3HOZG

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hozG01
1J6QA 4IFDI 1KXLA 4HIMA 4JI3Q 2R93G 3AYHB 1XPUA 1R9TH 1PH3A 1FVIA 3EBEA 5JEAJ 3HOUG 3S15H 4GN4B 2KHJA 2E2HH 1FL0A 3GTPH 3HKSA 1AH9A 3E9HA 1YJWA 1VQBA 1EYGA 4R4TA 1IL2A 1YI2A 2HT1A 4ALPA 1CKNB 2BA1A 4QIWE 4BBRH 2BA0A 3CCLA 3TS2A 1X55A 2VQEL 3T1HQ 4LFCL 4JI3L 4JI4Q 4DV0L 3IRBA 1NTGA 4AH6A 5C0XJ 2N49A 2MO0A 2I5HA 3M9BA 4QY7A 1A0IA 1LUZA 5IYCG 3CMEA 4X62Q 5JJKA 4LF8Q 2IX0A 2MFIA 2R7ZG 1IBLL 4A4IA 4GLVB 4NXNL 5GAHC 3ER0A 5C44G 4OONA 1XMOQ 4A3DG 1IBLQ 1YEZA 1VQ4A 4OX9Q 1PV4A 1X6OA 2WFWA 4BY1H 3HOZH 1TWCH 4DR6Q 1C0AA 4H02A 4DR4L 3I2ZA 1KRSA 1LM0A 4GLXA 4A3GG 1X3GA 3I55A 5IE8A 3CCUA 4A75A 4X65Q 4R4IA 1VQNA 2D62A 2MQHA 3M4PA 4APVA 2Q2IA 3U58A 2HHHQ 3HOWH 2ALYB 4A3EH 1VQMA 5IYCH 4A3DH 1E3PA 4BBSH 1PA6A 1Q81C 2WB1G 3E9IA 2PNHA 1PVOA 4RG1A 1VQAA 2B63H 3AFQA 4DV6Q 4DR4Q 3F2DA 4A3LH 1KL9A 4MZ9A 2R6GA 4UP8A 4YY3L 4HJ8A 4OX9L 4A3BG 1JJCB 3GO5A 2K50A 1UEBA 2Q2UA 4JI6L 2IHEA 1OTCA 4A3IG 2E2JH 4R4CA 3UE1A 5IYBG 4GS3A 3HOYG 2LXKA 1IYJB 3AFPA 4LF8L 2Z6KC 1VQKA 3PO2H 5C4XG 3JAMc 1Q46A 4JV5Q 4LUOA 2B3GA 4TVAB 2JA5H 3S14H 1WJJA 3I4OA 3WWVA 2MNAA 3K0XA 5IY0A 1E1TA 4UP9A 1KQSA 1OXVA 3L7ZC 4OO1I 1I94Q 2WAQG 4YWLA 4JI6Q 3T1HL 3K7AH 3HOXH 4DR3L 4A3JH 1W2BA 4LF9Q 3A5ZB 4IPHA 4DR2Q 1Y1WG 3GTGH 1K83H 4X64Q 2JEAI 2ZJPA 1HZ9A 2AKWB 4P72A 1HNZQ 1PH9A 1G6PA 4BA2I 3GTQH 1SRUA 1Z47A 5IYBH 3I56A 1L1OB 3W5OA 3A74A 5IP7G 2YTYA 1QVFA 1PYBA 3L0OA 1W3SA 4O2DA 4GN3B 3GTJH 2AHOB 2ATWA 1UE1A 2VW9A 4DV3L 2UUAQ 1EFWA 3RR5A 1QVGA 2OQ0A 1JJ2A 2E8GA 1WCMG 1Q1BA 1QZHA 3I4MG 1Q7YC 2UXCL 3J80c 3BJUA 4A3JG 4BA1I 1QZGA 4NB3A 1YVCA 2E5LQ 4LF6Q 1FJGQ 2Q2TA 2VUMG 3T1YL 3S17H 4K0KQ 2JQOA 4IPCA 3PCOB 1Y14B 2IX1A 2JA8G 3UDXA 4YHHQ 4FDBA 1KHIA 5K36G 1IXRA 1YHAA 1TWAH 4TQUS 4DV0Q 2UUCQ 3J7A5 4DV1L 3CPFA 4DR7L 4DNIA 4IJHA 4P71A 2PI2A 4LF5L 4AYBG 1PH4A 1S3OA 5HY6A 4DV1Q 1EIFA 2B29A 1GD7A 4C2MH 5M3MG 4QJFA 5GAEC 4NPSA 4A3IH 5FJ8H 4DV7Q 2HIXA 3OW2A 1JB7A 4LF6L 5IWAQ 1NMGA 1I5FA 4A3BH 3H15A 4XIGS 1VQ7A 1VQOA 4L5SA 2VUMH 2NZOA 4KHPL 3K7UC 2AWOA 3UDIA 4A3FG 1N34L 1YIJA 1JJGA 1I50H 2RHQB 2EQSA 4X66Q 3PUXA 2C35B 3GTOH 3S24A 1VQHA 5JEAG 4XTCS 1TWHH 1HH2P 4KLKA 1YHBA 4KI0A 1VQEA 2NN6G 5ELNA 4A3CH 5DLQE 2K5NA 1S72A 1N32L 3D0FA 3CCRA 2ID0A 2OQKA 1L2FA 2VZAA 1VQGA 4JI7L 2D0OA 4JI1L 1LYLA 3S2DH 3CC7A 1JE5A 3J81c 4HJ7A 4HJAA 4X64L 2EIFA 3PUZA 3JAMi 1HZCA 3BU2A 4B3RL 5IP7H 4BBRG 2YYZA 1O7IA 1P8LA 1KRTA 4A3KG 5JJLA 1L1OC 1I94L 3CCVA 1B8AA 3CW2C 3CAMA 2AMCB 4DV2Q 2VS1A 2I0QA 4O0AA 2ASBA 1M1KC 1LTLA 4YWKA 2JA6G 2N78A 1VQCA 3KYHC 4DR5Q 2ZJRA 3PO3H 3ULLA 5C4XH 3PO2G 2I5LX 2JK8A 2OCEA 4AQYQ 3K81C 3PUVA 1QUQA 3AQQA 2ZTDA 4PG3A 2RF4A 4AIMA 5M3FG 4JI2L 1VQ6A 3AEVA 1OXUA 2F3IA 4A93H 2NVTH 3CMAA 2OTLA 3RZOH 1UWVA 4OWTB 4IPDA 4WJ3M 4UP7A 1FGUA 1YNXA 3RLNA 3HOYH 4BY7H 3BZKA 1VQ9A 1HZBA 1P16A 3EN2A 3PUWA 4JI2Q 4BXXH 3E0EA 4DUYQ 4DR1L 4BBSG 4LUZA 4QQBX 2UXBL 1UE5A 4POGA 2IY5B 1PHJA 3ZJYC 4OWWB 4DUZL 3FKIH 3HKZG 5EAYA 3KOJA 5M3MH 3HOWG 4LFBL 2VY3A 4IJLA 1GO3E 1OXTA 4PZ8A 4GOPC 1PH1A 3UE0A 3PIOA 3HOVG 1HNWL 1N33Q 3KDFA 5C4JH 3HOZG 1E22A 2UU9Q 2JA7H 1NMFA 2GVBA 2H5XA 2XGTA 3S16H 1CKOA 3FP9A 5AJ3Q 1XTDA 1VQ8A 4LNQA 3UDGA 4JI8L 3G6EA 1NE3A 2UXDL 1HNXL 2PQAA 4JI1Q 4A3CG 4GKKL 4JOIA 1WI5A 5LMNL 3HOVH 3F1ZA 4C3HH 1OXSC 1V43A 2NN6I 2NVQH 1QVCA 3B6YA 5C3EH 4JCVE 3CC4A 4YWMA 3PIPA 2R7ZH 1N36L 4B3MQ 1VQ5A 1GVPA 5IP9G 3FKIG 3J7ZC 2JA7G 5GAGC 4LFAQ 5FLMG 1IBKQ 1BBUA 1L1OA 4LF4L 1N34Q 4DV5Q 1ASZA 5C3EG 4JYAL 2A8VA 2VQFQ 1JMCA 1HR0Q 4C3IH 4JBMA 4LF4Q 4QL5A 1B7YB 2UUBL 1J5EQ 4NXMQ 2K4KA 1TWGH 3KFUA 3D31A 1BBWA 1XPRA 4LFAL 1N9WA 3PO3G 4EX5A 3STBC 4ME3A 5IYDH 1IBMQ 4IO9A 1K73C 4B3ML 2WB1E 4EQ5A 4A3MG 3GTKH 4X6AH 3H0GG 4R4OA 1SE8A 4B3RQ 4GKKQ 5BR8Q 2Q2HA 3ERSX 4YHHL 3TRZA 1VCIA 1B70B 2E5LL 5AJ3L 3HFZB 5IT9c 4L5RC 2R7DA 4B3SL 1E24A 1JT8A 3PF5A 4WJ4A 1VQJA 5C0XG 1IBML 1N33L 3CCQA 1X3EA 5H1SE 4HJ5A 4L5TA 4YCUA 3J81i 1G291 3S1MH 3KDFB 4MNOA 4X66L 1XMQL 1XPOA 2CCZA 4JI0Q 1CSQA 1WOCA 2CQOA 4A3MH 4MTNA 1EQQA 5GROA 1Y1VH 3I4NH 1U0LA 3CXCA 3NENA 4LF7L 3M3YH 4GNXA 2VQFL 3G48A 3S1RH 1BVSA 2YV5A 4B3SQ 4A3GH 5ELOA 4DV5L 2PQAB 2CWAA 5LMUL 4LW1A 3PF4A 4Y7NH 1X3FA 3RN2A 1Y1WH 1HNZL 2K75A 3KF6A 2A19A 1KAWA 1X65A 1YBYA 5C0XI 3VDYA 1EOVA 2VNUD 1I3QH 4HIKA 3TQYA 1CSPA 1SN8A 3M4QA 4LF9L 1XNRQ 3K8AA 1YJ9A 2YTVA 2MO1A 3GDEA 3G4SA 1Q86C 3EIVA 4JBWA 1Q1EA 4HIOA 1HR0W 1OXXK 3A0JA 2DGYA 1K3RA 2FXQA 2RHSB 1KD1C 4DR7Q 1XNQL 5FLMH 4BXXG 4IFDG 1PYSB 3LGJA 1SR3A 2QGQA 4DV4Q 3M7NA 2UXDQ 4IFDJ 4A3LG 2F52A 4JI8Q 1YITA 4K0KL 2UUBQ 2F4VQ 4KHZA 2IHFA 3L2PA 5J3BA 3RNUA 2GN5A 2OWOA 2ZTCA 2UXCQ 1UE7A 3JC66 4GLAC 4YCVA 4JBJA 3KJOA 3DLLA 1EWIA 1TXYA 2ZM6L 4JYAQ 2B63G 1HNWQ 3KLWA 1EUJA 1PH2A 2UUAL 4YY3Q 1X56A 2BH8A 3OTOL 1TWFH 3U50C 4UPAA 1XMQQ 2QEXA 1YJNA 1X9NA 1IBKL 3H0GH 1Z9FA 2RCNA 4DPGA 4JBKA 4DUZQ 1M90C 3KJPA 1DGSA 4P73A 1QUQB 5IYDG 4DR1Q 1K8GA 2JA8H 2UXBQ 3KF8B 1L0WA 1CKMA 2R92H 3U4VA 2HHHL 3BZCA 4PMWA 5GADC 3G71A 4X65L 5M5WH 5LMNQ 4L5QA 2WP8J 3PSIA 5FLXc 5BR8L 1NY4A 1VQLA 2ZJQA 2BH2A 2VL6A 4DR6L 3F8TA 1AE3A 4GOPB 1BKBA 3NBHB 3S1QH 1HZAA 4P74A 1AE2A 3PV0A 1VQIA 1IZ6A 3RLOA 1A63A 3MXNB 3F2CA 2DUDA 2PMZE 1NBWA 4DR5L 3CCMA 4B3TQ 2K52A 4IOAA 4X62L 4A93G 1SLJA 2ZTEA 3DM3A 1Q12A 4J15A 3CC2A 2PI2E 4DV7L 4DV4L 4DV2L 5E7NA 4B3TL 1CUKA 3H3VH 3OYYA 5M5YH 1XNQQ 1VQPA 2R7FA 2JA5G 4JI4L 2Z6KA 3I4MH 1E1OA 4LWCA 4DAMA 4LFCQ 2R93H 3FHWA 1GKHA 4DKAC 1C9OA 3CCEA 4AYBE 1XNRL 4DAYB 1GM5A 1NJIC 1E7ZA 3TEHB 4JI7Q 3T1YQ 1ASYA 1WYDA 2JJQA 1VQDA 2YTXA 3M85A 4YCWA 4OO1G 1N32Q 1X54A 2K5HA 2Y0SE 1G51A 3PGZA 2KCTA 1SFOH 4RMFA 1U5KA 3W1GA 4DV3Q 1HNXQ 4JI5L 3PUYA 3RLFA 3ULJA 3UDFA 1KIXA 3J81j 3OTOQ 4OWXB 1PH8A 1D7QA 3MEFA 2JE6I 1MIUA 4R1JA 5IP9H 2CWPA 2ZM6Q 1KC8C 3RZDH 1PH6A 3CQZH 1I6HH 4PZ7A 4DK3C 1A8VA 3TREA 1MKHA 5LMNW 2F4VL 2GVAA 1WCMH 3HKZE 3A5UA 2KBNA 2Y0SG 2K14A 4GNXC 4LUVA 1Q82C 4LFBQ 3Q8DA 2CKZB 4A3FH 3TS0A 2ES2A 1CKNA 3CD6A 1T9HA 2A1AA 4DUYL 4HIDA 3SGIA 2OTJA 3CCJA 3S2HH 4LF5Q 3W1BA 2VQEQ 2Z0SA 2L15A 4JC0A 2AWNA 3NELA 5JJIA 4JG2A 2UUCL 2WAQE 4POFA 4Y52H 4OXPA 2KCMA 1FJGL 1J5EL 4NXML 1EIYB 1RIPA 5LMUQ 4A3KH 2I5MX 3NEMA 1EQRA 5FJ8G 1PH7A 4AQYL 1HR0L 5HGQA 2EXDA 2LXJA 4C3JH 4KHPQ 1WFQA 4LF7Q 3CF5A 4A76A 5M5XH 3M4OH 1VQFA 4IOCA 3CCSA 1RL2A 1HJPA 2KENA 5IWAL 1XJVA 4JI0L 4GNXB 2LSSA 4DV6L 1H95A 4BY1G 4HJ9A 3CP0A 3F2BA 1S40A 1N36Q 3ICEA 3GTLH 5M3FH 4QGUA 5C44H 1VS0A 2QA4A 3ULPA 2E2IH 2N3SA 2JA9A 3H3VI 1Y1VG 1N8RC 3I4NG 3KF6B 1K9MC 3HOUH 2K5VA 2JEBI 3CPWA 2JA6H 1MJCA 1YHQA 4GKJL 1UE6A 1V9PA 4IPGA 1YZ6A 2NVXH 4GKJQ 1C7YA 4UY8C 4R4QA 1PFSA 3U4ZA 4DR2L 1MJEA 4DR3Q 2CFMA 3GD7A 4GN5A 4BY7G 4DK6C 1V1QA 4PZ6A 1D8LA 2NVYH 4GOPA 2UU9L 2N8NA 1XMOL 5GQOA 1K8AC 4P75A 2YU9H 3S1NH 1K0RA 2D0PA 1PH5A 4A3EG 4NXNQ 3GTMH 2V1CC 4JV5L 2IT1A 2KHIA 2HQLA 3J80i 3HOXG 4JI5Q 2HIVA 4JOIC 3I7FA 3RN5A 2R92G 1A62A 1SROA 2XTIA 3STBD 1SMXA 2NZHA 1Q8KA 3K80C
chains in the Genus database with same CATH superfamily
3DWQA 2IL8A 1RD9D 1PRTC 2Y0SA 5FLXL 3Q2OA 4JV1A 2NN6H 1R9TH 4KHPH 1PH3A 4XYOA 5JEAJ 5IGBA 4A3JB 4GN4B 2KHJA 4DLKA 2EDGA 3RZOB 4V190 2R86A 2R84A 3D4DA 1K3BC 1YI2A 1F2ZA 4KD4A 1I3QA 4BBRH 1XMQH 4B08A 1X55A 3N6RA 3T1HQ 3EFXD 4YY3H 4JI4Q 4EBDA 4U68A 2FHTA 1QE6A 1Y1VB 1PFNA 2MO0A 2NVYB 4QY7A 1LUZA 2NTSA 4LF8Q 3W2DA 2GPSA 5BMVF 1IBLL 5A2QL 3Q8SB 1CS0A 4MV7A 5DM73 1XMOQ 2B2WC 4KJNA 1A9XA 5KFKA 1PV4A 3HOZH 1ENFA 3I2ZA 1BXTA 4GLXA 5E4WC 3I55A 5IE8A 3ZYYX 1VQNA 1MZBA 5L1LA 2D62A 1MSHA 2LS01 4APVA 5IGCA 3HOWH 2BQRA 3A8JE 4A3EH 2R85A 4M7EA 1JC7A 4BBSH 2EYJA 1B44D 3BVZA 3E9IA 5EZYF 4JUZA 1PVOA 2LKVA 3DHQA 4RG1A 1VQAA 3R5FA 4MZ9A 4I7ZC 4C5BA 5K2MA 4B9WA 4BY7B 4FNFA 4OX9L 2K50A 4JI6L 2IHEA 3QJYA 5T1IA 1K1SA 2PN1A 2LXKA 1IYJB 2X0SA 3AFPA 1TWGA 1TY0A 1Q46A 4A2BA 4CJ0B 4JV5Q 4TVAB 2JA5H 3S14H 1BF4A 3I4OA 3QG1A 2FK1A 2MNAA 2R61A 5IY0A 2OH2A 4UP9A 2L1BA 4BY1B 3SI8A 3L7ZC 4OO1I 4HR7B 5AFWA 1Y1WB 3G8CA 2UVWA 2AGOA 1W2BA 1E4EB 2LY7A 2E5LH 2ZJPA 4MA5A 3KBGA 4M8AA 4BA2I 2WKCA 2HVSA 1ZXTA 3I56A 1L1OB 2FJ2A 1PYBA 4ILWA 3NSWA 3I70A 2AHOB 3KLSA 3T4AC 2VW9A 1EFWA 3DWPA 3RR5A 1QVGA 2E8GA 4K2LA 4NLGA 1R4QB 1QZHA 3S1RB 3VYSA 3LNNA 4NB3A 3ETHA 1T5EA 4DV2H 4CJ1B 2G9DA 2R93B 3RB4A 4RKBA 4JK1C 5KFGA 1Y14B 1EY9A 3PW4A 4JV2A 3RGZA 3MWYW 2QF7A 3URYA 1TWAH 2UUCQ 5K36G 4R8UB 3PW0A 4DNIA 4IJHA 4G7HC 4EFBA 1A3TA 3OHAA 3V6HA 3ITPA 1PH4A 3R23A 4HQ6A 4UHVA 1RJQA 4C2MH 4QJFA 1SBBB 3N42B 3OW2A 1JB7A 2KOLA 2L0CA 1SFOB 4IR1A 1NMGA 1EQTA 2XGPA 3RUZA 3LWBA 2FINB 5EQ0A 1VQOA 3CKIB 2VUMH 4H44C 3H6MA 3PW7A 5EJWA 2FLNA 3UDIA 5EBCA 1N34L 1XDNA 4FF1A 4QF4A 1I50H 4ECZA 1EYAA 2C35B 3PUXA 1KDBA 3S24A 1BBXC 1C3OA 5G3LD 3Q6SA 1TWHH 4LH7A 2W7PA 1WSCA 2ZXPA 1G2TA 4DAVA 4ECTA 2HCIA 3F2UA 3D0FA 3CCRA 3M7GA 2OQKA 1L2FA 2VZAA 2D0OA 3K5OA 3CC7A 4HJ7A 2BE5C 5BPHA 4CDEC 4X64L 4XYLB 3BU2A 2WB1A 1IBLH 4BBRG 2YYZA 3AMUA 3NTHA 3Q1KA 5C1OA 1KRTA 4A3KG 5J2TF 4ETSA 3CW2C 3T5LA 3CAMA 3TP8A 4CJ2C 2ASBA 3MR2A 1RYSA 2WIIB 2Z1CA 1LTLA 4YWKA 2JA6G 3SR1A 4C1NK 5JVG3 3KYHC 3L3OC 3HB9A 2K5DA 2ZJRA 3ULLA 3UI2A 5C4XH 2R82A 2JK8A 3JSLA 2FB9A 4PG3A 2ZTDA 3AEVA 1DM0B 2RF4A 4N9TA 1VQ6A 1OXUA 2K33A 4A93H 1TWFB 3CMAA 4MV9A 3RZOH 1JOQA 1FR3A 2NU8B 4OWTB 4IPDA 4WJ3M 1FGUA 1KAAA 3HXLA 5CB4F 2R92A 2EE1A 4FYDA 4JI3H 1TAEA 1P16A 1FGBD 3PUWA 4JI2Q 2VA3A 3MWEA 4DR1L 4BBSG 2IY5B 3IKJA 4QQBX 1VKZA 1UE5A 4POGA 2W57A 3CU7A 3ZJYC 3KOJA 3HOWG 1SEBD 4HCEA 2QKIC 1XX8A 2BDNA 4PZ8A 4GOPC 2YL2A 2YS6A 2D2CC 2P5ZX 1HNWL 4RNNA 4KKUA 5I4DA 4QCLA 4YBZB 5C4JH 4Q44A 2E2DC 2JA7H 1NMFA 2GVBA 2XGTA 1CKOA 4C3JB 1N33H 3GV8B 2F0WA 2AUKA 2DN8A 4MN3A 1XWEA 3J7YW 4IUPA 1I4RA 4ED0A 2NVQB 4JI1Q 1K83A 4GKKL 1I6UA 4R8NA 1V43A 4O42A 2NVQH 5CBEE 3CC4A 3P7JA 4H7BA 4QWAA 3GIIA 4ABNA 2F0LA 3J7ZC 5FLMG 2EYMA 5T14A 3R5XA 3QZ7A 2HVQA 4TSSA 1BBUA 1WD0A 1MSGA 2EYFA 5DGBA 3KK7A 1ASZA 2NTTA 4JYAL 4F4WA 3SK4A 2V9WA 2A8VA 5KT5A 1HR0Q 4AQYH 4JBMA 1O78A 3ORQA 1IYUA 1TWGB 2IJ0A 4QL5A 3S1MB 3MR3A 4NXMQ 1PMRA 2K4KA 1TWGH 3D31A 2XRQD 3M4YA 5JPMC 5M9OA 4WORA 1GUOA 1VBHA 1J9OA 3GTKH 4C3IG 4R4OA 2B2UA 4RA8A 4MV6A 2B63B 5J22A 4B3RQ 5BR8Q 2Q2HA 5C5JA 1ZHSA 3T51B 4FVMA 1HXYD 5CYUA 2E2JB 4L8JA 1S5BD 4B3SL 1LTTD 4WJ4A 1VQJA 1IBML 5BN5A 2W9CA 1G291 4DXGA 4YIJA 2PZTA 4JI0Q 1WOCA 1SNMA 1EQQA 3I4NH 3CXCA 3NENA 2AUJD 4GNXA 4Y7NB 3S1RH 5EDWA 1BVSA 2YV5A 3J81W 4DV5L 3C0FB 4ME5A 3PF4A 1LO5D 4Y7NH 3GTPA 3RN2A 1V1PB 1HNZL 3KF6A 1KAWA 5IWAH 4Q45A 5C0XI 4FP5D 1EOVA 1XNRQ 4G7ZC 4LFCH 2MO1A 2PCFB 2B2VC 3G4SA 3EYYA 2B2WA 4JBWA 3A54A 1Q1EA 3QOJA 5T1GA 1CQJB 4IR9A 4JPBW 1HR0W 2UVRA 4RWSC 2O5IC 2DGYA 3GTQB 4C2MB 4DR7Q 4F87A 5FLMH 5KT2A 2QGQA 4DV4Q 2UXDQ 4IFDJ 5JQWA 3QO2A 2YRWA 3N40P 1PZKD 3TP6A 3RNUA 3R3OA 2OWOA 3RB3A 5KFZA 1H9JA 3WOFA 3ERQA 4YCVA 3KJOA 4TRDA 4H13C 2UUAL 5JEAH 2BH8A 3OTOL 2HJWA 2RDJA 1T5XD 1BCPB 3H0GH 1C4QA 1Z9FA 3PO2B 2K05A 3I90A 2R7MA 1TWHB 4DUZQ 3BA9A 3Q22A 1M90C 4PNYA 2VOBA 3K7AB 2EY1A 3K5NA 3JRXA 5IYDG 2UXBQ 5BN3A 5LMUH 1TWHA 4DAPA 1WH2A 2EVBA 2BDOA 5CA0F 1TT2A 1ESFA 4K8IA 5GADC 5LMNQ 1SE3A 5M3MB 2A6HC 4L5QA 1DV1A 2WP8J 4IUTA 1NR2A 1S03G 5BR8L 4TV8F 2F0JA 3FKIA 