3HOZG

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hozG01
4JI5L 3J7ZC 4IFDJ 2R6GA 4KI0A 3PO3G 4DPGA 4FDBA 1XMOL 4JI0Q 4IPHA 1N33Q 4JBWA 1UWVA 1SN8A 3F8TA 2K52A 3H3VH 4DUZL 2UU9Q 2CFMA 5AJ3L 4TVAB 1L2FA 3HOYG 2IHFA 2K4KA 3M3YH 1X54A 4QQBX 2OQKA 4JBJA 4DR3L 2Y0SG 1U5KA 3HKZG 5IP9H 4DV4L 1A62A 3F2CA 3ULJA 1DGSA 1VS0A 3AFQA 5IYDG 1N9WA 4B3RQ 3RNUA 1YVCA 1ASZA 1Q7YC 4X6AH 2UUBQ 3PGZA 3HOZG 3M4PA 4IPCA 4AYBE 4JI3Q 5H1SE 4X64Q 3RLOA 4C3IH 3GD7A 2WP8J 5IWAL 2HHHL 4B3TQ 3CPFA 2H5XA 4A3KH 1S40A 1WI5A 3KLWA 3K8AA 1E24A 3A5ZB 1K8GA 3HOUG 1HR0L 1Y1VG 4JI8Q 5BR8Q 5C0XJ 3CCLA 4DV7Q 1FJGQ 3PCOB 1EIYB 3M85A 4Y7NH 4P75A 3K80C 1QZGA 4B3SL 1PH6A 1NMGA 2N8NA 1Y1WG 1SROA 3NEMA 1J5EQ 3AYHB 2N3SA 2ASBA 3T1YL 2HIXA 5GADC 4UP9A 3CF5A 5JEAG 3CC4A 4DR7Q 2JA9A 3JAMi 4MNOA 1QUQA 1QVFA 4BY1H 1GKHA 1HNXL 4LFCL 2UUCL 3UDFA 1QUQB 2UXBQ 2UUAL 5HY6A 4X66Q 2NVTH 1NJIC 2C35B 1LTLA 3ULPA 5C4XH 2E8GA 4ALPA 1SMXA 1HR0W 2B63G 1E7ZA 3S2DH 4APVA 3EBEA 5GQOA 3RR5A 4DV2Q 4GOPC 4UP7A 4DAMA 3PUXA 4NXML 5C4JH 4NXNL 2WFWA 1UE7A 4A3BG 1KAWA 5IP7G 1H95A 4DV0Q 1QVGA 5IYBH 3DLLA 4GN5A 4GLVB 4YCVA 3J7A5 1BBUA 1I3QH 2E5LQ 1VQFA 2YV5A 4DR6L 1XTDA 3AFPA 4JG2A 3PUZA 3W5OA 4A3JG 4GKKL 2CQOA 2GVBA 1WYDA 1NTGA 4LNQA 2CWAA 3I4OA 2I0QA 3A0JA 2F3IA 4J15A 4X65Q 4LFBQ 1VQ7A 3NELA 4GLAC 1YJNA 5C44H 3I2ZA 2VQEQ 1KD1C 3HFZB 2WB1E 3KDFA 4DV5L 3PO3H 4AYBG 1AE2A 1GVPA 3FHWA 3KDFB 5LMNQ 1YI2A 3ULLA 2RHQB 4A3CG 3NBHB 2K50A 3S1RH 4JI2Q 1TWHH 2K75A 4DV1Q 1SRUA 4KHZA 1E22A 2OQ0A 3PSIA 4OWXB 2R7FA 3ERSX 3OTOQ 4JI0L 4JI7L 1N33L 3KFUA 1HH2P 1YHBA 1KXLA 1XMQQ 2HQLA 1AE3A 1Q46A 3HOVG 4JYAQ 2QEXA 5ELOA 1WFQA 1PH2A 1I50H 1TXYA 3TS0A 5IYDH 1UEBA 3GTOH 3GTQH 1B8AA 2KCMA 4IPDA 2IX1A 1PFSA 5K36G 1UE5A 3HOZH 5JEAJ 2JA7G 4JOIC 3CQZH 4YCUA 5ELNA 3HOXG 2BA0A 3U4ZA 1W2BA 4B3RL 2UUBL 3CCSA 5C0XG 3FKIG 3BU2A 1VQDA 3PO2H 4JI3L 1XPRA 1P8LA 3U58A 1X9NA 3CP0A 3CXCA 1M90C 5M3MH 1FVIA 1T9HA 2LSSA 4B3TL 3HOUH 3STBC 3M4OH 1VQ5A 1K83H 4A3DG 1S3OA 5LMUQ 1NMFA 1PH5A 3I4MH 4QIWE 3PUWA 5DLQE 4R4TA 1X3GA 3M9BA 3A74A 4XTCS 2Q2HA 4JI8L 5BR8L 4DV7L 1Y1WH 1SFOH 5M5XH 5M5YH 1FJGL 3PV0A 4K0KQ 3KJOA 3BZCA 4A93G 1BBWA 2D62A 4DUYQ 2XTIA 2B3GA 2GN5A 1HZ9A 3LGJA 3KJPA 3KOJA 4LF4Q 1U0LA 1Q86C 1TWCH 1PYSB 3E9HA 1PA6A 1VQKA 2ZJQA 4A76A 3T1HQ 4LF9Q 3I4NG 4TQUS 3L7ZC 4A4IA 4DR7L 2ZJRA 1M1KC 4POGA 4WJ3M 2YTYA 3S24A 4LF7L 2B63H 2UXBL 1PH1A 4AIMA 4X66L 2BH2A 1Z47A 4A3IG 1BVSA 4IPGA 4A3EG 1OXTA 4HJ8A 4L5SA 3A5UA 2OTJA 4DKAC 4EQ5A 1VCIA 5C0XI 2JEAI 4GN4B 3I56A 1YEZA 1I94Q 1EFWA 2JA5G 1C9OA 2ZTDA 1SE8A 2A1AA 1E3PA 5IP7H 1FGUA 3OW2A 3F2BA 2K5VA 2YTVA 4YWMA 4PG3A 2CWPA 2ATWA 2R93G 4POFA 3AEVA 4YCWA 2LXJA 3GTJH 3CMAA 4DV0L 1IBKQ 2F4VQ 3EIVA 2AKWB 4IO9A 4DR5Q 4JI1Q 4A3JH 3M7NA 2I5MX 2N49A 3CCEA 4A3LG 3G4SA 3L0OA 4PZ6A 3PIPA 2UXCQ 1LUZA 2MQHA 2AMCB 3ZJYC 1K8AC 1YIJA 1PH3A 4MTNA 3S14H 1YNXA 2IY5B 5JJLA 4WJ4A 4L5QA 3L2PA 4LW1A 1JJ2A 3FP9A 4OX9Q 3GTPH 4X65L 4LFBL 1IBMQ 4A3CH 1VQNA 2VQEL 1D8LA 3ER0A 3RN5A 2JA8H 4A3GG 3W1GA 1IYJB 1TWAH 2EQSA 1UE6A 5LMNL 4JI6Q 4DV6Q 2Q2UA 5IE8A 1Q82C 1X56A 4JI2L 1XNQL 3J80i 2Q2IA 4BBRG 1VQLA 3BZKA 3HOVH 4LFAQ 3OTOL 1YITA 1E1OA 1JJCB 4GKJL 2XGTA 5FLMG 2VUMG 1XMQL 4JYAL 2MO0A 1HJPA 4AQYL 2JA7H 3HOXH 1N36Q 2L15A 2D0PA 1C0AA 3CCRA 4JI4Q 1IBLQ 1IXRA 4RG1A 2PMZE 4A3MG 3FKIH 1VQBA 3S1MH 4R4QA 5LMNW 4UY8C 2VQFQ 1Q12A 4A3FG 1EUJA 4EX5A 4LF8Q 4A3DH 1VQOA 4C3HH 4PMWA 4HJAA 1JJGA 4LF5L 4AH6A 4L5TA 1PVOA 3GDEA 4UP8A 2WAQE 4DR2Q 1Q8KA 3B6YA 4LF6Q 3S16H 5LMUL 3CCJA 2JEBI 2ZTEA 1Q1BA 4A93H 3KF6A 2AHOB 1XMOQ 2R7ZG 3KF6B 3U50C 4DR1L 2VY3A 4ME3A 4X62Q 3GTMH 4IJLA 1KC8C 1NY4A 4K0KL 2K5NA 5M5WH 1NE3A 4YWKA 4DUYL 3VDYA 3I4NH 3GO5A 2D0OA 4DR3Q 3PUVA 1KRTA 1YJWA 4LF4L 1JT8A 2ZM6L 1A8VA 3CW2C 5E7NA 4LF9L 3M4QA 2LXKA 1LM0A 1GM5A 4A3EH 4OO1G 2YTXA 3K81C 2MNAA 3K0XA 2PNHA 1HNZL 1FL0A 3CPWA 4YY3Q 4HIMA 1HZBA 4HJ7A 3HOYH 1HNWQ 5HGQA 2JA5H 3I55A 4DR4Q 2NZOA 4DV3Q 1B7YB 1X65A 5IWAQ 1OXVA 2N78A 1KHIA 4R4CA 1KIXA 2UU9L 4LUVA 1KQSA 3S15H 4OWTB 2R93H 1WCMG 1I94L 3F1ZA 4QL5A 1XPUA 3W1BA 4JV5Q 5JJIA 1PH8A 1VQ9A 1CUKA 1O7IA 1V9PA 4QY7A 1N8RC 1VQIA 2I5HA 3GTKH 4A3LH 1CKNA 3KYHC 1RL2A 1Y14B 3CC2A 2F4VL 1CKNB 2Y0SE 2BH8A 3HKZE 4DR5L 1UE1A 4JI1L 3KF8B 4KHPQ 4X64L 4P74A 1K3RA 3H0GG 3S17H 1Y1VH 1YBYA 2UXCL 2MO1A 1PYBA 3CCUA 5GROA 2UUAQ 3D0FA 2KHJA 3E0EA 1EQQA 5M3FG 1IBML 1JMCA 1TWGH 4BBRH 1VQ6A 1IZ6A 2GVAA 3CC7A 1PHJA 4DV6L 2Z6KA 2PI2E 3J80c 3HKSA 3G71A 1J5EL 4NXMQ 3HOWG 2UXDQ 2JK8A 5FLMH 3S2HH 4JBKA 1GD7A 4O2DA 4LFAL 1ASYA 1WOCA 4PZ7A 4YHHQ 2VW9A 4A3MH 4DR6Q 2NZHA 1N36L 2OCEA 3J81i 1TWFH 1BKBA 2E2JH 2RHSB 3IRBA 3WWVA 3J81j 1IBLL 4A3FH 3UDGA 4B3MQ 4HJ5A 2K14A 4GKKQ 3PUYA 2WB1G 2JE6I 5GAEC 5IYCG 1K9MC 1PV4A 2ZTCA 4LUZA 4JCVE 4DV2L 4HIDA 1VQCA 2F52A 1XJVA 4LF8L 1VQ4A 3AQQA 4DNIA 2HIVA 4GS3A 3CMEA 4DAYB 3ICEA 4R4IA 2R7ZH 2R92G 3CCMA 2ZJPA 1Q81C 4BXXG 1MIUA 4DR2L 1LYLA 3RN2A 4JC0A 1J6QA 2E5LL 4LF6L 4HIKA 1L1OA 1VQAA 5FJ8G 4P71A 3E9IA 1HZCA 2ALYB 4JI7Q 1L1OB 2JQOA 2MFIA 4P73A 2NVYH 4C2MH 4QGUA 4UPAA 4X62L 4OXPA 2BA1A 1PH7A 1YJ9A 2ES2A 2KENA 3UDIA 5C3EG 1YZ6A 2RCNA 3RZDH 4IOCA 1MKHA 1OXSC 4IJHA 2JA6G 1VQHA 4BA1I 4P72A 1N32Q 5GAGC 2KCTA 2Q2TA 4JBMA 4NPSA 3I7FA 3TS2A 2K5HA 1OXUA 3GTLH 1R9TH 3RLFA 1B70B 4DV1L 4LUOA 4YY3L 1N34Q 1Q1EA 1HNWL 1WCMH 4DR4L 2B29A 4DV3L 1SR3A 3K7UC 1PH4A 3UDXA 5JJKA 1VQPA 4IOAA 3PO2G 4KLKA 1V43A 2AWOA 2ID0A 5EAYA 3NENA 5M3MG 2E2IH 1PH9A 1I5FA 1YHAA 1XNRQ 4A75A 1X55A 4DK3C 1D7QA 3UE0A 3CD6A 3F2DA 3I4MG 2HT1A 4BY7G 4HJ9A 3H0GH 5IY0A 2V1CC 4BBSG 3BJUA 4O0AA 4KHPL 2RF4A 3UE1A 1RIPA 4QJFA 1C7YA 3MXNB 4GLXA 2OWOA 5AJ3Q 4LF7Q 5M3FH 2KBNA 3TREA 4JI5Q 1VQEA 2CCZA 3MEFA 3CCVA 2A8VA 5J3BA 1X6OA 3TEHB 2PQAA 1VQGA 5FLXc 4DUZQ 3HOWH 1EOVA 2PQAB 1IL2A 2KHIA 2E2HH 2VS1A 3PF5A 2PI2A 1KRSA 1E1TA 2UXDL 2NN6G 4NB3A 4DV4Q 3T1HL 1K73C 2QA4A 4A3IH 2OTLA 4OWWB 1WJJA 1P16A 1G51A 2YU9H 3U4VA 2JJQA 1X3FA 5IP9G 4H02A 1CSPA 1YHQA 4YHHL 3K7AH 1EWIA 1CKOA 4OONA 3J81c 5IYCH 2IT1A 2HHHQ 2NVQH 1X3EA 1NBWA 1XPOA 4B3ML 3EN2A 4GNXC 4IFDG 4R4OA 4YWLA 3S1NH 4HIOA 1HR0Q 4GOPA 4A3KG 2R92H 1MJEA 1JB7A 4BXXH 1JE5A 3TRZA 4GOPB 4PZ8A 2AWNA 1IBKL 4B3SQ 5FJ8H 4MZ9A 2Z6KC 2NVXH 4XIGS 1XNQQ 3H15A 1K0RA 2JA8G 3G48A 3PIOA 3T1YQ 1CKMA 3SGIA 5C3EH 2FXQA 1QZHA 4JV5L 1HNXQ 2UUCQ 4LFCQ 3S1QH 2EXDA 2JA6H 3H3VI 4GKJQ 4GNXA 4A3GH 2NN6I 1Z9FA 2Z0SA 4GNXB 4OX9L 4AQYQ 4OO1I 2YYZA 2EIFA 2CKZB 2A19A 4BY1G 1OTCA 3GTGH 4A3BH 1A63A 1N32L 1A0IA 2IX0A 3CCQA 4L5RC 4DK6C 4BA2I 4JI6L 5C4XG 2VNUD 2DUDA 4Y52H 4LWCA 2I5LX 1GO3E 2VUMH 2DGYA 2WAQG 1N34L 4NXNQ 2VZAA 3RLNA 4IFDI 1HZAA 4LF5Q 1I6HH 4GN3B 1VQJA 3PF4A 3CAMA 1EYGA 1L1OC 3Q8DA 4BY7H 3OYYA 4JI4L 1MJCA 5IYBG 5IT9c 3D31A 1XNRL 4R1JA 4DR1Q 3TQYA 4BBSH 1S72A 3JC66 4JOIA 2R7DA 1CSQA 2QGQA 1L0WA 4C3JH 5GAHC 1VQMA 3RZOH 1G6PA 1EIFA 3G6EA 2VQFL 1KL9A 2IHEA 1W3SA 4RMFA 3STBD 2ZM6Q 1QVCA 1SLJA 1V1QA 4DV5Q 1EQRA 1G291 3JAMc 2VL6A 1OXXK 1AH9A 1VQ8A 3DM3A 5C44G 1HNZQ
chains in the Genus database with same CATH superfamily
4JI5L 4IFDJ 2EY1A 1L2ZA 1XMOL 4LJZC 1GUOA 4ZQ3A 1WTWA 2B2YC 2L9HA 5KYLA 4C3HB 4ZI7F 4JI7H 3NHHA 1KBLA 1JICA 1U5KA 4R8NA 4DL4A 2CW0C 1DGSA 1VS0A 1RCVD 5IYDG 2MCTA 1N9WA 5FPRA 1RODA 1ASZA 3GTMB 4I7AA 3OIQA 3SE0A 3HOZG 3JAML 5JVG3 2C2EA 3IFDA 4HQ6A 3RLOA 3J81E 4C3IH 2HHHL 1N34H 4K2KA 1EZ8A 2RSNA 4A3KH 1CZGA 4QMGA 1S40A 2F0IA 4J9RA 2CW0D 3DWAA 2X69A 1I4GA 2R7MA 5KFXA 3EYYA 1DZ1A 3D3RA 1C3OA 2EY2A 1FJGQ 3HOYB 1M7JA 2PW7A 2JA5B 3PW7A 2RVLA 5BR8H 1LABA 2KA7A 3U9TA 1SROA 3AYHB 2N3SA 2YZNA 2HIXA 5JEAG 1H9SA 3PQIA 4DR7Q 3T16A 2UUCL 3A56A 1QUQB 1ENFA 3UDFA 3V6HA 2NVTH 4ECWA 3HG9A 4QUCA 2K6AA 5JH7F 4UCRA 2W9CB 4ALPA 3IAYA 1IYUA 1CQJB 2P5ZX 1HR0W 2EJFC 2CVRA 3UFXB 2K33A 3DWQA 1WH2A 1BOSA 1PTOH 3QWNA 3S17B 1Y1VB 1K83B 3QIAA 2XD4A 4ED7A 3C1EA 5GQOA 4DAMA 5KT3A 4RHRA 3KHLA 2ZDGA 1KAWA 3I90A 5IP7G 2V5AA 1H95A 4DV0Q 2VPQA 1TR5A 3J7A5 1I3QH 1TQOA 5KG0A 3NQTA 4DR6L 1XTDA 5EWGA 3BVZA 1A3UA 5C3XA 5IT9E 4ECTA 2GVBA 3S2HB 2NU9B 1TS5A 2HHHH 2CWAA 1DV2A 4DL6A 4TQSA 4G7HC 1JLLB 4YR0A 3A0JA 2QYZA 1CA5A 4EQPA 1YJNA 5C44H 3I2ZA 1HUMA 1CK1A 3KDFB 2PN1A 1TWFB 2E2JB 3W2DA 4EYHB 2K50A 4A3FB 3S1RH 3T53B 3QG1A 1TWHH 4JI2Q 3H09A 4DV1Q 4A3BB 5LMNH 3T5LA 3OTOQ 4G7OC 1L0YB 1KXLA 1XMQQ 2C00A 1LTTD 5KFOA 1H9RA 4FBUA 1LTID 1WFQA 5IYDH 1WD1A 3D4WA 4ZRZA 2KEEA 1B8AA 4IPDA 5I9OA 3GTQH 5K36G 3HOZH 2HD3A 4YCUA 3HOXG 3U4ZA 4IUQA 3CCSA 2FLPA 5C0XG 1K3BC 5BPFA 4AYBB 1XPRA 1X9NA 5FKAC 1E4GT 1M90C 2CH4W 5M3MH 2LSSA 3K5NA 3M4OH 4F87A 3HP3A 3GLKA 1R9TA 1Q8IA 4C3HG 5JPMC 5DM63 3PW5A 2HVSA 1F2ZA 4R4TA 1B1ZA 1D5MC 1SFOH 3G8CA 1GUNA 1FJGL 1CI3M 4EQOA 3PV0A 3BZCA 1CE8A 4K5WA 2B3GA 5JEAH 2GN5A 3KJPA 4DR1H 1NR2A 4LF4Q 2TSSA 5DQHA 1Q86C 3E9HA 4RA8A 2JA7B 1QG7A 3L7ZC 4A4IA 4CHTB 4DR7L 4XQNA 4WJ3M 1JDBB 3FKIB 2R7NA 4ED8A 1G2TA 2BH2A 4IRCA 3QOJA 4A3IG 1BVSA 2J9GA 4Q8FA 5CYUA 1HNZH 1F9PA 2ZT9C 1I94Q 4UCUA 2JA5G 2ZTDA 2A1AA 5IP7H 1FGUA 1HQMC 4UAIA 1G2SA 1W6JA 3OW2A 2NYZD 5M3FB 2W8KA 1T3NA 4PNYA 5KG4A 4C5BA 2ATWA 1PRTC 4POFA 3MTSA 2LXJA 1HPCA 3CMAA 4DV0L 3ZYYX 3J80L 1EFID 5I4DA 1TU2B 5KFEA 3RBDA 2AKWB 3M7NA 4J9KA 2N49A 3CCEA 3VR4A 1TA8A 3G4SA 2DIKA 2P0AA 2EYMA 1SE2A 2MQHA 3ZJYC 1K8AC 3S14H 2IY5B 2ZDQA 1PH3A 5JJLA 3L2PA 1V51A 1WTHA 5KNDA 3FMCA 3MFGA 4XYLB 4GZYC 1B44D 5IODA 3MJFA 3ER0A 4A3GG 2WB1B 1IYJB 3E5NA 1TWAH 1UE6A 4LMQD 1PX2A 1X56A 4JI2L 1VQLA 3R93A 2C5CA 2G9HD 2R92A 3KLSX 3OTOL 3K3PA 4GKJL 1DIKA 1XMQL 5LHY1 1V4YA 4DR7H 1MI2A 1I4RA 1M8AA 3D4DA 3HOXH 2D0PA 4I55F 1IBLQ 1IXRA 4XYQA 5GONF 5C0XH 2F0DA 1I4XA 1ONLA 1OO9B 3OIPA 5KG6A 1ILPA 1EEFD 2F0LA 4LF8Q 4A3FG 1S9FA 4EX5A 5IGFA 3VR2A 3GTGA 1CA6A 4TV8F 4C3HH 4HJAA 3BQ2A 5D14A 1JJGA 3KLSA 4UP8A 1Q8KA 4LH7A 4QIWA 3CHBD 2PO4A 4B9WA 1Q1BA 2KJXA 1FD7D 1F2YA 3HRZC 3KF6A 4F8MA 3J7AV 2FLNA 3AB9A 3EROA 4L8JA 2VY3A 4X62Q 4I65A 3GTMH 4IJLA 4F4YA 1NY4A 1RTOA 1NE3A 1EYDA 4DR3Q 3MXPA 3PUVA 1YJWA 4LF4L 1K1SA 3RAQA 2ZM6L 2LFNA 3CW2C 4YR2A 3BG3A 1LM0A 2CW8A 2YTXA 3K81C 5D1PA 1TY0A 3DEOA 2BCOA 1M4VA 4BBSB 3K0XA 4FXGC 2F0EA 1ILQA 4YY3Q 3VYRA 3CPWA 3HOYH 1HNWQ 3MR2A 4M1UB 3MVVA 2JA5H 3ND8A 4JI2H 2KCNA 3D4RA 4DV1H 5IWAQ 3VA7A 1LACA 4KK7A 2F0KA 5I2YA 3C3LA 3Q0AA 3EJIA 3OTOH 1B9NA 5BN3A 1I94L 3N40P 2R7ZB 5JJIA 3T51B 2QDLA 1CUKA 1O7IA 3D8GA 4RCNA 2F0FA 5KFSA 4QY7A 1M0TA 4U68A 1CQFA 1CKNB 2CH4A 1BDOA 1UE1A 2NU8B 3KF8B 4X64L 1T36A 3A7LA 3VA5A 3S17H 1Y1VH 1YBYA 1KDCA 1JB3A 1MHWC 1PYBA 3P7JA 1EY5A 5GROA 4EEQA 3D0FA 1A6XA 2Q8IB 3NUCA 2J6UA 2A6EC 1EQQA 3I4LA 2PNRC 5M3FG 1I4PA 3IG0A 4NKLA 3I3CA 1IZ6A 2Z6KA 3HKSA 3G6JB 1GHKA 2JK8A 3WDNA 2AGQA 3S2HH 3D6WA 2NU7B 4O2DA 1Z7TA 2A6ED 3BQ1A 1WOCA 4FM9A 3R2IA 2W6NA 3A54A 5J22A 3KAJA 2UVWA 5JAVA 1TWFH 1CM9A 3N6RA 1JE4A 3J81i 2E2JH 4YAKB 1IBLL 4A3FH 3UDGA 1KEEA 2PMZB 2K14A 2OXPA 2WB1G 4IURA 1K9MC 1PV4A 1K1QA 2AU0A 1S5DD 2EDGA 3TDQA 4IR9A 2JEJA 3CRKC 5KFDA 1I94H 4LF8L 3I91A 1U4RA 4MV6A 1FYCA 4MHEA 1LT6D 4LH6A 1O78A 5EPKA 1NCVA 4DAYB 4DXGA 1UUPA 1B6SA 2WAQA 4DFAA 2F0UA 3HS0C 5E4XA 3G6XA 4ZLTF 1J6QA 4G57A 3E9IA 1HZCA 2ALYB 5ELEA 1L1OB 4P73A 4ED3A 3E0JA 4X62L 1PH7A 3BG5A 3NP8A 5L1IA 3M4IA 4MV3A 3UDIA 1YZ6A 2MUYA 5D3DA 