3HP0A

Crystal structure of a putative polyketide biosynthesis enoyl-coa hydratase (pksh) from bacillus subtilis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
250
structure length
250
Chain Sequence
TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative polyketide biosynthesis enoyl-CoA hydratase (pksH) from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Putative polyketide biosynthesis enoyl-CoA hydratase homolog
total genus 66
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3hp0A00
5JBXA 2J5GD 5DU4A 3Q1TA 2J5GA 5INGA 5KDRB 1UYRA 4JOTA 4JCQA 4FJWD 4JJTA 3R9TA 4IZDA 5G1RA 3BEZA 2W3PA 2BZRA 1RJNA 4ZDDA 3GF7A 1TYFA 2HW5A 3TVUA 2IEXA 2WTBA 3T3WA 3BPPA 3TLFA 3FDUA 3HRXA 1FC6A 4B3HA 5E0SH 3ISAA 1PJHA 3OT6A 5FIFA 4JVTA 2X24A 3T88A 3LKEA 5DZKH 2PPYA 3QXZA 1UYVA 4K29A 3ST9A 3BF0A 3GLMA 2ZQRA 2ZQQA 1WDMA 3H02A 3L3SA 1O8UA 2ZL4A 4RYFA 2VREA 4F47A 1ON9A 2J5II 1XO6A 3H0JA 5E0NX 3QKAA 3H0UA 5KDRA 4HC8A 1PIXA 4JCRA 3KTJA 5MGBA 4ZU2A 3V5IA 2J5IB 4B3IA 4EMPA 5DU6A 2QQ3A 5INIA 5FUSA 3PEAA 4GM2A 5DU8A 1HZDA 4DI1A 5G1QA 3T8AA 3N6RB 1SZOA 4GHNA 4FNBA 1VRGA 3OMEA 3P5MA 2F9IB 3TZ3A 2F9YA 4B3JA 3V5EA 3KTKA 3DJAA 3I47A 3QXIA 3DORA 4OMRA 3HP0A 4JCSA 4MOUA 3M6MA 5CTCA 1HNOA 1FC7A 4JFCA 5DTPA 4WYOB 5KJPA 4LK5A 3R9QA 4QFEA 1DCIA 1NZYB 4K3WA 3Q0GA 4JCTA 2FBMA 3MFMA 2F9IA 2A7KA 5DUFA 2VSUF 5INFA 3MT6A 1UYSA 4FB8A 1MJ3A 2Q2XA 3OC7A 3QYRA 1YG6A 2DEOA 4ZDEA 4ZDCA 3TV5A 3PE8A 3TRRA 4KPKA 3G64A 4IZCA 3H0QA 2VSUA 1XNYA 2A81A 2Q35A 4I42A 3TT7A 4NEKA 5DKPA 4OLQA 2DUBA 5DZKA 3NJBA 4ELWA 1Y7OA 4IZBA 2F6IA 2J5SA 4ASIA 2EJ5A 4FNDA 1UIYA 1WDKA 3P85A 2D3TA 4EMMA 4MI2A 4RYFH 3ZW9A 4RCNA 3PZKA 3K50A 3TDCA 2Q34A 3IB9A 5DL1A 1Q52A 3KTGA 2PBPA 3NJDA 5C90A 1JXZA 3HINA 4JSBA 1EY3A 5DTWA 2NP9A 1SG4A 1XNVA 1RJMA 1NZYA 4FN8A 2J5IA 2CE3A 4QIIA 3FF6A 4K2NA 3RSIA 3T89A 1WDLA 3GF3A 3R0OA 4EMLA 3ZW8A 4KNPA 1WZ8A 2PG8A 1TG6A 2ZL3A 4U18A 4FN7A 4FZWC 4JYLA 4Z0MA 1K39A 3MOYA 1HNUA 4L6WA 1N6DA 3ZWCA 3TT6A 4JWVA 4L8KA 4U1AA 2F9YB 3H0SA 5JBWA 1FCFA 3SLLA 3IAVA 3RSTA 4U0HA 4G2RA 4KD6A 3Q7HA 3ZWAA 5G1SA 2VSUE 4Q1IA 3P2LA 5E0SA 1EF9A 1X0UA 2A7SA 2CBYA 3QWDA 3GMAA 