3HOZG

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hozG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3hozG01
5GAGC 5HGQA 2FXQA 5IYBG 4LFCQ 4X64Q 3S16H 4DR3Q 1D7QA 4GN3B 3RZDH 2OWOA 4JI6L 1I5FA 1YJWA 4AYBE 1N36L 2IHFA 2UUAL 4XIGS 1HR0W 1NMGA 2K50A 4KHZA 3ULLA 4LW1A 2ZJQA 4OONA 1C9OA 1VQPA 3M4OH 2BH8A 2VQFQ 3KFUA 4DV5L 3HOVG 1YBYA 3G48A 4A4IA 3HOYH 2UUCL 3OYYA 1EIYB 1BBUA 5GADC 1YVCA 4A3BG 1CKMA 4A3LH 1L1OA 2CWPA 3S1QH 2H5XA 3I4NH 1VCIA 5C3EG 4IOAA 2PI2A 3M4QA 5M3FG 3MEFA 1GKHA 1K8GA 4GKJL 1G291 1VQHA 2JA6H 2NVTH 5C4XG 1TWGH 1WCMG 5DLQE 1SE8A 4DR4Q 4LFBQ 3CAMA 1KC8C 2Q2HA 2VY3A 4OX9Q 3PUXA 3GTKH 1HZAA 1MJEA 3G4SA 3JC66 2ZTEA 3KJOA 1I94L 4DR6L 2Y0SG 4JI3Q 2WP8J 3U4ZA 4DUZQ 4DK6C 4A3GG 3TRZA 4BBRG 3KOJA 3OW2A 4IOCA 2EQSA 4LF9Q 1J5EQ 3FHWA 1XMQL 4UP7A 4GS3A 1H95A 5BR8Q 1D8LA 2PQAA 3H0GH 3CC2A 2B63H 4J15A 1IXRA 4GOPB 2BA0A 4NXNQ 4YY3Q 1CSPA 3G6EA 5HY6A 1PH5A 2JEAI 1X3GA 1N33L 4FDBA 4DV4L 2L15A 2MFIA 1KRSA 3I55A 1AH9A 1WYDA 3HOXG 1UE5A 1HZCA 3AFPA 4C3IH 2VW9A 4JYAL 1OXSC 3KDFA 2A19A 4UP9A 3CCUA 3WWVA 4B3RQ 1NY4A 2OCEA 5AJ3Q 2CKZB 3PV0A 1Q12A 4YCVA 4LF6L 4LF8Q 4GLXA 3I56A 4GN4B 4IPCA 1QUQA 3LGJA 1Q1EA 2XGTA 3UDXA 4X65L 3ULPA 2N8NA 1A8VA 5FLMH 2UU9L 1SR3A 1RIPA 3J80c 2ZM6Q 1JJCB 4P71A 3UE1A 5M5XH 4A3MH 1I3QH 3HOUG 1L1OC 3S15H 3HKZE 4POGA 2IX0A 2ATWA 1VQCA 2R7DA 3MXNB 2QEXA 4DV2Q 1WOCA 3L2PA 1PYSB 3M4PA 5GROA 1W2BA 1E3PA 3GTPH 2ES2A 1GM5A 4MNOA 3BU2A 1VQ4A 4GKKL 1VQFA 3AFQA 3KYHC 3CMEA 2JQOA 4HJ8A 4DR2Q 1MKHA 4DK3C 4X66L 4BXXH 2JA9A 4B3SQ 4MZ9A 3S17H 2NN6I 1MIUA 3AQQA 2D0OA 3RR5A 1HNZL 1FVIA 4HIDA 4K0KQ 3CCLA 2EXDA 3OTOL 1K9MC 3UDIA 1C0AA 5FJ8H 1IBKL 3PO3G 2JK8A 4JV5Q 4DV3L 3KF8B 4DPGA 2E2JH 1Q82C 5C4JH 1FJGQ 3BJUA 1J6QA 4X6AH 2IHEA 1CKNB 1Y1VG 3DM3A 2E2HH 4BBSG 3CPFA 3TEHB 3J7A5 1X55A 3F2CA 1CUKA 2CWAA 5JEAG 5LMNQ 4DR5Q 1SRUA 2UUAQ 3KF6B 1PH1A 3H3VH 3HOWG 4R4IA 2PMZE 1N34L 4P72A 3NBHB 2I5LX 1UE6A 3S14H 4R4TA 4DV6Q 1XNRL 3I4MH 2UXDQ 4DV1Q 2AWNA 4DV5Q 2KCTA 4Y52H 5IYDG 1P8LA 2RHSB 4H02A 4KI0A 3CXCA 4BY7H 3BZCA 4MTNA 4OO1I 5C0XI 3S2HH 4JI7L 3GTMH 2C35B 3CCVA 5K36G 5JJKA 3AYHB 5JEAJ 1S72A 2R7ZH 4JI5L 4YHHQ 2VUMG 1YEZA 3RLFA 2R6GA 4JI0L 3PF4A 1W3SA 2LXKA 3I7FA 4DUYL 1PH9A 2YYZA 4A3KH 2PI2E 2R92H 2RHQB 1QVGA 1EUJA 4R1JA 4A76A 2CCZA 4DAMA 2JA5G 2MO1A 4NPSA 3J81j 3CD6A 4A3CG 2N3SA 3ER0A 4DR1Q 4LF4L 5LMUL 4L5RC 3PUYA 1K83H 2JA8G 3PGZA 1PH7A 5IE8A 2D62A 4A3IH 3GTGH 3UE0A 1JE5A 3ERSX 2LXJA 2VZAA 1Y1WH 1C7YA 4NXML 4HIKA 2JA8H 1LM0A 3K0XA 2E5LL 3U4VA 1PFSA 2CQOA 5LMNW 4WJ3M 2K5VA 4YCWA 1OXUA 3NENA 3STBC 1NBWA 2YTYA 3PUZA 1HR0L 4OWWB 1VQ9A 2AKWB 3HOVH 3FKIH 3CCRA 1UWVA 2PNHA 1HNWQ 1X9NA 2JJQA 1KL9A 3PUWA 3F2BA 1L2FA 3K7UC 2K75A 1O7IA 4A3FG 2YTVA 2F4VL 4A3BH 4IFDI 1B70B 4IPDA 3W5OA 1N8RC 3HOYG 5J3BA 3W1GA 2Z6KA 1VQLA 5C3EH 3T1HQ 4LFAL 5IYCH 3L7ZC 1VQKA 4A93H 4X65Q 1WJJA 1PH3A 4A3LG 1IBMQ 1QVCA 1N9WA 1SMXA 3I4OA 4JI1L 1PVOA 4HJ7A 2UU9Q 3CMAA 3I4NG 1TWAH 4R4QA 1OXVA 3EBEA 3CP0A 2V1CC 4A3EG 3DLLA 1JB7A 1QVFA 1QZGA 2IT1A 1PYBA 4PZ8A 3TQYA 3T1YL 5IWAQ 1XPRA 2UXBL 2IY5B 3CPWA 4RG1A 1N32L 1A0IA 3CC7A 1SLJA 4JBWA 4A3GH 3HOZG 4DV0L 5M5WH 3RNUA 1Q46A 2HHHL 2NZHA 3STBD 1PA6A 4GOPC 1HNXL 4GNXB 2UUBL 1I6HH 1VQIA 4DR7L 5IY0A 4DV7Q 3PF5A 1SFOH 1VQ7A 3ICEA 1IYJB 1E24A 2KENA 2E8GA 2HQLA 1TXYA 3RLOA 4DR3L 3M3YH 3A5UA 3G71A 2LSSA 4OXPA 4X62L 1S3OA 4APVA 4JI4Q 1BVSA 4AH6A 1IBKQ 2I0QA 1NMFA 3H0GG 2R93H 2D0PA 1BKBA 3PCOB 4LUZA 3HOXH 1Q8KA 2B29A 2VL6A 5H1SE 1PH6A 2B63G 2WB1G 2I5HA 3CCSA 1AE2A 2R7FA 3PO2G 2AHOB 2VQFL 5E7NA 4TQUS 3KLWA 1ASZA 3PIOA 2JA7H 4B3TQ 2UXCQ 4PG3A 2E2IH 1XMOQ 2NN6G 1YI2A 3CW2C 3GTOH 4PMWA 1YJ9A 1T9HA 2YU9H 4YWMA 1XNQQ 4QIWE 1V9PA 3HOUH 4JI8Q 1RL2A 3ZJYC 2ALYB 2Z6KC 5FLMG 2YV5A 4YCUA 1JJ2A 5JJLA 1R9TH 4AQYL 4LF7Q 4DR4L 4A3MG 4QQBX 1DGSA 1FL0A 1LTLA 2VQEQ 2GVAA 1A62A 4LF5Q 1YZ6A 2BA1A 4JI3L 2Z0SA 3CQZH 4A3JH 3CC4A 3K7AH 5IT9c 4L5TA 2ZJPA 1Y14B 4TVAB 5M5YH 5IP7G 4LF9L 4HIMA 1J5EL 1FGUA 4GLAC 2HT1A 4P74A 2ID0A 1Q1BA 2KCMA 1WFQA 1JMCA 2MO0A 5BR8L 5C0XG 4JI6Q 4LF4Q 3PO3H 4B3ML 1P16A 4OO1G 5LMUQ 1N36Q 1IBLL 2IX1A 3CCEA 2JE6I 2RF4A 2YTXA 4IJHA 4NXNL 4YY3L 1HZBA 4B3TL 4JI2L 1A63A 4AYBG 1IZ6A 3M85A 3D31A 1SN8A 4C3JH 1K3RA 4O0AA 1TWCH 3UDGA 4R4OA 2UUCQ 5AJ3L 2GN5A 4GLVB 1XJVA 1L0WA 5C44G 4UP8A 5C0XJ 4JC0A 4IJLA 5ELNA 4LF8L 2QGQA 4YWKA 5IYDH 1UEBA 2K14A 1OXTA 4BY1G 3RLNA 1VQ6A 2I5MX 4KHPL 5IP9G 2ZJRA 3AEVA 1U5KA 4GKJQ 4IPGA 3UDFA 3I4MG 1OTCA 1E1TA 1EOVA 2AMCB 1VQ8A 3U50C 4JCVE 2F3IA 4QGUA 1AE3A 4GOPA 1VQ5A 2VUMH 1VQJA 4DV2L 3CCQA 1LUZA 3KDFB 4YWLA 1HH2P 1I94Q 1CSQA 1I50H 3H3VI 2R7ZG 4DR6Q 1G6PA 5C4XH 4IO9A 3EN2A 5IYBH 4DR2L 5M3MG 2UXBQ 4WJ4A 1GD7A 2JA5H 4B3SL 4A3DG 1GVPA 1XMQQ 4IFDG 3B6YA 1VQOA 4UPAA 4K0KL 3F8TA 4HJAA 2WFWA 4HJ5A 4JV5L 3I2ZA 2MQHA 5GQOA 1B8AA 1LYLA 1UE7A 3IRBA 3J81i 1FJGL 1N33Q 3A0JA 4DV4Q 4OWXB 1EWIA 4A3IG 2VNUD 4JOIC 1UE1A 2DUDA 4JYAQ 4X62Q 1Y1WG 4UY8C 1KXLA 1OXXK 5LMNL 1NTGA 4HIOA 2ZTCA 4DR5L 2N78A 1KIXA 4IFDJ 3J81c 4RMFA 5M3FH 4LF6Q 2N49A 5GAHC 3S2DH 3GD7A 4A3FH 4KLKA 1YJNA 4LWCA 3J7ZC 4DV6L 1PH2A 2NVYH 2UXDL 4DV1L 3FKIG 2KBNA 4EX5A 3EIVA 3M9BA 1Q81C 4GN5A 4P73A 1WCMH 1Z9FA 2RCNA 1TWFH 3PUVA 1HJPA 1V43A 4POFA 2F52A 1Q7YC 3PIPA 1JT8A 3K80C 3Q8DA 2JA6G 1HZ9A 4YHHL 3A5ZB 2WAQE 5ELOA 5IYCG 1CKNA 4A93G 3HKZG 4A3EH 3TS2A 2NVXH 4GKKQ 3CF5A 4BBRH 4GNXC 2K52A 3W1BA 3GDEA 4AQYQ 3KF6A 4X66Q 1X65A 4O2DA 1V1QA 2CFMA 1KHIA 2NZOA 3HOZH 4L5QA 4LFCL 3GTLH 4X64L 1HNZQ 3GTJH 2OTJA 3VDYA 3OTOQ 2K5HA 4DR1L 3RN5A 4DV3Q 1WI5A 3A74A 1PHJA 1EQRA 1YITA 3F1ZA 3TREA 2Q2IA 2XTIA 4LUVA 3FP9A 2K5NA 1VQNA 4LNQA 3S1RH 3ULJA 1U0LA 3BZKA 1MJCA 4B3MQ 1IBLQ 4QJFA 4PZ6A 3HKSA 3GTQH 2Q2UA 4JBMA 3H15A 3PO2H 1VQAA 4JI2Q 1N34Q 3S1NH 2R93G 1KRTA 1HNWL 1XNRQ 1SROA 1B7YB 3JAMi 2DGYA 3KJPA 2VS1A 5FLXc 3U58A 2BH2A 1Z47A 1NE3A 2A8VA 3J80i 4JG2A 2JA7G 2ASBA 1E22A 3E0EA 3T1HL 1KD1C 4JI7Q 4LFBL 1XTDA 2Y0SE 3JAMc 4OX9L 4JI5Q 1IBML 2MNAA 1XPUA 4KHPQ 4QY7A 4JI0Q 2HIVA 3TS0A 4BA2I 4DUYQ 2OQKA 3HFZB 4C3HH 3CCJA 4DUZL 1L1OB 3M7NA 1K73C 5IWAL 3K81C 1E7ZA 4BXXG 5JJIA 1CKOA 4JOIA 4AIMA 1X3EA 3S24A 3E9IA 4DKAC 1PH8A 2EIFA 1GO3E 5IP7H 2KHIA 2OQ0A 2B3GA 5FJ8G 4DNIA 5EAYA 4DV7L 4BA1I 4HJ9A 1Y1VH 4A3JG 2GVBA 3NELA 3K8AA 3PSIA 1Q86C 1TWHH 4NXMQ 4BBSH 2A1AA 2ZTDA 2E5LQ 2QA4A 1M90C 3HOWH 4JI4L 1X6OA 2K4KA 3F2DA 4Y7NH 2JEBI 2WB1E 4B3RL 3E9HA 1VQBA 4L5SA 1VQGA 4P75A 4OWTB 1HR0Q 1BBWA 3S1MH 4ME3A 1EIFA 2HIXA 1ASYA 1JJGA 2NVQH 2PQAB 2F4VQ 1G51A 3SGIA 1XPOA 1X3FA 1QZHA 4JBJA 4C2MH 4R4CA 5C44H 2ZM6L 4NB3A 1VQMA 4DAYB 1XMOL 1M1KC 2OTLA 1PV4A 2UXCL 1VS0A 2Q2TA 4GNXA 4ALPA 4BY1H 1EYGA 4BY7G 1X54A 4LUOA 4LFAQ 5IP9H 1XNQL 4XTCS 4JI1Q 5GAEC 1YIJA 4IPHA 4A75A 4JI8L 1X56A 4PZ7A 1K0RA 4JBKA 1YHAA 1YHBA 1K8AC 4LF7L 1EFWA 3L0OA 3T1YQ 1PH4A 3NEMA 1S40A 1QUQB 3CCMA 4A3KG 3RZOH 2R92G 4A3CH 1N32Q 2VQEL 3D0FA 1VQDA 2KHJA 4DV0Q 1VQEA 1KQSA 1E1OA 3RN2A 1YHQA 2HHHQ 4LF5L 5M3MH 2UUBQ 2AWOA 4EQ5A 1HNXQ 4A3DH 1YNXA 2WAQG 1KAWA 1IL2A 1NJIC 3GO5A 4DR7Q 4QL5A 1EQQA
chains in the Genus database with same CATH superfamily
3SR1A 1SNOA 3L9AX 4P2CB 1AUXA 1BCPD 4GN3B 4OIJA 4CDDC 1E4EA 2ATLA 3A8JE 1YJWA 1N36L 2IHFA 2UUAL 2X6LA 4ZRZA 1PK8A 2UXCH 3WOFA 1XMOH 2ZJQA 4IUTA 3P7JA 3M4OH 2ZJTA 2VQFQ 4FF4A 3J81L 4CJ2C 1RODA 2UUCL 1LTBD 3G6JB 4A3BB 3MEHA 1BBUA 1G2SA 4XYOA 2EY2A 1CKMA 3AU7A 4NMZA 5C3EB 4C5AA 3OWEB 4IOAA 1SNDA 5LP6F 4EGJA 1GKHA 2Q8RE 2VQEH 5JOBA 2DY8A 4ECQA 1HA5A 2JN4A 2MGSA 5K2MA 1WD0A 5CAEB 4DR4Q 4LFBQ 2FK3A 4ZKCB 1JOKA 4LAAA 1MJEA 5H80A 2FMMA 2MPMA 3JC66 2ZTEA 2RSNA 1JIHA 2Y0SG 3KALA 4JI6H 4A3GG 4DK6C 2E2HA 1GSOA 4BBRG 4ZQ3A 4KTAA 1SFOB 5DLGA 1MSHA 5KFWA 2KA7A 4MV4A 1F9PA 3H0GH 2FINB 2B63H 2MJ8A 3QOJA 2QK4A 1PFBA 1PH5A 2R93B 3HXLA 1E4FT 3D4RA 5KFAA 3HOXB 4FDBA 2MFIA 5KYIA 3JRXA 1BJTA 3AFPA 2L4NA 2PYKA 4C3IH 2VW9A 4UFZA 5EWGA 4UP9A 1W6KA 1SYBA 3WWVA 3QR8A 2OCEA 4F4XA 3PV0A 4APMA 4KJNA 2IW3A 2F3VA 4X65L 4IPCA 3LGJA 2YU9B 2LY7A 3UDXA 2C2RA 5JPNC 5FLMH 3C1FA 4CDCC 5I6YA 1RIPA 1SEBD 4HTHA 2W7PA 4RZRA 2O4XA 4P71A 5KT7A 1S0NA 3RB4A 4DK1A 3L4KA 2Z4HA 4DL5A 2R7DA 3MXNB 2I46A 2QEXA 3JRWA 4G4KA 5GROA 1W2BA 2SNSA 3GTPH 1JLLB 1GM5A 1VQFA 2JQOA 1KC7A 1MKHA 4DK3C 3K7AB 2H4OA 5CV6A 4MZ9A 4EQOA 5KEEA 1LTGD 1SYXB 3J81E 3BS1A 3UDIA 1C0AA 2VPQA 1SNCA 3RFCA 1HUMA 4PNYA 2XGPA 5F2DA 4MA5A 4DPGA 5EKKA 3H3VC 1O7LA 1FJGQ 1DV1A 2X0SA 3PW5A 1ET6A 2IHEA 3CPFA 2IBKA 2R7LA 4DR5Q 1TWCB 3H94A 1TWAA 2HUGA 3M9NB 4R4IA 2BCOA 5LL6S 1HRJA 3NBHB 4EQPA 1L2ZA 2NTSA 1JDEA 2UXDQ 2GPWA 4QW9A 1D6EC 4DV5Q 1P8LA 4H02A 4KI0A 2RVLA 3LP8A 5C0XI 1F9SA 3Q23A 2VUMB 5CV9A 2UVUA 1S72A 2F0LA 1HNZH 1KEEA 3I7FA 1CI3M 1I50B 4RWSC 1PH9A 3PQIA 1IBKH 5BN3A 2R92H 2RHQB 1SNMA 2KEDA 4R1JA 5BN4A 1UUPA 3R5FA 1JWMD 1C4QA 4A3CG 4DR1Q 5KG0A 4G57A 1S5CD 3SK5A 4L5RC 3QB3A 1K83H 4ID6A 1F9QA 2JA7A 4ZQIA 2E2IA 3UE0A 1HTPA 2LXJA 1Y1WH 1C7YA 3GTOA 4HIKA 5LA6F 3QJYA 2JEGA 3Q1KA 4K5WA 2AGOA 5LMNW 4WJ3M 2K5VA 4MV7A 4ED6A 2A5HA 5A2QL 3PUZA 1EOTA 2YTYA 3I72A 4OWWB 1VQ9A 4K8IA 4IN3A 3S2DB 3FKIH 2R61A 3MWYW 4Q43A 1K1QA 1KJIA 1O7IA 4A3FG 4ECZA 1EL0A 4IPDA 3W5OA 1GUOA 1N8RC 2HQEA 2CW7A 1WJJA 4A3LG 1PVOA 3GV3A 2ZXPA 4CJ1B 3E3XA 4R4QA 4ABNA 2UVVA 2J7ZA 4IUPA 5KFRA 2V1CC 1HHVA 3A8IE 2VPSA 1RTNA 5LMUH 1CQJB 1XPRA 1PX2A 5KFOA 2XRQD 5M9OA 3CC7A 1SLJA 3PW0A 3RNUA 2HHHL 2NZHA 4F4ZA 4A2AA 1I6HH 1HNXL 5KT5A 5G3LF 1DIKA 1VQIA 1B50A 3T5KA 2FPIB 1MGSA 1HR0H 2NUAB 1IYJB 3C1EA 1TIID 4IZOA 1R4PB 4F50A 1TXYA 1NR2A 5EOYA 2F4VH 2I0QA 1Q3LA 1JDBB 1UNNC 4TV8F 3GTQB 2M2LA 3PO2B 2WB1G 1AE2A 1HA6A 2KCNA 4KN4C 1BQQT 1KABA 1WTRA 3KLWA 3V6HA 2AGPA 3SK8A 2TMPA 3NE5B 3PIOA 2UXCQ 4HMJA 2V5AA 1GUWA 1XMOQ 1STEA 3CW2C 1YJ9A 3T4AC 2UXBH 1R4QB 3T1YH 3OUUA 1N32H 1JC7A 3HOUH 4DV0H 2ALYB 4YCUA 1CA5A 4DL4A 1R9TH 5CA0F 2UUBH 1DOLA 1TU2B 1LTLA 1T5XD 3D4WA 5LOVF 4Q8EA 2VQEQ 5F9LA 4O1NA 1A62A 4DR3H 4JI3L 4X62H 2Z0SA 4B08A 4A3JH 1Q90A 5A2QE 5BN5A 2O2LD 5IP7G 4LF9L 2YCHA 1FGUA 4GLAC 3N41B 1WFQA 4OO1G 4JI6Q 3VYTA 4CDFC 2Z9HA 4Q5VA 1PDQA 2RDGA 2RF4A 3MJFA 2L1BA 4IWXA 4YY3L 4AYBB 1B3AA 3HG9A 4F8MA 1TWFA 2E76C 4QWAA 2XN9C 1S03G 4HAEA 3H91A 2NVQB 4O0AA 4Q0YA 1NR4A 5FPRA 4C2MB 2DJFC 3X3NA 4ED8A 2GN5A 4OGQC 1XJVA 1L0WA 4OHJA 5C0XJ 5KG5A 4AQYH 5BPHA 5IYDH 2QGQA 1UEBA 1OXTA 4BY1G 1SFOA 3R5HA 5IP9G 3UDFA 3I4MG 1RD9D 1JORA 1E1TA 3HP3A 1VQ8A 3SHLA 4JCVE 2F3IA 2R7KA 4QGUA 1VQ5A 2AQ1B 1V8QA 5CYUA 5KYLA 5KFEA 4FXDA 3MAQA 3RZOB 4IRCA 4HSPA 4RAUC 3GIPA 3L3OC 3SEBA 3H3VI 3HRZC 4XT3B 2R7ZG 5BR8H 1G6PA 1GSAA 4IO9A 3BAAA 1IBLH 3PR4A 1MHWC 2HCCA 3KLSA 4DR2L 5M3MG 5KT4A 4N9PA 4B3SL 2WB1A 4O3QA 1EEFD 1EFID 2YU9A 3RZDB 2WFWA 4I7AA 4G3IA 3I2ZA 2MQHA 4KY7A 4RU9A 1QOHA 3R2IA 3IRBA 2EXZA 4EYIB 2PVPA 4A3IG 3MR5A 4LF8H 3MXNA 3J81W 2ASLA 2VUGA 2ZXOA 5CA1F 4NW2A 5EWEA 2N78A 3I90A 3BDLA 3J81c 2E2DC 3GIJA 1EHIA 3GD7A 1LT5D 3S1QB 3VMMA 2NVYH 3I4NB 4DV1L 2NU8B 4MHEA 1IKMA 2L0CA 4C56C 1Z9FA 2C2EA 2HDMA 1HJPA 3PUVA 1Q7YC 2F52A 3PIPA 4YP3A 3OSOA 3R93A 1TWGB 5F9NA 1HZ9A 4YHHL 1Y1VA 3A5ZB 3EFXD 5EKIA 3GTKB 1T5EA 4A93G 1SYCA 4A3EH 1HFNA 4HR7B 1PFNA 2MUYA 4BBRH 3CF5A 3S9WA 4JV5H 1TWCA 1X65A 2CZGA 4O2DA 2B8FA 4L6TB 4L5QA 4LFCL 4XQNA 4BS9A 2K28A 