3HOZG

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hozG01
2KHIA 2QEXA 3CCRA 2I0QA 2UUBQ 4A3JH 4JI3Q 2N78A 4QIWE 4TQUS 1KD1C 1PH2A 4LF7L 2HHHQ 4LWCA 1Q82C 4DV2L 1I5FA 1L1OC 2UXBL 1A0IA 2LXKA 1SROA 4GLVB 3PO3G 4LF5L 4KHPL 5JJKA 3S1RH 1JJCB 4BBSH 1EWIA 4DV7Q 1HNWL 5JJIA 2MO0A 1K0RA 2UUAL 4DUZQ 4LNQA 2K52A 3S1QH 4GS3A 1NMFA 2I5HA 1VQ8A 1MIUA 1Q8KA 3CP0A 2YTXA 4LUVA 5AJ3Q 1IBLQ 3PSIA 4POFA 1ASZA 2GVBA 1X3EA 3F8TA 5GROA 1VQLA 1OXSC 2NVXH 4AIMA 4JI1L 2YTYA 1X3GA 3PCOB 4DUYQ 2Q2UA 1YNXA 3AFQA 1SE8A 1MJCA 4OO1G 4IFDG 2N49A 3PUZA 3U4ZA 2EQSA 1BBUA 1VS0A 2BH8A 5GAHC 2ZJRA 3CCLA 3NEMA 1VCIA 2Z6KA 3IRBA 1QVFA 5LMNW 2JA8G 5IYDG 1HZBA 1Y14B 1TWFH 2K5HA 1GVPA 4XTCS 1HNZQ 3NENA 4JI0Q 3I4NH 3F2BA 4X6AH 4KLKA 1VQOA 3HOUH 2R7FA 3CMEA 1C7YA 1X54A 4NB3A 3KJOA 5C4XG 4AQYQ 3I4MH 1B7YB 1UEBA 1J5EL 1NMGA 3TEHB 1XMQL 1LYLA 4X64Q 1YI2A 1GM5A 2MFIA 4LF8Q 1XNQQ 2R7ZG 3PO2G 2KBNA 1PH1A 4HIDA 4POGA 5C3EG 3GTJH 3L2PA 1GO3E 2ZJQA 2NVTH 4BXXH 3STBC 2H5XA 5C44H 3CCEA 3T1YQ 3GTGH 1X6OA 1V43A 1SFOH 3UDFA 4JI8L 2B63H 1W3SA 4A3DG 4PZ7A 5IP9H 2N3SA 1JT8A 1E7ZA 1HZCA 2ZJPA 3H3VI 4LFBL 4BY7H 4GKJQ 5HGQA 1YJNA 4A3GH 4UP7A 4A3LG 1NTGA 3CCJA 4GN4B 3HKZE 4JI7Q 1CKNA 2WFWA 1L2FA 4DR7L 1YITA 3KLWA 1S40A 3TREA 2ZTCA 3BZKA 2RHQB 4JYAQ 3FP9A 2E5LL 3D31A 3EIVA 1X65A 4P71A 3RLFA 2IT1A 4LF4L 4AYBG 5LMNL 2R7DA 2IX0A 4KHPQ 1G51A 4DK6C 1N33Q 4BBRG 1E3PA 1XMOQ 3AFPA 3PF4A 3S2DH 1RL2A 4JI4Q 3PO3H 2GVAA 3I4OA 2WP8J 3PGZA 3G4SA 3TS2A 2UXCL 1WFQA 2Z6KC 4X62L 2K14A 1OXUA 2LSSA 4DR5Q 1CKMA 2VQFL 4OX9Q 1PVOA 1HR0W 3ULJA 1CKOA 1QVCA 1MJEA 3A74A 1B8AA 3JAMc 2R93H 1PH6A 2HIVA 3KFUA 1EIFA 1VQEA 3TS0A 1FGUA 4IPDA 5BR8Q 4GKKL 4TVAB 1AE2A 4DV1L 4DR6L 3S14H 4GOPB 1M1KC 2GN5A 3AYHB 5IY0A 3J81j 1KRTA 4B3MQ 4A3IH 3HOWH 3KYHC 1XPOA 2JA8H 1CSPA 3FKIG 4EX5A 1YIJA 5IYDH 4GLXA 2I5MX 1VQFA 3G48A 1KXLA 1YHBA 3L7ZC 1VQGA 2JE6I 4R4CA 3JAMi 2K5NA 3GTKH 2V1CC 4K0KQ 1PH3A 1N32L 3CXCA 1Q7YC 1N34Q 1TWGH 2EXDA 4DR1Q 1XJVA 2E2IH 3S17H 1JJGA 5C4XH 1PH8A 2UU9Q 4KI0A 1Y1WG 2UUCQ 5LMUL 4C3JH 3G71A 1Q86C 1EQRA 3PF5A 4B3TL 1I94Q 1CUKA 1KRSA 1VQ6A 3PO2H 1TWAH 5C3EH 4DKAC 4L5SA 1I6HH 1SMXA 4QQBX 1KQSA 5HY6A 3BU2A 4A3EG 3CC2A 1YBYA 3T1HL 3RLOA 2F4VL 3GTQH 2OWOA 3S1NH 3RR5A 1P8LA 4LFBQ 2D0OA 3FHWA 3E0EA 1XTDA 1E1OA 4R4QA 4OO1I 1HNXL 4IFDI 4JV5L 1P16A 3OTOQ 1HR0L 4YY3Q 5M5WH 2UXDQ 1S72A 2AKWB 3UE1A 2E5LQ 3KJPA 3CMAA 5M5XH 3PUXA 1IXRA 3UDXA 2ATWA 4PG3A 5M3MG 1IBKQ 4HJ7A 2PI2A 2JA7G 1R9TH 1JJ2A 4LFCQ 5IYCH 4DV0Q 1KAWA 1XPUA 5JEAG 2AMCB 4BBRH 1HZAA 3KDFA 4YHHQ 3F2DA 2IX1A 4GNXA 3CCUA 4X62Q 2YU9H 2E2JH 1OTCA 4J15A 1O7IA 2N8NA 1WCMH 2JA6G 4LF9L 3HOZG 2K75A 1NY4A 1GD7A 3KDFB 4QL5A 4JI2L 4GNXB 3PV0A 1YJ9A 4LF6Q 3S16H 2F52A 4WJ3M 2CWPA 4JI5Q 4GKKQ 2YV5A 1N8RC 1FJGL 5M3FG 5K36G 3LGJA 4IJHA 1IBML 3CF5A 2OQKA 5C0XJ 2NVQH 2CQOA 4DR3L 4A3BG 1G6PA 1AE3A 1QUQA 5EAYA 4DR4L 3E9HA 1HZ9A 4GN3B 1E1TA 4UPAA 4LUZA 2JEBI 1N36L 4PMWA 1LM0A 4DV3L 4P72A 4A3KH 2Q2IA 4RMFA 4OWXB 1VQJA 3FKIH 1PH5A 1N32Q 3H0GG 2Q2HA 3HKSA 1QUQB 1SLJA 3HOVG 1XNRQ 2IY5B 1YHQA 5LMUQ 1BBWA 1EUJA 4DV4L 4JG2A 2OTLA 1I50H 1PH9A 2Y0SE 1Y1WH 4X66Q 4DV6L 1UE7A 3K81C 4DR2L 4B3SL 2VY3A 2WB1G 4AYBE 3PUYA 1EFWA 1VQ9A 4LFAQ 1EQQA 3ER0A 4JI6L 1VQIA 2FXQA 5M5YH 1UE5A 5J3BA 1N9WA 4JC0A 5C0XI 1K8GA 3STBD 4DV5Q 2VNUD 4B3RL 1X9NA 4IOCA 2OQ0A 4UP9A 4BA1I 4BY1G 4O0AA 3AQQA 1KIXA 3GTPH 4LF7Q 3UDIA 2Y0SG 4DV2Q 3K7AH 2UXBQ 4GNXC 3RNUA 4NXNL 4LF5Q 4A93G 2KCMA 3NBHB 2C35B 3F2CA 3RN2A 4LW1A 4JBMA 1HNWQ 2UUAQ 4A3MG 4A3JG 2HQLA 2K4KA 2NN6G 2ZM6L 3UDGA 4R4OA 5IE8A 1V1QA 5M3MH 2DGYA 3J81c 3BJUA 2UUBL 2NZOA 2D0PA 3M9BA 4JI3L 2JA7H 3HOWG 5IWAL 1IZ6A 3Q8DA 4IPHA 4YCWA 1E24A 4GOPA 1E22A 4JI1Q 1VQPA 2HHHL 1IL2A 3S15H 3K8AA 1U5KA 1RIPA 4MTNA 3M85A 1WI5A 2JA9A 3J80i 3HOXG 3EN2A 3NELA 4DR6Q 2R6GA 4PZ6A 4GN5A 4DV7L 2JA6H 2AWOA 2VQEL 3HOZH 3JC66 4QJFA 1PYBA 4DUZL 4APVA 1X55A 3J81i 2JJQA 3PIPA 2E8GA 4R4TA 3GTMH 1A62A 5IP7G 5M3FH 3S1MH 1IBLL 4IFDJ 5AJ3L 3ICEA 4P75A 4L5QA 2MO1A 5ELOA 3HFZB 2DUDA 3VDYA 1C9OA 1J5EQ 3K7UC 4A3BH 2I5LX 4IPGA 4DUYL 1XMQQ 1ASYA 1N33L 1S3OA 2KHJA 1WJJA 1C0AA 4YCVA 1VQKA 3MXNB 2QA4A 5H1SE 2QGQA 3DLLA 4R1JA 2F3IA 2R7ZH 1Y1VG 3H0GH 4JCVE 1TXYA 3RN5A 2RF4A 1WOCA 3CPWA 4P73A 1PYSB 4HJ8A 1EIYB 4JI0L 1D7QA 4DV6Q 3I4MG 1QZHA 4JBWA 1PH4A 4JI8Q 1EYGA 1Z9FA 4UY8C 2KCTA 4OXPA 3I56A 3I7FA 4A3DH 3MEFA 1U0LA 4X64L 4LF8L 2A1AA 4BXXG 3EBEA 3AEVA 1J6QA 1X56A 4DR7Q 4B3RQ 4RG1A 2IHFA 3G6EA 4HIOA 4A3LH 1OXVA 1FL0A 2ES2A 1LTLA 1HH2P 2B63G 5JJLA 1BKBA 1GKHA 2CFMA 5IP9G 4BY1H 1KC8C 4LF4Q 3TRZA 3WWVA 3PUVA 2HT1A 4BY7G 4HJ5A 3OW2A 1PV4A 5LMNQ 2OTJA 1PA6A 4A3GG 1I3QH 2WAQG 5GAGC 4GOPC 4OONA 5FLMG 1T9HA 1NE3A 2NZHA 3F1ZA 4GKJL 4DPGA 4A93H 4NXML 4JI7L 4DNIA 4A76A 3GO5A 4YWMA 4LUOA 3GD7A 1NBWA 1PH7A 2UXCQ 1FVIA 2PI2E 4A3MH 3U4VA 2VQFQ 5IWAQ 2ASBA 4JYAL 4FDBA 4YCUA 3J7ZC 2LXJA 4WJ4A 3ULPA 1VQ7A 4H02A 1SRUA 3CPFA 5IYBG 3ERSX 5FJ8G 2PQAA 3KF6A 4IJLA 4DV1Q 1G291 4UP8A 1PFSA 3HOXH 3CCVA 2MQHA 5ELNA 2VQEQ 3CC7A 1VQDA 1XMOL 2WB1E 2Q2TA 1V9PA 4QGUA 2ID0A 1QVGA 2BA1A 4JI4L 2JEAI 2R92G 4IOAA 3BZCA 2VUMG 2B29A 3M4OH 1H95A 2PQAB 3KF6B 4DR5L 4OWTB 2R93G 2ZTDA 4OX9L 2K5VA 2CWAA 2BH2A 2XGTA 1UE6A 3M3YH 1K8AC 3A5ZB 5IP7H 1K73C 1SN8A 4A3FG 2E2HH 3D0FA 1Z47A 5BR8L 1NJIC 3B6YA 3A5UA 3H3VH 4A3IG 4GLAC 4B3TQ 2JK8A 4ALPA 4Y7NH 2NN6I 3HOYG 3A0JA 2L15A 4X65L 2NVYH 4B3ML 2YYZA 3H15A 1OXXK 1Q1BA 1XPRA 4BA2I 1Y1VH 1CSQA 1VQAA 1YZ6A 4JOIA 3L0OA 2A8VA 3W5OA 2Z0SA 3PIOA 3T1HQ 3TQYA 1EOVA 3K80C 1OXTA 3E9IA 2F4VQ 2ZTEA 4K0KL 1WYDA 3RLNA 4A4IA 1N34L 5FLXc 4L5TA 4DR1L 4A3EH 2MNAA 3CQZH 3S2HH 2UU9L 1KL9A 3M4QA 1HNXQ 2UUCL 4R4IA 4DAYB 1M90C 3GDEA 1HR0Q 4JV5Q 4JBJA 4C3HH 4Y52H 1QZGA 4DK3C 3CCSA 3I55A 1TWCH 1I94L 1PHJA 5GQOA 3PUWA 5GADC 1VQBA 3J7A5 3ULLA 4A3CG 2JA5G 4KHZA 4XIGS 3J80c 3CD6A 5E7NA 1UWVA 3I2ZA 1VQ4A 4YWLA 4HIMA 1KHIA 1YJWA 1D8LA 4NXMQ 3UE0A 4AH6A 3W1GA 4DAMA 5FLMH 3OTOL 4YY3L 1X3FA 3KOJA 4QY7A 3CC4A 2UXDL 1DGSA 4OWWB 2ALYB 2PNHA 4IPCA 4BBSG 4LF9Q 3CW2C 1CKNB 2D62A 1L0WA 4JI2Q 5JEAJ 1VQHA 1K3RA 5IYCG 3CCQA 3RZOH 3CCMA 1IBKL 4A75A 1FJGQ 1JB7A 2VZAA 3GTLH 4LFCL 5IYBH 1IBMQ 4DV0L 1AH9A 5DLQE 1IYJB 2VL6A 5FJ8H 1VQCA 1L1OA 3SGIA 4DR3Q 3HOVH 4HJ9A 1K83H 1WCMG 3HKZG 2AWNA 4YHHL 4DR4Q 2YTVA 1SR3A 2B3GA 2VS1A 2R92H 1N36Q 4DV3Q 1Q46A 5IT9c 1JMCA 1VQNA 1JE5A 1TWHH 5GAEC 2VUMH 2VW9A 5C0XG 1HJPA 1B70B 1L1OB 2HIXA 4EQ5A 3I4NG 4JOIC 3U58A 1Q1EA 1Q81C 4LF6L 4MZ9A 3HOUG 4JI5L 4DV4Q 4A3FH 1A8VA 1BVSA 1HNZL 1VQ5A 1W2BA 3DM3A 3U50C 1YHAA 3KF8B 4DR2Q 4B3SQ 2KENA 4X65Q 3K0XA 3OYYA 4A3KG 4C2MH 2WAQE 3S24A 1VQMA 4AQYL 4JI6Q 3HOYH 2RHSB 2K50A 4MNOA 5C4JH 1K9MC 4P74A 1XNQL 3ZJYC 5C44G 3M7NA 1XNRL 2CKZB 2IHEA 2XTIA 1LUZA 1UE1A 4IO9A 3GTOH 4O2DA 1YEZA 4YWKA 2PMZE 2EIFA 2RCNA 4PZ8A 3T1YL 3W1BA 1MKHA 4X66L 2BA0A 2CCZA 1A63A 4LFAL 4HJAA 4NXNQ 1Q12A 4NPSA 2OCEA 1YVCA 2A19A 3RZDH 4L5RC 3CAMA 2AHOB 4C3IH 4A3CH 4ME3A 3M4PA 2JA5H 4JBKA 2ZM6Q 4DV5L 4HIKA 2JQOA
chains in the Genus database with same CATH superfamily
2KHIA 3SK4A 2QEXA 2I0QA 2UUBQ 1QWYA 4DAVA 1A3UA 4LFCH 1I4XA 2F0OA 4DV0H 4J9LA 4R7RA 4XYQA 1L1OC 3H91A 3WO0A 3HOZB 2A6EC 4RU9A 2J4XA 5T1GA 3ZYYX 4BBSH 1SDFA 4DV7Q 1HNWL 1PZKD 1SYEA 3P20A 4N9PA 2LKVA 1F2YA 4HMJA 1T3NA 4LNQA 4ZI7F 4I50F 2R84A 4UCTA 1PTOH 5BPFA 2C2DA 5D65A 2K52A 4LF6H 4GS3A 1VQ8A 1MIUA 1GUSA 1BF4A 2YW2A 4Y8VB 4FP5D 4POFA 2NVXH 1JOOA 2F0UA 4RUCA 2FPIB 3CKIB 3PCOB 1Z2NX 1LLRD 1SE8A 2KA7A 3A8JE 1MJCA 3WDNA 4OO1G 4AQYH 4K2LA 2EQSA 2F4IA 3CCLA 4DR6L 1HRJA 1QVFA 3FMCA 5C0XH 1N32H 1XNQH 3S9WA 4XTCS 1HNZQ 4JI0Q 1TS5A 4NDXA 4TQRA 1JICA 2NTTA 4RZRA 3QR8A 1O7LA 1PZID 3KJOA 4A3DB 4X66H 1J5EL 1NMGA 2FFKB 2EY1A 4C3JG 3QFFA 1XMQL 5DG7A 2MFIA 3TMEA 4J8QA 2KBNA 1PH1A 2NWGA 4ABNA 4IR1A 4AYBA 5DQIA 4BS9A 4DV5H 3CCEA 2H5XA 2MP1A 5FOBB 3BVGA 1HTLD 1X3QA 1O7YA 1TVXA 5IODA 2OXPA 4A3DG 3HG9A 4EQNA 2N3SA 1HZCA 1TS3A 1YJNA 1GSOA 1BXTA 3CCJA 1H9JA 3O13A 2RDIA 3HKZE 4JI7Q 2JP1A 5KNDA 1CKNA 4LF5H 2WFWA 1YITA 1BUVT 1S40A 3TREA 3WO1A 1CFMA 1DXMA 3RIZA 2RHQB 4JYAQ 3OSPA 5KG0A 2E5LL 3MXPA 3RLFA 2FK1A 2IJ0A 4Q0FA 2WACA 1G51A 4M1UB 4JI1H 3Q8PB 3AFPA 5J22A 1HQMC 3S2DH 3LWEA 1RL2A 4JI4Q 4DLKA 1PFNA 2EXZA 2WP8J 1MBYA 1ZKOA 1SE4A 3PGZA 5CORA 1A3TA 5E4XA 2B2VA 2CHBD 2LSSA 2XD4A 5FO9B 1PVOA 2E2HB 3ULJA 5KFLA 3R5XA 1PH6A 2HIVA 2F0KA 2FKLA 2R85A 3TS0A 2DJFC 5KFXA 3MA2B 4IPDA 2F0NA 3NQTA 2HGSA 4DV1L 1RF2D 3AYHB 2D2CC 5JPMC 5CGKA 4B3MQ 4A3IH 3KYHC 1CSPA 2V58A 3OUZA 4HQ6A 3GTPA 2G5DA 1KXLA 2I5MX 3L7ZC 1I6HH 3GTKH 4R4CA 3JAMi 3PIP3 2BDNA 2A74C 3VPCA 4DV6H 1PH3A 5KG5A 1Q7YC 2E2IH 1TWGH 2AQ1B 3ERQA 3BDLA 4DR1Q 3S17H 1JJGA 1EWCA 2F0WA 2H4OA 1HFNA 2VPSA 4IUTA 2W6OA 2CH4A 1EQRA 1XDNA 2B2WC 1V4YA 2NYZD 4B3RH 1EY6A 1SMXA 4QQBX 5HY6A 4I7ZC 1EZ6A 2V9WA 3GIPA 3J7AK 3RLOA 1B04A 1ZXTA 4LF4H 1CHQD 3E5NA 2EYFA 3E0EA 1LO5D 1XTDA 5CA0F 3MVVA 1E1OA 1KLGD 4IFDI 2B2TA 2BR0A 3ETJA 4YY3Q 2DNEA 2UXDQ 3GIDA 3U9TA 2PNRC 3D6WA 4Q8EA 3RFCA 2YS6A 2VA3A 3KJPA 1TU2B 5M5XH 3RAXA 4JV1A 3GTLB 1IXRA 5IWAH 2F0PA 5EOYA 3DXJC 4FO2A 4HJ7A 2PI2A 2I80A 4LFCQ 4DV0Q 1KAWA 2L4NA 2AMCB 4ZLTF 1E4EB 1K0SA 3OWEB 4GNXA 2MCTA 3CCUA 2I07B 1OTCA 3I91A 4J15A 3TDQA 2OLSA 1O7IA 2N8NA 5C3XA 1GUWA 2F0EA 4C2MA 5DLGA 4MHEA 4U6PA 2J9GA 4EFEA 4O1NA 2RBMA 1GD7A 2R8HA 3EPIA 4JI2L 1GUTA 4LF6Q 4WJ3M 2CWPA 3GV5B 3MZ5A 2HDMA 1H9KA 1CA6A 2L11A 1MSGA 2YL2A 5EZYF 2R86A 4V190 5D14A 5EAYA 3JAMW 4RAZA 3E9HA 5C4JB 1HZ9A 4GN3B 4UPAA 1WTVA 4B3TH 2JEBI 3IFDA 4IAJA 2K33A 4ME5A 5KG3A 1ULZA 4HAEA 5FPRA 1N32Q 2K32A 3FKIH 5KFDA 3JAME 3H0GG 1DOMA 2AQ3B 3NTHA 3TP5A 5KFPA 2IY5B 3C1FA 2WYOA 5F2DA 1YHQA 4O3OA 1JWSD 3VR2A 1SNMA 4JG2A 1I50H 5A2QL 1PH9A 2Y0SE 1Y1WH 2JYOA 4X66Q 1UE7A 4DR2L 1RTNA 3K6OA 4C3IB 4DL7A 3PUYA 4N9TA 1EQQA 2W71A 2JEJA 1CZWA 1GSAA 4RA8A 5M5YH 1NNXA 5J3BA 5LL6S 3TQTA 1LT3D 1K8GA 3STBD 2V4DA 4DV5Q 1BNZA 2VNUD 2YRWA 5JH7F 1JB3A 2OQ0A 2WINB 3AQQA 3KAKA 1STHA 1C3OA 1E2WA 3BQ1A 4YJ2F 2C2EA 1B2TA 4L8JA 2XVSA 4C3IG 4R8NA 2NVXA 4LF5Q 1Q90A 3NBHB 2KHSA 4ED2A 4KY6A 2E2HA 1N56A 4MIUA 4WORA 2ZT9C 2NN6G 2ZM6L 3UDGA 1JWUD 4PV1C 1V1QA 5M3MH 1C8CA 1FJGH 3M9BA 1B33N 1I6UA 3SEBA 3JSLA 4JI1Q 2HD3A 3QOJA 3K8AA 4DR3H 2OT2A 1DJRD 4MTNA 4PQXA 2K5DA 3CU7A 3HOXG 1TKWB 3MXUA 4DR4H 3I4NB 2KEDA 4C1NK 1N36H 3D8GA 5LOVF 4DV3H 4YJ3F 4O3QA 4PZ6A 3AMUA 3HOUB 2VQEL 1RYRA 4QJFA 1PYBA 4JW0A 4DUZL 1D5MC 1X55A 3UFXB 3J81i 5J1ZA 5A35A 5NUCA 5K36H 3CQZB 1IBLL 5AJ3L 4IFDJ 2WE6A 4MA0A 3RUPA 2FB9A 4HSVA 4A3BH 3K5HA 2I5LX 1ILPA 4IPGA 4DUYL 3GTJB 1ASYA 1S3OA 5I9OA 1WJJA 3GV7B 1LTRD 1O80A 3IG0A 3GTGB 4JI6H 2QDLA 2QGQA 1SFOB 4JCVE 1E4FT 1SMYD 2RF4A 2B63B 1D7QA 5CYUA 4DV6Q 2R7MA 1PH4A 2Z1CA 4J9QA 4UY8C 5KG6A 1SCUB 4C3HG 1S97A 2PMZA 1S03G 3I7FA 2A1AA 4BXXG 1AZPA 4B3RQ 4O3PA 4A3LH 2FK3A 1EQVA 3URYA 1LTLA 2B63G 1GJXA 4U7CA 3K58A 4LF4Q 2R92A 3MC0B 1H9SB 3WWVA 4QMGA 1Y69U 1E4EA 2HQEA 1PA6A 1A6XA 1I3QH 5GAGC 2HHHH 4OONA 4XQNA 5DQGA 2ZXOA 5FLMG 1NE3A 2PYKA 1CHPD 2EPBA 5I47A 4A93H 4KHVA 4K14A 1SBBB 2A6ED 4F50A 3GD7A 2PZUA 1GYFA 1DZ1A 3LMLA 5C1OA 5IWAQ 3N40P 1STAA 5CB4F 4FDBA 2FHTA 4KV6A 2LXJA 3ULPA 1VQ7A 3GIIA 3S14B 1SRUA 3FPUB 3I90A 2E2IA 2EY2A 5FJ8G 1N33L 