3T8BA 3KTIA 3PGQA 1J7XA 1YG8A 3HLN1 4U19A 3QREA 4ELXA 2VSSE 4HNKA 1FC9A 4ZDFA 4ZDBA 3JU1A 3HE2A 3RRVA 4NNQA 1OD2A 1N6FA 1W2XA 4ELSA 3Q0JA 1EF8A 4OG1A 4YLHA 3R9SA 1N6EA 4KWBA 5C9GA 4U0GH 3WG5A 4Q0GA 3IBBA 3K8XA 4QIJA 3ZWBA 1XNWA 2ZL0A 2GTRA 2VSUC 4U0GA 3H81A 3U9RB 4I4ZA 2UZFA 3TVWA 2ZL2A 3QK8A 4I52A 2F6QA 2C8TA 3M6NA 1Q51A 3STAA 3SWXA 3R6HA 5DUCA 3KQFA 1OD4A 2VSSA 3U9SB 3VIVA 5IKLB 3QMJA 1XX4A 1K32A 2FW2A 2FZSA 2X58A 1ON3A 1UYTA 4MXIA 4FZWA 3GKBA 3LAOA 4WZ8B 2VSSF 4JYJA 1DUBA 3MYBA 4WCZA 2VX2A 3KTHA 5CTBA 3U9TB
chains in the Genus database with same CATH superfamily
5JBXA 2J5GD 5DU4A 3Q1TA 2J5GA 5INGA 5KDRB 1UYRA 4JOTA 4JCQA 4FJWD 4JJTA 3R9TA 4IZDA 5G1RA 3BEZA 2W3PA 2BZRA 1RJNA 4ZDDA 3GF7A 1TYFA 2HW5A 3TVUA 2IEXA 2WTBA 3T3WA 3BPPA 3TLFA 3FDUA 3HRXA 1FC6A 4B3HA 5E0SH 3ISAA 1PJHA 3OT6A 5FIFA 4JVTA 2X24A 3T88A 3LKEA 5DZKH 2PPYA 3QXZA 1UYVA 4J2UA 4K29A 3ST9A 3BF0A 3GLMA 2ZQRA 2ZQQA 1WDMA 3H02A 3L3SA 1O8UA 2ZL4A 4RYFA 2VREA 4F47A 1ON9A 2J5II 1XO6A 3H0JA 5E0NX 3QKAA 3H0UA 5KDRA 4HC8A 1PIXA 4JCRA 3KTJA 5MGBA 4ZU2A 3V5IA 2J5IB 4B3IA 4EMPA 5DU6A 2QQ3A 5INIA 5FUSA 5HUQA 3PEAA 4GM2A 5DU8A 1HZDA 4DI1A 5G1QA 3T8AA 3N6RB 1SZOA 4GHNA 4FNBA 1VRGA 3OMEA 3P5MA 2F9IB 3TZ3A 2F9YA 4B3JA 3V5EA 3KTKA 3DJAA 3I47A 3QXIA 3DORA 4OMRA 3HP0A 4JCSA 4MOUA 3M6MA 5CTCA 1HNOA 1FC7A 4JFCA 5DTPA 4WYOB 5KJPA 4LK5A 3R9QA 4QFEA 1DCIA 1NZYB 4K3WA 3Q0GA 4JCTA 2FBMA 3MFMA 2F9IA 2A7KA 5DUFA 2VSUF 5INFA 3MT6A 1UYSA 4FB8A 1MJ3A 2Q2XA 3OC7A 3QYRA 1YG6A 2DEOA 4ZDEA 4ZDCA 3TV5A 3PE8A 3TRRA 4KPKA 3G64A 4IZCA 3H0QA 2VSUA 1XNYA 2A81A 2Q35A 4I42A 3TT7A 4NEKA 5DKPA 4OLQA 2DUBA 5DZKA 3NJBA 4ELWA 1Y7OA 4IZBA 2F6IA 2J5SA 4ASIA 2EJ5A 4FNDA 1UIYA 1WDKA 3P85A 2D3TA 4EMMA 4MI2A 4RYFH 2YJGA 3ZW9A 4RCNA 3PZKA 3K50A 3TDCA 2Q34A 3IB9A 5DL1A 1Q52A 3KTGA 2PBPA 3NJDA 5C90A 1JXZA 3HINA 4JSBA 3BPTA 1EY3A 5DTWA 2NP9A 1SG4A 1XNVA 1RJMA 1NZYA 4FN8A 2J5IA 2CE3A 4QIIA 3FF6A 4K2NA 3RSIA 3T89A 1WDLA 3GF3A 3R0OA 4EMLA 3ZW8A 4KNPA 1WZ8A 2PG8A 1TG6A 2ZL3A 4U18A 4FN7A 4HDTA 4FZWC 4JYLA 4Z0MA 1K39A 3MOYA 1HNUA 4L6WA 1N6DA 3ZWCA 3TT6A 4JWVA 4L8KA 4U1AA 2F9YB 3H0SA 5JBWA 1FCFA 3SLLA 3IAVA 3RSTA 4U0HA 4G2RA 