4X64L 1HNZQ 3GTJH 2PPBC 4EGQA 5C3XA 3VDYA 1EQVA 5E1FA 2K5HA 2YRWA 1D1IA 2ZT9C 2Q8IB 2R8JA 1Y8OB 3F1ZA 4LUVA 1C30A 3PIO3 3PMFA 2VUMA 1PRTF 3MC0B 3S1RH 3ULJA 3GQBA 4XXEA 4PZ6A 4K2LA 4CDEC 2NBFA 3HKSA 4O3RA 4JBMA 1E2VA 3H15A 3T13A 1ML0D 1HUNA 2V58A 1HNWL 3JAMi 2W9AA 1EYCA 3KJPA 3TP8A 3OPOA 1S68A 4RGTA 4OL7A 3J80i 4J9PA 4MAMA 5M5XB 5DM63 3E0EA 2ASBA 2LKVA 5KNCA 1KD1C 5C6AA 1XTDA 2KSWA 4ZUIA 1BNCA 4J9SA 4J9RA 2W8LA 1QB5D 1IBML 2JYOA 1DD2A 4KHPQ 2F0QA 2R3ZA 3TS0A 4BA2I 2XVSA 3NBIA 3RB0A 2OQKA 3CCJA 4DUZL 4DAVA 5KG7A 2W9CB 4LJZC 4WJWA 3K58A 2O5IC 4UCSA 2EYPA 3S17B 5JJIA 3QO2A 4AIMA 3H20A 1STHA 3T5JA 1BUVT 4HJ9A 2F0VA 1YNJC 2E2JB 4O3PA 1PTOB 2W70A 1Q86C 3NGDA 3BQ1A 2A1AA 3BYYB 5KFDA 3MFYA 4JI4L 1KLGD 3FMCA 4HSVA 2E2HB 4O4HF 2JEBI 1KNAA 2RDHA 2AQ4A 1VQGA 1HR0Q 1JKJB 2M05A 3V4SA 3DUZA 3T1HH 4LFBH 3IN5A 2F4VQ 1G51A 1EYGA 4JBJA 1JE4A 1BCPC 1BCPB 2ZM6L 4NB3A 5DNFA 1VQMA 4B3TL 2OTLA 1PV4A 3CVZA 4ALPA 3GP7A 4JVZA 1Y69U 1U4PA 1SSOA 3ND9A 1AZPA 4IPHA 4A75A 3PN1A 1S0MA 3H0GA 2F1MA 1YHBA 3Q22A 1EFWA 2PCFB 3L0OA 3T1YQ 2B63A 4DV7H 4A3CH 2R92G 1N32Q 3T5LA 2EY6A 4JW0A 2OLSA 3D0FA 4EVOA 4DV0Q 3JZIA 1KQSA 3R3OA 1TKWB 1BXTA 4XQQA 2UUBQ 2AWOA 1JR0D 2A6ED 4A3DH 2ZDQA 4PQXA 3GTGB 4UCVA 5KFPA 1SE2A 1D5MC 3S16H 4DR3Q 2CQAA 1EU3A 1D7QA 2PMZA 1BR9A 1I5FA 4AYBE 5A2QW 4KHVA 1SXTA 1RDPD 4ETSA 4QWCA 3VR6A 3BDCA 3KFUA 1JOQA 1M7JA 5KFCA 2L12A 3GTPA 1EIYB 4EEQA 4A3LH 3BA8A 2CWPA 2FB9A 4LF7H 3DWPA 3RUPA 2PI2A 5M3FG 2PN1A 4GKJL 3QIAA 1TWAB 2HJWA 1VQHA 4KV6A 2JA6H 3V4ZA 1SE3A 2NVTH 2HVRA 3TQ1A 2A68D 1WCMG 4AYBA 3CAMA 2VY3A 1DONA 3PUXA 5D1PA 5KRUA 2K1BA 1CE8A 4A3GB 3L4JA 5M5WB 2QDBA 5FOBB 2XWJB 1S5BD 3KAKA 2J6UA 1ENAA 3NXWA 4IOCA 4FVMA 4TQSA 4GS3A 5BR8Q 3RB3A 1D8LA 1I7LA 4I7ZC 4DV5H 1WTXA 4J15A 1IXRA 1VMPA 4GOPB 2K5QA 2BA0A 2QILA 4DAYA 1CSPA 1X3GA 5K5PA 3I55A 1KRSA 5EDWA 1BDOA 1RHPA 1UE5A 5KNBA 1OXSC 3CCUA 2A19A 3H4DA 2JA7B 4IHJF 5AJ3Q 1S97A 2E2IB 2OH2A 4L1KA 1LTAD 4YCVA 5ISRA 3GTOB 4LF8Q 4GLXA 2PBZA 2R92A 1QUQA 1Q1EA 2QDLA 2XGTA 1VF5C 2N8NA 2UU9L 1G6ZA 2GPSA 3CRLC 5EPKA 1I94H 3V2TA 4DR6H 2B2VC 3KLSX 4UCUA 3JAML 3HOUG 1L1OC 1TS4A 3S15H 4WBNF 4KK7A 2IX0A 1VQCA 3OIPA 4LMYA 1WOCA 3M4PA 1XMQH 2ES2A 1Y1WA 3BU2A 1VQ4A 1ULZA 3J7AK 3AFQA 3KYHC 4IQZA 2EY1A 4X66L 4BXXH 1RF2D 5CV5A 4C3HG 5M5YB 1N33H 5T1IA 3GIIA 2RDIA 4DV4H 1FVIA 2X6GA 3FKIA 1CM9A 3BVMA 2EXDA 3OTOL 1K9MC 3CCLA 1AUVA 4JYAH 5KFMA 4JV5Q 4DV3L 4I65A 1QG7A 1A15A 3RB6A 4LF6H 2V4DA 1TWGA 4F88A 2I87A 5DQIA 2NB0A 4FNFA 3J7A5 3TEHB 3GTKA 5DLFA 2UUAQ 3BG3A 3EJIA 3H3VH 3RD4A 5KKNB 4I55F 4CC6A 3RBDA 3I4MH 5JVLA 2EE1A 5IYDG 5E3FA 1O75A 5KFSA 4FYDA 4GKKH 4XX0B 1V1PB 5D3DA 3S2HH 4JI7L 3GTMH 4YIJA 2VR1A 3CCVA 5JEAJ 4QWDA 2R7ZH 4JI5L 2R7NA 4JI0L 4RUAA 5I6WA 2B8GA 2WACA 1TR5A 4RB3C 5T14A 5C4XB 3N44B 2F0IA 3G6VA 2W6OA 2L5TA 2VA2A 1UAPA 4DAMA 2RGVA 1KTKA 2MO1A 5KFIA 3CD6A 4XYMB 3ER0A 4LF4L 4ZOLF 2JA8G 1PH7A 3TP5A 5IE8A 2D62A 4A3IH 3FVQA 1LLRD 1IYUA 5DQGA 3ERSX 1N34H 1XNRH 1O80A 1OWTA 4FS2A 1B33N 3SI8A 3JAME 3W2DA 1NBWA 2DPJA 3HOVH 1R9TA 2KEEA 1UWVA 1SNPA 2PNHA 4FO2A 3H6MA 3DWAA 4ODGA 4A3FB 1X9NA 2W9CA 2ZDGA 3K7UC 3VR4A 2QKIC 2YTVA 3N8DA 3M9OB 4N8FA 4IFDI 1SMYD 1V1OA 3HOYG 4GZYC 3W1GA 3MWDA 2Z6KA 1TWFB 4FP5D 3T1HQ 4DUYH 3SK4A 4LFAL 3L7ZC 2G9DA 1VQKA 4X65Q 1PH3A 4A93H 4TUYF 2R8IA 3OIQA 4JI1L 4HJ7A 3CMAA 3CP0A 4F4YA 4A3EG 2IWHA 1PYBA 5KG4A 5IWAQ 1LV9A 3TZUA 4PMCA 4RG1A 4HEDA 3EPIA 4NXMH 1AN8A 3H09A 2E5LH 1PA6A 1M0TA 4GNXB 5KFNA 5JJZA 3GIKA 4DR7L 1RYSA 2HD3A 4DV7Q 3PF5A 1VQ7A 1PFMA 1D2BA 3ICEA 1LO5D 2KENA 4R9WA 3EQLC 1MD2D 3M3YH 4LH7A 4J9QA 3N6XA 3M7GA 2FHTA 4APVA 2F03A 1BVSA 4AH6A 1M6VA 5KFJA 1PZID 2CW0D 2K33A 2WB1B 5KG2A 2VL6A 1PH6A 4E4TA 1Z6HA 5CV8A 3I3CA 2VQFL 3LWBA 4ECSA 4TQUS 1ESRA 1W96A 1TAEA 3DHQA 2J6TA 2WAQA 4XQJA 1STYA 1T9HA 1STGA 1V51A 3Q8SB 3GTGA 3ONAB 1V9PA 1A2TA 3TSSA 3K5MA 5BMVF 3ZJYC 1GXDC 5JJLA 1JJ2A 4LF7Q 3ETJA 4DR4L 3VA7A 4A3MG 4QQBX 2K05A 5CBEE 2WTFA 3IL8A 1WTHA 1EUCB 1LACA 2PW5A 3CQZH 5A35A 3CC4A 3ORRA 3AB9A 3KBXA 4L5TA 2A69D 4QB4A 3KUPA 4WFN3 4HIMA 1Y1VB 2HT1A 5JQWA 4L8JA 4P74A 4DU9A 2ID0A 3PO3H 4BBSB 5C0XG 4B3ML 5CBAE 3HOWB 4QW8A 4TQRA 4ZHQF 4Y7NB 4IJHA 5I2YA 1HZBA 2J9GA 3QG1A 3RV3A 4JI2L 1A63A 1K3BC 2KJXA 4KKUA 1O7YA 3M85A 3D31A 4ED1A 4K14A 1SN8A 4C3JH 1T94A 2Y0SA 4I7HA 4R4OA 5BPFA 3TBIB 4GLVB 4UP8A 5FO8B 1I4XA 3URYA 3X3MA 5ELNA 1X3QA 4BY1B 1YNNC 2FKLA 2K14A 4X3SA 2I5MX 5CMDA 2I8CA 4IPGA 3GTJA 1TT2A 4RUCA 3O13A 4GOPA 3GIMA 4DF7A 1VQJA 4BWSC 1S5FD 4QWBA 3T56B 1X3PA 3SXHA 1J5EH 3N43B 1B44D 4MIUA 1HH2P 4YWLA 3H4BA 1I94Q 1CSQA 4DR6Q 1EY6A 2KVMA 2RQXA 5M3MB 3A7LA 5IGEA 2R84A 3EN2A 2W6ZA 1DM0B 4NXNH 1GD7A 2JA5H 4A3DG 1A6XA 1XMQQ 1EYZA 4S3SA 2GA4B 3Q8RB 5HURA 4HJAA 3FRPB 2FLLA 2DNEA 1B8AA 1QE6A 1FJGL 1N33Q 2D2CC 1CQFA 3A0JA 3TDQA 4DV4Q 2DWCA 4OWXB 1EWIA 1RYRA 3M4OB 1UE1A 1BXRA 4JYAQ 3LWEA 1JXLA 1CS0A 4KKSA 1F2MA 4ULLA 4KHPH 2SEBD 1KIXA 1NTGA 4DR5L 3H40A 4IFDJ 1A3TA 1JICA 2CHBD 5M3FH 4LF6Q 5GAHC 1ENFA 1SE4A 2PNRC 3W3AA 2IL8A 4KLKA 1PH2A 2UXDL 2GLTA 4DV2H 3CU7A 2CH4A 4GN5A 4P73A 4QUCA 4J1MA 4NP5A 1WCMH 1SYFA 3J7AV 1JT8A 5CR3A 2JA6G 5FD6A 1EY4A 4ED2A 1EY9A 4MV9A 4EFEA 4LK1C 3EYYA 5IYCG 2NU7B 3HKZG 2NVXH 1CHPD 3EPGA 4GKKQ 4K0KH 3NTKA 3VR2A 1AP0A 3GDEA 2F0OA 1W6JA 1UC8A 4M9UA 1V1QA 5FK9C 3HOZH 1KHIA 2NZOA 3GTLH 4OELB 4CGYB 5KFFA 3RAQA 5COYA 2OTJA 2K5DA 2EYMA 4DR1L 3RN5A 3K3PA 3H0GB 1WI5A 1Z7TA 2B63B 1YITA 5LMNH 1OO9B 3TREA 4B9WA 1V1PA 4YAKB 4YR3A 3FP9A 3WO1A 1G2TA 4DV6H 2HVSA 1ZEQX 4C3IB 3BZKA 3OUZA 4YR0A 3UFXB 1PTOF 3K5LA 2JEFA 1M4VA 1VQAA 1N34Q 3S1NH 2C22A 2R93G 3Q24A 1SROA 1LTRD 2P5ZX 2PMZB 4U68A 1XNRQ 1BGWA 4EQNA 2VS1A 3U58A 5CV4A 3Q6SA 2A8VA 4I4TF 3JAMW 1M8AA 4JG2A 2F0PA 3PW2A 2RSOA 3FDTA 3BYTB 5IGGA 4FBTA 3JAMc 1BCPF 4OX9L 3I73A 2QF7A 4F7XA 4DL6A 1WD1A 3GTPB 4XYLB 1NUCA 4DUYQ 4CC5A 4C3HH 5EBCA 5L9XA 4ZAIA 4BXXG 1NSNS 1X3EA 2FPGB 2V9WA 4RCNA 1C3OA 1PH8A 2EIFA 3TN2A 1K28A 2OQ0A 1RCVD 4CKBA 3KTMA 2YZNA 2GVBA 3PSIA 1TVXA 3NELA 4NXMQ 1TWHH 2NZ1D 2E5LQ 5I2XA 3TIIA 3F2DA 4B3RL 2WB1E 3E9HA 1SJHD 1VQBA 4UCOA 4L5SA 4P75A 2ICIA 4OWTB 2A6EC 1BBWA 3S1MH 3MXUA 1K1SA 4ME3A 3BABA 2JA6A 1ASYA 1K8OA 4Y8VB 3DF7A 1EZ6A 3HKZA 1X3FA 2F0TA 1E0BA 2L55A 5C44H 2UXCL 4ECXA 1E4GT 4DAYB 1XMOL 1M1KC 5IOCA 1EY0A 2Q2TA 1SYEA 4GNXA 2MCTA 3VPDA 2FMAA 2N88A 1X54A 3DXJC 4LUOA 3Q0AA 2L9HA 3V96A 4XTCS 1YIJA 2K5WA 3DMUA 2OXPA 1IW7D 1YHAA 3SDZA 4IUUA 4MTEA 3HBLA 2R92B 3SK6A 1EWHA 1QUQB 4DK0A 3FEWX 3P75A 2R6FA 2K03A 2VQEL 3BQ0A 2JA8H 2KHJA 4F4WA 3RJ0A 2IJ0A 1VKZA 4EQ5A 2R87A 1CZWA 3K5OA 4DXFA 1K83B 1KAWA 4QL5A 1EQQA 1KLUD 2A68C 4N9TA 2FXQA 1FYCA 5HGQA 5IYBG 4X64Q 4LFCQ 2FE3A 1Y1WB 2DPIA 4JI6L 1RK5A 3DM1A 4XIGS 3MFIA 5I4DA 1EYDA 2K50A 3TP7A 3ULLA 4RB2C 1EYAA 4RH6A 4CKCA 4OONA 3QFFA 1C9OA 1VQPA 1STAA 3FKIB 1XNQH 2B2YA 4K5VA 3HOVG 1YBYA 2KECA 3G48A 4A4IA 3HOYH 2F0HA 4EBEA 1H9SA 2NWGA 3OYYA 4JI8H 5GADC 1KJQA 4ECUA 1YVCA 2Z8LA 1STNA 1CQIB 1VCIA 3A54A 1KBLA 3M4QA 4OEMB 5ELCA 1K8GA 1ZHQA 3QZ8A 4LF5H 3MFGA 1RKNA 4C5BA 5ELFA 2PZUA 3OMGA 5DLQE 1SE8A 1KC8C 5HV6A 2Q2HA 1HZAA 4HNTA 3MFHA 2JP1A 2C5CA 1LTID 1I7NA 5IGCA 2WP8J 4DUZQ 2V4RA 1N36H 4JV2A 2IP4A 1I6HB 2UUAH 4R7RA 3HS0C 1SYGA 1J5EQ 4TV9F 4UP7A 4C1NI 1H95A 3QOLA 2EYLA 3A8KE 2PQAA 5LXTF 4O3OA 4YQWA 3U9SA 3CHBD 5C3WA 2M9VA 2BE5D 4X3TA 4NXNQ 3TQTA 2UUCH 5JPMC 5HY6A 2JEAI 1F2YA 2CH4W 2B2UA 2CVRA 1KDCA 1AH9A 3GTMA 1HZCA 3NWTA 4FF2A 2R7ZA 4L63B 1NY4A 1B9MA 2K01A 4IUVA 3UI2A 2BDOA 1Q12A 1GUTA 5KT3A 4ED7A 2QCPX 1WR2A 3I4LA 3MR6A 5FLXL 2EOTA 2F0DA 4GN4B 3TP6A 3WNZA 1A8VA 1SR3A 2ZM6Q 3HOUB 1BO0A 3UE1A 4A3MH 1I3QH 1R9TB 5L1JA 4POGA 4DV2Q 3LX0A 4J9LA 2JXMB 3L2PA 1PYSB 3Q8QB 5KNDA 3R5XA 4R8UB 5E4WC 3MZ5A 5J39A 1HPCA 3OW7A 4ECVA 1PZJD 3CMEA 3LWUA 2EZVA 1DZ1A 2A73B 4A3JB 3KHGA 1B2TA 1I4HA 2JA9A 1AFPA 1PTOC 5C0XH 2NN6I 3RR5A 3OWFA 1HNZL 2G9HD 4K0KQ 2G5DA 4ZUJA 2O03A 1WVLA 2R82A 5FJ8H 1IBKL 3PO3G 3DWQA 3ND8A 5C4JH 2PO4A 3M4IA 4MTDA 3NHHA 1J6QA 4X65H 1C8CA 1VBHA 3D3RA 2QYZA 3K0YA 1Z2PX 3F2CA 5FPOA 1CUKA 2CWAA 5JEAG 1CZGA 5LMNQ 5IYZF 3KF6B 4C3JG 3VYSA 5DAUA 2EPBA 2PMZE 3M4YA 2VB3X 4RB0A 3S14H 5IWAH 3NK9A 4R4TA 4WRDA 4DV6Q 4Y52H 1WTVA 2KCTA 4DFAA 4HNVA 4BY7H 2HGSA 1RK6A 3PW4A 4MTNA 4J6HA 1BNZA 5KFTA 1WTPA 5K36G 2B2WA 5JJKA 2IA6A 3RLFA 2R6GA 2A6HD 4FXKC 3PF4A 1W3SA 1MBYA 2WAQB 1RJRA 2XCLA 4MV6A 4A3KH 2PI2E 2NUCA 1SMYC 5C1PA 1WTOA 1HFGA 3ZYYX 2ZDHA 2JA5G 4RNOA 3GIDA 3J81j 4EFBA 2N3SA 5ELEA 5AFWA 5D1OB 4Q44A 3C2PA 5LMUL 2E75C 2WV6D 3PUYA 2JSOA 4IRKA 2C2DA 1JE5A 1B4OA 2M00A 5FLXE 2VZAA 3GQCA 3BVZA 1LM0A 3U4VA 1PFSA 2CQOA 1TA8A 4C1NK 5HBRB 3NENA 2EDGA 2PZWA 1JWUD 3MXPA 2EY5A 1HR0L 4MV1A 4QWEA 3D6CA 1PLFA 5DGBA 1CHQD 3PUWA 3F2BA 1L2FA 2NVYB 2F4VL 4K8JA 5EPLA 4A3BH 3K5IA 4TRDA 3I70A 5J3BA 3FMAA 1VQLA 5C3EH 1EUDB 2CW0C 2OF1A 2YRXA 3CQZA 5IYCH 3UQ8A 2OT2A 1J9OA 2BQUA 3I4OA 2XD4A 1QILA 2Y0SB 2UU9Q 3G6XA 2AU0A 3I4NG 2ZXRA 3MA2B 4A3EB 2R8KA 1JB3A 5LL6X 2VOBA 4BBRB 1QVFA 2UXBL 4PZ8A 2WYOA 3T1YL 2IY5B 5ELDA 3IFDA 5GONF 5J2TF 2W8KA 1N32L 3VYUA 2YS7A 1A0IA 4JUZA 3RAXA 2C28A 1SYDA 4DV0L 5EQ0A 3GTJB 3A7AB 3HOZG 1Q46A 3STBD 2UUBL 4GOPC 5KG6A 1SBBB 1VMCA 2OEOA 4DNRB 5IY0A 1SFOH 4H0LC 2YL2A 1E24A 3KAJA 4DR3L 1RTOA 3A5UA 2R8HA 4HN7A 4OXPA 4DN4M 4X62L 3S1RB 1ICWA 2J0TD 1XYIA 3U9TA 4KKTA 2R93H 1ILPA 4DL3A 3HOXH 1Q8KA 5H1SE 1XX8A 5KG3A 2A69C 3CCSA 1U4LA 1I4RA 4K2KA 5NUCA 3K6OA 1ZYRD 5E7NA 3BVGA 1ASZA 2ENBA 4PG3A 2RCFA 4R8NA 1YI2A 1QJOA 1LT4D 1B3QA 3GLKA 4PMWA 1K83A 2TSSA 4ZKBB 1AN7A 2Z1CA 2YU9H 1XNQQ 2W6QA 1O7ZA 3J80L 1A3VA 1K8MA 2CQYA 4JI8Q 4U673 3N6RA 2HHHH 1Z2OX 4A3MB 1HNXH 4AQYL 4IRDA 4Q8FA 1F2LA 3DEPA 1FL0A 3MVVA 4IZ8A 4LF5Q 5DG8A 1Q8IA 1YZ6A 3K7AH 2VQDA 1QNUA 3OMCA 3K57A 2KCMA 5BR8L 4LF4Q 1MI2A 1N36Q 1IBLL 3RF2A 5KFKA 2L11A 2JE6I 2VA3A 4RFBA 3K5NA 1WCMA 5KT6A 3VPBA 1IZ6A 1ZHSA 3DEOA 2F3WA 4WORA 1EZ8A 4G7OC 5KGUA 4PV1C 2JEIA 3UDGA 1TWCH 2UUCQ 3KHHA 5AJ3L 5JUMA 2NVXA 5D3IB 5C44G 4RAYA 4KD3A 2R85A 4JC0A 5G3LD 4LF8L 3KLRA 4FBUA 3A55A 2YZGA 2ZJRA 3AEVA 1U5KA 3GTLA 1IL8A 4DA2A 2QEJC 3U50C 4JI3H 1F77A 2D5DA 5TSSA 2VUMH 5EPJA 4LH6A 1A3UA 3Q8PB 4E6IA 4LF9H 1LUZA 2AUJD 3KDFB 4X3KA 5KIXA 3NWSA 1I50H 1CA6A 4A3DB 1VDZA 5IYBH 4WJ4A 3AMUA 4YY3H 2F4IA 4CBVA 2R7MA 1GVPA 1BF4A 1G8ZD 4IFDG 3B6YA 4RNMA 3S16B 1ZQ7A 5I47A 4UPAA 3F8TA 1EY7A 4HJ5A 4EBCA 4IUNA 4JV5L 2W71A 2B39A 3D4DA 2AQ2B 2MHVA 3J80E 2DUDA 2EYFA 2B2TA 4R8UA 5I9OA 2ZTCA 3GV6A 2YYAA 5FD5A 4RMFA 1IKLA 3S2DH 5DEHA 4QF4A 4XYQA 1YJNA 2V59A 1HQRD 3J7ZC 2F0JA 4EX5A 3EIVA 4M8AA 2XWBB 1H9RA 2EJFC 2RCNA 4U6PA 4POFA 4A2BA 2JA6B 2WKDA 2NVTB 2YW2A 5IIFA 4FF3A 4DR2H 4B3SH 1ESFA 3HKZB 1LTTD 2WAQE 4HMIA 1TWHA 4KJOA 1GOZA 2F0EA 5FKAC 4GNXC 3P1HA 2H1EA 3KF6A 2EVBA 3LMLA 4EG0A 2AQ3B 4NLGA 2CFMA 2X69A 4BWGB 2LFNA 3J7AF 5KFQA 2SOBA 5I9PA 3D8GA 3RGXA 1EZ1A 1WTWA 3RBEA 4G7ZC 3A74A 1NAPA 1EQRA 4DXGA 4FM9A 4ED0A 2Q2IA 4DNTB 1ZKOA 3SVMA 1I6VC 1VQNA 4LNQA 4RHSA 1DJRD 1CT1D 2F0GA 1U0LA 4B3MQ 1WSCA 4FF1A 1FNUA 4DV1H 4QJFA 2PQEA 4ZCKA 2N55A 2Q2UA 3GTQH 3QZ7A 4DLKA 3PO2H 2JEJA 5FLXW 4JI2Q 4O3SA 3V05A 1B9NA 4XZ3B 5DGAA 1B7YB 5EBDA 1FD7D 2NN6H 4YHHH 3HEJA 5FLXc 2BH2A 4IURA 5D1OA 3G6YA 2ASJA 