3GTGB 4DR6L 2VL6A 3J81E 1M0WA 4F50A 1BKBA 2HUGA 2K1BA 2L55A 4P74A 1Z6HA 3X3NA 4ZKBB 3MXNB 2DUDA 4DR5L 2IBKA 4K5VA 3CCMA 2FKLA 1DCZA 4XT3B 4IOAA 1SLJA 3FDTA 3CC2A 2ICEC 1S0OA 1WCMB 1W93A 1XNQQ 3HZXA 3WOEA 3RBDA 2C28A 2JA5G 4RNMA 2FLLA 4LFCQ 3RB6A 1TWCA 3S2DB 3FHWA 5EPLA 2OLSA 4FF4A 2DJFC 1ONLA 1M8AA 4CBVA 4JI7Q 3BDLA 1SYXB 1WYDA 1VQDA 1UAPA 4YCWA 3M85A 3S2HB 3U9TA 1D5XC 3FPUB 1IW7C 2E75C 3E3XA 4KN7C 4QUCA 2HHHH 4RMFA 1TY2A 3HEJA 1LT4D 4UCSA 3ULJA 3UDFA 3J81j 1QB5D 1LTGD 1D7QA 4R1JA 1MIUA 3G6YA 3LX0A 4DK3C 5I2XA 5CV9A 3TREA 4PWQA 5KFSA 1FD7D 3LMLA 5LMNW 3TINA 5M3FB 3A5UA 4DL3A 4F88A 1PFBA 4GNXC 3MR6A 4TKOB 2OF1A 4YAKB 2ES2A 1CKNA 1PTOH 1JOOA 3SGIA 2R87A 4LF5Q 4ZYSA 4C3JG 4JC0A 2DJGC 3GQCA 5JJIA 4JG2A 2WAQE 3HRZC 4POFA 4NXMH 3D6WA 2F1MA 3GIKA 4OXPA 2E76C 2KCMA 1FJGL 5DLGA 4ME6A 5C5MA 3HKZA 3BJYA 1HR0H 5LMUQ 3BAAA 3NEMA 2RDIA 1PH7A 4QWCA 1PZJD 5HGQA 3HKZB 1N34H 5K36H 1CQFA 2GPWA 1LABA 4RHRA 4A76A 3CCSA 2KENA 1HJPA 5IWAL 1XJVA 1F2MA 1ESRA 2ZDQA 3V6KA 3MAQA 2XRSD 4EEQA 3M9NB 2N3SA 3H3VI 3I4NG 2QK4A 2JEBI 3CPWA 2JA6H 3GTKA 1E2ZA 4R4QA 1PFSA 2JA6B 4DU9A 1S10A 4K5XA 1V1QA 4C5CA 2NVYH 4O2AF 2UU9L 4MAMA 1AEXA 1U4PA 2LFNA 1K8AC 2YU9H 4P75A 2C00A 4LMYA 2FJZA 4NXNQ 3VYTA 3H4DA 1SCUB 2KHIA 1SYDA 3J80i 1NAPA 4JOIC 2HIVA 2ZXRA 1BDOA 4B9XA 1J6QA 5FO9B 2JA8B 4IFDI 1RJRA 2DPIA 3J7AF 4JI3Q 1S5DD 3AYHB 3FMCA 1I6HB 3VR2A 4DL7A 3HOUG 3EBEA 2PYKA 3CRLC 3S15H 4UCRA 4J9KA 3N8DA 2YZNA 4A3EB 3GTPH 3HKSA 4RHSA 1AH9A 1YJWA 1EYGA 4DUZH 1IL2A 5D8DA 2HT1A 1IL8A 3CCLA 3S1QB 3TS2A 2J4XA 2MPMA 3RD4A 2XIWA 4TQSA 5DQHA 4O3OA 2K03A 1AZPA 1PYWD 3EJIA 3VA5A 2RDGA 2KUMA 5IIFA 3PW2A 1M7JA 1H9MA 2UVUA 2I5HA 3M9BA 3CMEA 4X62Q 2MFIA 4BWGB 5GAHC 4DV4H 5JVDF 4L63B 4OONA 5C44G 3D6CA 2W6QA 5DGAA 2W9AA 2XN9C 2UVVA 2HDLA 3T13A 1X6OA 4BY1H 4FXGC 4O3RA 1I7LA 1CFMA 4LJZC 3G7LA 1X3GA 3OHXC 2F3VA 4A75A 4X65Q 2VB3X 3M4PA 4L6TB 3H0GA 3PMFA 4IUNA 2R8JA 2E2HB 3K5IA 1IBKH 4R7RA 2C5CA 3V05A 2F3WA 2PNHA 4DF7A 2EYPA 4A3LH 4DV6Q 3AU7A 3F2DA 3E5NA 3OUUA 3VYRA 4A3BB 5FD5A 4JI7H 4YY3L 4ED8A 4MTEA 5DG9A 1M0TA 3UFXB 2NWGA 1UEBA 3HG9A 2Q2UA 3IAYA 1W6JA 4A3IG 3HOYG 4YR2A 1JWMD 3WO1A 1XNQH 1VQKA 5C4XG 3E6ZX 1F9RA 3EA6A 4LUOA 2B3GA 1WCMA 1GUGA 2HDMA 3BYYB 3K0XA 1E1TA 4KY6A 4B3TH 4QMGA 1I94Q 4JI6Q 2UUCH 1I4PA 3HOXH 4F4YA 4DR3L 4A3JH 1HRJA 4LF9Q 3A5ZB 4DR2Q 1GUSA 3FRPB 4ZHQF 4IRDA 2JEAI 4U7CA 4F4ZA 1HZ9A 2AKWB 5KKNB 4HSPA 5M5WB 1PH9A 1G6PA 3RAQA 1SDFA 1STHA 2QDBA 1STAA 1DJRD 1RODA 4RFBA 3RTXA 3A74A 5M5XB 1QVFA 2UXBH 4A3IB 2K6AA 1W3SA 2C9OA 1F77A 1HTPA 4O2DA 4GN3B 2F0HA 3GTJH 1WTVA 1EHIA 1PXUA 2M2LA 2UUAQ 3GTJB 1O75A 2ZDHA 4DK0A 3MXPA 2OQ0A 5EOYA 1JJ2A 2VUGA 2J6SA 1HNWH 2Q8RE 3J80c 2CW0D 3R2TA 3NXWA 4HYKA 3HOUB 2PBZA 2R7NA 1YVCA 3JRWA 2WAQA 3S17H 2VUMG 3T1YL 3ETJA 2JQOA 1NR4A 2JA8G 4WBNF 4FDBA 1EQVA 1IXRA 1I6VC 4DR7L 4YB8B 4DV1L 5IOCA 3BG3A 1HQMC 3MZ5A 4P71A 3RGXA 4J1MA 3NPPA 3J7AV 4DV1Q 3TZUA 2B29A 3HP3A 5GAEC 2VXWA 2MJ8A 4DV7Q 3TQTA 1EWCA 3BQ0A 5IWAQ 1I5FA 2A73B 4XIGS 1VQ7A 1BQQT 1G8ZD 3K7UC 1F9PA 1HHVA 3SE0A 1YIJA 1JDEA 1ET6A 4J9MA 2AGPA 2CQYA 4IUUA 2XCAA 1R9TA 2XVSA 2B2YC 1N48A 1D5MC 1MD2D 1RTOA 3S14B 2JA5B 5A2QW 2N88A 4M1UB 2QYZA 1K8MA 5IYZF 4A3CH 1Q8IA 4HR7A 2K5NA 2WDTA 1Y1WA 2P0AA 3TBIB 4RAYA 1JE5A 3J81c 4HJAA 2JA6A 3JAMi 4B3RL 2SEBD 5E3FA 1O7IA 5BR8H 1JR0D 1SAPA 2J0TD 1QCBD 3R93A 2WINB 1E2WA 3DEOA 1I94L 3VR3A 3CCVA 1GYFA 5CV4A 1C48A 2CZGA 2NVYA 4UCTA 4ZQ3A 1IBMH 2H4OA 2W6PA 1EEFD 3NP8A 3K58A 1STEA 2N78A 5CV5A 1WTXA 1X32A 1VQCA 3PO3H 3ONAB 4JI4H 1ICWA 2I5LX 4MIUA 2OCEA 4AQYQ 3PUVA 1QUQA 4AIMA 2NVTB 1WR2A 4TUYF 3S15B 1DOLA 2WE6A 2NVTH 1BGWA 4CC6A 1UWVA 1KJIA 3BS1A 2X6LA 4DL5A 2RSOA 3RLNA 2SCUB 3SHLA 2L4NA 1STNA 4BY7H 2JEGA 3BZKA 1VQ9A 2SDFA 1EY8A 4OWWB 2DY8A 3HKZG 4LFBL 4IUVA 3DMUA 4A3MB 3TP7A 3UE0A 3PIOA 1N33Q 4QW9A 3KDFA 3HOZG 4DR3H 3FP9A 5AJ3Q 5DLFA 4JI8L 3MR5A 1HNXL 5JUMA 4YJ3F 5EGTA 1MHWC 1S5CD 3M4OB 4L1KA 5LMNL 3HOVH 2R8HA 3F1ZA 1SYGA 5F9LA 3MFHA 4EQOA 4FF3A 1J8IA 3PIPA 1N36L 1KDAA 3ND8A 4J6HA 5JAVA 2JA7G 5LL6b 4LFAQ 3FKIB 1EYZA 4YR3A 2AQ1B 3D8GA 3D4WA 4IWXA 1TKWB 3OSNA 3MFGA 1L1OA 4ZUJA 4LF4L 2I07B 1Y8OB 3MXNA 4F7XA 4J9RA 1IOWA 1AW7A 3OSOA 2VQFQ 1JMCA 1KJ9A 4EBEA 4I50F 1KDCA 1CHPD 1Y8PB 5ELCA 4WD3A 4MTDA 2SNSA 4FF2A 2EY5A 1J5EQ 1F2YA 1KTKA 1XTCD 4EX5A 1X3PA 1VF7A 3GTLA 5CV8A 4ME3A 4XQJA 4IO9A 1K73C 4B3ML 4G57A 2KA7A 3GTLB 1TWAA 2BQUA 4PDBA 4A3MG 4X6AH 3X3MA 4ED6A 1HUMA 1SE8A 5D3IB 3ORRA 1OO9B 4EQNA 4OGQC 1DOMA 5KT3A 4ODGA 1ENCA 5LHY1 1GHKA 3PF5A 2RBMA 2FFKB 5H1SE 4X3SA 4IN3A 3JSNA 3OTOH 3KAKA 4QIWA 1KC7A 4L5TA 4YCUA 3J81i 2PZWA 2F0OA 3OIPA 3GTJA 1I50A 1Y1VH 5EKIA 3M3YH 2L12A 2VQFL 2O5JC 4B3SQ 5ELOA 2AU0A 4XQNA 2CWAA 5LMUL 1ZKOA 4UDUC 1HQRD 3RIZA 1X3FA 5FKAC 5IT9W 4UCOA 2A19A 4E4TA 1X65A 1I7NA 1EU4A 2IPKD 2H1EA 3TQYA 1CSPA 1SN8A 4EG0A 4LF9L 3K8AA 1II3A 4ED1A 3GDEA 1Q86C 2R8IA 3EIVA 5KYLA 2SNMA 1ML0D 1STYA 2RHSB 4TQRA 4CC5A 4DL6A 3LGJA 1SR3A 3RAXA 1STGA 4BBSB 2F4IA 2F52A 4JI8Q 4EFEA 1NCVA 1A2UA 3L2PA 3CHBD 5J3BA 2GN5A 4A2AA 2ALZA 1S9FA 2BQ3A 2CH4A 3DUZA 3S1NB 2R8GA 2VB2X 1HCZA 4JYAQ 3R8BA 2Z4HA 1B9MA 2A69C 4YY3Q 1X56A 1TWFH 1JKJB 1XMQQ 1X9NA 2HQEA 2ASJA 1V1OA 4DPGA 4CDDC 3KF8A 4JBKA 3RV4A 3KJPA 1T36A 3KF8B 5LOVF 2R92H 5I9OA 1SYFA 3GTKB 4LK1C 5KFTA 4PMWA 2F0TA 3G71A 4X65L 2B63A 1EZ6A 4RU9A 5A2QE 1JDBB 5CC4A 3S9WA 1NY4A 4K8JA 5IGEA 2ZJQA 3FMAA 4C1NI 1BXRA 5KFQA 1AE3A 4X64H 4JYAH 4Q5VA 5JPNC 1VQIA 3K57A 1A63A 4ECQA 2A74C 2PMZE 2JA7B 3LWEA 2G5DA 3RFCA 3A8KE 4X62L 2ZTEA 3OUZA 2JA7A 4V0BA 4EQPA 4KV6A 2BOSA 4CKCA 3G6JB 3H3VH 5E7NA 1IOVA 4MV8A 3I4MB 3OYYA 5M5YH 4GC7A 4ECSA 1A2TA 3JAMW 2Z6KA 3I4MH 1E1OA 1EWHA 4RUAA 2R93H 2AQ4A 4IWYA 2EXZA 1HNXH 4DKAC 3CCEA 4DV3H 4AYBE 2RQXA 4Q8FA 1V1PA 4HNVA 4IAJA 4KMUC 4IURA 5FPOA 5D65A 4HN7A 3H3VC 2YCHA 3G6XA 4RUCA 1X54A 4DL2A 1A3UA 2Y0SE 2FK2A 4ZUIA 2XGQA 4LF7H 1SFOH 2ENBA 1HFNA 2V4RA 1XXGA 4DV3Q 1ZEQX 1GXDC 2L5TA 1GUWA 1JWSD 4APMA 1C30A 2VQDA 3OTOQ 4OWXB 1B53A 2FPGB 1BO0A 1M6VA 3H91A 1UC8A 1BCPF 5ELFA 1HA5A 3RZDH 2F0FA 1KC8C 3CQZH 1PH6A 1U4RA 4PZ7A 1A8VA 1MKHA 4ZKCB 2KBNA 3PQIA 4EYIB 2K14A 3EROA 3HOYB 1KJQA 4ZQIA 3Q8DA 4A3FH 3WNZA 4WFN3 4DUYL 1F9SA 3RV3A 2CW0C 5KG2A 1YNNC 3W1BA 2L15A 2KECA 4ZCKA 3J80W 1ICFB 5EWFA 1JB3A 2KEDA 4S3SA 2CW7A 2WB1B 2W7OA 2ZJTA 1J5EH 4A3KB 3K59A 1KJ8A 1J5EL 1AN7A 3T5KA 4A3KH 5FJ8G 1CT1D 3DWAA 3KTMA 1I4GA 4C5AA 2XC9A 2LXJA 2CH4W 2DWCA 3J7AK 2KHSA 1W6KA 1VQFA 2HVRA 1RL2A 1BR9A 4QWDA 3RB0A 4JI0L 4GNXB 1JORA 2A68C 2FLPA 3U9SA 3MXGA 1EY6A 1N36Q 3ICEA 3P75A 3GTLH 2R7ZB 1GJXA 4MA0A 4ZRZA 2QA4A 4JI8H 3PIO3 2E2IH 2JA9A 1Z2NX 1K9MC 2K5VA 5G3LF 4KD3A 5JJZA 4GKJL 2MCTA 1V9PA 2JEIA 5KG7A 4UY8C 3U4ZA 4DR2L 4DR3Q 2K28A 4I55F 1MBYA 2EYOA 4KN4C 1D8LA 4GOPA 2N8NA 4G4KA 1BCPD 4ED3A 3C2PA 1EYDA 1QOHA 2D0PA 1PH5A 2A6EC 4QIWB 3CVZA 3GTMH 2FPPB 3U9OA 3P1HA 4KY5A 3RN5A 1A62A 2XTIA 3STBD 4K14A 2A5HA 1Q8KA 3K80C 5IGFA 1KXLA 4HIMA 5CR3A 3RUPA 2NB0A 1XPUA 2C2EA 1ZETA 3GV3A 5C4JB 4Q0YA 2OT2A 1CM9A 2E2HH 5C44B 1VQBA 5KYIA 1I4XA 3GIMA 2K5WA 4ALPA 1CKNB 2YZMA 4FU0A 2VQEL 4LFCL 1SJHD 4UCUA 3Q8QB 1C8CA 2FMAA 4G7OC 1CTMA 1WTPA 3V4ZA 4XDXA 4AH6A 5C0XJ 3JZIA 1SXTA 2N55A 2Q8TA 1VBGA 2F4VH 1S4ZA 2IX0A 5DEHA 2R7ZG 1JIHA 4GLVB 4ED7A 3ER0A 5D1OB 4HTHA 4OX9Q 2WFWA 4ID6A 4I4TF 1RJTA 1TWCH 4IZ8A 5I2YA 4DR6Q 4H02A 1TWFA 2R7LA 1VDZA 3CCUA 3A56A 2DIKA 4R4IA 1LT6D 2K04A 2Q2IA 1YNJD 3U58A 2R92B 2IW3A 3K5HA 3MEHA 4X3UA 4IRCA 1CZGA 5IYCH 4ECXA 1RCVD 4A3DH 1E3PA 3H20A 4O3QA 1PA6A 1Q81C 2WB1G 4HMJA 1O7YA 2B63H 1WVLA 4PV1C 1AUXA 4UP8A 2CW8A 1FYCA 4HJ8A 4A3BG 2DNEA 3K5LA 4RGMA 1OTCA 2E2JH 4R4CA 5IYBG 1PLFA 4LF8L 3SEBA 4DV7H 2Z6KC 4DFAA 1M4VA 1RK6A 2W9BB 5L1JA 4DV1H 4E6IA 1SNQA 2PNRC 1KQSA 4ZI7F 1U4LA 3T1HL 1PX2A 4EGVA 2YYAA 4K6LA 4ZLTF 1Y1WG 2XIGA 1EZ1A 4X64Q 4O3PA 3DF7A 2QDLA 4DUYH 3CRKC 1HNZQ 3TSSA 3GTQH 1Z47A 4HMIA 4KKTA 3J80L 2OXPA 5IP7G 5KFYA 2YTYA 4IQZA 3JAME 3L0OA 4IALA 2ATWA 1UE1A 4DV3L 3UQ8A 5KG3A 3I72A 3MWDA 1FKAH 3I4MG 3IL8A 3NHHA 1EY4A 1DYQA 1Q7YC 3MFYA 5HV6A 1BCPC 5DM63 3BJUA 4A3JG 4KK7A 4BA1I 3CQZA 1HUNA 1BNCA 1FJGQ 4K0KQ 1R4PB 2DY7A 4PMCA 2FP4B 2B2TC 2IX1A 4DR2H 2RCFA 5KRUA 3OMCA 1YHAA 2PMZA 4DV0Q 1U4MA 2VUMA 4XQQA 4AYBG 4LF5L 5HY6A 4I65A 3MC0B 1KLGD 4H0LC 1BUVT 2B2VA 2HIXA 4OHJA 1D1IA 4A3BH 4RGOS 3A7LA 5KG1A 3VYUA 2NZOA 3E0JA 3VR6A 4KHPL 2AWOA 2K7VA 5C5LA 4A3FG 4B3SH 5KG4A 1JJGA 4EEYA 1TS4A 2EQSA 2E74C 2V58A 4BWSC 5KFUA 4XTCS 5KX5F 1BOSA 1HH2P 4KLKA 3NQIA 2NN6G 4KI0A 5ELNA 4X65H 4HNTA 4A93B 3SE7A 2E2IA 1VQGA 4JI7L 3S2DH 4JI1L 1LYLA 5EPJA 5I9PA 1FNVA 2EIFA 3PUZA 2W70A 1SE2A 1I3QB 2WACA 5IP7H 1V4YA 4RAUC 1JQYD 4GKKH 5JJLA 3GV5B 1L1OC 5DG8A 2A69D 1B33N 1B8AA 3QWNA 3GIQA 4YHHH 1ET9A 4OEMB 2MUYA 3GTMB 2AMCB 1GLVA 1B3AA 4O0AA 3GTMA 1I50B 3BYTB 1M1KC 2X69A 2VA2A 5L37A 2ZXOA 3KLRA 2BCOA 4DR5Q 3PO2G 2UUAH 1LLRD 5KT6A 2C2RA 3K81C 5M3FG 4JI2L 3M4OH 1B6RA 4XYMB 3VPDA 2VQFH 1WTOA 2F3IA 3QIAA 2AQ3B 1RK5A 2OTLA 4CDFC 2M9VA 1CA5A 3T5JA 2B2YA 2E2HA 3Q23A 1CA6A 3QFFA 4TV9F 4LFAH 4IUQA 2NVXB 4KJOA 3EN2A 1CE8A 4RB3C 4BXXH 1PTOB 4FS1A 3NUCA 2KQ3A 2RDHA 2UXBL 4LUZA 1BJTA 4QWBA 1PTOD 4DUZL 2I8CA 1H9KA 3KHRA 4IJLA 1GO3E 1OXTA 1PH1A 4NXNH 1I94H 3SDZA 1UUPA 1R9TB 1A15A 3JAML 2UU9Q 3S16H 1JLLB 1VQ8A 3PN1A 5KFCA 3FPPA 4J9SA 2EYLA 1NE3A 2K5QA 2UXDL 2F0GA 3A7AB 3QZ8A 2PQAA 1SNDA 1WI5A 4LAAA 4C3HH 2VPSA 4DNRB 2NN6I 2EPBA 1Z2OX 1IW7D 3B6YA 3TIIA 4GZYC 5J39A 4YWMA 1KNEA 4MV4A 2TSSA 4B3MQ 1S0NA 1GVPA 3FKIG 4RCNA 5NUCA 1UNNC 4G3IA 1IBKQ 4CHTB 2NYZD 3I3CA 1H9RA 2I46A 1CHQD 5LL6X 2ZDGA 1GSOA 5DQIA 1N34Q 4JW0A 4DV5Q 3BQ2A 4J9QA 1AFPA 4N8FA 4C3IH 4LF4Q 5I47A 3TN2A 1B7YB 2UUBL 1SNOA 3BVGA 3C1EA 1K8OA 3KFUA 1BBWA 4LFAL 3OWFA 1N9WA 3HOZB 3M9OB 3STBC 5ELDA 1L2ZA 5D1PA 5IYDH 1IBMQ 3PO3B 1E4FT 2W6ZA 1AN8A 2DLNA 1O80A 3H0GG 3OWEB 4ECYA 4Y8VB 3HOWB 4GC6A 4K5WA 1PTOF 5FD6A 3N44B 3ERSX 3TRZA 1VCIA 1EFID 4RZRA 3OSPA 5AJ3L 3HFZB 3OW7A 2R6FA 3AB9A 2R7DA 2IWHA 5KFXA 1AUVA 1E24A 5ELEA 1RJPA 1N33L 4PMBA 5KFEA 3KXYT 2PZUA 5KFWA 4HAEA 3S1MH 2Q8IB 3KDFB 4MNOA 4X66L 5DQGA 1XPOA 2WV6D 4A3MH 3TP5A 2B2UC 4MTNA 4X66H 5GROA 4DV6H 4LF7L 2MP1A 2XWJB 1PK8A 3I12A 3EVQA 5C6AA 4A3GH 2C22A 2ICIA 5KNCA 1RYRA 2LMCB 1Y1WH 3VMMA 1L0XB 2K75A 1YBYA 5KNBA 3VDYA 2VNUD 5KFVA 4HIKA 3M4QA 3HOVB 1YJ9A 4O1NA 2JXMB 5LYJF 1PDQA 4DAYA 3K0YA 1OXXK 2NBFA 1K3RA 2FXQA 4OIJA 4R8IA 1KD1C 1XNQL 4IFDG 4RB2C 3M7NA 1U9RA 4A3LG 1YITA 4QWEA 4X62H 4KHZA 2IHFA 5HGTA 3GP7A 4LF6H 2UXCQ 1UE7A 2EJMA 3JC66 4U6PA 4X3TA 5E4XA 1GSHA 4GLAC 2XSCA 3DLLA 1EWIA 2B63G 1HNWQ 1PH2A 1EUJA 2R3ZA 5LP6F 4O4IF 5HBRB 2WKDA 2QEXA 5LMNH 1GOZA 1VF5C 1DGSA 2XNAC 4P73A 4DR1Q 1K8GA 1L0WA 3L9AX 4C56C 3U4VA 3BZCA 1SYCA 3DM1A 5M5WH 1HA6A 3K5MA 4OL7A 3PSIA 5FLXc 2ASDA 1VQLA 2HD3A 4NP5A 1EIGA 2BH2A 2JN4A 1KLUD 3F8TA 4GOPB 1JXLA 4LF9H 4BBRB 1SNPA 1HZAA 2Z9HA 5LL6S 1AE2A 3PV0A 1IZ6A 3RLOA 1NBWA 1DXMA 4JI6H 1TS2A 2VUMB 4B3TQ 3RZDB 1VMPA 1Q12A 4DV7L 4DV4L 3BDCA 1CUKA 5EPKA 2ZM6H 1VQPA 2FK3A 5KFIA 4JI4L 1WD1A 5KFOA 4DAMA 2KJXA 1EIHA 1C9OA 4JVZA 1XNRL 1GM5A 2YS7A 1NJIC 3RBEA 2VPQA 4DR4H 2NU6B 3T1YQ 3KHLA 1EYCA 5CORA 2JJQA 2YTXA 2PW7A 3G6VA 1SMYC 1B4OA 