1G291 4UP8A 3CCVA 2JA8B 3J81W 3HP3A 1EIHA 2WB1E 1RTOA 1DOLA 1QVGA 4MA5A 4QWBA 2R8KA 2W6PA 4DL4A 2VUMG 2B29A 5EPJA 3J81E 3M4OH 2C5CA 2PQAB 1RK6A 2B2UC 3BABA 2ASJA 4FBUA 4G4KA 4OX9L 2QYZA 4QW9A 2BH2A 2XGTA 4WBNF 2P5ZX 3H20A 1SEBD 4EEYA 3TIGA 2HVSA 4KD3A 4IWXA 2JXMB 4RB0A 4G3IA 5BR8L 4RCOA 3OHXC 3B6YA 2P0AA 4GLAC 4B3TQ 1KAAA 4X64H 4ALPA 4DNTB 4Y7NH 3HOYG 3A0JA 2EE1A 2NVYH 4X65L 2SNSA 5LP6F 1CM9A 3GTQB 1Y1VH 1CSQA 5I6YA 1EY8A 5KNCA 3RUZA 3PIOA 2Z0SA 5IGBA 4RKLA 3K3VA 3T1YH 1WYDA 2WTFA 1N34L 5M5WB 4A3EH 4M9UA 2MNAA 5TSSA 5DAUA 3M4QA 4MTKA 4R4IA 1M90C 2K05A 3I8ZA 1FKAH 3NBHA 5KNBA 1QZGA 4QW8A 4DK3C 2IBKA 3I55A 4HNVA 4GKJH 1TWCH 1EHIA 4ODGA 2BCOA 2ENBA 2MJ8A 4IQZA 1VQBA 4HR7B 4KHZA 4V0BA 5JVDF 1SJED 3HKZA 1I4QA 4IZ8A 4O4LF 4BBRB 2W9BB 3E3XA 4HIMA 3PW2A 4YAKB 2EY5A 1WCMB 3OTOL 4FNFA 2VOBA 1XMOH 1PFMA 4HN7A 5JEAH 3QZ8A 2F0MA 1K8OA 1SSOA 4OWWB 3S16B 4IPCA 3K5MA 2FLPA 3K5LA 4DR5H 4N8X1 5JEAJ 5KFTA 3FKIA 2G9DA 3CCMA 1FJGQ 3VR4A 4LH7A 5L1LA 4XQQA 4RAUC 3I72A 5DLQE 1EY0A 4DR3Q 3HOVH 4HJ9A 1K83H 1WCMG 4YHHL 4DR4Q 3GTGA 2YTVA 1G2TA 1SFOA 2OF1A 1N36Q 4DV3Q 1Q46A 3M7GA 2C22A 1A3VA 5GAEC 5D3IB 3DM1A 3U9OA 3ETHA 2K1BA 1W2BA 4O4HF 3KF8B 4X3SA 2UUCH 2L0CA 1AUVA 5KFCA 1AW7A 2NB0A 2WAQE 1K8MA 3MR2A 2RKSA 1F2ZA 4JI6Q 1I94H 2K50A 4P74A 1HFGA 3M7NA 2IHEA 1EUCB 3K7AB 2PPBC 2RCNA 1IW7C 3W1BA 5KRUA 1QILA 5FLXW 2PO4A 4NPSA 3RZDH 1HUMA 3CAMA 2E5LH 2JA5H 1WTPA 2JA7B 4RB3C 5FLXE 1JE4A 3TQ1A 3S15B 1IBKH 1K1QA 4A3JH 2Z6BA 1SYDA 4QIWE 4TQUS 1KD1C 3W3AA 3MR5A 3DMUA 2HHHQ 1HCZA 3OHAA 4DV2L 1I5FA 4J6HA 4O3RA 1ENFA 2UXBL 1X3PA 2LXKA 3PO3G 4KHPL 5JJKA 1JJCB 3EA6A 1EWIA 4K8IA 5JJIA 4YBZB 2UUAL 1I7LA 4FM9A 2PQEA 3TZDA 3S1QH 3V4ZA 4RB2C 3T5KA 4JI5H 3DHQA 1D5XC 4LUVA 4XQJA 1JDBB 3PSIA 1JQYD 1ONLA 1ZYRD 5GROA 5CV7A 3GQBA 1ILQA 4AIMA 2HUGA 1U9RA 2YTYA 3AFQA 4ZAIA 4MV9A 3PO2B 3P75A 4EBCA 3PUZA 3V96A 1BBUA 5C3EB 3G6JB 2ZJRA 3HOWG 2E74C 5LMNW 4IZOA 5IYDG 2K01A 2K5QA 1Y14B 1TWFH 4X6AH 5KX5F 2L12A 3NK9A 4B9WA 3F2BA 5IT9W 1VQOA 4ECWA 2R7FA 3CMEA 1C7YA 1ESRA 1WTOA 2MGSA 5C4XG 4RGMA 5IT9E 4ME6A 1VBGA 5EKIA 4QB4A 5EBDA 1DCZA 4EFBA 4LFAH 2XN9C 4X64Q 3PO2G 1I3QA 4HR7A 4POGA 2UVUA 3R5HA 5C3EG 1DV2A 2A6HC 3U9SA 2LFNA 4BY1B 1MZBA 4RUAA 2NVTH 4ID6A 1S68A 3STBC 5EJWA 3T1YQ 4ECVA 1PMRA 2RGVA 5D1OA 1W3SA 4LF7H 1IKMA 1QB5D 4F7XA 5IP9H 3IL8A 1JT8A 2ZJPA 4LFBL 4PDBA 4GKJQ 4A3GH 1E2VA 4A3MB 3BA9A 4I55F 1QNUA 1YNJC 1M4VA 1LT5D 4IUNA 1L2FA 4DR7L 3KLWA 3VMMA 2F0HA 2ZTCA 3OIQA 4HCSA 1CE8A 1EU4A 3OSOA 3D31A 2W57A 2NUAB 4TQSA 2IT1A 1UUPA 4AYBG 4U673 2IX0A 4ECSA 3I70A 3D6CA 1CQFA 1B9MA 1QNKA 4K6DA 4DK6C 1W6KA 1M0WA 1XMOQ 2EYJA 5G3LD 1WTXA 3PF4A 1V1PB 1G8ZD 1S4ZA 3QO2A 3H4DA 3I4OA 2L9HA 3K59A 3G4SA 1DV1A 4X62L 4DR5Q 1OXUA 1CKMA 2D5DA 2FJ2A 2VQFL 2W6QA 1GXDC 4X3KA 5HGTA 3A74A 5KG4A 3PW7A 3KF8A 3JAMc 4LK1C 1ZEQX 3BG3A 4YIJA 4O2BF 4TVAB 2W6NA 1GUNA 2RDGA 1M1KC 4EYIB 1RK5A 3JRWA 2B39A 4OO1H 4Q0YA 3H40A 1KRTA 2W7OA 2FJZA 4GC6A 4LJZC 4APMA 4DN4M 1YIJA 1OO9B 1YHBA 2JE6I 2R7KA 2K5NA 2V1CC 3MHBA 1T5XD 4HCEA 3CXCA 2EXDA 3SK8A 1SJHD 4JI8H 2UUCQ 2GPSA 3VYUA 5LMUL 4C3JH 3G71A 3SHLA 1K1SA 1I94Q 3BA8A 4ED3A 2JA7A 1M0TA 4RZQA 3IAYA 3K5IA 4Q43A 3BU2A 4F4XA 2O4XA 3T1HL 3S1NH 4ZOLF 1P8LA 2D0OA 1E2ZA 3VPBA 2JA6A 5LMNH 2UVRA 4R4QA 1HNXL 3V6HA 4UCOA 4NKLA 1HR0L 1G91A 2PN1A 3HXLA 1S5DD 3OOCA 2F03A 1S72A 1PK8A 2E5LQ 5I9PA 5DGAA 1XTCD 2UXCH 2B2VC 3PUXA 3UDXA 1O75A 4A2AA 1IBKQ 1HA5A 3BYTB 5M3FB 1QCBD 1R9TH 1JJ2A 2F1MA 5IYCH 3V6JA 3KLRA 4ECUA 2IX1A 4KN7C 2VB3X 2VQEH 1BOSA 2IL8A 5CR3A 1JDEA 4IUPA 4LF9L 3HOZG 1X32A 1DYQA 4UFZA 4S3SA 2WB1A 4ULLA 5J39A 4GNXB 1LTSD 1YJ9A 2WKDA 3P1HA 3MFYA 4JI5Q 4QWCA 1N8RC 3FRPB 5M3FG 5KFFA 1ET9A 4C2MB 2RDJA 1H9RA 1T36A 3Q22A 4WRDA 3CF5A 2OQKA 5C0XJ 3VYSA 4DA2A 2NVQH 1SYFA 1PDQA 4LUZA 1I6VC 2E76C 2QF7A 4PMWA 1LM0A 4P72A 3NUCA 2L55A 1VQJA 1PH5A 5KG7A 4L6TB 2UVWA 3HKSA 1M6VA 2GLTA 2ZDGA 2F4VH 5CV4A 1EUJA 4DV4L 2OTLA 2W70A 2EYMA 4Q45A 4JK1C 2I46A 2BQRA 1EYAA 3TZUA 1FNVA 3RD4A 4ECQA 4JV5H 2EZVA 2B2TC 1EFWA 1VQ9A 5KFUA 4LFAQ 2V4RA 2H1EA 2Q8TA 2ZXRA 1RJTA 3MXGA 5T14A 1FYCA 3RB0A 1VQIA 1UE5A 1N9WA 1VMCA 3E5SA 3MFHA 2NZ1D 4IOCA 4O0AA 3PW0A 2V4QA 4JV2A 4UCVA 4LF7Q 4DXGA 3G7LA 1V1PA 1MD2D 4GNXC 3RNUA 4NXNL 2HDLA 4FF2A 1EY9A 1PTOB 3F2CA 3AB9A 5IIFA 4JBMA 5I4DA 1UNNC 1IHZA 2RGRA 2K4KA 1SYCA 4DXFA 2NVXB 4J1MA 3J81c 3BJUA 2UUBL 1EU3A 4YR3A 2DJGC 5KFVA 4YCWA 5FK9C 1IBMH 1IL2A 5KKNB 2FP4B 3A55A 2LY7A 3M85A 4KY7A 1ZHQA 3J80i 3P7JA 1EYDA 4K5WA 4RCNA 4DV7L 4RFBA 1MI2A 3VYRA 2MUYA 3LX0A 2R87A 4QCLA 2ATLA 1B44D 2E8GA 4F87A 3GTMH 5IP7G 1B4OA 3MR3A 3ICEA 4P75A 3S2HB 5ELOA 3HFZB 2XWJB 1C9OA 4B3SH 5K2MA 4C1NI 1IKLA 3FDSA 1SE2A 2SEBD 5KFYA 2KHJA 4DL2A 5L37A 3DWQA 1SYGA 1CQVA 1FD7D 3DLLA 4R1JA 4CKBA 4OIKA 2R7ZH 2WAQA 3H0GH 1S0OA 1JKJB 1VF7A 5CC4A 1PYSB 4HJ8A 4JI0L 2W6MA 4JBWA 1PYWD 3DUZA 4JI8Q 1U4RA 4TV8F 1KTKA 1GUGA 2KCTA 4XDXA 1IW7D 3MEFA 3DEPA 4KY5A 1BO0A 3EBEA 3T51B 1CZGA 3RGXA 2F0GA 3MR6A 2IW3A 4KKSA 1U4MA 2PMZB 1EYCA 1HH2P 1B1ZA 2V59A 2FPGB 1EQTA 3K0YA 5ELCA 1JCKB 4M8AA 4JI3H 2AQ2B 3PUVA 3R2TA 3QZ7A 2OTJA 1PV4A 5LMNQ 3S2DB 4MAMA 5L1JA 4O42A 4HYKA 4I4TF 2VR1A 4K2KA 1F9PA 5KFNA 1UC8A 4MV3A 2R92B 2VUGA 4NXML 2EDGA 4JI7L 1C48A 2DNCA 4YWMA 1L2ZA 1NBWA 1PH7A 2IPKD 2UXCQ 1FVIA 2NN6H 4ECTA 2ASBA 4JYAL 1UC9A 2ICEC 2YS7A 3D4WA 3J80W 4WJ4A 3I73A 3T4AC 4A3FB 4A2BA 2WV6D 5IYBG 3H09A 1ZYRC 5EPKA 5HV6A 4NP5A 5T1IA 3J80E 4A3IB 1F9SA 3HOXH 2MQHA 5ELNA 2VQEQ 3CC7A 1VQDA 5D1PA 4QGUA 4JI4L 2R92G 1CQJB 1I6HB 3JZIA 3GTOA 2W9AA 1STEA 1JWMD 2KOLA 1SE3A 3BZCA 3K5OA 2E2IB 1TWGB 3S17B 4O2AF 3M3YH 1UE6A 5DEHA 1K8AC 1K73C 3HBLA 1KEEA 4A3FG 3DWAA 3M9NB 2XIGA 2M00A 3A5UA 4A3IG 1GHJA 2NBFA 4LF8H 1EEID 1K3BC 2L15A 4B3ML 2YYZA 2AGQA 1JOKA 1OXXK 4F4YA 2KECA 1XPRA 2Z4IA 4BA2I 2AGOA 5D3DA 4JOIA 3J7AF 4DAYA 4RNNA 2DLNA 1TY0A 2A6HD 3MTSA 1JR0D 2F4VQ 2HVQA 2ZTEA 5G3LF 3T53B 3RLNA 2VXWA 4A4IA 2SDFA 5FLXc 4L5TA 4DR1L 3CQZH 2QK4A 4JV5Q 4Y52H 4C3HH 1R9TA 5BMVF 4CDEC 4DNRB 4RH6A 4ZRZA 2QCPX 5GQOA 5KFHA 4BWGB 1AZQA 1PX2A 3ULLA 4RGNA 1YNJD 2F0FA 4FXKC 3CD6A 3Q6SA 3V6KA 1KNAA 1SYXB 2B8GA 3Q0AA 1YJWA 4F4WA 2WKCA 4RKBA 1XWEA 1LTAD 4KHPH 4X3TA 3HKZB 3NHHA 5FLMH 3H4BA 2K7VA 4YY3L 4I65A 4QY7A 4MV1A 3CC4A 2UXDL 2ALYB 2PNHA 5IGEA 3N41B 2N88A 2I87A 4ILWA 4MTDA 1VQHA 3RZOH 1L0XB 2J6SA 4BWSC 1JB7A 3EVQA 4Q44A 2ASDA 4LFCL 1IBMQ 1D1IA 4DV0L 1V1OA 2VL6A 1CT1D 5FJ8H 1VQCA 3SGIA 4JUZA 3T13A 3HKZG 2AWNA 3FKIB 5C8YF 2VS1A 1I7NA 1AN7A 5IT9c 5KT7A 1JMCA 1JE5A 1TWHH 2VUMH 1HJPA 3T5HA 3I4NG 4GC7A 2BQUA 5C44B 3U58A 1Y1WB 4LF6L 4K0KH 3HOUG 1D2BA 1A8VA 1O78A 2Z8LA 2C2RA 1VQ5A 4DL5A 2UVVA 3U50C 1BBXC 1LTTD 2UU9H 4B3SQ 2KENA 4X65Q 3K0XA 5M5YB 4CC5A 3OYYA 1J8IA 1A2TA 4ZQ3A 3MWDA 4AQYL 3HOYH 2HJWA 2ICIA 5KYLA 2R7LA 3UI2A 4LSAA 4MNOA 1XNQL 5C44G 3VR3A 1AP0A 2XTIA 4HSPA 4IO9A 3PVXA 5EPLA 4UHVA 2ALZA 2EIFA 2F3WA 3JSNA 2A68D 4X66L 3J7YW 4QWDA 4O3SA 5KFZA 3NGDA 3BQ2A 2OCEA 2SNMA 4J9PA 3TIIA 3X3MA 5M3MB 2KVMA 2M05A 4IUVA 4DV5L 1KJ9A 5CV5A 2KQ3A 2EYOA 1JC7A 4JI3Q 4Z9CB 3SR1A 1PH2A 3MWYW 1Q82C 3TP7A 3GIJA 1V8QA 3GTKA 4X62H 1A0IA 3RB4A 1SROA 4LF5L 1LTBD 1TWGA 3S1RH 4MN3A 2PZTA 4I7AA 1KLUD 3G6XA 3ITPA 1ZQ7A 1BDOA 2O5IC 2L1BA 2XWBB 5EWGA 3MWMA 1II3A 3G6VA 1F77A 2R7ZA 1NMFA 3H0GA 4UCRA 1Q8KA 3CP0A 4ZYSA 5KFQA 3HGBA 1ASZA 1VQLA 1X3EA 2N55A 1EZ1A 4G7HC 3LWBA 4C5CA 4JI1L 2XCPA 3GILA 1X3GA 2Q2UA 5E1FA 1YNXA 1O7ZA 2XSCA 1LTGD 3TSSA 2QKIC 4IFDG 4ZHQF 2BH8A 1VS0A 1AUXA 2PW5A 2JA8G 1VCIA 2RCFA 2Z6KA 1GVPA 3RB3A 3NENA 1ICWA 1QJOA 4TRDA 3V4SA 3EPGA 4KLKA 3TN2A 1XNRH 5LMUH 2JEGA 1X54A 4NB3A 1Z6HA 3I4MH 1B7YB 3NTKA 3G8CA 1SNDA 4B9XA 2RVLA 1YI2A 4LF8Q 5KFMA 5J2UF 2IWHA 4HIDA 3L2PA 4CDCC 3G6YA 4J9SA 1J9OA 2X0SA 1I3QB 1VDZA 2Y0SB 1X6OA 1V43A 5L9XA 3D4DA 3V2TA 3IN5A 2PZWA 1DIKA 2M2LA 2PCFB 5FO7B 3H3VI 4RGTA 4BY7H 5HGQA 4UP7A 4A3LG 1NTGA 1TR5A 4GN4B 5D1OB 2E75C 4XYLB 1E0BA 1HNWH 1NAPA 1ENCA 1CK1A 2QILA 5DQHA 2EOTA 2Z9HA 3FP9A 4F88A 3N44B 5KFJA 3GV3A 4EQOA 2W7PA 3J7AV 4P71A 4LF4L 2NU7B 4KHPQ 4R8IA 2OEOA 4L1KA 4RGOS 4BBRG 2RDHA 3M4OB 4LAAA 4RB1A 1BCPB 3PO3H 4C5BA 2GVAA 1I50A 4DR6H 5EQ0A 1WFQA 1Y1WA 3T5JA 2K14A 1F9RA 4DK0A 2VQDA 3UQ8A 2B8FA 4DAPA 3K5NA 3V05A 1TS2A 2Z4HA 1CKOA 1QVCA 1MJEA 2RQXA 5E3FA 1B8AA 4CHTB 1RODA 2R93H 3KFUA 4EYHB 2EVBA 2F0DA 3I12A 3EQLC 4GKKL 1J5EH 4IURA 4WD3A 1M8AA 1C30A 4GOPB 3BZDB 5LL6b 1Y1VB 1XMQH 2RSNA 3TP6A 1PLFA 2FLLA 2D9UA 3HOWH 4HEDA 1BCPF 5BPHA 4J9NA 2NTSA 4EX5A 5IYDH 2C9OA 2TSSA 1VQFA 2EJGC 3G48A 4TKOB 4A3EB 1VQGA 2NU6B 3F8NA 4K0KQ 3H94A 1RYSA 3MWEA 1XJVA 1B3QA 5C4XH 1TWCB 2UU9Q 4NMZA 1S5CD 4JPBW 1HA6A 4J0MA 2CH4W 1PTOD 5I2YA 3PF5A 3I4LA 4B3TL 3EROA 1CUKA 1KRSA 3PO2H 1LV9A 5JVLA 1TWAH 5C3EH 3OMGA 1KQSA 1LT6D 4MTEA 5DG9A 1TT2A 5KFGA 4A3EG 3CC2A 1F9QA 1YBYA 4DL3A 3E0JA 4FXGC 2OWOA 2DWCA 4LFBQ 1EIGA 5CBAE 1BCPC 5IGGA 1WTWA 4OO1I 3UE1A 2BQ3A 2JA6B 5A2QW 3IFTA 1EZ8A 4CJ1B 3MJFA 5LYJF 4ED1A 2PBZA 3KBXA 1UAPA 3MFGA 4ZUJA 4PG3A 1TWHA 1RJPA 3HS0C 4OL7A 5A2QE 3HOVB 3S1MB 2JA7G 3Q8RB 2KSWA 1Y8PB 1NR4A 3PMFA 5KFKA 5JEAG 2W6ZA 4ED7A 3KDFA 4DV1H 2QW7A 1W96A 2YU9H 4X62Q 2E2JH 4IUUA 5CMDA 5LL6X 1S0NA 2M9VA 2JA6G 5L1IA 1BNCA 5CA1F 1NY4A 3NBIA 4QL5A 2F52A 1KC7A 4MV6A 1FJGL 4HNTA 3NQIA 2I8CA 3LGJA 4IJHA 3KHRA 1JXLA 3R23A 5BN4A 2WB1B 1G6PA 2CQOA 4DR3L 1I4GA 1QUQA 4DR4L 3CRLC 4K6LA 2G9HD 2YZNA 1N36L 3BVMA 4DV3L 4X3UA 4EGQA 4A3KH 2Q2IA 3RMHA 2Y0SA 4LSXA 2K6AA 2Q2HA 1CQIB 1XNRQ 1LTID 5LMUQ 1BBWA 3KTMA 2R61A 3RZDB 1LABA 1LACA 3K81C 2WB1G 3N43B 3N6XA 2JA5B 3NWSA 3L9AX 1GUOA 3ER0A 4XT1B 1N48A 4JI6L 4J9MA 4FS2A 5C0XI 4A3JB 4KKUA 1WD0A 4JV0A 3VPDA 2KCNA 4BY1G 4PNYA 2YZMA 2JEFA 4DFAA 3GTPH 2C28A 5CV6A 3OMCA 3R3OA 3SDZA 1MHWC 3GV8B 2MHVA 4IRDA 4ZKCB 3NTIA 2KCMA 2C35B 3TBIB 3RN2A 4LW1A 1HNWQ 3S1QB 4EGVA 2DZDA 1HUNA 4A3MG 4FVMA 4A3JG 2HQLA 3KALA 2XIWA 3JAML 3NE5B 4JI2H 1PZJD 1KNEA 2WDTA 4E6IA 2NVYA 1IZ6A 3Q8DA 4IPHA 2XC9A 2VPQA 4GOPA 1E22A 1Y1VA 2HHHL 1RJRA 2O5JC 5K5PA 4XYMB 1WI5A 2JA9A 1GHKA 1CI3M 2ZDHA 1TWFB 1VF5C 2QEJC 1L0YB 4DR6Q 4DGZA 4GN5A 3HOZH 2NUCA 4YR2A 2JJQA 1B6RA 4R4TA 1T94A 3PR4A 1A62A 1TWCA 5M3FH 3MXNA 2R7NA 1QOHA 5C1PA 4L5QA 2DUDA 3VDYA 1J5EQ 4DR2H 2AUJD 3K7UC 2ZJTA 3KHGA 1XMQQ 1KDBA 2NVTB 1C0AA 3KK7A 4YCVA 2YYAA 1EY4A 2QA4A 2W9CB 3OSNA 3PN1A 4J9OA 2F3IA 2Q8RE 3LNNA 1TXYA 4UCUA 3CPWA 4H0LC 4P73A 1EIYB 3VR6A 2DY8A 5KFRA 1QZHA 4JVZA 1EYGA 4A3GB 1GSHA 2YRXA 1Z9FA 2WAQB 3N8DA 3BDOA 2KEEA 2A68C 4OXPA 1RDPD 4KMUC 3I56A 1S9FA 4A3DH 4X64L 5KFOA 1SEIA 3AEVA 1J6QA 4IHJF 4U68A 2IHFA 4HIOA 5LXTF 1TS4A 1FL0A 2ES2A 2ZM6H 1PXUA 3H3VC 1K83A 1PRTB 3VYTA 5JJLA 1BKBA 1GKHA 4KJOA 5IP9G 1KC8C 2HT1A 1CA5A 1HHVA 4A3GG 2WAQG 4PWQA 2R93A 1T9HA 2NZHA 3GQCA 4GKJL 5KT5A 2B2YA 4DNIA 3GO5A 4OHJA 4DUZH 1E4GT 4QIWB 4YCUA 1PRTF 4H02A 1A9XA 4Q5VA 3FEWX 3QJYA 1SXTA 2AQ4A 1IBLH 3RJ0A 3ERSX 1VAJA 2XNAC 2K5WA 3KF6A 4IJLA 4DV1Q 4DUYH 1MGSA 1XMOL 1IYVA 1A15A 1V9PA 2BA1A 4IOAA 4ETSA 1WTQA 2DN8A 5GONF 1STGA 1H95A 3FVQA 4DR5L 3A56A 4RNOA 4OWTB 2ASLA 5BN3A 5IGCA 1TWAA 2CWAA 3NP8A 1SNCA 3GTOB 5IP7H 2CW0D 1SN8A 3WOEA 4C3JB 4EGJA 1DM0B 2E2HH 3MFIA 5DLFA 1Y8NB 2JA5A 1NJIC 5KFEA 1PRTC 1AEXA 2NN6I 3T16A 