4UAIA 2JA7G 1E22A 1CTMA 3T1HL 4UCRA 4NDXA 4LFBL 3S15B 1CFMA 2Y0SE 2B2YC 3HZXA 3TZDA 2XIWA 4LFCH 2LS01 3CRKC 4X64H 2HIVA 1GHJA 1H9SB 3M9MB 4J9KA 4IR1A 4H44C 5KFLA 4CJ0B 3M7NA 1K73C 5IWAL 3MWMA 3BQ2A 3RV4A 2W7OA 4JOIA 5IT9L 5FO9B 2CW8A 2XC9A 2NVYA 5FO7B 5KFYA 1IW7C 5FJ8G 5EAYA 4DV7L 1X32A 4ECRA 3VR3A 1KDBA 2FFKB 5KFXA 5JEAH 1HNWH 1JOOA 2QA4A 2IMWP 3BG5A 1X6OA 4Q45A 5LL6b 1JX4A 2FP4B 5KG1A 2KOLA 4M1UB 1ENCA 1C48A 4RCOA 3VYRA 4QUFA 2XNAC 4EGVA 2HIXA 2NVQH 2PQAB 1SDFA 1M0WA 3I4MB 4TSSA 1IBMH 1QZHA 1GUNA 1XPOA 4C2MH 2F0MA 4ILWA 4KMUC 5K36H 2B2UC 4DUZH 3E5NA 4BY7G 3S2HB 2P0AA 3GTMB 3PW7A 1N56A 1FGBD 4HCSA 3ERQA 2R7ZB 1RJPA 2WDTA 1PRTD 2FJZA 1X56A 3NQIA 1K0RA 4JBKA 3IKJA 1H9MA 1QNKA 1K8AC 4LF7L 1PH4A 4O3NA 5CV7A 3NEMA 4A3KG 3RZOH 1MSGA 4FU0A 2D9UA 1VQDA 2FK1A 1VQEA 5KFHA 2NYZD 1YHQA 2HHHQ 5DG9A 1GUSA 4JI4H 1HNXQ 4EYHB 5KT2A 1E2WA 1NJIC 3GO5A 5C4XG 4A3IB 2NU6B 3I8ZA 5KFUA 2F0UA 5GAGC 3N42B 4N8X1 3R8BA 5JVG3 4ECWA 4KY5A 5EJWA 3RZDH 2OWOA 4Z9CB 1J8IA 1XWEA 3A56A 3QWNA 3MR3A 1HR0W 3GV7B 4O42A 2ZM6H 2RDJA 1NMGA 1KAAA 4B3TH 4KHZA 4LW1A 1FNWA 1I3QA 4DAPA 3HOVB 2BH8A 1S10A 1A2UA 3E6ZX 4DV5L 3D6WA 4A3BG 2B2VA 2BE5C 1L1OA 3KBGA 3S1QH 3C0FB 2IX3A 2H5XA 3I4NH 1KNEA 2DY7A 5C3EG 4A93B 1KJ9A 4RKLA 2I80A 2R86A 5KFBA 4X3UA 3MEFA 3RUZA 5IT9E 2DNCA 4XT1B 4QIWB 1G291 3F2UA 5EGTA 3TMEA 3OSNA 5C1OA 4KN7C 2W9BA 3N52A 1GGOA 1TWGH 1XTCD 4OX9Q 3GTKH 4LSXA 1Z2NX 4O2AF 3WOEA 3P20A 2LMCB 3G4SA 1G91A 3KJOA 1SJED 1H9JA 1I94L 4DR6L 4ME6A 4JI3Q 2HVQA 3U4ZA 5JVDF 2EJGC 5ELBA 3TRZA 2B2WC 3KOJA 3OW2A 4LF9Q 2EQSA 5D8DA 3FHWA 1XMQL 3PR5B 1SEIA 2RKSA 2C00A 1EQTA 2BQRA 1PMRA 3IAYA 3CC2A 3M3YB 4YY3Q 1WTQA 3G6EA 1FNVA 1N33L 2RGRA 3EVQA 3MTSA 4DV4L 2L15A 1IYVA 3RGZA 1EY8A 1WYDA 3HOXG 4JYAL 2KHSA 3KDFA 3R2TA 4B3RQ 4GKJH 1A9XA 2CKZB 1W93A 4J9OA 4LF6L 3J80W 5KFGA 3OOCA 3I56A 1B1ZA 3ULPA 4OIKA 2XCPA 1TY2A 3J80c 1JJCB 3U9OA 2YZMA 5M5XH 5EKLA 3HGBA 1ILQA 3HKZE 5L1KA 2ATWA 2NU9B 1AEXA 3NTIA 1E3PA 2E74C 3MXGA 4MNOA 1KJJA 2Q8TA 1DCZA 4GKKL 5L1IA 4HJ8A 3OSPA 5JVH3 3CQZB 4DR2Q 4G7HC 2F0FA 4B3SQ 3NPPA 3S17H 4V190 1MIUA 1U9RA 3AQQA 2D0OA 4HYKA 4HIDA 2UVRA 3PO3B 2DN8A 2EYJA 5IGFA 2A6HC 2JK8A 2DLNA 4IUQA 3KF8B 2E2JH 4JPBW 1Q82C 4YJ3F 1PTOH 1D5ZC 2K7VA 3BJUA 4X6AH 3Q2OA 1CKNB 1RJTA 1Y1VG 4I50F 2IPKD 1D1KA 3DM3A 3E5SA 2E2HH 4BBSG 1X55A 2UU9H 1L0YB 1S5ED 1I4QA 4C3JB 5IODA 1SRUA 1PH1A 1DOKA 3HOWG 1JCKB 1EIGA 3MHBA 1IOWA 1N34L 4P72A 3V6JA 4J9MA 2I5LX 1UE6A 1JWSD 1XNRL 1ZXTA 4DV1Q 2AWNA 3K3VA 1H9KA 2RHSB 1GLVA 1D5XC 3CXCA 1XDNA 3BZCA 1HQMC 5IGDA 1RJQA 4OO1I 1I4PA 4PDBA 2FPPB 2C35B 4X66H 4EBDA 4DL7A 3AYHB 2VUMG 4YHHQ 1UC9A 1EU4A 1ONLA 1YEZA 1NNXA 1U4MA 3BJYA 4LSAA 3OHAA 1GHKA 3FPUB 2LXKA 4ECYA 5C5MA 3OTOH 4DUYL 2YYZA 4DV3H 1XXGA 4IFDH 4MN3A 2ICEC 1QVGA 4B9XA 4IWYA 1EUJA 2KCCA 5KX5F 2R93A 2JA5B 3TIGA 4K6LA 4A76A 2CCZA 2PW7A 2V4QA 1TY0A 4NPSA 1VAJA 5HGTA 1DOMA 3C3LA 4RB1A 3PGZA 2W6PA 4HNUA 2RDFA 3GTGH 1IHZA 1PXUA 4NXML 1EY5A 2WINB 3K0XA 1VF7A 2E5LL 3SE7A 3ITPA 3HB9A 2Z4IA 1S4ZA 4YCWA 2YS6A 1OXUA 2DJGC 3STBC 5IGBA 4RA8A 4JV0A 1PZKD 1YNND 2DZDA 1FKAH 2AKWB 4DGZA 5M3FB 3CCRA 1HNWQ 4JI7H 2JJQA 1KL9A 4ECTA 5CC4A 4JI5H 2K75A 4RHRA 4JI0H 2BQ3A 1B70B 4K5XA 1WCMB 5JAVA 2HDLA 5J2UF 2NTTA 3N40P 1IBMQ 1QVCA 1N9WA 1SMXA 4RGOS 2O5JC 4HCEA 1KDAA 1TWAH 1ZYRC 5EWFA 4LF4H 1OXVA 3EBEA 2NVXB 4YJ2F 1STBA 3VR5A 4DL2A 3DLLA 1JB7A 3SE0A 1QZGA 3IFTA 2IT1A 2XIGA 3TQYA 4UCTA 3CPWA 3HOZB 5LHY1 3GTLB 1EWCA 4JBWA 4A3GH 5T1GA 2XGQA 2UVWA 5M5WH 1V4YA 2PZTA 2F0NA 4RKBA 4FXGC 4ME5A 4O2BF 4QCLA 3MWEA 2E8GA 3NBHA 2HQLA 3RLOA 2QW7A 3G71A 2LSSA 3KXYT 2I07B 1S3OA 4JI4Q 1JQYD 2BDNA 5C5JA 1IBKQ 2K04A 1F9RA 1BOSA 1NMFA 3H0GG 2HCIA 2D0PA 1BKBA 1NCVA 2BOSA 3PCOB 4LUZA 2B63G 2B29A 2SCUB 2I5HA 3PO2G 2R7FA 3S1NB 4LFAH 1I6UA 3NTHA 2AHOB 2W6MA 4RGMA 1DXMA 4JI1H 2JA7H 4B3TQ 1SAPA 4C3IG 2E2IH 2NN6G 3VA5A 4U7CA 3KHLA 1I50A 2XSCA 3MR2A 3GTOH 3K5HA 3J7YW 4YWMA 4J8QA 1GSHA 4QIWE 2B2TC 1E4EB 4MA0A 5KFZA 1RL2A 5L37A 2Z6KC 5FLMG 2YV5A 1EIHA 4C3HB 3F8NA 3I91A 3TINA 4DR7H 1DGSA 1CQVA 4H7BA 3FDSA 2SNMA 5E4XA 5IT9W 2GVAA 3WO0A 1DYQA 2J6SA 2BA1A 5D14A 5IT9c 2ZJPA 1S5DD 1Y14B 1GJXA 4WD3A 4TVAB 5M5YH 1HTLD 1J5EL 3GILA 2MP1A 1Q1BA 1TWHB 1JMCA 2MO0A 4Q0FA 2VQFH 4RAZA 1P16A 5LMUQ 2IX1A 5LYJF 3CCEA 2YTXA 4NXNL 4QIWA 3NSWA 1DV2A 4YAJB 4AYBG 3S1MB 5L1LA 3JSLA 1S9FA 1K3RA 5C44B 2F0WA 3GIQA 1L0XB 4IJLA 1SCUB 3E0JA 4YWKA 4DR4H 1VQ6A 3RLNA 4KHPL 4GKJQ 1K0SA 2FLPA 4MV3A 1OTCA 1EOVA 2AMCB 2RA4A 1VBGA 1LABA 1AE3A 4J0MA 4O4LF 2VXWA 2WIIB 3T51B 1LT6D 5C5LA 4DV2L 3CCQA 3BA9A 4O4IF 3RTXA 2JA8B 5C4XH 4B3MH 2ASDA 2UXBQ 3GTQA 3ETHA 4HQ6A 4UDUC 4RNNA 4JI2H 3K59A 2F0KA 1VQOA 1WH2A 4K0KL 1T36A 2K32A 5DQHA 3LNNA 5GQOA 3FPPA 2WKCA 1LYLA 1PYWD 1SNQA 1UE7A 4NKLA 1ET9A 3J81i 5JH7F 1S0OA 3RIZA 2VNUD 2FLNA 5DG7A 4JOIC 4X62Q 1Y1WG 1Y8PB 4UY8C 3PVXA 1KXLA 1HXYD 1OXXK 4KD4A 5LMNL 4HIOA 3HOYB 1MZBA 4K6DA 2EJMA 3BDOA 2N49A 4A3FH 4LWCA 4DV6L 3FKIG 1QCBD 2KBNA 4CKEA 3M9BA 3PIP3 1Q81C 2A74C 1TWFH 3C46A 1V43A 1LTSD 3KF8A 3K80C 3Q8DA 4GC6A 1FR3A 2AGQA 4M7EA 2C9OA 3G8CA 5ELOA 1CKNA 3TS2A 4RZQA 4IALA 3EROA 4ZLTF 1B6RA 2K52A 3W1BA 4AQYQ 3IG0A 4X66Q 1FJGH 2BR0A 4MTKA 5CB4F 2FK2A 3T53B 3OTOQ 5J1ZA 1BBXC 4FS1A 3EA6A 3KK7A 4DV3Q 1AZQA 1PHJA 4C2MA 4DR5H 4KY6A 2XTIA 2W57A 3GV8B 2K5NA 4ZYSA 2ALZA 4J9NA 4JV1A 4QMGA 2UXDH 4F87A 1MJCA 1IBLQ 1IOVA 5C4ZA 4TKOB 4C5CA 4YR2A 2EYHA 1KRTA 4EEYA 2JA5A 2DGYA 2J4XA 5CGKA 2KUMA 1ICFB 4ZI7F 4XDXA 3V6KA 3G7LA 1Z47A 1NE3A 4ZK9B 3OHXC 1I3QB 3CKIB 3BZDB 4JI7Q 2W6NA 1TS2A 3I12A 4UHVA 4JI5Q 3RMHA 2MNAA 1XPUA 4QY7A 4JI0Q 4YB8B 5C8YF 4DR1H 3HFZB 3KHRA 4ED3A 4IR9A 1GYFA 1L1OB 2XCAA 3K81C 4RGNA 4LMQD 5D65A 1UEAB 1E7ZA 2K6AA 3WDNA 1T3NA 1EEID 1I4GA 1F2ZA 1CKOA 3ORQA 3NUCA 5KFVA 3S24A 3E9IA 4DKAC 2W9BB 1PRTC 1PRTB 1GO3E 5IP7H 1AW7A 1HCZA 4R8IA 4IAJA 2KHIA 2Z6BA 4CHTB 2B3GA 3OHBA 4DNIA 4BA1I 1B53A 1Y1VH 5C4JB 4A3JG 2FJ2A 4PMBA 5CORA 4OO1H 3K8AA 4BBSH 3NP8A 2ZTDA 2XRSD 1M90C 1QWYA 4PWQA 5C4HA 3HOWH 2K4KA 1B6SA 4Y7NH 3T5HA 1CK1A 1TS5A 5DM73 1ZETA 1GUGA 2VB2X 1TQOA 1N48A 1EIFA 2WE6A 1JJGA 3S14B 3VPCA 4OX9H 3JSNA 3SGIA 4H13C 2R8GA 2DIKA 4R4CA 2FMCA 4BY7B 4HR7A 1VS0A 2RBMA 1UNSA 4BY1H 4V0BA 1TS3A 2SDFA 4LFAQ 5IP9H 1XNQL 4JI1Q 5GAEC 2F0SA 3T16A 4JK1C 4JI8L 4PZ7A 5J22A 1E2ZA 1KJ8A 1YNJD 1Y8NB 2AUKA 3R23A 1PTOD 3NQTA 4A3KB 1B04A 1S40A 3CCMA 2KQ3A 5EZYF 4YBZB 1LT3D 1O78A 4GC7A 1U4RA 1E1OA 3RN2A 4LF5L 4MV8A 5M3MH 3GV5B 4B3RH 1YNXA 2EYOA 2WAQG 4DR7Q 1IL2A 3PZPA 1II3A
chains in the Genus database with same CATH topology
5GAGC 5HGQA 2FXQA 5IYBG 4LFCQ 4X64Q 3S16H 4DR3Q 1D7QA 4GN3B 3RZDH 2OWOA 4JI6L 1I5FA 1YJWA 4AYBE 1N36L 2IHFA 2UUAL 4XIGS 1HR0W 1NMGA 2K50A 4KHZA 3ULLA 4LW1A 2ZJQA 4OONA 1C9OA 1VQPA 3M4OH 2BH8A 2VQFQ 3KFUA 4DV5L 3HOVG 1YBYA 3G48A 4A4IA 3HOYH 2UUCL 3OYYA 1EIYB 1BBUA 5GADC 1YVCA 4A3BG 1CKMA 4A3LH 1L1OA 2CWPA 3S1QH 2H5XA 3I4NH 1VCIA 5C3EG 4IOAA 2PI2A 3M4QA 5M3FG 3MEFA 1GKHA 1K8GA 4GKJL 1G291 1VQHA 2JA6H 2NVTH 5C4XG 1TWGH 1WCMG 5DLQE 1SE8A 4DR4Q 4LFBQ 3CAMA 1KC8C 2Q2HA 2VY3A 4OX9Q 3PUXA 3GTKH 1HZAA 1MJEA 3G4SA 3JC66 2ZTEA 3KJOA 1I94L 4DR6L 2Y0SG 4JI3Q 2WP8J 3U4ZA 4DUZQ 4DK6C 4A3GG 3TRZA 4BBRG 3KOJA 3OW2A 4IOCA 2EQSA 4LF9Q 1J5EQ 3FHWA 1XMQL 4UP7A 4GS3A 1H95A 5BR8Q 1D8LA 2PQAA 3H0GH 3CC2A 2B63H 4J15A 1IXRA 4GOPB 2BA0A 4NXNQ 4YY3Q 1CSPA 3G6EA 5HY6A 1PH5A 2JEAI 1X3GA 1N33L 4FDBA 4DV4L 2L15A 2MFIA 1KRSA 3I55A 1AH9A 1WYDA 3HOXG 1UE5A 1HZCA 3AFPA 4C3IH 2VW9A 4JYAL 1OXSC 3KDFA 2A19A 4UP9A 3CCUA 3WWVA 4B3RQ 1NY4A 2OCEA 5AJ3Q 2CKZB 3PV0A 1Q12A 4YCVA 4LF6L 4LF8Q 4GLXA 3I56A 4GN4B 4IPCA 1QUQA 3LGJA 1Q1EA 2XGTA 3UDXA 4X65L 3ULPA 2N8NA 1A8VA 5FLMH 2UU9L 1SR3A 1RIPA 3J80c 2ZM6Q 1JJCB 4P71A 3UE1A 5M5XH 4A3MH 1I3QH 3HOUG 1L1OC 3S15H 3HKZE 4POGA 2IX0A 2ATWA 1VQCA 2R7DA 3MXNB 2QEXA 4DV2Q 1WOCA 3L2PA 1PYSB 3M4PA 5GROA 1W2BA 1E3PA 3GTPH 2ES2A 1GM5A 4MNOA 3BU2A 1VQ4A 4GKKL 1VQFA 3AFQA 3KYHC 3CMEA 2JQOA 4HJ8A 4DR2Q 1MKHA 4DK3C 4X66L 4BXXH 2JA9A 4B3SQ 4MZ9A 3S17H 2NN6I 1MIUA 3AQQA 2D0OA 3RR5A 1HNZL 1FVIA 4HIDA 4K0KQ 3CCLA 2EXDA 3OTOL 1K9MC 3UDIA 1C0AA 5FJ8H 1IBKL 3PO3G 2JK8A 4JV5Q 4DV3L 3KF8B 4DPGA 2E2JH 1Q82C 5C4JH 1FJGQ 3BJUA 1J6QA 4X6AH 2IHEA 1CKNB 1Y1VG 3DM3A 2E2HH 4BBSG 3CPFA 3TEHB 3J7A5 1X55A 3F2CA 1CUKA 2CWAA 5JEAG 5LMNQ 4DR5Q 1SRUA 2UUAQ 3KF6B 1PH1A 3H3VH 3HOWG 4R4IA 2PMZE 1N34L 4P72A 3NBHB 2I5LX 1UE6A 3S14H 4R4TA 4DV6Q 1XNRL 3I4MH 2UXDQ 4DV1Q 2AWNA 4DV5Q 2KCTA 4Y52H 5IYDG 1P8LA 2RHSB 4H02A 4KI0A 3CXCA 4BY7H 3BZCA 4MTNA 4OO1I 5C0XI 3S2HH 4JI7L 3GTMH 2C35B 3CCVA 5K36G 5JJKA 3AYHB 5JEAJ 1S72A 2R7ZH 4JI5L 4YHHQ 2VUMG 1YEZA 3RLFA 2R6GA 4JI0L 3PF4A 1W3SA 2LXKA 3I7FA 4DUYL 1PH9A 2YYZA 4A3KH 2PI2E 2R92H 2RHQB 1QVGA 1EUJA 4R1JA 4A76A 2CCZA 4DAMA 2JA5G 2MO1A 4NPSA 3J81j 3CD6A 4A3CG 2N3SA 3ER0A 4DR1Q 4LF4L 5LMUL 4L5RC 3PUYA 1K83H 2JA8G 3PGZA 1PH7A 5IE8A 2D62A 4A3IH 3GTGH 3UE0A 1JE5A 3ERSX 2LXJA 2VZAA 1Y1WH 1C7YA 4NXML 4HIKA 2JA8H 1LM0A 3K0XA 2E5LL 3U4VA 1PFSA 2CQOA 5LMNW 4WJ3M 2K5VA 4YCWA 1OXUA 3NENA 3STBC 1NBWA 2YTYA 3PUZA 1HR0L 4OWWB 1VQ9A 2AKWB 3HOVH 3FKIH 3CCRA 1UWVA 2PNHA 1HNWQ 1X9NA 2JJQA 1KL9A 3PUWA 3F2BA 1L2FA 3K7UC 2K75A 1O7IA 4A3FG 2YTVA 2F4VL 4A3BH 4IFDI 1B70B 4IPDA 3W5OA 1N8RC 3HOYG 5J3BA 3W1GA 2Z6KA 1VQLA 5C3EH 3T1HQ 4LFAL 5IYCH 3L7ZC 1VQKA 4A93H 4X65Q 1WJJA 1PH3A 4A3LG 1IBMQ 1QVCA 1N9WA 1SMXA 3I4OA 4JI1L 1PVOA 4HJ7A 2UU9Q 3CMAA 3I4NG 1TWAH 4R4QA 1OXVA 3EBEA 3CP0A 2V1CC 4A3EG 3DLLA 1JB7A 1QVFA 1QZGA 2IT1A 1PYBA 4PZ8A 3TQYA 3T1YL 5IWAQ 1XPRA 2UXBL 2IY5B 3CPWA 4RG1A 1N32L 1A0IA 3CC7A 1SLJA 4JBWA 4A3GH 3HOZG 4DV0L 5M5WH 3RNUA 1Q46A 2HHHL 2NZHA 3STBD 1PA6A 4GOPC 1HNXL 4GNXB 2UUBL 1I6HH 1VQIA 4DR7L 5IY0A 4DV7Q 3PF5A 1SFOH 1VQ7A 3ICEA 1IYJB 1E24A 2KENA 2E8GA 2HQLA 1TXYA 3RLOA 4DR3L 3M3YH 3A5UA 3G71A 2LSSA 4OXPA 4X62L 1S3OA 4APVA 4JI4Q 1BVSA 4AH6A 1IBKQ 2I0QA 1NMFA 3H0GG 2R93H 2D0PA 1BKBA 3PCOB 4LUZA 3HOXH 1Q8KA 2B29A 2VL6A 5H1SE 1PH6A 2B63G 2WB1G 2I5HA 3CCSA 1AE2A 2R7FA 3PO2G 2AHOB 2VQFL 5E7NA 4TQUS 3KLWA 1ASZA 3PIOA 2JA7H 4B3TQ 2UXCQ 4PG3A 2E2IH 1XMOQ 2NN6G 1YI2A 3CW2C 3GTOH 4PMWA 1YJ9A 1T9HA 2YU9H 4YWMA 1XNQQ 4QIWE 1V9PA 3HOUH 4JI8Q 1RL2A 3ZJYC 2ALYB 2Z6KC 5FLMG 2YV5A 4YCUA 1JJ2A 5JJLA 1R9TH 4AQYL 4LF7Q 4DR4L 4A3MG 4QQBX 1DGSA 1FL0A 1LTLA 2VQEQ 2GVAA 1A62A 4LF5Q 1YZ6A 2BA1A 4JI3L 2Z0SA 3CQZH 4A3JH 3CC4A 3K7AH 5IT9c 4L5TA 2ZJPA 1Y14B 4TVAB 5M5YH 5IP7G 4LF9L 4HIMA 1J5EL 1FGUA 4GLAC 2HT1A 4P74A 2ID0A 1Q1BA 2KCMA 1WFQA 1JMCA 2MO0A 5BR8L 5C0XG 4JI6Q 4LF4Q 3PO3H 4B3ML 1P16A 4OO1G 5LMUQ 1N36Q 1IBLL 2IX1A 3CCEA 2JE6I 2RF4A 2YTXA 4IJHA 4NXNL 4YY3L 1HZBA 4B3TL 4JI2L 1A63A 4AYBG 1IZ6A 3M85A 3D31A 1SN8A 4C3JH 1K3RA 4O0AA 1TWCH 3UDGA 4R4OA 2UUCQ 5AJ3L 2GN5A 4GLVB 1XJVA 1L0WA 5C44G 4UP8A 5C0XJ 4JC0A 4IJLA 5ELNA 4LF8L 2QGQA 4YWKA 5IYDH 1UEBA 2K14A 1OXTA 4BY1G 3RLNA 1VQ6A 2I5MX 4KHPL 5IP9G 2ZJRA 3AEVA 1U5KA 4GKJQ 4IPGA 3UDFA 3I4MG 1OTCA 1E1TA 1EOVA 2AMCB 1VQ8A 3U50C 4JCVE 2F3IA 4QGUA 1AE3A 4GOPA 1VQ5A 2VUMH 1VQJA 4DV2L 3CCQA 1LUZA 3KDFB 4YWLA 1HH2P 1I94Q 1CSQA 1I50H 3H3VI 2R7ZG 4DR6Q 1G6PA 5C4XH 4IO9A 3EN2A 5IYBH 4DR2L 5M3MG 2UXBQ 4WJ4A 1GD7A 2JA5H 4B3SL 4A3DG 1GVPA 1XMQQ 