2C2RA 4H44C 4IJHA 4MA5A 5JJZA 4MV1A 5GAGC 1O7YA 1KNEA 3I7FA 4HYKA 3I12A 5DG9A 4XDXA 1N32H 4XT1B 3RLFA 5IGBA 2KVMA 4C5AA 2I80A 4FBTA 4YY3L 1HNWL 1C8CA 2VB2X 2B29A 2W9BB 1PH4A 1XXGA 3N6XA 3PO3B 4O4HF 1PDQA 1ZYRC 2AWOA 3MHBA 4YP3A 4CKCA 2J7ZA 1X55A 3A55A 4PMBA 3SEBA 4ECRA 5C3EB 1F2LA 3I4MG 1ULZA 1IBLH 4HJ9A 2Y0SB 2JA6B 4BBSG 2V1CC 3HKZB 3BJUA 1DV1A 4K14A 2L4NA 1SYCA 4C3JG 2RF4A 4EGQA 1ZYRD 3UE1A 4LF8H 2VR1A 5M9OA 3N43B 2OWOA 5C6AA 1WD0A 5AJ3Q 5M3FH 5FPOA 3CQZA 4J6HA 1TT2A 3TEHB 5DLFA 3NXWA 1VQGA 5FLXc 3PO2B 1IL2A 2I8CA 3L4KA 4RKBA 3HOUB 1Q90A 2VS1A 3PF5A 2PI2A 1I6HB 5CB4F 1BO0A 2NN6G 4NB3A 1K73C 2W9AA 2MPMA 4DR3H 5KFQA 3PZPA 1WJJA 1P16A 2EYFA 3U4VA 4JPBW 1JWMD 4ME6A 5M5YB 1CSPA 4U6PA 4TV9F 5L9XA 4M7EA 5C5MA 1CKOA 4OONA 1CZWA 4YY3H 1TWCB 4EG0A 2IPKD 3EN2A 4GNXC 4HCEA 5IWAH 1DJRD 4IFDG 3G7LA 1TS3A 4ED0A 3DM1A 1SMYD 4L1KA 1JE5A 1FNVA 4CKEA 4GOPB 2DY8A 4B3SQ 4MZ9A 1Z2OX 2B2VC 1STYA 4UFZA 1XNQQ 3H15A 4XYOA 3T1YQ 1DYQA 1CKMA 3SGIA 4CBVA 3V05A 2EXDA 3WOFA 4MTKA 1D6EC 2Z0SA 4GNXB 2V4QA 4AQYQ 4EQNA 2CKZB 2HVQA 5A2QW 1OTCA 1A63A 2XGPA 2HVRA 4B08A 1CHPD 1S0NA 1PMRA 1M6VA 1I6VC 2A74C 4Y52H 2AGPA 2I5LX 4KMUC 1XDNA 5HBRB 4HMJA 1ZKOA 1EEID 2B2TC 3RMHA 2IMWP 1PTOC 2JA8B 3C46A 1M0WA 2D9UA 3PF4A 5KKNB 5CAEB 1YNNC 5EQ0A 1Z2NX 5DQIA 1MJCA 4BBSH 1EWHA 4JVZA 3TQYA 3JC66 3HOVB 4JOIA 1L0WA 2QGQA 4C3JH 3SK4A 1G6PA 2CQYA 5KG2A 2NVTB 5JQWA 3STBD 1PTOD 5EKKA 4O3NA 1AH9A 2JYOA 1RK5A 1VQ8A 5L37A 2R85A 4DV5H 5AJ3L 1N56A 3J7ZC 3S1MB 5C3WA 3PO3G 5CMDA 5C5LA 4JBWA 1SN8A 3F8TA 2XC9A 3H3VH 1EYZA 2NN6H 1L2FA 4RB3C 2K4KA 4JI0H 4GC7A 1X54A 5CBEE 4QQBX 4OO1H 2X6LA 2OQKA 4JBJA 4CGYB 2F0VA 2Y0SG 5DLGA 3HKZG 2D5DA 3ERQA 2XIGA 2NTTA 3QO2A 1VAJA 1SYEA 3RNUA 1VMCA 1YVCA 4C1NI 4IUPA 4X6AH 3QR8A 1Q7YC 1DOLA 4KY5A 2UUBQ 4EGVA 4N8FA 3HXLA 4ZKCB 4JI3Q 5H1SE 2Z8LA 4M8AA 2IWHA 2RA4A 4IFDH 5KIXA 1B04A 4B3TQ 2WP8J 4KTAA 5C4ZA 3CPFA 2H5XA 3RUZA 1SYFA 1WI5A 4R8UB 3G6VA 1EZ6A 3A5ZB 3HOUG 5HGTA 1SNCA 2M2LA 1W6KA 3KK7A 4JI8Q 5BR8Q 4DLKA 2UVVA 4FP5D 3PCOB 3M85A 2ICIA 1QZGA 4P75A 4B3SL 5EWEA 5KFPA 3DEPA 1PZKD 3Q8SB 2R93A 3OMCA 3S15B 3NEMA 1J5EQ 1TAEA 2ASBA 3JAMW 3T1YL 3CC4A 1ET6A 4UP9A 3BABA 2JA9A 2BDOA 2Z4HA 4NMZA 1H9SB 1KNAA 2UXBQ 2JXMB 5HY6A 3W3AA 4X66Q 5D1OB 3OMGA 1I4QA 4ZUJA 1LTLA 3PW2A 2SDFA 1KJIA 3K6OA 1AZPA 4GC6A 5KT6A 3FPPA 1O80A 3JRXA 1RF2D 4ODGA 3M4YA 4APVA 3EBEA 1I7NA 2HCCA 4DV2Q 4NXML 1B2TA 3PUXA 3IKJA 1DONA 1V8QA 2XNAC 1S0MA 2KQ3A 1TWGA 3RGZA 4FS2A 3DLLA 1AZQA 1T5EA 1Y8PB 1VQFA 2IJ0A 4LAAA 4RAYA 1HFNA 4I7ZC 4KKSA 4GKKL 4LNQA 1HTPA 3WOEA 3I4OA 3OHXC 3TZUA 3KAKA 4LFBQ 3RGXA 4KY6A 5KG7A 4A3MB 1W96A 3PO3H 3FHWA 4FF4A 2R8IA 5LMNQ 3NBHA 5IOCA 1YI2A 3H40A 4A3CG 1SNOA 5EDWA 1VDZA 5ELDA 5AFWA 4B3SH 1E22A 4ECZA 3KFUA 4JI7L 3ERSX 3OUZA 5KFGA 1XNQH 2E76C 1GLVA 3J7AF 4TQRA 3T1YH 2RDIA 1YHBA 4OELB 3HOVG 4JV0A 1PH2A 4BS9A 3TS0A 4ECUA 5TSSA 1UEBA 1CS0A 1JORA 1PFSA 4AQYH 1UE5A 1TKWB 4QCLA 1OWTA 2NVYA 1W2BA 2UUBL 1VQDA 3PO2H 4JI3L 5I6WA 5COYA 4JUZA 3CP0A 1RJQA 1IL8A 4B3TL 1E0BA 1EY4A 3HOUH 3ETHA 1WTOA 4ZYSA 3VYUA 1VQ5A 5KT5A 3MR6A 2R8JA 1TWAB 5J2TF 4PMCA 1PH5A 3PUWA 1R9TB 2HCIA 3M9BA 4JI8L 5BR8L 2OTLA 4E4TA 1GUWA 2QILA 3E6ZX 5M5YH 3K5HA 3LP8A 2C9OA 2ZXOA 1BBWA 4JW0A 3IN5A 3F2UA 5FO7B 2R82A 1HZ9A 3EPIA 4MV7A 1TWCH 1PA6A 1JWSD 1IHZA 4XXEA 4A76A 4FF2A 5L1JA 4DUYH 2E2IA 1MBYA 2ZJRA 1M1KC 1SSOA 1BCPD 2LY7A 4QUFA 4LF9H 2VPSA 2UXBL 1PH1A 4X66L 2RSOA 4IPGA 4A3EG 3H0GA 4QWBA 4HNUA 4HJ8A 5ISRA 3A5UA 5A2QE 1BCPB 4DKAC 2DY7A 5C0XI 3I56A 1CT1D 1PZJD 1K28A 2K04A 3F2BA 2YTVA 1STAA 2WKDA 4PG3A 1JQYD 2EPBA 3MZ5A 4V190 4YCWA 4O1NA 3KHHA 3EIVA 1KLUD 3X3NA 4IO9A 2F0OA 2R61A 5DAUA 4A3LG 2UUBH 4PZ6A 5LL6b 3PIPA 3OSNA 2FP4B 1LUZA 4JI3H 1QOHA 1YNXA 4A3IB 3VR5A 3RV3A 4L5QA 4B3TH 1EQVA 1JJ2A 1PK8A 4LFBL 4A3CH 1D8LA 3E5SA 4HSVA 2JA8H 2F3WA 3O13A 4JI8H 5LMNL 3A8JE 2Q2UA 3A7AB 4JI6Q 2NVQB 3J80W 2BDNA 4XZ3B 5KFRA 4WORA 1BXRA 2RDFA 3BZKA 4DV6H 3HOVH 3MA2B 5L1KA 1J5EH 1YITA 2R92B 1RKNA 1JJCB 5EBDA 3BYYB 2HGSA 2ASJA 2VUMG 3TIIA 3JZIA 4OHJA 2NVXA 2EOTA 3SI8A 2UXBH 4X66H 4JI4Q 5FK9C 2F4IA 4A3MG 3S1MH 1N36H 4R4QA 4UCSA 1SAPA 2VQFQ 1EUJA 4OIKA 4A3GB 4J8QA 4WRDA 1VQOA 1EU3A 3N8DA 4G3IA 1Y8OB 3GTGB 4DV2H 2BQUA 4DL5A 4AH6A 5CV5A 4DR2Q 3F8NA 3Q8RB 4OIJA 2JEBI 1DM0B 4QIWB 2VUMA 3PMFA 3KF6B 3U50C 4DR1L 3WNZA 4F50A 3V6JA 5KRUA 5CV7A 4YWKA 4FF3A 1QILA 1KRTA 3QFFA 4EEYA 4IUUA 1II3A 3R8BA 1RK6A 4LFBH 4A3EH 3JAME 3LWEA 2MNAA 2L5TA 2WTFA 3TSSA 2PNHA 1HNZL 2GLTA 5FD6A 2Z1CA 1E2VA 1G91A 3RZOB 3K57A 1ESRA 2ENBA 3TMEA 4R7RA 1ENCA 3GIQA 3S15H 4LUVA 1KQSA 5CBAE 1XPUA 2BR0A 3MC0B 1PH8A 5FLXL 1C4QA 2PBZA 4A3LH 3KYHC 4O42A 3QB3A 2A69C 3SVMA 3M3YB 4QWEA 1STHA 2K32A 2B2WA 4KHPQ 2EY5A 4UCTA 3NTHA 4DU9A 4YB8B 5LL6X 4CJ2C 2UUAQ 2YS6A 4QF4A 4RHSA 1PZID 2A69D 1HQRD 3UQ8A 4MAMA 3CC7A 2EY6A 2W71A 2NB0A 3Q1KA 1SCUB 4ZOLF 3EQLC 3DUZA 2WDTA 1TVXA 1GD7A 1VF7A 3SK5A 1LTSD 5CA0F 2UXDH 2L0CA 1F9SA 4PZ7A 4A3MH 4P2CB 1GSHA 3OPOA 1H9JA 1JR0D 1PLFA 3IRBA 4B9XA 5A35A 2FMCA 1J9OA 1KJ9A 2JE6I 1S0OA 1EIHA 1D2BA 2ZTCA 4LUZA 4BY1B 2I87A 4B3MH 1VQCA 1XJVA 1EU4A 3AQQA 4DN4M 1LT4D 3ICEA 4GS3A 5C4XB 3H6MA 3R23A 4RUAA 2R92G 1Q81C 4YJ3F 4DR2L 2WAQB 4LMYA 1LYLA 5KG5A 3RN2A 3S2DB 4P71A 4QW9A 2J6TA 2EVBA 4HCSA 4UPAA 3K0YA 3BS1A 3V4SA 3T13A 3M9MB 4XQJA 1D1KA 2RCNA 4IOCA 2W6OA 2ALZA 1N32Q 2Q8TA 2SEBD 1VQHA 2FMMA 4J9QA 2IA6A 2Q2TA 4Q44A 1OXUA 2YZGA 1R9TH 1BNCA 2R7KA 4DV1L 1GYFA 1PTOF 5CA1F 4JI6H 3P20A 4MV8A 4KJOA 3P75A 1BQQT 1SR3A 3K7UC 5EBCA 1ML0D 5K36H 1DOKA 3JSNA 2R7LA 1VQPA 2B2YA 4IOAA 3V6KA 3ND9A 5EAYA 3ORRA 1YHAA 1AN8A 2LKVA 1XNRQ 1E2WA 4DK3C 5IGDA 4ECQA 3CD6A 4H7BA 3F2DA 4JI4H 3DXJC 3BVGA 2PZUA 4IHJF 3K3VA 2E74C 2Z6BA 4KKTA 1EOTA 4O0AA 1I50A 4KHPL 2VQFH 3GTOA 2XRSD 4HMIA 3GIMA 2QK4A 1ET9A 3EFXD 2YZMA 3T5JA 1SNPA 1S5BD 4LF7Q 3LWBA 3TREA 1IKLA 1VQEA 3OUUA 3CQZB 3MEFA 2A8VA 4UHVA 5J3BA 4DR2H 4M9UA 5E1FA 4KJNA 1KABA 1S5CD 4DUZH 1KRSA 3MWYW 3J80E 3TZDA 3A8IE 4A3IH 3I4MB 4I7HA 1DCZA 4X3TA 4G7ZC 1Y1WA 3H3VC 4DV4H 2W57A 4TSSA 1YHQA 4C3JB 1NSNS 1EWIA 1YNJD 4RAUC 3GIPA 3J81c 2Z4IA 2NVQH 1X3EA 1I7LA 4NDXA 4X3SA 3PIP3 2B63A 5C4HA 4HIOA 2R92H 1X3QA 1JB7A 4U7CA 5DG8A 5FOBB 4DL2A 1R4PB 4OL7A 4G4KA 2FK2A 1HR0H 3MWDA 2FK3A 2TMPA 1PYWD 3K59A 5BN4A 1K0RA 2J0TD 4O2BF 1TS4A 4ZAIA 4K8IA 1QZHA 2ZDHA 3ETJA 1BUVT 4KHPH 4LFCQ 3H3VI 3GTJA 4A3GH 2NN6I 2XRQD 4H0LC 4OO1I 1EQTA 1HNXH 2YYZA 3GTGH 4BY1G 2UUAH 1VMPA 1SYXB 1RD9D 2R84A 1SNDA 4A3JB 2F3VA 1N32L 4IZOA 3CCQA 4L5RC 4KD4A 4BA2I 5C4XG 2FINB 1C48A 2UVUA 1TIID 4HR7A 3PVXA 1GO3E 3BYTB 2WAQG 4IUTA 3GTPA 2L55A 1MGSA 2VZAA 4IFDI 4LF5Q 4NXNH 4GN3B 4A2AA 1A3TA 2JEIA 3CAMA 1L1OC 2EZVA 2CW7A 5IT9c 3D31A 1XNRL 1S72A 3HZXA 2R7DA 1GUGA 3RZOH 4ZHQF 1T5XD 3NPPA 3G6EA 1ICFB 4J1MA 2IHEA 4RMFA 4DV5Q 1ZXTA 2HJWA 3VMMA 2DJFC 3JAMc 2VL6A 1OXXK 4J9NA 3FKIA 2IX3A 2KSWA 4MV9A 2E75C 2H1EA 4KI0A 1JXLA 4DPGA 4JI0Q 4IPHA 1N33Q 4JV2A 3NGDA 5FO9B 2UU9Q 1IOWA 3OSOA 4TVAB 4IWXA 3M3YH 3RB3A 4DR3L 3FVQA 5EOYA 1EY6A 5JVLA 3S16B 1A62A 3F2CA 2QF7A 3SR1A 3ULJA 3AFQA 1F2MA 4A93B 3KALA 2RGVA 1JIHA 3GILA 3M4PA 4IPCA 4AYBE 1E4FT 4J9OA 3MWMA 3GD7A 4UDUC 5IWAL 4ECVA 1BCPF 2FPGB 2HDMA 1NAPA 3QJYA 2QDBA 3KLWA 1BXTA 1K8GA 5CV6A 2AUKA 5L1LA 5C0XJ 4Q5VA 4DV7Q 2PCFB 2C2DA 1Z2PX 5BPHA 4Y7NH 2SOBA 1MSGA 1XNRH 1PH6A 4E6IA 2DZDA 1N48A 4TUYF 1Z6HA 2R93B 2OT2A 3DF7A 5GADC 4FU0A 4ED2A 4K5VA 3JAMi 3K5MA 4MNOA 1QVFA 4BY1H 1GKHA 3GTKA 4F4WA 4LFCL 3H20A 1S03G 1U4MA 4OEMB 2E2DC 1VKZA 2XIWA 4N9TA 5I6YA 4LF7H 1EIGA 5C4XH 2E8GA 4K6LA 3ULPA 5D8DA 1J8IA 2A5HA 1KAAA 3S2DH 5ELCA 4LSXA 3K5IA 3RR5A 4GOPC 4UP7A 4O4LF 2O5JC 2WFWA 1UE7A 5CORA 1WR2A 1SMYC 2VQDA 1NNXA 3OWEB 1QVGA 2FLLA 4YCVA 1TWGB 5IGEA 4PV1C 2E5LQ 1KJJA 3AFPA 2QW7A 3PUZA 3BDOA 1HTLD 4A3JG 2CQOA 3TIGA 1KTKA 2KECA 3N52A 3J7AK 5DEHA 1Y69U 4MIUA 1EL0A 4J15A 3NELA 1HXYD 3RF2A 3DWPA 3HFZB 2WB1E 4DV5L 3OSPA 1AE2A 1STGA 4X65H 3BZDB 2RHQB 1D5ZC 3NBHB 4J9SA 4CDDC 1SRUA 1TS2A 3N44B 4KHZA 1BF4A 2OQ0A 2RDHA 4JI0L 1LT5D 1N33L 2YCHA 1HH2P 3A8KE 4DXFA 3RJ0A 2R7ZA 2QEXA 4LFCH 3CKIB 4ZK9B 5IYZF 1QNUA 2IX1A 4NW2A 4JYAH 2R8KA 3FMAA 3MFHA 4C2MA 3CQZH 2CHBD 4QW8A 2BA0A 1AW7A 1UEAB 2BE5C 2NVYB 4UCVA 2B2UC 1NUCA 5CR3A 2PZWA 4R8IA 5C5JA 3U58A 3RZDB 1UNSA 3OW7A 1T9HA 4S3SA 3STBC 1GGOA 1ZEQX 3JRWA 3MFIA 4DNTB 3GTLA 4DNRB 1S3OA 1VBGA 1SEBD 1NMFA 4LF5H 3I4MH 2X6GA 5DLQE 3TP5A 5HV6A 1LTBD 1X3GA 2BE5D 4PDBA 4XTCS 1WCMA 5F9NA 3RAXA 4DV7L 4RAZA 3EA6A 3M7GA 4A93G 2D62A 4DUYQ 3LGJA 3KOJA 3BAAA 1U0LA 4OGQC 3VPCA 1NR4A 4LF9Q 2ZJQA 3QZ8A 3T1HQ 1IKMA 1F9RA 3I4NG 2E2IB 1ZQ7A 4ILWA 4POGA 2YTYA 1B53A 3S24A 2IBKA 1Z47A 4L6TB 2F0GA 1L0XB 1LV9A 1XWEA 1RYRA 3H0GB 4EQ5A 1VCIA 5KNCA 1PFMA 5D65A 2JEAI 3QZ7A 1EWCA 1C9OA 1SE8A 2NUCA 3BVMA 1E3PA 2UU9H 1GSOA 2MGSA 2SNSA 2K5VA 1B3AA 2R93G 2B39A 4Q0FA 2F4VQ 2RDJA 1IBKQ 4KV6A 3U9SA 3HOWB 4DR5Q 4JI1Q 4A3JH 3GV8B 2K7VA 2E2HA 1MSHA 2LMCB 4ED6A 4QWCA 3L0OA 2UXCQ 1YIJA 3GV5B 4MTNA 4A3EB 4WJ4A 4FNFA 3Q8QB 3GV7B 4OX9Q 1G8ZD 3M9NB 1R4QB 3GV3A 4O2AF 1VQNA 3MR5A 1SE3A 1KDAA 3RN5A 1LO5D 3N42B 2EQSA 5DNFA 1IBMH 4DV7H 2XSCA 4RGNA 4DV6Q 5IE8A 1Q82C 1QE6A 3GIJA 2FE3A 1XNQL 3J80i 2X0SA 4MV4A 2HUGA 3S1NB 2WIIB 2OEOA 1E1OA 1A15A 5FLMG 2W7OA 1V1PA 4CDFC 2MO0A 4AQYL 4ECXA 1N36Q 2L15A 1C0AA 2NVXB 1RDPD 3CCRA 1O75A 2PMZE 3Q23A 1O7LA 4FVMA 5LMNW 4UY8C 3S1QB 3PW4A 2I46A 2A68D 2V4RA 1S5ED 2F0JA 4PMWA 4WFN3 1EYCA 1E4EA 4L5TA 3NWSA 3B6YA 1F9QA 2NZ1D 4IUNA 4LF6Q 3CCJA 3S16H 1K8OA 4Q45A 4A93H 2IW3A 1QB5D 1XMOQ 2VOBA 2SCUB 4CDCC 2VUMB 2E5LH 2L12A 4ME3A 5JUMA 5KFJA 1KC8C 2YYAA 2K5NA 3I4NH 4DUYL 3VDYA 2D0OA 2N55A 1A8VA 5D3IB 1GUTA 3E3XA 5E7NA 4LF9L 3M4QA 5K2MA 1U4PA 3SE7A 4BY7B 3BJYA 3WO0A 2ZXPA 1CTMA 2FK1A 3I55A 2NZOA 4DV3Q 1B7YB 3TN2A 3KTMA 3Q24A 1OXVA 2N78A 1KHIA 4R4CA 5KT2A 2Q8RE 5T1GA 2O2LD 2R93H 4QL5A 3W1BA 1IOVA 4CC6A 1CQIB 1VQ9A 1SBBB 4I4TF 1VQIA 2I5HA 1RL2A 2VB3X 3CC2A 1WTXA 2Y0SE 4FF1A 2F4VL 2BH8A 2ZXRA 2L1BA 3HKZE 3BA9A 4H13C 4DR5L 4JI1L 2PVPA 2Z9HA 4ME5A 4P74A 4ABNA 1K3RA 3H0GG 2UXCL 4I50F 5BMVF 2XWJB 2R6FA 2A6HD 2FJ2A 1EUCB 3J81L 2V58A 1BCPC 5JVDF 3PR4A 2VUGA 1SJED 2RCFA 1I4HA 1TWGH 3SHLA 5LP6F 4HAEA 2QCPX 1VQ6A 4YJ2F 2GVAA 5FD5A 4DV6L 3KBXA 3G71A 2B2VA 1J5EL 4IWYA 3HOWG 2UXDQ 5FLMH 4JBKA 1X3PA 1ASYA 3T1HH 4RGTA 1PFNA 4YHHQ 3GIKA 1SJHD 2AQ2B 5C1PA 4DR6Q 1N36L 2FFKB 3WWVA 2B8FA 3J81j 4B3MQ 4IR1A 5EWFA 2OH2A 5KFTA 2OLSA 4DV2L 4HIDA 5EZYF 2F52A 2G9DA 1VQ4A 3V4ZA 1RYSA 4FS1A 4DNIA 2HIVA 1XX8A 4R4IA 4LK1C 2B2TA 1HUNA 2ZJPA 2F4VH 1GXDC 5LA6F 1IBKH 4LF6L 4DR5H 4JI1H 4JV5Q 2JQOA 4EGJA 4QGUA 2NVYH 4ID6A 5C4JB 2YW2A 2YU9A 5HURA 1YJ9A 2ES2A 4FXDA 2UXCH 4O3RA 5IT9L 3RZDH 4C1NK 1I3QA 1GOZA 4P72A 4OX9H 2KCTA 4JBMA 4NPSA 4YR3A 1B9MA 1B70B 5EJWA 1EY7A 1Q1EA 4HTHA 3G6YA 3GQCA 2RGRA 3Q22A 4DV3L 2NU6B 4DL7A 3UDXA 1KLGD 4IALA 4R8UA 5KFBA 2LS01 2PZTA 3ORQA 2DJGC 5M3MG 1TWHA 2E2IH 1PH9A 2XVSA 3SK8A 1I5FA 4ZUIA 1LLRD 2QKIC 3OWFA 2K1BA 2HT1A 4BY7G 5E3FA 3H0GH 3C0FB 4RGMA 3D6CA 3MXNA 1I50B 1XTCD 1B4OA 1E2ZA 4DAVA 3GTQA 3GTOB 2DPIA 3LWUA 4GLXA 2F1MA 2K5WA 5KG1A 5D1OA 4JI5H 4LF6H 2EYOA 2PQAA 4DUZQ 3HOWH 1EOVA 1XMOH 2AUJD 4Z9CB 4XQQA 2WE6A 3AU7A 5BN5A 5G3LF 