3FPPA 4H7BA 3S1NB 1YZ6A 1VQAA 1YNNC 5ELEA 3NXWA 2A8VA 3W5OA 3ONAB 1EOVA 3E9IA 2F0QA 3PIO3 3S2HH 2UUCL 5FD5A 4DAYB 4IRCA 3KHHA 2NU8B 3QIAA 4JBJA 3T56B 4K5XA 3C46A 2ZDQA 5ELBA 1HTPA 1I94L 4BBSB 3PUWA 4J9KA 1VMPA 2YU9A 4YAJB 4A3CG 4PMCA 4XIGS 3J81L 1TY2A 1R9TB 5C5LA 3I2ZA 1W6JA 4YWLA 2K03A 4IN3A 4NXMQ 3UE0A 1SNPA 4AH6A 2BE5C 3W1GA 1TWFA 1N33H 3TINA 1X3FA 1LT4D 3R5FA 4BBSG 5ELFA 1U4LA 3CW2C 2SOBA 2D62A 1L0WA 4JI2Q 4OX9H 1CTMA 1K3RA 1QG7A 5IYCG 3CCQA 1BXRA 2J6UA 1IBKL 2NVQB 1PTOF 5C5MA 4A75A 3L4JA 4NW2A 3GTLH 1B6SA 3ND8A 5IYBH 1AH9A 1IYJB 5BR8H 2DPJA 1L1OA 3GIKA 4E4TA 4QWEA 2W9CA 2B3GA 1KJQA 2R92H 3R93A 1EY5A 3F2UA 4X65H 5L1KA 4KK7A 5IGFA 1V51A 4C5AA 5C0XG 1B70B 2HIXA 4JOIC 3RV3A 1Q1EA 4MZ9A 5KG2A 4JI5L 5DGBA 1N34H 5FKAC 4A3FH 4ZCKA 2W8KA 1HNZL 1YHAA 1S5ED 4DR2Q 1IYUA 1QE6A 1WTHA 3GP7A 3SK5A 2VB2X 2J6TA 4XXEA 1WD1A 3RF2A 3S24A 1JOQA 1PTOC 3Q8SB 4YR0A 4IALA 1KBLA 4FF4A 2F0LA 4FF1A 3OHBA 5C4JH 1G2SA 3ZJYC 1WH2A 2CKZB 5F9NA 1K28A 2JN4A 4TSSA 1EY7A 2K28A 1YEZA 4O2DA 2Q8IB 4PZ8A 5JVH3 1MKHA 2BA0A 2RDFA 1BCPD 3OTOH 1KJIA 1M7JA 1A63A 4CDFC 4LFAL 4HJAA 4QUFA 1YVCA 2A19A 2MPMA 4L5RC 4C3IH 5KFWA 2R6FA 5LHY1 1JLLB 3K3PA 4ZQIA 2XRQD 4QIWA 3M4PA 4JBKA 2ZM6Q 3KUPA 2JQOA 3CCRA 3BQ0A 2N78A 4LF7L 4LWCA 5LA6F 1I4RA 5J2TF 3RGZA 4YHHH 4ED0A 3N42B 4GLVB 3WOFA 1MSHA 2MO0A 1K0RA 4XT3B 3GTMB 3KXYT 4DUZQ 1Z2PX 5ISRA 2LS01 3GTKB 4CJ0B 4WJWA 3L4KA 2GA4B 2I5HA 5D8DA 4GKKH 5BN5A 3NSWA 2YTXA 1IBLQ 5AJ3Q 5I2XA 2GVBA 3F8TA 1OXSC 4DUYQ 4CKEA 3SE7A 2R7ZB 3X3NA 2A69C 3VR5A 3H0GB 2N49A 3U4ZA 2PVPA 5GAHC 4QUCA 3NEMA 3IRBA 5H80A 5JQWA 1SYBA 4WFN3 1HZBA 2K5HA 3I4NH 2F0JA 1IL8A 2DIKA 5FLXL 4HNUA 3HOUH 1NCVA 3D3RA 1AFPA 2BDOA 4AQYQ 2IP4A 2FLNA 1UEBA 2O2LD 3TEHB 3FDTA 3BDCA 2FMAA 1LYLA 1GM5A 2R7ZG 3IKJA 1XNQQ 4MV8A 1S5BD 5EWFA 3A8IE 4CGYB 3M4YA 3GTJH 5M5XB 2EY6A 4ZUIA 1VBHA 1GO3E 2ZJQA 4XYOA 4KKTA 4BXXH 3BAAA 3GTGH 2X69A 4OEMB 5C44H 4IWYA 3PR5B 2OH2A 4CBVA 1SNOA 3QB3A 1SFOH 3UDFA 3OWFA 4EG0A 4JI8L 2B63H 4N8FA 4PZ7A 3R8BA 1E7ZA 4UCSA 4DV2H 4FS1A 2AGPA 2TMPA 2B2WA 2UXBH 1D5ZC 2HCIA 1JORA 1A2UA 1WSCA 4LH6A 2FPPB 1BGWA 4O3NA 2UUAH 1SAPA 3BZKA 1D6EC 4XX0B 5KIXA 1GLVA 4ED8A 3EIVA 5JOBA 1X65A 3EYYA 3A54A 2R8GA 2ZXPA 1H9MA 2BOSA 3QOLA 3SXHA 4RWSC 3HOXB 3GLKA 3DF7A 5LMNL 2R7DA 4DK1A 3N6RA 2XGQA 1N33Q 1E3PA 2J7ZA 4R9WA 5IT9L 3C0FB 2CQAA 3M4IA 3M3YB 3TS2A 2UXCL 2Z6KC 2R8IA 1EEFD 1S5FD 4OX9Q 2V5AA 3BYYB 4ZKBB 1HR0W 3MEHA 3AU7A 1I50B 3GV6A 1EIFA 1VQEA 2LMCB 1FGUA 2SCUB 5BR8Q 2HVRA 4QWAA 1AE2A 1BQQT 3S14H 2JSOA 2GN5A 5IY0A 3J81j 4IFDH 3H6MA 1XPOA 2JA8H 4YB8B 1XX8A 3FKIG 4HTHA 5FD6A 3PZPA 4GLXA 4G57A 3BVZA 4OIJA 1N32L 4UAIA 1N34Q 4C3HB 1PH8A 4KI0A 1Y1WG 3OPOA 1ML0D 4LFBH 4I7HA 3RBDA 5C5JA 5C6AA 1Q86C 1VQ6A 5KT3A 1GGOA 2RSOA 2IA6A 1TA8A 4GZYC 4DR7H 4DKAC 4L5SA 4IR9A 1Q3LA 3BJYA 1STBA 2F0TA 1FR3A 2F4VL 3GTQH 5EKLA 3RR5A 2XGPA 4RAYA 3FHWA 4Q8FA 3Q2OA 1NUCA 1PFBA 4JV5L 1NSNS 1P16A 1R4QB 3OTOQ 3HB9A 3GTLA 5M5WH 3C1EA 3NWTA 3GTMA 2AKWB 2JEIA 3L3OC 1Y8OB 4EQPA 3RZOB 3CMAA 1DONA 2VQFH 2ATWA 3WNZA 2YZGA 3CRKC 5M3MG 2F0IA 1BJTA 3CHBD 2FE3A 5KFAA 1XPUA 5JJZA 4A3BB 4BBRH 1HZAA 1TWHB 5CV9A 4YHHQ 3F2DA 2VUMB 4CJ2C 4ZK9B 3KBGA 1WCMH 1U4PA 2K75A 4C56C 1RKNA 3KDFB 3Q1KA 3PV0A 3SK6A 3S16H 5ELDA 4GKKQ 2YV5A 1STNA 5K36G 2CW0C 1IBML 1OWTA 3HOYB 4CC6A 4A3BG 4HMIA 1AE3A 2R82A 1E1TA 1UNSA 2XRSD 4FXDA 2PW7A 1UEAB 4RMFA 1PRTD 2A73B 4OWXB 3OW7A 1RJQA 1QUQB 1SLJA 3T1HH 1YNND 5EDWA 3LP8A 3PW4A 4YP3A 4DL6A 1R4PB 4DV6L 3KAJA 4KTAA 4B3SL 1HNXH 2VY3A 4AYBE 4OGQC 1HR0H 4A93B 1FGBD 1I4HA 1HPCA 2FXQA 5KT4A 1IOVA 3DEOA 5C4ZA 4JC0A 3Q24A 1DD2A 3C3LA 5KFBA 4ECXA 1F2MA 3SI8A 5KGUA 4B3RL 3EFXD 4TV9F 1X9NA 4UP9A 2RA4A 4BA1I 1KIXA 1KJ8A 1FNUA 4ECRA 1B9NA 2F0SA 1S0MA 1RHPA 3LWUA 3UDIA 2Y0SG 4EVOA 5I6WA 4DV2Q 3S1RB 3K7AH 2UXBQ 2E2DC 2BE5D 4A93G 3D4RA 3CVZA 5IYZF 3A7AB 2UUAQ 2XCAA 4LF9H 1TIID 3HRZC 2EJMA 4R4OA 5IE8A 3SVMA 1ESFA 2DGYA 5KG1A 2CVRA 2NZOA 2D0PA 4JI3L 2JA7H 4LMYA 4MV7A 5IWAL 1E24A 1VQPA 3S15H 2R3ZA 3RTXA 3FMAA 1U5KA 1RIPA 5EBCA 3EN2A 4Y7NB 3NELA 3TP8A 4FU0A 5F9LA 4F4ZA 2NVYB 2W8LA 2R6GA 1EL0A 4K5VA 3CQZA 2JA6H 2AWOA 4G7OC 3JC66 3ORQA 4ECYA 4APVA 1Z7TA 5KT2A 3PIPA 5KFIA 4KD4A 3OIPA 1EFID 3I4MB 3GTJA 5COYA 1KDCA 4DV4H 2QDBA 4G7ZC 1STYA 3S1MH 2YCHA 2MO1A 5JVG3 3VA7A 4EBDA 4CDDC 1EUDB 2WIIB 5CBEE 2J0TD 2B63A 1VQKA 2HCCA 3MXNB 5AFWA 2FMCA 5H1SE 5KT6A 2B2UA 1Y1VG 3Q23A 4ECZA 3RN5A 1WOCA 4FBTA 3DWPA 3I4MG 3Q8QB 3PW5A 5DG8A 4BY7B 4O4IF 1B3AA 4UDUC 1RCVD 1T5EA 3QG1A 4NXNH 1U0LA 4LF8L 1TAEA 2FINB 1H9SA 4DR7Q 1X56A 3KLSA 4RG1A 4M7EA 4H13C 3G6EA 1JIHA 1OXVA 4R8UB 1NR2A 1F2LA 2CFMA 3TRZA 4BY1H 2L5TA 1I4PA 4RNMA 1G6ZA 2UUBH 1WTRA 5EGTA 3W2DA 4HJ5A 3OW2A 4BY7G 4PMBA 4MV4A 4L63B 2VUMA 3PO3B 5JPNC 1WVLA 4GOPC 4J9RA 1K83B 5IOCA 1C4QA 3F1ZA 3VA5A 4DPGA 2F0VA 4KN4C 4A76A 1ZHSA 4LUOA 4DV7H 3QWNA 1KJJA 2PI2E 1ICFB 1GOZA 3U4VA 2VQFQ 1HXYD 4A3MH 2R93B 2AUKA 3RAQA 5KFSA 3J7ZC 3ND9A 4DF7A 2A5HA 1D1KA 3CPFA 2PQAA 3HOWB 3HOVG 1PFSA 2Q2TA 2ID0A 2VA2A 2JEAI 1B50A 2NU9B 3T5LA 2A69D 2X6GA 1EOTA 1XYIA 3KF6B 5JAVA 2R93G 2ZTDA 4CKCA 2K5VA 1BR9A 1RD9D 3BS1A 5C4XB 1HNZH 3BG5A 4JI0H 2F3VA 3EJIA 3A5ZB 5KYIA 5CV8A 3D0FA 4XZ3B 1Z47A 3OUUA 3GTQA 2XCLA 3A8KE 3H3VH 1TWAB 1IOWA 5FO8B 2CW7A 4IUQA 3PQIA 2JK8A 1ENAA 2CZGA 3RBEA 2FMMA 4RHSA 3MAQA 4H44C 3H15A 1Q1BA 5E4WC 1Z2OX 3A7LA 1WR2A 3ORRA 3L0OA 2IMWP 5EWEA 1CS0A 3T1HQ 3TQYA 1HQRD 3K80C 1OXTA 4K0KL 2EJFC 1ZETA 4LMQD 4FYDA 2C00A 2UU9L 1KL9A 1HNXQ 5FPOA 2DPIA 3GDEA 1HR0Q 3I3CA 4EEQA 3GIQA 3J80L 3CCSA 1S10A 4NXMH 1PHJA 2B2YC 1KDAA 5GADC 2W9BA 4JI7H 1DOKA 4FF3A 3J7A5 2JA5G 2CW8A 4AYBB 4JYAH 3J80c 4RHRA 1WCMA 5E7NA 4ED6A 1UWVA 1VQ4A 4YQWA 1KHIA 2DY7A 2YU9B 4B08A 4DU9A 2E2JB 1EYZA 1D8LA 4NLGA 4DAMA 1B53A 1KABA 2CQYA 3KOJA 2FK2A 4JI4H 1JX4A 1DGSA 1Q8IA 2KUMA 5EKKA 5HURA 4LF9Q 3RB6A 3KHLA 2EYLA 4TUYF 1CKNB 4KJNA 2IX3A 3JRXA 5DNFA 5HBRB 4QF4A 3E6ZX 2VZAA 4P2CB 4K8JA 1AN8A 1TQOA 4A3KB 2EYHA 1ET6A 1SR3A 3HEJA 3K57A 2GPWA 4F8MA 3C2PA 1VQNA 4B3MH 4IRKA 2VW9A 1L1OB 4EQ5A 4EBEA 1Q81C 2R8JA 5KEEA 4DV4Q 5IGDA 5M9OA 4DR1H 1XXGA 1BVSA 5C3WA 3KLSX 3DM3A 3RV4A 2K04A 4A3KG 4C2MH 4OELB 5JUMA 2AU0A 5C4HA 1VQMA 3SE0A 2O03A 2X6LA 2EYPA 4R8UA 1SMYC 2KJXA 2RHSB 1FNWA 1K9MC 3GTPB 1XNRL 1LUZA 1UE1A 5DM73 3GTOH 5CAEB 3M9MB 4YWKA 2PMZE 1VKZA 3T1YL 2CCZA 3R2IA 5DM63 1SNQA 4YY3H 4NXNQ 3N52A 1Q12A 1EWHA 2KCCA 2UXDH 2AHOB 3HZXA 3GIMA 1W93A 3NPPA 4A3CH 4ME3A 4HIKA 3M9OB
chains in the Genus database with same CATH topology
2KHIA 2QEXA 3CCRA 2I0QA 2UUBQ 4A3JH 4JI3Q 2N78A 4QIWE 4TQUS 1KD1C 1PH2A 4LF7L 2HHHQ 4LWCA 1Q82C 4DV2L 1I5FA 1L1OC 2UXBL 1A0IA 2LXKA 1SROA 4GLVB 3PO3G 4LF5L 4KHPL 5JJKA 3S1RH 1JJCB 4BBSH 1EWIA 4DV7Q 1HNWL 5JJIA 2MO0A 1K0RA 2UUAL 4DUZQ 4LNQA 2K52A 3S1QH 4GS3A 1NMFA 2I5HA 1VQ8A 1MIUA 1Q8KA 3CP0A 2YTXA 4LUVA 5AJ3Q 1IBLQ 3PSIA 4POFA 1ASZA 2GVBA 1X3EA 3F8TA 5GROA 1VQLA 1OXSC 2NVXH 4AIMA 4JI1L 2YTYA 1X3GA 3PCOB 4DUYQ 2Q2UA 1YNXA 3AFQA 1SE8A 1MJCA 4OO1G 4IFDG 2N49A 3PUZA 3U4ZA 2EQSA 1BBUA 1VS0A 2BH8A 5GAHC 2ZJRA 3CCLA 3NEMA 1VCIA 2Z6KA 3IRBA 1QVFA 5LMNW 2JA8G 5IYDG 1HZBA 1Y14B 1TWFH 2K5HA 1GVPA 4XTCS 1HNZQ 3NENA 4JI0Q 3I4NH 3F2BA 4X6AH 4KLKA 1VQOA 3HOUH 2R7FA 3CMEA 1C7YA 1X54A 4NB3A 3KJOA 5C4XG 4AQYQ 3I4MH 1B7YB 1UEBA 1J5EL 1NMGA 3TEHB 1XMQL 1LYLA 4X64Q 1YI2A 1GM5A 2MFIA 4LF8Q 1XNQQ 2R7ZG 3PO2G 2KBNA 1PH1A 4HIDA 4POGA 5C3EG 3GTJH 3L2PA 1GO3E 2ZJQA 2NVTH 4BXXH 3STBC 2H5XA 5C44H 3CCEA 3T1YQ 3GTGH 1X6OA 1V43A 1SFOH 3UDFA 4JI8L 2B63H 1W3SA 4A3DG 4PZ7A 5IP9H 2N3SA 1JT8A 1E7ZA 1HZCA 2ZJPA 3H3VI 4LFBL 4BY7H 4GKJQ 5HGQA 1YJNA 4A3GH 4UP7A 4A3LG 1NTGA 3CCJA 4GN4B 3HKZE 4JI7Q 1CKNA 2WFWA 1L2FA 4DR7L 1YITA 3KLWA 1S40A 3TREA 2ZTCA 3BZKA 2RHQB 4JYAQ 3FP9A 2E5LL 3D31A 3EIVA 1X65A 4P71A 3RLFA 2IT1A 4LF4L 4AYBG 5LMNL 2R7DA 2IX0A 4KHPQ 1G51A 4DK6C 1N33Q 4BBRG 1E3PA 1XMOQ 3AFPA 3PF4A 3S2DH 1RL2A 4JI4Q 3PO3H 2GVAA 3I4OA 2WP8J 3PGZA 3G4SA 3TS2A 2UXCL 1WFQA 2Z6KC 4X62L 2K14A 1OXUA 2LSSA 4DR5Q 1CKMA 2VQFL 4OX9Q 1PVOA 1HR0W 3ULJA 1CKOA 1QVCA 1MJEA 3A74A 1B8AA 3JAMc 2R93H 1PH6A 2HIVA 3KFUA 1EIFA 1VQEA 3TS0A 1FGUA 4IPDA 5BR8Q 4GKKL 4TVAB 1AE2A 4DV1L 4DR6L 3S14H 4GOPB 1M1KC 2GN5A 3AYHB 5IY0A 3J81j 1KRTA 4B3MQ 4A3IH 3HOWH 3KYHC 1XPOA 2JA8H 1CSPA 3FKIG 4EX5A 1YIJA 5IYDH 4GLXA 2I5MX 1VQFA 3G48A 1KXLA 1YHBA 3L7ZC 1VQGA 2JE6I 4R4CA 3JAMi 2K5NA 3GTKH 2V1CC 4K0KQ 1PH3A 1N32L 3CXCA 1Q7YC 1N34Q 1TWGH 2EXDA 4DR1Q 1XJVA 2E2IH 3S17H 1JJGA 5C4XH 1PH8A 2UU9Q 4KI0A 1Y1WG 2UUCQ 5LMUL 4C3JH 3G71A 1Q86C 1EQRA 3PF5A 4B3TL 1I94Q 1CUKA 1KRSA 1VQ6A 3PO2H 1TWAH 5C3EH 4DKAC 4L5SA 1I6HH 1SMXA 4QQBX 1KQSA 5HY6A 3BU2A 4A3EG 3CC2A 1YBYA 3T1HL 3RLOA 2F4VL 3GTQH 2OWOA 3S1NH 3RR5A 1P8LA 4LFBQ 2D0OA 3FHWA 3E0EA 1XTDA 1E1OA 4R4QA 4OO1I 1HNXL 4IFDI 4JV5L 1P16A 3OTOQ 1HR0L 4YY3Q 5M5WH 2UXDQ 1S72A 2AKWB 3UE1A 2E5LQ 3KJPA 3CMAA 5M5XH 3PUXA 1IXRA 3UDXA 2ATWA 4PG3A 5M3MG 1IBKQ 4HJ7A 2PI2A 2JA7G 1R9TH 1JJ2A 4LFCQ 5IYCH 4DV0Q 1KAWA 1XPUA 5JEAG 2AMCB 4BBRH 1HZAA 3KDFA 4YHHQ 3F2DA 2IX1A 4GNXA 3CCUA 4X62Q 2YU9H 2E2JH 1OTCA 4J15A 1O7IA 2N8NA 1WCMH 2JA6G 4LF9L 3HOZG 2K75A 1NY4A 1GD7A 3KDFB 4QL5A 4JI2L 4GNXB 3PV0A 1YJ9A 4LF6Q 3S16H 2F52A 4WJ3M 2CWPA 4JI5Q 4GKKQ 2YV5A 1N8RC 1FJGL 5M3FG 5K36G 3LGJA 4IJHA 1IBML 3CF5A 2OQKA 5C0XJ 2NVQH 2CQOA 4DR3L 4A3BG 1G6PA 1AE3A 1QUQA 5EAYA 4DR4L 3E9HA 1HZ9A 4GN3B 1E1TA 4UPAA 4LUZA 2JEBI 1N36L 4PMWA 1LM0A 4DV3L 4P72A 4A3KH 2Q2IA 4RMFA 4OWXB 1VQJA 3FKIH 1PH5A 1N32Q 3H0GG 2Q2HA 3HKSA 1QUQB 1SLJA 3HOVG 1XNRQ 2IY5B 1YHQA 5LMUQ 1BBWA 1EUJA 4DV4L 4JG2A 2OTLA 1I50H 1PH9A 2Y0SE 1Y1WH 4X66Q 4DV6L 1UE7A 3K81C 4DR2L 4B3SL 2VY3A 2WB1G 4AYBE 3PUYA 1EFWA 1VQ9A 4LFAQ 1EQQA 3ER0A 4JI6L 1VQIA 2FXQA 5M5YH 1UE5A 5J3BA 1N9WA 4JC0A 5C0XI 1K8GA 3STBD 4DV5Q 2VNUD 4B3RL 1X9NA 4IOCA 2OQ0A 4UP9A 4BA1I 4BY1G 4O0AA 3AQQA 1KIXA 3GTPH 4LF7Q 3UDIA 2Y0SG 4DV2Q 3K7AH 2UXBQ 4GNXC 3RNUA 4NXNL 4LF5Q 4A93G 2KCMA 3NBHB 2C35B 3F2CA 3RN2A 4LW1A 4JBMA 1HNWQ 2UUAQ 4A3MG 4A3JG 2HQLA 2K4KA 2NN6G 2ZM6L 3UDGA 4R4OA 5IE8A 1V1QA 5M3MH 2DGYA 3J81c 3BJUA 2UUBL 2NZOA 2D0PA 3M9BA 4JI3L 2JA7H 3HOWG 5IWAL 1IZ6A 3Q8DA 4IPHA 4YCWA 1E24A 4GOPA 1E22A 4JI1Q 1VQPA 2HHHL 1IL2A 3S15H 3K8AA 1U5KA 1RIPA 4MTNA 3M85A 1WI5A 2JA9A 3J80i 3HOXG 3EN2A 3NELA 4DR6Q 2R6GA 4PZ6A 4GN5A 4DV7L 2JA6H 2AWOA 2VQEL 3HOZH 3JC66 4QJFA 1PYBA 4DUZL 4APVA 1X55A 3J81i 2JJQA 3PIPA 2E8GA 4R4TA 3GTMH 1A62A 5IP7G 5M3FH 3S1MH 1IBLL 4IFDJ 5AJ3L 3ICEA 4P75A 4L5QA 2MO1A 5ELOA 3HFZB 2DUDA 3VDYA 1C9OA 1J5EQ 3K7UC 4A3BH 2I5LX 4IPGA 4DUYL 1XMQQ 1ASYA 1N33L 1S3OA 2KHJA 1WJJA 1C0AA 4YCVA 1VQKA 3MXNB 2QA4A 5H1SE 2QGQA 3DLLA 4R1JA 2F3IA 2R7ZH 1Y1VG 3H0GH 4JCVE 1TXYA 3RN5A 2RF4A 1WOCA 3CPWA 4P73A 1PYSB 4HJ8A 1EIYB 4JI0L 1D7QA 4DV6Q 3I4MG 1QZHA 4JBWA 1PH4A 4JI8Q 1EYGA 1Z9FA 4UY8C 2KCTA 4OXPA 3I56A 3I7FA 4A3DH 3MEFA 1U0LA 4X64L 4LF8L 2A1AA 4BXXG 3EBEA 3AEVA 1J6QA 1X56A 4DR7Q 4B3RQ 4RG1A 2IHFA 3G6EA 4HIOA 4A3LH 1OXVA 1FL0A 2ES2A 1LTLA 1HH2P 2B63G 5JJLA 1BKBA 1GKHA 2CFMA 5IP9G 4BY1H 1KC8C 4LF4Q 3TRZA 3WWVA 3PUVA 2HT1A 4BY7G 4HJ5A 3OW2A 1PV4A 5LMNQ 2OTJA 1PA6A 4A3GG 1I3QH 2WAQG 5GAGC 4GOPC 4OONA 5FLMG 1T9HA 1NE3A 2NZHA 3F1ZA 