3HP1A

Crystal structure of human dck r104m/d133a in complex with l-dt and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
226
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Extending Thymidine Kinase Activity to the Catalytic Repertoire of Human Deoxycytidine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 226
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hp1A00
2ZUDA 2NGRA 4TTQA 3ZVRA 4DLTA 1OHHD 4JLPA 3T5DA 2JLUA 1TF2A 3BORA 4DT1B 1AZSC 3K0AB 4NYIQ 5JRJA 3BRWD 1SHZA 2PMDA 1XPRA 3TW8B 4KLNA 1YHNA 2BC9A 2VSXA 1XMJA 3AP3A 4BFXA 3KTAB 1RC8A 2B7BA 3UPUA 1ESNA 4DLZA 2A5YB 2MMGA 5E7IA 1M1YE 1FP6A 4CGZA 1IM2A 1P2VA 2BCJQ 4Q4HB 5FOWA 1BKDR 5L3SB 3K70B 4AKEA 1XPOA 2ZITA 5FBWB 1DG3A 1R0ZA 4V0ME 1YZNA 4NP6A 3B2EA 5JCPA 2ZM5A 1CTQA 3K53A 4NCNA 1KO8A 1UBGA 1W2HA 3B1VA 4XVUA 5IK2D 3BB3A 3THXA 3THYA 4JLJA 1Q3HA 5EP1A 1IN6A 1T8TA 1TQ4A 4AI6A 2UZ3A 4BLOA 2RGEA 3P26A 1M8PA 1JJ7A 2ECKA 1WP9A 1W44A 3EZ2A 2OLKA 2J46A 4NBSA 4CYMA 1Z0FA 2WWFA 2CHGA 2DCUA 2XTMA 4U5XA 1KSJA 5FTKA 4UXIA 1E1RD 2ZYUX 3DOFA 4D25A 3BH0A 1S9HA 1ZC4A 2PEZA 2I4IA 4UNPA 2OXRA 1YZKA 2VH5R 4MUAA 3DOEA 4OHZA 1FTNA 2C98A 3PUXA 1W0JD 1FMLA 3T34A 2H8KA 1ODFA 4C3ZA 1DG1G 1N5IA 4CEIB 2BBTA 2ZSEA 4Q1EA 4Q4JA 5IRCD 2O8BB 3TAUA 3EPHA 2RGNA 1Z47A 1G64A 3NH9A 4UNQA 1E9CA 1JR3E 1G3RA 1VCMA 1W0KD 1IN8A 3WBKA 4C7OB 1SVIA 2XZOA 4IRUB 4OQMA 2QMOA 3MJHA 4JLVA 1MO5A 2BBWA 3OZXA 2GJ8A 3FFAA 5EE9A 5FR2A 1T6NA 1XWIA 5J4VA 3LVQE 1A2KC 3AVOA 3OHMA 5CYOA 4QXAA 4NCIA 4P3YA 3K70C 1DE0A 1U8ZA 3ZVLA 2F3TA 3NEYA 2VL7A 3PENA 3TUJC 2ZEJA 1ZM9A 2QMEA 2ZJ2A 4F38A 2VP6A 4ZKEA 2IEZA 3WNBA 5JJLA 4LPKA 4ZCLA 5JWHA 4HAUA 2FSIA 4A9AA 4NYJR 1WQ1R 4Z1MA 4FMDF 2QGNA 3IHWA 4K8OA 4A8JB 3RABA 4I4LA 1N0UA 2PJRA 2ZI3A 2ZR9A 3L43A 3BGWA 3BOSA 4AY2A 4JT4A 3SR0A 5FPKA 1CRPA 4GZLA 3GEEA 1K8RA 5DYIA 1JPNA 4N0DA 4PC7A 5G40A 5JEDA 3DEFA 4IKEA 2UZIR 3CH4B 2A30A 2IYTA 3VR6A 4D0NA 1E1QA 5EZ6B 4M0LA 5EUMA 1NN5A 4GZMA 3ZZ0A 3O8RA 4M9SA 2O0JA 4LJ7A 5CLQA 3W34A 5JFGA 2VHJA 4OQNA 2ZVQX 2NO6A 3TAHA 1KKLA 3ZH9B 2GXQA 1EG7A 521PA 1MO4A 3U2QA 1Z22A 1OXUA 1G3UA 1U9IA 1CXZA 4D4LA 3FKSD 4DB2A 3KZ1E 3GJ3A 5DIFA 5BYJA 2IUUA 1XCMA 3WP0A 2ZRAA 4E5UA 1XEXA 1PJRA 1RVDA 1GZSA 1HA3A 1TEXA 3A4LA 4FI3C 1GNQA 3PEUA 4AWXA 1QDEA 5L3RA 2V7QA 1S96A 1ZYUA 5FR1A 3R8FA 2IYUA 1E9AA 1NG1A 3RS7A 3LNCA 1G17A 1NMYA 2Z83A 1F6BA 2BWJA 4BZPA 1OIXA 1UBCA 2FFHA 4HUQA 4Q4AB 3F5FA 3QVVA 1IN5A 4DCNA 1V43A 4V0KA 1P9RA 1VTKA 2PEYA 2OE2A 2R2AA 1KY2A 1P2UA 4HLUA 4ZDJA 2CVHA 4AG5A 3P1JA 4RKEA 1NF3A 3NH6A 1UJ2A 4E07A 4GP6A 2QQ0A 3IIMA 1S8FA 4JLOA 1H8HA 2GJSA 4RZ2A 5F3WB 1XB2A 2J3EA 4A8JC 1M7HA 2JDIA 5SZKB 3LDAA 2A2ZA 3OFND 4C0HA 1P75A 1KK1A 5KSYA 4LC0A 4PPFA 4Q1DA 4DIDA 2HYDA 4F93B 1EX6A 2ZYWX 1U2RA 5DHAA 5AUPB 5FPTA 4V0LA 3LD9A 5TY0A 5A0FA 4CEHA 1AKYA 2F9LA 2BOVA 3CX6A 4PHFA 3NDBB 3QENA 2ERYA 4L5BA 2CHQA 3X1YA 3N5CA 2X2EA 4PZZA 2J1LA 2FMXA 4YDSA 2ZSBA 3K9LA 3BK7A 2DPXA 3THXB 3THYB 4OI0A 4TMZA 1VG9B 3GJ0A 3Q5DA 5BXQC 2V3CC 2XX3A 3FGNA 2VP5A 1YQTA 2GVZC 3RC8A 2HXSA 1E69A 3CRQA 4M1SA 4B33A 2OFWA 3KUDA 1G7CA 3IGFA 4LHZA 1AS2A 1SULA 3RWMB 3TVTA 1YR7A 3MLEA 5FPYA 5FFMA 1IY2A 