4KD6A 3Q7HA 3ZWAA 5G1SA 2VSUE 4Q1IA 3P2LA 5E0SA 1EF9A 1X0UA 2A7SA 2CBYA 3QWDA 3GMAA 3T8BA 3KTIA 3PGQA 1J7XA 1YG8A 3HLN1 4U19A 4NARA 3QREA 4ELXA 2VSSE 4HNKA 1FC9A 4ZDFA 4ZDBA 3JU1A 3HE2A 3RRVA 4NNQA 1OD2A 1N6FA 1W2XA 4ELSA 3Q0JA 1EF8A 4OG1A 4YLHA 3R9SA 1N6EA 4KWBA 5C9GA 4U0GH 3WG5A 4Q0GA 3IBBA 3K8XA 4QIJA 3ZWBA 1XNWA 2ZL0A 2GTRA 2VSUC 4U0GA 3H81A 3U9RB 4I4ZA 2UZFA 3TVWA 2ZL2A 3QK8A 4I52A 2F6QA 2C8TA 3M6NA 1Q51A 3STAA 3SWXA 3R6HA 5DUCA 3KQFA 1OD4A 2VSSA 3U9SB 3VIVA 5IKLB 3QMJA 1XX4A 1K32A 2FW2A 2FZSA 2X58A 1ON3A 1UYTA 4MXIA 4FZWA 3GKBA 3LAOA 4WZ8B 2VSSF 4JYJA 1DUBA 3MYBA 4WCZA 2VX2A 3KTHA 5CTBA 3U9TB
chains in the Genus database with same CATH topology
5JBXA 2J5GD 5DU4A 3Q1TA 2J5GA 5INGA 5KDRB 1UYRA 4JOTA 4JCQA 4FJWD 4JJTA 3R9TA 4IZDA 5G1RA 3BEZA 2W3PA 2BZRA 1RJNA 4ZDDA 3GF7A 1TYFA 2HW5A 3TVUA 2IEXA 2WTBA 3T3WA 3BPPA 3TLFA 3FDUA 3HRXA 1FC6A 4B3HA 5E0SH 3ISAA 1PJHA 3OT6A 5FIFA 4JVTA 2X24A 3T88A 3LKEA 5DZKH 2PPYA 3QXZA 1UYVA 4J2UA 4K29A 3ST9A 3BF0A 3GLMA 2ZQRA 2ZQQA 1WDMA 3H02A 3L3SA 1O8UA 2ZL4A 4RYFA 2VREA 4F47A 1ON9A 2J5II 1XO6A 3H0JA 5E0NX 3QKAA 3H0UA 5KDRA 4HC8A 1PIXA 4JCRA 3KTJA 5MGBA 4ZU2A 3V5IA 2J5IB 4B3IA 4EMPA 5DU6A 2QQ3A 5INIA 5FUSA 5HUQA 3PEAA 4GM2A 5DU8A 1HZDA 4DI1A 5G1QA 3T8AA 3N6RB 1SZOA 4GHNA 4FNBA 1VRGA 3OMEA 3P5MA 2F9IB 3TZ3A 2F9YA 4B3JA 3V5EA 3KTKA 3DJAA 3I47A 3QXIA 3DORA 4OMRA 3HP0A 4JCSA 4MOUA 3M6MA 5CTCA 1HNOA 1FC7A 4JFCA 5DTPA 4WYOB 5KJPA 4LK5A 3R9QA 4QFEA 1DCIA 1NZYB 4K3WA 3Q0GA 4JCTA 2FBMA 3MFMA 2F9IA 2A7KA 5DUFA 2VSUF 5INFA 3MT6A 1UYSA 4FB8A 1MJ3A 2Q2XA 3OC7A 3QYRA 1YG6A 2DEOA 4ZDEA 4ZDCA 3TV5A 3PE8A 3TRRA 4KPKA 3G64A 4IZCA 3H0QA 2VSUA 1XNYA 2A81A 2Q35A 4I42A 3TT7A 4NEKA 5DKPA 4OLQA 2DUBA 5DZKA 3NJBA 4ELWA 1Y7OA 4IZBA 2F6IA 2J5SA 4ASIA 2EJ5A 4FNDA 1UIYA 1WDKA 3P85A 2D3TA 4EMMA 4MI2A 4RYFH 2YJGA 3ZW9A 4RCNA 3PZKA 3K50A 3TDCA 2Q34A 3IB9A 5DL1A 1Q52A 3KTGA 2PBPA 3NJDA 5C90A 1JXZA 3HINA 4JSBA 3BPTA 1EY3A 5DTWA 2NP9A 1SG4A 1XNVA 1RJMA 1NZYA 4FN8A 2J5IA 2CE3A 4QIIA 3FF6A 4K2NA 3RSIA 3T89A 1WDLA 3GF3A 3R0OA 4EMLA 3ZW8A 4KNPA 1WZ8A 2PG8A 1TG6A 2ZL3A 4U18A 4FN7A 4HDTA 4FZWC 4JYLA 4Z0MA 1K39A 3MOYA 1HNUA 4L6WA 