3Q8RB 3V96A 2F0QA 1G51A 3O13A 4WRDA 4IZOA 1PZID 3T1YH 3PGZA 2HGSA 1B50A 2J9GA 4JI5L 3PUYA 3RLFA 1KIXA 3A8IE 1TS5A 3Q0AA 5IP9H 2CWPA 2ZM6Q 1ZYRD 2EZVA 3T5HA 4ED2A 4OELB 1GUNA 1T3NA 3NE5B 3FEWX 3WO0A 1EY5A 5C4XB 2F4VL 2GVAA 1Z7TA 5F2DA 2JA5A 1CI3M 2Y0SG 2YRXA 3RF2A 2C2DA 4LUVA 4B3RH 2M00A 5TSSA 2ASLA 1Q90A 5A35A 3CD6A 1T9HA 3C46A 2OTJA 3CCJA 3S2HH 2TMPA 2FMMA 3QB3A 1Y69U 2AWNA 3NELA 3NTKA 3GIPA 3V4SA 2UUCL 4Y52H 3MFIA 4DNTB 1A3VA 5C1PA 4LF4H 5D3DA 5CMDA 4NXML 1RIPA 1ILQA 3N43B 2I5MX 1EQRA 1SMYD 2PQEA 4FS2A 2YU9B 5JVH3 1HR0L 1SSOA 2EXDA 4C3JH 2F0PA 1Y1VA 4F4XA 4RGNA 1WFQA 5K5PA 3CF5A 1ULZA 5H80A 4IOCA 3GTOA 3F8NA 4FM9A 4DV6L 2WAQB 2R7KA 1H95A 4HEDA 4BY1G 3GTOB 4RGTA 2JYOA 4YR0A 3NWSA 5FOBB 4HJ9A 3CP0A 1S40A 2W6MA 2B8FA 4QGUA 5C44H 3J81L 2HCCA 2XCPA 3ULPA 4YAJB 1N8RC 4JI1H 1HFGA 3KF6B 1EU3A 2F0IA 1MJCA 1UE6A 4DR7H 5EWEA 1YZ6A 5EKKA 4ECWA 1MJEA 1DONA 1X3QA 2CFMA 3GD7A 1EEID 4GN5A 1L0YB 4BY7G 2NU7B 4PZ6A 3HBLA 4RB0A 2J6UA 4CKEA 3S1NH 4C2MA 5IODA 5IT9E 3ND9A 3J80E 1K0RA 1HPCA 2JSOA 4UFZA 4Q43A 2IA6A 4A3EG 4RZQA 3D4RA 4Q8EA 1O7ZA 2FPIB 1YNND 4JV5L 4O4HF 2IT1A 4Z9CB 2HQLA 3LWUA 2DNCA 2AQ2B 3I7FA 3FVQA 1SROA 2DZDA 3E5SA 2O4XA 2NUAB 4A3GB 3V2TA 2A6HD 2R93G 3CQZB 3PR4A 4DXFA 1STBA 3VA7A 4JI0H 1FVIA 4FXKC 2GA4B 1E4EA 2CHBD 3OMGA 1VAJA 4J9OA 2D5DA 1FL0A 5J2UF 1D1KA 3TQ1A 3E9HA 4R4TA 5LA6F 3C1FA 2BA1A 2KVMA 4QIWE 2BA0A 3D3RA 2JEJA 4P2CB 4DR5H 5COYA 5GONF 4JI3L 1LTID 4LF5H 4DV0L 3IRBA 1NTGA 2W6OA 3M4IA 2F0NA 4K6DA 3I4NB 2N49A 2UXCH 5IYCG 5JJKA 1A0IA 1GUTA 1G2SA 3GLKA 1T94A 4A4IA 4NXNL 2UXDH 2W6NA 5LXTF 2WTFA 4A3DG 3RJ0A 1PFMA 4O3SA 1IBLQ 1YEZA 1VQ4A 4MHEA 2R93A 3TDQA 4DR4L 1QNUA 1KRSA 1LM0A 5I6WA 4A3GG 1KEEA 1SNCA 1XNRH 2MQHA 5FPRA 4EYHB 2EJGC 2HHHQ 2R7ZA 2ALYB 2QCPX 3HOXB 1VQMA 2F0DA 5C4HA 2E2IB 4EVOA 4KHVA 4CDCC 2I87A 1DIKA 3AFQA 1SFOA 5C0XH 4DR4Q 1AP0A 4N8X1 1KL9A 1WTQA 1TU2B 2R6GA 1JJCB 3GO5A 1UC9A 3UE1A 4MV3A 4GS3A 1FNWA 1KNAA 3KHGA 3PO2H 3JAMc 1Y8NB 1WJJA 3WWVA 1OXVA 1ZHQA 3NQTA 1RTNA 2WAQG 4YWLA 1K83B 1QWYA 3K7AH 5IGGA 2NUCA 4IPHA 2IP4A 3GTGH 2RGVA 2FMCA 1K83H 1F2LA 2V5AA 2EJFC 1KABA 1B04A 4J8QA 4P72A 3HGBA 4JI2H 1YNJC 5KG6A 1SYBA 5J1ZA 5KGUA 4J0MA 1SRUA 4O4LF 1D2BA 5KT4A 5IYBH 3EPGA 3W5OA 2CVRA 2IMWP 2A68D 1F9QA 4DR1H 1SJED 3IN5A 1B2TA 4DV5H 3GV7B 4I7HA 1S5FD 5KEEA 5CGKA 2X6GA 4FBUA 1E4GT 4RKLA 4YQWA 1WCMG 1Q1BA 5L1KA 2BE5D 2UXCL 2J6TA 2K01A 4B3MH 2Y0SB 1B3QA 1QZGA 3MWMA 2E5LQ 4LF6Q 4YP3A 2Q2TA 4IPCA 3VPBA 2V59A 3PCOB 3UDXA 4YHHQ 1TIID 1KHIA 2YZGA 4TQUS 3J7A5 1EY7A 5KFLA 5KG0A 1JE4A 3CPFA 3KLSX 2PI2A 4ULLA 5KFJA 4QW8A 1S3OA 5BN4A 3NTIA 1EIFA 4A3DB 1GD7A 5I6YA 5M3MG 4JV5H 4YJ2F 2ZT9C 4NPSA 2Z6BA 5FJ8H 4A3IH 2W71A 2XCLA 4LF6L 1KBLA 3H15A 3GIJA 4J9LA 2L11A 4L5SA 2G9HD 1RF2D 5KIXA 2NZ1D 3GIDA 1W96A 3PZPA 5F9NA 4O2BF 3PIP3 2F0EA 2RHQB 3M9MB 4X66Q 3GTOH 5IGDA 3N41B 5KT7A 1VQHA 2K32A 5CV6A 5JEAG 3PW5A 1WTHA 4NW2A 1PRTF 4U673 2EY6A 1OWTA 1YHBA 1VQEA 2F0UA 4DN4M 5M5YB 5DLQE 3K3PA 5L1IA 3NBIA 1S72A 1N32L 1IKLA 2ID0A 5ISRA 3L4KA 5JVLA 3BG5A 5KFHA 3L4JA 1EZ8A 2XD4A 3VR5A 1HZCA 1P8LA 1TR5A 1S97A 1CK1A 4LF8H 1D5ZC 5CBAE 4K0KH 4DV2Q 2VS1A 3BA8A 1CZWA 3H09A 4LMQD 4NDXA 2I0QA 5KNDA 3I8ZA 3NK9A 4WJWA 2VR1A 2O2LD 3T1HH 3WDNA 3DEPA 3AQQA 2PW5A 3QR8A 4RNOA 3GV6A 2W8LA 4UP7A 1YNXA 3DXJC 1B1ZA 2PMZB 3TZDA 1SE4A 4CKBA 3HOYH 4EGJA 3BQ1A 4UCVA 1HZBA 3MTSA 3GILA 3PR5B 1HNZH 2L9HA 3E0EA 2MGSA 4XYQA 4DUYQ 2QILA 5HURA 1PHJA 2QW7A 4JI5H 1LACA 3FKIH 5EAYA 5M3MH 3TIGA 2PVPA 2VY3A 3SK8A 4C3IB 1JWUD 4C3HG 4XT1B 5BPFA 3HOVG 3KHHA 4J9NA 4OO1H 1SYEA 1E22A 2CQAA 2UU9H 3P20A 2H5XA 3T16A 1XTDA 4LNQA 3UDGA 3G6EA 3N6XA 3NGDA 4A3CG 5KFPA 4M9UA 5C3EB 4JOIA 2OEOA 5KFRA 1OXSC 5KFMA 4ECRA 5EKLA 1QVCA 4R8UA 1FJGH 5C3EH 4JCVE 3OPOA 1TA8A 5KFAA 2R7ZH 3GTQA 1VQ5A 5IP9G 2NU9B 5C8YF 5GAGC 3K3VA 2BR0A 1LTAD 4UAIA 1DV2A 3QOLA 5DAUA 4FXDA 5C3EG 1FNUA 1EL0A 4IRKA 1O7LA 4JV0A 4I7AA 2EYHA 1LT3D 1I4QA 1IYVA 1EUCB 4OX9H 4EGQA 1MGSA 4DGZA 1XPRA 1RHPA 1K1QA 3NWTA 1S0MA 3PO3G 1EY0A 3M3YB 3Q24A 2VQEH 3SK5A 5DNFA 1SEIA 1JICA 4ECUA 2WB1E 4EQ5A 1PRTB 1QNKA 4RAZA 1DOKA 2SOBA 3H4BA 5CAEB 4X3KA 2PPBC 4GKKQ 2NVXA 3HS0C 2F0KA 4YHHL 3GTGA 4F8MA 1B70B 2E5LL 2R8KA 5IT9c 4L5RC 1JT8A 3LP8A 5JOBA 3KALA 5C0XG 2MHVA 2J7ZA 3CCQA 1X3EA 4NMZA 4HJ5A 4IFDH 1RDPD 2JEFA 1XMQL 2CCZA 4RCOA 1WTRA 4XXEA 3RMHA 1CSQA 4K2KA 2CQOA 1PTOC 1K0SA 1U0LA 2KCNA 1QILA 1G91A 2V4QA 3G48A 4FBTA 1H9SA 3SVMA 2PQAB 1E0BA 4LW1A 2QEJC 1H9SB 4LSAA 1MI2A 4DL4A 4ZK9B 1LT5D 4CGYB 2I80A 4NKLA 1TWCB 2ATLA 1I3QH 3I73A 2IX3A 4DA2A 4MTKA 3KAJA 2YTVA 4C3HB 3R2IA 4DR6H 1D6EC 3T53B 4HIOA 5D14A 1BNZA 3MA2B 5FO7B 3A0JA 4BS9A 1XMOH 4BXXG 2KEEA 1PYSB 5FK9C 2F03A 4DV0H 1JCKB 4K0KL 1B6SA 5FLXE 2UUBQ 2RKSA 2F4VQ 2GLTA 5KG5A 4ZAIA 2YU9A 2V4DA 2ZTCA 1GSAA 1LTRD 2KSWA 4JBJA 4KKSA 1TXYA 3BZDB 2ZM6L 3S17B 1DD2A 3KLWA 1S68A 1RKNA 3KBXA 3U50C 4UPAA 1YJNA 1IBKL 3EQLC 2RCNA 2RVLA 5C3XA 1E2VA 1QUQB 5C4ZA 2JA8H 5ELBA 1CKMA 1JOKA 5EWGA 4Q0FA 2HHHL 2O03A 3IFDA 1PRTD 2A6ED 2B39A 4LSXA 1EUDB 1CQVA 4OIKA 1V8QA 3NBHB 3S1QH 4IHJF 3FDSA 3F2CA 2F0MA 1QG7A 2RDFA 3NBHA 3I4LA 5EBDA 3S16B 4J9PA 5D1OA 2UUBH 2AGQA 2RGRA 3OIQA 3SK6A 2K52A 4A93G 3DM3A 4R9WA 4J15A 1JX4A 2PI2E 3KUPA 4DV2L 4B3TL 3MJFA 4MV1A 1G6ZA 2R7FA 1UNSA 3VR4A 2F0SA 1GGOA 5KFBA 1N56A 2D9UA 4LWCA 3A55A 4RB1A 3H0GB 3W3AA 1GKHA 1GHJA 2M05A 1HTLD 1IKMA 4EBCA 4DAYB 4A3FB 1N36H 1E7ZA 3GQBA 3TEHB 1TQOA 2EY2A 1ASYA 3BABA 4OO1G 1N32Q 5CA1F 3H40A 2K5HA 2B8GA 5C3WA 1CQIB 4DK1A 2KCTA 2Z8LA 2RSNA 2DPJA 1B9NA 1U5KA 2XWBB 3W1GA 1HNXQ 3N52A 2W9CB 4AYBB 1TS3A 1PH8A 4N9PA 2W9BA 1NUCA 3MEFA 2JE6I 2KCCA 4AYBA 5KFDA 1I6HH 3IFTA 4KTAA 5FO8B 3PVXA 2WYOA 1WCMH 5E1FA 3HKZE 3V6JA 1WTWA 5JH7F 3SXHA 3GTPB 1NSNS 1Q82C 2Z4IA 4LFBQ 5KFFA 2CKZB 3TS0A 3I91A 3MVVA 4LFBH 1TWAB 2A1AA 1LV9A 4HIDA 1LTSD 3BVMA 5FLXW 3EPIA 2VQEQ 4HNUA 2Z0SA 1NNXA 1ILPA 1AZQA 5CV7A 4HCSA 3BDOA 3R5HA 1ZQ7A 3OHBA 1A6XA 1EIYB 4RH6A 2YW2A 4AQYL 4KHPQ 2FE3A 3T56B 1TVXA 4LF7Q 3OOCA 4KY7A 5M5XH 1S5ED 4ECVA 3IG0A 2B2TA 4LH6A 4O3NA 5L9XA 4ZOLF 1I4HA 2RA4A 2LSSA 3C3LA 1N32H 3MXUA 3VPCA 2EOTA 4QUFA 3F2BA 5M3FH 3TMEA 1VS0A 4FO2A 5DG7A 1LTBD 1Y1VG 5KFNA 3HOUH 1ZYRC 3H94A 1Q3LA 5IT9L 1YHQA 4IPGA 1V51A 1Z2PX 2W8KA 2NVXH 4GKJQ 1C7YA 4GKJH 3MHBA 3Q8PB 1K28A 4PQXA 1DZ1A 1ENAA 3K6OA 4DK6C 2PO4A 4XX0B 1XMOL 4HSVA 5GQOA 4XZ3B 1XYIA 1VMCA 1KJJA 4QB4A 2V1CC 2JP1A 1UEAB 3HOXG 1EOTA 1IHZA 4JI5Q 2R92G 1C0AA 1SMXA 2NZHA 2F0VA 1QJOA
chains in the Genus database with same CATH topology
1J6QA 4IFDI 1KXLA 4HIMA 4JI3Q 2R93G 3AYHB 1XPUA 1R9TH 1PH3A 1FVIA 3EBEA 5JEAJ 3HOUG 3S15H 4GN4B 2KHJA 2E2HH 1FL0A 3GTPH 3HKSA 1AH9A 3E9HA 1YJWA 1VQBA 1EYGA 4R4TA 1IL2A 1YI2A 2HT1A 4ALPA 1CKNB 2BA1A 4QIWE 4BBRH 2BA0A 3CCLA 3TS2A 1X55A 2VQEL 3T1HQ 4LFCL 4JI3L 4JI4Q 4DV0L 3IRBA 1NTGA 4AH6A 5C0XJ 2N49A 2MO0A 2I5HA 3M9BA 4QY7A 1A0IA 1LUZA 5IYCG 3CMEA 4X62Q 5JJKA 4LF8Q 2IX0A 2MFIA 2R7ZG 1IBLL 4A4IA 4GLVB 4NXNL 5GAHC 3ER0A 5C44G 4OONA 1XMOQ 4A3DG 1IBLQ 1YEZA 1VQ4A 4OX9Q 1PV4A 1X6OA 2WFWA 4BY1H 3HOZH 1TWCH 4DR6Q 1C0AA 4H02A 4DR4L 3I2ZA 1KRSA 1LM0A 4GLXA 4A3GG 1X3GA 3I55A 5IE8A 3CCUA 4A75A 4X65Q 4R4IA 1VQNA 2D62A 2MQHA 3M4PA 4APVA 2Q2IA 3U58A 2HHHQ 3HOWH 2ALYB 4A3EH 1VQMA 5IYCH 4A3DH 1E3PA 4BBSH 1PA6A 1Q81C 2WB1G 3E9IA 2PNHA 1PVOA 4RG1A 1VQAA 2B63H 3AFQA 4DV6Q 4DR4Q 3F2DA 4A3LH 1KL9A 4MZ9A 2R6GA 4UP8A 4YY3L 4HJ8A 4OX9L 4A3BG 1JJCB 3GO5A 2K50A 1UEBA 2Q2UA 4JI6L 2IHEA 1OTCA 4A3IG 2E2JH 4R4CA 3UE1A 5IYBG 4GS3A 3HOYG 2LXKA 1IYJB 3AFPA 4LF8L 2Z6KC 1VQKA 3PO2H 5C4XG 3JAMc 1Q46A 4JV5Q 4LUOA 2B3GA 4TVAB 2JA5H 3S14H 1WJJA 3I4OA 3WWVA 2MNAA 3K0XA 5IY0A 1E1TA 4UP9A 1KQSA 1OXVA 3L7ZC 4OO1I 1I94Q 2WAQG 4YWLA 4JI6Q 3T1HL 3K7AH 3HOXH 4DR3L 4A3JH 1W2BA 4LF9Q 3A5ZB 4IPHA 4DR2Q 1Y1WG 3GTGH 1K83H 4X64Q 2JEAI 2ZJPA 1HZ9A 2AKWB 4P72A 1HNZQ 1PH9A 1G6PA 4BA2I 3GTQH 1SRUA 1Z47A 5IYBH 3I56A 1L1OB 3W5OA 3A74A 5IP7G 2YTYA 1QVFA 1PYBA 3L0OA 1W3SA 4O2DA 4GN3B 3GTJH 2AHOB 2ATWA 1UE1A 2VW9A 4DV3L 2UUAQ 1EFWA 3RR5A 1QVGA 2OQ0A 1JJ2A 2E8GA 1WCMG 1Q1BA 1QZHA 3I4MG 1Q7YC 2UXCL 3J80c 3BJUA 4A3JG 4BA1I 1QZGA 4NB3A 1YVCA 2E5LQ 4LF6Q 1FJGQ 2Q2TA 2VUMG 3T1YL 3S17H 4K0KQ 2JQOA 4IPCA 3PCOB 1Y14B 2IX1A 2JA8G 3UDXA 4YHHQ 4FDBA 1KHIA 5K36G 1IXRA 1YHAA 1TWAH 4TQUS 4DV0Q 2UUCQ 3J7A5 4DV1L 3CPFA 4DR7L 4DNIA 4IJHA 4P71A 2PI2A 4LF5L 4AYBG 1PH4A 1S3OA 5HY6A 4DV1Q 1EIFA 2B29A 1GD7A 4C2MH 5M3MG 4QJFA 5GAEC 4NPSA 4A3IH 5FJ8H 4DV7Q 2HIXA 3OW2A 1JB7A 4LF6L 5IWAQ 1NMGA 1I5FA 4A3BH 3H15A 4XIGS 1VQ7A 1VQOA 4L5SA 2VUMH 2NZOA 4KHPL 3K7UC 2AWOA 3UDIA 4A3FG 1N34L 1YIJA 1JJGA 1I50H 2RHQB 2EQSA 4X66Q 3PUXA 2C35B 3GTOH 3S24A 1VQHA 5JEAG 4XTCS 1TWHH 1HH2P 4KLKA 1YHBA 4KI0A 1VQEA 2NN6G 5ELNA 4A3CH 5DLQE 2K5NA 1S72A 1N32L 3D0FA 3CCRA 2ID0A 2OQKA 1L2FA 2VZAA 1VQGA 4JI7L 2D0OA 4JI1L 1LYLA 3S2DH 3CC7A 1JE5A 3J81c 4HJ7A 4HJAA 4X64L 2EIFA 3PUZA 3JAMi 1HZCA 3BU2A 4B3RL 5IP7H 4BBRG 2YYZA 1O7IA 1P8LA 1KRTA 4A3KG 5JJLA 1L1OC 1I94L 3CCVA 1B8AA 3CW2C 3CAMA 2AMCB 4DV2Q 2VS1A 2I0QA 4O0AA 2ASBA 1M1KC 1LTLA 4YWKA 2JA6G 2N78A 1VQCA 3KYHC 4DR5Q 2ZJRA 3PO3H 3ULLA 5C4XH 3PO2G 2I5LX 2JK8A 2OCEA 4AQYQ 3K81C 3PUVA 1QUQA 3AQQA 2ZTDA 4PG3A 2RF4A 4AIMA 5M3FG 4JI2L 1VQ6A 3AEVA 1OXUA 2F3IA 4A93H 2NVTH 3CMAA 2OTLA 3RZOH 1UWVA 4OWTB 4IPDA 4WJ3M 4UP7A 1FGUA 1YNXA 3RLNA 3HOYH 4BY7H 3BZKA 1VQ9A 1HZBA 1P16A 3EN2A 3PUWA 4JI2Q 4BXXH 3E0EA 4DUYQ 4DR1L 4BBSG 4LUZA 4QQBX 2UXBL 1UE5A 4POGA 2IY5B 1PHJA 3ZJYC 4OWWB 4DUZL 3FKIH 3HKZG 5EAYA 3KOJA 5M3MH 3HOWG 4LFBL 2VY3A 4IJLA 1GO3E 1OXTA 4PZ8A 4GOPC 1PH1A 3UE0A 3PIOA 3HOVG 1HNWL 1N33Q 3KDFA 5C4JH 3HOZG 1E22A 2UU9Q 2JA7H 1NMFA 2GVBA 2H5XA 2XGTA 3S16H 1CKOA 3FP9A 5AJ3Q 1XTDA 1VQ8A 4LNQA 3UDGA 4JI8L 3G6EA 1NE3A 2UXDL 1HNXL 2PQAA 4JI1Q 4A3CG 4GKKL 4JOIA 1WI5A 5LMNL 3HOVH 3F1ZA 4C3HH 1OXSC 1V43A 2NN6I 2NVQH 1QVCA 3B6YA 5C3EH 4JCVE 3CC4A 4YWMA 3PIPA 2R7ZH 1N36L 4B3MQ 1VQ5A 1GVPA 5IP9G 3FKIG 3J7ZC 2JA7G 5GAGC 4LFAQ 5FLMG 1IBKQ 1BBUA 1L1OA 4LF4L 1N34Q 4DV5Q 1ASZA 5C3EG 4JYAL 2A8VA 2VQFQ 1JMCA 1HR0Q 4C3IH 4JBMA 4LF4Q 4QL5A 1B7YB 2UUBL 1J5EQ 4NXMQ 2K4KA 1TWGH 3KFUA 3D31A 1BBWA 1XPRA 4LFAL 1N9WA 3PO3G 4EX5A 3STBC 4ME3A 5IYDH 1IBMQ 4IO9A 1K73C 4B3ML 2WB1E 4EQ5A 4A3MG 3GTKH 4X6AH 3H0GG 4R4OA 1SE8A 4B3RQ 4GKKQ 5BR8Q 2Q2HA 3ERSX 4YHHL 3TRZA 1VCIA 1B70B 2E5LL 5AJ3L 3HFZB 5IT9c 4L5RC 2R7DA 4B3SL 1E24A 1JT8A 3PF5A 4WJ4A 1VQJA 5C0XG 1IBML 1N33L 3CCQA 1X3EA 5H1SE 4HJ5A 4L5TA 4YCUA 3J81i 1G291 3S1MH 3KDFB 4MNOA 4X66L 1XMQL 1XPOA 2CCZA 4JI0Q 1CSQA 1WOCA 2CQOA 4A3MH 4MTNA 1EQQA 5GROA 1Y1VH 3I4NH 1U0LA 3CXCA 3NENA 4LF7L 3M3YH 4GNXA 2VQFL 3G48A 3S1RH 1BVSA 2YV5A 4B3SQ 4A3GH 5ELOA 4DV5L 2PQAB 2CWAA 5LMUL 4LW1A 3PF4A 4Y7NH 1X3FA 3RN2A 1Y1WH 1HNZL 2K75A 3KF6A 2A19A 1KAWA 1X65A 1YBYA 5C0XI 3VDYA 1EOVA 2VNUD 1I3QH 4HIKA 3TQYA 1CSPA 1SN8A 3M4QA 4LF9L 1XNRQ 3K8AA 1YJ9A 2YTVA 2MO1A 3GDEA 3G4SA 1Q86C 3EIVA 4JBWA 1Q1EA 4HIOA 1HR0W 1OXXK 3A0JA 2DGYA 1K3RA 2FXQA 2RHSB 1KD1C 4DR7Q 1XNQL 5FLMH 4BXXG 4IFDG 1PYSB 3LGJA 1SR3A 2QGQA 4DV4Q 3M7NA 2UXDQ 4IFDJ 4A3LG 2F52A 4JI8Q 1YITA 4K0KL 2UUBQ 2F4VQ 4KHZA 2IHFA 3L2PA 5J3BA 3RNUA 2GN5A 2OWOA 2ZTCA 2UXCQ 1UE7A 3JC66 4GLAC 4YCVA 4JBJA 