4GKJL 4DPGA 4A93H 4NXML 4JI7L 4DNIA 4A76A 3GO5A 4YWMA 4LUOA 3GD7A 1NBWA 1PH7A 2UXCQ 1FVIA 2PI2E 4A3MH 3U4VA 2VQFQ 5IWAQ 2ASBA 4JYAL 4FDBA 4YCUA 3J7ZC 2LXJA 4WJ4A 3ULPA 1VQ7A 4H02A 1SRUA 3CPFA 5IYBG 3ERSX 5FJ8G 2PQAA 3KF6A 4IJLA 4DV1Q 1G291 4UP8A 1PFSA 3HOXH 3CCVA 2MQHA 5ELNA 2VQEQ 3CC7A 1VQDA 1XMOL 2WB1E 2Q2TA 1V9PA 4QGUA 2ID0A 1QVGA 2BA1A 4JI4L 2JEAI 2R92G 4IOAA 3BZCA 2VUMG 2B29A 3M4OH 1H95A 2PQAB 3KF6B 4DR5L 4OWTB 2R93G 2ZTDA 4OX9L 2K5VA 2CWAA 2BH2A 2XGTA 1UE6A 3M3YH 1K8AC 3A5ZB 5IP7H 1K73C 1SN8A 4A3FG 2E2HH 3D0FA 1Z47A 5BR8L 1NJIC 3B6YA 3A5UA 3H3VH 4A3IG 4GLAC 4B3TQ 2JK8A 4ALPA 4Y7NH 2NN6I 3HOYG 3A0JA 2L15A 4X65L 2NVYH 4B3ML 2YYZA 3H15A 1OXXK 1Q1BA 1XPRA 4BA2I 1Y1VH 1CSQA 1VQAA 1YZ6A 4JOIA 3L0OA 2A8VA 3W5OA 2Z0SA 3PIOA 3T1HQ 3TQYA 1EOVA 3K80C 1OXTA 3E9IA 2F4VQ 2ZTEA 4K0KL 1WYDA 3RLNA 4A4IA 1N34L 5FLXc 4L5TA 4DR1L 4A3EH 2MNAA 3CQZH 3S2HH 2UU9L 1KL9A 3M4QA 1HNXQ 2UUCL 4R4IA 4DAYB 1M90C 3GDEA 1HR0Q 4JV5Q 4JBJA 4C3HH 4Y52H 1QZGA 4DK3C 3CCSA 3I55A 1TWCH 1I94L 1PHJA 5GQOA 3PUWA 5GADC 1VQBA 3J7A5 3ULLA 4A3CG 2JA5G 4KHZA 4XIGS 3J80c 3CD6A 5E7NA 1UWVA 3I2ZA 1VQ4A 4YWLA 4HIMA 1KHIA 1YJWA 1D8LA 4NXMQ 3UE0A 4AH6A 3W1GA 4DAMA 5FLMH 3OTOL 4YY3L 1X3FA 3KOJA 4QY7A 3CC4A 2UXDL 1DGSA 4OWWB 2ALYB 2PNHA 4IPCA 4BBSG 4LF9Q 3CW2C 1CKNB 2D62A 1L0WA 4JI2Q 5JEAJ 1VQHA 1K3RA 5IYCG 3CCQA 3RZOH 3CCMA 1IBKL 4A75A 1FJGQ 1JB7A 2VZAA 3GTLH 4LFCL 5IYBH 1IBMQ 4DV0L 1AH9A 5DLQE 1IYJB 2VL6A 5FJ8H 1VQCA 1L1OA 3SGIA 4DR3Q 3HOVH 4HJ9A 1K83H 1WCMG 3HKZG 2AWNA 4YHHL 4DR4Q 2YTVA 1SR3A 2B3GA 2VS1A 2R92H 1N36Q 4DV3Q 1Q46A 5IT9c 1JMCA 1VQNA 1JE5A 1TWHH 5GAEC 2VUMH 2VW9A 5C0XG 1HJPA 1B70B 1L1OB 2HIXA 4EQ5A 3I4NG 4JOIC 3U58A 1Q1EA 1Q81C 4LF6L 4MZ9A 3HOUG 4JI5L 4DV4Q 4A3FH 1A8VA 1BVSA 1HNZL 1VQ5A 1W2BA 3DM3A 3U50C 1YHAA 3KF8B 4DR2Q 4B3SQ 2KENA 4X65Q 3K0XA 3OYYA 4A3KG 4C2MH 2WAQE 3S24A 1VQMA 4AQYL 4JI6Q 3HOYH 2RHSB 2K50A 4MNOA 5C4JH 1K9MC 4P74A 1XNQL 3ZJYC 5C44G 3M7NA 1XNRL 2CKZB 2IHEA 2XTIA 1LUZA 1UE1A 4IO9A 3GTOH 4O2DA 1YEZA 4YWKA 2PMZE 2EIFA 2RCNA 4PZ8A 3T1YL 3W1BA 1MKHA 4X66L 2BA0A 2CCZA 1A63A 4LFAL 4HJAA 4NXNQ 1Q12A 4NPSA 2OCEA 1YVCA 2A19A 3RZDH 4L5RC 3CAMA 2AHOB 4C3IH 4A3CH 4ME3A 3M4PA 2JA5H 4JBKA 2ZM6Q 4DV5L 4HIKA 2JQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHI A;  2QEX A;  3CCR A;  2I0Q A;  2UUB Q;  4A3J H;  4JI3 Q;  2N78 A;  4QIW E;  4TQU S;  1KD1 C;  1PH2 A;  4LF7 L;  2HHH Q;  4LWC A;  1Q82 C;  4DV2 L;  1I5F A;  1L1O C;  2UXB L;  1A0I A;  2LXK A;  1SRO A;  4GLV B;  3PO3 G;  4LF5 L;  4KHP L;  5JJK A;  3S1R H;  1JJC B;  4BBS H;  1EWI A;  4DV7 Q;  1HNW L;  5JJI A;  2MO0 A;  1K0R A;  2UUA L;  4DUZ Q;  4LNQ A;  2K52 A;  3S1Q H;  4GS3 A;  1NMF A;  2I5H A;  1VQ8 A;  1MIU A;  1Q8K A;  3CP0 A;  2YTX A;  4LUV A;  5AJ3 Q;  1IBL Q;  3PSI A;  4POF A;  1ASZ A;  2GVB A;  1X3E A;  3F8T A;  5GRO A;  1VQL A;  1OXS C;  2NVX H;  4AIM A;  4JI1 L;  2YTY A;  1X3G A;  3PCO B;  4DUY Q;  2Q2U A;  1YNX A;  3AFQ A;  1SE8 A;  1MJC A;  4OO1 G;  4IFD G;  2N49 A;  3PUZ A;  3U4Z A;  2EQS A;  1BBU A;  1VS0 A;  2BH8 A;  5GAH C;  2ZJR A;  3CCL A;  3NEM A;  1VCI A;  2Z6K A;  3IRB A;  1QVF A;  5LMN W;  2JA8 G;  5IYD G;  1HZB A;  1Y14 B;  1TWF H;  2K5H A;  1GVP A;  4XTC S;  1HNZ Q;  3NEN A;  4JI0 Q;  3I4N H;  3F2B A;  4X6A H;  4KLK A;  1VQO A;  3HOU H;  2R7F A;  3CME A;  1C7Y A;  1X54 A;  4NB3 A;  3KJO A;  5C4X G;  4AQY Q;  3I4M H;  1B7Y B;  1UEB A;  1J5E L;  1NMG A;  3TEH B;  1XMQ L;  1LYL A;  4X64 Q;  1YI2 A;  1GM5 A;  2MFI A;  4LF8 Q;  1XNQ Q;  2R7Z G;  3PO2 G;  2KBN A;  1PH1 A;  4HID A;  4POG A;  5C3E G;  3GTJ H;  3L2P A;  1GO3 E;  2ZJQ A;  2NVT H;  4BXX H;  3STB C;  2H5X A;  5C44 H;  3CCE A;  3T1Y Q;  3GTG H;  1X6O A;  1V43 A;  1SFO H;  3UDF A;  4JI8 L;  2B63 H;  1W3S A;  4A3D G;  4PZ7 A;  5IP9 H;  2N3S A;  1JT8 A;  1E7Z A;  1HZC A;  2ZJP A;  3H3V I;  4LFB L;  4BY7 H;  4GKJ Q;  5HGQ A;  1YJN A;  4A3G H;  4UP7 A;  4A3L G;  1NTG A;  3CCJ A;  4GN4 B;  3HKZ E;  4JI7 Q;  1CKN A;  2WFW A;  1L2F A;  4DR7 L;  1YIT A;  3KLW A;  1S40 A;  3TRE A;  2ZTC A;  3BZK A;  2RHQ B;  4JYA Q;  3FP9 A;  2E5L L;  3D31 A;  3EIV A;  1X65 A;  4P71 A;  3RLF A;  2IT1 A;  4LF4 L;  4AYB G;  5LMN L;  2R7D A;  2IX0 A;  4KHP Q;  1G51 A;  4DK6 C;  1N33 Q;  4BBR G;  1E3P A;  1XMO Q;  3AFP A;  3PF4 A;  3S2D H;  1RL2 A;  4JI4 Q;  3PO3 H;  2GVA A;  3I4O A;  2WP8 J;  3PGZ A;  3G4S A;  3TS2 A;  2UXC L;  1WFQ A;  2Z6K C;  4X62 L;  2K14 A;  1OXU A;  2LSS A;  4DR5 Q;  1CKM A;  2VQF L;  4OX9 Q;  1PVO A;  1HR0 W;  3ULJ A;  1CKO A;  1QVC A;  1MJE A;  3A74 A;  1B8A A;  3JAM c;  2R93 H;  1PH6 A;  2HIV A;  3KFU A;  1EIF A;  1VQE A;  3TS0 A;  1FGU A;  4IPD A;  5BR8 Q;  4GKK L;  4TVA B;  1AE2 A;  4DV1 L;  4DR6 L;  3S14 H;  4GOP B;  1M1K C;  2GN5 A;  3AYH B;  5IY0 A;  3J81 j;  1KRT A;  4B3M Q;  4A3I H;  3HOW H;  3KYH C;  1XPO A;  2JA8 H;  1CSP A;  3FKI G;  4EX5 A;  1YIJ A;  5IYD H;  4GLX A;  2I5M X;  1VQF A;  3G48 A;  1KXL A;  1YHB A;  3L7Z C;  1VQG A;  2JE6 I;  4R4C A;  3JAM i;  2K5N A;  3GTK H;  2V1C C;  4K0K Q;  1PH3 A;  1N32 L;  3CXC A;  1Q7Y C;  1N34 Q;  1TWG H;  2EXD A;  4DR1 Q;  1XJV A;  2E2I H;  3S17 H;  1JJG A;  5C4X H;  1PH8 A;  2UU9 Q;  4KI0 A;  1Y1W G;  2UUC Q;  5LMU L;  4C3J H;  3G71 A;  1Q86 C;  1EQR A;  3PF5 A;  4B3T L;  1I94 Q;  1CUK A;  1KRS A;  1VQ6 A;  3PO2 H;  1TWA H;  5C3E H;  4DKA C;  4L5S A;  1I6H H;  1SMX A;  4QQB X;  1KQS A;  5HY6 A;  3BU2 A;  4A3E G;  3CC2 A;  1YBY A;  3T1H L;  3RLO A;  2F4V L;  3GTQ H;  2OWO A;  3S1N H;  3RR5 A;  1P8L A;  4LFB Q;  2D0O A;  3FHW A;  3E0E A;  1XTD A;  1E1O A;  4R4Q A;  4OO1 I;  1HNX L;  4IFD I;  4JV5 L;  1P16 A;  3OTO Q;  1HR0 L;  4YY3 Q;  5M5W H;  2UXD Q;  1S72 A;  2AKW B;  3UE1 A;  2E5L Q;  3KJP A;  3CMA A;  5M5X H;  3PUX A;  1IXR A;  3UDX A;  2ATW A;  4PG3 A;  5M3M G;  1IBK Q;  4HJ7 A;  2PI2 A;  2JA7 G;  1R9T H;  1JJ2 A;  4LFC Q;  5IYC H;  4DV0 Q;  1KAW A;  1XPU A;  5JEA G;  2AMC B;  4BBR H;  1HZA A;  3KDF A;  4YHH Q;  3F2D A;  2IX1 A;  4GNX A;  3CCU A;  4X62 Q;  2YU9 H;  2E2J H;  1OTC A;  4J15 A;  1O7I A;  2N8N A;  1WCM H;  2JA6 G;  4LF9 L;  3HOZ G;  2K75 A;  1NY4 A;  1GD7 A;  3KDF B;  4QL5 A;  4JI2 L;  4GNX B;  3PV0 A;  1YJ9 A;  4LF6 Q;  3S16 H;  2F52 A;  4WJ3 M;  2CWP A;  4JI5 Q;  4GKK Q;  2YV5 A;  1N8R C;  1FJG L;  5M3F G;  5K36 G;  3LGJ A;  4IJH A;  1IBM L;  3CF5 A;  2OQK A;  5C0X J;  2NVQ H;  2CQO A;  4DR3 L;  4A3B G;  1G6P A;  1AE3 A;  1QUQ A;  5EAY A;  4DR4 L;  3E9H A;  1HZ9 A;  4GN3 B;  1E1T A;  4UPA A;  4LUZ A;  2JEB I;  1N36 L;  4PMW A;  1LM0 A;  4DV3 L;  4P72 A;  4A3K H;  2Q2I A;  4RMF A;  4OWX B;  1VQJ A;  3FKI H;  1PH5 A;  1N32 Q;  3H0G G;  2Q2H A;  3HKS A;  1QUQ B;  1SLJ A;  3HOV G;  1XNR Q;  2IY5 B;  1YHQ A;  5LMU Q;  1BBW A;  1EUJ A;  4DV4 L;  4JG2 A;  2OTL A;  1I50 H;  1PH9 A;  2Y0S E;  1Y1W H;  4X66 Q;  4DV6 L;  1UE7 A;  3K81 C;  4DR2 L;  4B3S L;  2VY3 A;  2WB1 G;  4AYB E;  3PUY A;  1EFW A;  1VQ9 A;  4LFA Q;  1EQQ A;  3ER0 A;  4JI6 L;  1VQI A;  2FXQ A;  5M5Y H;  1UE5 A;  5J3B A;  1N9W A;  4JC0 A;  5C0X I;  1K8G A;  3STB D;  4DV5 Q;  2VNU D;  4B3R L;  1X9N A;  4IOC A;  2OQ0 A;  4UP9 A;  4BA1 I;  4BY1 G;  4O0A A;  3AQQ A;  1KIX A;  3GTP H;  4LF7 Q;  3UDI A;  2Y0S G;  4DV2 Q;  3K7A H;  2UXB Q;  4GNX C;  3RNU A;  4NXN L;  4LF5 Q;  4A93 G;  2KCM A;  3NBH B;  2C35 B;  3F2C A;  3RN2 A;  4LW1 A;  4JBM A;  1HNW Q;  2UUA Q;  4A3M G;  4A3J G;  2HQL A;  2K4K A;  2NN6 G;  2ZM6 L;  3UDG A;  4R4O A;  5IE8 A;  1V1Q A;  5M3M H;  2DGY A;  3J81 c;  3BJU A;  2UUB L;  2NZO A;  2D0P A;  3M9B A;  4JI3 L;  2JA7 H;  3HOW G;  5IWA L;  1IZ6 A;  3Q8D A;  4IPH A;  4YCW A;  1E24 A;  4GOP A;  1E22 A;  4JI1 Q;  1VQP A;  2HHH L;  1IL2 A;  3S15 H;  3K8A A;  1U5K A;  1RIP A;  4MTN A;  3M85 A;  1WI5 A;  2JA9 A;  3J80 i;  3HOX G;  3EN2 A;  3NEL A;  4DR6 Q;  2R6G A;  4PZ6 A;  4GN5 A;  4DV7 L;  2JA6 H;  2AWO A;  2VQE L;  3HOZ H;  3JC6 6;  4QJF A;  1PYB A;  4DUZ L;  4APV A;  1X55 A;  3J81 i;  2JJQ A;  3PIP A;  2E8G A;  4R4T A;  3GTM H;  1A62 A;  5IP7 G;  5M3F H;  3S1M H;  1IBL L;  4IFD J;  5AJ3 L;  3ICE A;  4P75 A;  4L5Q A;  2MO1 A;  5ELO A;  3HFZ B;  2DUD A;  3VDY A;  1C9O A;  1J5E Q;  3K7U C;  4A3B H;  2I5L X;  4IPG A;  4DUY L;  1XMQ Q;  1ASY A;  1N33 L;  1S3O A;  2KHJ A;  1WJJ A;  1C0A A;  4YCV A;  1VQK A;  3MXN B;  2QA4 A;  5H1S E;  2QGQ A;  3DLL A;  4R1J A;  2F3I A;  2R7Z H;  1Y1V G;  3H0G H;  4JCV E;  1TXY A;  3RN5 A;  2RF4 A;  1WOC A;  3CPW A;  4P73 A;  1PYS B;  4HJ8 A;  1EIY B;  4JI0 L;  1D7Q A;  4DV6 Q;  3I4M G;  1QZH A;  4JBW A;  1PH4 A;  4JI8 Q;  1EYG A;  1Z9F A;  4UY8 C;  2KCT A;  4OXP A;  3I56 A;  3I7F A;  4A3D H;  3MEF A;  1U0L A;  4X64 L;  4LF8 L;  2A1A A;  4BXX G;  3EBE A;  3AEV A;  1J6Q A;  1X56 A;  4DR7 Q;  4B3R Q;  4RG1 A;  2IHF A;  3G6E A;  4HIO A;  4A3L H;  1OXV A;  1FL0 A;  2ES2 A;  1LTL A;  1HH2 P;  2B63 G;  5JJL A;  1BKB A;  1GKH A;  2CFM A;  5IP9 G;  4BY1 H;  1KC8 C;  4LF4 Q;  3TRZ A;  3WWV A;  3PUV A;  2HT1 A;  4BY7 G;  4HJ5 A;  3OW2 A;  1PV4 A;  5LMN Q;  2OTJ A;  1PA6 A;  4A3G G;  1I3Q H;  2WAQ G;  5GAG C;  4GOP C;  4OON A;  5FLM G;  1T9H A;  1NE3 A;  2NZH A;  3F1Z A;  4GKJ L;  4DPG A;  4A93 H;  4NXM L;  4JI7 L;  4DNI A;  4A76 A;  3GO5 A;  4YWM A;  4LUO A;  3GD7 A;  1NBW A;  1PH7 A;  2UXC Q;  1FVI A;  2PI2 E;  4A3M H;  3U4V A;  2VQF Q;  5IWA Q;  2ASB A;  4JYA L;  4FDB A;  4YCU A;  3J7Z C;  2LXJ A;  4WJ4 A;  3ULP A;  1VQ7 A;  4H02 A;  1SRU A;  3CPF A;  5IYB G;  3ERS X;  5FJ8 G;  2PQA A;  3KF6 A;  4IJL A;  4DV1 Q;  1G29 1;  4UP8 A;  1PFS A;  3HOX H;  3CCV A;  2MQH A;  5ELN A;  2VQE Q;  3CC7 A;  1VQD A;  1XMO L;  2WB1 E;  2Q2T A;  1V9P A;  4QGU A;  2ID0 A;  1QVG A;  2BA1 A;  4JI4 L;  2JEA I;  2R92 G;  4IOA A;  3BZC A;  2VUM G;  2B29 A;  3M4O H;  1H95 A;  2PQA B;  3KF6 B;  4DR5 L;  4OWT B;  2R93 G;  2ZTD A;  4OX9 L;  2K5V A;  2CWA A;  2BH2 A;  2XGT A;  1UE6 A;  3M3Y H;  1K8A C;  3A5Z B;  5IP7 H;  1K73 C;  1SN8 A;  4A3F G;  2E2H H;  3D0F A;  1Z47 A;  5BR8 L;  1NJI C;  3B6Y A;  3A5U A;  3H3V H;  4A3I G;  4GLA C;  4B3T Q;  2JK8 A;  4ALP A;  4Y7N H;  2NN6 I;  3HOY G;  3A0J A;  2L15 A;  4X65 L;  2NVY H;  4B3M L;  2YYZ A;  3H15 A;  1OXX K;  1Q1B A;  1XPR A;  4BA2 I;  1Y1V H;  1CSQ A;  1VQA A;  1YZ6 A;  4JOI A;  3L0O A;  2A8V A;  3W5O A;  2Z0S A;  3PIO A;  3T1H Q;  3TQY A;  1EOV A;  3K80 C;  1OXT A;  3E9I A;  2F4V Q;  2ZTE A;  4K0K L;  1WYD A;  3RLN A;  4A4I A;  1N34 L;  5FLX c;  4L5T A;  4DR1 L;  4A3E H;  2MNA A;  3CQZ H;  3S2H H;  2UU9 L;  1KL9 A;  3M4Q A;  1HNX Q;  2UUC L;  4R4I A;  4DAY B;  1M90 C;  3GDE A;  1HR0 Q;  4JV5 Q;  4JBJ A;  4C3H H;  4Y52 H;  1QZG A;  4DK3 C;  3CCS A;  3I55 A;  1TWC H;  1I94 L;  1PHJ A;  5GQO A;  3PUW A;  5GAD C;  1VQB A;  3J7A 5;  3ULL A;  4A3C G;  2JA5 G;  4KHZ A;  4XIG S;  3J80 c;  3CD6 A;  5E7N A;  1UWV A;  3I2Z A;  1VQ4 A;  4YWL A;  4HIM A;  1KHI A;  1YJW A;  1D8L A;  4NXM Q;  3UE0 A;  4AH6 A;  3W1G A;  4DAM A;  5FLM H;  3OTO L;  4YY3 L;  1X3F A;  3KOJ A;  4QY7 A;  3CC4 A;  2UXD L;  1DGS A;  4OWW B;  2ALY B;  2PNH A;  4IPC A;  4BBS G;  4LF9 Q;  3CW2 C;  1CKN B;  2D62 A;  1L0W A;  4JI2 Q;  5JEA J;  1VQH A;  1K3R A;  5IYC G;  3CCQ A;  3RZO H;  3CCM A;  1IBK L;  4A75 A;  1FJG Q;  1JB7 A;  2VZA A;  3GTL H;  4LFC L;  5IYB H;  1IBM Q;  4DV0 L;  1AH9 A;  5DLQ E;  1IYJ B;  2VL6 A;  5FJ8 H;  1VQC A;  1L1O A;  3SGI A;  4DR3 Q;  3HOV H;  4HJ9 A;  1K83 H;  1WCM G;  3HKZ G;  2AWN A;  4YHH L;  4DR4 Q;  2YTV A;  1SR3 A;  2B3G A;  2VS1 A;  2R92 H;  1N36 Q;  4DV3 Q;  1Q46 A;  5IT9 c;  1JMC A;  1VQN A;  1JE5 A;  1TWH H;  5GAE C;  2VUM H;  2VW9 A;  5C0X G;  1HJP A;  1B70 B;  1L1O B;  2HIX A;  4EQ5 A;  3I4N G;  4JOI C;  3U58 A;  1Q1E A;  1Q81 C;  4LF6 L;  4MZ9 A;  3HOU G;  4JI5 L;  4DV4 Q;  4A3F H;  1A8V A;  1BVS A;  1HNZ L;  1VQ5 A;  1W2B A;  3DM3 A;  3U50 C;  1YHA A;  3KF8 B;  4DR2 Q;  4B3S Q;  2KEN A;  4X65 Q;  3K0X A;  3OYY A;  4A3K G;  4C2M H;  2WAQ E;  3S24 A;  1VQM A;  4AQY L;  4JI6 Q;  3HOY H;  2RHS B;  2K50 A;  4MNO A;  5C4J H;  1K9M C;  4P74 A;  1XNQ L;  3ZJY C;  5C44 G;  3M7N A;  1XNR L;  2CKZ B;  2IHE A;  2XTI A;  1LUZ A;  1UE1 A;  4IO9 A;  3GTO H;  4O2D A;  1YEZ A;  4YWK A;  2PMZ E;  2EIF A;  2RCN A;  4PZ8 A;  3T1Y L;  3W1B A;  1MKH A;  4X66 L;  2BA0 A;  2CCZ A;  1A63 A;  4LFA L;  4HJA A;  4NXN Q;  1Q12 A;  4NPS A;  2OCE A;  1YVC A;  2A19 A;  3RZD H;  4L5R C;  3CAM A;  2AHO B;  4C3I H;  4A3C H;  4ME3 A;  3M4P A;  2JA5 H;  4JBK A;  2ZM6 Q;  4DV5 L;  4HIK A;  2JQO A; 