4IFDG 3B6YA 1VQOA 4UPAA 4K0KL 3F8TA 4HJAA 2WFWA 4HJ5A 4JV5L 3I2ZA 2MQHA 5GQOA 1B8AA 1LYLA 1UE7A 3IRBA 3J81i 1FJGL 1N33Q 3A0JA 4DV4Q 4OWXB 1EWIA 4A3IG 2VNUD 4JOIC 1UE1A 2DUDA 4JYAQ 4X62Q 1Y1WG 4UY8C 1KXLA 1OXXK 5LMNL 1NTGA 4HIOA 2ZTCA 4DR5L 2N78A 1KIXA 4IFDJ 3J81c 4RMFA 5M3FH 4LF6Q 2N49A 5GAHC 3S2DH 3GD7A 4A3FH 4KLKA 1YJNA 4LWCA 3J7ZC 4DV6L 1PH2A 2NVYH 2UXDL 4DV1L 3FKIG 2KBNA 4EX5A 3EIVA 3M9BA 1Q81C 4GN5A 4P73A 1WCMH 1Z9FA 2RCNA 1TWFH 3PUVA 1HJPA 1V43A 4POFA 2F52A 1Q7YC 3PIPA 1JT8A 3K80C 3Q8DA 2JA6G 1HZ9A 4YHHL 3A5ZB 2WAQE 5ELOA 5IYCG 1CKNA 4A93G 3HKZG 4A3EH 3TS2A 2NVXH 4GKKQ 3CF5A 4BBRH 4GNXC 2K52A 3W1BA 3GDEA 4AQYQ 3KF6A 4X66Q 1X65A 4O2DA 1V1QA 2CFMA 1KHIA 2NZOA 3HOZH 4L5QA 4LFCL 3GTLH 4X64L 1HNZQ 3GTJH 2OTJA 3VDYA 3OTOQ 2K5HA 4DR1L 3RN5A 4DV3Q 1WI5A 3A74A 1PHJA 1EQRA 1YITA 3F1ZA 3TREA 2Q2IA 2XTIA 4LUVA 3FP9A 2K5NA 1VQNA 4LNQA 3S1RH 3ULJA 1U0LA 3BZKA 1MJCA 4B3MQ 1IBLQ 4QJFA 4PZ6A 3HKSA 3GTQH 2Q2UA 4JBMA 3H15A 3PO2H 1VQAA 4JI2Q 1N34Q 3S1NH 2R93G 1KRTA 1HNWL 1XNRQ 1SROA 1B7YB 3JAMi 2DGYA 3KJPA 2VS1A 5FLXc 3U58A 2BH2A 1Z47A 1NE3A 2A8VA 3J80i 4JG2A 2JA7G 2ASBA 1E22A 3E0EA 3T1HL 1KD1C 4JI7Q 4LFBL 1XTDA 2Y0SE 3JAMc 4OX9L 4JI5Q 1IBML 2MNAA 1XPUA 4KHPQ 4QY7A 4JI0Q 2HIVA 3TS0A 4BA2I 4DUYQ 2OQKA 3HFZB 4C3HH 3CCJA 4DUZL 1L1OB 3M7NA 1K73C 5IWAL 3K81C 1E7ZA 4BXXG 5JJIA 1CKOA 4JOIA 4AIMA 1X3EA 3S24A 3E9IA 4DKAC 1PH8A 2EIFA 1GO3E 5IP7H 2KHIA 2OQ0A 2B3GA 5FJ8G 4DNIA 5EAYA 4DV7L 4BA1I 4HJ9A 1Y1VH 4A3JG 2GVBA 3NELA 3K8AA 3PSIA 1Q86C 1TWHH 4NXMQ 4BBSH 2A1AA 2ZTDA 2E5LQ 2QA4A 1M90C 3HOWH 4JI4L 1X6OA 2K4KA 3F2DA 4Y7NH 2JEBI 2WB1E 4B3RL 3E9HA 1VQBA 4L5SA 1VQGA 4P75A 4OWTB 1HR0Q 1BBWA 3S1MH 4ME3A 1EIFA 2HIXA 1ASYA 1JJGA 2NVQH 2PQAB 2F4VQ 1G51A 3SGIA 1XPOA 1X3FA 1QZHA 4JBJA 4C2MH 4R4CA 5C44H 2ZM6L 4NB3A 1VQMA 4DAYB 1XMOL 1M1KC 2OTLA 1PV4A 2UXCL 1VS0A 2Q2TA 4GNXA 4ALPA 4BY1H 1EYGA 4BY7G 1X54A 4LUOA 4LFAQ 5IP9H 1XNQL 4XTCS 4JI1Q 5GAEC 1YIJA 4IPHA 4A75A 4JI8L 1X56A 4PZ7A 1K0RA 4JBKA 1YHAA 1YHBA 1K8AC 4LF7L 1EFWA 3L0OA 3T1YQ 1PH4A 3NEMA 1S40A 1QUQB 3CCMA 4A3KG 3RZOH 2R92G 4A3CH 1N32Q 2VQEL 3D0FA 1VQDA 2KHJA 4DV0Q 1VQEA 1KQSA 1E1OA 3RN2A 1YHQA 2HHHQ 4LF5L 5M3MH 2UUBQ 2AWOA 4EQ5A 1HNXQ 4A3DH 1YNXA 2WAQG 1KAWA 1IL2A 1NJIC 3GO5A 4DR7Q 4QL5A 1EQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG C;  5HGQ A;  2FXQ A;  5IYB G;  4LFC Q;  4X64 Q;  3S16 H;  4DR3 Q;  1D7Q A;  4GN3 B;  3RZD H;  2OWO A;  4JI6 L;  1I5F A;  1YJW A;  4AYB E;  1N36 L;  2IHF A;  2UUA L;  4XIG S;  1HR0 W;  1NMG A;  2K50 A;  4KHZ A;  3ULL A;  4LW1 A;  2ZJQ A;  4OON A;  1C9O A;  1VQP A;  3M4O H;  2BH8 A;  2VQF Q;  3KFU A;  4DV5 L;  3HOV G;  1YBY A;  3G48 A;  4A4I A;  3HOY H;  2UUC L;  3OYY A;  1EIY B;  1BBU A;  5GAD C;  1YVC A;  4A3B G;  1CKM A;  4A3L H;  1L1O A;  2CWP A;  3S1Q H;  2H5X A;  3I4N H;  1VCI A;  5C3E G;  4IOA A;  2PI2 A;  3M4Q A;  5M3F G;  3MEF A;  1GKH A;  1K8G A;  4GKJ L;  1G29 1;  1VQH A;  2JA6 H;  2NVT H;  5C4X G;  1TWG H;  1WCM G;  5DLQ E;  1SE8 A;  4DR4 Q;  4LFB Q;  3CAM A;  1KC8 C;  2Q2H A;  2VY3 A;  4OX9 Q;  3PUX A;  3GTK H;  1HZA A;  1MJE A;  3G4S A;  3JC6 6;  2ZTE A;  3KJO A;  1I94 L;  4DR6 L;  2Y0S G;  4JI3 Q;  2WP8 J;  3U4Z A;  4DUZ Q;  4DK6 C;  4A3G G;  3TRZ A;  4BBR G;  3KOJ A;  3OW2 A;  4IOC A;  2EQS A;  4LF9 Q;  1J5E Q;  3FHW A;  1XMQ L;  4UP7 A;  4GS3 A;  1H95 A;  5BR8 Q;  1D8L A;  2PQA A;  3H0G H;  3CC2 A;  2B63 H;  4J15 A;  1IXR A;  4GOP B;  2BA0 A;  4NXN Q;  4YY3 Q;  1CSP A;  3G6E A;  5HY6 A;  1PH5 A;  2JEA I;  1X3G A;  1N33 L;  4FDB A;  4DV4 L;  2L15 A;  2MFI A;  1KRS A;  3I55 A;  1AH9 A;  1WYD A;  3HOX G;  1UE5 A;  1HZC A;  3AFP A;  4C3I H;  2VW9 A;  4JYA L;  1OXS C;  3KDF A;  2A19 A;  4UP9 A;  3CCU A;  3WWV A;  4B3R Q;  1NY4 A;  2OCE A;  5AJ3 Q;  2CKZ B;  3PV0 A;  1Q12 A;  4YCV A;  4LF6 L;  4LF8 Q;  4GLX A;  3I56 A;  4GN4 B;  4IPC A;  1QUQ A;  3LGJ A;  1Q1E A;  2XGT A;  3UDX A;  4X65 L;  3ULP A;  2N8N A;  1A8V A;  5FLM H;  2UU9 L;  1SR3 A;  1RIP A;  3J80 c;  2ZM6 Q;  1JJC B;  4P71 A;  3UE1 A;  5M5X H;  4A3M H;  1I3Q H;  3HOU G;  1L1O C;  3S15 H;  3HKZ E;  4POG A;  2IX0 A;  2ATW A;  1VQC A;  2R7D A;  3MXN B;  2QEX A;  4DV2 Q;  1WOC A;  3L2P A;  1PYS B;  3M4P A;  5GRO A;  1W2B A;  1E3P A;  3GTP H;  2ES2 A;  1GM5 A;  4MNO A;  3BU2 A;  1VQ4 A;  4GKK L;  1VQF A;  3AFQ A;  3KYH C;  3CME A;  2JQO A;  4HJ8 A;  4DR2 Q;  1MKH A;  4DK3 C;  4X66 L;  4BXX H;  2JA9 A;  4B3S Q;  4MZ9 A;  3S17 H;  2NN6 I;  1MIU A;  3AQQ A;  2D0O A;  3RR5 A;  1HNZ L;  1FVI A;  4HID A;  4K0K Q;  3CCL A;  2EXD A;  3OTO L;  1K9M C;  3UDI A;  1C0A A;  5FJ8 H;  1IBK L;  3PO3 G;  2JK8 A;  4JV5 Q;  4DV3 L;  3KF8 B;  4DPG A;  2E2J H;  1Q82 C;  5C4J H;  1FJG Q;  3BJU A;  1J6Q A;  4X6A H;  2IHE A;  1CKN B;  1Y1V G;  3DM3 A;  2E2H H;  4BBS G;  3CPF A;  3TEH B;  3J7A 5;  1X55 A;  3F2C A;  1CUK A;  2CWA A;  5JEA G;  5LMN Q;  4DR5 Q;  1SRU A;  2UUA Q;  3KF6 B;  1PH1 A;  3H3V H;  3HOW G;  4R4I A;  2PMZ E;  1N34 L;  4P72 A;  3NBH B;  2I5L X;  1UE6 A;  3S14 H;  4R4T A;  4DV6 Q;  1XNR L;  3I4M H;  2UXD Q;  4DV1 Q;  2AWN A;  4DV5 Q;  2KCT A;  4Y52 H;  5IYD G;  1P8L A;  2RHS B;  4H02 A;  4KI0 A;  3CXC A;  4BY7 H;  3BZC A;  4MTN A;  4OO1 I;  5C0X I;  3S2H H;  4JI7 L;  3GTM H;  2C35 B;  3CCV A;  5K36 G;  5JJK A;  3AYH B;  5JEA J;  1S72 A;  2R7Z H;  4JI5 L;  4YHH Q;  2VUM G;  1YEZ A;  3RLF A;  2R6G A;  4JI0 L;  3PF4 A;  1W3S A;  2LXK A;  3I7F A;  4DUY L;  1PH9 A;  2YYZ A;  4A3K H;  2PI2 E;  2R92 H;  2RHQ B;  1QVG A;  1EUJ A;  4R1J A;  4A76 A;  2CCZ A;  4DAM A;  2JA5 G;  2MO1 A;  4NPS A;  3J81 j;  3CD6 A;  4A3C G;  2N3S A;  3ER0 A;  4DR1 Q;  4LF4 L;  5LMU L;  4L5R C;  3PUY A;  1K83 H;  2JA8 G;  3PGZ A;  1PH7 A;  5IE8 A;  2D62 A;  4A3I H;  3GTG H;  3UE0 A;  1JE5 A;  3ERS X;  2LXJ A;  2VZA A;  1Y1W H;  1C7Y A;  4NXM L;  4HIK A;  2JA8 H;  1LM0 A;  3K0X A;  2E5L L;  3U4V A;  1PFS A;  2CQO A;  5LMN W;  4WJ3 M;  2K5V A;  4YCW A;  1OXU A;  3NEN A;  3STB C;  1NBW A;  2YTY A;  3PUZ A;  1HR0 L;  4OWW B;  1VQ9 A;  2AKW B;  3HOV H;  3FKI H;  3CCR A;  1UWV A;  2PNH A;  1HNW Q;  1X9N A;  2JJQ A;  1KL9 A;  3PUW A;  3F2B A;  1L2F A;  3K7U C;  2K75 A;  1O7I A;  4A3F G;  2YTV A;  2F4V L;  4A3B H;  4IFD I;  1B70 B;  4IPD A;  3W5O A;  1N8R C;  3HOY G;  5J3B A;  3W1G A;  2Z6K A;  1VQL A;  5C3E H;  3T1H Q;  4LFA L;  5IYC H;  3L7Z C;  1VQK A;  4A93 H;  4X65 Q;  1WJJ A;  1PH3 A;  4A3L G;  1IBM Q;  1QVC A;  1N9W A;  1SMX A;  3I4O A;  4JI1 L;  1PVO A;  4HJ7 A;  2UU9 Q;  3CMA A;  3I4N G;  1TWA H;  4R4Q A;  1OXV A;  3EBE A;  3CP0 A;  2V1C C;  4A3E G;  3DLL A;  1JB7 A;  1QVF A;  1QZG A;  2IT1 A;  1PYB A;  4PZ8 A;  3TQY A;  3T1Y L;  5IWA Q;  1XPR A;  2UXB L;  2IY5 B;  3CPW A;  4RG1 A;  1N32 L;  1A0I A;  3CC7 A;  1SLJ A;  4JBW A;  4A3G H;  3HOZ G;  4DV0 L;  5M5W H;  3RNU A;  1Q46 A;  2HHH L;  2NZH A;  3STB D;  1PA6 A;  4GOP C;  1HNX L;  4GNX B;  2UUB L;  1I6H H;  1VQI A;  4DR7 L;  5IY0 A;  4DV7 Q;  3PF5 A;  1SFO H;  1VQ7 A;  3ICE A;  1IYJ B;  1E24 A;  2KEN A;  2E8G A;  2HQL A;  1TXY A;  3RLO A;  4DR3 L;  3M3Y H;  3A5U A;  3G71 A;  2LSS A;  4OXP A;  4X62 L;  1S3O A;  4APV A;  4JI4 Q;  1BVS A;  4AH6 A;  1IBK Q;  2I0Q A;  1NMF A;  3H0G G;  2R93 H;  2D0P A;  1BKB A;  3PCO B;  4LUZ A;  3HOX H;  1Q8K A;  2B29 A;  2VL6 A;  5H1S E;  1PH6 A;  2B63 G;  2WB1 G;  2I5H A;  3CCS A;  1AE2 A;  2R7F A;  3PO2 G;  2AHO B;  2VQF L;  5E7N A;  4TQU S;  3KLW A;  1ASZ A;  3PIO A;  2JA7 H;  4B3T Q;  2UXC Q;  4PG3 A;  2E2I H;  1XMO Q;  2NN6 G;  1YI2 A;  3CW2 C;  3GTO H;  4PMW A;  1YJ9 A;  1T9H A;  2YU9 H;  4YWM A;  1XNQ Q;  4QIW E;  1V9P A;  3HOU H;  4JI8 Q;  1RL2 A;  3ZJY C;  2ALY B;  2Z6K C;  5FLM G;  2YV5 A;  4YCU A;  1JJ2 A;  5JJL A;  1R9T H;  4AQY L;  4LF7 Q;  4DR4 L;  4A3M G;  4QQB X;  1DGS A;  1FL0 A;  1LTL A;  2VQE Q;  2GVA A;  1A62 A;  4LF5 Q;  1YZ6 A;  2BA1 A;  4JI3 L;  2Z0S A;  3CQZ H;  4A3J H;  3CC4 A;  3K7A H;  5IT9 c;  4L5T A;  2ZJP A;  1Y14 B;  4TVA B;  5M5Y H;  5IP7 G;  4LF9 L;  4HIM A;  1J5E L;  1FGU A;  4GLA C;  2HT1 A;  4P74 A;  2ID0 A;  1Q1B A;  2KCM A;  1WFQ A;  1JMC A;  2MO0 A;  5BR8 L;  5C0X G;  4JI6 Q;  4LF4 Q;  3PO3 H;  4B3M L;  1P16 A;  4OO1 G;  5LMU Q;  1N36 Q;  1IBL L;  2IX1 A;  3CCE A;  2JE6 I;  2RF4 A;  2YTX A;  4IJH A;  4NXN L;  4YY3 L;  1HZB A;  4B3T L;  4JI2 L;  1A63 A;  4AYB G;  1IZ6 A;  3M85 A;  3D31 A;  1SN8 A;  4C3J H;  1K3R A;  4O0A A;  1TWC H;  3UDG A;  4R4O A;  2UUC Q;  5AJ3 L;  2GN5 A;  4GLV B;  1XJV A;  1L0W A;  5C44 G;  4UP8 A;  5C0X J;  4JC0 A;  4IJL A;  5ELN A;  4LF8 L;  2QGQ A;  4YWK A;  5IYD H;  1UEB A;  2K14 A;  1OXT A;  4BY1 G;  3RLN A;  1VQ6 A;  2I5M X;  4KHP L;  5IP9 G;  2ZJR A;  3AEV A;  1U5K A;  4GKJ Q;  4IPG A;  3UDF A;  3I4M G;  1OTC A;  1E1T A;  1EOV A;  2AMC B;  1VQ8 A;  3U50 C;  4JCV E;  2F3I A;  4QGU A;  1AE3 A;  4GOP A;  1VQ5 A;  2VUM H;  1VQJ A;  4DV2 L;  3CCQ A;  1LUZ A;  3KDF B;  4YWL A;  1HH2 P;  1I94 Q;  1CSQ A;  1I50 H;  3H3V I;  2R7Z G;  4DR6 Q;  1G6P A;  5C4X H;  4IO9 A;  3EN2 A;  5IYB H;  4DR2 L;  5M3M G;  2UXB Q;  4WJ4 A;  1GD7 A;  2JA5 H;  4B3S L;  4A3D G;  1GVP A;  1XMQ Q;  4IFD G;  3B6Y A;  1VQO A;  4UPA A;  4K0K L;  3F8T A;  4HJA A;  2WFW A;  4HJ5 A;  4JV5 L;  3I2Z A;  2MQH A;  5GQO A;  1B8A A;  1LYL A;  1UE7 A;  3IRB A;  3J81 i;  1FJG L;  1N33 Q;  3A0J A;  4DV4 Q;  4OWX B;  1EWI A;  4A3I G;  2VNU D;  4JOI C;  1UE1 A;  2DUD A;  4JYA Q;  4X62 Q;  1Y1W G;  4UY8 C;  1KXL A;  1OXX K;  5LMN L;  1NTG A;  4HIO A;  2ZTC A;  4DR5 L;  2N78 A;  1KIX A;  4IFD J;  3J81 c;  4RMF A;  5M3F H;  4LF6 Q;  2N49 A;  5GAH C;  3S2D H;  3GD7 A;  4A3F H;  4KLK A;  1YJN A;  4LWC A;  3J7Z C;  4DV6 L;  1PH2 A;  2NVY H;  2UXD L;  4DV1 L;  3FKI G;  2KBN A;  4EX5 A;  3EIV A;  3M9B A;  1Q81 C;  4GN5 A;  4P73 A;  1WCM H;  1Z9F A;  2RCN A;  1TWF H;  3PUV A;  1HJP A;  1V43 A;  4POF A;  2F52 A;  1Q7Y C;  3PIP A;  1JT8 A;  3K80 C;  3Q8D A;  2JA6 G;  1HZ9 A;  4YHH L;  3A5Z B;  2WAQ E;  5ELO A;  5IYC G;  1CKN A;  4A93 G;  3HKZ G;  4A3E H;  3TS2 A;  2NVX H;  4GKK Q;  3CF5 A;  4BBR H;  4GNX C;  2K52 A;  3W1B A;  3GDE A;  4AQY Q;  3KF6 A;  4X66 Q;  1X65 A;  4O2D A;  1V1Q A;  2CFM A;  1KHI A;  2NZO A;  3HOZ H;  4L5Q A;  4LFC L;  3GTL H;  4X64 L;  1HNZ Q;  3GTJ H;  2OTJ A;  3VDY A;  3OTO Q;  2K5H A;  4DR1 L;  3RN5 A;  4DV3 Q;  1WI5 A;  3A74 A;  1PHJ A;  1EQR A;  1YIT A;  3F1Z A;  3TRE A;  2Q2I A;  2XTI A;  4LUV A;  3FP9 A;  2K5N A;  1VQN A;  4LNQ A;  3S1R H;  3ULJ A;  1U0L A;  3BZK A;  1MJC A;  4B3M Q;  1IBL Q;  4QJF A;  4PZ6 A;  3HKS A;  3GTQ H;  2Q2U A;  4JBM A;  3H15 A;  3PO2 H;  1VQA A;  4JI2 Q;  1N34 Q;  3S1N H;  2R93 G;  1KRT A;  1HNW L;  1XNR Q;  1SRO A;  1B7Y B;  3JAM i;  2DGY A;  3KJP A;  2VS1 A;  5FLX c;  3U58 A;  2BH2 A;  1Z47 A;  1NE3 A;  2A8V A;  3J80 i;  4JG2 A;  2JA7 G;  2ASB A;  1E22 A;  3E0E A;  3T1H L;  1KD1 C;  4JI7 Q;  4LFB L;  1XTD A;  2Y0S E;  3JAM c;  4OX9 L;  4JI5 Q;  1IBM L;  2MNA A;  1XPU A;  4KHP Q;  4QY7 A;  4JI0 Q;  2HIV A;  3TS0 A;  4BA2 I;  4DUY Q;  2OQK A;  3HFZ B;  4C3H H;  3CCJ A;  4DUZ L;  1L1O B;  3M7N A;  1K73 C;  5IWA L;  3K81 C;  1E7Z A;  4BXX G;  5JJI A;  1CKO A;  4JOI A;  4AIM A;  1X3E A;  3S24 A;  3E9I A;  4DKA C;  1PH8 A;  2EIF A;  1GO3 E;  5IP7 H;  2KHI A;  2OQ0 A;  2B3G A;  5FJ8 G;  4DNI A;  5EAY A;  4DV7 L;  4BA1 I;  4HJ9 A;  1Y1V H;  4A3J G;  2GVB A;  3NEL A;  3K8A A;  3PSI A;  1Q86 C;  1TWH H;  4NXM Q;  4BBS H;  2A1A A;  2ZTD A;  2E5L Q;  2QA4 A;  1M90 C;  3HOW H;  4JI4 L;  1X6O A;  2K4K A;  3F2D A;  4Y7N H;  2JEB I;  2WB1 E;  4B3R L;  3E9H A;  1VQB A;  4L5S A;  1VQG A;  4P75 A;  4OWT B;  1HR0 Q;  1BBW A;  3S1M H;  4ME3 A;  1EIF A;  2HIX A;  1ASY A;  1JJG A;  2NVQ H;  2PQA B;  2F4V Q;  1G51 A;  3SGI A;  1XPO A;  1X3F A;  1QZH A;  4JBJ A;  4C2M H;  4R4C A;  5C44 H;  2ZM6 L;  4NB3 A;  1VQM A;  4DAY B;  1XMO L;  1M1K C;  2OTL A;  1PV4 A;  2UXC L;  1VS0 A;  2Q2T A;  4GNX A;  4ALP A;  4BY1 H;  1EYG A;  4BY7 G;  1X54 A;  4LUO A;  4LFA Q;  5IP9 H;  1XNQ L;  4XTC S;  4JI1 Q;  5GAE C;  1YIJ A;  4IPH A;  4A75 A;  4JI8 L;  1X56 A;  4PZ7 A;  1K0R A;  4JBK A;  1YHA A;  1YHB A;  1K8A C;  4LF7 L;  1EFW A;  3L0O A;  3T1Y Q;  1PH4 A;  3NEM A;  1S40 A;  1QUQ B;  3CCM A;  4A3K G;  3RZO H;  2R92 G;  4A3C H;  1N32 Q;  2VQE L;  3D0F A;  1VQD A;  2KHJ A;  4DV0 Q;  1VQE A;  1KQS A;  1E1O A;  3RN2 A;  1YHQ A;  2HHH Q;  4LF5 L;  5M3M H;  2UUB Q;  2AWO A;  4EQ5 A;  1HNX Q;  4A3D H;  1YNX A;  2WAQ G;  1KAW A;  1IL2 A;  1NJI C;  3GO5 A;  4DR7 Q;  4QL5 A;  1EQQ A; 