3KJOA 3DLLA 1EWIA 1TXYA 2ZM6L 4JYAQ 2B63G 1HNWQ 3KLWA 1EUJA 1PH2A 2UUAL 4YY3Q 1X56A 2BH8A 3OTOL 1TWFH 3U50C 4UPAA 1XMQQ 2QEXA 1YJNA 1X9NA 1IBKL 3H0GH 1Z9FA 2RCNA 4DPGA 4JBKA 4DUZQ 1M90C 3KJPA 1DGSA 4P73A 1QUQB 5IYDG 4DR1Q 1K8GA 2JA8H 2UXBQ 3KF8B 1L0WA 1CKMA 2R92H 3U4VA 2HHHL 3BZCA 4PMWA 5GADC 3G71A 4X65L 5M5WH 5LMNQ 4L5QA 2WP8J 3PSIA 5FLXc 5BR8L 1NY4A 1VQLA 2ZJQA 2BH2A 2VL6A 4DR6L 3F8TA 1AE3A 4GOPB 1BKBA 3NBHB 3S1QH 1HZAA 4P74A 1AE2A 3PV0A 1VQIA 1IZ6A 3RLOA 1A63A 3MXNB 3F2CA 2DUDA 2PMZE 1NBWA 4DR5L 3CCMA 4B3TQ 2K52A 4IOAA 4X62L 4A93G 1SLJA 2ZTEA 3DM3A 1Q12A 4J15A 3CC2A 2PI2E 4DV7L 4DV4L 4DV2L 5E7NA 4B3TL 1CUKA 3H3VH 3OYYA 5M5YH 1XNQQ 1VQPA 2R7FA 2JA5G 4JI4L 2Z6KA 3I4MH 1E1OA 4LWCA 4DAMA 4LFCQ 2R93H 3FHWA 1GKHA 4DKAC 1C9OA 3CCEA 4AYBE 1XNRL 4DAYB 1GM5A 1NJIC 1E7ZA 3TEHB 4JI7Q 3T1YQ 1ASYA 1WYDA 2JJQA 1VQDA 2YTXA 3M85A 4YCWA 4OO1G 1N32Q 1X54A 2K5HA 2Y0SE 1G51A 3PGZA 2KCTA 1SFOH 4RMFA 1U5KA 3W1GA 4DV3Q 1HNXQ 4JI5L 3PUYA 3RLFA 3ULJA 3UDFA 1KIXA 3J81j 3OTOQ 4OWXB 1PH8A 1D7QA 3MEFA 2JE6I 1MIUA 4R1JA 5IP9H 2CWPA 2ZM6Q 1KC8C 3RZDH 1PH6A 3CQZH 1I6HH 4PZ7A 4DK3C 1A8VA 3TREA 1MKHA 5LMNW 2F4VL 2GVAA 1WCMH 3HKZE 3A5UA 2KBNA 2Y0SG 2K14A 4GNXC 4LUVA 1Q82C 4LFBQ 3Q8DA 2CKZB 4A3FH 3TS0A 2ES2A 1CKNA 3CD6A 1T9HA 2A1AA 4DUYL 4HIDA 3SGIA 2OTJA 3CCJA 3S2HH 4LF5Q 3W1BA 2VQEQ 2Z0SA 2L15A 4JC0A 2AWNA 3NELA 5JJIA 4JG2A 2UUCL 2WAQE 4POFA 4Y52H 4OXPA 2KCMA 1FJGL 1J5EL 4NXML 1EIYB 1RIPA 5LMUQ 4A3KH 2I5MX 3NEMA 1EQRA 5FJ8G 1PH7A 4AQYL 1HR0L 5HGQA 2EXDA 2LXJA 4C3JH 4KHPQ 1WFQA 4LF7Q 3CF5A 4A76A 5M5XH 3M4OH 1VQFA 4IOCA 3CCSA 1RL2A 1HJPA 2KENA 5IWAL 1XJVA 4JI0L 4GNXB 2LSSA 4DV6L 1H95A 4BY1G 4HJ9A 3CP0A 3F2BA 1S40A 1N36Q 3ICEA 3GTLH 5M3FH 4QGUA 5C44H 1VS0A 2QA4A 3ULPA 2E2IH 2N3SA 2JA9A 3H3VI 1Y1VG 1N8RC 3I4NG 3KF6B 1K9MC 3HOUH 2K5VA 2JEBI 3CPWA 2JA6H 1MJCA 1YHQA 4GKJL 1UE6A 1V9PA 4IPGA 1YZ6A 2NVXH 4GKJQ 1C7YA 4UY8C 4R4QA 1PFSA 3U4ZA 4DR2L 1MJEA 4DR3Q 2CFMA 3GD7A 4GN5A 4BY7G 4DK6C 1V1QA 4PZ6A 1D8LA 2NVYH 4GOPA 2UU9L 2N8NA 1XMOL 5GQOA 1K8AC 4P75A 2YU9H 3S1NH 1K0RA 2D0PA 1PH5A 4A3EG 4NXNQ 3GTMH 2V1CC 4JV5L 2IT1A 2KHIA 2HQLA 3J80i 3HOXG 4JI5Q 2HIVA 4JOIC 3I7FA 3RN5A 2R92G 1A62A 1SROA 2XTIA 3STBD 1SMXA 2NZHA 1Q8KA 3K80C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  4IFD I;  1KXL A;  4HIM A;  4JI3 Q;  2R93 G;  3AYH B;  1XPU A;  1R9T H;  1PH3 A;  1FVI A;  3EBE A;  5JEA J;  3HOU G;  3S15 H;  4GN4 B;  2KHJ A;  2E2H H;  1FL0 A;  3GTP H;  3HKS A;  1AH9 A;  3E9H A;  1YJW A;  1VQB A;  1EYG A;  4R4T A;  1IL2 A;  1YI2 A;  2HT1 A;  4ALP A;  1CKN B;  2BA1 A;  4QIW E;  4BBR H;  2BA0 A;  3CCL A;  3TS2 A;  1X55 A;  2VQE L;  3T1H Q;  4LFC L;  4JI3 L;  4JI4 Q;  4DV0 L;  3IRB A;  1NTG A;  4AH6 A;  5C0X J;  2N49 A;  2MO0 A;  2I5H A;  3M9B A;  4QY7 A;  1A0I A;  1LUZ A;  5IYC G;  3CME A;  4X62 Q;  5JJK A;  4LF8 Q;  2IX0 A;  2MFI A;  2R7Z G;  1IBL L;  4A4I A;  4GLV B;  4NXN L;  5GAH C;  3ER0 A;  5C44 G;  4OON A;  1XMO Q;  4A3D G;  1IBL Q;  1YEZ A;  1VQ4 A;  4OX9 Q;  1PV4 A;  1X6O A;  2WFW A;  4BY1 H;  3HOZ H;  1TWC H;  4DR6 Q;  1C0A A;  4H02 A;  4DR4 L;  3I2Z A;  1KRS A;  1LM0 A;  4GLX A;  4A3G G;  1X3G A;  3I55 A;  5IE8 A;  3CCU A;  4A75 A;  4X65 Q;  4R4I A;  1VQN A;  2D62 A;  2MQH A;  3M4P A;  4APV A;  2Q2I A;  3U58 A;  2HHH Q;  3HOW H;  2ALY B;  4A3E H;  1VQM A;  5IYC H;  4A3D H;  1E3P A;  4BBS H;  1PA6 A;  1Q81 C;  2WB1 G;  3E9I A;  2PNH A;  1PVO A;  4RG1 A;  1VQA A;  2B63 H;  3AFQ A;  4DV6 Q;  4DR4 Q;  3F2D A;  4A3L H;  1KL9 A;  4MZ9 A;  2R6G A;  4UP8 A;  4YY3 L;  4HJ8 A;  4OX9 L;  4A3B G;  1JJC B;  3GO5 A;  2K50 A;  1UEB A;  2Q2U A;  4JI6 L;  2IHE A;  1OTC A;  4A3I G;  2E2J H;  4R4C A;  3UE1 A;  5IYB G;  4GS3 A;  3HOY G;  2LXK A;  1IYJ B;  3AFP A;  4LF8 L;  2Z6K C;  1VQK A;  3PO2 H;  5C4X G;  3JAM c;  1Q46 A;  4JV5 Q;  4LUO A;  2B3G A;  4TVA B;  2JA5 H;  3S14 H;  1WJJ A;  3I4O A;  3WWV A;  2MNA A;  3K0X A;  5IY0 A;  1E1T A;  4UP9 A;  1KQS A;  1OXV A;  3L7Z C;  4OO1 I;  1I94 Q;  2WAQ G;  4YWL A;  4JI6 Q;  3T1H L;  3K7A H;  3HOX H;  4DR3 L;  4A3J H;  1W2B A;  4LF9 Q;  3A5Z B;  4IPH A;  4DR2 Q;  1Y1W G;  3GTG H;  1K83 H;  4X64 Q;  2JEA I;  2ZJP A;  1HZ9 A;  2AKW B;  4P72 A;  1HNZ Q;  1PH9 A;  1G6P A;  4BA2 I;  3GTQ H;  1SRU A;  1Z47 A;  5IYB H;  3I56 A;  1L1O B;  3W5O A;  3A74 A;  5IP7 G;  2YTY A;  1QVF A;  1PYB A;  3L0O A;  1W3S A;  4O2D A;  4GN3 B;  3GTJ H;  2AHO B;  2ATW A;  1UE1 A;  2VW9 A;  4DV3 L;  2UUA Q;  1EFW A;  3RR5 A;  1QVG A;  2OQ0 A;  1JJ2 A;  2E8G A;  1WCM G;  1Q1B A;  1QZH A;  3I4M G;  1Q7Y C;  2UXC L;  3J80 c;  3BJU A;  4A3J G;  4BA1 I;  1QZG A;  4NB3 A;  1YVC A;  2E5L Q;  4LF6 Q;  1FJG Q;  2Q2T A;  2VUM G;  3T1Y L;  3S17 H;  4K0K Q;  2JQO A;  4IPC A;  3PCO B;  1Y14 B;  2IX1 A;  2JA8 G;  3UDX A;  4YHH Q;  4FDB A;  1KHI A;  5K36 G;  1IXR A;  1YHA A;  1TWA H;  4TQU S;  4DV0 Q;  2UUC Q;  3J7A 5;  4DV1 L;  3CPF A;  4DR7 L;  4DNI A;  4IJH A;  4P71 A;  2PI2 A;  4LF5 L;  4AYB G;  1PH4 A;  1S3O A;  5HY6 A;  4DV1 Q;  1EIF A;  2B29 A;  1GD7 A;  4C2M H;  5M3M G;  4QJF A;  5GAE C;  4NPS A;  4A3I H;  5FJ8 H;  4DV7 Q;  2HIX A;  3OW2 A;  1JB7 A;  4LF6 L;  5IWA Q;  1NMG A;  1I5F A;  4A3B H;  3H15 A;  4XIG S;  1VQ7 A;  1VQO A;  4L5S A;  2VUM H;  2NZO A;  4KHP L;  3K7U C;  2AWO A;  3UDI A;  4A3F G;  1N34 L;  1YIJ A;  1JJG A;  1I50 H;  2RHQ B;  2EQS A;  4X66 Q;  3PUX A;  2C35 B;  3GTO H;  3S24 A;  1VQH A;  5JEA G;  4XTC S;  1TWH H;  1HH2 P;  4KLK A;  1YHB A;  4KI0 A;  1VQE A;  2NN6 G;  5ELN A;  4A3C H;  5DLQ E;  2K5N A;  1S72 A;  1N32 L;  3D0F A;  3CCR A;  2ID0 A;  2OQK A;  1L2F A;  2VZA A;  1VQG A;  4JI7 L;  2D0O A;  4JI1 L;  1LYL A;  3S2D H;  3CC7 A;  1JE5 A;  3J81 c;  4HJ7 A;  4HJA A;  4X64 L;  2EIF A;  3PUZ A;  3JAM i;  1HZC A;  3BU2 A;  4B3R L;  5IP7 H;  4BBR G;  2YYZ A;  1O7I A;  1P8L A;  1KRT A;  4A3K G;  5JJL A;  1L1O C;  1I94 L;  3CCV A;  1B8A A;  3CW2 C;  3CAM A;  2AMC B;  4DV2 Q;  2VS1 A;  2I0Q A;  4O0A A;  2ASB A;  1M1K C;  1LTL A;  4YWK A;  2JA6 G;  2N78 A;  1VQC A;  3KYH C;  4DR5 Q;  2ZJR A;  3PO3 H;  3ULL A;  5C4X H;  3PO2 G;  2I5L X;  2JK8 A;  2OCE A;  4AQY Q;  3K81 C;  3PUV A;  1QUQ A;  3AQQ A;  2ZTD A;  4PG3 A;  2RF4 A;  4AIM A;  5M3F G;  4JI2 L;  1VQ6 A;  3AEV A;  1OXU A;  2F3I A;  4A93 H;  2NVT H;  3CMA A;  2OTL A;  3RZO H;  1UWV A;  4OWT B;  4IPD A;  4WJ3 M;  4UP7 A;  1FGU A;  1YNX A;  3RLN A;  3HOY H;  4BY7 H;  3BZK A;  1VQ9 A;  1HZB A;  1P16 A;  3EN2 A;  3PUW A;  4JI2 Q;  4BXX H;  3E0E A;  4DUY Q;  4DR1 L;  4BBS G;  4LUZ A;  4QQB X;  2UXB L;  1UE5 A;  4POG A;  2IY5 B;  1PHJ A;  3ZJY C;  4OWW B;  4DUZ L;  3FKI H;  3HKZ G;  5EAY A;  3KOJ A;  5M3M H;  3HOW G;  4LFB L;  2VY3 A;  4IJL A;  1GO3 E;  1OXT A;  4PZ8 A;  4GOP C;  1PH1 A;  3UE0 A;  3PIO A;  3HOV G;  1HNW L;  1N33 Q;  3KDF A;  5C4J H;  3HOZ G;  1E22 A;  2UU9 Q;  2JA7 H;  1NMF A;  2GVB A;  2H5X A;  2XGT A;  3S16 H;  1CKO A;  3FP9 A;  5AJ3 Q;  1XTD A;  1VQ8 A;  4LNQ A;  3UDG A;  4JI8 L;  3G6E A;  1NE3 A;  2UXD L;  1HNX L;  2PQA A;  4JI1 Q;  4A3C G;  4GKK L;  4JOI A;  1WI5 A;  5LMN L;  3HOV H;  3F1Z A;  4C3H H;  1OXS C;  1V43 A;  2NN6 I;  2NVQ H;  1QVC A;  3B6Y A;  5C3E H;  4JCV E;  3CC4 A;  4YWM A;  3PIP A;  2R7Z H;  1N36 L;  4B3M Q;  1VQ5 A;  1GVP A;  5IP9 G;  3FKI G;  3J7Z C;  2JA7 G;  5GAG C;  4LFA Q;  5FLM G;  1IBK Q;  1BBU A;  1L1O A;  4LF4 L;  1N34 Q;  4DV5 Q;  1ASZ A;  5C3E G;  4JYA L;  2A8V A;  2VQF Q;  1JMC A;  1HR0 Q;  4C3I H;  4JBM A;  4LF4 Q;  4QL5 A;  1B7Y B;  2UUB L;  1J5E Q;  4NXM Q;  2K4K A;  1TWG H;  3KFU A;  3D31 A;  1BBW A;  1XPR A;  4LFA L;  1N9W A;  3PO3 G;  4EX5 A;  3STB C;  4ME3 A;  5IYD H;  1IBM Q;  4IO9 A;  1K73 C;  4B3M L;  2WB1 E;  4EQ5 A;  4A3M G;  3GTK H;  4X6A H;  3H0G G;  4R4O A;  1SE8 A;  4B3R Q;  4GKK Q;  5BR8 Q;  2Q2H A;  3ERS X;  4YHH L;  3TRZ A;  1VCI A;  1B70 B;  2E5L L;  5AJ3 L;  3HFZ B;  5IT9 c;  4L5R C;  2R7D A;  4B3S L;  1E24 A;  1JT8 A;  3PF5 A;  4WJ4 A;  1VQJ A;  5C0X G;  1IBM L;  1N33 L;  3CCQ A;  1X3E A;  5H1S E;  4HJ5 A;  4L5T A;  4YCU A;  3J81 i;  1G29 1;  3S1M H;  3KDF B;  4MNO A;  4X66 L;  1XMQ L;  1XPO A;  2CCZ A;  4JI0 Q;  1CSQ A;  1WOC A;  2CQO A;  4A3M H;  4MTN A;  1EQQ A;  5GRO A;  1Y1V H;  3I4N H;  1U0L A;  3CXC A;  3NEN A;  4LF7 L;  3M3Y H;  4GNX A;  2VQF L;  3G48 A;  3S1R H;  1BVS A;  2YV5 A;  4B3S Q;  4A3G H;  5ELO A;  4DV5 L;  2PQA B;  2CWA A;  5LMU L;  4LW1 A;  3PF4 A;  4Y7N H;  1X3F A;  3RN2 A;  1Y1W H;  1HNZ L;  2K75 A;  3KF6 A;  2A19 A;  1KAW A;  1X65 A;  1YBY A;  5C0X I;  3VDY A;  1EOV A;  2VNU D;  1I3Q H;  4HIK A;  3TQY A;  1CSP A;  1SN8 A;  3M4Q A;  4LF9 L;  1XNR Q;  3K8A A;  1YJ9 A;  2YTV A;  2MO1 A;  3GDE A;  3G4S A;  1Q86 C;  3EIV A;  4JBW A;  1Q1E A;  4HIO A;  1HR0 W;  1OXX K;  3A0J A;  2DGY A;  1K3R A;  2FXQ A;  2RHS B;  1KD1 C;  4DR7 Q;  1XNQ L;  5FLM H;  4BXX G;  4IFD G;  1PYS B;  3LGJ A;  1SR3 A;  2QGQ A;  4DV4 Q;  3M7N A;  2UXD Q;  4IFD J;  4A3L G;  2F52 A;  4JI8 Q;  1YIT A;  4K0K L;  2UUB Q;  2F4V Q;  4KHZ A;  2IHF A;  3L2P A;  5J3B A;  3RNU A;  2GN5 A;  2OWO A;  2ZTC A;  2UXC Q;  1UE7 A;  3JC6 6;  4GLA C;  4YCV A;  4JBJ A;  3KJO A;  3DLL A;  1EWI A;  1TXY A;  2ZM6 L;  4JYA Q;  2B63 G;  1HNW Q;  3KLW A;  1EUJ A;  1PH2 A;  2UUA L;  4YY3 Q;  1X56 A;  2BH8 A;  3OTO L;  1TWF H;  3U50 C;  4UPA A;  1XMQ Q;  2QEX A;  1YJN A;  1X9N A;  1IBK L;  3H0G H;  1Z9F A;  2RCN A;  4DPG A;  4JBK A;  4DUZ Q;  1M90 C;  3KJP A;  1DGS A;  4P73 A;  1QUQ B;  5IYD G;  4DR1 Q;  1K8G A;  2JA8 H;  2UXB Q;  3KF8 B;  1L0W A;  1CKM A;  2R92 H;  3U4V A;  2HHH L;  3BZC A;  4PMW A;  5GAD C;  3G71 A;  4X65 L;  5M5W H;  5LMN Q;  4L5Q A;  2WP8 J;  3PSI A;  5FLX c;  5BR8 L;  1NY4 A;  1VQL A;  2ZJQ A;  2BH2 A;  2VL6 A;  4DR6 L;  3F8T A;  1AE3 A;  4GOP B;  1BKB A;  3NBH B;  3S1Q H;  1HZA A;  4P74 A;  1AE2 A;  3PV0 A;  1VQI A;  1IZ6 A;  3RLO A;  1A63 A;  3MXN B;  3F2C A;  2DUD A;  2PMZ E;  1NBW A;  4DR5 L;  3CCM A;  4B3T Q;  2K52 A;  4IOA A;  4X62 L;  4A93 G;  1SLJ A;  2ZTE A;  3DM3 A;  1Q12 A;  4J15 A;  3CC2 A;  2PI2 E;  4DV7 L;  4DV4 L;  4DV2 L;  5E7N A;  4B3T L;  1CUK A;  3H3V H;  3OYY A;  5M5Y H;  1XNQ Q;  1VQP A;  2R7F A;  2JA5 G;  4JI4 L;  2Z6K A;  3I4M H;  1E1O A;  4LWC A;  4DAM A;  4LFC Q;  2R93 H;  3FHW A;  1GKH A;  4DKA C;  1C9O A;  3CCE A;  4AYB E;  1XNR L;  4DAY B;  1GM5 A;  1NJI C;  1E7Z A;  3TEH B;  4JI7 Q;  3T1Y Q;  1ASY A;  1WYD A;  2JJQ A;  1VQD A;  2YTX A;  3M85 A;  4YCW A;  4OO1 G;  1N32 Q;  1X54 A;  2K5H A;  2Y0S E;  1G51 A;  3PGZ A;  2KCT A;  1SFO H;  4RMF A;  1U5K A;  3W1G A;  4DV3 Q;  1HNX Q;  4JI5 L;  3PUY A;  3RLF A;  3ULJ A;  3UDF A;  1KIX A;  3J81 j;  3OTO Q;  4OWX B;  1PH8 A;  1D7Q A;  3MEF A;  2JE6 I;  1MIU A;  4R1J A;  5IP9 H;  2CWP A;  2ZM6 Q;  1KC8 C;  3RZD H;  1PH6 A;  3CQZ H;  1I6H H;  4PZ7 A;  4DK3 C;  1A8V A;  3TRE A;  1MKH A;  5LMN W;  2F4V L;  2GVA A;  1WCM H;  3HKZ E;  3A5U A;  2KBN A;  2Y0S G;  2K14 A;  4GNX C;  4LUV A;  1Q82 C;  4LFB Q;  3Q8D A;  2CKZ B;  4A3F H;  3TS0 A;  2ES2 A;  1CKN A;  3CD6 A;  1T9H A;  2A1A A;  4DUY L;  4HID A;  3SGI A;  2OTJ A;  3CCJ A;  3S2H H;  4LF5 Q;  3W1B A;  2VQE Q;  2Z0S A;  2L15 A;  4JC0 A;  2AWN A;  3NEL A;  5JJI A;  4JG2 A;  2UUC L;  2WAQ E;  4POF A;  4Y52 H;  4OXP A;  2KCM A;  1FJG L;  1J5E L;  4NXM L;  1EIY B;  1RIP A;  5LMU Q;  4A3K H;  2I5M X;  3NEM A;  1EQR A;  5FJ8 G;  1PH7 A;  4AQY L;  1HR0 L;  5HGQ A;  2EXD A;  2LXJ A;  4C3J H;  4KHP Q;  1WFQ A;  4LF7 Q;  3CF5 A;  4A76 A;  5M5X H;  3M4O H;  1VQF A;  4IOC A;  3CCS A;  1RL2 A;  1HJP A;  2KEN A;  5IWA L;  1XJV A;  4JI0 L;  4GNX B;  2LSS A;  4DV6 L;  1H95 A;  4BY1 G;  4HJ9 A;  3CP0 A;  3F2B A;  1S40 A;  1N36 Q;  3ICE A;  3GTL H;  5M3F H;  4QGU A;  5C44 H;  1VS0 A;  2QA4 A;  3ULP A;  2E2I H;  2N3S A;  2JA9 A;  3H3V I;  1Y1V G;  1N8R C;  3I4N G;  3KF6 B;  1K9M C;  3HOU H;  2K5V A;  2JEB I;  3CPW A;  2JA6 H;  1MJC A;  1YHQ A;  4GKJ L;  1UE6 A;  1V9P A;  4IPG A;  1YZ6 A;  2NVX H;  4GKJ Q;  1C7Y A;  4UY8 C;  4R4Q A;  1PFS A;  3U4Z A;  4DR2 L;  1MJE A;  4DR3 Q;  2CFM A;  3GD7 A;  4GN5 A;  4BY7 G;  4DK6 C;  1V1Q A;  4PZ6 A;  1D8L A;  2NVY H;  4GOP A;  2UU9 L;  2N8N A;  1XMO L;  5GQO A;  1K8A C;  4P75 A;  2YU9 H;  3S1N H;  1K0R A;  2D0P A;  1PH5 A;  4A3E G;  4NXN Q;  3GTM H;  2V1C C;  4JV5 L;  2IT1 A;  2KHI A;  2HQL A;  3J80 i;  3HOX G;  4JI5 Q;  2HIV A;  4JOI C;  3I7F A;  3RN5 A;  2R92 G;  1A62 A;  1SRO A;  2XTI A;  3STB D;  1SMX A;  2NZH A;  1Q8K A;  3K80 C; 