#chains in the Genus database with same CATH topology
 2KHI A;  3SK4 A;  2QEX A;  2I0Q A;  2UUB Q;  1QWY A;  4DAV A;  1A3U A;  4LFC H;  1I4X A;  2F0O A;  4DV0 H;  4J9L A;  4R7R A;  4XYQ A;  1L1O C;  3H91 A;  3WO0 A;  3HOZ B;  2A6E C;  4RU9 A;  2J4X A;  5T1G A;  3ZYY X;  4BBS H;  1SDF A;  4DV7 Q;  1HNW L;  1PZK D;  1SYE A;  3P20 A;  4N9P A;  2LKV A;  1F2Y A;  4HMJ A;  1T3N A;  4LNQ A;  4ZI7 F;  4I50 F;  2R84 A;  4UCT A;  1PTO H;  5BPF A;  2C2D A;  5D65 A;  2K52 A;  4LF6 H;  4GS3 A;  1VQ8 A;  1MIU A;  1GUS A;  1BF4 A;  2YW2 A;  4Y8V B;  4FP5 D;  4POF A;  2NVX H;  1JOO A;  2F0U A;  4RUC A;  2FPI B;  3CKI B;  3PCO B;  1Z2N X;  1LLR D;  1SE8 A;  2KA7 A;  3A8J E;  1MJC A;  3WDN A;  4OO1 G;  4AQY H;  4K2L A;  2EQS A;  2F4I A;  3CCL A;  4DR6 L;  1HRJ A;  1QVF A;  3FMC A;  5C0X H;  1N32 H;  1XNQ H;  3S9W A;  4XTC S;  1HNZ Q;  4JI0 Q;  1TS5 A;  4NDX A;  4TQR A;  1JIC A;  2NTT A;  4RZR A;  3QR8 A;  1O7L A;  1PZI D;  3KJO A;  4A3D B;  4X66 H;  1J5E L;  1NMG A;  2FFK B;  2EY1 A;  4C3J G;  3QFF A;  1XMQ L;  5DG7 A;  2MFI A;  3TME A;  4J8Q A;  2KBN A;  1PH1 A;  2NWG A;  4ABN A;  4IR1 A;  4AYB A;  5DQI A;  4BS9 A;  4DV5 H;  3CCE A;  2H5X A;  2MP1 A;  5FOB B;  3BVG A;  1HTL D;  1X3Q A;  1O7Y A;  1TVX A;  5IOD A;  2OXP A;  4A3D G;  3HG9 A;  4EQN A;  2N3S A;  1HZC A;  1TS3 A;  1YJN A;  1GSO A;  1BXT A;  3CCJ A;  1H9J A;  3O13 A;  2RDI A;  3HKZ E;  4JI7 Q;  2JP1 A;  5KND A;  1CKN A;  4LF5 H;  2WFW A;  1YIT A;  1BUV T;  1S40 A;  3TRE A;  3WO1 A;  1CFM A;  1DXM A;  3RIZ A;  2RHQ B;  4JYA Q;  3OSP A;  5KG0 A;  2E5L L;  3MXP A;  3RLF A;  2FK1 A;  2IJ0 A;  4Q0F A;  2WAC A;  1G51 A;  4M1U B;  4JI1 H;  3Q8P B;  3AFP A;  5J22 A;  1HQM C;  3S2D H;  3LWE A;  1RL2 A;  4JI4 Q;  4DLK A;  1PFN A;  2EXZ A;  2WP8 J;  1MBY A;  1ZKO A;  1SE4 A;  3PGZ A;  5COR A;  1A3T A;  5E4X A;  2B2V A;  2CHB D;  2LSS A;  2XD4 A;  5FO9 B;  1PVO A;  2E2H B;  3ULJ A;  5KFL A;  3R5X A;  1PH6 A;  2HIV A;  2F0K A;  2FKL A;  2R85 A;  3TS0 A;  2DJF C;  5KFX A;  3MA2 B;  4IPD A;  2F0N A;  3NQT A;  2HGS A;  4DV1 L;  1RF2 D;  3AYH B;  2D2C C;  5JPM C;  5CGK A;  4B3M Q;  4A3I H;  3KYH C;  1CSP A;  2V58 A;  3OUZ A;  4HQ6 A;  3GTP A;  2G5D A;  1KXL A;  2I5M X;  3L7Z C;  1I6H H;  3GTK H;  4R4C A;  3JAM i;  3PIP 3;  2BDN A;  2A74 C;  3VPC A;  4DV6 H;  1PH3 A;  5KG5 A;  1Q7Y C;  2E2I H;  1TWG H;  2AQ1 B;  3ERQ A;  3BDL A;  4DR1 Q;  3S17 H;  1JJG A;  1EWC A;  2F0W A;  2H4O A;  1HFN A;  2VPS A;  4IUT A;  2W6O A;  2CH4 A;  1EQR A;  1XDN A;  2B2W C;  1V4Y A;  2NYZ D;  4B3R H;  1EY6 A;  1SMX A;  4QQB X;  5HY6 A;  4I7Z C;  1EZ6 A;  2V9W A;  3GIP A;  3J7A K;  3RLO A;  1B04 A;  1ZXT A;  4LF4 H;  1CHQ D;  3E5N A;  2EYF A;  3E0E A;  1LO5 D;  1XTD A;  5CA0 F;  3MVV A;  1E1O A;  1KLG D;  4IFD I;  2B2T A;  2BR0 A;  3ETJ A;  4YY3 Q;  2DNE A;  2UXD Q;  3GID A;  3U9T A;  2PNR C;  3D6W A;  4Q8E A;  3RFC A;  2YS6 A;  2VA3 A;  3KJP A;  1TU2 B;  5M5X H;  3RAX A;  4JV1 A;  3GTL B;  1IXR A;  5IWA H;  2F0P A;  5EOY A;  3DXJ C;  4FO2 A;  4HJ7 A;  2PI2 A;  2I80 A;  4LFC Q;  4DV0 Q;  1KAW A;  2L4N A;  2AMC B;  4ZLT F;  1E4E B;  1K0S A;  3OWE B;  4GNX A;  2MCT A;  3CCU A;  2I07 B;  1OTC A;  3I91 A;  4J15 A;  3TDQ A;  2OLS A;  1O7I A;  2N8N A;  5C3X A;  1GUW A;  2F0E A;  4C2M A;  5DLG A;  4MHE A;  4U6P A;  2J9G A;  4EFE A;  4O1N A;  2RBM A;  1GD7 A;  2R8H A;  3EPI A;  4JI2 L;  1GUT A;  4LF6 Q;  4WJ3 M;  2CWP A;  3GV5 B;  3MZ5 A;  2HDM A;  1H9K A;  1CA6 A;  2L11 A;  1MSG A;  2YL2 A;  5EZY F;  2R86 A;  4V19 0;  5D14 A;  5EAY A;  3JAM W;  4RAZ A;  3E9H A;  5C4J B;  1HZ9 A;  4GN3 B;  4UPA A;  1WTV A;  4B3T H;  2JEB I;  3IFD A;  4IAJ A;  2K33 A;  4ME5 A;  5KG3 A;  1ULZ A;  4HAE A;  5FPR A;  1N32 Q;  2K32 A;  3FKI H;  5KFD A;  3JAM E;  3H0G G;  1DOM A;  2AQ3 B;  3NTH A;  3TP5 A;  5KFP A;  2IY5 B;  3C1F A;  2WYO A;  5F2D A;  1YHQ A;  4O3O A;  1JWS D;  3VR2 A;  1SNM A;  4JG2 A;  1I50 H;  5A2Q L;  1PH9 A;  2Y0S E;  1Y1W H;  2JYO A;  4X66 Q;  1UE7 A;  4DR2 L;  1RTN A;  3K6O A;  4C3I B;  4DL7 A;  3PUY A;  4N9T A;  1EQQ A;  2W71 A;  2JEJ A;  1CZW A;  1GSA A;  4RA8 A;  5M5Y H;  1NNX A;  5J3B A;  5LL6 S;  3TQT A;  1LT3 D;  1K8G A;  3STB D;  2V4D A;  4DV5 Q;  1BNZ A;  2VNU D;  2YRW A;  5JH7 F;  1JB3 A;  2OQ0 A;  2WIN B;  3AQQ A;  3KAK A;  1STH A;  1C3O A;  1E2W A;  3BQ1 A;  4YJ2 F;  2C2E A;  1B2T A;  4L8J A;  2XVS A;  4C3I G;  4R8N A;  2NVX A;  4LF5 Q;  1Q90 A;  3NBH B;  2KHS A;  4ED2 A;  4KY6 A;  2E2H A;  1N56 A;  4MIU A;  4WOR A;  2ZT9 C;  2NN6 G;  2ZM6 L;  3UDG A;  1JWU D;  4PV1 C;  1V1Q A;  5M3M H;  1C8C A;  1FJG H;  3M9B A;  1B33 N;  1I6U A;  3SEB A;  3JSL A;  4JI1 Q;  2HD3 A;  3QOJ A;  3K8A A;  4DR3 H;  2OT2 A;  1DJR D;  4MTN A;  4PQX A;  2K5D A;  3CU7 A;  3HOX G;  1TKW B;  3MXU A;  4DR4 H;  3I4N B;  2KED A;  4C1N K;  1N36 H;  3D8G A;  5LOV F;  4DV3 H;  4YJ3 F;  4O3Q A;  4PZ6 A;  3AMU A;  3HOU B;  2VQE L;  1RYR A;  4QJF A;  1PYB A;  4JW0 A;  4DUZ L;  1D5M C;  1X55 A;  3UFX B;  3J81 i;  5J1Z A;  5A35 A;  5NUC A;  5K36 H;  3CQZ B;  1IBL L;  5AJ3 L;  4IFD J;  2WE6 A;  4MA0 A;  3RUP A;  2FB9 A;  4HSV A;  4A3B H;  3K5H A;  2I5L X;  1ILP A;  4IPG A;  4DUY L;  3GTJ B;  1ASY A;  1S3O A;  5I9O A;  1WJJ A;  3GV7 B;  1LTR D;  1O80 A;  3IG0 A;  3GTG B;  4JI6 H;  2QDL A;  2QGQ A;  1SFO B;  4JCV E;  1E4F T;  1SMY D;  2RF4 A;  2B63 B;  1D7Q A;  5CYU A;  4DV6 Q;  2R7M A;  1PH4 A;  2Z1C A;  4J9Q A;  4UY8 C;  5KG6 A;  1SCU B;  4C3H G;  1S97 A;  2PMZ A;  1S03 G;  3I7F A;  2A1A A;  4BXX G;  1AZP A;  4B3R Q;  4O3P A;  4A3L H;  2FK3 A;  1EQV A;  3URY A;  1LTL A;  2B63 G;  1GJX A;  4U7C A;  3K58 A;  4LF4 Q;  2R92 A;  3MC0 B;  1H9S B;  3WWV A;  4QMG A;  1Y69 U;  1E4E A;  2HQE A;  1PA6 A;  1A6X A;  1I3Q H;  5GAG C;  2HHH H;  4OON A;  4XQN A;  5DQG A;  2ZXO A;  5FLM G;  1NE3 A;  2PYK A;  1CHP D;  2EPB A;  5I47 A;  4A93 H;  4KHV A;  4K14 A;  1SBB B;  2A6E D;  4F50 A;  3GD7 A;  2PZU A;  1GYF A;  1DZ1 A;  3LML A;  5C1O A;  5IWA Q;  3N40 P;  1STA A;  5CB4 F;  4FDB A;  2FHT A;  4KV6 A;  2LXJ A;  3ULP A;  1VQ7 A;  3GII A;  3S14 B;  1SRU A;  3FPU B;  3I90 A;  2E2I A;  2EY2 A;  5FJ8 G;  1N33 L;  1G29 1;  4UP8 A;  3CCV A;  2JA8 B;  3J81 W;  3HP3 A;  1EIH A;  2WB1 E;  1RTO A;  1DOL A;  1QVG A;  4MA5 A;  4QWB A;  2R8K A;  2W6P A;  4DL4 A;  2VUM G;  2B29 A;  5EPJ A;  3J81 E;  3M4O H;  2C5C A;  2PQA B;  1RK6 A;  2B2U C;  3BAB A;  2ASJ A;  4FBU A;  4G4K A;  4OX9 L;  2QYZ A;  4QW9 A;  2BH2 A;  2XGT A;  4WBN F;  2P5Z X;  3H20 A;  1SEB D;  4EEY A;  3TIG A;  2HVS A;  4KD3 A;  4IWX A;  2JXM B;  4RB0 A;  4G3I A;  5BR8 L;  4RCO A;  3OHX C;  3B6Y A;  2P0A A;  4GLA C;  4B3T Q;  1KAA A;  4X64 H;  4ALP A;  4DNT B;  4Y7N H;  3HOY G;  3A0J A;  2EE1 A;  2NVY H;  4X65 L;  2SNS A;  5LP6 F;  1CM9 A;  3GTQ B;  1Y1V H;  1CSQ A;  5I6Y A;  1EY8 A;  5KNC A;  3RUZ A;  3PIO A;  2Z0S A;  5IGB A;  4RKL A;  3K3V A;  3T1Y H;  1WYD A;  2WTF A;  1N34 L;  5M5W B;  4A3E H;  4M9U A;  2MNA A;  5TSS A;  5DAU A;  3M4Q A;  4MTK A;  4R4I A;  1M90 C;  2K05 A;  3I8Z A;  1FKA H;  3NBH A;  5KNB A;  1QZG A;  4QW8 A;  4DK3 C;  2IBK A;  3I55 A;  4HNV A;  4GKJ H;  1TWC H;  1EHI A;  4ODG A;  2BCO A;  2ENB A;  2MJ8 A;  4IQZ A;  1VQB A;  4HR7 B;  4KHZ A;  4V0B A;  5JVD F;  1SJE D;  3HKZ A;  1I4Q A;  4IZ8 A;  4O4L F;  4BBR B;  2W9B B;  3E3X A;  4HIM A;  3PW2 A;  4YAK B;  2EY5 A;  1WCM B;  3OTO L;  4FNF A;  2VOB A;  1XMO H;  1PFM A;  4HN7 A;  5JEA H;  3QZ8 A;  2F0M A;  1K8O A;  1SSO A;  4OWW B;  3S16 B;  4IPC A;  3K5M A;  2FLP A;  3K5L A;  4DR5 H;  4N8X 1;  5JEA J;  5KFT A;  3FKI A;  2G9D A;  3CCM A;  1FJG Q;  3VR4 A;  4LH7 A;  5L1L A;  4XQQ A;  4RAU C;  3I72 A;  5DLQ E;  1EY0 A;  4DR3 Q;  3HOV H;  4HJ9 A;  1K83 H;  1WCM G;  4YHH L;  4DR4 Q;  3GTG A;  2YTV A;  1G2T A;  1SFO A;  2OF1 A;  1N36 Q;  4DV3 Q;  1Q46 A;  3M7G A;  2C22 A;  1A3V A;  5GAE C;  5D3I B;  3DM1 A;  3U9O A;  3ETH A;  2K1B A;  1W2B A;  4O4H F;  3KF8 B;  4X3S A;  2UUC H;  2L0C A;  1AUV A;  5KFC A;  1AW7 A;  2NB0 A;  2WAQ E;  1K8M A;  3MR2 A;  2RKS A;  1F2Z A;  4JI6 Q;  1I94 H;  2K50 A;  4P74 A;  1HFG A;  3M7N A;  2IHE A;  1EUC B;  3K7A B;  2PPB C;  2RCN A;  1IW7 C;  3W1B A;  5KRU A;  1QIL A;  5FLX W;  2PO4 A;  4NPS A;  3RZD H;  1HUM A;  3CAM A;  2E5L H;  2JA5 H;  1WTP A;  2JA7 B;  4RB3 C;  5FLX E;  1JE4 A;  3TQ1 A;  3S15 B;  1IBK H;  1K1Q A;  4A3J H;  2Z6B A;  1SYD A;  4QIW E;  4TQU S;  1KD1 C;  3W3A A;  3MR5 A;  3DMU A;  2HHH Q;  1HCZ A;  3OHA A;  4DV2 L;  1I5F A;  4J6H A;  4O3R A;  1ENF A;  2UXB L;  1X3P A;  2LXK A;  3PO3 G;  4KHP L;  5JJK A;  1JJC B;  3EA6 A;  1EWI A;  4K8I A;  5JJI A;  4YBZ B;  2UUA L;  1I7L A;  4FM9 A;  2PQE A;  3TZD A;  3S1Q H;  3V4Z A;  4RB2 C;  3T5K A;  4JI5 H;  3DHQ A;  1D5X C;  4LUV A;  4XQJ A;  1JDB B;  3PSI A;  1JQY D;  1ONL A;  1ZYR D;  5GRO A;  5CV7 A;  3GQB A;  1ILQ A;  4AIM A;  2HUG A;  1U9R A;  2YTY A;  3AFQ A;  4ZAI A;  4MV9 A;  3PO2 B;  3P75 A;  4EBC A;  3PUZ A;  3V96 A;  1BBU A;  5C3E B;  3G6J B;  2ZJR A;  3HOW G;  2E74 C;  5LMN W;  4IZO A;  5IYD G;  2K01 A;  2K5Q A;  1Y14 B;  1TWF H;  4X6A H;  5KX5 F;  2L12 A;  3NK9 A;  4B9W A;  3F2B A;  5IT9 W;  1VQO A;  4ECW A;  2R7F A;  3CME A;  1C7Y A;  1ESR A;  1WTO A;  2MGS A;  5C4X G;  4RGM A;  5IT9 E;  4ME6 A;  1VBG A;  5EKI A;  4QB4 A;  5EBD A;  1DCZ A;  4EFB A;  4LFA H;  2XN9 C;  4X64 Q;  3PO2 G;  1I3Q A;  4HR7 A;  4POG A;  2UVU A;  3R5H A;  5C3E G;  1DV2 A;  2A6H C;  3U9S A;  2LFN A;  4BY1 B;  1MZB A;  4RUA A;  2NVT H;  4ID6 A;  1S68 A;  3STB