#chains in the Genus database with same CATH topology
 3SR1 A;  1SNO A;  3L9A X;  4P2C B;  1AUX A;  1BCP D;  4GN3 B;  4OIJ A;  4CDD C;  1E4E A;  2ATL A;  3A8J E;  1YJW A;  1N36 L;  2IHF A;  2UUA L;  2X6L A;  4ZRZ A;  1PK8 A;  2UXC H;  3WOF A;  1XMO H;  2ZJQ A;  4IUT A;  3P7J A;  3M4O H;  2ZJT A;  2VQF Q;  4FF4 A;  3J81 L;  4CJ2 C;  1ROD A;  2UUC L;  1LTB D;  3G6J B;  4A3B B;  3MEH A;  1BBU A;  1G2S A;  4XYO A;  2EY2 A;  1CKM A;  3AU7 A;  4NMZ A;  5C3E B;  4C5A A;  3OWE B;  4IOA A;  1SND A;  5LP6 F;  4EGJ A;  1GKH A;  2Q8R E;  2VQE H;  5JOB A;  2DY8 A;  4ECQ A;  1HA5 A;  2JN4 A;  2MGS A;  5K2M A;  1WD0 A;  5CAE B;  4DR4 Q;  4LFB Q;  2FK3 A;  4ZKC B;  1JOK A;  4LAA A;  1MJE A;  5H80 A;  2FMM A;  2MPM A;  3JC6 6;  2ZTE A;  2RSN A;  1JIH A;  2Y0S G;  3KAL A;  4JI6 H;  4A3G G;  4DK6 C;  2E2H A;  1GSO A;  4BBR G;  4ZQ3 A;  4KTA A;  1SFO B;  5DLG A;  1MSH A;  5KFW A;  2KA7 A;  4MV4 A;  1F9P A;  3H0G H;  2FIN B;  2B63 H;  2MJ8 A;  3QOJ A;  2QK4 A;  1PFB A;  1PH5 A;  2R93 B;  3HXL A;  1E4F T;  3D4R A;  5KFA A;  3HOX B;  4FDB A;  2MFI A;  5KYI A;  3JRX A;  1BJT A;  3AFP A;  2L4N A;  2PYK A;  4C3I H;  2VW9 A;  4UFZ A;  5EWG A;  4UP9 A;  1W6K A;  1SYB A;  3WWV A;  3QR8 A;  2OCE A;  4F4X A;  3PV0 A;  4APM A;  4KJN A;  2IW3 A;  2F3V A;  4X65 L;  4IPC A;  3LGJ A;  2YU9 B;  2LY7 A;  3UDX A;  2C2R A;  5JPN C;  5FLM H;  3C1F A;  4CDC C;  5I6Y A;  1RIP A;  1SEB D;  4HTH A;  2W7P A;  4RZR A;  2O4X A;  4P71 A;  5KT7 A;  1S0N A;  3RB4 A;  4DK1 A;  3L4K A;  2Z4H A;  4DL5 A;  2R7D A;  3MXN B;  2I46 A;  2QEX A;  3JRW A;  4G4K A;  5GRO A;  1W2B A;  2SNS A;  3GTP H;  1JLL B;  1GM5 A;  1VQF A;  2JQO A;  1KC7 A;  1MKH A;  4DK3 C;  3K7A B;  2H4O A;  5CV6 A;  4MZ9 A;  4EQO A;  5KEE A;  1LTG D;  1SYX B;  3J81 E;  3BS1 A;  3UDI A;  1C0A A;  2VPQ A;  1SNC A;  3RFC A;  1HUM A;  4PNY A;  2XGP A;  5F2D A;  4MA5 A;  4DPG A;  5EKK A;  3H3V C;  1O7L A;  1FJG Q;  1DV1 A;  2X0S A;  3PW5 A;  1ET6 A;  2IHE A;  3CPF A;  2IBK A;  2R7L A;  4DR5 Q;  1TWC B;  3H94 A;  1TWA A;  2HUG A;  3M9N B;  4R4I A;  2BCO A;  5LL6 S;  1HRJ A;  3NBH B;  4EQP A;  1L2Z A;  2NTS A;  1JDE A;  2UXD Q;  2GPW A;  4QW9 A;  1D6E C;  4DV5 Q;  1P8L A;  4H02 A;  4KI0 A;  2RVL A;  3LP8 A;  5C0X I;  1F9S A;  3Q23 A;  2VUM B;  5CV9 A;  2UVU A;  1S72 A;  2F0L A;  1HNZ H;  1KEE A;  3I7F A;  1CI3 M;  1I50 B;  4RWS C;  1PH9 A;  3PQI A;  1IBK H;  5BN3 A;  2R92 H;  2RHQ B;  1SNM A;  2KED A;  4R1J A;  5BN4 A;  1UUP A;  3R5F A;  1JWM D;  1C4Q A;  4A3C G;  4DR1 Q;  5KG0 A;  4G57 A;  1S5C D;  3SK5 A;  4L5R C;  3QB3 A;  1K83 H;  4ID6 A;  1F9Q A;  2JA7 A;  4ZQI A;  2E2I A;  3UE0 A;  1HTP A;  2LXJ A;  1Y1W H;  1C7Y A;  3GTO A;  4HIK A;  5LA6 F;  3QJY A;  2JEG A;  3Q1K A;  4K5W A;  2AGO A;  5LMN W;  4WJ3 M;  2K5V A;  4MV7 A;  4ED6 A;  2A5H A;  5A2Q L;  3PUZ A;  1EOT A;  2YTY A;  3I72 A;  4OWW B;  1VQ9 A;  4K8I A;  4IN3 A;  3S2D B;  3FKI H;  2R61 A;  3MWY W;  4Q43 A;  1K1Q A;  1KJI A;  1O7I A;  4A3F G;  4ECZ A;  1EL0 A;  4IPD A;  3W5O A;  1GUO A;  1N8R C;  2HQE A;  2CW7 A;  1WJJ A;  4A3L G;  1PVO A;  3GV3 A;  2ZXP A;  4CJ1 B;  3E3X A;  4R4Q A;  4ABN A;  2UVV A;  2J7Z A;  4IUP A;  5KFR A;  2V1C C;  1HHV A;  3A8I E;  2VPS A;  1RTN A;  5LMU H;  1CQJ B;  1XPR A;  1PX2 A;  5KFO A;  2XRQ D;  5M9O A;  3CC7 A;  1SLJ A;  3PW0 A;  3RNU A;  2HHH L;  2NZH A;  4F4Z A;  4A2A A;  1I6H H;  1HNX L;  5KT5 A;  5G3L F;  1DIK A;  1VQI A;  1B50 A;  3T5K A;  2FPI B;  1MGS A;  1HR0 H;  2NUA B;  1IYJ B;  3C1E A;  1TII D;  4IZO A;  1R4P B;  4F50 A;  1TXY A;  1NR2 A;  5EOY A;  2F4V H;  2I0Q A;  1Q3L A;  1JDB B;  1UNN C;  4TV8 F;  3GTQ B;  2M2L A;  3PO2 B;  2WB1 G;  1AE2 A;  1HA6 A;  2KCN A;  4KN4 C;  1BQQ T;  1KAB A;  1WTR A;  3KLW A;  3V6H A;  2AGP A;  3SK8 A;  2TMP A;  3NE5 B;  3PIO A;  2UXC Q;  4HMJ A;  2V5A A;  1GUW A;  1XMO Q;  1STE A;  3CW2 C;  1YJ9 A;  3T4A C;  2UXB H;  1R4Q B;  3T1Y H;  3OUU A;  1N32 H;  1JC7 A;  3HOU H;  4DV0 H;  2ALY B;  4YCU A;  1CA5 A;  4DL4 A;  1R9T H;  5CA0 F;  2UUB H;  1DOL A;  1TU2 B;  1LTL A;  1T5X D;  3D4W A;  5LOV F;  4Q8E A;  2VQE Q;  5F9L A;  4O1N A;  1A62 A;  4DR3 H;  4JI3 L;  4X62 H;  2Z0S A;  4B08 A;  4A3J H;  1Q90 A;  5A2Q E;  5BN5 A;  2O2L D;  5IP7 G;  4LF9 L;  2YCH A;  1FGU A;  4GLA C;  3N41 B;  1WFQ A;  4OO1 G;  4JI6 Q;  3VYT A;  4CDF C;  2Z9H A;  4Q5V A;  1PDQ A;  2RDG A;  2RF4 A;  3MJF A;  2L1B A;  4IWX A;  4YY3 L;  4AYB B;  1B3A A;  3HG9 A;  4F8M A;  1TWF A;  2E76 C;  4QWA A;  2XN9 C;  1S03 G;  4HAE A;  3H91 A;  2NVQ B;  4O0A A;  4Q0Y A;  1NR4 A;  5FPR A;  4C2M B;  2DJF C;  3X3N A;  4ED8 A;  2GN5 A;  4OGQ C;  1XJV A;  1L0W A;  4OHJ A;  5C0X J;  5KG5 A;  4AQY H;  5BPH A;  5IYD H;  2QGQ A;  1UEB A;  1OXT A;  4BY1 G;  1SFO A;  3R5H A;  5IP9 G;  3UDF A;  3I4M G;  1RD9 D;  1JOR A;  1E1T A;  3HP3 A;  1VQ8 A;  3SHL A;  4JCV E;  2F3I A;  2R7K A;  4QGU A;  1VQ5 A;  2AQ1 B;  1V8Q A;  5CYU A;  5KYL A;  5KFE A;  4FXD A;  3MAQ A;  3RZO B;  4IRC A;  4HSP A;  4RAU C;  3GIP A;  3L3O C;  3SEB A;  3H3V I;  3HRZ C;  4XT3 B;  2R7Z G;  5BR8 H;  1G6P A;  1GSA A;  4IO9 A;  3BAA A;  1IBL H;  3PR4 A;  1MHW C;  2HCC A;  3KLS A;  4DR2 L;  5M3M G;  5KT4 A;  4N9P A;  4B3S L;  2WB1 A;  4O3Q A;  1EEF D;  1EFI D;  2YU9 A;  3RZD B;  2WFW A;  4I7A A;  4G3I A;  3I2Z A;  2MQH A;  4KY7 A;  4RU9 A;  1QOH A;  3R2I A;  3IRB A;  2EXZ A;  4EYI B;  2PVP A;  4A3I G;  3MR5 A;  4LF8 H;  3MXN A;  3J81 W;  2ASL A;  2VUG A;  2ZXO A;  5CA1 F;  4NW2 A;  5EWE A;  2N78 A;  3I90 A;  3BDL A;  3J81 c;  2E2D C;  3GIJ A;  1EHI A;  3GD7 A;  1LT5 D;  3S1Q B;  3VMM A;  2NVY H;  3I4N B;  4DV1 L;  2NU8 B;  4MHE A;  1IKM A;  2L0C A;  4C56 C;  1Z9F A;  2C2E A;  2HDM A;  1HJP A;  3PUV A;  1Q7Y C;  2F52 A;  3PIP A;  4YP3 A;  3OSO A;  3R93 A;  1TWG B;  5F9N A;  1HZ9 A;  4YHH L;  1Y1V A;  3A5Z B;  3EFX D;  5EKI A;  3GTK B;  1T5E A;  4A93 G;  1SYC A;  4A3E H;  1HFN A;  4HR7 B;  1PFN A;  2MUY A;  4BBR H;  3CF5 A;  3S9W A;  4JV5 H;  1TWC A;  1X65 A;  2CZG A;  4O2D A;  2B8F A;  4L6T B;  4L5Q A;  4LFC L;  4XQN A;  4BS9 A;  2K28 A;  4X64 L;  1HNZ Q;  3GTJ H;  2PPB C;  4EGQ A;  5C3X A;  3VDY A;  1EQV A;  5E1F A;  2K5H A;  2YRW A;  1D1I A;  2ZT9 C;  2Q8I B;  2R8J A;  1Y8O B;  3F1Z A;  4LUV A;  1C30 A;  3PIO 3;  3PMF A;  2VUM A;  1PRT F;  3MC0 B;  3S1R H;  3ULJ A;  3GQB A;  4XXE A;  4PZ6 A;  4K2L A;  4CDE C;  2NBF A;  3HKS A;  4O3R A;  4JBM A;  1E2V A;  3H15 A;  3T13 A;  1ML0 D;  1HUN A;  2V58 A;  1HNW L;  3JAM i;  2W9A A;  1EYC A;  3KJP A;  3TP8 A;  3OPO A;  1S68 A;  4RGT A;  4OL7 A;  3J80 i;  4J9P A;  4MAM A;  5M5X B;  5DM6 3;  3E0E A;  2ASB A;  2LKV A;  5KNC A;  1KD1 C;  5C6A A;  1XTD A;  2KSW A;  4ZUI A;  1BNC A;  4J9S A;  4J9R A;  2W8L A;  1QB5 D;  1IBM L;  2JYO A;  1DD2 A;  4KHP Q;  2F0Q A;  2R3Z A;  3TS0 A;  4BA2 I;  2XVS A;  3NBI A;  3RB0 A;  2OQK A;  3CCJ A;  4DUZ L;  4DAV A;  5KG7 A;  2W9C B;  4LJZ C;  4WJW A;  3K58 A;  2O5I C;  4UCS A;  2EYP A;  3S17 B;  5JJI A;  3QO2 A;  4AIM A;  3H20 A;  1STH A;  3T5J A;  1BUV T;  4HJ9 A;  2F0V A;  1YNJ C;  2E2J B;  4O3P A;  1PTO B;  2W70 A;  1Q86 C;  3NGD A;  3BQ1 A;  2A1A A;  3BYY B;  5KFD A;  3MFY A;  4JI4 L;  1KLG D;  3FMC A;  4HSV A;  2E2H B;  4O4H F;  2JEB I;  1KNA A;  2RDH A;  2AQ4 A;  1VQG A;  1HR0 Q;  1JKJ B;  2M05 A;  3V4S A;  3DUZ A;  3T1H H;  4LFB H;  3IN5 A;  2F4V Q;  1G51 A;  1EYG A;  4JBJ A;  1JE4 A;  1BCP C;  1BCP B;  2ZM6 L;  4NB3 A;  5DNF A;  1VQM A;  4B3T L;  2OTL A;  1PV4 A;  3CVZ A;  4ALP A;  3GP7 A;  4JVZ A;  1Y69 U;  1U4P A;  1SSO A;  3ND9 A;  1AZP A;  4IPH A;  4A75 A;  3PN1 A;  1S0M A;  3H0G A;  2F1M A;  1YHB A;  3Q22 A;  1EFW A;  2PCF B;  3L0O A;  3T1Y Q;  2B63 A;  4DV7 H;  4A3C H;  2R92 G;  1N32 Q;  3T5L A;  2EY6 A;  4JW0 A;  2OLS A;  3D0F A;  4EVO A;  4DV0 Q;  3JZI A;  1KQS A;  3R3O A;  1TKW B;  1BXT A;  4XQQ A;  2UUB Q;  2AWO A;  1JR0 D;  2A6E D;  4A3D H;  2ZDQ A;  4PQX A;  3GTG B;  4UCV A;  5KFP A;  1SE2 A;  1D5M C;  3S16 H;  4DR3 Q;  2CQA A;  1EU3 A;  1D7Q A;  2PMZ A;  1BR9 A;  1I5F A;  4AYB E;  5A2Q W;  4KHV A;  1SXT A;  1RDP D;  4ETS A;  4QWC A;  3VR6 A;  3BDC A;  3KFU A;  1JOQ A;  1M7J A;  5KFC A;  2L12 A;  3GTP A;  1EIY B;  4EEQ A;  4A3L H;  3BA8 A;  2CWP A;  2FB9 A;  4LF7 H;  3DWP A;  3RUP A;  2PI2 A;  5M3F G;  2PN1 A;  4GKJ L;  3QIA A;  1TWA B;  2HJW A;  1VQH A;  4KV6 A;  2JA6 H;  3V4Z A;  1SE3 A;  2NVT H;  2HVR A;  3TQ1 A;  2A68 D;  1WCM G;  4AYB A;  3CAM A;  2VY3 A;  1DON A;  3PUX A;  5D1P A;  5KRU A;  2K1B A;  1CE8 A;  4A3G B;  3L4J A;  5M5W B;  2QDB A;  5FOB B;  2XWJ B;  1S5B D;  3KAK A;  2J6U A;  1ENA A;  3NXW A;  4IOC A;  4FVM A;  4TQS A;  4GS3 A;  5BR8 Q;  3RB3 A;  1D8L A;  1I7L A;  4I7Z C;  4DV5 H;  1WTX A;  4J15 A;  1IXR A;  1VMP A;  4GOP B;  2K5Q A;  2BA0 A;  2QIL A;  4DAY A;  1CSP A;  1X3G A;  5K5P A;  3I55 A;  1KRS A;  5EDW A;  1BDO A;  1RHP A;  1UE5 A;  5KNB A;  1OXS C;  3CCU A;  2A19 A;  3H4D A;  2JA7 B;  4IHJ F;  5AJ3 Q;  1S97 A;  2E2I B;  2OH2 A;  4L1K A;  1LTA D;  4YCV A;  5ISR A;  3GTO B;  4LF8 Q;  4GLX A;  2PBZ A;  2R92 A;  1QUQ A;  1Q1E A;  2QDL A;  2XGT A;  1VF5 C;  2N8N A;  2UU9 L;  1G6Z A;  2GPS A;  3CRL C;  5EPK A;  1I94 H;  3V2T A;  4DR6 H;  2B2V C;  3KLS X;  4UCU A;  3JAM L;  3HOU G;  1L1O C;  1TS4 A;  3S15 H;  4WBN F;  4KK7 A;  2IX0 A;  1VQC A;  3OIP A;  4LMY A;  1WOC A;  3M4P A;  1XMQ H;  2ES2 A;  1Y1W A;  3BU2 A;  1VQ4 A;  1ULZ A;  3J7A K;  3AFQ A;  3KYH C;  4IQZ A;  2EY1 A;  4X66 L;  4BXX H;  1RF2 D;  5CV5 A;  