#chains in the Genus database with same CATH topology
 3DWQ A;  2IL8 A;  1RD9 D;  1PRT C;  2Y0S A;  5FLX L;  3Q2O A;  4JV1 A;  2NN6 H;  1R9T H;  4KHP H;  1PH3 A;  4XYO A;  5JEA J;  5IGB A;  4A3J B;  4GN4 B;  2KHJ A;  4DLK A;  2EDG A;  3RZO B;  4V19 0;  2R86 A;  2R84 A;  3D4D A;  1K3B C;  1YI2 A;  1F2Z A;  4KD4 A;  1I3Q A;  4BBR H;  1XMQ H;  4B08 A;  1X55 A;  3N6R A;  3T1H Q;  3EFX D;  4YY3 H;  4JI4 Q;  4EBD A;  4U68 A;  2FHT A;  1QE6 A;  1Y1V B;  1PFN A;  2MO0 A;  2NVY B;  4QY7 A;  1LUZ A;  2NTS A;  4LF8 Q;  3W2D A;  2GPS A;  5BMV F;  1IBL L;  5A2Q L;  3Q8S B;  1CS0 A;  4MV7 A;  5DM7 3;  1XMO Q;  2B2W C;  4KJN A;  1A9X A;  5KFK A;  1PV4 A;  3HOZ H;  1ENF A;  3I2Z A;  1BXT A;  4GLX A;  5E4W C;  3I55 A;  5IE8 A;  3ZYY X;  1VQN A;  1MZB A;  5L1L A;  2D62 A;  1MSH A;  2LS0 1;  4APV A;  5IGC A;  3HOW H;  2BQR A;  3A8J E;  4A3E H;  2R85 A;  4M7E A;  1JC7 A;  4BBS H;  2EYJ A;  1B44 D;  3BVZ A;  3E9I A;  5EZY F;  4JUZ A;  1PVO A;  2LKV A;  3DHQ A;  4RG1 A;  1VQA A;  3R5F A;  4MZ9 A;  4I7Z C;  4C5B A;  5K2M A;  4B9W A;  4BY7 B;  4FNF A;  4OX9 L;  2K50 A;  4JI6 L;  2IHE A;  3QJY A;  5T1I A;  1K1S A;  2PN1 A;  2LXK A;  1IYJ B;  2X0S A;  3AFP A;  1TWG A;  1TY0 A;  1Q46 A;  4A2B A;  4CJ0 B;  4JV5 Q;  4TVA B;  2JA5 H;  3S14 H;  1BF4 A;  3I4O A;  3QG1 A;  2FK1 A;  2MNA A;  2R61 A;  5IY0 A;  2OH2 A;  4UP9 A;  2L1B A;  4BY1 B;  3SI8 A;  3L7Z C;  4OO1 I;  4HR7 B;  5AFW A;  1Y1W B;  3G8C A;  2UVW A;  2AGO A;  1W2B A;  1E4E B;  2LY7 A;  2E5L H;  2ZJP A;  4MA5 A;  3KBG A;  4M8A A;  4BA2 I;  2WKC A;  2HVS A;  1ZXT A;  3I56 A;  1L1O B;  2FJ2 A;  1PYB A;  4ILW A;  3NSW A;  3I70 A;  2AHO B;  3KLS A;  3T4A C;  2VW9 A;  1EFW A;  3DWP A;  3RR5 A;  1QVG A;  2E8G A;  4K2L A;  4NLG A;  1R4Q B;  1QZH A;  3S1R B;  3VYS A;  3LNN A;  4NB3 A;  3ETH A;  1T5E A;  4DV2 H;  4CJ1 B;  2G9D A;  2R93 B;  3RB4 A;  4RKB A;  4JK1 C;  5KFG A;  1Y14 B;  1EY9 A;  3PW4 A;  4JV2 A;  3RGZ A;  3MWY W;  2QF7 A;  3URY A;  1TWA H;  2UUC Q;  5K36 G;  4R8U B;  3PW0 A;  4DNI A;  4IJH A;  4G7H C;  4EFB A;  1A3T A;  3OHA A;  3V6H A;  3ITP A;  1PH4 A;  3R23 A;  4HQ6 A;  4UHV A;  1RJQ A;  4C2M H;  4QJF A;  1SBB B;  3N42 B;  3OW2 A;  1JB7 A;  2KOL A;  2L0C A;  1SFO B;  4IR1 A;  1NMG A;  1EQT A;  2XGP A;  3RUZ A;  3LWB A;  2FIN B;  5EQ0 A;  1VQO A;  3CKI B;  2VUM H;  4H44 C;  3H6M A;  3PW7 A;  5EJW A;  2FLN A;  3UDI A;  5EBC A;  1N34 L;  1XDN A;  4FF1 A;  4QF4 A;  1I50 H;  4ECZ A;  1EYA A;  2C35 B;  3PUX A;  1KDB A;  3S24 A;  1BBX C;  1C3O A;  5G3L D;  3Q6S A;  1TWH H;  4LH7 A;  2W7P A;  1WSC A;  2ZXP A;  1G2T A;  4DAV A;  4ECT A;  2HCI A;  3F2U A;  3D0F A;  3CCR A;  3M7G A;  2OQK A;  1L2F A;  2VZA A;  2D0O A;  3K5O A;  3CC7 A;  4HJ7 A;  2BE5 C;  5BPH A;  4CDE C;  4X64 L;  4XYL B;  3BU2 A;  2WB1 A;  1IBL H;  4BBR G;  2YYZ A;  3AMU A;  3NTH A;  3Q1K A;  5C1O A;  1KRT A;  4A3K G;  5J2T F;  4ETS A;  3CW2 C;  3T5L A;  3CAM A;  3TP8 A;  4CJ2 C;  2ASB A;  3MR2 A;  1RYS A;  2WII B;  2Z1C A;  1LTL A;  4YWK A;  2JA6 G;  3SR1 A;  4C1N K;  5JVG 3;  3KYH C;  3L3O C;  3HB9 A;  2K5D A;  2ZJR A;  3ULL A;  3UI2 A;  5C4X H;  2R82 A;  2JK8 A;  3JSL A;  2FB9 A;  4PG3 A;  2ZTD A;  3AEV A;  1DM0 B;  2RF4 A;  4N9T A;  1VQ6 A;  1OXU A;  2K33 A;  4A93 H;  1TWF B;  3CMA A;  4MV9 A;  3RZO H;  1JOQ A;  1FR3 A;  2NU8 B;  4OWT B;  4IPD A;  4WJ3 M;  1FGU A;  1KAA A;  3HXL A;  5CB4 F;  2R92 A;  2EE1 A;  4FYD A;  4JI3 H;  1TAE A;  1P16 A;  1FGB D;  3PUW A;  4JI2 Q;  2VA3 A;  3MWE A;  4DR1 L;  4BBS G;  2IY5 B;  3IKJ A;  4QQB X;  1VKZ A;  1UE5 A;  4POG A;  2W57 A;  3CU7 A;  3ZJY C;  3KOJ A;  3HOW G;  1SEB D;  4HCE A;  2QKI C;  1XX8 A;  2BDN A;  4PZ8 A;  4GOP C;  2YL2 A;  2YS6 A;  2D2C C;  2P5Z X;  1HNW L;  4RNN A;  4KKU A;  5I4D A;  4QCL A;  4YBZ B;  5C4J H;  4Q44 A;  2E2D C;  2JA7 H;  1NMF A;  2GVB A;  2XGT A;  1CKO A;  4C3J B;  1N33 H;  3GV8 B;  2F0W A;  2AUK A;  2DN8 A;  4MN3 A;  1XWE A;  3J7Y W;  4IUP A;  1I4R A;  4ED0 A;  2NVQ B;  4JI1 Q;  1K83 A;  4GKK L;  1I6U A;  4R8N A;  1V43 A;  4O42 A;  2NVQ H;  5CBE E;  3CC4 A;  3P7J A;  4H7B A;  4QWA A;  3GII A;  4ABN A;  2F0L A;  3J7Z C;  5FLM G;  2EYM A;  5T14 A;  3R5X A;  3QZ7 A;  2HVQ A;  4TSS A;  1BBU A;  1WD0 A;  1MSG A;  2EYF A;  5DGB A;  3KK7 A;  1ASZ A;  2NTT A;  4JYA L;  4F4W A;  3SK4 A;  2V9W A;  2A8V A;  5KT5 A;  1HR0 Q;  4AQY H;  4JBM A;  1O78 A;  3ORQ A;  1IYU A;  1TWG B;  2IJ0 A;  4QL5 A;  3S1M B;  3MR3 A;  4NXM Q;  1PMR A;  2K4K A;  1TWG H;  3D31 A;  2XRQ D;  3M4Y A;  5JPM C;  5M9O A;  4WOR A;  1GUO A;  1VBH A;  1J9O A;  3GTK H;  4C3I G;  4R4O A;  2B2U A;  4RA8 A;  4MV6 A;  2B63 B;  5J22 A;  4B3R Q;  5BR8 Q;  2Q2H A;  5C5J A;  1ZHS A;  3T51 B;  4FVM A;  1HXY D;  5CYU A;  2E2J B;  4L8J A;  1S5B D;  4B3S L;  1LTT D;  4WJ4 A;  1VQJ A;  1IBM L;  5BN5 A;  2W9C A;  1G29 1;  4DXG A;  4YIJ A;  2PZT A;  4JI0 Q;  1WOC A;  1SNM A;  1EQQ A;  3I4N H;  3CXC A;  3NEN A;  2AUJ D;  4GNX A;  4Y7N B;  3S1R H;  5EDW A;  1BVS A;  2YV5 A;  3J81 W;  4DV5 L;  3C0F B;  4ME5 A;  3PF4 A;  1LO5 D;  4Y7N H;  3GTP A;  3RN2 A;  1V1P B;  1HNZ L;  3KF6 A;  1KAW A;  5IWA H;  4Q45 A;  5C0X I;  4FP5 D;  1EOV A;  1XNR Q;  4G7Z C;  4LFC H;  2MO1 A;  2PCF B;  2B2V C;  3G4S A;  3EYY A;  2B2W A;  4JBW A;  3A54 A;  1Q1E A;  3QOJ A;  5T1G A;  1CQJ B;  4IR9 A;  4JPB W;  1HR0 W;  2UVR A;  4RWS C;  2O5I C;  2DGY A;  3GTQ B;  4C2M B;  4DR7 Q;  4F87 A;  5FLM H;  5KT2 A;  2QGQ A;  4DV4 Q;  2UXD Q;  4IFD J;  5JQW A;  3QO2 A;  2YRW A;  3N40 P;  1PZK D;  3TP6 A;  3RNU A;  3R3O A;  2OWO A;  3RB3 A;  5KFZ A;  1H9J A;  3WOF A;  3ERQ A;  4YCV A;  3KJO A;  4TRD A;  4H13 C;  2UUA L;  5JEA H;  2BH8 A;  3OTO L;  2HJW A;  2RDJ A;  1T5X D;  1BCP B;  3H0G H;  1C4Q A;  1Z9F A;  3PO2 B;  2K05 A;  3I90 A;  2R7M A;  1TWH B;  4DUZ Q;  3BA9 A;  3Q22 A;  1M90 C;  4PNY A;  2VOB A;  3K7A B;  2EY1 A;  3K5N A;  3JRX A;  5IYD G;  2UXB Q;  5BN3 A;  5LMU H;  1TWH A;  4DAP A;  1WH2 A;  2EVB A;  2BDO A;  5CA0 F;  1TT2 A;  1ESF A;  4K8I A;  5GAD C;  5LMN Q;  1SE3 A;  5M3M B;  2A6H C;  4L5Q A;  1DV1 A;  2WP8 J;  4IUT A;  1NR2 A;  1S03 G;  5BR8 L;  4TV8 F;  2F0J A;  3FKI A;  3GTG B;  4DR6 L;  2VL6 A;  3J81 E;  1M0W A;  4F50 A;  1BKB A;  2HUG A;  2K1B A;  2L55 A;  4P74 A;  1Z6H A;  3X3N A;  4ZKB B;  3MXN B;  2DUD A;  4DR5 L;  2IBK A;  4K5V A;  3CCM A;  2FKL A;  1DCZ A;  4XT3 B;  4IOA A;  1SLJ A;  3FDT A;  3CC2 A;  2ICE C;  1S0O A;  1WCM B;  1W93 A;  1XNQ Q;  3HZX A;  3WOE A;  3RBD A;  2C28 A;  2JA5 G;  4RNM A;  2FLL A;  4LFC Q;  3RB6 A;  1TWC A;  3S2D B;  3FHW A;  5EPL A;  2OLS A;  4FF4 A;  2DJF C;  1ONL A;  1M8A A;  4CBV A;  4JI7 Q;  3BDL A;  1SYX B;  1WYD A;  1VQD A;  1UAP A;  4YCW A;  3M85 A;  3S2H B;  3U9T A;  1D5X C;  3FPU B;  1IW7 C;  2E75 C;  3E3X A;  4KN7 C;  4QUC A;  2HHH H;  4RMF A;  1TY2 A;  3HEJ A;  1LT4 D;  4UCS A;  3ULJ A;  3UDF A;  3J81 j;  1QB5 D;  1LTG D;  1D7Q A;  4R1J A;  1MIU A;  3G6Y A;  3LX0 A;  4DK3 C;  5I2X A;  5CV9 A;  3TRE A;  4PWQ A;  5KFS A;  1FD7 D;  3LML A;  5LMN W;  3TIN A;  5M3F B;  3A5U A;  4DL3 A;  4F88 A;  1PFB A;  4GNX C;  3MR6 A;  4TKO B;  2OF1 A;  4YAK B;  2ES2 A;  1CKN A;  1PTO H;  1JOO A;  3SGI A;  2R87 A;  4LF5 Q;  4ZYS A;  4C3J G;  4JC0 A;  2DJG C;  3GQC A;  5JJI A;  4JG2 A;  2WAQ E;  3HRZ C;  4POF A;  4NXM H;  3D6W A;  2F1M A;  3GIK A;  4OXP A;  2E76 C;  2KCM A;  1FJG L;  5DLG A;  4ME6 A;  5C5M A;  3HKZ A;  3BJY A;  1HR0 H;  5LMU Q;  3BAA A;  3NEM A;  2RDI A;  1PH7 A;  4QWC A;  1PZJ D;  5HGQ A;  3HKZ B;  1N34 H;  5K36 H;  1CQF A;  2GPW A;  1LAB A;  4RHR A;  4A76 A;  3CCS A;  2KEN A;  1HJP A;  5IWA L;  1XJV A;  1F2M A;  1ESR A;  2ZDQ A;  3V6K A;  3MAQ A;  2XRS D;  4EEQ A;  3M9N B;  2N3S A;  3H3V I;  3I4N G;  2QK4 A;  2JEB I;  3CPW A;  2JA6 H;  3GTK A;  1E2Z A;  4R4Q A;  1PFS A;  2JA6 B;  4DU9 A;  1S10 A;  4K5X A;  1V1Q A;  4C5C A;  2NVY H;  4O2A F;  2UU9 L;  4MAM A;  1AEX A;  1U4P A;  2LFN A;  1K8A C;  2YU9 H;  4P75 A;  2C00 A;  4LMY A;  2FJZ A;  4NXN Q;  3VYT A;  3H4D A;  1SCU B;  2KHI A;  1SYD A;  3J80 i;  1NAP A;  4JOI C;  2HIV A;  2ZXR A;  1BDO A;  4B9X A;  1J6Q A;  5FO9 B;  2JA8 B;  4IFD I;  1RJR A;  2DPI A;  3J7A F;  4JI3 Q;  1S5D D;  3AYH B;  3FMC A;  1I6H B;  3VR2 A;  4DL7 A;  3HOU G;  3EBE A;  2PYK A;  3CRL C;  3S15 H;  4UCR A;  4J9K A;  3N8D A;  2YZN A;  4A3E B;  3GTP H;  3HKS A;  4RHS A;  1AH9 A;  1YJW A;  1EYG A;  4DUZ H;  1IL2 A;  5D8D A;  2HT1 A;  1IL8 A;  3CCL A;  3S1Q B;  3TS2 A;  2J4X A;  2MPM A;  3RD4 A;  2XIW A;  4TQS A;  5DQH A;  4O3O A;  2K03 A;  1AZP A;  1PYW D;  3EJI A;  3VA5 A;  2RDG A;  2KUM A;  5IIF A;  3PW2 A;  1M7J A;  1H9M A;  2UVU A;  2I5H A;  3M9B A;  3CME A;  4X62 Q;  2MFI A;  4BWG B;  5GAH C;  4DV4 H;  5JVD F;  4L63 B;  4OON A;  5C44 G;  3D6C A;  2W6Q A;  5DGA A;  2W9A A;  2XN9 C;  2UVV A;  2HDL A;  3T13 A;  1X6O A;  4BY1 H;  4FXG C;  4O3R A;  1I7L A;  1CFM A;  4LJZ C;  3G7L A;  1X3G A;  3OHX C;  2F3V A;  4A75 A;  4X65 Q;  2VB3 X;  3M4P A;  4L6T B;  3H0G A;  3PMF A;  4IUN A;  2R8J A;  2E2H B;  3K5I A;  1IBK H;  4R7R A;  2C5C A;  3V05 A;  2F3W A;  2PNH A;  4DF7 A;  2EYP A;  4A3L H;  4DV6 Q;  3AU7 A;  3F2D A;  3E5N A;  3OUU A;  3VYR A;  4A3B B;  5FD5 A;  4JI7 H;  4YY3 L;  4ED8 A;  4MTE A;  5DG9 A;  1M0T A;  3UFX B;  2NWG A;  1UEB A;  3HG9 A;  2Q2U A;  3IAY A;  1W6J A;  4A3I G;  3HOY G;  4YR2 A;  1JWM D;  3WO1 A;  1XNQ H;  1VQK A;  5C4X G;  3E6Z X;  1F9R A;  3EA6 A;  4LUO A;  2B3G A;  1WCM A;  1GUG A;  2HDM A;  3BYY B;  3K0X A;  1E1T A;  