4WJWA 4O3QA 2AQ4A 1DXMA 2UXDL 4DV4Q 3MWEA 2QA4A 3Q2OA 3I70A 4PQXA 3TBIB 4RU9A 1FKAH 1SFOA 2KCCA 1G51A 2YU9H 2YRWA 4Q8EA 1Y1WB 3K58A 1X3FA 5IP9G 5M5XB 4UCOA 4YHHL 1BGWA 4O3OA 4EBDA 1PFBA 2R86A 1KJQA 1XPOA 4B3ML 3GQBA 1LTGD 3C2PA 1ZHSA 4DV3H 2NWGA 1HFGA 1H9MA 1Y8NB 3S1NH 1HR0Q 4DK0A 2B63B 3H94A 2RDGA 5KFAA 2EYJA 3R3OA 4C5CA 5EPJA 3NQIA 1KDBA 5NUCA 3FDSA 2Z6KC 2NVXH 3RB6A 1ENAA 2K5QA 1JWUD 3G48A 5LL6S 3PW0A 1STEA 4DAPA 4JV5L 1WVLA 2XWBB 1HNXQ 3S1QH 1S5FD 1UC8A 4GKJQ 2RKSA 1IW7C 1MZBA 3GTJB 2EE1A 2UUCH 2G5DA 2YL2A 1IYVA 1A0IA 3KUPA 2RBMA 4IZ8A 4RNOA 2HDLA 4JI6L 5KGUA 3UI2A 2DUDA 4LWCA 2VUMH 2DGYA 4NXNQ 1IW7D 4HR7B 5JPNC 2K5DA 1CQVA 2W70A 3RFCA 2F0WA 3OHBA 3RLNA 3GTPB 1EY0A 1VQJA 5EGTA 1TWAA 4F4XA 4Y7NB 5I2XA 1EYGA 1LT3D 4YIJA 4BY7H 4YHHH 3TP8A 5IYBG 4JI4L 5T14A 1FGBD 4R1JA 4K8JA 4DR6H 5DM73 5GAHC 1VQMA 2VQFL 4EVOA 2ZM6Q 1QVCA 3ONAB 1UC9A 1K8MA 3DM3A 5KFVA 2W9BA 5KFCA 3LNNA 1ZETA 5LOVF 2DN8A 2R6GA 1JDEA 3KLRA 1N33H 1LTRD 4FDBA 3RUPA 3SDZA 4N8X1 1RJPA 2MP1A 1UWVA 3DHQA 4A3DB 2K52A 4DUZL 2W6PA 2CFMA 5FLXE 5CV9A 3HOYG 2IHFA 4JV5H 3T5KA 3BDLA 1FNUA 5KFYA 5IP9H 4DV4L 4B3RQ 4J9LA 3GTMA 1D1IA 3PGZA 2R87A 5M5WB 3CU7A 4X64Q 2O4XA 2F0QA 3T4AC 3PIO3 2K28A 1SXTA 3K8AA 1E24A 1BR9A 4MTEA 1PRTD 3BQ0A 2R3ZA 1Y1VG 2RQXA 4HSPA 1HR0L 3CCLA 2J4XA 3FPUB 2JA5A 1UAPA 1X32A 1EIYB 3K80C 4V0BA 1PRTB 4J0MA 4QWAA 1NMGA 2N8NA 1Y1WG 4YQWA 1FJGH 2EJMA 2XCAA 3KBGA 2O03A 2J6SA 1D5XC 3CF5A 3RD4A 3LX0A 3SK6A 1QUQA 3L9AX 4JK1C 2M00A 1HNXL 2M05A 2UUAL 3GTKB 5J39A 1NJIC 2EXZA 2ASLA 1Q3LA 1SYGA 2C35B 2W9CA 1SMXA 5CV8A 2K01A 2B63G 1E7ZA 1YNJC 3URYA 4RCOA 2EYLA 1Y1VA 1K83A 1F77A 4RZQA 5DQGA 3R5HA 1GHJA 4APMA 3R5XA 5C4JH 2F03A 4NXNL 4A3BG 4CKBA 3TP7A 1UNNC 4C56C 5IYBH 4GN5A 4GLVB 3OHAA 4EFEA 4A2BA 4BBRB 1BBUA 4DV0H 4FO2A 2YV5A 5KFNA 1STBA 3R2TA 4JG2A 3H4BA 3W5OA 4MN3A 1WYDA 1NTGA 5C1OA 2FPIB 2I0QA 5LXTF 2XCLA 2F3IA 2PW5A 4X65Q 1VQ7A 4GLAC 1W93A 3IFTA 1KD1C 2JSOA 2VQEQ 3KDFA 4Q43A 4RKLA 1ESFA 4DK1A 1TWFA 4AYBG 1GVPA 2NTSA 4JV1A 3NTKA 3ULLA 5KFIA 2K75A 5I9PA 5KFHA 1JC7A 3PSIA 2FMAA 4OWXB 2R7FA 1C30A 3KXYT 2R8GA 1B6RA 2A73B 1SNQA 1ZHQA 2HQLA 1AE3A 1Q46A 4JYAQ 1DOMA 4LSAA 3FRPB 5ELOA 1EUDB 1I50H 1TXYA 4GKJH 1EZ1A 3GTOH 1XMQH 1H9KA 1EY9A 2KCMA 2F0TA 5JEAJ 2ZJTA 2JA7G 4JOIC 5ELNA 4B3RL 2KUMA 4C2MB 3M9OB 3QOLA 2F0SA 4AYBA 2NBFA 5IIFA 3FKIG 3BU2A 2YRXA 4WD3A 1P8LA 2PYKA 3RB4A 3CXCA 1FVIA 3KHGA 1K83H 1JKJB 4A3DG 3VPDA 3MEHA 3Q8PB 3OOCA 3RB0A 2NUAB 1S10A 1T94A 2DNCA 5LMUQ 5KFFA 3GTLB 4QIWE 3VR6A 3TINA 1Y1WH 3A74A 2Q2HA 2W8LA 2DNEA 5M5XH 1WCMB 4K0KQ 1RJTA 3KJOA 3VPBA 3EVQA 3PR5B 2XTIA 4XYMB 3ITPA 2JA7A 1LTAD 1RHPA 1PYSB 4CJ1B 2WACA 4IN3A 3MAQA 1VQKA 4TQUS 4Y8VB 4J9MA 4LF4H 2ZM6H 2GPSA 4LF7L 2B63H 4AIMA 2B8GA 5EPLA 1OXTA 4Q0YA 3TQTA 3VYTA 4L5SA 3LMLA 2OTJA 1JCKB 4GN4B 4A3BH 1YEZA 1EFWA 5F9LA 4IRKA 2WINB 2K05A 3K5LA 4KY7A 4YWMA 2PQEA 4QB4A 4DL3A 4N9PA 2CWPA 5CV4A 2JP1A 3AEVA 2BOSA 3GTJH 4EBCA 5KG3A 2C28A 2UVRA 1TY2A 3GIIA 4B3RH 2I5MX 3I4NB 2E2HB 3J7YW 5DGBA 5KX5F 2AMCB 4X64H 1JOOA 3PN1A 3CVZA 2AQ1B 2PPBC 5G3LD 4LW1A 3FP9A 3HB9A 3GTPH 4X65L 1IBMQ 4BWSC 2WB1A 3K7AB 2VQEL 4F4ZA 3W1GA 3HGBA 2ICEC 2JEFA 2EYPA 1RJRA 5JOBA 1KC7A 4BBRG 2Q2IA 4MTDA 3DMUA 1AUVA 1FR3A 1QCBD 4DGZA 4LFAQ 4KN4C 3MXUA 2VXWA 1WSCA 2FB9A 2XGTA 1FNWA 2AGOA 1QNKA 4JYAL 2JA7H 1HJPA 1V1PB 4HN7A 4ECYA 5J2UF 4RNNA 2FKLA 3H4DA 2V4DA 5H80A 4RG1A 3FKIH 1VQBA 1HRJA 1KJ8A 5KFUA 3T5HA 4HNVA 1Q12A 1G6ZA 2H4OA 1HCZA 3I73A 4A3DH 5KYIA 1S97A 1AFPA 5C8YF 2HQEA 5FO8B 4F7XA 4LF5L 1PVOA 3GDEA 2WAQE 1E4EB 3V2TA 5LMUL 2ZTEA 1HA6A 1VF5C 2XGQA 2BQ3A 2R7ZG 2AHOB 2V9WA 1XYIA 4KN7C 1JOQA 5DG7A 3WO1A 1CFMA 1BNZA 3NSWA 4KHVA 4K0KL 5M5WH 1S4ZA 3GO5A 4X62H 1JT8A 3KHRA 2W6ZA 2EJGC 2LXKA 4EBEA 1GM5A 4OO1G 4O4IF 3C1FA 1BJTA 2VQEH 3L3OC 1WTVA 4F88A 4CC5A 1FL0A 4K6DA 4HIMA 1HZBA 4HJ7A 1B50A 5HGQA 4DR4Q 4RWSC 4ED1A 5F2DA 1X65A 1STNA 5T1IA 1KIXA 2UU9L 4K5XA 1HNWH 1I6UA 4RB0A 3MR3A 1AEXA 4OWTB 2BQRA 1WCMG 3F1ZA 4YAJB 1O7ZA 1SYBA 4RFBA 1V9PA 2DWCA 2VA3A 1N8RC 3GTKH 4EFBA 1A2TA 1CKNA 1Y14B 3GV6A 1B3QA 3KF8A 4ULLA 4EYIB 1MD2D 4CDEC 1K0SA 2MO1A 3TP6A 3CCUA 2K03A 2GPWA 1EYAA 2KHJA 2R8HA 3JSLA 4U673 3E0EA 2F0MA 3NTIA 4RZRA 5LMUH 1IBML 2KOLA 1JMCA 3HEJA 4TRDA 4RB1A 1WTQA 4BBRH 4C3IB 1PHJA 4K2LA 3RIZA 4A3KB 2PI2E 3J80c 4K0KH 4NXMQ 2CZGA 5EKIA 1ICWA 4LFAL 2WYOA 4TKOB 4KKUA 2AQ3B 5I47A 2W7PA 2VW9A 4ZCKA 2FPPB 4X3UA 1VBHA 3J81W 2NZHA 2OCEA 1BKBA 1SNMA 2PMZA 2RHSB 1SE4A 4GKKQ 4HJ5A 4O3SA 3PUYA 1A9XA 5GAEC 5IYCG 4J9PA 1U9RA 1BBXC 4IAJA 3RBEA 4JCVE 1CHQD 4ZKBB 2F0HA 4DAYA 5CGKA 3CMEA 4ECSA 1YNND 5KT4A 2R7ZH 3AMUA 4ZQIA 3CCMA 4BXXG 1MIUA 4O3PA 1PTOB 4JC0A 2DLNA 2E5LL 4BWGB 4HIKA 3S9WA 1L1OA 1VQAA 5FJ8G 4JI7Q 1U4LA 2MFIA 2XCPA 4C2MH 2F0PA 4OXPA 2BA1A 2KENA 2YU9B 5C3EG 5LYJF 1OXSC 1MKHA 2JA6G 2W6MA 4BA1I 1I3QB 2ASDA 3I72A 4YBZB 3TS2A 2K5HA 1QWYA 3U9OA 3GTLH 3FEWX 1WTRA 1B33N 4LUOA 1N34Q 4FYDA 3GIDA 1WCMH 4HNTA 4DR4L 3T56B 5C44B 4RB2C 5JJKA 2A68C 3TQ1A 3RTXA 3PO2G 5DGAA 4LFAH 4KLKA 1V43A 2ID0A 5K5PA 5KNBA 2QEJC 3NENA 1EHIA 3S1RB 5IT9W 1TWHB 4CJ0B 4A75A 1D7QA 4XT3B 3UE0A 3I8ZA 3H91A 3K5OA 5E4WC 5J1ZA 2Y0SA 4WBNF 4RUCA 3HKZA 2JA6A 5IY0A 1SEIA 3MXGA 4NP5A 1A3VA 1SYDA 2MHVA 1RIPA 4QJFA 1C7YA 3MXNB 3GTQB 1A2UA 2YS7A 2KHSA 3HOZB 2KBNA 3R5FA 4JI5Q 2MJ8A 2CCZA 3CCVA 1HA5A 1X6OA 4IUVA 5EKLA 5KFLA 2FHTA 1GJXA 4X3KA 2PQAB 2KHIA 5M3MB 1GUSA 2E2HH 1PRTF 3M4OB 3MFYA 4FXKC 5IGCA 4QWDA 5KFMA 1E1TA 4OWWB 3T1HL 2XN9C 3Q6SA 3GP7A 5ELFA 2I07B 4DF7A 1DD2A 2JJQA 1SFOB 3BA8A 4H02A 3K7AH 2B2WC 2M9VA 5KEEA 4RH6A 5IYCH 1HHVA 1TWCA 2IT1A 2HHHQ 1NBWA 4ETSA 1JX4A 2V59A 4DR4H 2GA4B 3RV4A 3NE5B 5A2QL 4C3IG 3NBIA 4R4OA 4YWLA 3NWTA 3P1HA 2A6HC 4GOPA 4A3KG 1V1OA 1MJEA 4IRDA 4BXXH 1PXUA 3TRZA 5KFZA 2EYHA 4PZ8A 2VA2A 3CRLC 4L63B 2AWNA 1IBKL 4RGOS 3VYSA 5FJ8H 1QJOA 4XIGS 2CQAA 2JA8G 3PIOA 2WKCA 4KD3A 3EPGA 2D2CC 2FXQA 5C3EH 2F0NA 2ATLA 5KFWA 1S68A 2UUCQ 2JA6H 3FDTA 4GNXA 5ELBA 4NLGA 1SDFA 1Z9FA 1AN7A 2N88A 4OX9L 2EIFA 2A19A 2DPJA 5FLXW 1JOKA 2IL8A 2IX0A 3X3MA 4DK6C 3V96A 2VNUD 3S14B 1AP0A 2C22A 5KFKA 4RNMA 1N34L 3L4JA 4NXMH 1HZAA 5IGGA 1WTPA 1I6HH 2W6QA 4MA0A 2L11A 1AUXA 4HEDA 2OF1A 3Q8DA 1EY8A 3OYYA 3SXHA 3HBLA 4R9WA 2IP4A 4DR1Q 5CC4A 1CSQA 3VR3A 5JVH3 2SNMA 2KEDA 4PWQA 1EIFA 4GKKH 1KL9A 2B2UA 2JN4A 1W3SA 4IQZA 1GSAA 4DA2A 1SLJA 2FJZA 1RTNA 1V1QA 1EQRA 1G291 4XX0B 2JEGA 3HOXB 2WV6D 3N41B 5KT7A 2O5IC 3BDCA 3IL8A 5C44G 1HNZQ 3NK9A
chains in the Genus database with same CATH topology
4JI5L 3J7ZC 4IFDJ 2R6GA 4KI0A 3PO3G 4DPGA 4FDBA 1XMOL 4JI0Q 4IPHA 1N33Q 4JBWA 1UWVA 1SN8A 3F8TA 2K52A 3H3VH 4DUZL 2UU9Q 2CFMA 5AJ3L 4TVAB 1L2FA 3HOYG 2IHFA 2K4KA 3M3YH 1X54A 4QQBX 2OQKA 4JBJA 4DR3L 2Y0SG 1U5KA 3HKZG 5IP9H 4DV4L 1A62A 3F2CA 3ULJA 1DGSA 1VS0A 3AFQA 5IYDG 1N9WA 4B3RQ 3RNUA 1YVCA 1ASZA 1Q7YC 4X6AH 2UUBQ 3PGZA 3HOZG 3M4PA 4IPCA 4AYBE 4JI3Q 5H1SE 4X64Q 3RLOA 4C3IH 3GD7A 2WP8J 5IWAL 2HHHL 4B3TQ 3CPFA 2H5XA 4A3KH 1S40A 1WI5A 3KLWA 3K8AA 1E24A 3A5ZB 1K8GA 3HOUG 1HR0L 1Y1VG 4JI8Q 5BR8Q 5C0XJ 3CCLA 4DV7Q 1FJGQ 3PCOB 1EIYB 3M85A 4Y7NH 4P75A 3K80C 1QZGA 4B3SL 1PH6A 1NMGA 2N8NA 1Y1WG 1SROA 3NEMA 1J5EQ 3AYHB 2N3SA 2ASBA 3T1YL 2HIXA 5GADC 4UP9A 3CF5A 5JEAG 3CC4A 4DR7Q 2JA9A 3JAMi 4MNOA 1QUQA 1QVFA 4BY1H 1GKHA 1HNXL 4LFCL 2UUCL 3UDFA 1QUQB 2UXBQ 2UUAL 5HY6A 4X66Q 2NVTH 1NJIC 2C35B 1LTLA 3ULPA 5C4XH 2E8GA 4ALPA 1SMXA 1HR0W 2B63G 1E7ZA 3S2DH 4APVA 3EBEA 5GQOA 3RR5A 4DV2Q 4GOPC 4UP7A 4DAMA 3PUXA 4NXML 5C4JH 4NXNL 2WFWA 1UE7A 4A3BG 1KAWA 5IP7G 1H95A 4DV0Q 1QVGA 5IYBH 3DLLA 4GN5A 4GLVB 4YCVA 3J7A5 1BBUA 1I3QH 2E5LQ 1VQFA 2YV5A 4DR6L 1XTDA 3AFPA 4JG2A 3PUZA 3W5OA 4A3JG 4GKKL 2CQOA 2GVBA 1WYDA 1NTGA 4LNQA 2CWAA 3I4OA 2I0QA 3A0JA 2F3IA 4J15A 4X65Q 4LFBQ 1VQ7A 3NELA 4GLAC 1YJNA 5C44H 3I2ZA 2VQEQ 1KD1C 3HFZB 2WB1E 3KDFA 4DV5L 3PO3H 4AYBG 1AE2A 1GVPA 3FHWA 3KDFB 5LMNQ 1YI2A 3ULLA 2RHQB 4A3CG 3NBHB 2K50A 3S1RH 4JI2Q 1TWHH 2K75A 4DV1Q 1SRUA 4KHZA 1E22A 2OQ0A 3PSIA 4OWXB 2R7FA 3ERSX 3OTOQ 4JI0L 4JI7L 1N33L 3KFUA 1HH2P 1YHBA 1KXLA 1XMQQ 2HQLA 1AE3A 1Q46A 3HOVG 4JYAQ 2QEXA 5ELOA 1WFQA 1PH2A 1I50H 1TXYA 3TS0A 5IYDH 1UEBA 3GTOH 3GTQH 1B8AA 2KCMA 4IPDA 2IX1A 1PFSA 5K36G 1UE5A 3HOZH 5JEAJ 2JA7G 4JOIC 3CQZH 4YCUA 5ELNA 3HOXG 2BA0A 3U4ZA 1W2BA 4B3RL 2UUBL 3CCSA 5C0XG 3FKIG 3BU2A 1VQDA 3PO2H 4JI3L 1XPRA 1P8LA 3U58A 1X9NA 3CP0A 3CXCA 1M90C 5M3MH 1FVIA 1T9HA 2LSSA 4B3TL 3HOUH 3STBC 3M4OH 1VQ5A 1K83H 4A3DG 1S3OA 5LMUQ 1NMFA 1PH5A 3I4MH 4QIWE 3PUWA 5DLQE 4R4TA 1X3GA 3M9BA 3A74A 4XTCS 2Q2HA 4JI8L 5BR8L 4DV7L 1Y1WH 1SFOH 5M5XH 5M5YH 1FJGL 3PV0A 4K0KQ 3KJOA 3BZCA 4A93G 1BBWA 2D62A 4DUYQ 2XTIA 2B3GA 2GN5A 1HZ9A 3LGJA 3KJPA 3KOJA 4LF4Q 1U0LA 1Q86C 1TWCH 1PYSB 3E9HA 1PA6A 1VQKA 2ZJQA 4A76A 3T1HQ 4LF9Q 3I4NG 4TQUS 3L7ZC 4A4IA 4DR7L 2ZJRA 1M1KC 4POGA 4WJ3M 2YTYA 3S24A 4LF7L 2B63H 2UXBL 1PH1A 4AIMA 4X66L 2BH2A 1Z47A 4A3IG 1BVSA 4IPGA 4A3EG 1OXTA 4HJ8A 4L5SA 3A5UA 2OTJA 4DKAC 4EQ5A 1VCIA 5C0XI 2JEAI 4GN4B 3I56A 1YEZA 1I94Q 1EFWA 2JA5G 1C9OA 2ZTDA 1SE8A 2A1AA 1E3PA 5IP7H 1FGUA 3OW2A 3F2BA 2K5VA 2YTVA 4YWMA 4PG3A 2CWPA 2ATWA 2R93G 4POFA 3AEVA 4YCWA 2LXJA 3GTJH 3CMAA 4DV0L 1IBKQ 2F4VQ 3EIVA 2AKWB 4IO9A 4DR5Q 4JI1Q 4A3JH 3M7NA 2I5MX 2N49A 3CCEA 4A3LG 3G4SA 3L0OA 4PZ6A 3PIPA 2UXCQ 1LUZA 2MQHA 2AMCB 3ZJYC 1K8AC 1YIJA 1PH3A 4MTNA 3S14H 1YNXA 2IY5B 5JJLA 4WJ4A 4L5QA 3L2PA 4LW1A 1JJ2A 3FP9A 4OX9Q 3GTPH 4X65L 4LFBL 1IBMQ 4A3CH 1VQNA 2VQEL 1D8LA 3ER0A 3RN5A 2JA8H 4A3GG 3W1GA 1IYJB 1TWAH 2EQSA 1UE6A 5LMNL 4JI6Q 4DV6Q 2Q2UA 5IE8A 1Q82C 1X56A 4JI2L 1XNQL 3J80i 2Q2IA 4BBRG 1VQLA 3BZKA 3HOVH 4LFAQ 3OTOL 1YITA 1E1OA 1JJCB 4GKJL 2XGTA 5FLMG 2VUMG 1XMQL 4JYAL 2MO0A 1HJPA 4AQYL 2JA7H 3HOXH 1N36Q 2L15A 2D0PA 1C0AA 3CCRA 4JI4Q 1IBLQ 1IXRA 4RG1A 2PMZE 4A3MG 3FKIH 1VQBA 3S1MH 4R4QA 5LMNW 4UY8C 2VQFQ 1Q12A 4A3FG 1EUJA 4EX5A 4LF8Q 4A3DH 1VQOA 4C3HH 4PMWA 4HJAA 1JJGA 4LF5L 4AH6A 4L5TA 1PVOA 3GDEA 4UP8A 2WAQE 4DR2Q 1Q8KA 3B6YA 4LF6Q 3S16H 5LMUL 3CCJA 2JEBI 2ZTEA 1Q1BA 4A93H 3KF6A 2AHOB 1XMOQ 2R7ZG 3KF6B 3U50C 4DR1L 2VY3A 4ME3A 4X62Q 3GTMH 4IJLA 1KC8C 1NY4A 4K0KL 2K5NA 5M5WH 1NE3A 4YWKA 4DUYL 3VDYA 3I4NH 3GO5A 2D0OA 4DR3Q 3PUVA 1KRTA 1YJWA 4LF4L 1JT8A 2ZM6L 1A8VA 3CW2C 5E7NA 4LF9L 3M4QA 2LXKA 1LM0A 1GM5A 4A3EH 4OO1G 2YTXA 3K81C 2MNAA 3K0XA 2PNHA 1HNZL 1FL0A 3CPWA 4YY3Q 4HIMA 1HZBA 4HJ7A 3HOYH 1HNWQ 5HGQA 2JA5H 3I55A 4DR4Q 2NZOA 4DV3Q 1B7YB 1X65A 5IWAQ 1OXVA 2N78A 1KHIA 4R4CA 1KIXA 2UU9L 4LUVA 1KQSA 3S15H 4OWTB 2R93H 1WCMG 1I94L 3F1ZA 4QL5A 1XPUA 3W1BA 4JV5Q 5JJIA 1PH8A 1VQ9A 1CUKA 1O7IA 1V9PA 4QY7A 1N8RC 1VQIA 2I5HA 3GTKH 4A3LH 1CKNA 3KYHC 1RL2A 1Y14B 3CC2A 2F4VL 1CKNB 2Y0SE 2BH8A 3HKZE 4DR5L 1UE1A 4JI1L 3KF8B 4KHPQ 4X64L 4P74A 1K3RA 3H0GG 3S17H 1Y1VH 1YBYA 2UXCL 2MO1A 1PYBA 3CCUA 5GROA 2UUAQ 3D0FA 2KHJA 3E0EA 1EQQA 5M3FG 1IBML 1JMCA 1TWGH 4BBRH 1VQ6A 1IZ6A 2GVAA 3CC7A 1PHJA 4DV6L 2Z6KA 2PI2E 3J80c 3HKSA 3G71A 1J5EL 4NXMQ 3HOWG 2UXDQ 2JK8A 5FLMH 3S2HH 4JBKA 1GD7A 4O2DA 4LFAL 1ASYA 1WOCA 4PZ7A 4YHHQ 2VW9A 4A3MH 4DR6Q 2NZHA 1N36L 2OCEA 3J81i 1TWFH 1BKBA 2E2JH 2RHSB 3IRBA 3WWVA 3J81j 1IBLL 4A3FH 3UDGA 4B3MQ 4HJ5A 2K14A 4GKKQ 3PUYA 2WB1G 