4C3H G;  5M5Y B;  1N33 H;  5T1I A;  3GII A;  2RDI A;  4DV4 H;  1FVI A;  2X6G A;  3FKI A;  1CM9 A;  3BVM A;  2EXD A;  3OTO L;  1K9M C;  3CCL A;  1AUV A;  4JYA H;  5KFM A;  4JV5 Q;  4DV3 L;  4I65 A;  1QG7 A;  1A15 A;  3RB6 A;  4LF6 H;  2V4D A;  1TWG A;  4F88 A;  2I87 A;  5DQI A;  2NB0 A;  4FNF A;  3J7A 5;  3TEH B;  3GTK A;  5DLF A;  2UUA Q;  3BG3 A;  3EJI A;  3H3V H;  3RD4 A;  5KKN B;  4I55 F;  4CC6 A;  3RBD A;  3I4M H;  5JVL A;  2EE1 A;  5IYD G;  5E3F A;  1O75 A;  5KFS A;  4FYD A;  4GKK H;  4XX0 B;  1V1P B;  5D3D A;  3S2H H;  4JI7 L;  3GTM H;  4YIJ A;  2VR1 A;  3CCV A;  5JEA J;  4QWD A;  2R7Z H;  4JI5 L;  2R7N A;  4JI0 L;  4RUA A;  5I6W A;  2B8G A;  2WAC A;  1TR5 A;  4RB3 C;  5T14 A;  5C4X B;  3N44 B;  2F0I A;  3G6V A;  2W6O A;  2L5T A;  2VA2 A;  1UAP A;  4DAM A;  2RGV A;  1KTK A;  2MO1 A;  5KFI A;  3CD6 A;  4XYM B;  3ER0 A;  4LF4 L;  4ZOL F;  2JA8 G;  1PH7 A;  3TP5 A;  5IE8 A;  2D62 A;  4A3I H;  3FVQ A;  1LLR D;  1IYU A;  5DQG A;  3ERS X;  1N34 H;  1XNR H;  1O80 A;  1OWT A;  4FS2 A;  1B33 N;  3SI8 A;  3JAM E;  3W2D A;  1NBW A;  2DPJ A;  3HOV H;  1R9T A;  2KEE A;  1UWV A;  1SNP A;  2PNH A;  4FO2 A;  3H6M A;  3DWA A;  4ODG A;  4A3F B;  1X9N A;  2W9C A;  2ZDG A;  3K7U C;  3VR4 A;  2QKI C;  2YTV A;  3N8D A;  3M9O B;  4N8F A;  4IFD I;  1SMY D;  1V1O A;  3HOY G;  4GZY C;  3W1G A;  3MWD A;  2Z6K A;  1TWF B;  4FP5 D;  3T1H Q;  4DUY H;  3SK4 A;  4LFA L;  3L7Z C;  2G9D A;  1VQK A;  4X65 Q;  1PH3 A;  4A93 H;  4TUY F;  2R8I A;  3OIQ A;  4JI1 L;  4HJ7 A;  3CMA A;  3CP0 A;  4F4Y A;  4A3E G;  2IWH A;  1PYB A;  5KG4 A;  5IWA Q;  1LV9 A;  3TZU A;  4PMC A;  4RG1 A;  4HED A;  3EPI A;  4NXM H;  1AN8 A;  3H09 A;  2E5L H;  1PA6 A;  1M0T A;  4GNX B;  5KFN A;  5JJZ A;  3GIK A;  4DR7 L;  1RYS A;  2HD3 A;  4DV7 Q;  3PF5 A;  1VQ7 A;  1PFM A;  1D2B A;  3ICE A;  1LO5 D;  2KEN A;  4R9W A;  3EQL C;  1MD2 D;  3M3Y H;  4LH7 A;  4J9Q A;  3N6X A;  3M7G A;  2FHT A;  4APV A;  2F03 A;  1BVS A;  4AH6 A;  1M6V A;  5KFJ A;  1PZI D;  2CW0 D;  2K33 A;  2WB1 B;  5KG2 A;  2VL6 A;  1PH6 A;  4E4T A;  1Z6H A;  5CV8 A;  3I3C A;  2VQF L;  3LWB A;  4ECS A;  4TQU S;  1ESR A;  1W96 A;  1TAE A;  3DHQ A;  2J6T A;  2WAQ A;  4XQJ A;  1STY A;  1T9H A;  1STG A;  1V51 A;  3Q8S B;  3GTG A;  3ONA B;  1V9P A;  1A2T A;  3TSS A;  3K5M A;  5BMV F;  3ZJY C;  1GXD C;  5JJL A;  1JJ2 A;  4LF7 Q;  3ETJ A;  4DR4 L;  3VA7 A;  4A3M G;  4QQB X;  2K05 A;  5CBE E;  2WTF A;  3IL8 A;  1WTH A;  1EUC B;  1LAC A;  2PW5 A;  3CQZ H;  5A35 A;  3CC4 A;  3ORR A;  3AB9 A;  3KBX A;  4L5T A;  2A69 D;  4QB4 A;  3KUP A;  4WFN 3;  4HIM A;  1Y1V B;  2HT1 A;  5JQW A;  4L8J A;  4P74 A;  4DU9 A;  2ID0 A;  3PO3 H;  4BBS B;  5C0X G;  4B3M L;  5CBA E;  3HOW B;  4QW8 A;  4TQR A;  4ZHQ F;  4Y7N B;  4IJH A;  5I2Y A;  1HZB A;  2J9G A;  3QG1 A;  3RV3 A;  4JI2 L;  1A63 A;  1K3B C;  2KJX A;  4KKU A;  1O7Y A;  3M85 A;  3D31 A;  4ED1 A;  4K14 A;  1SN8 A;  4C3J H;  1T94 A;  2Y0S A;  4I7H A;  4R4O A;  5BPF A;  3TBI B;  4GLV B;  4UP8 A;  5FO8 B;  1I4X A;  3URY A;  3X3M A;  5ELN A;  1X3Q A;  4BY1 B;  1YNN C;  2FKL A;  2K14 A;  4X3S A;  2I5M X;  5CMD A;  2I8C A;  4IPG A;  3GTJ A;  1TT2 A;  4RUC A;  3O13 A;  4GOP A;  3GIM A;  4DF7 A;  1VQJ A;  4BWS C;  1S5F D;  4QWB A;  3T56 B;  1X3P A;  3SXH A;  1J5E H;  3N43 B;  1B44 D;  4MIU A;  1HH2 P;  4YWL A;  3H4B A;  1I94 Q;  1CSQ A;  4DR6 Q;  1EY6 A;  2KVM A;  2RQX A;  5M3M B;  3A7L A;  5IGE A;  2R84 A;  3EN2 A;  2W6Z A;  1DM0 B;  4NXN H;  1GD7 A;  2JA5 H;  4A3D G;  1A6X A;  1XMQ Q;  1EYZ A;  4S3S A;  2GA4 B;  3Q8R B;  5HUR A;  4HJA A;  3FRP B;  2FLL A;  2DNE A;  1B8A A;  1QE6 A;  1FJG L;  1N33 Q;  2D2C C;  1CQF A;  3A0J A;  3TDQ A;  4DV4 Q;  2DWC A;  4OWX B;  1EWI A;  1RYR A;  3M4O B;  1UE1 A;  1BXR A;  4JYA Q;  3LWE A;  1JXL A;  1CS0 A;  4KKS A;  1F2M A;  4ULL A;  4KHP H;  2SEB D;  1KIX A;  1NTG A;  4DR5 L;  3H40 A;  4IFD J;  1A3T A;  1JIC A;  2CHB D;  5M3F H;  4LF6 Q;  5GAH C;  1ENF A;  1SE4 A;  2PNR C;  3W3A A;  2IL8 A;  4KLK A;  1PH2 A;  2UXD L;  2GLT A;  4DV2 H;  3CU7 A;  2CH4 A;  4GN5 A;  4P73 A;  4QUC A;  4J1M A;  4NP5 A;  1WCM H;  1SYF A;  3J7A V;  1JT8 A;  5CR3 A;  2JA6 G;  5FD6 A;  1EY4 A;  4ED2 A;  1EY9 A;  4MV9 A;  4EFE A;  4LK1 C;  3EYY A;  5IYC G;  2NU7 B;  3HKZ G;  2NVX H;  1CHP D;  3EPG A;  4GKK Q;  4K0K H;  3NTK A;  3VR2 A;  1AP0 A;  3GDE A;  2F0O A;  1W6J A;  1UC8 A;  4M9U A;  1V1Q A;  5FK9 C;  3HOZ H;  1KHI A;  2NZO A;  3GTL H;  4OEL B;  4CGY B;  5KFF A;  3RAQ A;  5COY A;  2OTJ A;  2K5D A;  2EYM A;  4DR1 L;  3RN5 A;  3K3P A;  3H0G B;  1WI5 A;  1Z7T A;  2B63 B;  1YIT A;  5LMN H;  1OO9 B;  3TRE A;  4B9W A;  1V1P A;  4YAK B;  4YR3 A;  3FP9 A;  3WO1 A;  1G2T A;  4DV6 H;  2HVS A;  1ZEQ X;  4C3I B;  3BZK A;  3OUZ A;  4YR0 A;  3UFX B;  1PTO F;  3K5L A;  2JEF A;  1M4V A;  1VQA A;  1N34 Q;  3S1N H;  2C22 A;  2R93 G;  3Q24 A;  1SRO A;  1LTR D;  2P5Z X;  2PMZ B;  4U68 A;  1XNR Q;  1BGW A;  4EQN A;  2VS1 A;  3U58 A;  5CV4 A;  3Q6S A;  2A8V A;  4I4T F;  3JAM W;  1M8A A;  4JG2 A;  2F0P A;  3PW2 A;  2RSO A;  3FDT A;  3BYT B;  5IGG A;  4FBT A;  3JAM c;  1BCP F;  4OX9 L;  3I73 A;  2QF7 A;  4F7X A;  4DL6 A;  1WD1 A;  3GTP B;  4XYL B;  1NUC A;  4DUY Q;  4CC5 A;  4C3H H;  5EBC A;  5L9X A;  4ZAI A;  4BXX G;  1NSN S;  1X3E A;  2FPG B;  2V9W A;  4RCN A;  1C3O A;  1PH8 A;  2EIF A;  3TN2 A;  1K28 A;  2OQ0 A;  1RCV D;  4CKB A;  3KTM A;  2YZN A;  2GVB A;  3PSI A;  1TVX A;  3NEL A;  4NXM Q;  1TWH H;  2NZ1 D;  2E5L Q;  5I2X A;  3TII A;  3F2D A;  4B3R L;  2WB1 E;  3E9H A;  1SJH D;  1VQB A;  4UCO A;  4L5S A;  4P75 A;  2ICI A;  4OWT B;  2A6E C;  1BBW A;  3S1M H;  3MXU A;  1K1S A;  4ME3 A;  3BAB A;  2JA6 A;  1ASY A;  1K8O A;  4Y8V B;  3DF7 A;  1EZ6 A;  3HKZ A;  1X3F A;  2F0T A;  1E0B A;  2L55 A;  5C44 H;  2UXC L;  4ECX A;  1E4G T;  4DAY B;  1XMO L;  1M1K C;  5IOC A;  1EY0 A;  2Q2T A;  1SYE A;  4GNX A;  2MCT A;  3VPD A;  2FMA A;  2N88 A;  1X54 A;  3DXJ C;  4LUO A;  3Q0A A;  2L9H A;  3V96 A;  4XTC S;  1YIJ A;  2K5W A;  3DMU A;  2OXP A;  1IW7 D;  1YHA A;  3SDZ A;  4IUU A;  4MTE A;  3HBL A;  2R92 B;  3SK6 A;  1EWH A;  1QUQ B;  4DK0 A;  3FEW X;  3P75 A;  2R6F A;  2K03 A;  2VQE L;  3BQ0 A;  2JA8 H;  2KHJ A;  4F4W A;  3RJ0 A;  2IJ0 A;  1VKZ A;  4EQ5 A;  2R87 A;  1CZW A;  3K5O A;  4DXF A;  1K83 B;  1KAW A;  4QL5 A;  1EQQ A;  1KLU D;  2A68 C;  4N9T A;  2FXQ A;  1FYC A;  5HGQ A;  5IYB G;  4X64 Q;  4LFC Q;  2FE3 A;  1Y1W B;  2DPI A;  4JI6 L;  1RK5 A;  3DM1 A;  4XIG S;  3MFI A;  5I4D A;  1EYD A;  2K50 A;  3TP7 A;  3ULL A;  4RB2 C;  1EYA A;  4RH6 A;  4CKC A;  4OON A;  3QFF A;  1C9O A;  1VQP A;  1STA A;  3FKI B;  1XNQ H;  2B2Y A;  4K5V A;  3HOV G;  1YBY A;  2KEC A;  3G48 A;  4A4I A;  3HOY H;  2F0H A;  4EBE A;  1H9S A;  2NWG A;  3OYY A;  4JI8 H;  5GAD C;  1KJQ A;  4ECU A;  1YVC A;  2Z8L A;  1STN A;  1CQI B;  1VCI A;  3A54 A;  1KBL A;  3M4Q A;  4OEM B;  5ELC A;  1K8G A;  1ZHQ A;  3QZ8 A;  4LF5 H;  3MFG A;  1RKN A;  4C5B A;  5ELF A;  2PZU A;  3OMG A;  5DLQ E;  1SE8 A;  1KC8 C;  5HV6 A;  2Q2H A;  1HZA A;  4HNT A;  3MFH A;  2JP1 A;  2C5C A;  1LTI D;  1I7N A;  5IGC A;  2WP8 J;  4DUZ Q;  2V4R A;  1N36 H;  4JV2 A;  2IP4 A;  1I6H B;  2UUA H;  4R7R A;  3HS0 C;  1SYG A;  1J5E Q;  4TV9 F;  4UP7 A;  4C1N I;  1H95 A;  3QOL A;  2EYL A;  3A8K E;  2PQA A;  5LXT F;  4O3O A;  4YQW A;  3U9S A;  3CHB D;  5C3W A;  2M9V A;  2BE5 D;  4X3T A;  4NXN Q;  3TQT A;  2UUC H;  5JPM C;  5HY6 A;  2JEA I;  1F2Y A;  2CH4 W;  2B2U A;  2CVR A;  1KDC A;  1AH9 A;  3GTM A;  1HZC A;  3NWT A;  4FF2 A;  2R7Z A;  4L63 B;  1NY4 A;  1B9M A;  2K01 A;  4IUV A;  3UI2 A;  2BDO A;  1Q12 A;  1GUT A;  5KT3 A;  4ED7 A;  2QCP X;  1WR2 A;  3I4L A;  3MR6 A;  5FLX L;  2EOT A;  2F0D A;  4GN4 B;  3TP6 A;  3WNZ A;  1A8V A;  1SR3 A;  2ZM6 Q;  3HOU B;  1BO0 A;  3UE1 A;  4A3M H;  1I3Q H;  1R9T B;  5L1J A;  4POG A;  4DV2 Q;  3LX0 A;  4J9L A;  2JXM B;  3L2P A;  1PYS B;  3Q8Q B;  5KND A;  3R5X A;  4R8U B;  5E4W C;  3MZ5 A;  5J39 A;  1HPC A;  3OW7 A;  4ECV A;  1PZJ D;  3CME A;  3LWU A;  2EZV A;  1DZ1 A;  2A73 B;  4A3J B;  3KHG A;  1B2T A;  1I4H A;  2JA9 A;  1AFP A;  1PTO C;  5C0X H;  2NN6 I;  3RR5 A;  3OWF A;  1HNZ L;  2G9H D;  4K0K Q;  2G5D A;  4ZUJ A;  2O03 A;  1WVL A;  2R82 A;  5FJ8 H;  1IBK L;  3PO3 G;  3DWQ A;  3ND8 A;  5C4J H;  2PO4 A;  3M4I A;  4MTD A;  3NHH A;  1J6Q A;  4X65 H;  1C8C A;  1VBH A;  3D3R A;  2QYZ A;  3K0Y A;  1Z2P X;  3F2C A;  5FPO A;  1CUK A;  2CWA A;  5JEA G;  1CZG A;  5LMN Q;  5IYZ F;  3KF6 B;  4C3J G;  3VYS A;  5DAU A;  2EPB A;  2PMZ E;  3M4Y A;  2VB3 X;  4RB0 A;  3S14 H;  5IWA H;  3NK9 A;  4R4T A;  4WRD A;  4DV6 Q;  4Y52 H;  1WTV A;  2KCT A;  4DFA A;  4HNV A;  4BY7 H;  2HGS A;  1RK6 A;  3PW4 A;  4MTN A;  4J6H A;  1BNZ A;  5KFT A;  1WTP A;  5K36 G;  2B2W A;  5JJK A;  2IA6 A;  3RLF A;  2R6G A;  2A6H D;  4FXK C;  3PF4 A;  1W3S A;  1MBY A;  2WAQ B;  1RJR A;  2XCL A;  4MV6 A;  4A3K H;  2PI2 E;  2NUC A;  1SMY C;  5C1P A;  1WTO A;  1HFG A;  3ZYY X;  2ZDH A;  2JA5 G;  4RNO A;  3GID A;  3J81 j;  4EFB A;  2N3S A;  5ELE A;  5AFW A;  5D1O B;  4Q44 A;  3C2P A;  5LMU L;  2E75 C;  2WV6 D;  3PUY A;  2JSO A;  4IRK A;  2C2D A;  1JE5 A;  1B4O A;  2M00 A;  5FLX E;  2VZA A;  3GQC A;  3BVZ A;  1LM0 A;  3U4V A;  1PFS A;  2CQO A;  1TA8 A;  4C1N K;  5HBR B;  3NEN A;  2EDG A;  2PZW A;  1JWU D;  3MXP A;  2EY5 A;  1HR0 L;  4MV1 A;  4QWE A;  3D6C A;  1PLF A;  5DGB A;  1CHQ D;  3PUW A;  3F2B A;  1L2F A;  2NVY B;  2F4V L;  4K8J A;  5EPL A;  4A3B H;  3K5I A;  4TRD A;  3I70 A;  5J3B A;  3FMA A;  1VQL A;  5C3E H;  1EUD B;  2CW0 C;  2OF1 A;  2YRX A;  3CQZ A;  5IYC H;  3UQ8 A;  2OT2 A;  1J9O A;  2BQU A;  3I4O A;  2XD4 A;  1QIL A;  2Y0S B;  2UU9 Q;  3G6X A;  2AU0 A;  3I4N G;  2ZXR A;  3MA2 B;  4A3E B;  2R8K A;  1JB3 A;  5LL6 X;  2VOB A;  4BBR B;  1QVF A;  2UXB L;  4PZ8 A;  2WYO A;  3T1Y L;  2IY5 B;  5ELD A;  3IFD A;  5GON F;  5J2T F;  2W8K A;  1N32 L;  3VYU A;  2YS7 A;  1A0I A;  4JUZ A;  3RAX A;  2C28 A;  1SYD A;  4DV0 L;  5EQ0 A;  3GTJ B;  3A7A B;  3HOZ G;  1Q46 A;  3STB D;  2UUB L;  4GOP C;  5KG6 A;  1SBB B;  1VMC A;  2OEO A;  4DNR B;  5IY0 A;  1SFO H;  4H0L C;  2YL2 A;  1E24 A;  3KAJ A;  4DR3 L;  1RTO A;  3A5U A;  2R8H A;  4HN7 A;  4OXP A;  4DN4 M;  4X62 L;  3S1R B;  1ICW A;  2J0T D;  1XYI A;  3U9T A;  4KKT A;  2R93 H;  1ILP A;  4DL3 A;  3HOX H;  1Q8K A;  5H1S E;  1XX8 A;  5KG3 A;  2A69 C;  3CCS A;  1U4L A;  1I4R A;  4K2K A;  5NUC A;  3K6O A;  1ZYR D;  5E7N A;  3BVG A;  1ASZ A;  2ENB A;  4PG3 A;  2RCF A;  4R8N A;  1YI2 A;  1QJO A;  1LT4 D;  1B3Q A;  3GLK A;  4PMW A;  1K83 A;  2TSS A;  4ZKB B;  1AN7 A;  2Z1C A;  2YU9 H;  1XNQ Q;  2W6Q A;  1O7Z A;  3J80 L;  1A3V A;  1K8M A;  2CQY A;  4JI8 Q;  4U67 3;  3N6R A;  2HHH H;  1Z2O X;  4A3M B;  1HNX H;  4AQY L;  4IRD A;  4Q8F A;  1F2L A;  3DEP A;  1FL0 A;  3MVV A;  4IZ8 A;  4LF5 Q;  5DG8 A;  1Q8I A;  1YZ6 A;  3K7A H;  2VQD A;  1QNU A;  3OMC A;  3K57 A;  2KCM A;  5BR8 L;  4LF4 Q;  1MI2 A;  1N36 Q;  1IBL L;  