4KY6 A;  4B3T H;  4QMG A;  1I94 Q;  4JI6 Q;  2UUC H;  1I4P A;  3HOX H;  4F4Y A;  4DR3 L;  4A3J H;  1HRJ A;  4LF9 Q;  3A5Z B;  4DR2 Q;  1GUS A;  3FRP B;  4ZHQ F;  4IRD A;  2JEA I;  4U7C A;  4F4Z A;  1HZ9 A;  2AKW B;  5KKN B;  4HSP A;  5M5W B;  1PH9 A;  1G6P A;  3RAQ A;  1SDF A;  1STH A;  2QDB A;  1STA A;  1DJR D;  1ROD A;  4RFB A;  3RTX A;  3A74 A;  5M5X B;  1QVF A;  2UXB H;  4A3I B;  2K6A A;  1W3S A;  2C9O A;  1F77 A;  1HTP A;  4O2D A;  4GN3 B;  2F0H A;  3GTJ H;  1WTV A;  1EHI A;  1PXU A;  2M2L A;  2UUA Q;  3GTJ B;  1O75 A;  2ZDH A;  4DK0 A;  3MXP A;  2OQ0 A;  5EOY A;  1JJ2 A;  2VUG A;  2J6S A;  1HNW H;  2Q8R E;  3J80 c;  2CW0 D;  3R2T A;  3NXW A;  4HYK A;  3HOU B;  2PBZ A;  2R7N A;  1YVC A;  3JRW A;  2WAQ A;  3S17 H;  2VUM G;  3T1Y L;  3ETJ A;  2JQO A;  1NR4 A;  2JA8 G;  4WBN F;  4FDB A;  1EQV A;  1IXR A;  1I6V C;  4DR7 L;  4YB8 B;  4DV1 L;  5IOC A;  3BG3 A;  1HQM C;  3MZ5 A;  4P71 A;  3RGX A;  4J1M A;  3NPP A;  3J7A V;  4DV1 Q;  3TZU A;  2B29 A;  3HP3 A;  5GAE C;  2VXW A;  2MJ8 A;  4DV7 Q;  3TQT A;  1EWC A;  3BQ0 A;  5IWA Q;  1I5F A;  2A73 B;  4XIG S;  1VQ7 A;  1BQQ T;  1G8Z D;  3K7U C;  1F9P A;  1HHV A;  3SE0 A;  1YIJ A;  1JDE A;  1ET6 A;  4J9M A;  2AGP A;  2CQY A;  4IUU A;  2XCA A;  1R9T A;  2XVS A;  2B2Y C;  1N48 A;  1D5M C;  1MD2 D;  1RTO A;  3S14 B;  2JA5 B;  5A2Q W;  2N88 A;  4M1U B;  2QYZ A;  1K8M A;  5IYZ F;  4A3C H;  1Q8I A;  4HR7 A;  2K5N A;  2WDT A;  1Y1W A;  2P0A A;  3TBI B;  4RAY A;  1JE5 A;  3J81 c;  4HJA A;  2JA6 A;  3JAM i;  4B3R L;  2SEB D;  5E3F A;  1O7I A;  5BR8 H;  1JR0 D;  1SAP A;  2J0T D;  1QCB D;  3R93 A;  2WIN B;  1E2W A;  3DEO A;  1I94 L;  3VR3 A;  3CCV A;  1GYF A;  5CV4 A;  1C48 A;  2CZG A;  2NVY A;  4UCT A;  4ZQ3 A;  1IBM H;  2H4O A;  2W6P A;  1EEF D;  3NP8 A;  3K58 A;  1STE A;  2N78 A;  5CV5 A;  1WTX A;  1X32 A;  1VQC A;  3PO3 H;  3ONA B;  4JI4 H;  1ICW A;  2I5L X;  4MIU A;  2OCE A;  4AQY Q;  3PUV A;  1QUQ A;  4AIM A;  2NVT B;  1WR2 A;  4TUY F;  3S15 B;  1DOL A;  2WE6 A;  2NVT H;  1BGW A;  4CC6 A;  1UWV A;  1KJI A;  3BS1 A;  2X6L A;  4DL5 A;  2RSO A;  3RLN A;  2SCU B;  3SHL A;  2L4N A;  1STN A;  4BY7 H;  2JEG A;  3BZK A;  1VQ9 A;  2SDF A;  1EY8 A;  4OWW B;  2DY8 A;  3HKZ G;  4LFB L;  4IUV A;  3DMU A;  4A3M B;  3TP7 A;  3UE0 A;  3PIO A;  1N33 Q;  4QW9 A;  3KDF A;  3HOZ G;  4DR3 H;  3FP9 A;  5AJ3 Q;  5DLF A;  4JI8 L;  3MR5 A;  1HNX L;  5JUM A;  4YJ3 F;  5EGT A;  1MHW C;  1S5C D;  3M4O B;  4L1K A;  5LMN L;  3HOV H;  2R8H A;  3F1Z A;  1SYG A;  5F9L A;  3MFH A;  4EQO A;  4FF3 A;  1J8I A;  3PIP A;  1N36 L;  1KDA A;  3ND8 A;  4J6H A;  5JAV A;  2JA7 G;  5LL6 b;  4LFA Q;  3FKI B;  1EYZ A;  4YR3 A;  2AQ1 B;  3D8G A;  3D4W A;  4IWX A;  1TKW B;  3OSN A;  3MFG A;  1L1O A;  4ZUJ A;  4LF4 L;  2I07 B;  1Y8O B;  3MXN A;  4F7X A;  4J9R A;  1IOW A;  1AW7 A;  3OSO A;  2VQF Q;  1JMC A;  1KJ9 A;  4EBE A;  4I50 F;  1KDC A;  1CHP D;  1Y8P B;  5ELC A;  4WD3 A;  4MTD A;  2SNS A;  4FF2 A;  2EY5 A;  1J5E Q;  1F2Y A;  1KTK A;  1XTC D;  4EX5 A;  1X3P A;  1VF7 A;  3GTL A;  5CV8 A;  4ME3 A;  4XQJ A;  4IO9 A;  1K73 C;  4B3M L;  4G57 A;  2KA7 A;  3GTL B;  1TWA A;  2BQU A;  4PDB A;  4A3M G;  4X6A H;  3X3M A;  4ED6 A;  1HUM A;  1SE8 A;  5D3I B;  3ORR A;  1OO9 B;  4EQN A;  4OGQ C;  1DOM A;  5KT3 A;  4ODG A;  1ENC A;  5LHY 1;  1GHK A;  3PF5 A;  2RBM A;  2FFK B;  5H1S E;  4X3S A;  4IN3 A;  3JSN A;  3OTO H;  3KAK A;  4QIW A;  1KC7 A;  4L5T A;  4YCU A;  3J81 i;  2PZW A;  2F0O A;  3OIP A;  3GTJ A;  1I50 A;  1Y1V H;  5EKI A;  3M3Y H;  2L12 A;  2VQF L;  2O5J C;  4B3S Q;  5ELO A;  2AU0 A;  4XQN A;  2CWA A;  5LMU L;  1ZKO A;  4UDU C;  1HQR D;  3RIZ A;  1X3F A;  5FKA C;  5IT9 W;  4UCO A;  2A19 A;  4E4T A;  1X65 A;  1I7N A;  1EU4 A;  2IPK D;  2H1E A;  3TQY A;  1CSP A;  1SN8 A;  4EG0 A;  4LF9 L;  3K8A A;  1II3 A;  4ED1 A;  3GDE A;  1Q86 C;  2R8I A;  3EIV A;  5KYL A;  2SNM A;  1ML0 D;  1STY A;  2RHS B;  4TQR A;  4CC5 A;  4DL6 A;  3LGJ A;  1SR3 A;  3RAX A;  1STG A;  4BBS B;  2F4I A;  2F52 A;  4JI8 Q;  4EFE A;  1NCV A;  1A2U A;  3L2P A;  3CHB D;  5J3B A;  2GN5 A;  4A2A A;  2ALZ A;  1S9F A;  2BQ3 A;  2CH4 A;  3DUZ A;  3S1N B;  2R8G A;  2VB2 X;  1HCZ A;  4JYA Q;  3R8B A;  2Z4H A;  1B9M A;  2A69 C;  4YY3 Q;  1X56 A;  1TWF H;  1JKJ B;  1XMQ Q;  1X9N A;  2HQE A;  2ASJ A;  1V1O A;  4DPG A;  4CDD C;  3KF8 A;  4JBK A;  3RV4 A;  3KJP A;  1T36 A;  3KF8 B;  5LOV F;  2R92 H;  5I9O A;  1SYF A;  3GTK B;  4LK1 C;  5KFT A;  4PMW A;  2F0T A;  3G71 A;  4X65 L;  2B63 A;  1EZ6 A;  4RU9 A;  5A2Q E;  1JDB B;  5CC4 A;  3S9W A;  1NY4 A;  4K8J A;  5IGE A;  2ZJQ A;  3FMA A;  4C1N I;  1BXR A;  5KFQ A;  1AE3 A;  4X64 H;  4JYA H;  4Q5V A;  5JPN C;  1VQI A;  3K57 A;  1A63 A;  4ECQ A;  2A74 C;  2PMZ E;  2JA7 B;  3LWE A;  2G5D A;  3RFC A;  3A8K E;  4X62 L;  2ZTE A;  3OUZ A;  2JA7 A;  4V0B A;  4EQP A;  4KV6 A;  2BOS A;  4CKC A;  3G6J B;  3H3V H;  5E7N A;  1IOV A;  4MV8 A;  3I4M B;  3OYY A;  5M5Y H;  4GC7 A;  4ECS A;  1A2T A;  3JAM W;  2Z6K A;  3I4M H;  1E1O A;  1EWH A;  4RUA A;  2R93 H;  2AQ4 A;  4IWY A;  2EXZ A;  1HNX H;  4DKA C;  3CCE A;  4DV3 H;  4AYB E;  2RQX A;  4Q8F A;  1V1P A;  4HNV A;  4IAJ A;  4KMU C;  4IUR A;  5FPO A;  5D65 A;  4HN7 A;  3H3V C;  2YCH A;  3G6X A;  4RUC A;  1X54 A;  4DL2 A;  1A3U A;  2Y0S E;  2FK2 A;  4ZUI A;  2XGQ A;  4LF7 H;  1SFO H;  2ENB A;  1HFN A;  2V4R A;  1XXG A;  4DV3 Q;  1ZEQ X;  1GXD C;  2L5T A;  1GUW A;  1JWS D;  4APM A;  1C30 A;  2VQD A;  3OTO Q;  4OWX B;  1B53 A;  2FPG B;  1BO0 A;  1M6V A;  3H91 A;  1UC8 A;  1BCP F;  5ELF A;  1HA5 A;  3RZD H;  2F0F A;  1KC8 C;  3CQZ H;  1PH6 A;  1U4R A;  4PZ7 A;  1A8V A;  1MKH A;  4ZKC B;  2KBN A;  3PQI A;  4EYI B;  2K14 A;  3ERO A;  3HOY B;  1KJQ A;  4ZQI A;  3Q8D A;  4A3F H;  3WNZ A;  4WFN 3;  4DUY L;  1F9S A;  3RV3 A;  2CW0 C;  5KG2 A;  1YNN C;  3W1B A;  2L15 A;  2KEC A;  4ZCK A;  3J80 W;  1ICF B;  5EWF A;  1JB3 A;  2KED A;  4S3S A;  2CW7 A;  2WB1 B;  2W7O A;  2ZJT A;  1J5E H;  4A3K B;  3K59 A;  1KJ8 A;  1J5E L;  1AN7 A;  3T5K A;  4A3K H;  5FJ8 G;  1CT1 D;  3DWA A;  3KTM A;  1I4G A;  4C5A A;  2XC9 A;  2LXJ A;  2CH4 W;  2DWC A;  3J7A K;  2KHS A;  1W6K A;  1VQF A;  2HVR A;  1RL2 A;  1BR9 A;  4QWD A;  3RB0 A;  4JI0 L;  4GNX B;  1JOR A;  2A68 C;  2FLP A;  3U9S A;  3MXG A;  1EY6 A;  1N36 Q;  3ICE A;  3P75 A;  3GTL H;  2R7Z B;  1GJX A;  4MA0 A;  4ZRZ A;  2QA4 A;  4JI8 H;  3PIO 3;  2E2I H;  2JA9 A;  1Z2N X;  1K9M C;  2K5V A;  5G3L F;  4KD3 A;  5JJZ A;  4GKJ L;  2MCT A;  1V9P A;  2JEI A;  5KG7 A;  4UY8 C;  3U4Z A;  4DR2 L;  4DR3 Q;  2K28 A;  4I55 F;  1MBY A;  2EYO A;  4KN4 C;  1D8L A;  4GOP A;  2N8N A;  4G4K A;  1BCP D;  4ED3 A;  3C2P A;  1EYD A;  1QOH A;  2D0P A;  1PH5 A;  2A6E C;  4QIW B;  3CVZ A;  3GTM H;  2FPP B;  3U9O A;  3P1H A;  4KY5 A;  3RN5 A;  1A62 A;  2XTI A;  3STB D;  4K14 A;  2A5H A;  1Q8K A;  3K80 C;  5IGF A;  1KXL A;  4HIM A;  5CR3 A;  3RUP A;  2NB0 A;  1XPU A;  2C2E A;  1ZET A;  3GV3 A;  5C4J B;  4Q0Y A;  2OT2 A;  1CM9 A;  2E2H H;  5C44 B;  1VQB A;  5KYI A;  1I4X A;  3GIM A;  2K5W A;  4ALP A;  1CKN B;  2YZM A;  4FU0 A;  2VQE L;  4LFC L;  1SJH D;  4UCU A;  3Q8Q B;  1C8C A;  2FMA A;  4G7O C;  1CTM A;  1WTP A;  3V4Z A;  4XDX A;  4AH6 A;  5C0X J;  3JZI A;  1SXT A;  2N55 A;  2Q8T A;  1VBG A;  2F4V H;  1S4Z A;  2IX0 A;  5DEH A;  2R7Z G;  1JIH A;  4GLV B;  4ED7 A;  3ER0 A;  5D1O B;  4HTH A;  4OX9 Q;  2WFW A;  4ID6 A;  4I4T F;  1RJT A;  1TWC H;  4IZ8 A;  5I2Y A;  4DR6 Q;  4H02 A;  1TWF A;  2R7L A;  1VDZ A;  3CCU A;  3A56 A;  2DIK A;  4R4I A;  1LT6 D;  2K04 A;  2Q2I A;  1YNJ D;  3U58 A;  2R92 B;  2IW3 A;  3K5H A;  3MEH A;  4X3U A;  4IRC A;  1CZG A;  5IYC H;  4ECX A;  1RCV D;  4A3D H;  1E3P A;  3H20 A;  4O3Q A;  1PA6 A;  1Q81 C;  2WB1 G;  4HMJ A;  1O7Y A;  2B63 H;  1WVL A;  4PV1 C;  1AUX A;  4UP8 A;  2CW8 A;  1FYC A;  4HJ8 A;  4A3B G;  2DNE A;  3K5L A;  4RGM A;  1OTC A;  2E2J H;  4R4C A;  5IYB G;  1PLF A;  4LF8 L;  3SEB A;  4DV7 H;  2Z6K C;  4DFA A;  1M4V A;  1RK6 A;  2W9B B;  5L1J A;  4DV1 H;  4E6I A;  1SNQ A;  2PNR C;  1KQS A;  4ZI7 F;  1U4L A;  3T1H L;  1PX2 A;  4EGV A;  2YYA A;  4K6L A;  4ZLT F;  1Y1W G;  2XIG A;  1EZ1 A;  4X64 Q;  4O3P A;  3DF7 A;  2QDL A;  4DUY H;  3CRK C;  1HNZ Q;  3TSS A;  3GTQ H;  1Z47 A;  4HMI A;  4KKT A;  3J80 L;  2OXP A;  5IP7 G;  5KFY A;  2YTY A;  4IQZ A;  3JAM E;  3L0O A;  4IAL A;  2ATW A;  1UE1 A;  4DV3 L;  3UQ8 A;  5KG3 A;  3I72 A;  3MWD A;  1FKA H;  3I4M G;  3IL8 A;  3NHH A;  1EY4 A;  1DYQ A;  1Q7Y C;  3MFY A;  5HV6 A;  1BCP C;  5DM6 3;  3BJU A;  4A3J G;  4KK7 A;  4BA1 I;  3CQZ A;  1HUN A;  1BNC A;  1FJG Q;  4K0K Q;  1R4P B;  2DY7 A;  4PMC A;  2FP4 B;  2B2T C;  2IX1 A;  4DR2 H;  2RCF A;  5KRU A;  3OMC A;  1YHA A;  2PMZ A;  4DV0 Q;  1U4M A;  2VUM A;  4XQQ A;  4AYB G;  4LF5 L;  5HY6 A;  4I65 A;  3MC0 B;  1KLG D;  4H0L C;  1BUV T;  2B2V A;  2HIX A;  4OHJ A;  1D1I A;  4A3B H;  4RGO S;  3A7L A;  5KG1 A;  3VYU A;  2NZO A;  3E0J A;  3VR6 A;  4KHP L;  2AWO A;  2K7V A;  5C5L A;  4A3F G;  4B3S H;  5KG4 A;  1JJG A;  4EEY A;  1TS4 A;  2EQS A;  2E74 C;  2V58 A;  4BWS C;  5KFU A;  4XTC S;  5KX5 F;  1BOS A;  1HH2 P;  4KLK A;  3NQI A;  2NN6 G;  4KI0 A;  5ELN A;  4X65 H;  4HNT A;  4A93 B;  3SE7 A;  2E2I A;  1VQG A;  4JI7 L;  3S2D H;  4JI1 L;  1LYL A;  5EPJ A;  5I9P A;  1FNV A;  2EIF A;  3PUZ A;  2W70 A;  1SE2 A;  1I3Q B;  2WAC A;  5IP7 H;  1V4Y A;  4RAU C;  1JQY D;  4GKK H;  5JJL A;  3GV5 B;  1L1O C;  5DG8 A;  2A69 D;  1B33 N;  1B8A A;  3QWN A;  3GIQ A;  4YHH H;  1ET9 A;  4OEM B;  2MUY A;  3GTM B;  2AMC B;  1GLV A;  1B3A A;  4O0A A;  3GTM A;  1I50 B;  3BYT B;  1M1K C;  2X69 A;  2VA2 A;  5L37 A;  2ZXO A;  3KLR A;  2BCO A;  4DR5 Q;  3PO2 G;  2UUA H;  1LLR D;  5KT6 A;  2C2R A;  3K81 C;  5M3F G;  4JI2 L;  3M4O H;  1B6R A;  4XYM B;  3VPD A;  2VQF H;  1WTO A;  2F3I A;  3QIA A;  2AQ3 B;  1RK5 A;  2OTL A;  4CDF C;  2M9V A;  1CA5 A;  3T5J A;  2B2Y A;  2E2H A;  3Q23 A;  1CA6 A;  3QFF A;  4TV9 F;  4LFA H;  4IUQ A;  2NVX B;  4KJO A;  3EN2 A;  1CE8 A;  4RB3 C;  4BXX H;  1PTO B;  4FS1 A;  3NUC A;  2KQ3 A;  2RDH A;  2UXB L;  4LUZ A;  1BJT A;  4QWB A;  1PTO D;  4DUZ L;  2I8C A;  1H9K A;  3KHR A;  4IJL A;  1GO3 E;  1OXT A;  1PH1 A;  4NXN H;  1I94 H;  3SDZ A;  1UUP A;  1R9T B;  1A15 A;  3JAM L;  2UU9 Q;  3S16 H;  1JLL B;  1VQ8 A;  3PN1 A;  5KFC A;  3FPP A;  4J9S A;  2EYL A;  1NE3 A;  2K5Q A;  2UXD L;  2F0G A;  3A7A B;  3QZ8 A;  2PQA A;  1SND A;  1WI5 A;  4LAA A;  4C3H H;  2VPS A;  4DNR B;  2NN6 I;  2EPB A;  1Z2O X;  1IW7 D;  3B6Y A;  3TII A;  4GZY C;  5J39 A;  4YWM A;  1KNE A;  4MV4 A;  2TSS A;  4B3M Q;  1S0N A;  1GVP A;  3FKI G;  4RCN A;  5NUC A;  1UNN C;  4G3I A;  1IBK Q;  4CHT B;  2NYZ D;  3I3C A;  1H9R A;  2I46 A;  1CHQ D;  5LL6 X;  2ZDG A;  1GSO A;  5DQI A;  1N34 Q;  4JW0 A;  4DV5 Q;  3BQ2 A;  4J9Q A;  1AFP A;  4N8F A;  4C3I H;  4LF4 Q;  5I47 A;  3TN2 A;  1B7Y B;  2UUB L;  1SNO A;  3BVG A;  3C1E A;  1K8O A;  3KFU A;  1BBW A;  4LFA L;  3OWF A;  