;  2IHE A;  4JC0 A;  1X3G A;  3A5Z B;  2Q2H A;  2B3G A;  2N3S A;  2VS1 A;  3F8T A;  4PZ6 A;  4DK6 C;  3H15 A;  4R4I A;  1YIT A;  1JMC A;  3ICE A;  3I4M H;  1KHI A;  5BR8 Q;  1M90 C;  1PYB A;  4JI5 L;  4JOI A;  4IOC A;  1NE3 A;  2EIF A;  2KHJ A;  4AH6 A;  3HOX G;  2Q2I A;  1YJ9 A;  2UUB Q;  3U58 A;  2VNU D;  2PQA B;  1P8L A;  1JE5 A;  4XTC S;  1K83 H;  5EAY A;  3F2B A;  1KXL A;  4IPD A;  4JI2 L;  4A4I A;  1O7I A;  4GLA C;  5C4J H;  4B3R Q;  4KHP Q;  3CC4 A;  1BBU A;  3PUZ A;  3T1Y Q;  1QUQ A;  3G48 A;  4A3I G;  4WJ3 M;  2PNH A;  2VL6 A;  3HOY G;  5HGQ A;  2PI2 E;  5M3M H;  2Y0S E;  3J80 i;  3PV0 A;  3CAM A;  3J81 i;  5GAH C;  3KJP A;  2Y0S G;  3KDF B;  2JE6 I;  1HNZ Q;  4YY3 L;  1XPU A;  3CW2 C;  1SE8 A;  4GKJ L;  2KBN A;  4A3M H;  1D8L A;  2ZM6 Q;  4AQY Q;  2HHH Q;  1YHQ A;  3RN2 A;  2BH8 A;  1Y1V H;  4PMW A;  3NEN A;  2KCT A;  4DR6 Q;  1FVI A;  3STB C;  1LTL A;  3ULJ A;  3W1B A;  3NEM A;  1ASZ A;  3CCJ A;  1G51 A;  4YCU A;  1PH3 A;  2HT1 A;  5FLM G;  1PV4 A;  2UU9 Q;  3S17 H;  5IP7 H;  4X6A H;  4DV5 Q;  3GTO H;  2K5V A;  1R9T H;  4JBM A;  5K36 G;  3B6Y A;  3IRB A;  3ZJY C;  1BKB A;  1Q82 C;  4K0K L;  4HJ9 A;  1KL9 A;  3T1H Q;  4LF6 L;  3CXC A;  4OO1 I;  3U50 C;  4LNQ A;  1VQC A;  1PH5 A;  4X65 L;  1N33 L;  2VW9 A;  1J5E L;  3W1G A;  2AKW B;  4KI0 A;  2GVA A;  5M5Y H;  3OW2 A;  5GAG C;  2R92 G;  1PH4 A;  1XMQ L;  3KJO A;  4LUZ A;  2E5L L;  3I4M G;  5JJI A;  3CCR A;  2OCE A;  1L1O B;  1HR0 W;  2ASB A;  3UE1 A;  1IBK Q;  5IYB G;  5H1S E;  3HOZ H;  1WI5 A;  4KLK A;  3UE0 A;  4JI6 Q;  2NN6 G;  3J7Z C;  4IFD I;  1YJW A;  4O0A A;  4DR3 Q;  3UDG A;  1I94 L;  2RHQ B;  1LM0 A;  2IX0 A;  4DV0 Q;  4OWX B;  4LFB Q;  3GTQ H;  1TWF H;  3HKS A;  2WB1 E;  2DGY A;  2JEB I;  1GO3 E;  4LFC Q;  2VQF L;  3PO3 H;  4LW1 A;  4P72 A;  2IT1 A;  1JB7 A;  2JA5 H;  4YWL A;  4X62 Q;  1KRT A;  3RZD H;  4JI6 L;  3OYY A;  2NVY H;  1I5F A;  3PUW A;  4B3S Q;  1A62 A;  5IY0 A;  5C44 H;  1YIJ A;  2K50 A;  1EQQ A;  2OTL A;  2MFI A;  3UDF A;  2E2J H;  2OWO A;  3PO2 H;  3S2D H;  3RLN A;  3S1R H;  2AWN A;  3CCE A;  3H0G H;  4X66 L;  1W3S A;  3S15 H;  4DR5 L;  4OX9 L;  3PUX A;  1YHB A;  4A3B G;  4BY7 G;  1VQP A;  1IBM Q;  3CPW A;  2KHI A;  2JA5 G;  4JCV E;  2F4V Q;  1N32 Q;  4L5S A;  1CUK A;  2BH2 A;  1IXR A;  1Y1W H;  4A3J H;  5J3B A;  2D0P A;  2Z6K C;  3PUV A;  4DPG A;  2UU9 L;  3HOU G;  3CCV A;  1W2B A;  3M4O H;  3CC2 A;  5M5W H;  3M9B A;  4HJA A;  2YTV A;  4L5T A;  4QY7 A;  1KQS A;  3TS2 A;  3BZK A;  5ELO A;  4AYB G;  4A3J G;  3PF4 A;  1OXV A;  3ULL A;  4YWM A;  2PMZ E;  1NY4 A;  4AQY L;  4UP7 A;  1HR0 L;  4GKJ Q;  2OTJ A;  1AE3 A;  