3RF2 A;  5KFK A;  2L11 A;  2JE6 I;  2VA3 A;  4RFB A;  3K5N A;  1WCM A;  5KT6 A;  3VPB A;  1IZ6 A;  1ZHS A;  3DEO A;  2F3W A;  4WOR A;  1EZ8 A;  4G7O C;  5KGU A;  4PV1 C;  2JEI A;  3UDG A;  1TWC H;  2UUC Q;  3KHH A;  5AJ3 L;  5JUM A;  2NVX A;  5D3I B;  5C44 G;  4RAY A;  4KD3 A;  2R85 A;  4JC0 A;  5G3L D;  4LF8 L;  3KLR A;  4FBU A;  3A55 A;  2YZG A;  2ZJR A;  3AEV A;  1U5K A;  3GTL A;  1IL8 A;  4DA2 A;  2QEJ C;  3U50 C;  4JI3 H;  1F77 A;  2D5D A;  5TSS A;  2VUM H;  5EPJ A;  4LH6 A;  1A3U A;  3Q8P B;  4E6I A;  4LF9 H;  1LUZ A;  2AUJ D;  3KDF B;  4X3K A;  5KIX A;  3NWS A;  1I50 H;  1CA6 A;  4A3D B;  1VDZ A;  5IYB H;  4WJ4 A;  3AMU A;  4YY3 H;  2F4I A;  4CBV A;  2R7M A;  1GVP A;  1BF4 A;  1G8Z D;  4IFD G;  3B6Y A;  4RNM A;  3S16 B;  1ZQ7 A;  5I47 A;  4UPA A;  3F8T A;  1EY7 A;  4HJ5 A;  4EBC A;  4IUN A;  4JV5 L;  2W71 A;  2B39 A;  3D4D A;  2AQ2 B;  2MHV A;  3J80 E;  2DUD A;  2EYF A;  2B2T A;  4R8U A;  5I9O A;  2ZTC A;  3GV6 A;  2YYA A;  5FD5 A;  4RMF A;  1IKL A;  3S2D H;  5DEH A;  4QF4 A;  4XYQ A;  1YJN A;  2V59 A;  1HQR D;  3J7Z C;  2F0J A;  4EX5 A;  3EIV A;  4M8A A;  2XWB B;  1H9R A;  2EJF C;  2RCN A;  4U6P A;  4POF A;  4A2B A;  2JA6 B;  2WKD A;  2NVT B;  2YW2 A;  5IIF A;  4FF3 A;  4DR2 H;  4B3S H;  1ESF A;  3HKZ B;  1LTT D;  2WAQ E;  4HMI A;  1TWH A;  4KJO A;  1GOZ A;  2F0E A;  5FKA C;  4GNX C;  3P1H A;  2H1E A;  3KF6 A;  2EVB A;  3LML A;  4EG0 A;  2AQ3 B;  4NLG A;  2CFM A;  2X69 A;  4BWG B;  2LFN A;  3J7A F;  5KFQ A;  2SOB A;  5I9P A;  3D8G A;  3RGX A;  1EZ1 A;  1WTW A;  3RBE A;  4G7Z C;  3A74 A;  1NAP A;  1EQR A;  4DXG A;  4FM9 A;  4ED0 A;  2Q2I A;  4DNT B;  1ZKO A;  3SVM A;  1I6V C;  1VQN A;  4LNQ A;  4RHS A;  1DJR D;  1CT1 D;  2F0G A;  1U0L A;  4B3M Q;  1WSC A;  4FF1 A;  1FNU A;  4DV1 H;  4QJF A;  2PQE A;  4ZCK A;  2N55 A;  2Q2U A;  3GTQ H;  3QZ7 A;  4DLK A;  3PO2 H;  2JEJ A;  5FLX W;  4JI2 Q;  4O3S A;  3V05 A;  1B9N A;  4XZ3 B;  5DGA A;  1B7Y B;  5EBD A;  1FD7 D;  2NN6 H;  4YHH H;  3HEJ A;  5FLX c;  2BH2 A;  4IUR A;  5D1O A;  3G6Y A;  2ASJ A;  4UAI A;  2JA7 G;  1E22 A;  1CTM A;  3T1H L;  4UCR A;  4NDX A;  4LFB L;  3S15 B;  1CFM A;  2Y0S E;  2B2Y C;  3HZX A;  3TZD A;  2XIW A;  4LFC H;  2LS0 1;  3CRK C;  4X64 H;  2HIV A;  1GHJ A;  1H9S B;  3M9M B;  4J9K A;  4IR1 A;  4H44 C;  5KFL A;  4CJ0 B;  3M7N A;  1K73 C;  5IWA L;  3MWM A;  3BQ2 A;  3RV4 A;  2W7O A;  4JOI A;  5IT9 L;  5FO9 B;  2CW8 A;  2XC9 A;  2NVY A;  5FO7 B;  5KFY A;  1IW7 C;  5FJ8 G;  5EAY A;  4DV7 L;  1X32 A;  4ECR A;  3VR3 A;  1KDB A;  2FFK B;  5KFX A;  5JEA H;  1HNW H;  1JOO A;  2QA4 A;  2IMW P;  3BG5 A;  1X6O A;  4Q45 A;  5LL6 b;  1JX4 A;  2FP4 B;  5KG1 A;  2KOL A;  4M1U B;  1ENC A;  1C48 A;  4RCO A;  3VYR A;  4QUF A;  2XNA C;  4EGV A;  2HIX A;  2NVQ H;  2PQA B;  1SDF A;  1M0W A;  3I4M B;  4TSS A;  1IBM H;  1QZH A;  1GUN A;  1XPO A;  4C2M H;  2F0M A;  4ILW A;  4KMU C;  5K36 H;  2B2U C;  4DUZ H;  3E5N A;  4BY7 G;  3S2H B;  2P0A A;  3GTM B;  3PW7 A;  1N56 A;  1FGB D;  4HCS A;  3ERQ A;  2R7Z B;  1RJP A;  2WDT A;  1PRT D;  2FJZ A;  1X56 A;  3NQI A;  1K0R A;  4JBK A;  3IKJ A;  1H9M A;  1QNK A;  1K8A C;  4LF7 L;  1PH4 A;  4O3N A;  5CV7 A;  3NEM A;  4A3K G;  3RZO H;  1MSG A;  4FU0 A;  2D9U A;  1VQD A;  2FK1 A;  1VQE A;  5KFH A;  2NYZ D;  1YHQ A;  2HHH Q;  5DG9 A;  1GUS A;  4JI4 H;  1HNX Q;  4EYH B;  5KT2 A;  1E2W A;  1NJI C;  3GO5 A;  5C4X G;  4A3I B;  2NU6 B;  3I8Z A;  5KFU A;  2F0U A;  5GAG C;  3N42 B;  4N8X 1;  3R8B A;  5JVG 3;  4ECW A;  4KY5 A;  5EJW A;  3RZD H;  2OWO A;  4Z9C B;  1J8I A;  1XWE A;  3A56 A;  3QWN A;  3MR3 A;  1HR0 W;  3GV7 B;  4O42 A;  2ZM6 H;  2RDJ A;  1NMG A;  1KAA A;  4B3T H;  4KHZ A;  4LW1 A;  1FNW A;  1I3Q A;  4DAP A;  3HOV B;  2BH8 A;  1S10 A;  1A2U A;  3E6Z X;  4DV5 L;  3D6W A;  4A3B G;  2B2V A;  2BE5 C;  1L1O A;  3KBG A;  3S1Q H;  3C0F B;  2IX3 A;  2H5X A;  3I4N H;  1KNE A;  2DY7 A;  5C3E G;  4A93 B;  1KJ9 A;  4RKL A;  2I80 A;  2R86 A;  5KFB A;  4X3U A;  3MEF A;  3RUZ A;  5IT9 E;  2DNC A;  4XT1 B;  4QIW B;  1G29 1;  3F2U A;  5EGT A;  3TME A;  3OSN A;  5C1O A;  4KN7 C;  2W9B A;  3N52 A;  1GGO A;  1TWG H;  1XTC D;  4OX9 Q;  3GTK H;  4LSX A;  1Z2N X;  4O2A F;  3WOE A;  3P20 A;  2LMC B;  3G4S A;  1G91 A;  3KJO A;  1SJE D;  1H9J A;  1I94 L;  4DR6 L;  4ME6 A;  4JI3 Q;  2HVQ A;  3U4Z A;  5JVD F;  2EJG C;  5ELB A;  3TRZ A;  2B2W C;  3KOJ A;  3OW2 A;  4LF9 Q;  2EQS A;  5D8D A;  3FHW A;  1XMQ L;  3PR5 B;  1SEI A;  2RKS A;  2C00 A;  1EQT A;  2BQR A;  1PMR A;  3IAY A;  3CC2 A;  3M3Y B;  4YY3 Q;  1WTQ A;  3G6E A;  1FNV A;  1N33 L;  2RGR A;  3EVQ A;  3MTS A;  4DV4 L;  2L15 A;  1IYV A;  3RGZ A;  1EY8 A;  1WYD A;  3HOX G;  4JYA L;  2KHS A;  3KDF A;  3R2T A;  4B3R Q;  4GKJ H;  1A9X A;  2CKZ B;  1W93 A;  4J9O A;  4LF6 L;  3J80 W;  5KFG A;  3OOC A;  3I56 A;  1B1Z A;  3ULP A;  4OIK A;  2XCP A;  1TY2 A;  3J80 c;  1JJC B;  3U9O A;  2YZM A;  5M5X H;  5EKL A;  3HGB A;  1ILQ A;  3HKZ E;  5L1K A;  2ATW A;  2NU9 B;  1AEX A;  3NTI A;  1E3P A;  2E74 C;  3MXG A;  4MNO A;  1KJJ A;  2Q8T A;  1DCZ A;  4GKK L;  5L1I A;  4HJ8 A;  3OSP A;  5JVH 3;  3CQZ B;  4DR2 Q;  4G7H C;  2F0F A;  4B3S Q;  3NPP A;  3S17 H;  4V19 0;  1MIU A;  1U9R A;  3AQQ A;  2D0O A;  4HYK A;  4HID A;  2UVR A;  3PO3 B;  2DN8 A;  2EYJ A;  5IGF A;  2A6H C;  2JK8 A;  2DLN A;  4IUQ A;  3KF8 B;  2E2J H;  4JPB W;  1Q82 C;  4YJ3 F;  1PTO H;  1D5Z C;  2K7V A;  3BJU A;  4X6A H;  3Q2O A;  1CKN B;  1RJT A;  1Y1V G;  4I50 F;  2IPK D;  1D1K A;  3DM3 A;  3E5S A;  2E2H H;  4BBS G;  1X55 A;  2UU9 H;  1L0Y B;  1S5E D;  1I4Q A;  4C3J B;  5IOD A;  1SRU A;  1PH1 A;  1DOK A;  3HOW G;  1JCK B;  1EIG A;  3MHB A;  1IOW A;  1N34 L;  4P72 A;  3V6J A;  4J9M A;  2I5L X;  1UE6 A;  1JWS D;  1XNR L;  1ZXT A;  4DV1 Q;  2AWN A;  3K3V A;  1H9K A;  2RHS B;  1GLV A;  1D5X C;  3CXC A;  1XDN A;  3BZC A;  1HQM C;  5IGD A;  1RJQ A;  4OO1 I;  1I4P A;  4PDB A;  2FPP B;  2C35 B;  4X66 H;  4EBD A;  4DL7 A;  3AYH B;  2VUM G;  4YHH Q;  1UC9 A;  1EU4 A;  1ONL A;  1YEZ A;  1NNX A;  1U4M A;  3BJY A;  4LSA A;  3OHA A;  1GHK A;  3FPU B;  2LXK A;  4ECY A;  5C5M A;  3OTO H;  4DUY L;  2YYZ A;  4DV3 H;  1XXG A;  4IFD H;  4MN3 A;  2ICE C;  1QVG A;  4B9X A;  4IWY A;  1EUJ A;  2KCC A;  5KX5 F;  2R93 A;  2JA5 B;  3TIG A;  4K6L A;  4A76 A;  2CCZ A;  2PW7 A;  2V4Q A;  1TY0 A;  4NPS A;  1VAJ A;  5HGT A;  1DOM A;  3C3L A;  4RB1 A;  3PGZ A;  2W6P A;  4HNU A;  2RDF A;  3GTG H;  1IHZ A;  1PXU A;  4NXM L;  1EY5 A;  2WIN B;  3K0X A;  1VF7 A;  2E5L L;  3SE7 A;  3ITP A;  3HB9 A;  2Z4I A;  1S4Z A;  4YCW A;  2YS6 A;  1OXU A;  2DJG C;  3STB C;  5IGB A;  4RA8 A;  4JV0 A;  1PZK D;  1YNN D;  2DZD A;  1FKA H;  2AKW B;  4DGZ A;  5M3F B;  3CCR A;  1HNW Q;  4JI7 H;  2JJQ A;  1KL9 A;  4ECT A;  5CC4 A;  4JI5 H;  2K75 A;  4RHR A;  4JI0 H;  2BQ3 A;  1B70 B;  4K5X A;  1WCM B;  5JAV A;  2HDL A;  5J2U F;  2NTT A;  3N40 P;  1IBM Q;  1QVC A;  1N9W A;  1SMX A;  4RGO S;  2O5J C;  4HCE A;  1KDA A;  1TWA H;  1ZYR C;  5EWF A;  4LF4 H;  1OXV A;  3EBE A;  2NVX B;  4YJ2 F;  1STB A;  3VR5 A;  4DL2 A;  3DLL A;  1JB7 A;  3SE0 A;  1QZG A;  3IFT A;  2IT1 A;  2XIG A;  3TQY A;  4UCT A;  3CPW A;  3HOZ B;  5LHY 1;  3GTL B;  1EWC A;  4JBW A;  4A3G H;  5T1G A;  2XGQ A;  2UVW A;  5M5W H;  1V4Y A;  2PZT A;  2F0N A;  4RKB A;  4FXG C;  4ME5 A;  4O2B F;  4QCL A;  3MWE A;  2E8G A;  3NBH A;  2HQL A;  3RLO A;  2QW7 A;  3G71 A;  2LSS A;  3KXY T;  2I07 B;  1S3O A;  4JI4 Q;  1JQY D;  2BDN A;  5C5J A;  1IBK Q;  2K04 A;  1F9R A;  1BOS A;  1NMF A;  3H0G G;  2HCI A;  2D0P A;  1BKB A;  1NCV A;  2BOS A;  3PCO B;  4LUZ A;  2B63 G;  2B29 A;  2SCU B;  2I5H A;  3PO2 G;  2R7F A;  3S1N B;  4LFA H;  1I6U A;  3NTH A;  2AHO B;  2W6M A;  4RGM A;  1DXM A;  4JI1 H;  2JA7 H;  4B3T Q;  1SAP A;  4C3I G;  2E2I H;  2NN6 G;  3VA5 A;  4U7C A;  3KHL A;  1I50 A;  2XSC A;  3MR2 A;  3GTO H;  3K5H A;  3J7Y W;  4YWM A;  4J8Q A;  1GSH A;  4QIW E;  2B2T C;  1E4E B;  4MA0 A;  5KFZ A;  1RL2 A;  5L37 A;  2Z6K C;  5FLM G;  2YV5 A;  1EIH A;  4C3H B;  3F8N A;  3I91 A;  3TIN A;  4DR7 H;  1DGS A;  1CQV A;  4H7B A;  3FDS A;  2SNM A;  5E4X A;  5IT9 W;  2GVA A;  3WO0 A;  1DYQ A;  2J6S A;  2BA1 A;  5D14 A;  5IT9 c;  2ZJP A;  1S5D D;  1Y14 B;  1GJX A;  4WD3 A;  4TVA B;  5M5Y H;  1HTL D;  1J5E L;  3GIL A;  2MP1 A;  1Q1B A;  1TWH B;  1JMC A;  2MO0 A;  4Q0F A;  2VQF H;  4RAZ A;  1P16 A;  5LMU Q;  2IX1 A;  5LYJ F;  3CCE A;  2YTX A;  4NXN L;  4QIW A;  3NSW A;  1DV2 A;  4YAJ B;  4AYB G;  3S1M B;  5L1L A;  3JSL A;  1S9F A;  1K3R A;  5C44 B;  2F0W A;  3GIQ A;  1L0X B;  4IJL A;  1SCU B;  3E0J A;  4YWK A;  4DR4 H;  1VQ6 A;  3RLN A;  4KHP L;  4GKJ Q;  1K0S A;  2FLP A;  4MV3 A;  1OTC A;  1EOV A;  2AMC B;  2RA4 A;  1VBG A;  1LAB A;  1AE3 A;  4J0M A;  4O4L F;  2VXW A;  2WII B;  3T51 B;  1LT6 D;  5C5L A;  4DV2 L;  3CCQ A;  3BA9 A;  4O4I F;  3RTX A;  2JA8 B;  5C4X H;  4B3M H;  2ASD A;  2UXB Q;  3GTQ A;  3ETH A;  4HQ6 A;  4UDU C;  4RNN A;  4JI2 H;  3K59 A;  2F0K A;  1VQO A;  1WH2 A;  4K0K L;  1T36 A;  2K32 A;  5DQH A;  3LNN A;  5GQO A;  3FPP A;  2WKC A;  1LYL A;  1PYW D;  1SNQ A;  1UE7 A;  4NKL A;  1ET9 A;  3J81 i;  5JH7 F;  1S0O A;  3RIZ A;  2VNU D;  2FLN A;  5DG7 A;  4JOI C;  4X62 Q;  1Y1W G;  1Y8P B;  4UY8 C;  3PVX A;  1KXL A;  1HXY D;  1OXX K;  4KD4 A;  5LMN L;  4HIO A;  3HOY B;  1MZB A;  4K6D A;  2EJM A;  3BDO A;  2N49 A;  4A3F H;  4LWC A;  4DV6 L;  3FKI G;  1QCB D;  2KBN A;  4CKE A;  3M9B A;  3PIP 3;  1Q81 C;  2A74 C;  1TWF H;  3C46 A;  1V43 A;  1LTS D;  3KF8 A;  3K80 C;  3Q8D A;  4GC6 A;  1FR3 A;  2AGQ A;  4M7E A;  2C9O A;  3G8C A;  5ELO A;  1CKN A;  3TS2 A;  4RZQ A;  4IAL A;  3ERO A;  4ZLT F;  1B6R A;  2K52 A;  3W1B A;  4AQY Q;  3IG0 A;  4X66 Q;  1FJG H;  2BR0 A;  4MTK A;  5CB4 F;  2FK2 A;  3T53 B;  3OTO Q;  5J1Z A;  1BBX C;  4FS1 A;  3EA6 A;  3KK7 A;  4DV3 Q;  1AZQ A;  1PHJ A;  4C2M A;  4DR5 H;  4KY6 A;  2XTI A;  2W57 A;  3GV8 B;  2K5N A;  4ZYS A;  2ALZ A;  4J9N A;  4JV1 A;  4QMG A;  2UXD H;  4F87 A;  1MJC A;  1IBL Q;  1IOV A;  5C4Z A;  4TKO B;  4C5C A;  4YR2 A;  2EYH A;  1KRT A;  4EEY A;  2JA5 A;  2DGY A;  2J4X A;  5CGK A;  2KUM A;  1ICF B;  4ZI7 F;  4XDX A;  3V6K A;  3G7L A;  1Z47 A;  1NE3 A;  4ZK9 B;  3OHX C;  1I3Q B;  3CKI B;  3BZD B;  4JI7 Q;  2W6N A;  1TS2 A;  3I12 A;  4UHV A;  4JI5 Q;  3RMH A;  2MNA A;  1XPU A;  4QY7 A;  4JI0 Q;  4YB8 B;  5C8Y F;  4DR1 H;  3HFZ B;  3KHR A;  4ED3 A;  4IR9 A;  1GYF A;  1L1O B;  2XCA A;  3K81 C;  4RGN A;  4LMQ D;  5D65 A;  1UEA B;  1E7Z A;  2K6A A;  3WDN A;  1T3N A;  1EEI D;  1I4G A;  1F2Z A;  1CKO A;  3ORQ A;  3NUC A;  5KFV A;  3S24 A;  3E9I A;  4DKA C;  2W9B B;  1PRT C;  1PRT B;  1GO3 E;  5IP7 H;  1AW7 A;  1HCZ A;  4R8I A;  4IAJ A;  2KHI A;  2Z6B A;  4CHT B;  2B3G A;  3OHB A;  4DNI A;  4BA1 I;  1B53 A;  1Y1V H;  5C4J B;  4A3J G;  2FJ2 A;  4PMB A;  5COR A;  4OO1 H;  3K8A A;  4BBS H;  3NP8 A;  2ZTD A;  2XRS D;  1M90 C;  1QWY A;  4PWQ A;  5C4H A;  3HOW H;  2K4K A;  1B6S A;  4Y7N H;  3T5H A;  1CK1 A;  1TS5 A;  5DM7 3;  1ZET A;  1GUG A;  2VB2 X;  1TQO A;  1N48 A;  1EIF A;  2WE6 A;  1JJG A;  3S14 B;  3VPC A;  4OX9 H;  3JSN A;  3SGI A;  4H13 C;  2R8G A;  2DIK A;  4R4C A;  2FMC A;  4BY7 B;  4HR7 A;  1VS0 A;  2RBM A;  1UNS A;  4BY1 H;  4V0B A;  1TS3 A;  2SDF A;  4LFA Q;  5IP9 H;  1XNQ L;  4JI1 Q;  5GAE C;  2F0S A;  3T16 A;  4JK1 C;  4JI8 L;  4PZ7 A;  5J22 A;  1E2Z A;  1KJ8 A;  1YNJ D;  1Y8N B;  2AUK A;  3R23 A;  1PTO D;  3NQT A;  4A3K B;  1B04 A;  1S40 A;  3CCM A;  2KQ3 A;  5EZY F;  4YBZ B;  1LT3 D;  1O78 A;  4GC7 A;  1U4R A;  1E1O A;  3RN2 A;  4LF5 L;  4MV8 A;  5M3M H;  3GV5 B;  4B3R H;  1YNX A;  2EYO A;  2WAQ G;  4DR7 Q;  1IL2 A;  3PZP A;  1II3 A; 