C;  5EJW A;  3T1Y Q;  4ECV A;  1PMR A;  2RGV A;  5D1O A;  1W3S A;  4LF7 H;  1IKM A;  1QB5 D;  4F7X A;  5IP9 H;  3IL8 A;  1JT8 A;  2ZJP A;  4LFB L;  4PDB A;  4GKJ Q;  4A3G H;  1E2V A;  4A3M B;  3BA9 A;  4I55 F;  1QNU A;  1YNJ C;  1M4V A;  1LT5 D;  4IUN A;  1L2F A;  4DR7 L;  3KLW A;  3VMM A;  2F0H A;  2ZTC A;  3OIQ A;  4HCS A;  1CE8 A;  1EU4 A;  3OSO A;  3D31 A;  2W57 A;  2NUA B;  4TQS A;  2IT1 A;  1UUP A;  4AYB G;  4U67 3;  2IX0 A;  4ECS A;  3I70 A;  3D6C A;  1CQF A;  1B9M A;  1QNK A;  4K6D A;  4DK6 C;  1W6K A;  1M0W A;  1XMO Q;  2EYJ A;  5G3L D;  1WTX A;  3PF4 A;  1V1P B;  1G8Z D;  1S4Z A;  3QO2 A;  3H4D A;  3I4O A;  2L9H A;  3K59 A;  3G4S A;  1DV1 A;  4X62 L;  4DR5 Q;  1OXU A;  1CKM A;  2D5D A;  2FJ2 A;  2VQF L;  2W6Q A;  1GXD C;  4X3K A;  5HGT A;  3A74 A;  5KG4 A;  3PW7 A;  3KF8 A;  3JAM c;  4LK1 C;  1ZEQ X;  3BG3 A;  4YIJ A;  4O2B F;  4TVA B;  2W6N A;  1GUN A;  2RDG A;  1M1K C;  4EYI B;  1RK5 A;  3JRW A;  2B39 A;  4OO1 H;  4Q0Y A;  3H40 A;  1KRT A;  2W7O A;  2FJZ A;  4GC6 A;  4LJZ C;  4APM A;  4DN4 M;  1YIJ A;  1OO9 B;  1YHB A;  2JE6 I;  2R7K A;  2K5N A;  2V1C C;  3MHB A;  1T5X D;  4HCE A;  3CXC A;  2EXD A;  3SK8 A;  1SJH D;  4JI8 H;  2UUC Q;  2GPS A;  3VYU A;  5LMU L;  4C3J H;  3G71 A;  3SHL A;  1K1S A;  1I94 Q;  3BA8 A;  4ED3 A;  2JA7 A;  1M0T A;  4RZQ A;  3IAY A;  3K5I A;  4Q43 A;  3BU2 A;  4F4X A;  2O4X A;  3T1H L;  3S1N H;  4ZOL F;  1P8L A;  2D0O A;  1E2Z A;  3VPB A;  2JA6 A;  5LMN H;  2UVR A;  4R4Q A;  1HNX L;  3V6H A;  4UCO A;  4NKL A;  1HR0 L;  1G91 A;  2PN1 A;  3HXL A;  1S5D D;  3OOC A;  2F03 A;  1S72 A;  1PK8 A;  2E5L Q;  5I9P A;  5DGA A;  1XTC D;  2UXC H;  2B2V C;  3PUX A;  3UDX A;  1O75 A;  4A2A A;  1IBK Q;  1HA5 A;  3BYT B;  5M3F B;  1QCB D;  1R9T H;  1JJ2 A;  2F1M A;  5IYC H;  3V6J A;  3KLR A;  4ECU A;  2IX1 A;  4KN7 C;  2VB3 X;  2VQE H;  1BOS A;  2IL8 A;  5CR3 A;  1JDE A;  4IUP A;  4LF9 L;  3HOZ G;  1X32 A;  1DYQ A;  4UFZ A;  4S3S A;  2WB1 A;  4ULL A;  5J39 A;  4GNX B;  1LTS D;  1YJ9 A;  2WKD A;  3P1H A;  3MFY A;  4JI5 Q;  4QWC A;  1N8R C;  3FRP B;  5M3F G;  5KFF A;  1ET9 A;  4C2M B;  2RDJ A;  1H9R A;  1T36 A;  3Q22 A;  4WRD A;  3CF5 A;  2OQK A;  5C0X J;  3VYS A;  4DA2 A;  2NVQ H;  1SYF A;  1PDQ A;  4LUZ A;  1I6V C;  2E76 C;  2QF7 A;  4PMW A;  1LM0 A;  4P72 A;  3NUC A;  2L55 A;  1VQJ A;  1PH5 A;  5KG7 A;  4L6T B;  2UVW A;  3HKS A;  1M6V A;  2GLT A;  2ZDG A;  2F4V H;  5CV4 A;  1EUJ A;  4DV4 L;  2OTL A;  2W70 A;  2EYM A;  4Q45 A;  4JK1 C;  2I46 A;  2BQR A;  1EYA A;  3TZU A;  1FNV A;  3RD4 A;  4ECQ A;  4JV5 H;  2EZV A;  2B2T C;  1EFW A;  1VQ9 A;  5KFU A;  4LFA Q;  2V4R A;  2H1E A;  2Q8T A;  2ZXR A;  1RJT A;  3MXG A;  5T14 A;  1FYC A;  3RB0 A;  1VQI A;  1UE5 A;  1N9W A;  1VMC A;  3E5S A;  3MFH A;  2NZ1 D;  4IOC A;  4O0A A;  3PW0 A;  2V4Q A;  4JV2 A;  4UCV A;  4LF7 Q;  4DXG A;  3G7L A;  1V1P A;  1MD2 D;  4GNX C;  3RNU A;  4NXN L;  2HDL A;  4FF2 A;  1EY9 A;  1PTO B;  3F2C A;  3AB9 A;  5IIF A;  4JBM A;  5I4D A;  1UNN C;  1IHZ A;  2RGR A;  2K4K A;  1SYC A;  4DXF A;  2NVX B;  4J1M A;  3J81 c;  3BJU A;  2UUB L;  1EU3 A;  4YR3 A;  2DJG C;  5KFV A;  4YCW A;  5FK9 C;  1IBM H;  1IL2 A;  5KKN B;  2FP4 B;  3A55 A;  2LY7 A;  3M85 A;  4KY7 A;  1ZHQ A;  3J80 i;  3P7J A;  1EYD A;  4K5W A;  4RCN A;  4DV7 L;  4RFB A;  1MI2 A;  3VYR A;  2MUY A;  3LX0 A;  2R87 A;  4QCL A;  2ATL A;  1B44 D;  2E8G A;  4F87 A;  3GTM H;  5IP7 G;  1B4O A;  3MR3 A;  3ICE A;  4P75 A;  3S2H B;  5ELO A;  3HFZ B;  2XWJ B;  1C9O A;  4B3S H;  5K2M A;  4C1N I;  1IKL A;  3FDS A;  1SE2 A;  2SEB D;  5KFY A;  2KHJ A;  4DL2 A;  5L37 A;  3DWQ A;  1SYG A;  1CQV A;  1FD7 D;  3DLL A;  4R1J A;  4CKB A;  4OIK A;  2R7Z H;  2WAQ A;  3H0G H;  1S0O A;  1JKJ B;  1VF7 A;  5CC4 A;  1PYS B;  4HJ8 A;  4JI0 L;  2W6M A;  4JBW A;  1PYW D;  3DUZ A;  4JI8 Q;  1U4R A;  4TV8 F;  1KTK A;  1GUG A;  2KCT A;  4XDX A;  1IW7 D;  3MEF A;  3DEP A;  4KY5 A;  1BO0 A;  3EBE A;  3T51 B;  1CZG A;  3RGX A;  2F0G A;  3MR6 A;  2IW3 A;  4KKS A;  1U4M A;  2PMZ B;  1EYC A;  1HH2 P;  1B1Z A;  2V59 A;  2FPG B;  1EQT A;  3K0Y A;  5ELC A;  1JCK B;  4M8A A;  4JI3 H;  2AQ2 B;  3PUV A;  3R2T A;  3QZ7 A;  2OTJ A;  1PV4 A;  5LMN Q;  3S2D B;  4MAM A;  5L1J A;  4O42 A;  4HYK A;  4I4T F;  2VR1 A;  4K2K A;  1F9P A;  5KFN A;  1UC8 A;  4MV3 A;  2R92 B;  2VUG A;  4NXM L;  2EDG A;  4JI7 L;  1C48 A;  2DNC A;  4YWM A;  1L2Z A;  1NBW A;  1PH7 A;  2IPK D;  2UXC Q;  1FVI A;  2NN6 H;  4ECT A;  2ASB A;  4JYA L;  1UC9 A;  2ICE C;  2YS7 A;  3D4W A;  3J80 W;  4WJ4 A;  3I73 A;  3T4A C;  4A3F B;  4A2B A;  2WV6 D;  5IYB G;  3H09 A;  1ZYR C;  5EPK A;  5HV6 A;  4NP5 A;  5T1I A;  3J80 E;  4A3I B;  1F9S A;  3HOX H;  2MQH A;  5ELN A;  2VQE Q;  3CC7 A;  1VQD A;  5D1P A;  4QGU A;  4JI4 L;  2R92 G;  1CQJ B;  1I6H B;  3JZI A;  3GTO A;  2W9A A;  1STE A;  1JWM D;  2KOL A;  1SE3 A;  3BZC A;  3K5O A;  2E2I B;  1TWG B;  3S17 B;  4O2A F;  3M3Y H;  1UE6 A;  5DEH A;  1K8A C;  1K73 C;  3HBL A;  1KEE A;  4A3F G;  3DWA A;  3M9N B;  2XIG A;  2M00 A;  3A5U A;  4A3I G;  1GHJ A;  2NBF A;  4LF8 H;  1EEI D;  1K3B C;  2L15 A;  4B3M L;  2YYZ A;  2AGQ A;  1JOK A;  1OXX K;  4F4Y A;  2KEC A;  1XPR A;  2Z4I A;  4BA2 I;  2AGO A;  5D3D A;  4JOI A;  3J7A F;  4DAY A;  4RNN A;  2DLN A;  1TY0 A;  2A6H D;  3MTS A;  1JR0 D;  2F4V Q;  2HVQ A;  2ZTE A;  5G3L F;  3T53 B;  3RLN A;  2VXW A;  4A4I A;  2SDF A;  5FLX c;  4L5T A;  4DR1 L;  3CQZ H;  2QK4 A;  4JV5 Q;  4Y52 H;  4C3H H;  1R9T A;  5BMV F;  4CDE C;  4DNR B;  4RH6 A;  4ZRZ A;  2QCP X;  5GQO A;  5KFH A;  4BWG B;  1AZQ A;  1PX2 A;  3ULL A;  4RGN A;  1YNJ D;  2F0F A;  4FXK C;  3CD6 A;  3Q6S A;  3V6K A;  1KNA A;  1SYX B;  2B8G A;  3Q0A A;  1YJW A;  4F4W A;  2WKC A;  4RKB A;  1XWE A;  1LTA D;  4KHP H;  4X3T A;  3HKZ B;  3NHH A;  5FLM H;  3H4B A;  2K7V A;  4YY3 L;  4I65 A;  4QY7 A;  4MV1 A;  3CC4 A;  2UXD L;  2ALY B;  2PNH A;  5IGE A;  3N41 B;  2N88 A;  2I87 A;  4ILW A;  4MTD A;  1VQH A;  3RZO H;  1L0X B;  2J6S A;  4BWS C;  1JB7 A;  3EVQ A;  4Q44 A;  2ASD A;  4LFC L;  1IBM Q;  1D1I A;  4DV0 L;  1V1O A;  2VL6 A;  1CT1 D;  5FJ8 H;  1VQC A;  3SGI A;  4JUZ A;  3T13 A;  3HKZ G;  2AWN A;  3FKI B;  5C8Y F;  2VS1 A;  1I7N A;  1AN7 A;  5IT9 c;  5KT7 A;  1JMC A;  1JE5 A;  1TWH H;  2VUM H;  1HJP A;  3T5H A;  3I4N G;  4GC7 A;  2BQU A;  5C44 B;  3U58 A;  1Y1W B;  4LF6 L;  4K0K H;  3HOU G;  1D2B A;  1A8V A;  1O78 A;  2Z8L A;  2C2R A;  1VQ5 A;  4DL5 A;  2UVV A;  3U50 C;  1BBX C;  1LTT D;  2UU9 H;  4B3S Q;  2KEN A;  4X65 Q;  3K0X A;  5M5Y B;  4CC5 A;  3OYY A;  1J8I A;  1A2T A;  4ZQ3 A;  3MWD A;  4AQY L;  3HOY H;  2HJW A;  2ICI A;  5KYL A;  2R7L A;  3UI2 A;  4LSA A;  4MNO A;  1XNQ L;  5C44 G;  3VR3 A;  1AP0 A;  2XTI A;  4HSP A;  4IO9 A;  3PVX A;  5EPL A;  4UHV A;  2ALZ A;  2EIF A;  2F3W A;  3JSN A;  2A68 D;  4X66 L;  3J7Y W;  4QWD A;  4O3S A;  5KFZ A;  3NGD A;  3BQ2 A;  2OCE A;  2SNM A;  4J9P A;  3TII A;  3X3M A;  5M3M B;  2KVM A;  2M05 A;  4IUV A;  4DV5 L;  1KJ9 A;  5CV5 A;  2KQ3 A;  2EYO A;  1JC7 A;  4JI3 Q;  4Z9C B;  3SR1 A;  1PH2 A;  3MWY W;  1Q82 C;  3TP7 A;  3GIJ A;  1V8Q A;  3GTK A;  4X62 H;  1A0I A;  3RB4 A;  1SRO A;  4LF5 L;  1LTB D;  1TWG A;  3S1R H;  4MN3 A;  2PZT A;  4I7A A;  1KLU D;  3G6X A;  3ITP A;  1ZQ7 A;  1BDO A;  2O5I C;  2L1B A;  2XWB B;  5EWG A;  3MWM A;  1II3 A;  3G6V A;  1F77 A;  2R7Z A;  1NMF A;  3H0G A;  4UCR A;  1Q8K A;  3CP0 A;  4ZYS A;  5KFQ A;  3HGB A;  1ASZ A;  1VQL A;  1X3E A;  2N55 A;  1EZ1 A;  4G7H C;  3LWB A;  4C5C A;  4JI1 L;  2XCP A;  3GIL A;  1X3G A;  2Q2U A;  5E1F A;  1YNX A;  1O7Z A;  2XSC A;  1LTG D;  3TSS A;  2QKI C;  4IFD G;  4ZHQ F;  2BH8 A;  1VS0 A;  1AUX A;  2PW5 A;  2JA8 G;  1VCI A;  2RCF A;  2Z6K A;  1GVP A;  3RB3 A;  3NEN A;  1ICW A;  1QJO A;  4TRD A;  3V4S A;  3EPG A;  4KLK A;  3TN2 A;  1XNR H;  5LMU H;  2JEG A;  1X54 A;  4NB3 A;  1Z6H A;  3I4M H;  1B7Y B;  3NTK A;  3G8C A;  1SND A;  4B9X A;  2RVL A;  1YI2 A;  4LF8 Q;  5KFM A;  5J2U F;  2IWH A;  4HID A;  3L2P A;  4CDC C;  3G6Y A;  4J9S A;  1J9O A;  2X0S A;  1I3Q B;  1VDZ A;  2Y0S B;  1X6O A;  1V43 A;  5L9X A;  3D4D A;  3V2T A;  3IN5 A;  2PZW A;  1DIK A;  2M2L A;  2PCF B;  5FO7 B;  3H3V I;  4RGT A;  4BY7 H;  5HGQ A;  4UP7 A;  4A3L G;  1NTG A;  1TR5 A;  4GN4 B;  5D1O B;  2E75 C;  4XYL B;  1E0B A;  1HNW H;  1NAP A;  1ENC A;  1CK1 A;  2QIL A;  5DQH A;  2EOT A;  2Z9H A;  3FP9 A;  4F88 A;  3N44 B;  5KFJ A;  3GV3 A;  4EQO A;  2W7P A;  3J7A V;  4P71 A;  4LF4 L;  2NU7 B;  4KHP Q;  4R8I A;  2OEO A;  4L1K A;  4RGO S;  4BBR G;  2RDH A;  3M4O B;  4LAA A;  4RB1 A;  1BCP B;  3PO3 H;  4C5B A;  2GVA A;  1I50 A;  4DR6 H;  5EQ0 A;  1WFQ A;  1Y1W A;  3T5J A;  2K14 A;  1F9R A;  4DK0 A;  2VQD A;  3UQ8 A;  2B8F A;  4DAP A;  3K5N A;  3V05 A;  1TS2 A;  2Z4H A;  1CKO A;  1QVC A;  1MJE A;  2RQX A;  5E3F A;  1B8A A;  4CHT B;  1ROD A;  2R93 H;  3KFU A;  4EYH B;  2EVB A;  2F0D A;  3I12 A;  3EQL C;  4GKK L;  1J5E H;  4IUR A;  4WD3 A;  1M8A A;  1C30 A;  4GOP B;  3BZD B;  5LL6 b;  1Y1V B;  1XMQ H;  2RSN A;  3TP6 A;  1PLF A;  2FLL A;  2D9U A;  3HOW H;  4HED A;  1BCP F;  5BPH A;  4J9N A;  2NTS A;  4EX5 A;  5IYD H;  2C9O A;  2TSS A;  1VQF A;  2EJG C;  3G48 A;  4TKO B;  4A3E B;  1VQG A;  2NU6 B;  3F8N A;  4K0K Q;  3H94 A;  1RYS A;  3MWE A;  1XJV A;  1B3Q A;  5C4X H;  1TWC B;  2UU9 Q;  4NMZ A;  1S5C D;  4JPB W;  1HA6 A;  4J0M A;  2CH4 W;  1PTO D;  5I2Y A;  3PF5 A;  3I4L A;  4B3T L;  3ERO A;  1CUK A;  1KRS A;  3PO2 H;  1LV9 A;  5JVL A;  1TWA H;  5C3E H;  3OMG A;  1KQS A;  1LT6 D;  4MTE A;  5DG9 A;  1TT2 A;  5KFG A;  4A3E G;  3CC2 A;  1F9Q A;  1YBY A;  4DL3 A;  3E0J A;  4FXG C;  2OWO A;  2DWC A;  4LFB Q;  1EIG A;  5CBA E;  1BCP C;  5IGG A;  1WTW A;  4OO1 I;  3UE1 A;  2BQ3 A;  2JA6 B;  5A2Q W;  3IFT A;  1EZ8 A;  4CJ1 B;  3MJF A;  5LYJ F;  4ED1 A;  2PBZ A;  3KBX A;  1UAP A;  3MFG A;  4ZUJ A;  4PG3 A;  1TWH A;  1RJP A;  3HS0 C;  4OL7 A;  5A2Q E;  3HOV B;  3S1M B;  2JA7 G;  3Q8R B;  2KSW A;  1Y8P B;  1NR4 A;  3PMF A;  5KFK A;  5JEA G;  2W6Z A;  4ED7 A;  3KDF A;  4DV1 H;  2QW7 A;  1W96 A;  2YU9 H;  4X62 Q;  2E2J H;  4IUU A;  5CMD A;  5LL6 X;  1S0N A;  2M9V A;  2JA6 G;  5L1I A;  1BNC A;  5CA1 F;  1NY4 A;  3NBI A;  4QL5 A;  2F52 A;  1KC7 A;  4MV6 A;  1FJG L;  4HNT A;  3NQI A;  2I8C A;  3LGJ A;  4IJH A;  3KHR A;  1JXL A;  3R23 A;  5BN4 A;  2WB1 B;  1G6P A;  2CQO A;  4DR3 L;  1I4G A;  1QUQ A;  4DR4 L;  3CRL C;  4K6L A;  2G9H D;  2YZN A;  1N36 L;  3BVM A;  4DV3 L;  4X3U A;  4EGQ A;  4A3K H;  2Q2I A;  3RMH A;  2Y0S A;  4LSX A;  2K6A A;  2Q2H A;  1CQI B;  1XNR Q;  1LTI D;  5LMU Q;  1BBW A;  3KTM A;  2R61 A;  3RZD B;  1LAB A;  1LAC A;  3K81 C;  2WB1 G;  3N43 B;  3N6X A;  2JA5 B;  3NWS A;  3L9A X;  1GUO A;  3ER0 A;  4XT1 B;  1N48 A;  4JI6 L;  4J9M A;  4FS2 A;  5C0X I;  4A3J B;  4KKU A;  1WD0 A;  4JV0 A;  3VPD A;  2KCN A;  4BY1 G;  4PNY A;  2YZM A;  2JEF A;  4DFA A;  3GTP H;  2C28 A;  5CV6 A;  3OMC A;  3R3O A;  3SDZ A;  1MHW C;  3GV8 B;  2MHV