2X19A 1FPMA 2Z6VA 1KO7A 1DPFA 1SVLA 2WOOA 2XSZA 2OCPA 2R6AA 2VBCA 2V1XA 1NN1A 2FNAA 4MYHA 2ODEA 1KO5A 1W48A 3BH6A 2FN4A 4CRWB 5KDOA 1EWRA 3QUSA 4I1OA 4AKIA 4IVRA 1LS1A 2F3RA 4B71A 2IUSA 1Z83A 4KI0A 3R9IA 2J59A 1IOZA 1B0UA 2HDNB 2R8RA 3AKEA 4DDTA 3W6NA 5H68A 3CW2A 4PC3A 4FCVA 1AGPA 3SJAA 4DSTA 4TL6A 3WRYC 2Q21A 3U6KA 2ZU6A 3LW8A 4MITA 1QHNA 3FWYA 2G88A 2QORA 1GNPA 2R6FA 2YZ2A 4LC1A 1NLZA 4Y0AA 4GT1A 2Q3HA 3LAWA 1OHHA 3TSOA 1WBBA 2ZS9A 2HEIA 4A2QA 1OH5A 4IOJA 1RRPA 3AVUA 1ZD9A 4R98A 2QTFA 1T3HA 1E96A 4LJ5A 4KLZA 2G77B 2YV5A 3LX5A 3GLIA 1M7GA 5E7JA 4DHEA 2O8CA 1Z0IA 1CJVC 2OAQ1 3C41J 4Q9LA 2R65A 1FNMA 2CNWD 3RHFA 1J99A 1G4AE 1Z2AA 1G9XA 8OHMA 2HXYA 1I2MA 5TARA 5JEEA 1IBRA 1I2DA 1M34E 2P67A 4ZKDA 3GLFE 5DO9A 2FG5A 1KK3A 3QQ5A 5IHPA 3IIJA 4M1YA 1UEJA 4HI0E 5EE0A 1NJGA 4OHYA 3SFVA 3ND9A 2F1RA 3R8CA 2WVJA 3OESA 2GZDA 2OCBA 4LX0A 2QROA 1N6PA 4TYPA 4TYWA 1L4YA 1OFHA 2IXGA 4PPGA 2FWRA 2QG6A 1SVOA 4MGIR 1VKJA 2F43A 3LXRA 1S0UA 3CPJB 4NONA 4I1UA 2FU5C 4WW0A 2GHIA 5FPSA 3R9XA 1KZGB 1W46A 2QM7A 1XEXB 2W2XA 2C77A 3TUIC 2IYYA 2V9PA 4JSTA 3QG5A 3SU8A 4M9XA 1R5BA 5GJCA 3SS8A 1WBDA 1JAHA 1KO4A 2H1LA 3OF5A 1E2PA 4C30A 4BFUA 4GL2A 3L0OA 2PH1A 4PC6A 2CDNA 2ZS8A 3KQLA 1TQ2A 1X8KA 1W36D 4V02A 3T61A 4X8HA 2ZI6A 4HUQB 5FOTA 5P21A 1KSGA 1SQ5A 1TF7A 2W58A 5KTYA 1XPUA 4NH0A 4CIDA 1OKKD 2VYFA 1WDTA 2FPLA 3U7GA 4GPTA 3PUZA 2QA5A 2IW3A 4Z8XA 1WMSA 2J0VA 3K09C 1GKIA 1HUQA 2CE7A 2ZRDA 2FJUA 2AHOA 1W0KA 1YU9A 3OEEA 3PV0A 1WE2A 4PPQA 1Z0KA 1HQCA 4C2TA 2IWRA 3NXSA 1U8AA 2F1JA 4HYYA 5JHHB 1SXJE 2GBLC 1Q44A 1ZW6A 3FVQA 3I61A 2C9YA 4PSVA 4LI0A 4RFVA 4RD2A 4DEYA 2OBNA 3CRMA 4TLDA 4WVFA 3RS2A 4CEHB 1CS4C 1E2FA 1Q1EA 1XTSA 1FMJA 1ZINA 2ZYVX 1E0AA 4N3NA 1A5TA 1OXXK 1OIVA 3IQWA 1OPXA 2GA8A 4AK9A 2NTYC 2V6JA 3GLHE 4IVQA 4B43A 4M22A 1Z08A 3DVLA 5TMPA 4ZCMA 2YJTD 2ZRMA 4LJ9A 4N0EA 2HUPA 2JJ2D 5H1YA 4Z51A 3LLMA 3EC2A 2QE7D 4C0LA 2JLRA 1Y63A 5EXSA 4Q9IA 4QBGB 2DFLA 4MYCA 4NL4H 4GBMA 3AB3A 4PAOA 3ZZUA 1MABA 1KDRA 2P0EA 4YMTA 2GXUA 5L3QB 2GAOA 1GRRA 2NMVA 2ZSAA 2O8DB 2CCGA 2WSMA 2ZU0C 1EGAA 2VSFA 1K6MA 4TLEA 3GPLA 3BS4A 4JJKA 2H7VA 5IDVA 3IEUA 4HLUC 3OE7D 1HTWA 4B3DA 1IONA 4BFYA 1Z0AA 5F2EA 4P0TA 4L9SA 1NRJB 2P6RA 3CF0A 4D80A 3OAAA 3PCRB 1E9BA 4KAXA 2V54A 3ZIAA 1CEEA 4RZXA 2P3SA 3BJIC 3D8BA 4PHGA 3U44A 5FOUA 2WJIA 1U90A 1NLYA 1YZLA 3WYFA 4DUGA 1NNEA 5KYKA 2GCOA 1N6KA 1OXVA 2P65A 2VEDA 4W5JA 4LCBA 5HCIA 5CITA 5JS8A 4PAQA 1TQDA 2ZJYA 4US0R 3UMSA 4DVGA 4QNMA 4Q19A 1AGRA 3LY5A 2XNDD 3DKPA 1YR6A 4P4TA 1OXSC 4HB0A 4GDFA 4C0BA 1JR3D 1VHTA 2Z4SA 3IPXA 3AF1A 3EX7C 2YHSA 4M9QA 1Z8FA 3RSOA 5EQTA 1DTSA 3PJRA 4HAXA 1GP2A 5JMTA 2BIFA 2DWPA 2ZI9A 4DLYA 1OH6A 2KWIA 2VIIA 2V6IA 2ZAOA 4D26A 4IEIA 2O8CB 3H0KA 1P61B 4HZIA 1XMIA 1TEVA 2J7KA 2ODNA 4IHQA 5KDLA 1E32A 2B6HA 2JASA 3GLGB 1TAGA 3QKSB 2AWOA 3D3QA 1O87A 4Q4LA 4WXPA 4CEJA 2DYKA 3NVAA 2X2FA 2NPFA 4DKXA 3L8ZA 2JLSA 2P6UA 2GEUA 4DSNA 5DN6D 2ZE7A 5IT5A 4F4CA 4C0JA 4UKDA 3JZMA 4OI2A 2B21A 1EFUA 1KTVA 4X8MA 1NLFA 1E99A 4ON9A 3R7WB 2AD5A 2DWQA 5FI1B 2F43B 4HAWA 3FE2A 3C8UA 1E4YA 1XRJA 3FMFA 4XTCS 3TLXA 2XXAB 3BH7A 1F48A 1UKEA 1XEFA 4TL8A 3JVVA 4HDCA 2EWWA 1DS6A 