3E9H A;  1EUJ A;  4LWC A;  1HZB A;  1Y14 B;  2R92 H;  1E3P A;  5LMN W;  1HNZ L;  2NZH A;  3KF8 B;  4MNO A;  2K5N A;  3D0F A;  2XGT A;  2B29 A;  3GO5 A;  2YTY A;  4GN5 A;  1HR0 Q;  4LUV A;  3GTG H;  2B63 H;  1I6H H;  5FJ8 H;  4GNX B;  1XJV A;  4QQB X;  2WAQ G;  3E0E A;  3K8A A;  3GTM H;  3KF6 A;  2VQE Q;  3JAM c;  1AE2 A;  1SRU A;  1S3O A;  1UE1 A;  2PQA A;  4OON A;  1L0W A;  2A1A A;  4GOP C;  2UUA L;  1PH8 A;  1QZH A;  2CWA A;  2YYZ A;  5IE8 A;  1X6O A;  4JI0 L;  4POG A;  4IFD G;  1X9N A;  4DV3 L;  1I3Q H;  3S1M H;  2KCM A;  1N34 Q;  2UXB L;  2YV5 A;  1OXU A;  1TWG H;  1PHJ A;  1Y1V G;  1YVC A;  4B3M L;  2NVQ H;  4JI8 Q;  2L15 A;  4JI5 Q;  3GTK H;  5BR8 L;  3L7Z C;  5GAE C;  1NMG A;  1C7Y A;  4PZ7 A;  5FLM H;  4DR5 Q;  4OX9 Q;  1UEB A;  1X65 A;  3CCS A;  2PI2 A;  4X66 Q;  3S24 A;  4A76 A;  4A3G H;  3STB D;  3PIP A;  1N36 Q;  5AJ3 L;  4BY1 H;  2VZA A;  3PSI A;  3BJU A;  5LMN L;  1VQN A;  4GKK L;  4O2D A;  1GD7 A;  2JA7 H;  1EOV A;  3FP9 A;  1MKH A;  2JQO A;  2VUM G;  1CSQ A;  1UE5 A;  4BA2 I;  1KIX A;  2WB1 G;  4LFA Q;  4P71 A;  4DV0 L;  3S16 H;  3KFU A;  1A8V A;  1NJI C;  4JYA L;  4LFB L;  1JJC B;  4DV7 L;  1VQL A;  4DR4 L;  1LYL A;  1Q46 A;  3HOZ G;  5C3E H;  2UXC Q;  1TWC H;  5FLX c;  1FJG Q;  1UWV A;  4DUY L;  2CQO A;  2Z6K A;  4GLX A;  4IPH A;  3CCM A;  1HNW L;  1FL0 A;  4ALP A;  1Z9F A;  2V1C C;  4HIM A;  3M85 A;  4JV5 L;  4P74 A;  2A8V A;  1VQB A;  4NB3 A;  1VQM A;  1J5E Q;  3S2H H;  4X65 Q;  2FXQ A;  3HOW H;  3TQY A;  1YZ6 A;  1KRS A;  3MEF A;  5C0X G;  3T1H L;  1GM5 A;  4LF6 Q;  4QGU A;  5M3M G;  4A75 A;  4XIG S;  4HJ7 A;  2QGQ A;  3HKZ E;  3ERS X;  1XTD A;  2AWO A;  4PZ8 A;  2Q2U A;  3H3V H;  4DR7 L;  4HJ5 A;  4DV2 L;  5IP9 G;  1NBW A;  4PG3 A;  2ZTC A;  1G6P A;  5C0X J;  1XNR L;  4DR6 L;  4JI4 Q;  3M3Y H;  2N8N A;  5GAD C;  2AMC B;  1AH9 A;  3Q8D A;  4P75 A;  3HOX H;  2ZM6 L;  2HHH L;  2C35 B;  4A3K H;  1C9O A;  1Y1W G;  1DGS A;  1V1Q A;  3DM3 A;  3NBH B;  4P73 A;  4UP8 A;  1SLJ A;  5M5X H;  2ZJP A;  2K4K A;  3I4N G;  4JV5 Q;  4R4T A;  3EIV A;  3I55 A;  2IHF A;  2K75 A;  1VQD A;  4JI1 L;  3AEV A;  1VQF A;  4DUZ L;  5M3F G;  4UP9 A;  1M1K C;  1WCM G;  1CKN A;  4DAY B;  3HOV H;  4DR4 Q;  4DV7 Q;  3T1Y L;  2BA1 A;  1I50 H;  1BVS A;  4APV A;  1KC8 C;  3J7A 5;  4RG1 A;  3GTJ H;  4JYA Q;  4LFA L;  3FHW A;  5C4X G;  1L2F A;  1MJC A;  1TWA H;  3HFZ B;  4GNX C;  1E24 A;  2F3I A;  2RCN A;  3BZC A;  3PUY A;  4A3F H;  4KHZ A;  4EQ5 A;  1UE6 A;  3F2D A;  1XNQ Q;  3CF5 A;  3TRE A;  3CC7 A;  4JI3 Q;  2R93 H;  1X55 A;  1D7Q A;  1TXY A;  2ZJR A;  3VDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...