A;  4IRD A;  4ZKC B;  3NTI A;  2KCM A;  2C35 B;  3TBI B;  3RN2 A;  4LW1 A;  1HNW Q;  3S1Q B;  4EGV A;  2DZD A;  1HUN A;  4A3M G;  4FVM A;  4A3J G;  2HQL A;  3KAL A;  2XIW A;  3JAM L;  3NE5 B;  4JI2 H;  1PZJ D;  1KNE A;  2WDT A;  4E6I A;  2NVY A;  1IZ6 A;  3Q8D A;  4IPH A;  2XC9 A;  2VPQ A;  4GOP A;  1E22 A;  1Y1V A;  2HHH L;  1RJR A;  2O5J C;  5K5P A;  4XYM B;  1WI5 A;  2JA9 A;  1GHK A;  1CI3 M;  2ZDH A;  1TWF B;  1VF5 C;  2QEJ C;  1L0Y B;  4DR6 Q;  4DGZ A;  4GN5 A;  3HOZ H;  2NUC A;  4YR2 A;  2JJQ A;  1B6R A;  4R4T A;  1T94 A;  3PR4 A;  1A62 A;  1TWC A;  5M3F H;  3MXN A;  2R7N A;  1QOH A;  5C1P A;  4L5Q A;  2DUD A;  3VDY A;  1J5E Q;  4DR2 H;  2AUJ D;  3K7U C;  2ZJT A;  3KHG A;  1XMQ Q;  1KDB A;  2NVT B;  1C0A A;  3KK7 A;  4YCV A;  2YYA A;  1EY4 A;  2QA4 A;  2W9C B;  3OSN A;  3PN1 A;  4J9O A;  2F3I A;  2Q8R E;  3LNN A;  1TXY A;  4UCU A;  3CPW A;  4H0L C;  4P73 A;  1EIY B;  3VR6 A;  2DY8 A;  5KFR A;  1QZH A;  4JVZ A;  1EYG A;  4A3G B;  1GSH A;  2YRX A;  1Z9F A;  2WAQ B;  3N8D A;  3BDO A;  2KEE A;  2A68 C;  4OXP A;  1RDP D;  4KMU C;  3I56 A;  1S9F A;  4A3D H;  4X64 L;  5KFO A;  1SEI A;  3AEV A;  1J6Q A;  4IHJ F;  4U68 A;  2IHF A;  4HIO A;  5LXT F;  1TS4 A;  1FL0 A;  2ES2 A;  2ZM6 H;  1PXU A;  3H3V C;  1K83 A;  1PRT B;  3VYT A;  5JJL A;  1BKB A;  1GKH A;  4KJO A;  5IP9 G;  1KC8 C;  2HT1 A;  1CA5 A;  1HHV A;  4A3G G;  2WAQ G;  4PWQ A;  2R93 A;  1T9H A;  2NZH A;  3GQC A;  4GKJ L;  5KT5 A;  2B2Y A;  4DNI A;  3GO5 A;  4OHJ A;  4DUZ H;  1E4G T;  4QIW B;  4YCU A;  1PRT F;  4H02 A;  1A9X A;  4Q5V A;  3FEW X;  3QJY A;  1SXT A;  2AQ4 A;  1IBL H;  3RJ0 A;  3ERS X;  1VAJ A;  2XNA C;  2K5W A;  3KF6 A;  4IJL A;  4DV1 Q;  4DUY H;  1MGS A;  1XMO L;  1IYV A;  1A15 A;  1V9P A;  2BA1 A;  4IOA A;  4ETS A;  1WTQ A;  2DN8 A;  5GON F;  1STG A;  1H95 A;  3FVQ A;  4DR5 L;  3A56 A;  4RNO A;  4OWT B;  2ASL A;  5BN3 A;  5IGC A;  1TWA A;  2CWA A;  3NP8 A;  1SNC A;  3GTO B;  5IP7 H;  2CW0 D;  1SN8 A;  3WOE A;  4C3J B;  4EGJ A;  1DM0 B;  2E2H H;  3MFI A;  5DLF A;  1Y8N B;  2JA5 A;  1NJI C;  5KFE A;  1PRT C;  1AEX A;  2NN6 I;  3T16 A;  3FPP A;  4H7B A;  3S1N B;  1YZ6 A;  1VQA A;  1YNN C;  5ELE A;  3NXW A;  2A8V A;  3W5O A;  3ONA B;  1EOV A;  3E9I A;  2F0Q A;  3PIO 3;  3S2H H;  2UUC L;  5FD5 A;  4DAY B;  4IRC A;  3KHH A;  2NU8 B;  3QIA A;  4JBJ A;  3T56 B;  4K5X A;  3C46 A;  2ZDQ A;  5ELB A;  1HTP A;  1I94 L;  4BBS B;  3PUW A;  4J9K A;  1VMP A;  2YU9 A;  4YAJ B;  4A3C G;  4PMC A;  4XIG S;  3J81 L;  1TY2 A;  1R9T B;  5C5L A;  3I2Z A;  1W6J A;  4YWL A;  2K03 A;  4IN3 A;  4NXM Q;  3UE0 A;  1SNP A;  4AH6 A;  2BE5 C;  3W1G A;  1TWF A;  1N33 H;  3TIN A;  1X3F A;  1LT4 D;  3R5F A;  4BBS G;  5ELF A;  1U4L A;  3CW2 C;  2SOB A;  2D62 A;  1L0W A;  4JI2 Q;  4OX9 H;  1CTM A;  1K3R A;  1QG7 A;  5IYC G;  3CCQ A;  1BXR A;  2J6U A;  1IBK L;  2NVQ B;  1PTO F;  5C5M A;  4A75 A;  3L4J A;  4NW2 A;  3GTL H;  1B6S A;  3ND8 A;  5IYB H;  1AH9 A;  1IYJ B;  5BR8 H;  2DPJ A;  1L1O A;  3GIK A;  4E4T A;  4QWE A;  2W9C A;  2B3G A;  1KJQ A;  2R92 H;  3R93 A;  1EY5 A;  3F2U A;  4X65 H;  5L1K A;  4KK7 A;  5IGF A;  1V51 A;  4C5A A;  5C0X G;  1B70 B;  2HIX A;  4JOI C;  3RV3 A;  1Q1E A;  4MZ9 A;  5KG2 A;  4JI5 L;  5DGB A;  1N34 H;  5FKA C;  4A3F H;  4ZCK A;  2W8K A;  1HNZ L;  1YHA A;  1S5E D;  4DR2 Q;  1IYU A;  1QE6 A;  1WTH A;  3GP7 A;  3SK5 A;  2VB2 X;  2J6T A;  4XXE A;  1WD1 A;  3RF2 A;  3S24 A;  1JOQ A;  1PTO C;  3Q8S B;  4YR0 A;  4IAL A;  1KBL A;  4FF4 A;  2F0L A;  4FF1 A;  3OHB A;  5C4J H;  1G2S A;  3ZJY C;  1WH2 A;  2CKZ B;  5F9N A;  1K28 A;  2JN4 A;  4TSS A;  1EY7 A;  2K28 A;  1YEZ A;  4O2D A;  2Q8I B;  4PZ8 A;  5JVH 3;  1MKH A;  2BA0 A;  2RDF A;  1BCP D;  3OTO H;  1KJI A;  1M7J A;  1A63 A;  4CDF C;  4LFA L;  4HJA A;  4QUF A;  1YVC A;  2A19 A;  2MPM A;  4L5R C;  4C3I H;  5KFW A;  2R6F A;  5LHY 1;  1JLL B;  3K3P A;  4ZQI A;  2XRQ D;  4QIW A;  3M4P A;  4JBK A;  2ZM6 Q;  3KUP A;  2JQO A;  3CCR A;  3BQ0 A;  2N78 A;  4LF7 L;  4LWC A;  5LA6 F;  1I4R A;  5J2T F;  3RGZ A;  4YHH H;  4ED0 A;  3N42 B;  4GLV B;  3WOF A;  1MSH A;  2MO0 A;  1K0R A;  4XT3 B;  3GTM B;  3KXY T;  4DUZ Q;  1Z2P X;  5ISR A;  2LS0 1;  3GTK B;  4CJ0 B;  4WJW A;  3L4K A;  2GA4 B;  2I5H A;  5D8D A;  4GKK H;  5BN5 A;  3NSW A;  2YTX A;  1IBL Q;  5AJ3 Q;  5I2X A;  2GVB A;  3F8T A;  1OXS C;  4DUY Q;  4CKE A;  3SE7 A;  2R7Z B;  3X3N A;  2A69 C;  3VR5 A;  3H0G B;  2N49 A;  3U4Z A;  2PVP A;  5GAH C;  4QUC A;  3NEM A;  3IRB A;  5H80 A;  5JQW A;  1SYB A;  4WFN 3;  1HZB A;  2K5H A;  3I4N H;  2F0J A;  1IL8 A;  2DIK A;  5FLX L;  4HNU A;  3HOU H;  1NCV A;  3D3R A;  1AFP A;  2BDO A;  4AQY Q;  2IP4 A;  2FLN A;  1UEB A;  2O2L D;  3TEH B;  3FDT A;  3BDC A;  2FMA A;  1LYL A;  1GM5 A;  2R7Z G;  3IKJ A;  1XNQ Q;  4MV8 A;  1S5B D;  5EWF A;  3A8I E;  4CGY B;  3M4Y A;  3GTJ H;  5M5X B;  2EY6 A;  4ZUI A;  1VBH A;  1GO3 E;  2ZJQ A;  4XYO A;  4KKT A;  4BXX H;  3BAA A;  3GTG H;  2X69 A;  4OEM B;  5C44 H;  4IWY A;  3PR5 B;  2OH2 A;  4CBV A;  1SNO A;  3QB3 A;  1SFO H;  3UDF A;  3OWF A;  4EG0 A;  4JI8 L;  2B63 H;  4N8F A;  4PZ7 A;  3R8B A;  1E7Z A;  4UCS A;  4DV2 H;  4FS1 A;  2AGP A;  2TMP A;  2B2W A;  2UXB H;  1D5Z C;  2HCI A;  1JOR A;  1A2U A;  1WSC A;  4LH6 A;  2FPP B;  1BGW A;  4O3N A;  2UUA H;  1SAP A;  3BZK A;  1D6E C;  4XX0 B;  5KIX A;  1GLV A;  4ED8 A;  3EIV A;  5JOB A;  1X65 A;  3EYY A;  3A54 A;  2R8G A;  2ZXP A;  1H9M A;  2BOS A;  3QOL A;  3SXH A;  4RWS C;  3HOX B;  3GLK A;  3DF7 A;  5LMN L;  2R7D A;  4DK1 A;  3N6R A;  2XGQ A;  1N33 Q;  1E3P A;  2J7Z A;  4R9W A;  5IT9 L;  3C0F B;  2CQA A;  3M4I A;  3M3Y B;  3TS2 A;  2UXC L;  2Z6K C;  2R8I A;  1EEF D;  1S5F D;  4OX9 Q;  2V5A A;  3BYY B;  4ZKB B;  1HR0 W;  3MEH A;  3AU7 A;  1I50 B;  3GV6 A;  1EIF A;  1VQE A;  2LMC B;  1FGU A;  2SCU B;  5BR8 Q;  2HVR A;  4QWA A;  1AE2 A;  1BQQ T;  3S14 H;  2JSO A;  2GN5 A;  5IY0 A;  3J81 j;  4IFD H;  3H6M A;  1XPO A;  2JA8 H;  4YB8 B;  1XX8 A;  3FKI G;  4HTH A;  5FD6 A;  3PZP A;  4GLX A;  4G57 A;  3BVZ A;  4OIJ A;  1N32 L;  4UAI A;  1N34 Q;  4C3H B;  1PH8 A;  4KI0 A;  1Y1W G;  3OPO A;  1ML0 D;  4LFB H;  4I7H A;  3RBD A;  5C5J A;  5C6A A;  1Q86 C;  1VQ6 A;  5KT3 A;  1GGO A;  2RSO A;  2IA6 A;  1TA8 A;  4GZY C;  4DR7 H;  4DKA C;  4L5S A;  4IR9 A;  1Q3L A;  3BJY A;  1STB A;  2F0T A;  1FR3 A;  2F4V L;  3GTQ H;  5EKL A;  3RR5 A;  2XGP A;  4RAY A;  3FHW A;  4Q8F A;  3Q2O A;  1NUC A;  1PFB A;  4JV5 L;  1NSN S;  1P16 A;  1R4Q B;  3OTO Q;  3HB9 A;  3GTL A;  5M5W H;  3C1E A;  3NWT A;  3GTM A;  2AKW B;  2JEI A;  3L3O C;  1Y8O B;  4EQP A;  3RZO B;  3CMA A;  1DON A;  2VQF H;  2ATW A;  3WNZ A;  2YZG A;  3CRK C;  5M3M G;  2F0I A;  1BJT A;  3CHB D;  2FE3 A;  5KFA A;  1XPU A;  5JJZ A;  4A3B B;  4BBR H;  1HZA A;  1TWH B;  5CV9 A;  4YHH Q;  3F2D A;  2VUM B;  4CJ2 C;  4ZK9 B;  3KBG A;  1WCM H;  1U4P A;  2K75 A;  4C56 C;  1RKN A;  3KDF B;  3Q1K A;  3PV0 A;  3SK6 A;  3S16 H;  5ELD A;  4GKK Q;  2YV5 A;  1STN A;  5K36 G;  2CW0 C;  1IBM L;  1OWT A;  3HOY B;  4CC6 A;  4A3B G;  4HMI A;  1AE3 A;  2R82 A;  1E1T A;  1UNS A;  2XRS D;  4FXD A;  2PW7 A;  1UEA B;  4RMF A;  1PRT D;  2A73 B;  4OWX B;  3OW7 A;  1RJQ A;  1QUQ B;  1SLJ A;  3T1H H;  1YNN D;  5EDW A;  3LP8 A;  3PW4 A;  4YP3 A;  4DL6 A;  1R4P B;  4DV6 L;  3KAJ A;  4KTA A;  4B3S L;  1HNX H;  2VY3 A;  4AYB E;  4OGQ C;  1HR0 H;  4A93 B;  1FGB D;  1I4H A;  1HPC A;  2FXQ A;  5KT4 A;  1IOV A;  3DEO A;  5C4Z A;  4JC0 A;  3Q24 A;  1DD2 A;  3C3L A;  5KFB A;  4ECX A;  1F2M A;  3SI8 A;  5KGU A;  4B3R L;  3EFX D;  4TV9 F;  1X9N A;  4UP9 A;  2RA4 A;  4BA1 I;  1KIX A;  1KJ8 A;  1FNU A;  4ECR A;  1B9N A;  2F0S A;  1S0M A;  1RHP A;  3LWU A;  3UDI A;  2Y0S G;  4EVO A;  5I6W A;  4DV2 Q;  3S1R B;  3K7A H;  2UXB Q;  2E2D C;  2BE5 D;  4A93 G;  3D4R A;  3CVZ A;  5IYZ F;  3A7A B;  2UUA Q;  2XCA A;  4LF9 H;  1TII D;  3HRZ C;  2EJM A;  4R4O A;  5IE8 A;  3SVM A;  1ESF A;  2DGY A;  5KG1 A;  2CVR A;  2NZO A;  2D0P A;  4JI3 L;  2JA7 H;  4LMY A;  4MV7 A;  5IWA L;  1E24 A;  1VQP A;  3S15 H;  2R3Z A;  3RTX A;  3FMA A;  1U5K A;  1RIP A;  5EBC A;  3EN2 A;  4Y7N B;  3NEL A;  3TP8 A;  4FU0 A;  5F9L A;  4F4Z A;  2NVY B;  2W8L A;  2R6G A;  1EL0 A;  4K5V A;  3CQZ A;  2JA6 H;  2AWO A;  4G7O C;  3JC6 6;  3ORQ A;  4ECY A;  4APV A;  1Z7T A;  5KT2 A;  3PIP A;  5KFI A;  4KD4 A;  3OIP A;  1EFI D;  3I4M B;  3GTJ A;  5COY A;  1KDC A;  4DV4 H;  2QDB A;  4G7Z C;  1STY A;  3S1M H;  2YCH A;  2MO1 A;  5JVG 3;  3VA7 A;  4EBD A;  4CDD C;  1EUD B;  2WII B;  5CBE E;  2J0T D;  2B63 A;  1VQK A;  2HCC A;  3MXN B;  5AFW A;  2FMC A;  5H1S E;  5KT6 A;  2B2U A;  1Y1V G;  3Q23 A;  4ECZ A;  3RN5 A;  1WOC A;  4FBT A;  3DWP A;  3I4M G;  3Q8Q B;  3PW5 A;  5DG8 A;  4BY7 B;  4O4I F;  1B3A A;  4UDU C;  1RCV D;  1T5E A;  3QG1 A;  4NXN H;  1U0L A;  4LF8 L;  1TAE A;  2FIN B;  1H9S A;  4DR7 Q;  1X56 A;  3KLS A;  4RG1 A;  4M7E A;  4H13 C;  3G6E A;  1JIH A;  1OXV A;  4R8U B;  1NR2 A;  1F2L A;  2CFM A;  3TRZ A;  4BY1 H;  2L5T A;  1I4P A;  4RNM A;  1G6Z A;  2UUB H;  1WTR A;  5EGT A;  3W2D A;  4HJ5 A;  3OW2 A;  4BY7 G;  4PMB A;  4MV4 A;  4L63 B;  2VUM A;  3PO3 B;  5JPN C;  1WVL A;  4GOP C;  4J9R A;  1K83 B;  5IOC A;  1C4Q A;  3F1Z A;  3VA5 A;  4DPG A;  2F0V A;  4KN4 C;  4A76 A;  1ZHS A;  4LUO A;  4DV7 H;  3QWN A;  1KJJ A;  2PI2 E;  1ICF B;  1GOZ A;  3U4V A;  2VQF Q;  1HXY D;  4A3M H;  2R93 B;  2AUK A;  3RAQ A;  5KFS A;  3J7Z C;  3ND9 A;  4DF7 A;  2A5H A;  1D1K A;  3CPF A;  2PQA A;  3HOW B;  3HOV G;  1PFS A;  2Q2T A;  2ID0 A;  2VA2 A;  2JEA I;  1B50 A;  2NU9 B;  3T5L A;  2A69 D;  2X6G A;  1EOT A;  1XYI A;  3KF6 B;  5JAV A;  2R93 G;  2ZTD A;  4CKC A;  2K5V A;  1BR9 A;  1RD9 D;  3BS1 A;  5C4X B;  1HNZ H;  3BG5 A;  4JI0 H;  2F3V A;  3EJI A;  3A5Z B;  5KYI A;  5CV8 A;  3D0F A;  4XZ3 B;  1Z47 A;  3OUU A;  3GTQ A;  2XCL A;  3A8K E;  3H3V H;  1TWA B;  1IOW A;  5FO8 B;  2CW7 A;  4IUQ A;  3PQI A;  2JK8 A;  1ENA A;  2CZG A;  3RBE A;  2FMM A;  4RHS A;  3MAQ A;  4H44 C;  3H15 A;  1Q1B A;  5E4W C;  1Z2O X;  3A7L A;  1WR2 A;  3ORR A;  3L0O A;  2IMW P;  5EWE A;  1CS0 A;  3T1H Q;  3TQY A;  1HQR D;  3K80 C;  1OXT A;  4K0K L;  2EJF C;  1ZET A;  4LMQ D;  4FYD A;  2C00 A;  2UU9 L;  1KL9 A;  1HNX Q;  5FPO A;  2DPI A;  3GDE A;  1HR0 Q;  3I3C A;  4EEQ A;  3GIQ A;  3J80 L;  3CCS A;  1S10 A;  4NXM H;  1PHJ A;  2B2Y C;  1KDA A;  5GAD C;  2W9B A;  4JI7 H;  1DOK A;  4FF3 A;  3J7A 5;  2JA5 G;  2CW8 A;  4AYB B;  4JYA H;  3J80 c;  4RHR A;  1WCM A;  5E7N A;  4ED6 A;  1UWV A;  1VQ4 A;  4YQW A;  1KHI A;  2DY7 A;  2YU9 B;  4B08 A;  4DU9 A;  2E2J B;  1EYZ A;  1D8L A;  4NLG A;  4DAM A;  1B53 A;  1KAB A;  2CQY A;  3KOJ A;  2FK2 A;  4JI4 H;  1JX4 A;  1DGS A;  1Q8I A;  2KUM A;  5EKK A;  5HUR A;  4LF9 Q;  3RB6 A;  3KHL A;  2EYL A;  4TUY F;  1CKN B;  4KJN A;  2IX3 A;  3JRX A;  5DNF A;  5HBR B;  4QF4 A;  3E6Z X;  2VZA A;  4P2C B;  4K8J A;  1AN8 A;  1TQO A;  4A3K B;  2EYH A;  1ET6 A;  1SR3 A;  3HEJ A;  3K57 A;  2GPW A;  4F8M A;  3C2P A;  1VQN A;  4B3M H;  4IRK A;  2VW9 A;  1L1O B;  4EQ5 A;  4EBE A;  1Q81 C;  2R8J A;  5KEE A;  4DV4 Q;  5IGD A;  5M9O A;  4DR1 H;  1XXG A;  1BVS A;  5C3W A;  3KLS X;  3DM3 A;  3RV4 A;  2K04 A;  4A3K G;  4C2M H;  4OEL B;  5JUM A;  2AU0 A;  5C4H A;  1VQM A;  3SE0 A;  2O03 A;  2X6L A;  2EYP A;  4R8U A;  1SMY C;  2KJX A;  2RHS B;  1FNW A;  1K9M C;  3GTP B;  1XNR L;  1LUZ A;  1UE1 A;  5DM7 3;  3GTO H;  5CAE B;  3M9M B;  4YWK A;  2PMZ E;  1VKZ A;  3T1Y L;  2CCZ A;  3R2I A;  5DM6 3;  1SNQ A;  4YY3 H;  4NXN Q;  3N52 A;  1Q12 A;  1EWH A;  2KCC A;  2UXD H;  2AHO B;  3HZX A;  3GIM A;  1W93 A;  3NPP A;  4A3C H;  4ME3 A;  4HIK A;  3M9O B; 