1N9W A;  3HOZ B;  3M9O B;  3STB C;  5ELD A;  1L2Z A;  5D1P A;  5IYD H;  1IBM Q;  3PO3 B;  1E4F T;  2W6Z A;  1AN8 A;  2DLN A;  1O80 A;  3H0G G;  3OWE B;  4ECY A;  4Y8V B;  3HOW B;  4GC6 A;  4K5W A;  1PTO F;  5FD6 A;  3N44 B;  3ERS X;  3TRZ A;  1VCI A;  1EFI D;  4RZR A;  3OSP A;  5AJ3 L;  3HFZ B;  3OW7 A;  2R6F A;  3AB9 A;  2R7D A;  2IWH A;  5KFX A;  1AUV A;  1E24 A;  5ELE A;  1RJP A;  1N33 L;  4PMB A;  5KFE A;  3KXY T;  2PZU A;  5KFW A;  4HAE A;  3S1M H;  2Q8I B;  3KDF B;  4MNO A;  4X66 L;  5DQG A;  1XPO A;  2WV6 D;  4A3M H;  3TP5 A;  2B2U C;  4MTN A;  4X66 H;  5GRO A;  4DV6 H;  4LF7 L;  2MP1 A;  2XWJ B;  1PK8 A;  3I12 A;  3EVQ A;  5C6A A;  4A3G H;  2C22 A;  2ICI A;  5KNC A;  1RYR A;  2LMC B;  1Y1W H;  3VMM A;  1L0X B;  2K75 A;  1YBY A;  5KNB A;  3VDY A;  2VNU D;  5KFV A;  4HIK A;  3M4Q A;  3HOV B;  1YJ9 A;  4O1N A;  2JXM B;  5LYJ F;  1PDQ A;  4DAY A;  3K0Y A;  1OXX K;  2NBF A;  1K3R A;  2FXQ A;  4OIJ A;  4R8I A;  1KD1 C;  1XNQ L;  4IFD G;  4RB2 C;  3M7N A;  1U9R A;  4A3L G;  1YIT A;  4QWE A;  4X62 H;  4KHZ A;  2IHF A;  5HGT A;  3GP7 A;  4LF6 H;  2UXC Q;  1UE7 A;  2EJM A;  3JC6 6;  4U6P A;  4X3T A;  5E4X A;  1GSH A;  4GLA C;  2XSC A;  3DLL A;  1EWI A;  2B63 G;  1HNW Q;  1PH2 A;  1EUJ A;  2R3Z A;  5LP6 F;  4O4I F;  5HBR B;  2WKD A;  2QEX A;  5LMN H;  1GOZ A;  1VF5 C;  1DGS A;  2XNA C;  4P73 A;  4DR1 Q;  1K8G A;  1L0W A;  3L9A X;  4C56 C;  3U4V A;  3BZC A;  1SYC A;  3DM1 A;  5M5W H;  1HA6 A;  3K5M A;  4OL7 A;  3PSI A;  5FLX c;  2ASD A;  1VQL A;  2HD3 A;  4NP5 A;  1EIG A;  2BH2 A;  2JN4 A;  1KLU D;  3F8T A;  4GOP B;  1JXL A;  4LF9 H;  4BBR B;  1SNP A;  1HZA A;  2Z9H A;  5LL6 S;  1AE2 A;  3PV0 A;  1IZ6 A;  3RLO A;  1NBW A;  1DXM A;  4JI6 H;  1TS2 A;  2VUM B;  4B3T Q;  3RZD B;  1VMP A;  1Q12 A;  4DV7 L;  4DV4 L;  3BDC A;  1CUK A;  5EPK A;  2ZM6 H;  1VQP A;  2FK3 A;  5KFI A;  4JI4 L;  1WD1 A;  5KFO A;  4DAM A;  2KJX A;  1EIH A;  1C9O A;  4JVZ A;  1XNR L;  1GM5 A;  2YS7 A;  1NJI C;  3RBE A;  2VPQ A;  4DR4 H;  2NU6 B;  3T1Y Q;  3KHL A;  1EYC A;  5COR A;  2JJQ A;  2YTX A;  2PW7 A;  3G6V A;  1SMY C;  1B4O A;  3Q8R B;  3V96 A;  2F0Q A;  1G51 A;  3O13 A;  4WRD A;  4IZO A;  1PZI D;  3T1Y H;  3PGZ A;  2HGS A;  1B50 A;  2J9G A;  4JI5 L;  3PUY A;  3RLF A;  1KIX A;  3A8I E;  1TS5 A;  3Q0A A;  5IP9 H;  2CWP A;  2ZM6 Q;  1ZYR D;  2EZV A;  3T5H A;  4ED2 A;  4OEL B;  1GUN A;  1T3N A;  3NE5 B;  3FEW X;  3WO0 A;  1EY5 A;  5C4X B;  2F4V L;  2GVA A;  1Z7T A;  5F2D A;  2JA5 A;  1CI3 M;  2Y0S G;  2YRX A;  3RF2 A;  2C2D A;  4LUV A;  4B3R H;  2M00 A;  5TSS A;  2ASL A;  1Q90 A;  5A35 A;  3CD6 A;  1T9H A;  3C46 A;  2OTJ A;  3CCJ A;  3S2H H;  2TMP A;  2FMM A;  3QB3 A;  1Y69 U;  2AWN A;  3NEL A;  3NTK A;  3GIP A;  3V4S A;  2UUC L;  4Y52 H;  3MFI A;  4DNT B;  1A3V A;  5C1P A;  4LF4 H;  5D3D A;  5CMD A;  4NXM L;  1RIP A;  1ILQ A;  3N43 B;  2I5M X;  1EQR A;  1SMY D;  2PQE A;  4FS2 A;  2YU9 B;  5JVH 3;  1HR0 L;  1SSO A;  2EXD A;  4C3J H;  2F0P A;  1Y1V A;  4F4X A;  4RGN A;  1WFQ A;  5K5P A;  3CF5 A;  1ULZ A;  5H80 A;  4IOC A;  3GTO A;  3F8N A;  4FM9 A;  4DV6 L;  2WAQ B;  2R7K A;  1H95 A;  4HED A;  4BY1 G;  3GTO B;  4RGT A;  2JYO A;  4YR0 A;  3NWS A;  5FOB B;  4HJ9 A;  3CP0 A;  1S40 A;  2W6M A;  2B8F A;  4QGU A;  5C44 H;  3J81 L;  2HCC A;  2XCP A;  3ULP A;  4YAJ B;  1N8R C;  4JI1 H;  1HFG A;  3KF6 B;  1EU3 A;  2F0I A;  1MJC A;  1UE6 A;  4DR7 H;  5EWE A;  1YZ6 A;  5EKK A;  4ECW A;  1MJE A;  1DON A;  1X3Q A;  2CFM A;  3GD7 A;  1EEI D;  4GN5 A;  1L0Y B;  4BY7 G;  2NU7 B;  4PZ6 A;  3HBL A;  4RB0 A;  2J6U A;  4CKE A;  3S1N H;  4C2M A;  5IOD A;  5IT9 E;  3ND9 A;  3J80 E;  1K0R A;  1HPC A;  2JSO A;  4UFZ A;  4Q43 A;  2IA6 A;  4A3E G;  4RZQ A;  3D4R A;  4Q8E A;  1O7Z A;  2FPI B;  1YNN D;  4JV5 L;  4O4H F;  2IT1 A;  4Z9C B;  2HQL A;  3LWU A;  2DNC A;  2AQ2 B;  3I7F A;  3FVQ A;  1SRO A;  2DZD A;  3E5S A;  2O4X A;  2NUA B;  4A3G B;  3V2T A;  2A6H D;  2R93 G;  3CQZ B;  3PR4 A;  4DXF A;  1STB A;  3VA7 A;  4JI0 H;  1FVI A;  4FXK C;  2GA4 B;  1E4E A;  2CHB D;  3OMG A;  1VAJ A;  4J9O A;  2D5D A;  1FL0 A;  5J2U F;  1D1K A;  3TQ1 A;  3E9H A;  4R4T A;  5LA6 F;  3C1F A;  2BA1 A;  2KVM A;  4QIW E;  2BA0 A;  3D3R A;  2JEJ A;  4P2C B;  4DR5 H;  5COY A;  5GON F;  4JI3 L;  1LTI D;  4LF5 H;  4DV0 L;  3IRB A;  1NTG A;  2W6O A;  3M4I A;  2F0N A;  4K6D A;  3I4N B;  2N49 A;  2UXC H;  5IYC G;  5JJK A;  1A0I A;  1GUT A;  1G2S A;  3GLK A;  1T94 A;  4A4I A;  4NXN L;  2UXD H;  2W6N A;  5LXT F;  2WTF A;  4A3D G;  3RJ0 A;  1PFM A;  4O3S A;  1IBL Q;  1YEZ A;  1VQ4 A;  4MHE A;  2R93 A;  3TDQ A;  4DR4 L;  1QNU A;  1KRS A;  1LM0 A;  5I6W A;  4A3G G;  1KEE A;  1SNC A;  1XNR H;  2MQH A;  5FPR A;  4EYH B;  2EJG C;  2HHH Q;  2R7Z A;  2ALY B;  2QCP X;  3HOX B;  1VQM A;  2F0D A;  5C4H A;  2E2I B;  4EVO A;  4KHV A;  4CDC C;  2I87 A;  1DIK A;  3AFQ A;  1SFO A;  5C0X H;  4DR4 Q;  1AP0 A;  4N8X 1;  1KL9 A;  1WTQ A;  1TU2 B;  2R6G A;  1JJC B;  3GO5 A;  1UC9 A;  3UE1 A;  4MV3 A;  4GS3 A;  1FNW A;  1KNA A;  3KHG A;  3PO2 H;  3JAM c;  1Y8N B;  1WJJ A;  3WWV A;  1OXV A;  1ZHQ A;  3NQT A;  1RTN A;  2WAQ G;  4YWL A;  1K83 B;  1QWY A;  3K7A H;  5IGG A;  2NUC A;  4IPH A;  2IP4 A;  3GTG H;  2RGV A;  2FMC A;  1K83 H;  1F2L A;  2V5A A;  2EJF C;  1KAB A;  1B04 A;  4J8Q A;  4P72 A;  3HGB A;  4JI2 H;  1YNJ C;  5KG6 A;  1SYB A;  5J1Z A;  5KGU A;  4J0M A;  1SRU A;  4O4L F;  1D2B A;  5KT4 A;  5IYB H;  3EPG A;  3W5O A;  2CVR A;  2IMW P;  2A68 D;  1F9Q A;  4DR1 H;  1SJE D;  3IN5 A;  1B2T A;  4DV5 H;  3GV7 B;  4I7H A;  1S5F D;  5KEE A;  5CGK A;  2X6G A;  4FBU A;  1E4G T;  4RKL A;  4YQW A;  1WCM G;  1Q1B A;  5L1K A;  2BE5 D;  2UXC L;  2J6T A;  2K01 A;  4B3M H;  2Y0S B;  1B3Q A;  1QZG A;  3MWM A;  2E5L Q;  4LF6 Q;  4YP3 A;  2Q2T A;  4IPC A;  3VPB A;  2V59 A;  3PCO B;  3UDX A;  4YHH Q;  1TII D;  1KHI A;  2YZG A;  4TQU S;  3J7A 5;  1EY7 A;  5KFL A;  5KG0 A;  1JE4 A;  3CPF A;  3KLS X;  2PI2 A;  4ULL A;  5KFJ A;  4QW8 A;  1S3O A;  5BN4 A;  3NTI A;  1EIF A;  4A3D B;  1GD7 A;  5I6Y A;  5M3M G;  4JV5 H;  4YJ2 F;  2ZT9 C;  4NPS A;  2Z6B A;  5FJ8 H;  4A3I H;  2W71 A;  2XCL A;  4LF6 L;  1KBL A;  3H15 A;  3GIJ A;  4J9L A;  2L11 A;  4L5S A;  2G9H D;  1RF2 D;  5KIX A;  2NZ1 D;  3GID A;  1W96 A;  3PZP A;  5F9N A;  4O2B F;  3PIP 3;  2F0E A;  2RHQ B;  3M9M B;  4X66 Q;  3GTO H;  5IGD A;  3N41 B;  5KT7 A;  1VQH A;  2K32 A;  5CV6 A;  5JEA G;  3PW5 A;  1WTH A;  4NW2 A;  1PRT F;  4U67 3;  2EY6 A;  1OWT A;  1YHB A;  1VQE A;  2F0U A;  4DN4 M;  5M5Y B;  5DLQ E;  3K3P A;  5L1I A;  3NBI A;  1S72 A;  1N32 L;  1IKL A;  2ID0 A;  5ISR A;  3L4K A;  5JVL A;  3BG5 A;  5KFH A;  3L4J A;  1EZ8 A;  2XD4 A;  3VR5 A;  1HZC A;  1P8L A;  1TR5 A;  1S97 A;  1CK1 A;  4LF8 H;  1D5Z C;  5CBA E;  4K0K H;  4DV2 Q;  2VS1 A;  3BA8 A;  1CZW A;  3H09 A;  4LMQ D;  4NDX A;  2I0Q A;  5KND A;  3I8Z A;  3NK9 A;  4WJW A;  2VR1 A;  2O2L D;  3T1H H;  3WDN A;  3DEP A;  3AQQ A;  2PW5 A;  3QR8 A;  4RNO A;  3GV6 A;  2W8L A;  4UP7 A;  1YNX A;  3DXJ C;  1B1Z A;  2PMZ B;  3TZD A;  1SE4 A;  4CKB A;  3HOY H;  4EGJ A;  3BQ1 A;  4UCV A;  1HZB A;  3MTS A;  3GIL A;  3PR5 B;  1HNZ H;  2L9H A;  3E0E A;  2MGS A;  4XYQ A;  4DUY Q;  2QIL A;  5HUR A;  1PHJ A;  2QW7 A;  4JI5 H;  1LAC A;  3FKI H;  5EAY A;  5M3M H;  3TIG A;  2PVP A;  2VY3 A;  3SK8 A;  4C3I B;  1JWU D;  4C3H G;  4XT1 B;  5BPF A;  3HOV G;  3KHH A;  4J9N A;  4OO1 H;  1SYE A;  1E22 A;  2CQA A;  2UU9 H;  3P20 A;  2H5X A;  3T16 A;  1XTD A;  4LNQ A;  3UDG A;  3G6E A;  3N6X A;  3NGD A;  4A3C G;  5KFP A;  4M9U A;  5C3E B;  4JOI A;  2OEO A;  5KFR A;  1OXS C;  5KFM A;  4ECR A;  5EKL A;  1QVC A;  4R8U A;  1FJG H;  5C3E H;  4JCV E;  3OPO A;  1TA8 A;  5KFA A;  2R7Z H;  3GTQ A;  1VQ5 A;  5IP9 G;  2NU9 B;  5C8Y F;  5GAG C;  3K3V A;  2BR0 A;  1LTA D;  4UAI A;  1DV2 A;  3QOL A;  5DAU A;  4FXD A;  5C3E G;  1FNU A;  1EL0 A;  4IRK A;  1O7L A;  4JV0 A;  4I7A A;  2EYH A;  1LT3 D;  1I4Q A;  1IYV A;  1EUC B;  4OX9 H;  4EGQ A;  1MGS A;  4DGZ A;  1XPR A;  1RHP A;  1K1Q A;  3NWT A;  1S0M A;  3PO3 G;  1EY0 A;  3M3Y B;  3Q24 A;  2VQE H;  3SK5 A;  5DNF A;  1SEI A;  1JIC A;  4ECU A;  2WB1 E;  4EQ5 A;  1PRT B;  1QNK A;  4RAZ A;  1DOK A;  2SOB A;  3H4B A;  5CAE B;  4X3K A;  2PPB C;  4GKK Q;  2NVX A;  3HS0 C;  2F0K A;  4YHH L;  3GTG A;  4F8M A;  1B70 B;  2E5L L;  2R8K A;  5IT9 c;  4L5R C;  1JT8 A;  3LP8 A;  5JOB A;  3KAL A;  5C0X G;  2MHV A;  2J7Z A;  3CCQ A;  1X3E A;  4NMZ A;  4HJ5 A;  4IFD H;  1RDP D;  2JEF A;  1XMQ L;  2CCZ A;  4RCO A;  1WTR A;  4XXE A;  3RMH A;  1CSQ A;  4K2K A;  2CQO A;  1PTO C;  1K0S A;  1U0L A;  2KCN A;  1QIL A;  1G91 A;  2V4Q A;  3G48 A;  4FBT A;  1H9S A;  3SVM A;  2PQA B;  1E0B A;  4LW1 A;  2QEJ C;  1H9S B;  4LSA A;  1MI2 A;  4DL4 A;  4ZK9 B;  1LT5 D;  4CGY B;  2I80 A;  4NKL A;  1TWC B;  2ATL A;  1I3Q H;  3I73 A;  2IX3 A;  4DA2 A;  4MTK A;  3KAJ A;  2YTV A;  4C3H B;  3R2I A;  4DR6 H;  1D6E C;  3T53 B;  4HIO A;  5D14 A;  1BNZ A;  3MA2 B;  5FO7 B;  3A0J A;  4BS9 A;  1XMO H;  4BXX G;  2KEE A;  1PYS B;  5FK9 C;  2F03 A;  4DV0 H;  1JCK B;  4K0K L;  1B6S A;  5FLX E;  2UUB Q;  2RKS A;  2F4V Q;  2GLT A;  5KG5 A;  4ZAI A;  2YU9 A;  2V4D A;  2ZTC A;  1GSA A;  1LTR D;  2KSW A;  4JBJ A;  4KKS A;  1TXY A;  3BZD B;  2ZM6 L;  3S17 B;  1DD2 A;  3KLW A;  1S68 A;  1RKN A;  3KBX A;  3U50 C;  4UPA A;  1YJN A;  1IBK L;  3EQL C;  2RCN A;  2RVL A;  5C3X A;  1E2V A;  1QUQ B;  5C4Z A;  2JA8 H;  5ELB A;  1CKM A;  1JOK A;  5EWG A;  4Q0F A;  2HHH L;  2O03 A;  3IFD A;  1PRT D;  2A6E D;  2B39 A;  4LSX A;  1EUD B;  1CQV A;  4OIK A;  1V8Q A;  3NBH B;  3S1Q H;  4IHJ F;  3FDS A;  3F2C A;  2F0M A;  1QG7 A;  2RDF A;  3NBH A;  3I4L A;  5EBD A;  3S16 B;  4J9P A;  5D1O A;  2UUB H;  2AGQ A;  2RGR A;  3OIQ A;  3SK6 A;  2K52 A;  4A93 G;  3DM3 A;  4R9W A;  4J15 A;  1JX4 A;  2PI2 E;  3KUP A;  4DV2 L;  4B3T L;  3MJF A;  4MV1 A;  1G6Z A;  2R7F A;  1UNS A;  3VR4 A;  2F0S A;  1GGO A;  5KFB A;  1N56 A;  2D9U A;  4LWC A;  3A55 A;  4RB1 A;  3H0G B;  3W3A A;  1GKH A;  1GHJ A;  2M05 A;  1HTL D;  1IKM A;  4EBC A;  4DAY B;  4A3F B;  1N36 H;  1E7Z A;  3GQB A;  3TEH B;  1TQO A;  2EY2 A;  1ASY A;  3BAB A;  4OO1 G;  1N32 Q;  5CA1 F;  3H40 A;  2K5H A;  2B8G A;  5C3W A;  1CQI B;  4DK1 A;  2KCT A;  2Z8L A;  2RSN A;  2DPJ A;  1B9N A;  1U5K A;  2XWB B;  3W1G A;  1HNX Q;  3N52 A;  2W9C B;  4AYB B;  1TS3 A;  1PH8 A;  4N9P A;  2W9B A;  1NUC A;  3MEF A;  2JE6 I;  2KCC A;  4AYB A;  5KFD A;  1I6H H;  3IFT A;  4KTA A;  5FO8 B;  3PVX A;  2WYO A;  1WCM H;  5E1F A;  3HKZ E;  3V6J A;  1WTW A;  5JH7 F;  3SXH A;  3GTP B;  1NSN S;  1Q82 C;  2Z4I A;  4LFB Q;  5KFF A;  2CKZ B;  3TS0 A;  3I91 A;  3MVV A;  4LFB H;  1TWA B;  2A1A A;  1LV9 A;  4HID A;  1LTS D;  3BVM A;  5FLX W;  3EPI A;  2VQE Q;  4HNU A;  2Z0S A;  1NNX A;  1ILP A;  1AZQ A;  5CV7 A;  4HCS A;  3BDO A;  3R5H A;  1ZQ7 A;  3OHB A;  1A6X A;  1EIY B;  4RH6 A;  2YW2 A;  4AQY L;  4KHP Q;  2FE3 A;  3T56 B;  1TVX A;  4LF7 