2JE6I 5GAEC 5IYCG 1K9MC 1PV4A 2ZTCA 4LUZA 4JCVE 4DV2L 4HIDA 1VQCA 2F52A 1XJVA 4LF8L 1VQ4A 3AQQA 4DNIA 2HIVA 4GS3A 3CMEA 4DAYB 3ICEA 4R4IA 2R7ZH 2R92G 3CCMA 2ZJPA 1Q81C 4BXXG 1MIUA 4DR2L 1LYLA 3RN2A 4JC0A 1J6QA 2E5LL 4LF6L 4HIKA 1L1OA 1VQAA 5FJ8G 4P71A 3E9IA 1HZCA 2ALYB 4JI7Q 1L1OB 2JQOA 2MFIA 4P73A 2NVYH 4C2MH 4QGUA 4UPAA 4X62L 4OXPA 2BA1A 1PH7A 1YJ9A 2ES2A 2KENA 3UDIA 5C3EG 1YZ6A 2RCNA 3RZDH 4IOCA 1MKHA 1OXSC 4IJHA 2JA6G 1VQHA 4BA1I 4P72A 1N32Q 5GAGC 2KCTA 2Q2TA 4JBMA 4NPSA 3I7FA 3TS2A 2K5HA 1OXUA 3GTLH 1R9TH 3RLFA 1B70B 4DV1L 4LUOA 4YY3L 1N34Q 1Q1EA 1HNWL 1WCMH 4DR4L 2B29A 4DV3L 1SR3A 3K7UC 1PH4A 3UDXA 5JJKA 1VQPA 4IOAA 3PO2G 4KLKA 1V43A 2AWOA 2ID0A 5EAYA 3NENA 5M3MG 2E2IH 1PH9A 1I5FA 1YHAA 1XNRQ 4A75A 1X55A 4DK3C 1D7QA 3UE0A 3CD6A 3F2DA 3I4MG 2HT1A 4BY7G 4HJ9A 3H0GH 5IY0A 2V1CC 4BBSG 3BJUA 4O0AA 4KHPL 2RF4A 3UE1A 1RIPA 4QJFA 1C7YA 3MXNB 4GLXA 2OWOA 5AJ3Q 4LF7Q 5M3FH 2KBNA 3TREA 4JI5Q 1VQEA 2CCZA 3MEFA 3CCVA 2A8VA 5J3BA 1X6OA 3TEHB 2PQAA 1VQGA 5FLXc 4DUZQ 3HOWH 1EOVA 2PQAB 1IL2A 2KHIA 2E2HH 2VS1A 3PF5A 2PI2A 1KRSA 1E1TA 2UXDL 2NN6G 4NB3A 4DV4Q 3T1HL 1K73C 2QA4A 4A3IH 2OTLA 4OWWB 1WJJA 1P16A 1G51A 2YU9H 3U4VA 2JJQA 1X3FA 5IP9G 4H02A 1CSPA 1YHQA 4YHHL 3K7AH 1EWIA 1CKOA 4OONA 3J81c 5IYCH 2IT1A 2HHHQ 2NVQH 1X3EA 1NBWA 1XPOA 4B3ML 3EN2A 4GNXC 4IFDG 4R4OA 4YWLA 3S1NH 4HIOA 1HR0Q 4GOPA 4A3KG 2R92H 1MJEA 1JB7A 4BXXH 1JE5A 3TRZA 4GOPB 4PZ8A 2AWNA 1IBKL 4B3SQ 5FJ8H 4MZ9A 2Z6KC 2NVXH 4XIGS 1XNQQ 3H15A 1K0RA 2JA8G 3G48A 3PIOA 3T1YQ 1CKMA 3SGIA 5C3EH 2FXQA 1QZHA 4JV5L 1HNXQ 2UUCQ 4LFCQ 3S1QH 2EXDA 2JA6H 3H3VI 4GKJQ 4GNXA 4A3GH 2NN6I 1Z9FA 2Z0SA 4GNXB 4OX9L 4AQYQ 4OO1I 2YYZA 2EIFA 2CKZB 2A19A 4BY1G 1OTCA 3GTGH 4A3BH 1A63A 1N32L 1A0IA 2IX0A 3CCQA 4L5RC 4DK6C 4BA2I 4JI6L 5C4XG 2VNUD 2DUDA 4Y52H 4LWCA 2I5LX 1GO3E 2VUMH 2DGYA 2WAQG 1N34L 4NXNQ 2VZAA 3RLNA 4IFDI 1HZAA 4LF5Q 1I6HH 4GN3B 1VQJA 3PF4A 3CAMA 1EYGA 1L1OC 3Q8DA 4BY7H 3OYYA 4JI4L 1MJCA 5IYBG 5IT9c 3D31A 1XNRL 4R1JA 4DR1Q 3TQYA 4BBSH 1S72A 3JC66 4JOIA 2R7DA 1CSQA 2QGQA 1L0WA 4C3JH 5GAHC 1VQMA 3RZOH 1G6PA 1EIFA 3G6EA 2VQFL 1KL9A 2IHEA 1W3SA 4RMFA 3STBD 2ZM6Q 1QVCA 1SLJA 1V1QA 4DV5Q 1EQRA 1G291 3JAMc 2VL6A 1OXXK 1AH9A 1VQ8A 3DM3A 5C44G 1HNZQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 L;  3J7Z C;  4IFD J;  2R6G A;  4KI0 A;  3PO3 G;  4DPG A;  4FDB A;  1XMO L;  4JI0 Q;  4IPH A;  1N33 Q;  4JBW A;  1UWV A;  1SN8 A;  3F8T A;  2K52 A;  3H3V H;  4DUZ L;  2UU9 Q;  2CFM A;  5AJ3 L;  4TVA B;  1L2F A;  3HOY G;  2IHF A;  2K4K A;  3M3Y H;  1X54 A;  4QQB X;  2OQK A;  4JBJ A;  4DR3 L;  2Y0S G;  1U5K A;  3HKZ G;  5IP9 H;  4DV4 L;  1A62 A;  3F2C A;  3ULJ A;  1DGS A;  1VS0 A;  3AFQ A;  5IYD G;  1N9W A;  4B3R Q;  3RNU A;  1YVC A;  1ASZ A;  1Q7Y C;  4X6A H;  2UUB Q;  3PGZ A;  3HOZ G;  3M4P A;  4IPC A;  4AYB E;  4JI3 Q;  5H1S E;  4X64 Q;  3RLO A;  4C3I H;  3GD7 A;  2WP8 J;  5IWA L;  2HHH L;  4B3T Q;  3CPF A;  2H5X A;  4A3K H;  1S40 A;  1WI5 A;  3KLW A;  3K8A A;  1E24 A;  3A5Z B;  1K8G A;  3HOU G;  1HR0 L;  1Y1V G;  4JI8 Q;  5BR8 Q;  5C0X J;  3CCL A;  4DV7 Q;  1FJG Q;  3PCO B;  1EIY B;  3M85 A;  4Y7N H;  4P75 A;  3K80 C;  1QZG A;  4B3S L;  1PH6 A;  1NMG A;  2N8N A;  1Y1W G;  1SRO A;  3NEM A;  1J5E Q;  3AYH B;  2N3S A;  2ASB A;  3T1Y L;  2HIX A;  5GAD C;  4UP9 A;  3CF5 A;  5JEA G;  3CC4 A;  4DR7 Q;  2JA9 A;  3JAM i;  4MNO A;  1QUQ A;  1QVF A;  4BY1 H;  1GKH A;  1HNX L;  4LFC L;  2UUC L;  3UDF A;  1QUQ B;  2UXB Q;  2UUA L;  5HY6 A;  4X66 Q;  2NVT H;  1NJI C;  2C35 B;  1LTL A;  3ULP A;  5C4X H;  2E8G A;  4ALP A;  1SMX A;  1HR0 W;  2B63 G;  1E7Z A;  3S2D H;  4APV A;  3EBE A;  5GQO A;  3RR5 A;  4DV2 Q;  4GOP C;  4UP7 A;  4DAM A;  3PUX A;  4NXM L;  5C4J H;  4NXN L;  2WFW A;  1UE7 A;  4A3B G;  1KAW A;  5IP7 G;  1H95 A;  4DV0 Q;  1QVG A;  5IYB H;  3DLL A;  4GN5 A;  4GLV B;  4YCV A;  3J7A 5;  1BBU A;  1I3Q H;  2E5L Q;  1VQF A;  2YV5 A;  4DR6 L;  1XTD A;  3AFP A;  4JG2 A;  3PUZ A;  3W5O A;  4A3J G;  4GKK L;  2CQO A;  2GVB A;  1WYD A;  1NTG A;  4LNQ A;  2CWA A;  3I4O A;  2I0Q A;  3A0J A;  2F3I A;  4J15 A;  4X65 Q;  4LFB Q;  1VQ7 A;  3NEL A;  4GLA C;  1YJN A;  5C44 H;  3I2Z A;  2VQE Q;  1KD1 C;  3HFZ B;  2WB1 E;  3KDF A;  4DV5 L;  3PO3 H;  4AYB G;  1AE2 A;  1GVP A;  3FHW A;  3KDF B;  5LMN Q;  1YI2 A;  3ULL A;  2RHQ B;  4A3C G;  3NBH B;  2K50 A;  3S1R H;  4JI2 Q;  1TWH H;  2K75 A;  4DV1 Q;  1SRU A;  4KHZ A;  1E22 A;  2OQ0 A;  3PSI A;  4OWX B;  2R7F A;  3ERS X;  3OTO Q;  4JI0 L;  4JI7 L;  1N33 L;  3KFU A;  1HH2 P;  1YHB A;  1KXL A;  1XMQ Q;  2HQL A;  1AE3 A;  1Q46 A;  3HOV G;  4JYA Q;  2QEX A;  5ELO A;  1WFQ A;  1PH2 A;  1I50 H;  1TXY A;  3TS0 A;  5IYD H;  1UEB A;  3GTO H;  3GTQ H;  1B8A A;  2KCM A;  4IPD A;  2IX1 A;  1PFS A;  5K36 G;  1UE5 A;  3HOZ H;  5JEA J;  2JA7 G;  4JOI C;  3CQZ H;  4YCU A;  5ELN A;  3HOX G;  2BA0 A;  3U4Z A;  1W2B A;  4B3R L;  2UUB L;  3CCS A;  5C0X G;  3FKI G;  3BU2 A;  1VQD A;  3PO2 H;  4JI3 L;  1XPR A;  1P8L A;  3U58 A;  1X9N A;  3CP0 A;  3CXC A;  1M90 C;  5M3M H;  1FVI A;  1T9H A;  2LSS A;  4B3T L;  3HOU H;  3STB C;  3M4O H;  1VQ5 A;  1K83 H;  4A3D G;  1S3O A;  5LMU Q;  1NMF A;  1PH5 A;  3I4M H;  4QIW E;  3PUW A;  5DLQ E;  4R4T A;  1X3G A;  3M9B A;  3A74 A;  4XTC S;  2Q2H A;  4JI8 L;  5BR8 L;  4DV7 L;  1Y1W H;  1SFO H;  5M5X H;  5M5Y H;  1FJG L;  3PV0 A;  4K0K Q;  3KJO A;  3BZC A;  4A93 G;  1BBW A;  2D62 A;  4DUY Q;  2XTI A;  2B3G A;  2GN5 A;  1HZ9 A;  3LGJ A;  3KJP A;  3KOJ A;  4LF4 Q;  1U0L A;  1Q86 C;  1TWC H;  1PYS B;  3E9H A;  1PA6 A;  1VQK A;  2ZJQ A;  4A76 A;  3T1H Q;  4LF9 Q;  3I4N G;  4TQU S;  3L7Z C;  4A4I A;  4DR7 L;  2ZJR A;  1M1K C;  4POG A;  4WJ3 M;  2YTY A;  3S24 A;  4LF7 L;  2B63 H;  2UXB L;  1PH1 A;  4AIM A;  4X66 L;  2BH2 A;  1Z47 A;  4A3I G;  1BVS A;  4IPG A;  4A3E G;  1OXT A;  4HJ8 A;  4L5S A;  3A5U A;  2OTJ A;  4DKA C;  4EQ5 A;  1VCI A;  5C0X I;  2JEA I;  4GN4 B;  3I56 A;  1YEZ A;  1I94 Q;  1EFW A;  2JA5 G;  1C9O A;  2ZTD A;  1SE8 A;  2A1A A;  1E3P A;  5IP7 H;  1FGU A;  3OW2 A;  3F2B A;  2K5V A;  2YTV A;  4YWM A;  4PG3 A;  2CWP A;  2ATW A;  2R93 G;  4POF A;  3AEV A;  4YCW A;  2LXJ A;  3GTJ H;  3CMA A;  4DV0 L;  1IBK Q;  2F4V Q;  3EIV A;  2AKW B;  4IO9 A;  4DR5 Q;  4JI1 Q;  4A3J H;  3M7N A;  2I5M X;  2N49 A;  3CCE A;  4A3L G;  3G4S A;  3L0O A;  4PZ6 A;  3PIP A;  2UXC Q;  1LUZ A;  2MQH A;  2AMC B;  3ZJY C;  1K8A C;  1YIJ A;  1PH3 A;  4MTN A;  3S14 H;  1YNX A;  2IY5 B;  5JJL A;  4WJ4 A;  4L5Q A;  3L2P A;  4LW1 A;  1JJ2 A;  3FP9 A;  4OX9 Q;  3GTP H;  4X65 L;  4LFB L;  1IBM Q;  4A3C H;  1VQN A;  2VQE L;  1D8L A;  3ER0 A;  3RN5 A;  2JA8 H;  4A3G G;  3W1G A;  1IYJ B;  1TWA H;  2EQS A;  1UE6 A;  5LMN L;  4JI6 Q;  4DV6 Q;  2Q2U A;  5IE8 A;  1Q82 C;  1X56 A;  4JI2 L;  1XNQ L;  3J80 i;  2Q2I A;  4BBR G;  1VQL A;  3BZK A;  3HOV H;  4LFA Q;  3OTO L;  1YIT A;  1E1O A;  1JJC B;  4GKJ L;  2XGT A;  5FLM G;  2VUM G;  1XMQ L;  4JYA L;  2MO0 A;  1HJP A;  4AQY L;  2JA7 H;  3HOX H;  1N36 Q;  2L15 A;  2D0P A;  1C0A A;  3CCR A;  4JI4 Q;  1IBL Q;  1IXR A;  4RG1 A;  2PMZ E;  4A3M G;  3FKI H;  1VQB A;  3S1M H;  4R4Q A;  5LMN W;  4UY8 C;  2VQF Q;  1Q12 A;  4A3F G;  1EUJ A;  4EX5 A;  4LF8 Q;  4A3D H;  1VQO A;  4C3H H;  4PMW A;  4HJA A;  1JJG A;  4LF5 L;  4AH6 A;  4L5T A;  1PVO A;  3GDE A;  4UP8 A;  2WAQ E;  4DR2 Q;  1Q8K A;  3B6Y A;  4LF6 Q;  3S16 H;  5LMU L;  3CCJ A;  2JEB I;  2ZTE A;  1Q1B A;  4A93 H;  3KF6 A;  2AHO B;  1XMO Q;  2R7Z G;  3KF6 B;  3U50 C;  4DR1 L;  2VY3 A;  4ME3 A;  4X62 Q;  3GTM H;  4IJL A;  1KC8 C;  1NY4 A;  4K0K L;  2K5N A;  5M5W H;  1NE3 A;  4YWK A;  4DUY L;  3VDY A;  3I4N H;  3GO5 A;  2D0O A;  4DR3 Q;  3PUV A;  1KRT A;  1YJW A;  4LF4 L;  1JT8 A;  2ZM6 L;  1A8V A;  3CW2 C;  5E7N A;  4LF9 L;  3M4Q A;  2LXK A;  1LM0 A;  1GM5 A;  4A3E H;  4OO1 G;  2YTX A;  3K81 C;  2MNA A;  3K0X A;  2PNH A;  1HNZ L;  1FL0 A;  3CPW A;  4YY3 Q;  4HIM A;  1HZB A;  4HJ7 A;  3HOY H;  1HNW Q;  5HGQ A;  2JA5 H;  3I55 A;  4DR4 Q;  2NZO A;  4DV3 Q;  1B7Y B;  1X65 A;  5IWA Q;  1OXV A;  2N78 A;  1KHI A;  4R4C A;  1KIX A;  2UU9 L;  4LUV A;  1KQS A;  3S15 H;  4OWT B;  2R93 H;  1WCM G;  1I94 L;  3F1Z A;  4QL5 A;  1XPU A;  3W1B A;  4JV5 Q;  5JJI A;  1PH8 A;  1VQ9 A;  1CUK A;  1O7I A;  1V9P A;  4QY7 A;  1N8R C;  1VQI A;  2I5H A;  3GTK H;  4A3L H;  1CKN A;  3KYH C;  1RL2 A;  1Y14 B;  3CC2 A;  2F4V L;  1CKN B;  2Y0S E;  2BH8 A;  3HKZ E;  4DR5 L;  1UE1 A;  4JI1 L;  3KF8 B;  4KHP Q;  4X64 L;  4P74 A;  1K3R A;  3H0G G;  3S17 H;  1Y1V H;  1YBY A;  2UXC L;  2MO1 A;  1PYB A;  3CCU A;  5GRO A;  2UUA Q;  3D0F A;  2KHJ A;  3E0E A;  1EQQ A;  5M3F G;  1IBM L;  1JMC A;  1TWG H;  4BBR H;  1VQ6 A;  1IZ6 A;  2GVA A;  3CC7 A;  1PHJ A;  4DV6 L;  2Z6K A;  2PI2 E;  3J80 c;  3HKS A;  3G71 A;  1J5E L;  4NXM Q;  3HOW G;  2UXD Q;  2JK8 A;  5FLM H;  3S2H H;  4JBK A;  1GD7 A;  4O2D A;  4LFA L;  1ASY A;  1WOC A;  4PZ7 A;  4YHH Q;  2VW9 A;  4A3M H;  4DR6 Q;  2NZH A;  1N36 L;  2OCE A;  3J81 i;  1TWF H;  1BKB A;  2E2J H;  2RHS B;  3IRB A;  3WWV A;  3J81 j;  1IBL L;  4A3F H;  3UDG A;  4B3M Q;  4HJ5 A;  2K14 A;  4GKK Q;  3PUY A;  2WB1 G;  2JE6 I;  5GAE C;  5IYC G;  1K9M C;  1PV4 A;  2ZTC A;  4LUZ A;  4JCV E;  4DV2 L;  4HID A;  1VQC A;  2F52 A;  1XJV A;  4LF8 L;  1VQ4 A;  3AQQ A;  4DNI A;  2HIV A;  4GS3 A;  3CME A;  4DAY B;  3ICE A;  4R4I A;  2R7Z H;  2R92 G;  3CCM A;  2ZJP A;  1Q81 C;  4BXX G;  1MIU A;  4DR2 L;  1LYL A;  3RN2 A;  4JC0 A;  1J6Q A;  2E5L L;  4LF6 L;  4HIK A;  1L1O A;  1VQA A;  5FJ8 G;  4P71 A;  3E9I A;  1HZC A;  2ALY B;  4JI7 Q;  1L1O B;  2JQO A;  2MFI A;  4P73 A;  2NVY H;  4C2M H;  4QGU A;  4UPA A;  4X62 L;  4OXP A;  2BA1 A;  1PH7 A;  1YJ9 A;  2ES2 A;  2KEN A;  3UDI A;  5C3E G;  1YZ6 A;  2RCN A;  3RZD H;  4IOC A;  1MKH A;  1OXS C;  4IJH A;  2JA6 G;  1VQH A;  4BA1 I;  4P72 A;  1N32 Q;  5GAG C;  2KCT A;  2Q2T A;  4JBM A;  4NPS A;  3I7F A;  3TS2 A;  2K5H A;  1OXU A;  3GTL H;  1R9T H;  3RLF A;  1B70 B;  4DV1 L;  4LUO A;  4YY3 L;  1N34 Q;  1Q1E A;  1HNW L;  1WCM H;  4DR4 L;  2B29 A;  4DV3 L;  1SR3 A;  3K7U C;  1PH4 A;  3UDX A;  5JJK A;  1VQP A;  4IOA A;  3PO2 G;  4KLK A;  1V43 A;  2AWO A;  2ID0 A;  5EAY A;  3NEN A;  5M3M G;  2E2I H;  1PH9 A;  1I5F A;  1YHA A;  1XNR Q;  4A75 A;  1X55 A;  4DK3 C;  1D7Q A;  3UE0 A;  3CD6 A;  3F2D A;  3I4M G;  2HT1 A;  4BY7 G;  4HJ9 A;  3H0G H;  5IY0 A;  2V1C C;  4BBS G;  3BJU A;  4O0A A;  4KHP L;  2RF4 A;  3UE1 A;  1RIP A;  4QJF A;  1C7Y A;  3MXN B;  4GLX A;  2OWO A;  5AJ3 Q;  4LF7 Q;  5M3F H;  2KBN A;  3TRE A;  4JI5 Q;  1VQE A;  2CCZ A;  3MEF A;  3CCV A;  2A8V A;  5J3B A;  1X6O A;  3TEH B;  2PQA A;  1VQG A;  5FLX c;  4DUZ Q;  3HOW H;  1EOV A;  2PQA B;  1IL2 A;  2KHI A;  2E2H H;  2VS1 A;  3PF5 A;  2PI2 A;  1KRS A;  1E1T A;  2UXD L;  2NN6 G;  4NB3 A;  4DV4 Q;  3T1H L;  1K73 C;  2QA4 A;  4A3I H;  2OTL A;  4OWW B;  1WJJ A;  1P16 A;  1G51 A;  2YU9 H;  3U4V A;  2JJQ A;  1X3F A;  5IP9 G;  4H02 A;  1CSP A;  1YHQ A;  4YHH L;  3K7A H;  1EWI A;  1CKO A;  4OON A;  3J81 c;  5IYC H;  2IT1 A;  2HHH Q;  2NVQ H;  1X3E A;  1NBW A;  1XPO A;  4B3M L;  3EN2 A;  4GNX C;  4IFD G;  4R4O A;  4YWL A;  3S1N H;  4HIO A;  1HR0 Q;  4GOP A;  4A3K G;  2R92 H;  1MJE A;  1JB7 A;  4BXX H;  1JE5 A;  3TRZ A;  4GOP B;  4PZ8 A;  2AWN A;  1IBK L;  4B3S Q;  5FJ8 H;  4MZ9 A;  2Z6K C;  2NVX H;  4XIG S;  1XNQ Q;  3H15 A;  1K0R A;  2JA8 G;  3G48 A;  3PIO A;  3T1Y Q;  1CKM A;  3SGI A;  5C3E H;  2FXQ A;  1QZH A;  4JV5 L;  1HNX Q;  2UUC Q;  4LFC Q;  3S1Q H;  2EXD A;  2JA6 H;  3H3V I;  4GKJ Q;  4GNX A;  4A3G H;  2NN6 I;  1Z9F A;  2Z0S A;  4GNX B;  4OX9 L;  4AQY Q;  4OO1 I;  2YYZ A;  2EIF A;  2CKZ B;  2A19 A;  4BY1 G;  1OTC A;  3GTG H;  4A3B H;  1A63 A;  1N32 L;  1A0I A;  2IX0 A;  3CCQ A;  4L5R C;  4DK6 C;  4BA2 I;  4JI6 L;  5C4X G;  2VNU D;  2DUD A;  4Y52 H;  4LWC A;  2I5L X;  1GO3 E;  2VUM H;  2DGY A;  2WAQ G;  1N34 L;  4NXN Q;  2VZA A;  3RLN A;  4IFD I;  1HZA A;  4LF5 Q;  1I6H H;  4GN3 B;  1VQJ A;  3PF4 A;  3CAM A;  1EYG A;  1L1O C;  3Q8D A;  4BY7 H;  3OYY A;  4JI4 L;  1MJC A;  5IYB G;  5IT9 c;  3D31 A;  1XNR L;  4R1J A;  4DR1 Q;  3TQY A;  4BBS H;  1S72 A;  3JC6 6;  4JOI A;  2R7D A;  1CSQ A;  2QGQ A;  1L0W A;  4C3J H;  5GAH C;  1VQM A;  3RZO H;  1G6P A;  1EIF A;  3G6E A;  2VQF L;  1KL9 A;  2IHE A;  1W3S A;  4RMF A;  3STB D;  2ZM6 Q;  1QVC A;  1SLJ A;  1V1Q A;  4DV5 Q;  1EQR A;  1G29 1;  3JAM c;  2VL6 A;  1OXX K;  1AH9 A;  1VQ8 A;  3DM3 A;  5C44 G;  1HNZ Q; 