1EFRA 1D2NA 3DM5A 1UDXA 3NBXX 2EFDB 1TPZA 1XD9A 2OEPA 5E3HA 4YXWD 3EW9A 4JSYA 4Z1MD 4C9BA 1ZNZA 4Q9HA 4HUTA 5BN3A 4B48A 5IF9A 2CJWA 4G5GA 1Z0DA 1G16A 1YVDA 2N42A 1ONBA 2G1JA 2ONKA 3Q85A 4JMPA 4W9MC 1CR2A 2BMJA 2VRWA 3SQWA 1JR6A 4M1KA 1L2TA 2EFCB 3CNOA 2ZETA 2H17A 2WJYA 3P20A 4MKHA 4BWYA 4GI7A 2OBMA 2Q3MA 2OFOA 3IKJA 5FTNA 1F3OA 2W2TA 4Q1AA 3X2SA 1KI9A 4W7SA 2D74A 1CF4A 1OW3B 2GK6A 2J0SA 1ZBDA 3CPEA 4MRRA 2JLWA 3JZAA 1R8QA 2Q0HA 3CO5A 2QTVB 3S1AB 3QEOA 1AZTA 4BEJA 4L8GA 5K8LA 1YZUA 2OO7A 4M9ZA 2FZ4A 4QHTA 3KKMA 1JNYA 4A0FA 2FFBA 2I1QA 1CRQA 4RCYA 3KDSE 4LHXA 1G6OA 5DHFA 4BZXA 4EFLA 4LBVA 4B47A 3FB4A 1JXOA 1F2TA 1U0LA 3C5CA 4DWJA 3LWNA 1P2SA 3UANA 1G8GA 5LBIA 2G0TA 1YZTA 3EIEA 4EJSA 3CRVA 3VR4A 5D3QA 1HE1C 3UXMA 1OT3A 4G01B 1AM4D 2W6JA 3A1UA 3NBZC 5CDFE 3CB4A 5L3VA 1J8MF 3HPQA 1A1VA 1GIAA 5DSZA 4JBYA 4V0OA 5LD2B 3N2IA 2YWHA 4ZPXA 1WA5A 1TMKA 3KB1A 2QENA 2NO1A 3B7GA 1FP7A 4RCZA 2QUZA 1QZXA 3THWA 2ZJ8A 2X1VA 1IY1A 3AF4A 4XTRA 4BE7B 2DFNA 4MKGA 3VKHA 2RB4A 2FPKA 4P4UA 1XXHE 4ZDKA 1R0WA 5L8VA 2JLYA 2XB2A 1OLOA 4TL9A 1WXQA 1US8A 4KFSA 4HB3A 4DLWA 2CL6X 1W4BA 4CVNA 2GCOB 4PQYA 4M2LA 1SVKA 3LQRA 2ZRJA 3A4NA 2VHCA 1HE8B 3OIWA 3CF2A 3WY9A 5AUNB 2Z5FA 4F91B 1DAKA 1WRBA 1N6LA 4NCHA 4DDVA 3RS0A 3IDQA 1XMVA 4M1OA 1EESA 4RZUA 1PLJA 4HLDA 3NBFA 3K9HA 2V8OA 3THOA 1AIPA 2NG1A 4NU0A 1OKKA 2NZ8A 2OG2A 1BS1A 1KI6B 1IJFA 1E98A 5JZVA 1UAAA 1VHLA 2PJZA 3VQTA 1JI0A 2Q9BA 4IFBA 3I92A 4TSFA 4KVGA 2GETA 2HF9A 3KJEA 1ZVQA 3AEZA 4NCJA 3TQFA 2IF2A 3NHBA 2XZPA 5LD2C 2BMEA 2GESA 4CF7A 1Q20A 1YRAA 4CEJB 4W5HA 4AC9A 2B8TA 2KI5A 1LTQA 3CRW1 3BBPA 1U8YA 3RS5A 4QRHA 3QOFA 5FL7A 1D2MA 5CK5A 2VLIA 2ZI4A 3ASYA 3RRMA 1PUJA 1MO6A 3PUYA 4KBFA 4UNNA 1E4VA 3U4QA 3PEYA 1KI1A 3LFUA 4XH9B 2JJ2A 1A82A 2QP9X 2O0KA 2QGZA 2QE7A 1GDDA 1XD8A 3ADKA 2HLDD 4B2IA 2JJ1D 4MQBA 4V0MA 2IX3A 4DCTA 2GK7A 4YDHB 1NIPA 2ORIA 4JJZA 1FZQA 2CJWB 2FA9A 4IOKA 3GP8A 5FUWA 4JYBA 3HR8A 5F98A 1M6NA 3B1XA 2AXNA 4LBWA 4BRWA 3KXIA 3OE7A 5TB5A 4Q7LA 4A2PA 4JL6A 2DR3A 2ATXA 2V55B 3QKRA 1AK2A 1MRSA 3LXXA 3N70A 5KNBA 2RGBA 1CBUA 3ZLJA 1BYIA 1E2DA 1E0KA 4CT4B 3I5YA 3D31A 1NKSA 3SE0A 3GJ7A 5FBQB 1TUEA 3CBQA 4MGZR 2NO0A 1OFTA 1Q57A 1IAQA 2CK3A 5K8UA 2ZRGA 2GAAA 1BMFA 4NMMA 2ZRLA 3V4FA 3I62A 1UADA 1VECA 2OESA 3W8RA 1XD2B 1I4DD 4RD1A 3I3SR 5LDDC 2XNDA 5KDDA 4C0QC 1EFTA 1JR3A 3P32A 4KYUA 4EQ6A 2ERXA 3B1ZA 2VA8A 3RNLA 3EZ6A 1KSFX 1DO2A 1SVMA 2QZ4A 3GJ4A 1O3YA 1QHXA 1QG2A 3LQQA 4A0GA 3NEJA 5AUOB 4EJSB 2QU8A 1X6VA 1E2NA 3KQNA 2EWVA 3QF4A 4QNRA 1GKYA 2R6DA 4RD6A 4BFSA 3RRYA 4MDEA 4WZ6A 5KNCA 1KMHB 5EJEA 1E2JA 3CX8A 3T15A 4R71A 1C4OA 5HZHA 1PLLA 721PA 1X1RA 3OEED 1D9ZA 1ZP6A 2FFAA 1BIFA 4IOLA 3UIEA 4D82A 2JLVA 1E9DA 5DN6A 4RKFA 2Q3FA 4PZLA 4DSOA 1V5WA 3KUCA 1E0SA 2O0HA 3LLUA 1G8FA 3X1WA 2NOAA 3KKOA 3SQXA 1ZNYA 5TV2A 1US8B 1IN4A 1ZRHA 2FF7A 3RC3A 2AXPA 4E09A 2J41A 1DADA 1UBFA 1ZC3A 4U02A 2QAJA 3WMGA 2CLSA 1N6IA 1VYVA 4YXWA 5KUTA 2PL3A 3EZFA 5JWOA 1KGDA 4URYR 3AV0B 5AJVB 2RAPA 1W36B 2A3RA 1HURA 1RE0A 1RRGA 1S2MA 3QJYA 1UKYA 3DKVA 3EPKA 3TSWA 2CE2X 2OUKA 4UNSA 4LYHA 1GM5A 1XTQA 2XJ4A 3MRSA 3DZDA 1KK2A 4GOJA 3M6AA 4Y0VA 2RGAA 2WIAA 