1N6DA 3ZWCA 3TT6A 4JWVA 4L8KA 4U1AA 2F9YB 3H0SA 5JBWA 1FCFA 3SLLA 3IAVA 3RSTA 4U0HA 4G2RA 4KD6A 3Q7HA 3ZWAA 5G1SA 2VSUE 4Q1IA 3P2LA 5E0SA 1EF9A 1X0UA 2A7SA 2CBYA 3QWDA 3GMAA 3T8BA 3KTIA 3PGQA 1J7XA 1YG8A 3HLN1 4U19A 4NARA 3QREA 4ELXA 2VSSE 4HNKA 1FC9A 4ZDFA 4ZDBA 3JU1A 3HE2A 3RRVA 4NNQA 1OD2A 1N6FA 1W2XA 4ELSA 3Q0JA 1EF8A 4OG1A 4YLHA 3R9SA 1N6EA 4KWBA 5C9GA 4U0GH 3WG5A 4Q0GA 3IBBA 3K8XA 4QIJA 3ZWBA 1XNWA 2ZL0A 2GTRA 2VSUC 4U0GA 3H81A 3U9RB 4I4ZA 2UZFA 3TVWA 2ZL2A 3QK8A 4I52A 2F6QA 2C8TA 3M6NA 1Q51A 3STAA 3SWXA 3R6HA 5DUCA 3KQFA 1OD4A 2VSSA 3U9SB 3VIVA 5IKLB 3QMJA 1XX4A 1K32A 2FW2A 2FZSA 2X58A 1ON3A 1UYTA 4MXIA 4FZWA 3GKBA 3LAOA 4WZ8B 2VSSF 4JYJA 1DUBA 3MYBA 4WCZA 2VX2A 3KTHA 5CTBA 3U9TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JBX A;  2J5G D;  5DU4 A;  3Q1T A;  2J5G A;  5ING A;  5KDR B;  1UYR A;  4JOT A;  4JCQ A;  4FJW D;  4JJT A;  3R9T A;  4IZD A;  5G1R A;  3BEZ A;  2W3P A;  2BZR A;  1RJN A;  4ZDD A;  3GF7 A;  1TYF A;  2HW5 A;  3TVU A;  2IEX A;  2WTB A;  3T3W A;  3BPP A;  3TLF A;  3FDU A;  3HRX A;  1FC6 A;  4B3H A;  5E0S H;  3ISA A;  1PJH A;  3OT6 A;  5FIF A;  4JVT A;  2X24 A;  3T88 A;  3LKE A;  5DZK H;  2PPY A;  3QXZ A;  1UYV A;  4K29 A;  3ST9 A;  3BF0 A;  3GLM A;  2ZQR A;  2ZQQ A;  1WDM A;  3H02 A;  3L3S A;  1O8U A;  2ZL4 A;  4RYF A;  2VRE A;  4F47 A;  1ON9 A;  2J5I I;  1XO6 A;  3H0J A;  5E0N X;  3QKA A;  3H0U A;  5KDR A;  4HC8 A;  1PIX A;  4JCR A;  3KTJ A;  5MGB A;  4ZU2 A;  3V5I A;  2J5I B;  4B3I A;  4EMP A;  5DU6 A;  2QQ3 A;  5INI A;  5FUS A;  3PEA A;  4GM2 A;  5DU8 A;  1HZD A;  4DI1 A;  5G1Q A;  3T8A A;  3N6R B;  1SZO A;  4GHN A;  4FNB A;  1VRG A;  3OME A;  3P5M A;  2F9I B;  3TZ3 A;  2F9Y A;  4B3J A;  3V5E A;  3KTK A;  3DJA A;  3I47 A;  3QXI A;  3DOR A;  4OMR A;  3HP0 A;  4JCS A;  4MOU A;  3M6M A;  5CTC A;  1HNO A;  1FC7 A;  4JFC A;  5DTP A;  4WYO B;  5KJP A;  4LK5 A;  3R9Q A;  4QFE A;  1DCI A;  1NZY B;  4K3W A;  3Q0G A;  4JCT A;  2FBM A;  3MFM A;  2F9I A;  2A7K A;  5DUF A;  2VSU F;  5INF A;  3MT6 A;  1UYS A;  4FB8 A;  1MJ3 A;  2Q2X A;  3OC7 A;  3QYR A;  1YG6 A;  2DEO A;  4ZDE A;  4ZDC A;  3TV5 A;  