#chains in the Genus database with same CATH topology
 4JI5 L;  4IFD J;  2EY1 A;  1L2Z A;  1XMO L;  4LJZ C;  1GUO A;  4ZQ3 A;  1WTW A;  2B2Y C;  2L9H A;  5KYL A;  4C3H B;  4ZI7 F;  4JI7 H;  3NHH A;  1KBL A;  1JIC A;  1U5K A;  4R8N A;  4DL4 A;  2CW0 C;  1DGS A;  1VS0 A;  1RCV D;  5IYD G;  2MCT A;  1N9W A;  5FPR A;  1ROD A;  1ASZ A;  3GTM B;  4I7A A;  3OIQ A;  3SE0 A;  3HOZ G;  3JAM L;  5JVG 3;  2C2E A;  3IFD A;  4HQ6 A;  3RLO A;  3J81 E;  4C3I H;  2HHH L;  1N34 H;  4K2K A;  1EZ8 A;  2RSN A;  4A3K H;  1CZG A;  4QMG A;  1S40 A;  2F0I A;  4J9R A;  2CW0 D;  3DWA A;  2X69 A;  1I4G A;  2R7M A;  5KFX A;  3EYY A;  1DZ1 A;  3D3R A;  1C3O A;  2EY2 A;  1FJG Q;  3HOY B;  1M7J A;  2PW7 A;  2JA5 B;  3PW7 A;  2RVL A;  5BR8 H;  1LAB A;  2KA7 A;  3U9T A;  1SRO A;  3AYH B;  2N3S A;  2YZN A;  2HIX A;  5JEA G;  1H9S A;  3PQI A;  4DR7 Q;  3T16 A;  2UUC L;  3A56 A;  1QUQ B;  1ENF A;  3UDF A;  3V6H A;  2NVT H;  4ECW A;  3HG9 A;  4QUC A;  2K6A A;  5JH7 F;  4UCR A;  2W9C B;  4ALP A;  3IAY A;  1IYU A;  1CQJ B;  2P5Z X;  1HR0 W;  2EJF C;  2CVR A;  3UFX B;  2K33 A;  3DWQ A;  1WH2 A;  1BOS A;  1PTO H;  3QWN A;  3S17 B;  1Y1V B;  1K83 B;  3QIA A;  2XD4 A;  4ED7 A;  3C1E A;  5GQO A;  4DAM A;  5KT3 A;  4RHR A;  3KHL A;  2ZDG A;  1KAW A;  3I90 A;  5IP7 G;  2V5A A;  1H95 A;  4DV0 Q;  2VPQ A;  1TR5 A;  3J7A 5;  1I3Q H;  1TQO A;  5KG0 A;  3NQT A;  4DR6 L;  1XTD A;  5EWG A;  3BVZ A;  1A3U A;  5C3X A;  5IT9 E;  4ECT A;  2GVB A;  3S2H B;  2NU9 B;  1TS5 A;  2HHH H;  2CWA A;  1DV2 A;  4DL6 A;  4TQS A;  4G7H C;  1JLL B;  4YR0 A;  3A0J A;  2QYZ A;  1CA5 A;  4EQP A;  1YJN A;  5C44 H;  3I2Z A;  1HUM A;  1CK1 A;  3KDF B;  2PN1 A;  1TWF B;  2E2J B;  3W2D A;  4EYH B;  2K50 A;  4A3F B;  3S1R H;  3T53 B;  3QG1 A;  1TWH H;  4JI2 Q;  3H09 A;  4DV1 Q;  4A3B B;  5LMN H;  3T5L A;  3OTO Q;  4G7O C;  1L0Y B;  1KXL A;  1XMQ Q;  2C00 A;  1LTT D;  5KFO A;  1H9R A;  4FBU A;  1LTI D;  1WFQ A;  5IYD H;  1WD1 A;  3D4W A;  4ZRZ A;  2KEE A;  1B8A A;  4IPD A;  5I9O A;  3GTQ H;  5K36 G;  3HOZ H;  2HD3 A;  4YCU A;  3HOX G;  3U4Z A;  4IUQ A;  3CCS A;  2FLP A;  5C0X G;  1K3B C;  5BPF A;  4AYB B;  1XPR A;  1X9N A;  5FKA C;  1E4G T;  1M90 C;  2CH4 W;  5M3M H;  2LSS A;  3K5N A;  3M4O H;  4F87 A;  3HP3 A;  3GLK A;  1R9T A;  1Q8I A;  4C3H G;  5JPM C;  5DM6 3;  3PW5 A;  2HVS A;  1F2Z A;  4R4T A;  1B1Z A;  1D5M C;  1SFO H;  3G8C A;  1GUN A;  1FJG L;  1CI3 M;  4EQO A;  3PV0 A;  3BZC A;  1CE8 A;  4K5W A;  2B3G A;  5JEA H;  2GN5 A;  3KJP A;  4DR1 H;  1NR2 A;  4LF4 Q;  2TSS A;  5DQH A;  1Q86 C;  3E9H A;  4RA8 A;  2JA7 B;  1QG7 A;  3L7Z C;  4A4I A;  4CHT B;  4DR7 L;  4XQN A;  4WJ3 M;  1JDB B;  3FKI B;  2R7N A;  4ED8 A;  1G2T A;  2BH2 A;  4IRC A;  3QOJ A;  4A3I G;  1BVS A;  2J9G A;  4Q8F A;  5CYU A;  1HNZ H;  1F9P A;  2ZT9 C;  1I94 Q;  4UCU A;  2JA5 G;  2ZTD A;  2A1A A;  5IP7 H;  1FGU A;  1HQM C;  4UAI A;  1G2S A;  1W6J A;  3OW2 A;  2NYZ D;  5M3F B;  2W8K A;  1T3N A;  4PNY A;  5KG4 A;  4C5B A;  2ATW A;  1PRT C;  4POF A;  3MTS A;  2LXJ A;  1HPC A;  3CMA A;  4DV0 L;  3ZYY X;  3J80 L;  1EFI D;  5I4D A;  1TU2 B;  5KFE A;  3RBD A;  2AKW B;  3M7N A;  4J9K A;  2N49 A;  3CCE A;  3VR4 A;  1TA8 A;  3G4S A;  2DIK A;  2P0A A;  2EYM A;  1SE2 A;  2MQH A;  3ZJY C;  1K8A C;  3S14 H;  2IY5 B;  2ZDQ A;  1PH3 A;  5JJL A;  3L2P A;  1V51 A;  1WTH A;  5KND A;  3FMC A;  3MFG A;  4XYL B;  4GZY C;  1B44 D;  5IOD A;  3MJF A;  3ER0 A;  4A3G G;  2WB1 B;  1IYJ B;  3E5N A;  1TWA H;  1UE6 A;  4LMQ D;  1PX2 A;  1X56 A;  4JI2 L;  1VQL A;  3R93 A;  2C5C A;  2G9H D;  2R92 A;  3KLS X;  3OTO L;  3K3P A;  4GKJ L;  1DIK A;  1XMQ L;  5LHY 1;  1V4Y A;  4DR7 H;  1MI2 A;  1I4R A;  1M8A A;  3D4D A;  3HOX H;  2D0P A;  4I55 F;  1IBL Q;  1IXR A;  4XYQ A;  5GON F;  5C0X H;  2F0D A;  1I4X A;  1ONL A;  1OO9 B;  3OIP A;  5KG6 A;  1ILP A;  1EEF D;  2F0L A;  4LF8 Q;  4A3F G;  1S9F A;  4EX5 A;  5IGF A;  3VR2 A;  3GTG A;  1CA6 A;  4TV8 F;  4C3H H;  4HJA A;  3BQ2 A;  5D14 A;  1JJG A;  3KLS A;  4UP8 A;  1Q8K A;  4LH7 A;  4QIW A;  3CHB D;  2PO4 A;  4B9W A;  1Q1B A;  2KJX A;  1FD7 D;  1F2Y A;  3HRZ C;  3KF6 A;  4F8M A;  3J7A V;  2FLN A;  3AB9 A;  3ERO A;  4L8J A;  2VY3 A;  4X62 Q;  4I65 A;  3GTM H;  4IJL A;  4F4Y A;  1NY4 A;  1RTO A;  1NE3 A;  1EYD A;  4DR3 Q;  3MXP A;  3PUV A;  1YJW A;  4LF4 L;  1K1S A;  3RAQ A;  2ZM6 L;  2LFN A;  3CW2 C;  4YR2 A;  3BG3 A;  1LM0 A;  2CW8 A;  2YTX A;  3K81 C;  5D1P A;  1TY0 A;  3DEO A;  2BCO A;  1M4V A;  4BBS B;  3K0X A;  4FXG C;  2F0E A;  1ILQ A;  4YY3 Q;  3VYR A;  3CPW A;  3HOY H;  1HNW Q;  3MR2 A;  4M1U B;  3MVV A;  2JA5 H;  3ND8 A;  4JI2 H;  2KCN A;  3D4R A;  4DV1 H;  5IWA Q;  3VA7 A;  1LAC A;  4KK7 A;  2F0K A;  5I2Y A;  3C3L A;  3Q0A A;  3EJI A;  3OTO H;  1B9N A;  5BN3 A;  1I94 L;  3N40 P;  2R7Z B;  5JJI A;  3T51 B;  2QDL A;  1CUK A;  1O7I A;  3D8G A;  4RCN A;  2F0F A;  5KFS A;  4QY7 A;  1M0T A;  4U68 A;  1CQF A;  1CKN B;  2CH4 A;  1BDO A;  1UE1 A;  2NU8 B;  3KF8 B;  4X64 L;  1T36 A;  3A7L A;  3VA5 A;  3S17 H;  1Y1V H;  1YBY A;  1KDC A;  1JB3 A;  1MHW C;  1PYB A;  3P7J A;  1EY5 A;  5GRO A;  4EEQ A;  3D0F A;  1A6X A;  2Q8I B;  3NUC A;  2J6U A;  2A6E C;  1EQQ A;  3I4L A;  2PNR C;  5M3F G;  1I4P A;  3IG0 A;  4NKL A;  3I3C A;  1IZ6 A;  2Z6K A;  3HKS A;  3G6J B;  1GHK A;  2JK8 A;  3WDN A;  2AGQ A;  3S2H H;  3D6W A;  2NU7 B;  4O2D A;  1Z7T A;  2A6E D;  3BQ1 A;  1WOC A;  4FM9 A;  3R2I A;  2W6N A;  3A54 A;  5J22 A;  3KAJ A;  2UVW A;  5JAV A;  1TWF H;  1CM9 A;  3N6R A;  1JE4 A;  3J81 i;  2E2J H;  4YAK B;  1IBL L;  4A3F H;  3UDG A;  1KEE A;  2PMZ B;  2K14 A;  2OXP A;  2WB1 G;  4IUR A;  1K9M C;  1PV4 A;  1K1Q A;  2AU0 A;  1S5D D;  2EDG A;  3TDQ A;  4IR9 A;  2JEJ A;  3CRK C;  5KFD A;  1I94 H;  4LF8 L;  3I91 A;  1U4R A;  4MV6 A;  1FYC A;  4MHE A;  1LT6 D;  4LH6 A;  1O78 A;  5EPK A;  1NCV A;  4DAY B;  4DXG A;  1UUP A;  1B6S A;  2WAQ A;  4DFA A;  2F0U A;  3HS0 C;  5E4X A;  3G6X A;  4ZLT F;  1J6Q A;  4G57 A;  3E9I A;  1HZC A;  2ALY B;  5ELE A;  1L1O B;  4P73 A;  4ED3 A;  3E0J A;  4X62 L;  1PH7 A;  3BG5 A;  3NP8 A;  5L1I A;  3M4I A;  4MV3 A;  3UDI A;  1YZ6 A;  2MUY A;  5D3D A;  2C2R A;  4H44 C;  4IJH A;  4MA5 A;  5JJZ A;  4MV1 A;  5GAG C;  1O7Y A;  1KNE A;  3I7F A;  4HYK A;  3I12 A;  5DG9 A;  4XDX A;  1N32 H;  4XT1 B;  3RLF A;  5IGB A;  2KVM A;  4C5A A;  2I80 A;  4FBT A;  4YY3 L;  1HNW L;  1C8C A;  2VB2 X;  2B29 A;  2W9B B;  1PH4 A;  1XXG A;  3N6X A;  3PO3 B;  4O4H F;  1PDQ A;  1ZYR C;  2AWO A;  3MHB A;  4YP3 A;  4CKC A;  2J7Z A;  1X55 A;  3A55 A;  4PMB A;  3SEB A;  4ECR A;  5C3E B;  1F2L A;  3I4M G;  1ULZ A;  1IBL H;  4HJ9 A;  2Y0S B;  2JA6 B;  4BBS G;  2V1C C;  3HKZ B;  3BJU A;  1DV1 A;  4K14 A;  2L4N A;  1SYC A;  4C3J G;  2RF4 A;  4EGQ A;  1ZYR D;  3UE1 A;  4LF8 H;  2VR1 A;  5M9O A;  3N43 B;  2OWO A;  5C6A A;  1WD0 A;  5AJ3 Q;  5M3F H;  5FPO A;  3CQZ A;  4J6H A;  1TT2 A;  3TEH B;  5DLF A;  3NXW A;  1VQG A;  5FLX c;  3PO2 B;  1IL2 A;  2I8C A;  3L4K A;  4RKB A;  3HOU B;  1Q90 A;  2VS1 A;  3PF5 A;  2PI2 A;  1I6H B;  5CB4 F;  1BO0 A;  2NN6 G;  4NB3 A;  1K73 C;  2W9A A;  2MPM A;  4DR3 H;  5KFQ A;  3PZP A;  1WJJ A;  1P16 A;  2EYF A;  3U4V A;  4JPB W;  1JWM D;  4ME6 A;  5M5Y B;  1CSP A;  4U6P A;  4TV9 F;  5L9X A;  4M7E A;  5C5M A;  1CKO A;  4OON A;  1CZW A;  4YY3 H;  1TWC B;  4EG0 A;  2IPK D;  3EN2 A;  4GNX C;  4HCE A;  5IWA H;  1DJR D;  4IFD G;  3G7L A;  1TS3 A;  4ED0 A;  3DM1 A;  1SMY D;  4L1K A;  1JE5 A;  1FNV A;  4CKE A;  4GOP B;  2DY8 A;  4B3S Q;  4MZ9 A;  1Z2O X;  2B2V C;  1STY A;  4UFZ A;  1XNQ Q;  3H15 A;  4XYO A;  3T1Y Q;  1DYQ A;  1CKM A;  3SGI A;  4CBV A;  3V05 A;  2EXD A;  3WOF A;  4MTK A;  1D6E C;  2Z0S A;  4GNX B;  2V4Q A;  4AQY Q;  4EQN A;  2CKZ B;  2HVQ A;  5A2Q W;  1OTC A;  1A63 A;  2XGP A;  2HVR A;  4B08 A;  1CHP D;  1S0N A;  1PMR A;  1M6V A;  1I6V C;  2A74 C;  4Y52 H;  2AGP A;  2I5L X;  4KMU C;  1XDN A;  5HBR B;  4HMJ A;  1ZKO A;  1EEI D;  2B2T C;  3RMH A;  2IMW P;  1PTO C;  2JA8 B;  3C46 A;  1M0W A;  2D9U A;  3PF4 A;  5KKN B;  5CAE B;  1YNN C;  5EQ0 A;  1Z2N X;  5DQI A;  1MJC A;  4BBS H;  1EWH A;  4JVZ A;  3TQY A;  3JC6 6;  3HOV B;  4JOI A;  1L0W A;  2QGQ A;  4C3J H;  3SK4 A;  1G6P A;  2CQY A;  5KG2 A;  2NVT B;  5JQW A;  3STB D;  1PTO D;  5EKK A;  4O3N A;  1AH9 A;  2JYO A;  1RK5 A;  1VQ8 A;  5L37 A;  2R85 A;  4DV5 H;  5AJ3 L;  1N56 A;  3J7Z C;  3S1M B;  5C3W A;  3PO3 G;  5CMD A;  5C5L A;  4JBW A;  1SN8 A;  3F8T A;  2XC9 A;  3H3V H;  1EYZ A;  2NN6 H;  1L2F A;  4RB3 C;  2K4K A;  4JI0 H;  4GC7 A;  1X54 A;  5CBE E;  4QQB X;  4OO1 H;  2X6L A;  2OQK A;  4JBJ A;  4CGY B;  2F0V A;  2Y0S G;  5DLG A;  3HKZ G;  2D5D A;  3ERQ A;  2XIG A;  2NTT A;  3QO2 A;  1VAJ A;  1SYE A;  3RNU A;  1VMC A;  1YVC A;  4C1N I;  4IUP A;  4X6A H;  3QR8 A;  1Q7Y C;  1DOL A;  4KY5 A;  2UUB Q;  4EGV A;  4N8F A;  3HXL A;  4ZKC B;  4JI3 Q;  5H1S E;  2Z8L A;  4M8A A;  2IWH A;  2RA4 A;  4IFD H;  5KIX A;  1B04 A;  4B3T Q;  2WP8 J;  4KTA A;  5C4Z A;  3CPF A;  2H5X A;  3RUZ A;  1SYF A;  1WI5 A;  4R8U B;  3G6V A;  1EZ6 A;  3A5Z B;  3HOU G;  5HGT A;  1SNC A;  2M2L A;  1W6K A;  3KK7 A;  4JI8 Q;  5BR8 Q;  4DLK A;  2UVV A;  4FP5 D;  3PCO B;  3M85 A;  2ICI A;  1QZG A;  4P75 A;  4B3S L;  5EWE A;  5KFP A;  3DEP A;  1PZK D;  3Q8S B;  2R93 A;  3OMC A;  3S15 B;  3NEM A;  1J5E Q;  1TAE A;  2ASB A;  3JAM W;  3T1Y L;  3CC4 A;  1ET6 A;  4UP9 A;  3BAB A;  2JA9 A;  2BDO A;  2Z4H A;  4NMZ A;  1H9S B;  1KNA A;  2UXB Q;  2JXM B;  5HY6 A;  3W3A A;  4X66 Q;  5D1O