2QSZA 4EJSC 4B35A 3RS4A 2Z4RA 2ZJZA 4I1SA 4OHVA 4TT3A 4XIGS 3EPLA 1JQJC 3MWLA 4IFEA 4LBYA 5FI0B 3CH5A 5GJBA 3OAAD 1OJLA 3QBVA 1EFHA 2Z0MA 3ZIAD 3IEVA 3IBGA 3MWKA 2FV8A 1E9RA 3K0SA 4NE2A 1T3SA 5SZJA 4DUGD 3SDZA 1G7TA 3AVQA 3EWSA 2R6GA 1KHTA 1GL6A 5KHOC 1NJFA 3REFA 4URXR 1JEDA 1F2UB 1IQPA 3AVXA 3L8YA 1AJEA 3SYLA 5GADl 3UATA 1N5JA 4QJ4A 2VTKA 3VR1A 1RZ3A 2AKAB 3CIOA 4PXAA 2X77A 1II0A 4GSYA 3TQCA 3EC1A 1SKYB 1OIWA 1QRAA 2C95A 3Q72A 4Q9JA 1GSIA 4D4JA 4ESHA 3CWQA 3H1TA 3K1JA 5JECA 4TQUS 2QPOA 1E9SA 1E9FA 1LW7A 4NHOA 1RPZA 4FWIB 4C0KA 5KSZA 4P31A 1E9EA 1XX6A 2WWWA 3Q9LA 3A1WA 3AVVA 1W36C 1GVNB 2OAP1 3EASA 2W2VA 5FPHA 4FMDB 3MGCA 4BFTA 3AKDA 3SZRA 4M1WA 5CLLA 2IYVA 3GJ6A 5DI9A 2D06A 1ZUNB 2WOJA 3FHCB 4M1MA 5KO2A 3B85A 1P7CA 3PVSA 5FUYA 3QPUA 4PAMA 3RS3A 4I81A 4GFDA 4BEBA 4EPWA 4UNRA 3SNHA 4O0MA 3PXGA 3K0CA 4Q1CA 4JVLA 4AG6A 4Q18A 5DISB 3T1TA 1EK0A 2GZAA 1GTVA 1GITA 1PLKA 3K0FA 4YONB 3E5HA 4MRSA 3W3ZB 1XF9A 2YWEA 2W0SA 4QJ3A 2QRZA 4OJKA 1G8PA 4CZ2A 5C46F 1G7RA 4XD7A 3TIFA 2QL6A 4OJQA 4JVMA 2ZJAA 2PT5A 5FH9A 1EFRD 1M2OB 4FXPA 4Q1BA 4C0AC 4EQ6B 1UFQA 1RW4A 2RHDA 4FCWA 4Q47A 2RGCA 2ZRBA 2IUTA 3AGQA 1X8JA 3Q3JB 4JKIA 4B6FA 2QN6A 3FPAA 1Z63A 5JJIA 2NPIA 3SJCA 2YNMA 1HT2E 1TL7C 3PUWA 1NP6A 1F60A 4QL3A 5J4KA 3QBTA 2WBLC 4A36A 1CKEA 1LFDB 1D9XA 1X86B 2FOLA 2OZEA 4JZKA 4Q4JB 4DLSA 2N46A 3BWDD 3ADCA 4H9GA 1HEIA 5BQ5A 3LA6A 1E2EA 1YJ5A 1J2JA 5KOYA 4MDFA 4B6EA 1T0JB 3BERA 3UKDA 1CU1A 2HJGA 3IILA 1GL9B 2ODBA 1W2GA 2GNOA 3T1QA 1XU4A 4ZDWA 3ADBA 2EVWX 1ETUA 3B60A 1PV4A 4QBFA 2TMKA 4JLNA 3GLFA 1KDTA 2LCFA 3NC1C 1FL9A 3NDPA 1MH1A 2L0XA 2N1BA 2W6IA 3KJIA 5AJXA 2HLDA 1UF9A 2ZE6A 2OXCA 2JJ1A 3NWJA 4M1TA 3VKWA 3TMKA 3WXMA 1NN3A 2EYUA 3SI7A 3VAAA 2YWFA 1T5LA 1D6JA 2E1RA 2H92A 1ANKA 3A58B 4HAVA 3LH5A 2OSBA 2AK2A 2W6JD 3Q5EA 2FSFA 1MKYA 3Q8XB 3O8BA 3SYKA 5B64A 2YOGA 3AM1A 2H57A 4MRNA 5EE3A 2IYZA 2RMKA 3QKUA 1LF0A 3VMFA 1YR9A 5C4GB 2ZRKA 4LJ6A 1TADA 1YZQA 4K81B 2O5VA 3VFDA 1H65A 3RWOA 3QXHA 2RGNC 4LDJA 3T06B 1EX7A 4ARZA 4KU4A 1Z5ZA 5DH9A 4B73A 3ADDA 2IK8A 3FTQA 3RVBA 3BAFA 2GF0A 3C5HA 1KYIA 2QT1A 2XNSA 3PITA 4C4PA 1GRNA 1N5LA 4O25A 3BB1A 3RRNA 2O8EA 1P5ZB 2GKSA 3PG5A 3KQHA 2GDJA 3PFIA 1AA9A 1SXJA 1KNXA 2DY1A 2ZREA 5CIQA 3GEHA 3LW7A 4TMVA 4US1R 4BFZA 3FFBA 3AVWA 2P5SA 3TSZA 3QXCA 2WMOB 4JLMA 5B58C 1G21E 3GLGE 2FX3A 2QI9C 2RH5A 3GLHA 3RYTC 4XSGA 3NC0C 2PT7A 5G41A 5EZ5A 5C4MA 4TSFD 4XOIA 4EUNA 2YINC 2PLRA 4NYIR 3MMPA 5EXTA 4PFSA 4WOPA 3TW4A 3U6BA 3BE4A 3TNFA 1OE0A 4DLRA 1JPJA 4WZAE 1N3BA 2WZQA 421PA 4GMXA 4B76A 2CHVA 3SBEA 1XZQA 1ZM7A 1KI8A 5FL7D 2XJ9A 3WMEA 1R4AA 4LJ4A 3CNLA 3CZPA 1G5PA 1XMSA 4IEEA 4TQAA 3PUVA 3U3MA 1G3IA 4IDQA 1ZNXA 1U9IC 5FOVA 2RGDA 1KJYA 2WKPA 3FDIA 4LYAA 3WYAA 1JALA 1LVGA 5M04A 4AKHA 2QP4A 2B92A 4NZYA 5F9HA 3B82A 4DSUA 1DOAA 1OB5A 3A1VA 3PEVA 3JVUA 3U7FB 2AK3A 2KJQA 1AQYA 3F3YA 3X1ZA 3EAQA 3AF0A 1XEWY 2FEOA 2OLJA 4PPNA 3KJHA 3AP2A 4FIDA 1U94A 4AKGA 2H5EA 4POAA 1FTSA 1Q12A 2GXAA 5AWFC 3L0SA 1TNDA 5B57C 1GFIA 4WZBE 4LHWA 1KAGA 3G0HA 4YMSA 3ECCA 4B34A 1KJWA 3MWYW 1CULC 1X1SA 5HE8A 2CK3D 3UMFA 3M1IA 1KJZA 4OKSA 1B23P 1BMFD 1R2QA 4BGDA 1KZ7B 2GCNA 1E3MA 1NI3A 