3PE8 A;  3TRR A;  4KPK A;  3G64 A;  4IZC A;  3H0Q A;  2VSU A;  1XNY A;  2A81 A;  2Q35 A;  4I42 A;  3TT7 A;  4NEK A;  5DKP A;  4OLQ A;  2DUB A;  5DZK A;  3NJB A;  4ELW A;  1Y7O A;  4IZB A;  2F6I A;  2J5S A;  4ASI A;  2EJ5 A;  4FND A;  1UIY A;  1WDK A;  3P85 A;  2D3T A;  4EMM A;  4MI2 A;  4RYF H;  3ZW9 A;  4RCN A;  3PZK A;  3K50 A;  3TDC A;  2Q34 A;  3IB9 A;  5DL1 A;  1Q52 A;  3KTG A;  2PBP A;  3NJD A;  5C90 A;  1JXZ A;  3HIN A;  4JSB A;  1EY3 A;  5DTW A;  2NP9 A;  1SG4 A;  1XNV A;  1RJM A;  1NZY A;  4FN8 A;  2J5I A;  2CE3 A;  4QII A;  3FF6 A;  4K2N A;  3RSI A;  3T89 A;  1WDL A;  3GF3 A;  3R0O A;  4EML A;  3ZW8 A;  4KNP A;  1WZ8 A;  2PG8 A;  1TG6 A;  2ZL3 A;  4U18 A;  4FN7 A;  4FZW C;  4JYL A;  4Z0M A;  1K39 A;  3MOY A;  1HNU A;  4L6W A;  1N6D A;  3ZWC A;  3TT6 A;  4JWV A;  4L8K A;  4U1A A;  2F9Y B;  3H0S A;  5JBW A;  1FCF A;  3SLL A;  3IAV A;  3RST A;  4U0H A;  4G2R A;  4KD6 A;  3Q7H A;  3ZWA A;  5G1S A;  2VSU E;  4Q1I A;  3P2L A;  5E0S A;  1EF9 A;  1X0U A;  2A7S A;  2CBY A;  3QWD A;  3GMA A;  3T8B A;  3KTI A;  3PGQ A;  1J7X A;  1YG8 A;  3HLN 1;  4U19 A;  3QRE A;  4ELX A;  2VSS E;  4HNK A;  1FC9 A;  4ZDF A;  4ZDB A;  3JU1 A;  3HE2 A;  3RRV A;  4NNQ A;  1OD2 A;  1N6F A;  1W2X A;  4ELS A;  3Q0J A;  1EF8 A;  4OG1 A;  4YLH A;  3R9S A;  1N6E A;  4KWB A;  5C9G A;  4U0G H;  3WG5 A;  4Q0G A;  3IBB A;  3K8X A;  4QIJ A;  3ZWB A;  1XNW A;  2ZL0 A;  2GTR A;  2VSU C;  4U0G A;  3H81 A;  3U9R B;  4I4Z A;  2UZF A;  3TVW A;  2ZL2 A;  3QK8 A;  4I52 A;  2F6Q A;  2C8T A;  3M6N A;  1Q51 A;  3STA A;  3SWX A;  3R6H A;  5DUC A;  3KQF A;  1OD4 A;  2VSS A;  3U9S B;  3VIV A;  5IKL B;  3QMJ A;  1XX4 A;  1K32 A;  2FW2 A;  2FZS A;  2X58 A;  1ON3 A;  1UYT A;  4MXI A;  4FZW A;  3GKB A;  3LAO A;  4WZ8 B;  2VSS F;  4JYJ A;  1DUB A;  3MYB A;  4WCZ A;  2VX2 A;  3KTH A;  5CTB A;  3U9T B; 
#chains in the Genus database with same CATH topology