B;  3OMG A;  1I4Q A;  4ZUJ A;  1LTL A;  3PW2 A;  2SDF A;  1KJI A;  3K6O A;  1AZP A;  4GC6 A;  5KT6 A;  3FPP A;  1O80 A;  3JRX A;  1RF2 D;  4ODG A;  3M4Y A;  4APV A;  3EBE A;  1I7N A;  2HCC A;  4DV2 Q;  4NXM L;  1B2T A;  3PUX A;  3IKJ A;  1DON A;  1V8Q A;  2XNA C;  1S0M A;  2KQ3 A;  1TWG A;  3RGZ A;  4FS2 A;  3DLL A;  1AZQ A;  1T5E A;  1Y8P B;  1VQF A;  2IJ0 A;  4LAA A;  4RAY A;  1HFN A;  4I7Z C;  4KKS A;  4GKK L;  4LNQ A;  1HTP A;  3WOE A;  3I4O A;  3OHX C;  3TZU A;  3KAK A;  4LFB Q;  3RGX A;  4KY6 A;  5KG7 A;  4A3M B;  1W96 A;  3PO3 H;  3FHW A;  4FF4 A;  2R8I A;  5LMN Q;  3NBH A;  5IOC A;  1YI2 A;  3H40 A;  4A3C G;  1SNO A;  5EDW A;  1VDZ A;  5ELD A;  5AFW A;  4B3S H;  1E22 A;  4ECZ A;  3KFU A;  4JI7 L;  3ERS X;  3OUZ A;  5KFG A;  1XNQ H;  2E76 C;  1GLV A;  3J7A F;  4TQR A;  3T1Y H;  2RDI A;  1YHB A;  4OEL B;  3HOV G;  4JV0 A;  1PH2 A;  4BS9 A;  3TS0 A;  4ECU A;  5TSS A;  1UEB A;  1CS0 A;  1JOR A;  1PFS A;  4AQY H;  1UE5 A;  1TKW B;  4QCL A;  1OWT A;  2NVY A;  1W2B A;  2UUB L;  1VQD A;  3PO2 H;  4JI3 L;  5I6W A;  5COY A;  4JUZ A;  3CP0 A;  1RJQ A;  1IL8 A;  4B3T L;  1E0B A;  1EY4 A;  3HOU H;  3ETH A;  1WTO A;  4ZYS A;  3VYU A;  1VQ5 A;  5KT5 A;  3MR6 A;  2R8J A;  1TWA B;  5J2T F;  4PMC A;  1PH5 A;  3PUW A;  1R9T B;  2HCI A;  3M9B A;  4JI8 L;  5BR8 L;  2OTL A;  4E4T A;  1GUW A;  2QIL A;  3E6Z X;  5M5Y H;  3K5H A;  3LP8 A;  2C9O A;  2ZXO A;  1BBW A;  4JW0 A;  3IN5 A;  3F2U A;  5FO7 B;  2R82 A;  1HZ9 A;  3EPI A;  4MV7 A;  1TWC H;  1PA6 A;  1JWS D;  1IHZ A;  4XXE A;  4A76 A;  4FF2 A;  5L1J A;  4DUY H;  2E2I A;  1MBY A;  2ZJR A;  1M1K C;  1SSO A;  1BCP D;  2LY7 A;  4QUF A;  4LF9 H;  2VPS A;  2UXB L;  1PH1 A;  4X66 L;  2RSO A;  4IPG A;  4A3E G;  3H0G A;  4QWB A;  4HNU A;  4HJ8 A;  5ISR A;  3A5U A;  5A2Q E;  1BCP B;  4DKA C;  2DY7 A;  5C0X I;  3I56 A;  1CT1 D;  1PZJ D;  1K28 A;  2K04 A;  3F2B A;  2YTV A;  1STA A;  2WKD A;  4PG3 A;  1JQY D;  2EPB A;  3MZ5 A;  4V19 0;  4YCW A;  4O1N A;  3KHH A;  3EIV A;  1KLU D;  3X3N A;  4IO9 A;  2F0O A;  2R61 A;  5DAU A;  4A3L G;  2UUB H;  4PZ6 A;  5LL6 b;  3PIP A;  3OSN A;  2FP4 B;  1LUZ A;  4JI3 H;  1QOH A;  1YNX A;  4A3I B;  3VR5 A;  3RV3 A;  4L5Q A;  4B3T H;  1EQV A;  1JJ2 A;  1PK8 A;  4LFB L;  4A3C H;  1D8L A;  3E5S A;  4HSV A;  2JA8 H;  2F3W A;  3O13 A;  4JI8 H;  5LMN L;  3A8J E;  2Q2U A;  3A7A B;  4JI6 Q;  2NVQ B;  3J80 W;  2BDN A;  4XZ3 B;  5KFR A;  4WOR A;  1BXR A;  2RDF A;  3BZK A;  4DV6 H;  3HOV H;  3MA2 B;  5L1K A;  1J5E H;  1YIT A;  2R92 B;  1RKN A;  1JJC B;  5EBD A;  3BYY B;  2HGS A;  2ASJ A;  2VUM G;  3TII A;  3JZI A;  4OHJ A;  2NVX A;  2EOT A;  3SI8 A;  2UXB H;  4X66 H;  4JI4 Q;  5FK9 C;  2F4I A;  4A3M G;  3S1M H;  1N36 H;  4R4Q A;  4UCS A;  1SAP A;  2VQF Q;  1EUJ A;  4OIK A;  4A3G B;  4J8Q A;  4WRD A;  1VQO A;  1EU3 A;  3N8D A;  4G3I A;  1Y8O B;  3GTG B;  4DV2 H;  2BQU A;  4DL5 A;  4AH6 A;  5CV5 A;  4DR2 Q;  3F8N A;  3Q8R B;  4OIJ A;  2JEB I;  1DM0 B;  4QIW B;  2VUM A;  3PMF A;  3KF6 B;  3U50 C;  4DR1 L;  3WNZ A;  4F50 A;  3V6J A;  5KRU A;  5CV7 A;  4YWK A;  4FF3 A;  1QIL A;  1KRT A;  3QFF A;  4EEY A;  4IUU A;  1II3 A;  3R8B A;  1RK6 A;  4LFB H;  4A3E H;  3JAM E;  3LWE A;  2MNA A;  2L5T A;  2WTF A;  3TSS A;  2PNH A;  1HNZ L;  2GLT A;  5FD6 A;  2Z1C A;  1E2V A;  1G91 A;  3RZO B;  3K57 A;  1ESR A;  2ENB A;  3TME A;  4R7R A;  1ENC A;  3GIQ A;  3S15 H;  4LUV A;  1KQS A;  5CBA E;  1XPU A;  2BR0 A;  3MC0 B;  1PH8 A;  5FLX L;  1C4Q A;  2PBZ A;  4A3L H;  3KYH C;  4O42 A;  3QB3 A;  2A69 C;  3SVM A;  3M3Y B;  4QWE A;  1STH A;  2K32 A;  2B2W A;  4KHP Q;  2EY5 A;  4UCT A;  3NTH A;  4DU9 A;  4YB8 B;  5LL6 X;  4CJ2 C;  2UUA Q;  2YS6 A;  4QF4 A;  4RHS A;  1PZI D;  2A69 D;  1HQR D;  3UQ8 A;  4MAM A;  3CC7 A;  2EY6 A;  2W71 A;  2NB0 A;  3Q1K A;  1SCU B;  4ZOL F;  3EQL C;  3DUZ A;  2WDT A;  1TVX A;  1GD7 A;  1VF7 A;  3SK5 A;  1LTS D;  5CA0 F;  2UXD H;  2L0C A;  1F9S A;  4PZ7 A;  4A3M H;  4P2C B;  1GSH A;  3OPO A;  1H9J A;  1JR0 D;  1PLF A;  3IRB A;  4B9X A;  5A35 A;  2FMC A;  1J9O A;  1KJ9 A;  2JE6 I;  1S0O A;  1EIH A;  1D2B A;  2ZTC A;  4LUZ A;  4BY1 B;  2I87 A;  4B3M H;  1VQC A;  1XJV A;  1EU4 A;  3AQQ A;  4DN4 M;  1LT4 D;  3ICE A;  4GS3 A;  5C4X B;  3H6M A;  3R23 A;  4RUA A;  2R92 G;  1Q81 C;  4YJ3 F;  4DR2 L;  2WAQ B;  4LMY A;  1LYL A;  5KG5 A;  3RN2 A;  3S2D B;  4P71 A;  4QW9 A;  2J6T A;  2EVB A;  4HCS A;  4UPA A;  3K0Y A;  3BS1 A;  3V4S A;  3T13 A;  3M9M B;  4XQJ A;  1D1K A;  2RCN A;  4IOC A;  2W6O A;  2ALZ A;  1N32 Q;  2Q8T A;  2SEB D;  1VQH A;  2FMM A;  4J9Q A;  2IA6 A;  2Q2T A;  4Q44 A;  1OXU A;  2YZG A;  1R9T H;  1BNC A;  2R7K A;  4DV1 L;  1GYF A;  1PTO F;  5CA1 F;  4JI6 H;  3P20 A;  4MV8 A;  4KJO A;  3P75 A;  1BQQ T;  1SR3 A;  3K7U C;  5EBC A;  1ML0 D;  5K36 H;  1DOK A;  3JSN A;  2R7L A;  1VQP A;  2B2Y A;  4IOA A;  3V6K A;  3ND9 A;  5EAY A;  3ORR A;  1YHA A;  1AN8 A;  2LKV A;  1XNR Q;  1E2W A;  4DK3 C;  5IGD A;  4ECQ A;  3CD6 A;  4H7B A;  3F2D A;  4JI4 H;  3DXJ C;  3BVG A;  2PZU A;  4IHJ F;  3K3V A;  2E74 C;  2Z6B A;  4KKT A;  1EOT A;  4O0A A;  1I50 A;  4KHP L;  2VQF H;  3GTO A;  2XRS D;  4HMI A;  3GIM A;  2QK4 A;  1ET9 A;  3EFX D;  2YZM A;  3T5J A;  1SNP A;  1S5B D;  4LF7 Q;  3LWB A;  3TRE A;  1IKL A;  1VQE A;  3OUU A;  3CQZ B;  3MEF A;  2A8V A;  4UHV A;  5J3B A;  4DR2 H;  4M9U A;  5E1F A;  4KJN A;  1KAB A;  1S5C D;  4DUZ H;  1KRS A;  3MWY W;  3J80 E;  3TZD A;  3A8I E;  4A3I H;  3I4M B;  4I7H A;  1DCZ A;  4X3T A;  4G7Z C;  1Y1W A;  3H3V C;  4DV4 H;  2W57 A;  4TSS A;  1YHQ A;  4C3J B;  1NSN S;  1EWI A;  1YNJ D;  4RAU C;  3GIP A;  3J81 c;  2Z4I A;  2NVQ H;  1X3E A;  1I7L A;  4NDX A;  4X3S A;  3PIP 3;  2B63 A;  5C4H A;  4HIO A;  2R92 H;  1X3Q A;  1JB7 A;  4U7C A;  5DG8 A;  5FOB B;  4DL2 A;  1R4P B;  4OL7 A;  4G4K A;  2FK2 A;  1HR0 H;  3MWD A;  2FK3 A;  2TMP A;  1PYW D;  3K59 A;  5BN4 A;  1K0R A;  2J0T D;  4O2B F;  1TS4 A;  4ZAI A;  4K8I A;  1QZH A;  2ZDH A;  3ETJ A;  1BUV T;  4KHP H;  4LFC Q;  3H3V I;  3GTJ A;  4A3G H;  2NN6 I;  2XRQ D;  4H0L C;  4OO1 I;  1EQT A;  1HNX H;  2YYZ A;  3GTG H;  4BY1 G;  2UUA H;  1VMP A;  1SYX B;  1RD9 D;  2R84 A;  1SND A;  4A3J B;  2F3V A;  1N32 L;  4IZO A;  3CCQ A;  4L5R C;  4KD4 A;  4BA2 I;  5C4X G;  2FIN B;  1C48 A;  2UVU A;  1TII D;  4HR7 A;  3PVX A;  1GO3 E;  3BYT B;  2WAQ G;  4IUT A;  3GTP A;  2L55 A;  1MGS A;  2VZA A;  4IFD I;  4LF5 Q;  4NXN H;  4GN3 B;  4A2A A;  1A3T A;  2JEI A;  3CAM A;  1L1O C;  2EZV A;  2CW7 A;  5IT9 c;  3D31 A;  1XNR L;  1S72 A;  3HZX A;  2R7D A;  1GUG A;  3RZO H;  4ZHQ F;  1T5X D;  3NPP A;  3G6E A;  1ICF B;  4J1M A;  2IHE A;  4RMF A;  4DV5 Q;  1ZXT A;  2HJW A;  3VMM A;  2DJF C;  3JAM c;  2VL6 A;  1OXX K;  4J9N A;  3FKI A;  2IX3 A;  2KSW A;  4MV9 A;  2E75 C;  2H1E A;  4KI0 A;  1JXL A;  4DPG A;  4JI0 Q;  4IPH A;  1N33 Q;  4JV2 A;  3NGD A;  5FO9 B;  2UU9 Q;  1IOW A;  3OSO A;  4TVA B;  4IWX A;  3M3Y H;  3RB3 A;  4DR3 L;  3FVQ A;  5EOY A;  1EY6 A;  5JVL A;  3S16 B;  1A62 A;  3F2C A;  2QF7 A;  3SR1 A;  3ULJ A;  3AFQ A;  1F2M A;  4A93 B;  3KAL A;  2RGV A;  1JIH A;  3GIL A;  3M4P A;  4IPC A;  4AYB E;  1E4F T;  4J9O A;  3MWM A;  3GD7 A;  4UDU C;  5IWA L;  4ECV A;  1BCP F;  2FPG B;  2HDM A;  1NAP A;  3QJY A;  2QDB A;  3KLW A;  1BXT A;  1K8G A;  5CV6 A;  2AUK A;  5L1L A;  5C0X J;  4Q5V A;  4DV7 Q;  2PCF B;  2C2D A;  1Z2P X;  5BPH A;  4Y7N H;  2SOB A;  1MSG A;  1XNR H;  1PH6 A;  4E6I A;  2DZD A;  1N48 A;  4TUY F;  1Z6H A;  2R93 B;  2OT2 A;  3DF7 A;  5GAD C;  4FU0 A;  4ED2 A;  4K5V A;  3JAM i;  3K5M A;  4MNO A;  1QVF A;  4BY1 H;  1GKH A;  3GTK A;  4F4W A;  4LFC L;  3H20 A;  1S03 G;  1U4M A;  4OEM B;  2E2D C;  1VKZ A;  2XIW A;  4N9T A;  5I6Y A;  4LF7 H;  1EIG A;  5C4X H;  2E8G A;  4K6L A;  3ULP A;  5D8D A;  1J8I A;  2A5H A;  1KAA A;  3S2D H;  5ELC A;  4LSX A;  3K5I A;  3RR5 A;  4GOP C;  4UP7 A;  4O4L F;  2O5J C;  2WFW A;  1UE7 A;  5COR A;  1WR2 A;  1SMY C;  2VQD A;  1NNX A;  3OWE B;  1QVG A;  2FLL A;  4YCV A;  1TWG B;  5IGE A;  4PV1 C;  2E5L Q;  1KJJ A;  3AFP A;  2QW7 A;  3PUZ A;  3BDO A;  1HTL D;  4A3J G;  2CQO A;  3TIG A;  1KTK A;  2KEC A;  3N52 A;  3J7A K;  5DEH A;  1Y69 U;  4MIU A;  1EL0 A;  4J15 A;  3NEL A;  1HXY D;  3RF2 A;  3DWP A;  3HFZ B;  2WB1 E;  4DV5 L;  3OSP A;  1AE2 A;  1STG A;  4X65 H;  3BZD B;  2RHQ B;  1D5Z C;  3NBH B;  4J9S A;  4CDD C;  1SRU A;  1TS2 A;  3N44 B;  4KHZ A;  1BF4 A;  2OQ0 A;  2RDH A;  4JI0 L;  1LT5 D;  1N33 L;  2YCH A;  1HH2 P;  3A8K E;  4DXF A;  3RJ0 A;  2R7Z A;  2QEX A;  4LFC H;  3CKI B;  4ZK9 B;  5IYZ F;  1QNU A;  2IX1 A;  4NW2 A;  4JYA H;  2R8K A;  3FMA A;  3MFH A;  4C2M A;  3CQZ H;  2CHB D;  4QW8 A;  2BA0 A;  1AW7 A;  1UEA B;  2BE5 C;  2NVY B;  4UCV A;  2B2U C;  1NUC A;  5CR3 A;  2PZW A;  4R8I A;  5C5J A;  3U58 A;  3RZD B;  1UNS A;  3OW7 A;  1T9H A;  4S3S A;  3STB C;  1GGO A;  1ZEQ X;  3JRW A;  3MFI A;  4DNT B;  3GTL A;  4DNR B;  1S3O A;  1VBG A;  1SEB D;  1NMF A;  4LF5 H;  3I4M H;  2X6G A;  5DLQ E;  3TP5 A;  5HV6 A;  1LTB D;  1X3G A;  2BE5 D;  4PDB A;  4XTC S;  1WCM A;  5F9N A;  3RAX A;  4DV7 L;  4RAZ A;  3EA6 A;  3M7G A;  4A93 G;  2D62 A;  4DUY Q;  3LGJ A;  3KOJ A;  3BAA A;  1U0L A;  4OGQ C;  3VPC A;  1NR4 A;  4LF9 Q;  2ZJQ A;  3QZ8 A;  3T1H Q;  1IKM A;  1F9R A;  3I4N G;  2E2I B;  1ZQ7 A;  4ILW A;  4POG A;  2YTY A;  1B53 A;  3S24 A;  2IBK A;  1Z47 A;  4L6T B;  2F0G A;  1L0X B;  1LV9 A;  1XWE A;  1RYR A;  3H0G B;  4EQ5 A;  1VCI A;  5KNC A;  1PFM A;  5D65 A;  2JEA I;  3QZ7 A;  1EWC A;  1C9O A;  1SE8 A;  2NUC A;  3BVM A;  1E3P A;  2UU9 H;  1GSO A;  2MGS A;  2SNS A;  2K5V A;  1B3A A;  2R93 G;  2B39 A;  4Q0F A;  2F4V Q;  2RDJ A;  1IBK Q;  4KV6 A;  3U9S A;  3HOW B;  4DR5 Q;  4JI1 Q;  4A3J H;  3GV8 B;  2K7V A;  2E2H A;  1MSH A;  2LMC B;  4ED6 A;  4QWC A;  3L0O A;  2UXC Q;  1YIJ A;  3GV5 B;  4MTN A;  4A3E B;  4WJ4 A;  4FNF A;  3Q8Q B;  3GV7 B;  4OX9 Q;  1G8Z D;  3M9N B;  1R4Q B;  3GV3 A;  4O2A F;  1VQN A;  3MR5 A;  1SE3 A;  1KDA A;  3RN5 A;  1LO5 D;  3N42 B;  2EQS A;  5DNF A;  1IBM H;  4DV7 H;  2XSC A;  4RGN A;  4DV6 Q;  5IE8 A;  1Q82 C;  1QE6 A;  3GIJ A;  2FE3 A;  1XNQ L;  3J80 i;  2X0S A;  4MV4 A;  2HUG A;  3S1N B;  2WII B;  2OEO A;  1E1O A;  1A15 A;  5FLM G;  2W7O A;  1V1P A;  4CDF C;  2MO0 A;  4AQY L;  4ECX A;  1N36 Q;  2L15 A;  1C0A A;  2NVX B;  1RDP D;  3CCR A;  1O75 A;  2PMZ E;  3Q23 A;  1O7L A;  4FVM A;  5LMN W;  4UY8 C;  3S1Q B;  3PW4 A;  2I46 A;  2A68 D;  2V4R A;  1S5E D;  2F0J A;  4PMW A;  4WFN 3;  1EYC A;  1E4E A;  4L5T A;  3NWS A;  3B6Y A;  1F9Q A;  2NZ1 D;  4IUN A;  4LF6 Q;  3CCJ A;  3S16 H;  1K8O A;  4Q45 A;  4A93 H;  2IW3 A;  1QB5 D;  1XMO Q;  2VOB A;  2SCU B;  4CDC C;  2VUM B;  2E5L H;  2L12 A;  4ME3 A;  5JUM A;  5KFJ A;  1KC8 C;  2YYA A;  2K5N A;  3I4N H;  4DUY L;  3VDY A;  2D0O A;  2N55 A;  1A8V A;  5D3I B;  1GUT A;  3E3X A;  5E7N A;  4LF9 L;  3M4Q A;  5K2M A;  1U4P A;  3SE7 A;  4BY7 B;  3BJY A;  3WO0 A;  2ZXP A;  1CTM A;  2FK1 A;  3I55 