3O8DA 2IYWA 1FQKA 2OBLA 2WMNB 3EXAA 4F7WA 3NHAA 2J0QA 1JECA 4HB2A 2C03A 3TUZC 3GLFB 4MUBA 2ANBA 2O52A 5C1BA 4Q02A 4QGAA 4G3XA 5DI3A 3ZYCA 4KYIB 4MKIA 3MG9A 3C15C 1SGWA 2ZRFA 3GLIB 4G5SA 4XWKA 2HYIC 4JYCA 3CZQA 5JCZA 4F92B 1QHYA 4Q48A 2MMCA 1KO1A 2MSDB 4RD3A 2VSOA 2WICA 4S35A 4KFUA 3DZ8A 3WRXC 4MRVA 4US2R 4ESVA 1Z0JA 1FFHA 1J70A 1KAOA 4BQSA 2SHKA 4DLXA 4M4SA 1P4SA 1L8QA 1SVWA 2A7QA 3ONWA 2ORVA 4HZUA 1EXMA 2QM8A 4H1VA 4PC1A 4DJTA 3RLFA 1KNQA 4U00A 2JEOA 3QG1A 1P3JA 4L15A 2H18A 2IC5A 4FMBB 4GRAA 3KJGA 2F55A 2BHRA 4ARZB 5AJYA 3HP1A 2WPDA 4QOSA 4OQLA 3C7KA 2R62A 4DDWA 1E79D 1OYWA 2ZRCA 3ZD6A 2OFXA 1UEIA 1ZM2A 1CR4A 4JT2A 4ZIRA 1ZMXA 3A1SA 3A37A 1XDBA 2DB3A 1G8HA 2C9CA 2VPPA 5BYKA 2O8EB 1AS3A 2D3WA 2ZR7A 2AN9A 1OFUX 4DDUA 2REBA 3OIVA 3H2YA 4PSAA 2FGJA 3AVPA 1MV5A 3U7HB 2KE5A 4XWOA 2CXXA 1CLUA 1DELA 1N6OA 1CP2A 2HF8A 1KI7A 2IL1A 1VCOA 5CM9C 2P6NA 2OT3B 2C9OA 3GLHB 3QXSA 4QHYA 5J47A 5JI2E 3K0AA 5JLJA 2GJAA 1QHHA 4B75A 4EFNA 4TT3D 2KB0A 3U5ZB 1G20E 3FYHA 4LJAA 2OM2A 3QY0A 2AL7A 1U81A 1K5GA 3VTKA 4FD2A 1P72A 5CDFA 3RANA 1IXZA 4WXRA 3TGPA 1ZIPA 4A2WA 1R7RA 3AVYA 1E2HA 3G5UA 3MUFA 1NG9A 2FSHA 1MT0A 2GWHA 2BV3A 5H70A 2FSGA 1XTRA 2AWNA 3KXKA 1X8LA 5FUVA 2ZRIA 3DPUA 1GRQA 1U99A 3I73A 1JEEA 1DAFA 3QEJA 4OHXA 5AR1A 3KKPA 5LB2A 1FW6A 1XJCA 3QPWA 4M21A 1XXHA 3U3KA 1DBSA 4A15A 5GVRA 2WWGA 5HE9A 3OEHA 5BWMA 1MABB 4Q9KA 4HEJA 1P60A 4TLBA 1VIAA 2F1HA 3QXXA 1G8YA 1Q22A 3DO6A 2XB4A 5EXPA 4ABYA 3T12A 5J4LA 3F0TA 5CJ2A 3ASZA 4QGHA 2BMDA 4TMKA 5HTKA 2AFIE 2R44A 3W3AA 4KITB 3K9GA 4IJMA 3ZD7A 1DO0A 3TJZA 4CEIA 2NQ2C 4HLQB 1H8EA 3GMTA 3WYGA 1J7KA 4TZ0A 2ZANA 2DBYA 4R9UC 3U44B 1PUIA 4P4SA 3CRRA 4TLAA 1ZCAA 3U61B 2YKGA 4UXJA 4AIIA 3I8SA 3H84A 4PX9A 2IS1A 4XWAA 2JATA 3KFXA 4XD7D 4URVR 2BJVA 5GVSA 1W4CA 3BIFA 2ASEA 1Z6AA 2WJVA 5EE5B 5DI3B 3M0EA 4OI1A 3HDTA 5B30A 3V00A 4MYTA 2BM0A 2I3BA 4KFTA 2GXSA 1Z6GA 2Q6TA 4RZ3A 4E22A 1QVAA 2ZXUA 4B3XA 3CONA 4DCVA 2D7DA 5KSPA 3AVTA 1IY0A 2ZRNA 5FUXA 5SZIA 4Q66C 2C2HA 2ZJOA 2IYRA 1DEKA 1NMZA 4KV9A 4QHSA 2XOKA 2ZVPX 3HR7A 4LOAA 3WNDA 3ZQJA 4A8JA 121PA 1G18A 1U98A 2GILA 4OL0A 2CVFA 1RRFA 5AUQA 2WV9A 3SJBA 2WWHA 2IYSA 1VYUA 4M53A 1N2CE 2ZSDA 1XTKA 1N6HA 3NIBA 2F6RA 3SBDA 3ZDQA 2IS4A 1KKMA 4HZUB 4OK3A 2WM9B 4YMWA 1R10A 1D8TA 4URWR 3UWOA 4EPXA 2GEVA 2ZAMA 4JLAA 4PANA 4BLRA 5G3ZA 1E2MA 1Z29A 4BECA 1N6NA 1XBTA 2RGGA 4DXAA 3ICEA 1W4AA 3NG1A 4IDOA 1BYUA 1ZU5A 2R6CA 1KDOA 5FTLA 3EA0A 3QSYA 1GNRA 2W6ID 1NBME 4DB4A 4DZZA 2WTUA 2CL7X 2JCSA 2ZYTX 4ZIRB 3IO5A 4ACAA 1UKZA 3UK6A 4ZO4A 4U7DA 3U7EB 4RVCA 4DCUA 2DHRA 5JWRA 1P6XA 3CR7A 4TN1A 1HT1E 4QGGA 1NY5A 2P5TB 3CKLA 4NPHA 1QVRA 4Z8YA 2ZTSA 4S2EA 2ZPTX 3LBHA 3M4YA 1IXRC 2GCPA 4Q4AA 3K9NA 1W4RA 1XEWX 3UG6A 2WJHA 4D0LB 5DLQC 4QFMA 1IJEA 3BFVA 2FEMA 4IVPA 4RSGA 4UXHA 4ASUA 1VCNA 1OSNA 2G6BA 2F7SA 1QHHB 1M7BA 4LUCA 4KSCA 5FBLB 1E0JA 3HU1A 2A5DA 2GVDC 2WWYA 2EU8A 4B3GA 2WSSA 1BOFA 2UVQA 3QVUA 5G53C 5KU1A 1QHSA 4JIMA 2PZEA 2NO9A 2NZJA 4Q5IA 3VKGA 1NN0A 5K8TA 1JJVA 4GOKA 1DAMA 1NVUQ 1R8SA 2VP0A 4DBLC 3A8TA 2G83A 2IYXA 4ERNA 2GF9A 5FOSA 2BM1A 1ESMA 1VPLA 1SKYE 1RFLA 2MSCB 3X1DA 3Q7PA 2XTZA 1LF5A 1F2TB 5AJWA 4A0RA 