 5JBX A;  2J5G D;  5DU4 A;  3Q1T A;  2J5G A;  5ING A;  5KDR B;  1UYR A;  4JOT A;  4JCQ A;  4FJW D;  4JJT A;  3R9T A;  4IZD A;  5G1R A;  3BEZ A;  2W3P A;  2BZR A;  1RJN A;  4ZDD A;  3GF7 A;  1TYF A;  2HW5 A;  3TVU A;  2IEX A;  2WTB A;  3T3W A;  3BPP A;  3TLF A;  3FDU A;  3HRX A;  1FC6 A;  4B3H A;  5E0S H;  3ISA A;  1PJH A;  3OT6 A;  5FIF A;  4JVT A;  2X24 A;  3T88 A;  3LKE A;  5DZK H;  2PPY A;  3QXZ A;  1UYV A;  4J2U A;  4K29 A;  3ST9 A;  3BF0 A;  3GLM A;  2ZQR A;  2ZQQ A;  1WDM A;  3H02 A;  3L3S A;  1O8U A;  2ZL4 A;  4RYF A;  2VRE A;  4F47 A;  1ON9 A;  2J5I I;  1XO6 A;  3H0J A;  5E0N X;  3QKA A;  3H0U A;  5KDR A;  4HC8 A;  1PIX A;  4JCR A;  3KTJ A;  5MGB A;  4ZU2 A;  3V5I A;  2J5I B;  4B3I A;  4EMP A;  5DU6 A;  2QQ3 A;  5INI A;  5FUS A;  5HUQ A;  3PEA A;  4GM2 A;  5DU8 A;  1HZD A;  4DI1 A;  5G1Q A;  3T8A A;  3N6R B;  1SZO A;  4GHN A;  4FNB A;  1VRG A;  3OME A;  3P5M A;  2F9I B;  3TZ3 A;  2F9Y A;  4B3J A;  3V5E A;  3KTK A;  3DJA A;  3I47 A;  3QXI A;  3DOR A;  4OMR A;  3HP0 A;  4JCS A;  4MOU A;  3M6M A;  5CTC A;  1HNO A;  1FC7 A;  4JFC A;  5DTP A;  4WYO B;  5KJP A;  4LK5 A;  3R9Q A;  4QFE A;  1DCI A;  1NZY B;  4K3W A;  3Q0G A;  4JCT A;  2FBM A;  3MFM A;  2F9I A;  2A7K A;  5DUF A;  2VSU F;  5INF A;  3MT6 A;  1UYS A;  4FB8 A;  1MJ3 A;  2Q2X A;  3OC7 A;  3QYR A;  1YG6 A;  2DEO A;  4ZDE A;  4ZDC A;  3TV5 A;  3PE8 A;  3TRR A;  4KPK A;  3G64 A;  4IZC A;  3H0Q A;  2VSU A;  1XNY A;  2A81 A;  2Q35 A;  4I42 A;  3TT7 A;  4NEK A;  5DKP A;  4OLQ A;  2DUB A;  5DZK A;  3NJB A;  4ELW A;  1Y7O A;  4IZB A;  2F6I A;  2J5S A;  4ASI A;  2EJ5 A;  4FND A;  1UIY A;  1WDK A;  3P85 A;  2D3T A;  4EMM A;  4MI2 A;  4RYF H;  2YJG A;  3ZW9 A;  4RCN A;  3PZK A;  3K50 A;  3TDC A;  2Q34 A;  3IB9 A;  5DL1 A;  1Q52 A;  3KTG A;  2PBP A;  3NJD A;  5C90 A;  1JXZ A;  3HIN A;  4JSB A;  3BPT A;  1EY3 A;  5DTW A;  2NP9 A;  1SG4 A;  1XNV A;  1RJM A;  1NZY A;  4FN8 A;  2J5I A;  2CE3 A;  4QII A;  3FF6 A;  4K2N A;  3RSI A;  3T89 A;  1WDL A;  3GF3 A;  3R0O A;  4EML A;  3ZW8 A;  4KNP A;  1WZ8 A;  2PG8 A;  1TG6 A;  2ZL3 A;  4U18 A;  4FN7 A;  4HDT A;  4FZW C;  4JYL A;  4Z0M A;  1K39 A;  3MOY A;  1HNU A;  4L6W A;  1N6D A;  3ZWC A;  3TT6 A;  4JWV A;  4L8K A;  4U1A A;  2F9Y B;  3H0S A;  5JBW A;  1FCF A;  3SLL A;  3IAV A;  3RST A;  4U0H A;  4G2R A;  4KD6 A;  3Q7H A;  3ZWA A;  5G1S A;  2VSU E;  