A;  2NZO A;  4DV3 Q;  1B7Y B;  3TN2 A;  3KTM A;  3Q24 A;  1OXV A;  2N78 A;  1KHI A;  4R4C A;  5KT2 A;  2Q8R E;  5T1G A;  2O2L D;  2R93 H;  4QL5 A;  3W1B A;  1IOV A;  4CC6 A;  1CQI B;  1VQ9 A;  1SBB B;  4I4T F;  1VQI A;  2I5H A;  1RL2 A;  2VB3 X;  3CC2 A;  1WTX A;  2Y0S E;  4FF1 A;  2F4V L;  2BH8 A;  2ZXR A;  2L1B A;  3HKZ E;  3BA9 A;  4H13 C;  4DR5 L;  4JI1 L;  2PVP A;  2Z9H A;  4ME5 A;  4P74 A;  4ABN A;  1K3R A;  3H0G G;  2UXC L;  4I50 F;  5BMV F;  2XWJ B;  2R6F A;  2A6H D;  2FJ2 A;  1EUC B;  3J81 L;  2V58 A;  1BCP C;  5JVD F;  3PR4 A;  2VUG A;  1SJE D;  2RCF A;  1I4H A;  1TWG H;  3SHL A;  5LP6 F;  4HAE A;  2QCP X;  1VQ6 A;  4YJ2 F;  2GVA A;  5FD5 A;  4DV6 L;  3KBX A;  3G71 A;  2B2V A;  1J5E L;  4IWY A;  3HOW G;  2UXD Q;  5FLM H;  4JBK A;  1X3P A;  1ASY A;  3T1H H;  4RGT A;  1PFN A;  4YHH Q;  3GIK A;  1SJH D;  2AQ2 B;  5C1P A;  4DR6 Q;  1N36 L;  2FFK B;  3WWV A;  2B8F A;  3J81 j;  4B3M Q;  4IR1 A;  5EWF A;  2OH2 A;  5KFT A;  2OLS A;  4DV2 L;  4HID A;  5EZY F;  2F52 A;  2G9D A;  1VQ4 A;  3V4Z A;  1RYS A;  4FS1 A;  4DNI A;  2HIV A;  1XX8 A;  4R4I A;  4LK1 C;  2B2T A;  1HUN A;  2ZJP A;  2F4V H;  1GXD C;  5LA6 F;  1IBK H;  4LF6 L;  4DR5 H;  4JI1 H;  4JV5 Q;  2JQO A;  4EGJ A;  4QGU A;  2NVY H;  4ID6 A;  5C4J B;  2YW2 A;  2YU9 A;  5HUR A;  1YJ9 A;  2ES2 A;  4FXD A;  2UXC H;  4O3R A;  5IT9 L;  3RZD H;  4C1N K;  1I3Q A;  1GOZ A;  4P72 A;  4OX9 H;  2KCT A;  4JBM A;  4NPS A;  4YR3 A;  1B9M A;  1B70 B;  5EJW A;  1EY7 A;  1Q1E A;  4HTH A;  3G6Y A;  3GQC A;  2RGR A;  3Q22 A;  4DV3 L;  2NU6 B;  4DL7 A;  3UDX A;  1KLG D;  4IAL A;  4R8U A;  5KFB A;  2LS0 1;  2PZT A;  3ORQ A;  2DJG C;  5M3M G;  1TWH A;  2E2I H;  1PH9 A;  2XVS A;  3SK8 A;  1I5F A;  4ZUI A;  1LLR D;  2QKI C;  3OWF A;  2K1B A;  2HT1 A;  4BY7 G;  5E3F A;  3H0G H;  3C0F B;  4RGM A;  3D6C A;  3MXN A;  1I50 B;  1XTC D;  1B4O A;  1E2Z A;  4DAV A;  3GTQ A;  3GTO B;  2DPI A;  3LWU A;  4GLX A;  2F1M A;  2K5W A;  5KG1 A;  5D1O A;  4JI5 H;  4LF6 H;  2EYO A;  2PQA A;  4DUZ Q;  3HOW H;  1EOV A;  1XMO H;  2AUJ D;  4Z9C B;  4XQQ A;  2WE6 A;  3AU7 A;  5BN5 A;  5G3L F;  4WJW A;  4O3Q A;  2AQ4 A;  1DXM A;  2UXD L;  4DV4 Q;  3MWE A;  2QA4 A;  3Q2O A;  3I70 A;  4PQX A;  3TBI B;  4RU9 A;  1FKA H;  1SFO A;  2KCC A;  1G51 A;  2YU9 H;  2YRW A;  4Q8E A;  1Y1W B;  3K58 A;  1X3F A;  5IP9 G;  5M5X B;  4UCO A;  4YHH L;  1BGW A;  4O3O A;  4EBD A;  1PFB A;  2R86 A;  1KJQ A;  1XPO A;  4B3M L;  3GQB A;  1LTG D;  3C2P A;  1ZHS A;  4DV3 H;  2NWG A;  1HFG A;  1H9M A;  1Y8N B;  3S1N H;  1HR0 Q;  4DK0 A;  2B63 B;  3H94 A;  2RDG A;  5KFA A;  2EYJ A;  3R3O A;  4C5C A;  5EPJ A;  3NQI A;  1KDB A;  5NUC A;  3FDS A;  2Z6K C;  2NVX H;  3RB6 A;  1ENA A;  2K5Q A;  1JWU D;  3G48 A;  5LL6 S;  3PW0 A;  1STE A;  4DAP A;  4JV5 L;  1WVL A;  2XWB B;  1HNX Q;  3S1Q H;  1S5F D;  1UC8 A;  4GKJ Q;  2RKS A;  1IW7 C;  1MZB A;  3GTJ B;  2EE1 A;  2UUC H;  2G5D A;  2YL2 A;  1IYV A;  1A0I A;  3KUP A;  2RBM A;  4IZ8 A;  4RNO A;  2HDL A;  4JI6 L;  5KGU A;  3UI2 A;  2DUD A;  4LWC A;  2VUM H;  2DGY A;  4NXN Q;  1IW7 D;  4HR7 B;  5JPN C;  2K5D A;  1CQV A;  2W70 A;  3RFC A;  2F0W A;  3OHB A;  3RLN A;  3GTP B;  1EY0 A;  1VQJ A;  5EGT A;  1TWA A;  4F4X A;  4Y7N B;  5I2X A;  1EYG A;  1LT3 D;  4YIJ A;  4BY7 H;  4YHH H;  3TP8 A;  5IYB G;  4JI4 L;  5T14 A;  1FGB D;  4R1J A;  4K8J A;  4DR6 H;  5DM7 3;  5GAH C;  1VQM A;  2VQF L;  4EVO A;  2ZM6 Q;  1QVC A;  3ONA B;  1UC9 A;  1K8M A;  3DM3 A;  5KFV A;  2W9B A;  5KFC A;  3LNN A;  1ZET A;  5LOV F;  2DN8 A;  2R6G A;  1JDE A;  3KLR A;  1N33 H;  1LTR D;  4FDB A;  3RUP A;  3SDZ A;  4N8X 1;  1RJP A;  2MP1 A;  1UWV A;  3DHQ A;  4A3D B;  2K52 A;  4DUZ L;  2W6P A;  2CFM A;  5FLX E;  5CV9 A;  3HOY G;  2IHF A;  4JV5 H;  3T5K A;  3BDL A;  1FNU A;  5KFY A;  5IP9 H;  4DV4 L;  4B3R Q;  4J9L A;  3GTM A;  1D1I A;  3PGZ A;  2R87 A;  5M5W B;  3CU7 A;  4X64 Q;  2O4X A;  2F0Q A;  3T4A C;  3PIO 3;  2K28 A;  1SXT A;  3K8A A;  1E24 A;  1BR9 A;  4MTE A;  1PRT D;  3BQ0 A;  2R3Z A;  1Y1V G;  2RQX A;  4HSP A;  1HR0 L;  3CCL A;  2J4X A;  3FPU B;  2JA5 A;  1UAP A;  1X32 A;  1EIY B;  3K80 C;  4V0B A;  1PRT B;  4J0M A;  4QWA A;  1NMG A;  2N8N A;  1Y1W G;  4YQW A;  1FJG H;  2EJM A;  2XCA A;  3KBG A;  2O03 A;  2J6S A;  1D5X C;  3CF5 A;  3RD4 A;  3LX0 A;  3SK6 A;  1QUQ A;  3L9A X;  4JK1 C;  2M00 A;  1HNX L;  2M05 A;  2UUA L;  3GTK B;  5J39 A;  1NJI C;  2EXZ A;  2ASL A;  1Q3L A;  1SYG A;  2C35 B;  2W9C A;  1SMX A;  5CV8 A;  2K01 A;  2B63 G;  1E7Z A;  1YNJ C;  3URY A;  4RCO A;  2EYL A;  1Y1V A;  1K83 A;  1F77 A;  4RZQ A;  5DQG A;  3R5H A;  1GHJ A;  4APM A;  3R5X A;  5C4J H;  2F03 A;  4NXN L;  4A3B G;  4CKB A;  3TP7 A;  1UNN C;  4C56 C;  5IYB H;  4GN5 A;  4GLV B;  3OHA A;  4EFE A;  4A2B A;  4BBR B;  1BBU A;  4DV0 H;  4FO2 A;  2YV5 A;  5KFN A;  1STB A;  3R2T A;  4JG2 A;  3H4B A;  3W5O A;  4MN3 A;  1WYD A;  1NTG A;  5C1O A;  2FPI B;  2I0Q A;  5LXT F;  2XCL A;  2F3I A;  2PW5 A;  4X65 Q;  1VQ7 A;  4GLA C;  1W93 A;  3IFT A;  1KD1 C;  2JSO A;  2VQE Q;  3KDF A;  4Q43 A;  4RKL A;  1ESF A;  4DK1 A;  1TWF A;  4AYB G;  1GVP A;  2NTS A;  4JV1 A;  3NTK A;  3ULL A;  5KFI A;  2K75 A;  5I9P A;  5KFH A;  1JC7 A;  3PSI A;  2FMA A;  4OWX B;  2R7F A;  1C30 A;  3KXY T;  2R8G A;  1B6R A;  2A73 B;  1SNQ A;  1ZHQ A;  2HQL A;  1AE3 A;  1Q46 A;  4JYA Q;  1DOM A;  4LSA A;  3FRP B;  5ELO A;  1EUD B;  1I50 H;  1TXY A;  4GKJ H;  1EZ1 A;  3GTO H;  1XMQ H;  1H9K A;  1EY9 A;  2KCM A;  2F0T A;  5JEA J;  2ZJT A;  2JA7 G;  4JOI C;  5ELN A;  4B3R L;  2KUM A;  4C2M B;  3M9O B;  3QOL A;  2F0S A;  4AYB A;  2NBF A;  5IIF A;  3FKI G;  3BU2 A;  2YRX A;  4WD3 A;  1P8L A;  2PYK A;  3RB4 A;  3CXC A;  1FVI A;  3KHG A;  1K83 H;  1JKJ B;  4A3D G;  3VPD A;  3MEH A;  3Q8P B;  3OOC A;  3RB0 A;  2NUA B;  1S10 A;  1T94 A;  2DNC A;  5LMU Q;  5KFF A;  3GTL B;  4QIW E;  3VR6 A;  3TIN A;  1Y1W H;  3A74 A;  2Q2H A;  2W8L A;  2DNE A;  5M5X H;  1WCM B;  4K0K Q;  1RJT A;  3KJO A;  3VPB A;  3EVQ A;  3PR5 B;  2XTI A;  4XYM B;  3ITP A;  2JA7 A;  1LTA D;  1RHP A;  1PYS B;  4CJ1 B;  2WAC A;  4IN3 A;  3MAQ A;  1VQK A;  4TQU S;  4Y8V B;  4J9M A;  4LF4 H;  2ZM6 H;  2GPS A;  4LF7 L;  2B63 H;  4AIM A;  2B8G A;  5EPL A;  1OXT A;  4Q0Y A;  3TQT A;  3VYT A;  4L5S A;  3LML A;  2OTJ A;  1JCK B;  4GN4 B;  4A3B H;  1YEZ A;  1EFW A;  5F9L A;  4IRK A;  2WIN B;  2K05 A;  3K5L A;  4KY7 A;  4YWM A;  2PQE A;  4QB4 A;  4DL3 A;  4N9P A;  2CWP A;  5CV4 A;  2JP1 A;  3AEV A;  2BOS A;  3GTJ H;  4EBC A;  5KG3 A;  2C28 A;  2UVR A;  1TY2 A;  3GII A;  4B3R H;  2I5M X;  3I4N B;  2E2H B;  3J7Y W;  5DGB A;  5KX5 F;  2AMC B;  4X64 H;  1JOO A;  3PN1 A;  3CVZ A;  2AQ1 B;  2PPB C;  5G3L D;  4LW1 A;  3FP9 A;  3HB9 A;  3GTP H;  4X65 L;  1IBM Q;  4BWS C;  2WB1 A;  3K7A B;  2VQE L;  4F4Z A;  3W1G A;  3HGB A;  2ICE C;  2JEF A;  2EYP A;  1RJR A;  5JOB A;  1KC7 A;  4BBR G;  2Q2I A;  4MTD A;  3DMU A;  1AUV A;  1FR3 A;  1QCB D;  4DGZ A;  4LFA Q;  4KN4 C;  3MXU A;  2VXW A;  1WSC A;  2FB9 A;  2XGT A;  1FNW A;  2AGO A;  1QNK A;  4JYA L;  2JA7 H;  1HJP A;  1V1P B;  4HN7 A;  4ECY A;  5J2U F;  4RNN A;  2FKL A;  3H4D A;  2V4D A;  5H80 A;  4RG1 A;  3FKI H;  1VQB A;  1HRJ A;  1KJ8 A;  5KFU A;  3T5H A;  4HNV A;  1Q12 A;  1G6Z A;  2H4O A;  1HCZ A;  3I73 A;  4A3D H;  5KYI A;  1S97 A;  1AFP A;  5C8Y F;  2HQE A;  5FO8 B;  4F7X A;  4LF5 L;  1PVO A;  3GDE A;  2WAQ E;  1E4E B;  3V2T A;  5LMU L;  2ZTE A;  1HA6 A;  1VF5 C;  2XGQ A;  2BQ3 A;  2R7Z G;  2AHO B;  2V9W A;  1XYI A;  4KN7 C;  1JOQ A;  5DG7 A;  3WO1 A;  1CFM A;  1BNZ A;  3NSW A;  4KHV A;  4K0K L;  5M5W H;  1S4Z A;  3GO5 A;  4X62 H;  1JT8 A;  3KHR A;  2W6Z A;  2EJG C;  2LXK A;  4EBE A;  1GM5 A;  4OO1 G;  4O4I F;  3C1F A;  1BJT A;  2VQE H;  3L3O C;  1WTV A;  4F88 A;  4CC5 A;  1FL0 A;  4K6D A;  4HIM A;  1HZB A;  4HJ7 A;  1B50 A;  5HGQ A;  4DR4 Q;  4RWS C;  4ED1 A;  5F2D A;  1X65 A;  1STN A;  5T1I A;  1KIX A;  2UU9 L;  4K5X A;  1HNW H;  1I6U A;  4RB0 A;  3MR3 A;  1AEX A;  4OWT B;  2BQR A;  1WCM G;  3F1Z A;  4YAJ B;  1O7Z A;  1SYB A;  4RFB A;  1V9P A;  2DWC A;  2VA3 A;  1N8R C;  3GTK H;  4EFB A;  1A2T A;  1CKN A;  1Y14 B;  3GV6 A;  1B3Q A;  3KF8 A;  4ULL A;  4EYI B;  1MD2 D;  4CDE C;  1K0S A;  2MO1 A;  3TP6 A;  3CCU A;  2K03 A;  2GPW A;  1EYA A;  2KHJ A;  2R8H A;  3JSL A;  4U67 3;  3E0E A;  2F0M A;  3NTI A;  4RZR A;  5LMU H;  1IBM L;  2KOL A;  1JMC A;  3HEJ A;  4TRD A;  4RB1 A;  1WTQ A;  4BBR H;  4C3I B;  1PHJ A;  4K2L A;  3RIZ A;  4A3K B;  2PI2 E;  3J80 c;  4K0K H;  4NXM Q;  2CZG A;  5EKI A;  1ICW A;  4LFA L;  2WYO A;  4TKO B;  4KKU A;  2AQ3 B;  5I47 A;  2W7P A;  2VW9 A;  4ZCK A;  2FPP B;  4X3U A;  1VBH A;  3J81 W;  2NZH A;  2OCE A;  1BKB A;  1SNM A;  2PMZ A;  2RHS B;  1SE4 A;  4GKK Q;  4HJ5 A;  4O3S A;  3PUY A;  1A9X A;  5GAE C;  5IYC G;  4J9P A;  1U9R A;  1BBX C;  4IAJ A;  3RBE A;  4JCV E;  1CHQ D;  4ZKB B;  2F0H A;  4DAY A;  5CGK A;  3CME A;  4ECS A;  1YNN D;  5KT4 A;  2R7Z H;  3AMU A;  4ZQI A;  3CCM A;  4BXX G;  1MIU A;  4O3P A;  1PTO B;  4JC0 A;  2DLN A;  2E5L L;  4BWG B;  4HIK A;  3S9W A;  1L1O A;  1VQA A;  5FJ8 G;  4JI7 Q;  1U4L A;  2MFI A;  2XCP A;  4C2M H;  2F0P A;  4OXP A;  2BA1 A;  2KEN A;  2YU9 B;  5C3E G;  5LYJ F;  1OXS C;  1MKH A;  2JA6 G;  2W6M A;  4BA1 I;  1I3Q B;  2ASD A;  3I72 A;  4YBZ B;  3TS2 A;  2K5H A;  1QWY A;  3U9O A;  3GTL H;  3FEW X;  1WTR A;  1B33 N;  4LUO A;  1N34 Q;  4FYD A;  3GID A;  1WCM H;  4HNT A;  4DR4 L;  3T56 B;  5C44 B;  4RB2 C;  5JJK A;  2A68 C;  3TQ1 A;  3RTX A;  3PO2 G;  5DGA A;  4LFA H;  4KLK A;  1V43 A;  2ID0 A;  5K5P A;  5KNB A;  2QEJ C;  3NEN A;  1EHI A;  3S1R B;  5IT9 W;  1TWH B;  4CJ0 B;  4A75 A;  1D7Q A;  4XT3 B;  3UE0 A;  3I8Z A;  3H91 A;  3K5O A;  5E4W C;  5J1Z A;  2Y0S A;  4WBN F;  4RUC A;  3HKZ A;  2JA6 A;  5IY0 A;  1SEI A;  3MXG A;  4NP5 A;  1A3V A;  1SYD A;  2MHV A;  1RIP A;  4QJF A;  1C7Y A;  3MXN B;  3GTQ B;  1A2U A;  2YS7 A;  2KHS A;  3HOZ B;  2KBN A;  3R5F A;  4JI5 Q;  2MJ8 A;  2CCZ A;  3CCV A;  1HA5 A;  1X6O A;  4IUV A;  5EKL A;  5KFL A;  2FHT A;  1GJX A;  4X3K A;  2PQA B;  2KHI A;  5M3M B;  1GUS A;  2E2H H;  1PRT F;  3M4O B;  3MFY A;  4FXK C;  5IGC A;  4QWD A;  5KFM A;  1E1T A;  4OWW B;  3T1H L;  2XN9 C;  3Q6S A;  3GP7 A;  5ELF A;  2I07 B;  4DF7 A;  1DD2 A;  2JJQ A;  1SFO B;  3BA8 A;  4H02 A;  3K7A H;  2B2W C;  2M9V A;  5KEE A;  4RH6 A;  5IYC H;  1HHV A;  1TWC A;  2IT1 A;  2HHH Q;  1NBW A;  4ETS A;  1JX4 A;  2V59 A;  4DR4 H;  2GA4 B;  3RV4 A;  3NE5 B;  5A2Q L;  4C3I G;  3NBI A;  4R4O A;  4YWL A;  3NWT A;  3P1H A;  2A6H C;  4GOP A;  4A3K G;  1V1O A;  1MJE A;  4IRD A;  4BXX H;  1PXU A;  3TRZ A;  5KFZ A;  2EYH A;  4PZ8 A;  2VA2 A;  3CRL C;  4L63 B;  2AWN A;  1IBK L;  4RGO S;  3VYS A;  5FJ8 H;  1QJO A;  4XIG S;  2CQA A;  2JA8 G;  3PIO A;  2WKC A;  4KD3 A;  3EPG A;  2D2C C;  2FXQ A;  5C3E H;  2F0N A;  2ATL A;  5KFW A;  1S68 A;  2UUC Q;  2JA6 H;  3FDT A;  4GNX A;  5ELB A;  4NLG A;  1SDF A;  1Z9F A;  1AN7 A;  2N88 A;  4OX9 L;  2EIF A;  2A19 A;  2DPJ A;  5FLX W;  1JOK A;  2IL8 A;  2IX0 A;  3X3M A;  4DK6 C;  3V96 A;  2VNU D;  3S14 B;  1AP0 A;  2C22 A;  5KFK A;  4RNM A;  1N34 L;  3L4J A;  4NXM H;  1HZA A;  5IGG A;  1WTP A;  1I6H H;  2W6Q A;  4MA0 A;  2L11 A;  1AUX A;  4HED A;  2OF1 A;  3Q8D A;  1EY8 A;  3OYY A;  3SXH A;  3HBL A;  4R9W A;  2IP4 A;  4DR1 Q;  5CC4 A;  1CSQ A;  3VR3 A;  5JVH 3;  2SNM A;  2KED A;  4PWQ A;  1EIF A;  4GKK H;  1KL9 A;  2B2U A;  2JN4 A;  1W3S A;  4IQZ A;  1GSA A;  4DA2 A;  1SLJ A;  2FJZ A;  1RTN A;  1V1Q A;  1EQR A;  1G29 1;  4XX0 B;  2JEG A;  3HOX B;  2WV6 D;  3N41 B;  5KT7 A;  2O5I C;  3BDC A;  3IL8 A;  5C44 G;  1HNZ Q;  3NK9 A; 