1D5CA 1SXJD 2IWHA 4PO1A 3QI2A 4BLTA 2WIBA 3U3JA 1YZGA 1U0JA 1COWA 5CM8B 3KB2A 1XXHB 2C78A 2VHQA 1RJ9A 2EFGA 4TYYA 1VYTA 3VU9A 3K8YA 4UJ3A 1NKTA 2J9RA 2AKYA 3E2IA 1KOFA 1K5DA 2WAXA 2D2FA 4OYHA 4IDPA 4JL8A 3HU3A 1CIPA 5KPDA 4UQOA 4LV6A 3ZS8A 3EPJA 1Q1BA 3VNUA 1OH7A 3TBKA 4QG7A 3WBJA 3THWB 4I1VA 3QE0A 4TMXA 4F4JA 3ND8A 5KSOA 1RRCA 4H1UA 3FMIA 1M74A 1R0YA 2HT6A 1KMQA 4HAZA 1N0WA 2BKUA 2CEAA 3FHOA 4WA7A 3VHLB 1E79A 1QF9A 4PO8A 1VDZA 1P73A 3AUXA 3FMOB 2QMUA 3B6EA 4P4SB 3TKLA 3SJZA 4WBSA 1MRNA 4L16A 5J4YA 3ZJYA 3GFOA 2ZE5A 1Q1QA 4JVSB 3TH5A 1T3LA 2K5UA 4V0NA 3W6PA 1OFIA 2JLXA 4LZZA 5JRZA 1RKBA 1XNJA 2UKDA 4IDHA 4HSEA 4KFRA 3WNCA 2DFTA 5J40A 1T4GA 1ZD1A 1NVVQ 4QBIA 5HKKA 1TX4B 2BDTA 4IXMA 2BBSA 3QKTA 2WWXA 4G0NA 5DE3A 1UKVY 2ZJBA 1E2IA 2GEDA 3W5JA 4AURA 5DNYB 4B3FX 2QEQA 3TVDA 3NBYC 4XJXA 3K09A 1YR8A 5D3MA 4EIWA 2QMHA 3A1TA 4Q21A 1JAIA 4Q7KA 2XITA 3I72A 2JLZA 1P2TA 3DM9B 2CBZA 3L82B 1J90A 2YVUA 4CDGA 2JLQA 3IIKA 3RAPR 5JSZA 2IS2A 2PMKA 2A9KA 2GBLA 2QQEA 3SFZA 4JLBA 4II7A 4IXNA 1E94E 2WAYA 3MCAA 2QP3A 2QRNA 3AKYA 3EWAA 3RRZA 2F9MA 1F5NA 4EPVA 4URUR 4OQFA 5E4FA 2C99A 2OILA 2P2LA 3IBYA 4RFSA 4OK5A 4JL5A 4ZDIA 1BH2A 2V1UA 3OIYA 3TK1A 1VG0B 2GTPA 3U4QB 3I1FA 5TDHA 5FBRB 5KPJA 3DDCA 2MSEB 1N0VC 1NSTA 2PX3A 3GD7A 1KIMA 2A5FA 3B78A 5AK0A 4LK2A 2GRJA 4D0GA 1Q1ZA 3X1XA 3MJRA 5FBVB 2C96A 3ZVMA 3A6PC 4X8OA 2A78A 1UM8A 3BD9A 3CLVA 5JI3E 1NVXQ 4XVQA 1XCPA 2J0UA 2HCJB 2REOA 1OYYA 1TU3A 3IHLA 4LSGA 1GAJA 2ZUCA 4ITRC 4C0SA 3BFXA 5FOXA 2NIPA 1OXTA 3U3RA 2YOHA 4HAYA 1GL7A 4YC7A 5DGXA 3L0IB 1FOEB 2JAQA 3EA5A 3QKRB 4X8LA 4QBHA 1TU4A 4LV5B 2PZFA 4RD4A 2BEJA 3FMPB 3KFVA 3MWJA 2JIZD 1NSFA 5E95A 3V9PA 3EG5A 1N5KA 1ZIOA 2LWIA 2WPDD 2G1KA 1E2GA 3VR5A 4MA4A 2W00A 1WF3A 1W47A 4TWZA 1WCV1 3A36A 3AF2A 3LV8A 4D2IA 4TL7A 4XSHA 4A92A 4B44A 2Z43A 1TTTA 1IHUA 4A6XA 3QIAA 1G19A 1ELOA 4EPTA 2IHBA 2VF8A 2O8FA 2XTNA 4KJZA 3RSLA 3AH8A 4A6PA 1CJUC 1C9KA 2CMKA 5EE1A 3AGPA 3SYNA 2PX0A 1VG1A 1R0XA 1RJ9B 3QF4B 4TYQA 4IW3B 2OHFA 3I32A 3IUYA 3MFYA 4DIEA 4IOMA 4QM7A 4NKRA 3VU9B 1NIJA 3GJ5A 4P32A 2G0NA 2AR7A 4NYMQ 3LRPA 4G5RA 2KSQA 2EW1A 1E6CA 2CLCX 1G5RA 1D2EA 3UG7A 4DRZA 4AD8A 5LPNA 3TE6A 3AF3A 3QXJA 5L3QA 3ZQ6A 3GFTA 1ZNWA 2WJJA 5KNDA 2XGJA 1Z28A 4UJ5A 1Q0UA 4BPBA 2BMFA 2O8DA 2FFQA 4BLPA 2G9NA 2CLDX 3EARA 1ZM3A 2PCJA 1RYHA 4OK6A 1ZU4A 3DMNA 3GEIA 5ELXA 1GILA 4V03A 4Q03A 1NL3A 2ZI5A 1OB2A 3K70D 3C14C 3W5IA 1N25A 1R5OA 3REGA 4KXFB 4PTLA 2B8WA 2QBYA 4Q00A 1KY3A 2FZLA 5H8WA 3VR2A 5BW8A 4NDZA 3OEHD 1UBEA 3QF7A 5GJWC 5J4HA 2CL0X 3HYRA 1Z6TA 5B2ZA 1SZPA 4EKDA 5EP3A 3W6OA 4W5WA 4PHHA 4KSBA 1L7VC 1FX0A 3AP1A 4A4DA 1RYFA 4Z54A 4TMWA 3HPRA 2J7PD 2X8AA 2C04A 1MO3A 5EP2A 3GJ8A 3O47A 3LBIA 3FOZA 2XEXA 2PZGA 3KKQA 4L4UA 5D3MB 1VMAA 4G1UC 1SHKA 5JSZB 1AN0A 2A5GA 3LX8A 1H8ED 4JBXA 2IA5A 4PSKA 1S4QA 4JS0A 3KXLA 2GJKA 3NTUA 4FMCF 3GLGA 4HDOB 3ICQB 3QKSA 5E7MA 5HCNA 1GUAA 4IDNA 1OV4A 4RFSB 2AD1A 2WWIA 3N2EA 4QC2A 1A4RA 2ZROA 1YKSA 3GCGA 3GLIE 1N6RA 4GOXA 3BFKA 221PA 3V4RA 4LYFA 5IK2A 3R7WA 1LY1A 3QPVA 4EFMA 3Q7QA 4DC9A 1IXSB 1WB9A 1ZCBA 3B9PA 1VG8A 3BB4A 3KX2A 3B1YA 1LB1B 1CJKC 2HT1A 4MGKR 2XXAA 4L9WA 3PEWA 3T5GA 