4Q1I A;  3P2L A;  5E0S A;  1EF9 A;  1X0U A;  2A7S A;  2CBY A;  3QWD A;  3GMA A;  3T8B A;  3KTI A;  3PGQ A;  1J7X A;  1YG8 A;  3HLN 1;  4U19 A;  4NAR A;  3QRE A;  4ELX A;  2VSS E;  4HNK A;  1FC9 A;  4ZDF A;  4ZDB A;  3JU1 A;  3HE2 A;  3RRV A;  4NNQ A;  1OD2 A;  1N6F A;  1W2X A;  4ELS A;  3Q0J A;  1EF8 A;  4OG1 A;  4YLH A;  3R9S A;  1N6E A;  4KWB A;  5C9G A;  4U0G H;  3WG5 A;  4Q0G A;  3IBB A;  3K8X A;  4QIJ A;  3ZWB A;  1XNW A;  2ZL0 A;  2GTR A;  2VSU C;  4U0G A;  3H81 A;  3U9R B;  4I4Z A;  2UZF A;  3TVW A;  2ZL2 A;  3QK8 A;  4I52 A;  2F6Q A;  2C8T A;  3M6N A;  1Q51 A;  3STA A;  3SWX A;  3R6H A;  5DUC A;  3KQF A;  1OD4 A;  2VSS A;  3U9S B;  3VIV A;  5IKL B;  3QMJ A;  1XX4 A;  1K32 A;  2FW2 A;  2FZS A;  2X58 A;  1ON3 A;  1UYT A;  4MXI A;  4FZW A;  3GKB A;  3LAO A;  4WZ8 B;  2VSS F;  4JYJ A;  1DUB A;  3MYB A;  4WCZ A;  2VX2 A;  3KTH A;  5CTB A;  3U9T B; 
#chains in the Genus database with same CATH homology
 5JBX A;  2J5G D;  5DU4 A;  3Q1T A;  2J5G A;  5ING A;  5KDR B;  1UYR A;  4JOT A;  4JCQ A;  4FJW D;  4JJT A;  3R9T A;  4IZD A;  5G1R A;  3BEZ A;  2W3P A;  2BZR A;  1RJN A;  4ZDD A;  3GF7 A;  1TYF A;  2HW5 A;  3TVU A;  2IEX A;  2WTB A;  3T3W A;  3BPP A;  3TLF A;  3FDU A;  3HRX A;  1FC6 A;  4B3H A;  5E0S H;  3ISA A;  1PJH A;  3OT6 A;  5FIF A;  4JVT A;  2X24 A;  3T88 A;  3LKE A;  5DZK H;  2PPY A;  3QXZ A;  1UYV A;  4J2U A;  4K29 A;  3ST9 A;  3BF0 A;  3GLM A;  2ZQR A;  2ZQQ A;  1WDM A;  3H02 A;  3L3S A;  1O8U A;  2ZL4 A;  4RYF A;  2VRE A;  4F47 A;  1ON9 A;  2J5I I;  1XO6 A;  3H0J A;  5E0N X;  3QKA A;  3H0U A;  5KDR A;  4HC8 A;  1PIX A;  4JCR A;  3KTJ A;  5MGB A;  4ZU2 A;  3V5I A;  2J5I B;  4B3I A;  4EMP A;  5DU6 A;  2QQ3 A;  5INI A;  5FUS A;  5HUQ A;  3PEA A;  4GM2 A;  5DU8 A;  1HZD A;  4DI1 A;  5G1Q A;  3T8A A;  3N6R B;  1SZO A;  4GHN A;  4FNB A;  1VRG A;  3OME A;  3P5M A;  2F9I B;  3TZ3 A;  2F9Y A;  4B3J A;  3V5E A;  3KTK A;  3DJA A;  3I47 A;  3QXI A;  3DOR A;  4OMR A;  3HP0 A;  4JCS A;  4MOU A;  3M6M A;  5CTC A;  1HNO A;  1FC7 A;  4JFC A;  5DTP A;  4WYO B;  5KJP A;  4LK5 A;  3R9Q A;  4QFE A;  1DCI A;  1NZY B;  4K3W A;  