#chains in the Genus database with same CATH homology
 4JI5 L;  3J7Z C;  4IFD J;  2R6G A;  4KI0 A;  3PO3 G;  4DPG A;  4FDB A;  1XMO L;  4JI0 Q;  4IPH A;  1N33 Q;  4JBW A;  1UWV A;  1SN8 A;  3F8T A;  2K52 A;  3H3V H;  4DUZ L;  2UU9 Q;  2CFM A;  5AJ3 L;  4TVA B;  1L2F A;  3HOY G;  2IHF A;  2K4K A;  3M3Y H;  1X54 A;  4QQB X;  2OQK A;  4JBJ A;  4DR3 L;  2Y0S G;  1U5K A;  3HKZ G;  5IP9 H;  4DV4 L;  1A62 A;  3F2C A;  3ULJ A;  1DGS A;  1VS0 A;  3AFQ A;  5IYD G;  1N9W A;  4B3R Q;  3RNU A;  1YVC A;  1ASZ A;  1Q7Y C;  4X6A H;  2UUB Q;  3PGZ A;  3HOZ G;  3M4P A;  4IPC A;  4AYB E;  4JI3 Q;  5H1S E;  4X64 Q;  3RLO A;  4C3I H;  3GD7 A;  2WP8 J;  5IWA L;  2HHH L;  4B3T Q;  3CPF A;  2H5X A;  4A3K H;  1S40 A;  1WI5 A;  3KLW A;  3K8A A;  1E24 A;  3A5Z B;  1K8G A;  3HOU G;  1HR0 L;  1Y1V G;  4JI8 Q;  5BR8 Q;  5C0X J;  3CCL A;  4DV7 Q;  1FJG Q;  3PCO B;  1EIY B;  3M85 A;  4Y7N H;  4P75 A;  3K80 C;  1QZG A;  4B3S L;  1PH6 A;  1NMG A;  2N8N A;  1Y1W G;  1SRO A;  3NEM A;  1J5E Q;  3AYH B;  2N3S A;  2ASB A;  3T1Y L;  2HIX A;  5GAD C;  4UP9 A;  3CF5 A;  5JEA G;  3CC4 A;  4DR7 Q;  2JA9 A;  3JAM i;  4MNO A;  1QUQ A;  1QVF A;  4BY1 H;  1GKH A;  1HNX L;  4LFC L;  2UUC L;  3UDF A;  1QUQ B;  2UXB Q;  2UUA L;  5HY6 A;  4X66 Q;  2NVT H;  1NJI C;  2C35 B;  1LTL A;  3ULP A;  5C4X H;  2E8G A;  4ALP A;  1SMX A;  1HR0 W;  2B63 G;  1E7Z A;  3S2D H;  4APV A;  3EBE A;  5GQO A;  3RR5 A;  4DV2 Q;  4GOP C;  4UP7 A;  4DAM A;  3PUX A;  4NXM L;  5C4J H;  4NXN L;  2WFW A;  1UE7 A;  4A3B G;  1KAW A;  5IP7 G;  1H95 A;  4DV0 Q;  1QVG A;  5IYB H;  3DLL A;  4GN5 A;  4GLV B;  4YCV A;  3J7A 5;  1BBU A;  1I3Q H;  2E5L Q;  1VQF A;  2YV5 A;  4DR6 L;  1XTD A;  3AFP A;  4JG2 A;  3PUZ A;  3W5O A;  4A3J G;  4GKK L;  2CQO A;  2GVB A;  1WYD A;  1NTG A;  4LNQ A;  2CWA A;  3I4O A;  2I0Q A;  3A0J A;  2F3I A;  4J15 A;  4X65 Q;  4LFB Q;  1VQ7 A;  3NEL A;  4GLA C;  1YJN A;  5C44 H;  3I2Z A;  2VQE Q;  1KD1 C;  3HFZ B;  2WB1 E;  3KDF A;  4DV5 L;  3PO3 H;  4AYB G;  1AE2 A;  1GVP A;  3FHW A;  3KDF B;  5LMN Q;  1YI2 A;  3ULL A;  2RHQ B;  4A3C G;  3NBH B;  2K50 A;  3S1R H;  4JI2 Q;  1TWH H;  2K75 A;  4DV1 Q;  1SRU A;  4KHZ A;  1E22 A;  2OQ0 A;  3PSI A;  4OWX B;  2R7F A;  3ERS X;  3OTO Q;  4JI0 L;  4JI7 L;  1N33 L;  3KFU A;  1HH2 P;  1YHB A;  1KXL A;  1XMQ Q;  2HQL A;  1AE3 A;  1Q46 A;  3HOV G;  4JYA Q;  2QEX A;  5ELO A;  1WFQ A;  1PH2 A;  1I50 H;  1TXY A;  3TS0 A;  5IYD H;  1UEB A;  3GTO H;  3GTQ H;  1B8A A;  2KCM A;  4IPD A;  2IX1 A;  1PFS A;  5K36 G;  1UE5 A;  3HOZ H;  5JEA J;  2JA7 G;  4JOI C;  3CQZ H;  4YCU A;  5ELN A;  3HOX G;  2BA0 A;  3U4Z A;  1W2B A;  4B3R L;  2UUB L;  3CCS A;  5C0X G;  3FKI G;  3BU2 A;  1VQD A;  3PO2 H;  4JI3 L;  1XPR A;  1P8L A;  3U58 A;  1X9N A;  3CP0 A;  3CXC A;  1M90 C;  5M3M H;  1FVI A;  1T9H A;  2LSS A;  4B3T L;  3HOU H;  3STB C;  3M4O H;  1VQ5 A;  1K83 H;  4A3D G;  1S3O A;  5LMU Q;  1NMF A;  1PH5 A;  3I4M H;  4QIW E;  3PUW A;  5DLQ E;  4R4T A;  1X3G A;  3M9B A;  3A74 A;  4XTC S;  2Q2H A;  4JI8 L;  5BR8 L;  4DV7 L;  1Y1W H;  1SFO H;  5M5X H;  5M5Y H;  1FJG L;  3PV0 A;  4K0K Q;  3KJO A;  3BZC A;  4A93 G;  1BBW A;  2D62 A;  4DUY Q;  2XTI A;  2B3G A;  2GN5 A;  1HZ9 A;  3LGJ A;  3KJP A;  3KOJ A;  4LF4 Q;  1U0L A;  1Q86 C;  1TWC H;  1PYS B;  3E9H A;  1PA6 A;  1VQK A;  2ZJQ A;  4A76 A;  3T1H Q;  4LF9 Q;  3I4N G;  4TQU S;  3L7Z C;  4A4I A;  4DR7 L;  2ZJR A;  1M1K C;  4POG A;  4WJ3 M;  2YTY A;  3S24 A;  4LF7 L;  2B63 H;  2UXB L;  1PH1 A;  4AIM A;  4X66 L;  2BH2 A;  1Z47 A;  4A3I G;  1BVS A;  4IPG A;  4A3E G;  1OXT A;  4HJ8 A;  4L5S A;  3A5U A;  2OTJ A;  4DKA C;  4EQ5 A;  1VCI A;  5C0X I;  2JEA I;  4GN4 B;  3I56 A;  1YEZ A;  1I94 Q;  1EFW A;  2JA5 G;  1C9O A;  2ZTD A;  1SE8 A;  2A1A A;  1E3P A;  5IP7 H;  1FGU A;  3OW2 A;  3F2B A;  2K5V A;  2YTV A;  4YWM A;  4PG3 A;  2CWP A;  2ATW A;  2R93 G;  4POF A;  3AEV A;  4YCW A;  2LXJ A;  3GTJ H;  3CMA A;  4DV0 L;  1IBK Q;  2F4V Q;  3EIV A;  2AKW B;  4IO9 A;  4DR5 Q;  4JI1 Q;  4A3J H;  3M7N A;  2I5M X;  2N49 A;  3CCE A;  4A3L G;  3G4S A;  3L0O A;  4PZ6 A;  3PIP A;  2UXC Q;  1LUZ A;  2MQH A;  2AMC B;  3ZJY C;  1K8A C;  1YIJ A;  1PH3 A;  4MTN A;  3S14 H;  1YNX A;  2IY5 B;  5JJL A;  4WJ4 A;  4L5Q A;  3L2P A;  4LW1 A;  1JJ2 A;  3FP9 A;  4OX9 Q;  3GTP H;  4X65 L;  4LFB L;  1IBM Q;  4A3C H;  1VQN A;  2VQE L;  1D8L A;  3ER0 A;  3RN5 A;  2JA8 H;  4A3G G;  3W1G A;  1IYJ B;  1TWA H;  2EQS A;  1UE6 A;  5LMN L;  4JI6 Q;  4DV6 Q;  2Q2U A;  5IE8 A;  1Q82 C;  1X56 A;  4JI2 L;  1XNQ L;  3J80 i;  2Q2I A;  4BBR G;  1VQL A;  3BZK A;  3HOV H;  4LFA Q;  3OTO L;  1YIT A;  1E1O A;  1JJC B;  4GKJ L;  2XGT A;  5FLM G;  2VUM G;  1XMQ L;  4JYA L;  2MO0 A;  1HJP A;  4AQY L;  2JA7 H;  3HOX H;  1N36 Q;  2L15 A;  2D0P A;  1C0A A;  3CCR A;  4JI4 Q;  1IBL Q;  1IXR A;  4RG1 A;  2PMZ E;  4A3M G;  3FKI H;  1VQB A;  3S1M H;  4R4Q A;  5LMN W;  4UY8 C;  2VQF Q;  1Q12 A;  4A3F G;  1EUJ A;  4EX5 A;  4LF8 Q;  4A3D H;  1VQO A;  4C3H H;  4PMW A;  4HJA A;  1JJG A;  4LF5 L;  4AH6 A;  4L5T A;  1PVO A;  3GDE A;  4UP8 A;  2WAQ E;  4DR2 Q;  1Q8K A;  3B6Y A;  4LF6 Q;  3S16 H;  5LMU L;  3CCJ A;  2JEB I;  2ZTE A;  1Q1B A;  4A93 H;  3KF6 A;  2AHO B;  1XMO Q;  2R7Z G;  3KF6 B;  3U50 C;  4DR1 L;  2VY3 A;  4ME3 A;  4X62 Q;  3GTM H;  4IJL A;  1KC8 C;  1NY4 A;  4K0K L;  2K5N A;  5M5W H;  1NE3 A;  4YWK A;  4DUY L;  3VDY A;  3I4N H;  3GO5 A;  2D0O A;  4DR3 Q;  3PUV A;  1KRT A;  1YJW A;  4LF4 L;  1JT8 A;  2ZM6 L;  1A8V A;  3CW2 C;  5E7N A;  4LF9 L;  3M4Q A;  2LXK A;  1LM0 A;  1GM5 A;  4A3E H;  4OO1 G;  2YTX A;  3K81 C;  2MNA A;  3K0X A;  2PNH A;  1HNZ L;  1FL0 A;  3CPW A;  4YY3 Q;  4HIM A;  1HZB A;  4HJ7 A;  3HOY H;  1HNW Q;  5HGQ A;  2JA5 H;  3I55 A;  4DR4 Q;  2NZO A;  4DV3 Q;  1B7Y B;  1X65 A;  5IWA Q;  1OXV A;  2N78 A;  1KHI A;  4R4C A;  1KIX A;  2UU9 L;  4LUV A;  1KQS A;  3S15 H;  4OWT B;  2R93 H;  1WCM G;  1I94 L;  3F1Z A;  4QL5 A;  1XPU A;  3W1B A;  4JV5 Q;  5JJI A;  1PH8 A;  1VQ9 A;  1CUK A;  1O7I A;  1V9P A;  4QY7 A;  1N8R C;  1VQI A;  2I5H A;  3GTK H;  4A3L H;  1CKN A;  3KYH C;  1RL2 A;  1Y14 B;  3CC2 A;  2F4V L;  1CKN B;  2Y0S E;  2BH8 A;  3HKZ E;  4DR5 L;  1UE1 A;  4JI1 L;  3KF8 B;  4KHP Q;  4X64 L;  4P74 A;  1K3R A;  3H0G G;  3S17 H;  1Y1V H;  1YBY A;  2UXC L;  2MO1 A;  1PYB A;  3CCU A;  5GRO A;  2UUA Q;  3D0F A;  2KHJ A;  3E0E A;  1EQQ A;  5M3F G;  1IBM L;  1JMC A;  1TWG H;  4BBR H;  1VQ6 A;  1IZ6 A;  2GVA A;  3CC7 A;  1PHJ A;  4DV6 L;  2Z6K A;  2PI2 E;  3J80 c;  3HKS A;  3G71 A;  1J5E L;  4NXM Q;  3HOW G;  2UXD Q;  2JK8 A;  5FLM H;  3S2H H;  4JBK A;  1GD7 A;  4O2D A;  4LFA L;  1ASY A;  1WOC A;  4PZ7 A;  4YHH Q;  2VW9 A;  4A3M H;  4DR6 Q;  2NZH A;  1N36 L;  2OCE A;  3J81 i;  1TWF H;  1BKB A;  2E2J H;  2RHS B;  3IRB A;  3WWV A;  3J81 j;  1IBL L;  4A3F H;  3UDG A;  4B3M Q;  4HJ5 A;  2K14 A;  4GKK Q;  3PUY A;  2WB1 G;  2JE6 I;  5GAE C;  5IYC G;  1K9M C;  1PV4 A;  2ZTC A;  4LUZ A;  4JCV E;  4DV2 L;  4HID A;  1VQC A;  2F52 A;  1XJV A;  4LF8 L;  1VQ4 A;  3AQQ A;  4DNI A;  2HIV A;  4GS3 A;  3CME A;  4DAY B;  3ICE A;  4R4I A;  2R7Z H;  2R92 G;  3CCM A;  2ZJP A;  1Q81 C;  4BXX G;  1MIU A;  4DR2 L;  1LYL A;  3RN2 A;  4JC0 A;  1J6Q A;  2E5L L;  4LF6 L;  4HIK A;  1L1O A;  1VQA A;  5FJ8 G;  4P71 A;  3E9I A;  1HZC A;  2ALY B;  4JI7 Q;  1L1O B;  2JQO A;  2MFI A;  4P73 A;  2NVY H;  4C2M H;  4QGU A;  4UPA A;  4X62 L;  4OXP A;  2BA1 A;  1PH7 A;  1YJ9 A;  2ES2 A;  2KEN A;  3UDI A;  5C3E G;  1YZ6 A;  2RCN A;  3RZD H;  4IOC A;  1MKH A;  1OXS C;  4IJH A;  2JA6 G;  1VQH A;  4BA1 I;  4P72 A;  1N32 Q;  5GAG C;  2KCT A;  2Q2T A;  4JBM A;  4NPS A;  3I7F A;  3TS2 A;  2K5H A;  1OXU A;  3GTL H;  1R9T H;  3RLF A;  1B70 B;  4DV1 L;  4LUO A;  4YY3 L;  1N34 Q;  1Q1E A;  1HNW L;  1WCM H;  4DR4 L;  2B29 A;  4DV3 L;  1SR3 A;  3K7U C;  1PH4 A;  3UDX A;  5JJK A;  1VQP A;  4IOA A;  3PO2 G;  4KLK A;  1V43 A;  2AWO A;  2ID0 A;  5EAY A;  3NEN A;  5M3M G;  2E2I H;  1PH9 A;  1I5F A;  1YHA A;  1XNR Q;  4A75 A;  1X55 A;  4DK3 C;  1D7Q A;  3UE0 A;  3CD6 A;  3F2D A;  3I4M G;  2HT1 A;  4BY7 G;  4HJ9 A;  3H0G H;  5IY0 A;  2V1C C;  4BBS G;  3BJU A;  4O0A A;  4KHP L;  2RF4 A;  3UE1 A;  1RIP A;  4QJF A;  1C7Y A;  3MXN B;  4GLX A;  2OWO A;  5AJ3 Q;  4LF7 Q;  5M3F H;  2KBN A;  3TRE A;  4JI5 Q;  1VQE A;  2CCZ A;  3MEF A;  3CCV A;  2A8V A;  5J3B A;  1X6O A;  3TEH B;  2PQA A;  1VQG A;  5FLX c;  4DUZ Q;  3HOW H;  1EOV A;  2PQA B;  1IL2 A;  2KHI A;  2E2H H;  2VS1 A;  3PF5 A;  2PI2 A;  1KRS A;  1E1T A;  2UXD L;  2NN6 G;  4NB3 A;  4DV4 Q;  3T1H L;  1K73 C;  2QA4 A;  4A3I H;  2OTL A;  4OWW B;  1WJJ A;  1P16 A;  1G51 A;  2YU9 H;  3U4V A;  2JJQ A;  1X3F A;  5IP9 G;  4H02 A;  1CSP A;  1YHQ A;  4YHH L;  3K7A H;  1EWI A;  1CKO A;  4OON A;  3J81 c;  5IYC H;  2IT1 A;  2HHH Q;  2NVQ H;  1X3E A;  1NBW A;  1XPO A;  4B3M L;  3EN2 A;  4GNX C;  4IFD G;  4R4O A;  4YWL A;  3S1N H;  4HIO A;  1HR0 Q;  4GOP A;  4A3K G;  2R92 H;  1MJE A;  1JB7 A;  4BXX H;  1JE5 A;  3TRZ A;  4GOP B;  4PZ8 A;  2AWN A;  1IBK L;  4B3S Q;  5FJ8 H;  4MZ9 A;  2Z6K C;  2NVX H;  4XIG S;  1XNQ Q;  3H15 A;  1K0R A;  2JA8 G;  3G48 A;  3PIO A;  3T1Y Q;  1CKM A;  3SGI A;  5C3E H;  2FXQ A;  1QZH A;  4JV5 L;  1HNX Q;  2UUC Q;  4LFC Q;  3S1Q H;  2EXD A;  2JA6 H;  3H3V I;  4GKJ Q;  4GNX A;  4A3G H;  2NN6 I;  1Z9F A;  2Z0S A;  4GNX B;  4OX9 L;  4AQY Q;  4OO1 I;  2YYZ A;  2EIF A;  2CKZ B;  2A19 A;  4BY1 G;  1OTC A;  3GTG H;  4A3B H;  1A63 A;  1N32 L;  1A0I A;  2IX0 A;  3CCQ A;  4L5R C;  4DK6 C;  4BA2 I;  4JI6 L;  5C4X G;  2VNU D;  2DUD A;  4Y52 H;  4LWC A;  2I5L X;  1GO3 E;  2VUM H;  2DGY A;  2WAQ G;  1N34 L;  4NXN Q;  2VZA A;  3RLN A;  4IFD I;  1HZA A;  4LF5 Q;  1I6H H;  4GN3 B;  1VQJ A;  3PF4 A;  3CAM A;  1EYG A;  1L1O C;  3Q8D A;  4BY7 H;  3OYY A;  4JI4 L;  1MJC A;  5IYB G;  5IT9 c;  3D31 A;  1XNR L;  4R1J A;  4DR1 Q;  3TQY A;  4BBS H;  1S72 A;  3JC6 6;  4JOI A;  2R7D A;  1CSQ A;  2QGQ A;  1L0W A;  4C3J H;  5GAH C;  1VQM A;  3RZO H;  1G6P A;  1EIF A;  3G6E A;  2VQF L;  1KL9 A;  2IHE A;  1W3S A;  4RMF A;  3STB D;  2ZM6 Q;  1QVC A;  1SLJ A;  1V1Q A;  4DV5 Q;  1EQR A;  1G29 1;  3JAM c;  2VL6 A;  1OXX K;  1AH9 A;  1VQ8 A;  3DM3 A;  5C44 G;  1HNZ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...