Q;  3OOC A;  4KY7 A;  5M5X H;  1S5E D;  4ECV A;  3IG0 A;  2B2T A;  4LH6 A;  4O3N A;  5L9X A;  4ZOL F;  1I4H A;  2RA4 A;  2LSS A;  3C3L A;  1N32 H;  3MXU A;  3VPC A;  2EOT A;  4QUF A;  3F2B A;  5M3F H;  3TME A;  1VS0 A;  4FO2 A;  5DG7 A;  1LTB D;  1Y1V G;  5KFN A;  3HOU H;  1ZYR C;  3H94 A;  1Q3L A;  5IT9 L;  1YHQ A;  4IPG A;  1V51 A;  1Z2P X;  2W8K A;  2NVX H;  4GKJ Q;  1C7Y A;  4GKJ H;  3MHB A;  3Q8P B;  1K28 A;  4PQX A;  1DZ1 A;  1ENA A;  3K6O A;  4DK6 C;  2PO4 A;  4XX0 B;  1XMO L;  4HSV A;  5GQO A;  4XZ3 B;  1XYI A;  1VMC A;  1KJJ A;  4QB4 A;  2V1C C;  2JP1 A;  1UEA B;  3HOX G;  1EOT A;  1IHZ A;  4JI5 Q;  2R92 G;  1C0A A;  1SMX A;  2NZH A;  2F0V A;  1QJO A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  4IFD I;  1KXL A;  4HIM A;  4JI3 Q;  2R93 G;  3AYH B;  1XPU A;  1R9T H;  1PH3 A;  1FVI A;  3EBE A;  5JEA J;  3HOU G;  3S15 H;  4GN4 B;  2KHJ A;  2E2H H;  1FL0 A;  3GTP H;  3HKS A;  1AH9 A;  3E9H A;  1YJW A;  1VQB A;  1EYG A;  4R4T A;  1IL2 A;  1YI2 A;  2HT1 A;  4ALP A;  1CKN B;  2BA1 A;  4QIW E;  4BBR H;  2BA0 A;  3CCL A;  3TS2 A;  1X55 A;  2VQE L;  3T1H Q;  4LFC L;  4JI3 L;  4JI4 Q;  4DV0 L;  3IRB A;  1NTG A;  4AH6 A;  5C0X J;  2N49 A;  2MO0 A;  2I5H A;  3M9B A;  4QY7 A;  1A0I A;  1LUZ A;  5IYC G;  3CME A;  4X62 Q;  5JJK A;  4LF8 Q;  2IX0 A;  2MFI A;  2R7Z G;  1IBL L;  4A4I A;  4GLV B;  4NXN L;  5GAH C;  3ER0 A;  5C44 G;  4OON A;  1XMO Q;  4A3D G;  1IBL Q;  1YEZ A;  1VQ4 A;  4OX9 Q;  1PV4 A;  1X6O A;  2WFW A;  4BY1 H;  3HOZ H;  1TWC H;  4DR6 Q;  1C0A A;  4H02 A;  4DR4 L;  3I2Z A;  1KRS A;  1LM0 A;  4GLX A;  4A3G G;  1X3G A;  3I55 A;  5IE8 A;  3CCU A;  4A75 A;  4X65 Q;  4R4I A;  1VQN A;  2D62 A;  2MQH A;  3M4P A;  4APV A;  2Q2I A;  3U58 A;  2HHH Q;  3HOW H;  2ALY B;  4A3E H;  1VQM A;  5IYC H;  4A3D H;  1E3P A;  4BBS H;  1PA6 A;  1Q81 C;  2WB1 G;  3E9I A;  2PNH A;  1PVO A;  4RG1 A;  1VQA A;  2B63 H;  3AFQ A;  4DV6 Q;  4DR4 Q;  3F2D A;  4A3L H;  1KL9 A;  4MZ9 A;  2R6G A;  4UP8 A;  4YY3 L;  4HJ8 A;  4OX9 L;  4A3B G;  1JJC B;  3GO5 A;  2K50 A;  1UEB A;  2Q2U A;  4JI6 L;  2IHE A;  1OTC A;  4A3I G;  2E2J H;  4R4C A;  3UE1 A;  5IYB G;  4GS3 A;  3HOY G;  2LXK A;  1IYJ B;  3AFP A;  4LF8 L;  2Z6K C;  1VQK A;  3PO2 H;  5C4X G;  3JAM c;  1Q46 A;  4JV5 Q;  4LUO A;  2B3G A;  4TVA B;  2JA5 H;  3S14 H;  1WJJ A;  3I4O A;  3WWV A;  2MNA A;  3K0X A;  5IY0 A;  1E1T A;  4UP9 A;  1KQS A;  1OXV A;  3L7Z C;  4OO1 I;  1I94 Q;  2WAQ G;  4YWL A;  4JI6 Q;  3T1H L;  3K7A H;  3HOX H;  4DR3 L;  4A3J H;  1W2B A;  4LF9 Q;  3A5Z B;  4IPH A;  4DR2 Q;  1Y1W G;  3GTG H;  1K83 H;  4X64 Q;  2JEA I;  2ZJP A;  1HZ9 A;  2AKW B;  4P72 A;  1HNZ Q;  1PH9 A;  1G6P A;  4BA2 I;  3GTQ H;  1SRU A;  1Z47 A;  5IYB H;  3I56 A;  1L1O B;  3W5O A;  3A74 A;  5IP7 G;  2YTY A;  1QVF A;  1PYB A;  3L0O A;  1W3S A;  4O2D A;  4GN3 B;  3GTJ H;  2AHO B;  2ATW A;  1UE1 A;  2VW9 A;  4DV3 L;  2UUA Q;  1EFW A;  3RR5 A;  1QVG A;  2OQ0 A;  1JJ2 A;  2E8G A;  1WCM G;  1Q1B A;  1QZH A;  3I4M G;  1Q7Y C;  2UXC L;  3J80 c;  3BJU A;  4A3J G;  4BA1 I;  1QZG A;  4NB3 A;  1YVC A;  2E5L Q;  4LF6 Q;  1FJG Q;  2Q2T A;  2VUM G;  3T1Y L;  3S17 H;  4K0K Q;  2JQO A;  4IPC A;  3PCO B;  1Y14 B;  2IX1 A;  2JA8 G;  3UDX A;  4YHH Q;  4FDB A;  1KHI A;  5K36 G;  1IXR A;  1YHA A;  1TWA H;  4TQU S;  4DV0 Q;  2UUC Q;  3J7A 5;  4DV1 L;  3CPF A;  4DR7 L;  4DNI A;  4IJH A;  4P71 A;  2PI2 A;  4LF5 L;  4AYB G;  1PH4 A;  1S3O A;  5HY6 A;  4DV1 Q;  1EIF A;  2B29 A;  1GD7 A;  4C2M H;  5M3M G;  4QJF A;  5GAE C;  4NPS A;  4A3I H;  5FJ8 H;  4DV7 Q;  2HIX A;  3OW2 A;  1JB7 A;  4LF6 L;  5IWA Q;  1NMG A;  1I5F A;  4A3B H;  3H15 A;  4XIG S;  1VQ7 A;  1VQO A;  4L5S A;  2VUM H;  2NZO A;  4KHP L;  3K7U C;  2AWO A;  3UDI A;  4A3F G;  1N34 L;  1YIJ A;  1JJG A;  1I50 H;  2RHQ B;  2EQS A;  4X66 Q;  3PUX A;  2C35 B;  3GTO H;  3S24 A;  1VQH A;  5JEA G;  4XTC S;  1TWH H;  1HH2 P;  4KLK A;  1YHB A;  4KI0 A;  1VQE A;  2NN6 G;  5ELN A;  4A3C H;  5DLQ E;  2K5N A;  1S72 A;  1N32 L;  3D0F A;  3CCR A;  2ID0 A;  2OQK A;  1L2F A;  2VZA A;  1VQG A;  4JI7 L;  2D0O A;  4JI1 L;  1LYL A;  3S2D H;  3CC7 A;  1JE5 A;  3J81 c;  4HJ7 A;  4HJA A;  4X64 L;  2EIF A;  3PUZ A;  3JAM i;  1HZC A;  3BU2 A;  4B3R L;  5IP7 H;  4BBR G;  2YYZ A;  1O7I A;  1P8L A;  1KRT A;  4A3K G;  5JJL A;  1L1O C;  1I94 L;  3CCV A;  1B8A A;  3CW2 C;  3CAM A;  2AMC B;  4DV2 Q;  2VS1 A;  2I0Q A;  4O0A A;  2ASB A;  1M1K C;  1LTL A;  4YWK A;  2JA6 G;  2N78 A;  1VQC A;  3KYH C;  4DR5 Q;  2ZJR A;  3PO3 H;  3ULL A;  5C4X H;  3PO2 G;  2I5L X;  2JK8 A;  2OCE A;  4AQY Q;  3K81 C;  3PUV A;  1QUQ A;  3AQQ A;  2ZTD A;  4PG3 A;  2RF4 A;  4AIM A;  5M3F G;  4JI2 L;  1VQ6 A;  3AEV A;  1OXU A;  2F3I A;  4A93 H;  2NVT H;  3CMA A;  2OTL A;  3RZO H;  1UWV A;  4OWT B;  4IPD A;  4WJ3 M;  4UP7 A;  1FGU A;  1YNX A;  3RLN A;  3HOY H;  4BY7 H;  3BZK A;  1VQ9 A;  1HZB A;  1P16 A;  3EN2 A;  3PUW A;  4JI2 Q;  4BXX H;  3E0E A;  4DUY Q;  4DR1 L;  4BBS G;  4LUZ A;  4QQB X;  2UXB L;  1UE5 A;  4POG A;  2IY5 B;  1PHJ A;  3ZJY C;  4OWW B;  4DUZ L;  3FKI H;  3HKZ G;  5EAY A;  3KOJ A;  5M3M H;  3HOW G;  4LFB L;  2VY3 A;  4IJL A;  1GO3 E;  1OXT A;  4PZ8 A;  4GOP C;  1PH1 A;  3UE0 A;  3PIO A;  3HOV G;  1HNW L;  1N33 Q;  3KDF A;  5C4J H;  3HOZ G;  1E22 A;  2UU9 Q;  2JA7 H;  1NMF A;  2GVB A;  2H5X A;  2XGT A;  3S16 H;  1CKO A;  3FP9 A;  5AJ3 Q;  1XTD A;  1VQ8 A;  4LNQ A;  3UDG A;  4JI8 L;  3G6E A;  1NE3 A;  2UXD L;  1HNX L;  2PQA A;  4JI1 Q;  4A3C G;  4GKK L;  4JOI A;  1WI5 A;  5LMN L;  3HOV H;  3F1Z A;  4C3H H;  1OXS C;  1V43 A;  2NN6 I;  2NVQ H;  1QVC A;  3B6Y A;  5C3E H;  4JCV E;  3CC4 A;  4YWM A;  3PIP A;  2R7Z H;  1N36 L;  4B3M Q;  1VQ5 A;  1GVP A;  5IP9 G;  3FKI G;  3J7Z C;  2JA7 G;  5GAG C;  4LFA Q;  5FLM G;  1IBK Q;  1BBU A;  1L1O A;  4LF4 L;  1N34 Q;  4DV5 Q;  1ASZ A;  5C3E G;  4JYA L;  2A8V A;  2VQF Q;  1JMC A;  1HR0 Q;  4C3I H;  4JBM A;  4LF4 Q;  4QL5 A;  1B7Y B;  2UUB L;  1J5E Q;  4NXM Q;  2K4K A;  1TWG H;  3KFU A;  3D31 A;  1BBW A;  1XPR A;  4LFA L;  1N9W A;  3PO3 G;  4EX5 A;  3STB C;  4ME3 A;  5IYD H;  1IBM Q;  4IO9 A;  1K73 C;  4B3M L;  2WB1 E;  4EQ5 A;  4A3M G;  3GTK H;  4X6A H;  3H0G G;  4R4O A;  1SE8 A;  4B3R Q;  4GKK Q;  5BR8 Q;  2Q2H A;  3ERS X;  4YHH L;  3TRZ A;  1VCI A;  1B70 B;  2E5L L;  5AJ3 L;  3HFZ B;  5IT9 c;  4L5R C;  2R7D A;  4B3S L;  1E24 A;  1JT8 A;  3PF5 A;  4WJ4 A;  1VQJ A;  5C0X G;  1IBM L;  1N33 L;  3CCQ A;  1X3E A;  5H1S E;  4HJ5 A;  4L5T A;  4YCU A;  3J81 i;  1G29 1;  3S1M H;  3KDF B;  4MNO A;  4X66 L;  1XMQ L;  1XPO A;  2CCZ A;  4JI0 Q;  1CSQ A;  1WOC A;  2CQO A;  4A3M H;  4MTN A;  1EQQ A;  5GRO A;  1Y1V H;  3I4N H;  1U0L A;  3CXC A;  3NEN A;  4LF7 L;  3M3Y H;  4GNX A;  2VQF L;  3G48 A;  3S1R H;  1BVS A;  2YV5 A;  4B3S Q;  4A3G H;  5ELO A;  4DV5 L;  2PQA B;  2CWA A;  5LMU L;  4LW1 A;  3PF4 A;  4Y7N H;  1X3F A;  3RN2 A;  1Y1W H;  1HNZ L;  2K75 A;  3KF6 A;  2A19 A;  1KAW A;  1X65 A;  1YBY A;  5C0X I;  3VDY A;  1EOV A;  2VNU D;  1I3Q H;  4HIK A;  3TQY A;  1CSP A;  1SN8 A;  3M4Q A;  4LF9 L;  1XNR Q;  3K8A A;  1YJ9 A;  2YTV A;  2MO1 A;  3GDE A;  3G4S A;  1Q86 C;  3EIV A;  4JBW A;  1Q1E A;  4HIO A;  1HR0 W;  1OXX K;  3A0J A;  2DGY A;  1K3R A;  2FXQ A;  2RHS B;  1KD1 C;  4DR7 Q;  1XNQ L;  5FLM H;  4BXX G;  4IFD G;  1PYS B;  3LGJ A;  1SR3 A;  2QGQ A;  4DV4 Q;  3M7N A;  2UXD Q;  4IFD J;  4A3L G;  2F52 A;  4JI8 Q;  1YIT A;  4K0K L;  2UUB Q;  2F4V Q;  4KHZ A;  2IHF A;  3L2P A;  5J3B A;  3RNU A;  2GN5 A;  2OWO A;  2ZTC A;  2UXC Q;  1UE7 A;  3JC6 6;  4GLA C;  4YCV A;  4JBJ A;  3KJO A;  3DLL A;  1EWI A;  1TXY A;  2ZM6 L;  4JYA Q;  2B63 G;  1HNW Q;  3KLW A;  1EUJ A;  1PH2 A;  2UUA L;  4YY3 Q;  1X56 A;  2BH8 A;  3OTO L;  1TWF H;  3U50 C;  4UPA A;  1XMQ Q;  2QEX A;  1YJN A;  1X9N A;  1IBK L;  3H0G H;  1Z9F A;  2RCN A;  4DPG A;  4JBK A;  4DUZ Q;  1M90 C;  3KJP A;  1DGS A;  4P73 A;  1QUQ B;  5IYD G;  4DR1 Q;  1K8G A;  2JA8 H;  2UXB Q;  3KF8 B;  1L0W A;  1CKM A;  2R92 H;  3U4V A;  2HHH L;  3BZC A;  4PMW A;  5GAD C;  3G71 A;  4X65 L;  5M5W H;  5LMN Q;  4L5Q A;  2WP8 J;  3PSI A;  5FLX c;  5BR8 L;  1NY4 A;  1VQL A;  2ZJQ A;  2BH2 A;  2VL6 A;  4DR6 L;  3F8T A;  1AE3 A;  4GOP B;  1BKB A;  3NBH B;  3S1Q H;  1HZA A;  4P74 A;  1AE2 A;  3PV0 A;  1VQI A;  1IZ6 A;  3RLO A;  1A63 A;  3MXN B;  3F2C A;  2DUD A;  2PMZ E;  1NBW A;  4DR5 L;  3CCM A;  4B3T Q;  2K52 A;  4IOA A;  4X62 L;  4A93 G;  1SLJ A;  2ZTE A;  3DM3 A;  1Q12 A;  4J15 A;  3CC2 A;  2PI2 E;  4DV7 L;  4DV4 L;  4DV2 L;  5E7N A;  4B3T L;  1CUK A;  3H3V H;  3OYY A;  5M5Y H;  1XNQ Q;  1VQP A;  2R7F A;  2JA5 G;  4JI4 L;  2Z6K A;  3I4M H;  1E1O A;  4LWC A;  4DAM A;  4LFC Q;  2R93 H;  3FHW A;  1GKH A;  4DKA C;  1C9O A;  3CCE A;  4AYB E;  1XNR L;  4DAY B;  1GM5 A;  1NJI C;  1E7Z A;  3TEH B;  4JI7 Q;  3T1Y Q;  1ASY A;  1WYD A;  2JJQ A;  1VQD A;  2YTX A;  3M85 A;  4YCW A;  4OO1 G;  1N32 Q;  1X54 A;  2K5H A;  2Y0S E;  1G51 A;  3PGZ A;  2KCT A;  1SFO H;  4RMF A;  1U5K A;  3W1G A;  4DV3 Q;  1HNX Q;  4JI5 L;  3PUY A;  3RLF A;  3ULJ A;  3UDF A;  1KIX A;  3J81 j;  3OTO Q;  4OWX B;  1PH8 A;  1D7Q A;  3MEF A;  2JE6 I;  1MIU A;  4R1J A;  5IP9 H;  2CWP A;  2ZM6 Q;  1KC8 C;  3RZD H;  1PH6 A;  3CQZ H;  1I6H H;  4PZ7 A;  4DK3 C;  1A8V A;  3TRE A;  1MKH A;  5LMN W;  2F4V L;  2GVA A;  1WCM H;  3HKZ E;  3A5U A;  2KBN A;  2Y0S G;  2K14 A;  4GNX C;  4LUV A;  1Q82 C;  4LFB Q;  3Q8D A;  2CKZ B;  4A3F H;  3TS0 A;  2ES2 A;  1CKN A;  3CD6 A;  1T9H A;  2A1A A;  4DUY L;  4HID A;  3SGI A;  2OTJ A;  3CCJ A;  3S2H H;  4LF5 Q;  3W1B A;  2VQE Q;  2Z0S A;  2L15 A;  4JC0 A;  2AWN A;  3NEL A;  5JJI A;  4JG2 A;  2UUC L;  2WAQ E;  4POF A;  4Y52 H;  4OXP A;  2KCM A;  1FJG L;  1J5E L;  4NXM L;  1EIY B;  1RIP A;  5LMU Q;  4A3K H;  2I5M X;  3NEM A;  1EQR A;  5FJ8 G;  1PH7 A;  4AQY L;  1HR0 L;  5HGQ A;  2EXD A;  2LXJ A;  4C3J H;  4KHP Q;  1WFQ A;  4LF7 Q;  3CF5 A;  4A76 A;  5M5X H;  3M4O H;  1VQF A;  4IOC A;  3CCS A;  1RL2 A;  1HJP A;  2KEN A;  5IWA L;  1XJV A;  4JI0 L;  4GNX B;  2LSS A;  4DV6 L;  1H95 A;  4BY1 G;  4HJ9 A;  3CP0 A;  3F2B A;  1S40 A;  1N36 Q;  3ICE A;  3GTL H;  5M3F H;  4QGU A;  5C44 H;  1VS0 A;  2QA4 A;  3ULP A;  2E2I H;  2N3S A;  2JA9 A;  3H3V I;  1Y1V G;  1N8R C;  3I4N G;  3KF6 B;  1K9M C;  3HOU H;  2K5V A;  2JEB I;  3CPW A;  2JA6 H;  1MJC A;  1YHQ A;  4GKJ L;  1UE6 A;  1V9P A;  4IPG A;  1YZ6 A;  2NVX H;  4GKJ Q;  1C7Y A;  4UY8 C;  4R4Q A;  1PFS A;  3U4Z A;  4DR2 L;  1MJE A;  4DR3 Q;  2CFM A;  3GD7 A;  4GN5 A;  4BY7 G;  4DK6 C;  1V1Q A;  4PZ6 A;  1D8L A;  2NVY H;  4GOP A;  2UU9 L;  2N8N A;  1XMO L;  5GQO A;  1K8A C;  4P75 A;  2YU9 H;  3S1N H;  1K0R A;  2D0P A;  1PH5 A;  4A3E G;  4NXN Q;  3GTM H;  2V1C C;  4JV5 L;  2IT1 A;  2KHI A;  2HQL A;  3J80 i;  3HOX G;  4JI5 Q;  2HIV A;  4JOI C;  3I7F A;  3RN5 A;  2R92 G;  1A62 A;  1SRO A;  2XTI A;  3STB D;  1SMX A;  2NZH A;  1Q8K A;  3K80 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...