1T9HA 3U60B 3TRFA 1U0HC 2WKRA 3G82C 1Y3AA 2J0UB 1DARA 3R20A 4BFVA 2XOKD 2NO7A 1E1RA 2ZIAA 4PQFA 4YMUA 1NBMD 821PA 3TR5A 1R6BX 4D4MA 4LHYA 4KCGA 3ZZTA 2J45A 4LV8B 1W0JA 3H86A 4F4IA 5CK4A 2QAGA 4KBGA 2KBFA 3OIUA 4I99A 1Q21A 1LNZA 2ZE8A 3F8TA 3LO5A 3K0FB 3MAAC 2ONJA 2E87A 2QNRA 4ILEA 3B1WA 1KI2A 2B7CA 4PZYA 2ANCA 5JJKA 4KO8A 5J5CA 3T1OA 2VF7A 2VO1A 2EFHB 2H16A 3S1AA 4FW9A 1AKEA 4WAUA 4BRUA 1PVOA 3VNVA 2IYLD 2I1VB 4FMCB 5F9FA 3GJXC 1E2KA 4Q7MB 3WHKA 1JB1A 3HWSA 4TYNA 2W0MA 3J81k 4EDHA 1II8A 4EPYA 1A2BA 1QBKC 2O8FB 3B8HA 1ZD8A 2QSYA 1G41A 1ZAKA 2ORWA 4HB4A 1R5NA 4RY2A 5BN5A 1Z2CA 4D4KA 4URZR 5HPYB 2KBEA 1XCGB 3IPYA 4LYJA 1DAGA 3B9QA 4LJYA 2ZSFA 3DMDA 3HJNA 1KSHA 1EWQA 1IN7A 4LJ8A 4BFWA 4ASUD 3EZ9A 5FTJA 4Q7JB 1DVRA 1G4UR 1C1YA 3MSXA 5JHGB 3E1SA 1T0HB 3P4XA 1TUIA 2PLFA 2FPMA 3AKCA 2IXEA 3CM0A 2D62A 5FL3A 3ZVNA 4BLSA 1FUUA 2DFKB 3PIRA 4R2HA 2WSSD 2WJGA 1XTIA 1ZJ6A 1II9A 2IS6A 5CYPA 1E2QA 3WMFA 4PHTA 2RCNA 3SEAA 2ZQ5A 4LRWA 3K0CC 1MR3F 1KI4A 2GZHA 2RGXA 4GP7A 4NYJQ 2ZUBA 1Z06A 3D7MA 3FKSA 4B3CA 4PQRA 5G3YA 2QBYB 3ZS9A 2FH5B 3I8XA 2BEKA 1DAIA 1COWD 3RDPA 5A4JA 2IBMA 4OBEA 4ACBA 5CIWA 1GG2A 4KODA 4LBZA 3KQUA 1ZM4A 4YLGA 1KI3A 2QPTA 1XZPA 1CR0A 3E70C 1I4TD 4O2RA 1FNNA 1W5TA 4OQXA 4KVAA 5FTMA 2BCGY 1FX0B 3H4MA 1KK0A 1HH4A 1YE8A 1MOZA 3AQ4A 4ZCIA 6Q21A 4EPRA 4MKFA 2HV8A 5HR5A 3KL4A 4E03A 1P9WA 1KI6A 2BKEA 5UKDA 2JIZA 2D2EA 2FGKA 2VHUA 5TVKA 4ZI3A 2YYZA 2JGNA 1NVVR 1VCIA 2AFHE 5HZKA 2LKCA 4N1AA 5TXGA 4CW7A 2J87A 3OFNA 3LVRE 4TMTA 2YOFA 4DLVA 1W5SA 3IO3A 3CWZA 1SVSA 2ODWA 2ZS7A 3MD0A 1CJMA 2ZRHA 3W9YA 1Z6XA 4DEXA 1FUKA 4QGFA 2EYQA 1T91A 1G3QA 1OF1A 4O2LA 2LKDA 3EIQA 1SXJB 4ZI2A 2IT1A 2WHXA 2WKQA 3QNUA 4BASA 1TQ6A 2EQBA 3NKVA 3CR8A 5DYGA 2E9SA 4MRPA 2J5XA 2VP4A 3EIHA 3T35A 4LWZA 1G291 3WHLA 2OV2A 4LY6A 2IEYA 1ZUIA 2RHMA 1Z6YA 5HKKD 4PC2A 3W8NA 3D6TB 1X3SA 3PR1A 4DT1A 3VX3A 4QM6A 4TTRA 4YQFA 3SHWA 5EXXA 1G1MA 4FCTA 2VQSA 3L2OB 2C5LA 2YC4C 2Q9CA 4O3MA 3KTAA 2IYQA 1G6HA 3R9WA 3I4LA 2OCYC 3U3OA 1G7SA 5LB4A 2D4HA 1S3SA 4R7ZA 4Q1FA 4AYXA 3P4YA 1S3GA 1XJ0A 2QTHA 3CPHA 3K0EA 2QAGB 4JBWA 3ZGXA 3CNNA 2V4ZA 3HU2A 3VHXA 4B74A 4Q4HA 1UPTA 2JJ8A 2XAUA 3CUEF 3DHWC 1GKUB 5K8IA 1OH8A 1S9DA 5L3SA 1E1QD 2ZI7A 5JBQA 4TTPA 1EFCA 3VX4A 1DAHA 1W7AA 2Q9AA 2ZR0A 2ZJ5A 4JKYA 4MYUA 4EAQA 1DAEA 2BJWA 4B3BA 4QKQA 2REXB 2R9VA 3SN6A 1XP8A 1ZUHA 4XVRA 3BC1A 1E2LA 1P62B 2QY9A 1XD2A 4B32A 1L4UA 1II8B 2DWOA 2GJ9A 2PCLA 5CB6A 1CJTC 5EUQB 2W83A 1SXJC 2V7QD 1Q3TA 3GQBA 4LGMA 4PO9A 1I4LD 3UWKA 1BO6A 2J7PA 4RJLA 2IHYA 1HV8A 2D7CA 4GNKA 4J0QA 2HJVA 3B5JA 1GWNA 3TR0A 1NY6A 3FHTA 3PQCA 5AJZA 3A4MA 2FE4A 2JA1A 4QJ5A 4DLUA 3B13B 4NTZA 2CNWA 3LBNA 2CCKA 4BZQA 2BVNA 2O8BA 1KMHA 3AUYA 3L0PA 2YC2C 3C16C 1H8HD 1A7JA 2RKOA 1HY3A 4JVNA 3DL0A 2JDID 4NYMR 4OHWA 2FDCA 2VHTA 4C7OA 2C8VA 1HYQA 1SKQA 4JLDA 3SC3A 4BLQA 1G3MA 4MGYR 4A1FA 1UDWA 4LHVA 1LV7A 2BBOA 1YRBA 4OI4A 4TZ6A 2QAGC 2F1IA 1XFAA 1QG4A 4YMVA 1Z07A 1JXMA 3VR3A 3EZ7A 1XTJA 1TF5A 1S1MA 1S1CA 3BXZA 2OCAA 2ZRPA 3CX7A 3UMRA 3C4JA 2QT0A 4KHZA 4JLKA 4P33A 4FN5A 3ETLA 4HATA 2AX4A 5C2JB 4MH0R 1JQLB 4AYWA 1KDPA 1VIYA 4WIAA 1PZNA 4A82A 2IXFA 4DCSA 1AQUA 