#chains in the Genus database with same CATH homology
 2KHI A;  2QEX A;  3CCR A;  2I0Q A;  2UUB Q;  4A3J H;  4JI3 Q;  2N78 A;  4QIW E;  4TQU S;  1KD1 C;  1PH2 A;  4LF7 L;  2HHH Q;  4LWC A;  1Q82 C;  4DV2 L;  1I5F A;  1L1O C;  2UXB L;  1A0I A;  2LXK A;  1SRO A;  4GLV B;  3PO3 G;  4LF5 L;  4KHP L;  5JJK A;  3S1R H;  1JJC B;  4BBS H;  1EWI A;  4DV7 Q;  1HNW L;  5JJI A;  2MO0 A;  1K0R A;  2UUA L;  4DUZ Q;  4LNQ A;  2K52 A;  3S1Q H;  4GS3 A;  1NMF A;  2I5H A;  1VQ8 A;  1MIU A;  1Q8K A;  3CP0 A;  2YTX A;  4LUV A;  5AJ3 Q;  1IBL Q;  3PSI A;  4POF A;  1ASZ A;  2GVB A;  1X3E A;  3F8T A;  5GRO A;  1VQL A;  1OXS C;  2NVX H;  4AIM A;  4JI1 L;  2YTY A;  1X3G A;  3PCO B;  4DUY Q;  2Q2U A;  1YNX A;  3AFQ A;  1SE8 A;  1MJC A;  4OO1 G;  4IFD G;  2N49 A;  3PUZ A;  3U4Z A;  2EQS A;  1BBU A;  1VS0 A;  2BH8 A;  5GAH C;  2ZJR A;  3CCL A;  3NEM A;  1VCI A;  2Z6K A;  3IRB A;  1QVF A;  5LMN W;  2JA8 G;  5IYD G;  1HZB A;  1Y14 B;  1TWF H;  2K5H A;  1GVP A;  4XTC S;  1HNZ Q;  3NEN A;  4JI0 Q;  3I4N H;  3F2B A;  4X6A H;  4KLK A;  1VQO A;  3HOU H;  2R7F A;  3CME A;  1C7Y A;  1X54 A;  4NB3 A;  3KJO A;  5C4X G;  4AQY Q;  3I4M H;  1B7Y B;  1UEB A;  1J5E L;  1NMG A;  3TEH B;  1XMQ L;  1LYL A;  4X64 Q;  1YI2 A;  1GM5 A;  2MFI A;  4LF8 Q;  1XNQ Q;  2R7Z G;  3PO2 G;  2KBN A;  1PH1 A;  4HID A;  4POG A;  5C3E G;  3GTJ H;  3L2P A;  1GO3 E;  2ZJQ A;  2NVT H;  4BXX H;  3STB C;  2H5X A;  5C44 H;  3CCE A;  3T1Y Q;  3GTG H;  1X6O A;  1V43 A;  1SFO H;  3UDF A;  4JI8 L;  2B63 H;  1W3S A;  4A3D G;  4PZ7 A;  5IP9 H;  2N3S A;  1JT8 A;  1E7Z A;  1HZC A;  2ZJP A;  3H3V I;  4LFB L;  4BY7 H;  4GKJ Q;  5HGQ A;  1YJN A;  4A3G H;  4UP7 A;  4A3L G;  1NTG A;  3CCJ A;  4GN4 B;  3HKZ E;  4JI7 Q;  1CKN A;  2WFW A;  1L2F A;  4DR7 L;  1YIT A;  3KLW A;  1S40 A;  3TRE A;  2ZTC A;  3BZK A;  2RHQ B;  4JYA Q;  3FP9 A;  2E5L L;  3D31 A;  3EIV A;  1X65 A;  4P71 A;  3RLF A;  2IT1 A;  4LF4 L;  4AYB G;  5LMN L;  2R7D A;  2IX0 A;  4KHP Q;  1G51 A;  4DK6 C;  1N33 Q;  4BBR G;  1E3P A;  1XMO Q;  3AFP A;  3PF4 A;  3S2D H;  1RL2 A;  4JI4 Q;  3PO3 H;  2GVA A;  3I4O A;  2WP8 J;  3PGZ A;  3G4S A;  3TS2 A;  2UXC L;  1WFQ A;  2Z6K C;  4X62 L;  2K14 A;  1OXU A;  2LSS A;  4DR5 Q;  1CKM A;  2VQF L;  4OX9 Q;  1PVO A;  1HR0 W;  3ULJ A;  1CKO A;  1QVC A;  1MJE A;  3A74 A;  1B8A A;  3JAM c;  2R93 H;  1PH6 A;  2HIV A;  3KFU A;  1EIF A;  1VQE A;  3TS0 A;  1FGU A;  4IPD A;  5BR8 Q;  4GKK L;  4TVA B;  1AE2 A;  4DV1 L;  4DR6 L;  3S14 H;  4GOP B;  1M1K C;  2GN5 A;  3AYH B;  5IY0 A;  3J81 j;  1KRT A;  4B3M Q;  4A3I H;  3HOW H;  3KYH C;  1XPO A;  2JA8 H;  1CSP A;  3FKI G;  4EX5 A;  1YIJ A;  5IYD H;  4GLX A;  2I5M X;  1VQF A;  3G48 A;  1KXL A;  1YHB A;  3L7Z C;  1VQG A;  2JE6 I;  4R4C A;  3JAM i;  2K5N A;  3GTK H;  2V1C C;  4K0K Q;  1PH3 A;  1N32 L;  3CXC A;  1Q7Y C;  1N34 Q;  1TWG H;  2EXD A;  4DR1 Q;  1XJV A;  2E2I H;  3S17 H;  1JJG A;  5C4X H;  1PH8 A;  2UU9 Q;  4KI0 A;  1Y1W G;  2UUC Q;  5LMU L;  4C3J H;  3G71 A;  1Q86 C;  1EQR A;  3PF5 A;  4B3T L;  1I94 Q;  1CUK A;  1KRS A;  1VQ6 A;  3PO2 H;  1TWA H;  5C3E H;  4DKA C;  4L5S A;  1I6H H;  1SMX A;  4QQB X;  1KQS A;  5HY6 A;  3BU2 A;  4A3E G;  3CC2 A;  1YBY A;  3T1H L;  3RLO A;  2F4V L;  3GTQ H;  2OWO A;  3S1N H;  3RR5 A;  1P8L A;  4LFB Q;  2D0O A;  3FHW A;  3E0E A;  1XTD A;  1E1O A;  4R4Q A;  4OO1 I;  1HNX L;  4IFD I;  4JV5 L;  1P16 A;  3OTO Q;  1HR0 L;  4YY3 Q;  5M5W H;  2UXD Q;  1S72 A;  2AKW B;  3UE1 A;  2E5L Q;  3KJP A;  3CMA A;  5M5X H;  3PUX A;  1IXR A;  3UDX A;  2ATW A;  4PG3 A;  5M3M G;  1IBK Q;  4HJ7 A;  2PI2 A;  2JA7 G;  1R9T H;  1JJ2 A;  4LFC Q;  5IYC H;  4DV0 Q;  1KAW A;  1XPU A;  5JEA G;  2AMC B;  4BBR H;  1HZA A;  3KDF A;  4YHH Q;  3F2D A;  2IX1 A;  4GNX A;  3CCU A;  4X62 Q;  2YU9 H;  2E2J H;  1OTC A;  4J15 A;  1O7I A;  2N8N A;  1WCM H;  2JA6 G;  4LF9 L;  3HOZ G;  2K75 A;  1NY4 A;  1GD7 A;  3KDF B;  4QL5 A;  4JI2 L;  4GNX B;  3PV0 A;  1YJ9 A;  4LF6 Q;  3S16 H;  2F52 A;  4WJ3 M;  2CWP A;  4JI5 Q;  4GKK Q;  2YV5 A;  1N8R C;  1FJG L;  5M3F G;  5K36 G;  3LGJ A;  4IJH A;  1IBM L;  3CF5 A;  2OQK A;  5C0X J;  2NVQ H;  2CQO A;  4DR3 L;  4A3B G;  1G6P A;  1AE3 A;  1QUQ A;  5EAY A;  4DR4 L;  3E9H A;  1HZ9 A;  4GN3 B;  1E1T A;  4UPA A;  4LUZ A;  2JEB I;  1N36 L;  4PMW A;  1LM0 A;  4DV3 L;  4P72 A;  4A3K H;  2Q2I A;  4RMF A;  4OWX B;  1VQJ A;  3FKI H;  1PH5 A;  1N32 Q;  3H0G G;  2Q2H A;  3HKS A;  1QUQ B;  1SLJ A;  3HOV G;  1XNR Q;  2IY5 B;  1YHQ A;  5LMU Q;  1BBW A;  1EUJ A;  4DV4 L;  4JG2 A;  2OTL A;  1I50 H;  1PH9 A;  2Y0S E;  1Y1W H;  4X66 Q;  4DV6 L;  1UE7 A;  3K81 C;  4DR2 L;  4B3S L;  2VY3 A;  2WB1 G;  4AYB E;  3PUY A;  1EFW A;  1VQ9 A;  4LFA Q;  1EQQ A;  3ER0 A;  4JI6 L;  1VQI A;  2FXQ A;  5M5Y H;  1UE5 A;  5J3B A;  1N9W A;  4JC0 A;  5C0X I;  1K8G A;  3STB D;  4DV5 Q;  2VNU D;  4B3R L;  1X9N A;  4IOC A;  2OQ0 A;  4UP9 A;  4BA1 I;  4BY1 G;  4O0A A;  3AQQ A;  1KIX A;  3GTP H;  4LF7 Q;  3UDI A;  2Y0S G;  4DV2 Q;  3K7A H;  2UXB Q;  4GNX C;  3RNU A;  4NXN L;  4LF5 Q;  4A93 G;  2KCM A;  3NBH B;  2C35 B;  3F2C A;  3RN2 A;  4LW1 A;  4JBM A;  1HNW Q;  2UUA Q;  4A3M G;  4A3J G;  2HQL A;  2K4K A;  2NN6 G;  2ZM6 L;  3UDG A;  4R4O A;  5IE8 A;  1V1Q A;  5M3M H;  2DGY A;  3J81 c;  3BJU A;  2UUB L;  2NZO A;  2D0P A;  3M9B A;  4JI3 L;  2JA7 H;  3HOW G;  5IWA L;  1IZ6 A;  3Q8D A;  4IPH A;  4YCW A;  1E24 A;  4GOP A;  1E22 A;  4JI1 Q;  1VQP A;  2HHH L;  1IL2 A;  3S15 H;  3K8A A;  1U5K A;  1RIP A;  4MTN A;  3M85 A;  1WI5 A;  2JA9 A;  3J80 i;  3HOX G;  3EN2 A;  3NEL A;  4DR6 Q;  2R6G A;  4PZ6 A;  4GN5 A;  4DV7 L;  2JA6 H;  2AWO A;  2VQE L;  3HOZ H;  3JC6 6;  4QJF A;  1PYB A;  4DUZ L;  4APV A;  1X55 A;  3J81 i;  2JJQ A;  3PIP A;  2E8G A;  4R4T A;  3GTM H;  1A62 A;  5IP7 G;  5M3F H;  3S1M H;  1IBL L;  4IFD J;  5AJ3 L;  3ICE A;  4P75 A;  4L5Q A;  2MO1 A;  5ELO A;  3HFZ B;  2DUD A;  3VDY A;  1C9O A;  1J5E Q;  3K7U C;  4A3B H;  2I5L X;  4IPG A;  4DUY L;  1XMQ Q;  1ASY A;  1N33 L;  1S3O A;  2KHJ A;  1WJJ A;  1C0A A;  4YCV A;  1VQK A;  3MXN B;  2QA4 A;  5H1S E;  2QGQ A;  3DLL A;  4R1J A;  2F3I A;  2R7Z H;  1Y1V G;  3H0G H;  4JCV E;  1TXY A;  3RN5 A;  2RF4 A;  1WOC A;  3CPW A;  4P73 A;  1PYS B;  4HJ8 A;  1EIY B;  4JI0 L;  1D7Q A;  4DV6 Q;  3I4M G;  1QZH A;  4JBW A;  1PH4 A;  4JI8 Q;  1EYG A;  1Z9F A;  4UY8 C;  2KCT A;  4OXP A;  3I56 A;  3I7F A;  4A3D H;  3MEF A;  1U0L A;  4X64 L;  4LF8 L;  2A1A A;  4BXX G;  3EBE A;  3AEV A;  1J6Q A;  1X56 A;  4DR7 Q;  4B3R Q;  4RG1 A;  2IHF A;  3G6E A;  4HIO A;  4A3L H;  1OXV A;  1FL0 A;  2ES2 A;  1LTL A;  1HH2 P;  2B63 G;  5JJL A;  1BKB A;  1GKH A;  2CFM A;  5IP9 G;  4BY1 H;  1KC8 C;  4LF4 Q;  3TRZ A;  3WWV A;  3PUV A;  2HT1 A;  4BY7 G;  4HJ5 A;  3OW2 A;  1PV4 A;  5LMN Q;  2OTJ A;  1PA6 A;  4A3G G;  1I3Q H;  2WAQ G;  5GAG C;  4GOP C;  4OON A;  5FLM G;  1T9H A;  1NE3 A;  2NZH A;  3F1Z A;  4GKJ L;  4DPG A;  4A93 H;  4NXM L;  4JI7 L;  4DNI A;  4A76 A;  3GO5 A;  4YWM A;  4LUO A;  3GD7 A;  1NBW A;  1PH7 A;  2UXC Q;  1FVI A;  2PI2 E;  4A3M H;  3U4V A;  2VQF Q;  5IWA Q;  2ASB A;  4JYA L;  4FDB A;  4YCU A;  3J7Z C;  2LXJ A;  4WJ4 A;  3ULP A;  1VQ7 A;  4H02 A;  1SRU A;  3CPF A;  5IYB G;  3ERS X;  5FJ8 G;  2PQA A;  3KF6 A;  4IJL A;  4DV1 Q;  1G29 1;  4UP8 A;  1PFS A;  3HOX H;  3CCV A;  2MQH A;  5ELN A;  2VQE Q;  3CC7 A;  1VQD A;  1XMO L;  2WB1 E;  2Q2T A;  1V9P A;  4QGU A;  2ID0 A;  1QVG A;  2BA1 A;  4JI4 L;  2JEA I;  2R92 G;  4IOA A;  3BZC A;  2VUM G;  2B29 A;  3M4O H;  1H95 A;  2PQA B;  3KF6 B;  4DR5 L;  4OWT B;  2R93 G;  2ZTD A;  4OX9 L;  2K5V A;  2CWA A;  2BH2 A;  2XGT A;  1UE6 A;  3M3Y H;  1K8A C;  3A5Z B;  5IP7 H;  1K73 C;  1SN8 A;  4A3F G;  2E2H H;  3D0F A;  1Z47 A;  5BR8 L;  1NJI C;  3B6Y A;  3A5U A;  3H3V H;  4A3I G;  4GLA C;  4B3T Q;  2JK8 A;  4ALP A;  4Y7N H;  2NN6 I;  3HOY G;  3A0J A;  2L15 A;  4X65 L;  2NVY H;  4B3M L;  2YYZ A;  3H15 A;  1OXX K;  1Q1B A;  1XPR A;  4BA2 I;  1Y1V H;  1CSQ A;  1VQA A;  1YZ6 A;  4JOI A;  3L0O A;  2A8V A;  3W5O A;  2Z0S A;  3PIO A;  3T1H Q;  3TQY A;  1EOV A;  3K80 C;  1OXT A;  3E9I A;  2F4V Q;  2ZTE A;  4K0K L;  1WYD A;  3RLN A;  4A4I A;  1N34 L;  5FLX c;  4L5T A;  4DR1 L;  4A3E H;  2MNA A;  3CQZ H;  3S2H H;  2UU9 L;  1KL9 A;  3M4Q A;  1HNX Q;  2UUC L;  4R4I A;  4DAY B;  1M90 C;  3GDE A;  1HR0 Q;  4JV5 Q;  4JBJ A;  4C3H H;  4Y52 H;  1QZG A;  4DK3 C;  3CCS A;  3I55 A;  1TWC H;  1I94 L;  1PHJ A;  5GQO A;  3PUW A;  5GAD C;  1VQB A;  3J7A 5;  3ULL A;  4A3C G;  2JA5 G;  4KHZ A;  4XIG S;  3J80 c;  3CD6 A;  5E7N A;  1UWV A;  3I2Z A;  1VQ4 A;  4YWL A;  4HIM A;  1KHI A;  1YJW A;  1D8L A;  4NXM Q;  3UE0 A;  4AH6 A;  3W1G A;  4DAM A;  5FLM H;  3OTO L;  4YY3 L;  1X3F A;  3KOJ A;  4QY7 A;  3CC4 A;  2UXD L;  1DGS A;  4OWW B;  2ALY B;  2PNH A;  4IPC A;  4BBS G;  4LF9 Q;  3CW2 C;  1CKN B;  2D62 A;  1L0W A;  4JI2 Q;  5JEA J;  1VQH A;  1K3R A;  5IYC G;  3CCQ A;  3RZO H;  3CCM A;  1IBK L;  4A75 A;  1FJG Q;  1JB7 A;  2VZA A;  3GTL H;  4LFC L;  5IYB H;  1IBM Q;  4DV0 L;  1AH9 A;  5DLQ E;  1IYJ B;  2VL6 A;  5FJ8 H;  1VQC A;  1L1O A;  3SGI A;  4DR3 Q;  3HOV H;  4HJ9 A;  1K83 H;  1WCM G;  3HKZ G;  2AWN A;  4YHH L;  4DR4 Q;  2YTV A;  1SR3 A;  2B3G A;  2VS1 A;  2R92 H;  1N36 Q;  4DV3 Q;  1Q46 A;  5IT9 c;  1JMC A;  1VQN A;  1JE5 A;  1TWH H;  5GAE C;  2VUM H;  2VW9 A;  5C0X G;  1HJP A;  1B70 B;  1L1O B;  2HIX A;  4EQ5 A;  3I4N G;  4JOI C;  3U58 A;  1Q1E A;  1Q81 C;  4LF6 L;  4MZ9 A;  3HOU G;  4JI5 L;  4DV4 Q;  4A3F H;  1A8V A;  1BVS A;  1HNZ L;  1VQ5 A;  1W2B A;  3DM3 A;  3U50 C;  1YHA A;  3KF8 B;  4DR2 Q;  4B3S Q;  2KEN A;  4X65 Q;  3K0X A;  3OYY A;  4A3K G;  4C2M H;  2WAQ E;  3S24 A;  1VQM A;  4AQY L;  4JI6 Q;  3HOY H;  2RHS B;  2K50 A;  4MNO A;  5C4J H;  1K9M C;  4P74 A;  1XNQ L;  3ZJY C;  5C44 G;  3M7N A;  1XNR L;  2CKZ B;  2IHE A;  2XTI A;  1LUZ A;  1UE1 A;  4IO9 A;  3GTO H;  4O2D A;  1YEZ A;  4YWK A;  2PMZ E;  2EIF A;  2RCN A;  4PZ8 A;  3T1Y L;  3W1B A;  1MKH A;  4X66 L;  2BA0 A;  2CCZ A;  1A63 A;  4LFA L;  4HJA A;  4NXN Q;  1Q12 A;  4NPS A;  2OCE A;  1YVC A;  2A19 A;  3RZD H;  4L5R C;  3CAM A;  2AHO B;  4C3I H;  4A3C H;  4ME3 A;  3M4P A;  2JA5 H;  4JBK A;  2ZM6 Q;  4DV5 L;  4HIK A;  2JQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...