#chains in the Genus database with same CATH homology
 5GAG C;  5HGQ A;  2FXQ A;  5IYB G;  4LFC Q;  4X64 Q;  3S16 H;  4DR3 Q;  1D7Q A;  4GN3 B;  3RZD H;  2OWO A;  4JI6 L;  1I5F A;  1YJW A;  4AYB E;  1N36 L;  2IHF A;  2UUA L;  4XIG S;  1HR0 W;  1NMG A;  2K50 A;  4KHZ A;  3ULL A;  4LW1 A;  2ZJQ A;  4OON A;  1C9O A;  1VQP A;  3M4O H;  2BH8 A;  2VQF Q;  3KFU A;  4DV5 L;  3HOV G;  1YBY A;  3G48 A;  4A4I A;  3HOY H;  2UUC L;  3OYY A;  1EIY B;  1BBU A;  5GAD C;  1YVC A;  4A3B G;  1CKM A;  4A3L H;  1L1O A;  2CWP A;  3S1Q H;  2H5X A;  3I4N H;  1VCI A;  5C3E G;  4IOA A;  2PI2 A;  3M4Q A;  5M3F G;  3MEF A;  1GKH A;  1K8G A;  4GKJ L;  1G29 1;  1VQH A;  2JA6 H;  2NVT H;  5C4X G;  1TWG H;  1WCM G;  5DLQ E;  1SE8 A;  4DR4 Q;  4LFB Q;  3CAM A;  1KC8 C;  2Q2H A;  2VY3 A;  4OX9 Q;  3PUX A;  3GTK H;  1HZA A;  1MJE A;  3G4S A;  3JC6 6;  2ZTE A;  3KJO A;  1I94 L;  4DR6 L;  2Y0S G;  4JI3 Q;  2WP8 J;  3U4Z A;  4DUZ Q;  4DK6 C;  4A3G G;  3TRZ A;  4BBR G;  3KOJ A;  3OW2 A;  4IOC A;  2EQS A;  4LF9 Q;  1J5E Q;  3FHW A;  1XMQ L;  4UP7 A;  4GS3 A;  1H95 A;  5BR8 Q;  1D8L A;  2PQA A;  3H0G H;  3CC2 A;  2B63 H;  4J15 A;  1IXR A;  4GOP B;  2BA0 A;  4NXN Q;  4YY3 Q;  1CSP A;  3G6E A;  5HY6 A;  1PH5 A;  2JEA I;  1X3G A;  1N33 L;  4FDB A;  4DV4 L;  2L15 A;  2MFI A;  1KRS A;  3I55 A;  1AH9 A;  1WYD A;  3HOX G;  1UE5 A;  1HZC A;  3AFP A;  4C3I H;  2VW9 A;  4JYA L;  1OXS C;  3KDF A;  2A19 A;  4UP9 A;  3CCU A;  3WWV A;  4B3R Q;  1NY4 A;  2OCE A;  5AJ3 Q;  2CKZ B;  3PV0 A;  1Q12 A;  4YCV A;  4LF6 L;  4LF8 Q;  4GLX A;  3I56 A;  4GN4 B;  4IPC A;  1QUQ A;  3LGJ A;  1Q1E A;  2XGT A;  3UDX A;  4X65 L;  3ULP A;  2N8N A;  1A8V A;  5FLM H;  2UU9 L;  1SR3 A;  1RIP A;  3J80 c;  2ZM6 Q;  1JJC B;  4P71 A;  3UE1 A;  5M5X H;  4A3M H;  1I3Q H;  3HOU G;  1L1O C;  3S15 H;  3HKZ E;  4POG A;  2IX0 A;  2ATW A;  1VQC A;  2R7D A;  3MXN B;  2QEX A;  4DV2 Q;  1WOC A;  3L2P A;  1PYS B;  3M4P A;  5GRO A;  1W2B A;  1E3P A;  3GTP H;  2ES2 A;  1GM5 A;  4MNO A;  3BU2 A;  1VQ4 A;  4GKK L;  1VQF A;  3AFQ A;  3KYH C;  3CME A;  2JQO A;  4HJ8 A;  4DR2 Q;  1MKH A;  4DK3 C;  4X66 L;  4BXX H;  2JA9 A;  4B3S Q;  4MZ9 A;  3S17 H;  2NN6 I;  1MIU A;  3AQQ A;  2D0O A;  3RR5 A;  1HNZ L;  1FVI A;  4HID A;  4K0K Q;  3CCL A;  2EXD A;  3OTO L;  1K9M C;  3UDI A;  1C0A A;  5FJ8 H;  1IBK L;  3PO3 G;  2JK8 A;  4JV5 Q;  4DV3 L;  3KF8 B;  4DPG A;  2E2J H;  1Q82 C;  5C4J H;  1FJG Q;  3BJU A;  1J6Q A;  4X6A H;  2IHE A;  1CKN B;  1Y1V G;  3DM3 A;  2E2H H;  4BBS G;  3CPF A;  3TEH B;  3J7A 5;  1X55 A;  3F2C A;  1CUK A;  2CWA A;  5JEA G;  5LMN Q;  4DR5 Q;  1SRU A;  2UUA Q;  3KF6 B;  1PH1 A;  3H3V H;  3HOW G;  4R4I A;  2PMZ E;  1N34 L;  4P72 A;  3NBH B;  2I5L X;  1UE6 A;  3S14 H;  4R4T A;  4DV6 Q;  1XNR L;  3I4M H;  2UXD Q;  4DV1 Q;  2AWN A;  4DV5 Q;  2KCT A;  4Y52 H;  5IYD G;  1P8L A;  2RHS B;  4H02 A;  4KI0 A;  3CXC A;  4BY7 H;  3BZC A;  4MTN A;  4OO1 I;  5C0X I;  3S2H H;  4JI7 L;  3GTM H;  2C35 B;  3CCV A;  5K36 G;  5JJK A;  3AYH B;  5JEA J;  1S72 A;  2R7Z H;  4JI5 L;  4YHH Q;  2VUM G;  1YEZ A;  3RLF A;  2R6G A;  4JI0 L;  3PF4 A;  1W3S A;  2LXK A;  3I7F A;  4DUY L;  1PH9 A;  2YYZ A;  4A3K H;  2PI2 E;  2R92 H;  2RHQ B;  1QVG A;  1EUJ A;  4R1J A;  4A76 A;  2CCZ A;  4DAM A;  2JA5 G;  2MO1 A;  4NPS A;  3J81 j;  3CD6 A;  4A3C G;  2N3S A;  3ER0 A;  4DR1 Q;  4LF4 L;  5LMU L;  4L5R C;  3PUY A;  1K83 H;  2JA8 G;  3PGZ A;  1PH7 A;  5IE8 A;  2D62 A;  4A3I H;  3GTG H;  3UE0 A;  1JE5 A;  3ERS X;  2LXJ A;  2VZA A;  1Y1W H;  1C7Y A;  4NXM L;  4HIK A;  2JA8 H;  1LM0 A;  3K0X A;  2E5L L;  3U4V A;  1PFS A;  2CQO A;  5LMN W;  4WJ3 M;  2K5V A;  4YCW A;  1OXU A;  3NEN A;  3STB C;  1NBW A;  2YTY A;  3PUZ A;  1HR0 L;  4OWW B;  1VQ9 A;  2AKW B;  3HOV H;  3FKI H;  3CCR A;  1UWV A;  2PNH A;  1HNW Q;  1X9N A;  2JJQ A;  1KL9 A;  3PUW A;  3F2B A;  1L2F A;  3K7U C;  2K75 A;  1O7I A;  4A3F G;  2YTV A;  2F4V L;  4A3B H;  4IFD I;  1B70 B;  4IPD A;  3W5O A;  1N8R C;  3HOY G;  5J3B A;  3W1G A;  2Z6K A;  1VQL A;  5C3E H;  3T1H Q;  4LFA L;  5IYC H;  3L7Z C;  1VQK A;  4A93 H;  4X65 Q;  1WJJ A;  1PH3 A;  4A3L G;  1IBM Q;  1QVC A;  1N9W A;  1SMX A;  3I4O A;  4JI1 L;  1PVO A;  4HJ7 A;  2UU9 Q;  3CMA A;  3I4N G;  1TWA H;  4R4Q A;  1OXV A;  3EBE A;  3CP0 A;  2V1C C;  4A3E G;  3DLL A;  1JB7 A;  1QVF A;  1QZG A;  2IT1 A;  1PYB A;  4PZ8 A;  3TQY A;  3T1Y L;  5IWA Q;  1XPR A;  2UXB L;  2IY5 B;  3CPW A;  4RG1 A;  1N32 L;  1A0I A;  3CC7 A;  1SLJ A;  4JBW A;  4A3G H;  3HOZ G;  4DV0 L;  5M5W H;  3RNU A;  1Q46 A;  2HHH L;  2NZH A;  3STB D;  1PA6 A;  4GOP C;  1HNX L;  4GNX B;  2UUB L;  1I6H H;  1VQI A;  4DR7 L;  5IY0 A;  4DV7 Q;  3PF5 A;  1SFO H;  1VQ7 A;  3ICE A;  1IYJ B;  1E24 A;  2KEN A;  2E8G A;  2HQL A;  1TXY A;  3RLO A;  4DR3 L;  3M3Y H;  3A5U A;  3G71 A;  2LSS A;  4OXP A;  4X62 L;  1S3O A;  4APV A;  4JI4 Q;  1BVS A;  4AH6 A;  1IBK Q;  2I0Q A;  1NMF A;  3H0G G;  2R93 H;  2D0P A;  1BKB A;  3PCO B;  4LUZ A;  3HOX H;  1Q8K A;  2B29 A;  2VL6 A;  5H1S E;  1PH6 A;  2B63 G;  2WB1 G;  2I5H A;  3CCS A;  1AE2 A;  2R7F A;  3PO2 G;  2AHO B;  2VQF L;  5E7N A;  4TQU S;  3KLW A;  1ASZ A;  3PIO A;  2JA7 H;  4B3T Q;  2UXC Q;  4PG3 A;  2E2I H;  1XMO Q;  2NN6 G;  1YI2 A;  3CW2 C;  3GTO H;  4PMW A;  1YJ9 A;  1T9H A;  2YU9 H;  4YWM A;  1XNQ Q;  4QIW E;  1V9P A;  3HOU H;  4JI8 Q;  1RL2 A;  3ZJY C;  2ALY B;  2Z6K C;  5FLM G;  2YV5 A;  4YCU A;  1JJ2 A;  5JJL A;  1R9T H;  4AQY L;  4LF7 Q;  4DR4 L;  4A3M G;  4QQB X;  1DGS A;  1FL0 A;  1LTL A;  2VQE Q;  2GVA A;  1A62 A;  4LF5 Q;  1YZ6 A;  2BA1 A;  4JI3 L;  2Z0S A;  3CQZ H;  4A3J H;  3CC4 A;  3K7A H;  5IT9 c;  4L5T A;  2ZJP A;  1Y14 B;  4TVA B;  5M5Y H;  5IP7 G;  4LF9 L;  4HIM A;  1J5E L;  1FGU A;  4GLA C;  2HT1 A;  4P74 A;  2ID0 A;  1Q1B A;  2KCM A;  1WFQ A;  1JMC A;  2MO0 A;  5BR8 L;  5C0X G;  4JI6 Q;  4LF4 Q;  3PO3 H;  4B3M L;  1P16 A;  4OO1 G;  5LMU Q;  1N36 Q;  1IBL L;  2IX1 A;  3CCE A;  2JE6 I;  2RF4 A;  2YTX A;  4IJH A;  4NXN L;  4YY3 L;  1HZB A;  4B3T L;  4JI2 L;  1A63 A;  4AYB G;  1IZ6 A;  3M85 A;  3D31 A;  1SN8 A;  4C3J H;  1K3R A;  4O0A A;  1TWC H;  3UDG A;  4R4O A;  2UUC Q;  5AJ3 L;  2GN5 A;  4GLV B;  1XJV A;  1L0W A;  5C44 G;  4UP8 A;  5C0X J;  4JC0 A;  4IJL A;  5ELN A;  4LF8 L;  2QGQ A;  4YWK A;  5IYD H;  1UEB A;  2K14 A;  1OXT A;  4BY1 G;  3RLN A;  1VQ6 A;  2I5M X;  4KHP L;  5IP9 G;  2ZJR A;  3AEV A;  1U5K A;  4GKJ Q;  4IPG A;  3UDF A;  3I4M G;  1OTC A;  1E1T A;  1EOV A;  2AMC B;  1VQ8 A;  3U50 C;  4JCV E;  2F3I A;  4QGU A;  1AE3 A;  4GOP A;  1VQ5 A;  2VUM H;  1VQJ A;  4DV2 L;  3CCQ A;  1LUZ A;  3KDF B;  4YWL A;  1HH2 P;  1I94 Q;  1CSQ A;  1I50 H;  3H3V I;  2R7Z G;  4DR6 Q;  1G6P A;  5C4X H;  4IO9 A;  3EN2 A;  5IYB H;  4DR2 L;  5M3M G;  2UXB Q;  4WJ4 A;  1GD7 A;  2JA5 H;  4B3S L;  4A3D G;  1GVP A;  1XMQ Q;  4IFD G;  3B6Y A;  1VQO A;  4UPA A;  4K0K L;  3F8T A;  4HJA A;  2WFW A;  4HJ5 A;  4JV5 L;  3I2Z A;  2MQH A;  5GQO A;  1B8A A;  1LYL A;  1UE7 A;  3IRB A;  3J81 i;  1FJG L;  1N33 Q;  3A0J A;  4DV4 Q;  4OWX B;  1EWI A;  4A3I G;  2VNU D;  4JOI C;  1UE1 A;  2DUD A;  4JYA Q;  4X62 Q;  1Y1W G;  4UY8 C;  1KXL A;  1OXX K;  5LMN L;  1NTG A;  4HIO A;  2ZTC A;  4DR5 L;  2N78 A;  1KIX A;  4IFD J;  3J81 c;  4RMF A;  5M3F H;  4LF6 Q;  2N49 A;  5GAH C;  3S2D H;  3GD7 A;  4A3F H;  4KLK A;  1YJN A;  4LWC A;  3J7Z C;  4DV6 L;  1PH2 A;  2NVY H;  2UXD L;  4DV1 L;  3FKI G;  2KBN A;  4EX5 A;  3EIV A;  3M9B A;  1Q81 C;  4GN5 A;  4P73 A;  1WCM H;  1Z9F A;  2RCN A;  1TWF H;  3PUV A;  1HJP A;  1V43 A;  4POF A;  2F52 A;  1Q7Y C;  3PIP A;  1JT8 A;  3K80 C;  3Q8D A;  2JA6 G;  1HZ9 A;  4YHH L;  3A5Z B;  2WAQ E;  5ELO A;  5IYC G;  1CKN A;  4A93 G;  3HKZ G;  4A3E H;  3TS2 A;  2NVX H;  4GKK Q;  3CF5 A;  4BBR H;  4GNX C;  2K52 A;  3W1B A;  3GDE A;  4AQY Q;  3KF6 A;  4X66 Q;  1X65 A;  4O2D A;  1V1Q A;  2CFM A;  1KHI A;  2NZO A;  3HOZ H;  4L5Q A;  4LFC L;  3GTL H;  4X64 L;  1HNZ Q;  3GTJ H;  2OTJ A;  3VDY A;  3OTO Q;  2K5H A;  4DR1 L;  3RN5 A;  4DV3 Q;  1WI5 A;  3A74 A;  1PHJ A;  1EQR A;  1YIT A;  3F1Z A;  3TRE A;  2Q2I A;  2XTI A;  4LUV A;  3FP9 A;  2K5N A;  1VQN A;  4LNQ A;  3S1R H;  3ULJ A;  1U0L A;  3BZK A;  1MJC A;  4B3M Q;  1IBL Q;  4QJF A;  4PZ6 A;  3HKS A;  3GTQ H;  2Q2U A;  4JBM A;  3H15 A;  3PO2 H;  1VQA A;  4JI2 Q;  1N34 Q;  3S1N H;  2R93 G;  1KRT A;  1HNW L;  1XNR Q;  1SRO A;  1B7Y B;  3JAM i;  2DGY A;  3KJP A;  2VS1 A;  5FLX c;  3U58 A;  2BH2 A;  1Z47 A;  1NE3 A;  2A8V A;  3J80 i;  4JG2 A;  2JA7 G;  2ASB A;  1E22 A;  3E0E A;  3T1H L;  1KD1 C;  4JI7 Q;  4LFB L;  1XTD A;  2Y0S E;  3JAM c;  4OX9 L;  4JI5 Q;  1IBM L;  2MNA A;  1XPU A;  4KHP Q;  4QY7 A;  4JI0 Q;  2HIV A;  3TS0 A;  4BA2 I;  4DUY Q;  2OQK A;  3HFZ B;  4C3H H;  3CCJ A;  4DUZ L;  1L1O B;  3M7N A;  1K73 C;  5IWA L;  3K81 C;  1E7Z A;  4BXX G;  5JJI A;  1CKO A;  4JOI A;  4AIM A;  1X3E A;  3S24 A;  3E9I A;  4DKA C;  1PH8 A;  2EIF A;  1GO3 E;  5IP7 H;  2KHI A;  2OQ0 A;  2B3G A;  5FJ8 G;  4DNI A;  5EAY A;  4DV7 L;  4BA1 I;  4HJ9 A;  1Y1V H;  4A3J G;  2GVB A;  3NEL A;  3K8A A;  3PSI A;  1Q86 C;  1TWH H;  4NXM Q;  4BBS H;  2A1A A;  2ZTD A;  2E5L Q;  2QA4 A;  1M90 C;  3HOW H;  4JI4 L;  1X6O A;  2K4K A;  3F2D A;  4Y7N H;  2JEB I;  2WB1 E;  4B3R L;  3E9H A;  1VQB A;  4L5S A;  1VQG A;  4P75 A;  4OWT B;  1HR0 Q;  1BBW A;  3S1M H;  4ME3 A;  1EIF A;  2HIX A;  1ASY A;  1JJG A;  2NVQ H;  2PQA B;  2F4V Q;  1G51 A;  3SGI A;  1XPO A;  1X3F A;  1QZH A;  4JBJ A;  4C2M H;  4R4C A;  5C44 H;  2ZM6 L;  4NB3 A;  1VQM A;  4DAY B;  1XMO L;  1M1K C;  2OTL A;  1PV4 A;  2UXC L;  1VS0 A;  2Q2T A;  4GNX A;  4ALP A;  4BY1 H;  1EYG A;  4BY7 G;  1X54 A;  4LUO A;  4LFA Q;  5IP9 H;  1XNQ L;  4XTC S;  4JI1 Q;  5GAE C;  1YIJ A;  4IPH A;  4A75 A;  4JI8 L;  1X56 A;  4PZ7 A;  1K0R A;  4JBK A;  1YHA A;  1YHB A;  1K8A C;  4LF7 L;  1EFW A;  3L0O A;  3T1Y Q;  1PH4 A;  3NEM A;  1S40 A;  1QUQ B;  3CCM A;  4A3K G;  3RZO H;  2R92 G;  4A3C H;  1N32 Q;  2VQE L;  3D0F A;  1VQD A;  2KHJ A;  4DV0 Q;  1VQE A;  1KQS A;  1E1O A;  3RN2 A;  1YHQ A;  2HHH Q;  4LF5 L;  5M3M H;  2UUB Q;  2AWO A;  4EQ5 A;  1HNX Q;  4A3D H;  1YNX A;  2WAQ G;  1KAW A;  1IL2 A;  1NJI C;  3GO5 A;  4DR7 Q;  4QL5 A;  1EQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...