3Q0G A;  4JCT A;  2FBM A;  3MFM A;  2F9I A;  2A7K A;  5DUF A;  2VSU F;  5INF A;  3MT6 A;  1UYS A;  4FB8 A;  1MJ3 A;  2Q2X A;  3OC7 A;  3QYR A;  1YG6 A;  2DEO A;  4ZDE A;  4ZDC A;  3TV5 A;  3PE8 A;  3TRR A;  4KPK A;  3G64 A;  4IZC A;  3H0Q A;  2VSU A;  1XNY A;  2A81 A;  2Q35 A;  4I42 A;  3TT7 A;  4NEK A;  5DKP A;  4OLQ A;  2DUB A;  5DZK A;  3NJB A;  4ELW A;  1Y7O A;  4IZB A;  2F6I A;  2J5S A;  4ASI A;  2EJ5 A;  4FND A;  1UIY A;  1WDK A;  3P85 A;  2D3T A;  4EMM A;  4MI2 A;  4RYF H;  2YJG A;  3ZW9 A;  4RCN A;  3PZK A;  3K50 A;  3TDC A;  2Q34 A;  3IB9 A;  5DL1 A;  1Q52 A;  3KTG A;  2PBP A;  3NJD A;  5C90 A;  1JXZ A;  3HIN A;  4JSB A;  3BPT A;  1EY3 A;  5DTW A;  2NP9 A;  1SG4 A;  1XNV A;  1RJM A;  1NZY A;  4FN8 A;  2J5I A;  2CE3 A;  4QII A;  3FF6 A;  4K2N A;  3RSI A;  3T89 A;  1WDL A;  3GF3 A;  3R0O A;  4EML A;  3ZW8 A;  4KNP A;  1WZ8 A;  2PG8 A;  1TG6 A;  2ZL3 A;  4U18 A;  4FN7 A;  4HDT A;  4FZW C;  4JYL A;  4Z0M A;  1K39 A;  3MOY A;  1HNU A;  4L6W A;  1N6D A;  3ZWC A;  3TT6 A;  4JWV A;  4L8K A;  4U1A A;  2F9Y B;  3H0S A;  5JBW A;  1FCF A;  3SLL A;  3IAV A;  3RST A;  4U0H A;  4G2R A;  4KD6 A;  3Q7H A;  3ZWA A;  5G1S A;  2VSU E;  4Q1I A;  3P2L A;  5E0S A;  1EF9 A;  1X0U A;  2A7S A;  2CBY A;  3QWD A;  3GMA A;  3T8B A;  3KTI A;  3PGQ A;  1J7X A;  1YG8 A;  3HLN 1;  4U19 A;  4NAR A;  3QRE A;  4ELX A;  2VSS E;  4HNK A;  1FC9 A;  4ZDF A;  4ZDB A;  3JU1 A;  3HE2 A;  3RRV A;  4NNQ A;  1OD2 A;  1N6F A;  1W2X A;  4ELS A;  3Q0J A;  1EF8 A;  4OG1 A;  4YLH A;  3R9S A;  1N6E A;  4KWB A;  5C9G A;  4U0G H;  3WG5 A;  4Q0G A;  3IBB A;  3K8X A;  4QIJ A;  3ZWB A;  1XNW A;  2ZL0 A;  2GTR A;  2VSU C;  4U0G A;  3H81 A;  3U9R B;  4I4Z A;  2UZF A;  3TVW A;  2ZL2 A;  3QK8 A;  4I52 A;  2F6Q A;  2C8T A;  3M6N A;  1Q51 A;  3STA A;  3SWX A;  3R6H A;  5DUC A;  3KQF A;  1OD4 A;  2VSS A;  3U9S B;  3VIV A;  5IKL B;  3QMJ A;  1XX4 A;  1K32 A;  2FW2 A;  2FZS A;  2X58 A;  1ON3 A;  1UYT A;  4MXI A;  4FZW A;  3GKB A;  3LAO A;  4WZ8 B;  2VSS F;  4JYJ A;  1DUB A;  3MYB A;  4WCZ A;  2VX2 A;  3KTH A;  5CTB A;  3U9T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...