3CF6R 2EFEB 1NBMA 1CR1A 1HQYE 1FQJA 1T8UA 4NCKA 5CJPA 1JBKA 5C18A 4FWTA 2XZLA 4M8NE 4D6PA 1W49A 5ANRB 4AYTA 3SOPA 4ZV4A 3KQKA 1RIFA 621PA 4C2UA 1W1WA 1QHGA 2HCBA 1Z3IX 4GMDA 5SZHB 3I5XA 4PR0A 2VP9A 3FKQA 2CCJA 2XSZD 4FINA 2PBRA 1GOTA 4BUJA 4K46A 4A0HA 4D81A 4G5QA 5EP4A 2YWGA 1P9NA 1XJQA 1G5TA 3IQXA 3KKNA 1AS0A 4Q01A 4RD0A 5BN4A 2G3YA 3T1VA 4R2IA 2QPAA 5A5GA 5GJVC 3GFPA 4B2PA 4B2LA 3W90A 4HLCA 1T5IA 1NMXA 2A5JA 1QHIA 4HDQB 1LS6A 4LPSA 4TQ9A 2ATVA 3SHFA 3WP1B 2VP2A 2Y8EA 1F2UA 1J8YF 5JS7A 3O8CA 1NVWQ 2IF0A 3HYTA 4G5OA 3P27A 4CT5A 5CB8A 4TLCA
chains in the Genus database with same CATH superfamily
2ZUDA 2NGRA 4TTQA 4KQKA 4OXYA 1V37A 1TZCA 1TXGA 3A4TA 1AB5A 1OHHD 2W2PA 1GRVA 3LYUA 1IWOA 5DM2A 5A0VA 2NT4A 3L4BA 3KAJA 1AZSC 4LXIA 4B3HA 4X9XA 4DT1B 1T29A 1TGYA 1W30A 4A7PA 1RAEA 3FWHA 3GLQA 3L8CA 1R4MA 3Q0EA 3R5JA 1K4MA 3EVAA 3TW8B 4KLNA 1RC8A 1MX3A 5A3JA 1Y81A 3HLKA 3A25A 3KTAB 3GNQA 4DOMA 2IV3A 4HQKA 4M0EA 5E7IA 1XQYA 1E1CA 1AOXA 4ZGBA 5IKOA 2EP8A 3KCQA 1FP6A 5FI3A 1DUVG 5GONA 4CGZA 1ZA1A 5JNWA 2WE7A 4Z0PA 3OQJA 3HU5A 1AURA 1I3LA 3E9YA 5L3SB 4OMCA 5ALPA 2IBSA 1W76A 4TXHA 1JEQB 5JNSA 5FBWB 2IIPA 4RVOA 3U4GA 2XY4A 1R0ZA 1FDSA 3ZOKA 4YRZA 4NP6A 4OHFA 4F60A 1R37A 4B5KA 2ZM5A 3K53A 4WWHA 1HI9A 2W22A 4NCNA 1UBGA 4QLAA 4EYKA 1LA2A 3THXA 1W9MA 4JI0B 1S7CA 1DWPA 1EDDA 2D5AA 3Q2OA 4RF5A 4C20A 1T8TA 4HNTA 3CGGA 2LD4A 2X6QA 5EIBC 1GQ2A 2R47A 3BRQA 3P26A 5ABPA 1JJ7A 1Q3KA 1WP9A 1W44A 2LE0A 1RKQA 4GXTA 4F3NA 2PPLA 5G0WA 2VJMB 3DEKA 4KQJA 2X8LA 3DOFA 1L5KA 5C7IO 3IODA 2I4IA 4AROA 2OXRA 3L6BA 1Y5IA 5DWDA 1PKXA 2ILTA 3MWEA 4GYYA 3K0HA 4D3ZA 4D8YA 1NJSA 4KH1A 1SVNA 2F4NA 4F11A 5I3ZA 2H8KA 4WVLA 1ODFA 1CB0A 1JFRA 1B8VA 4W6ZA 5LZ5A 4B8ZA 1QQ6A 1QPZA 4QXMA 1ADBA 2BBTA 3ISTA 4QUBA 3ZWAA 5FWNA 5IRCD 3IHTA 3EPHA 3NH9A 1Z47A 1MV8A 4FZ5A 2FSVA 4P36A 4PG6A 2PZ8A 3WMRA 3L06A 3RC2A 1G3RA 3GCDA 1W0KD 4HDKA 3RUAA 4IRUB 4M7PA 4MKZA 2QMOA 4MX8A 3KO8A 3PA6A 3RBXA 4CKWA 1MGPA 4J90A 3FFAA 3RYHA 3TPCA 1EXNA 1N8TA 4I4CA 1OUMA 3ZD9A 1O7JA 3AVOA 3JWGA 1U2QA 3GNSA 1CDOA 4HSGA 4COOA 2CSUA 1V9LA 3HB5X 3K70C 4F9TA 2F3TA 2YR0A 5IJ9A 1V16A 2OCXA 5I3CA 3HEBA 3PENA 2JGDB 2I66A 1ZIYA 3QHAA 4RZQA 4OFWA 1JQDA 2X6RA 1KJJA 1MLDA 2UYOA 2V7VA 4Z9XA 5KYYB 3DD5A 4H27A 4OQPA 1CF2O 2VDPB 3LUDA 4NYJR 4Z1MA 2HI0A 3IHWA 5H59A 4I4LA 4FHDA 4QAJA 4BVFA 2CFSA 5FPKA 4OJMX 3FBWA 2GHRA 4NATA 4WCDA 2AMJA 5FWXB 4PC7A 4PW0A 5G40A 3DEFA 2UZIR 3KQSA 4MVJA 4TRRA 2A30A 1HLGA 1LXCA 2IYTA 2VRCD 3AM4A 3NIGB 4D0NA 3HO8A 2HCTA 3T3IA 4B45A 2PYIA 3LHKA 5EUMA 3ZZ0A 3O8RA 4M9SA 2O0JA 2OP1A 5CLQA 3W34A 4ZMSA 5JFGA 3ZPXA 4CV1A 2OA0A 2Q6VA 4HNAA 5KWEA 2BTEA 4AMGA 2FWIA 1AO3A 2QXYA 3VV2A 4UTZA 5J2TF 3TRDA 3Q88A 1TD9A 5ULLA 4G0MA 4RTRA 1ID1A 1OXUA 1G3UA 1UQTA 2DZDA 3RK4A 1G59A 3U4CA 1CXZA 3DL7A 1ZGGA 3KZ1E 3CY6A 3GJ3A 4YP7A 1DC3A 3S68A 4IIEA 3ZW9A 1CHDA 3OOHA 4ZOLA 1RVDA 4ZQEA 4FI3C 5FI5A 5BV8A 3MTJA 4N4AA 1A50B 1NDQA 4KX3A 4EG8A 3O84A 1C3OB 5L3RA 4IV8A 1ZYUA 3AEQB 3ZE0B 4E2ZA 1E9AA 4UCQA 2FAXA 4D74A 4KO2S 1G17A 1P0IA 5IVIA 4UUMA 2Z83A 4MR9B 3BWYA 3TGWA 3CVUA 1UZMA 2QL7A 4BZPA 4ICIA 1UBCA 2FFHA 3TVYA 1K08A 2DF8A 1LC3A 1J8FA 2C2YA 2P4EA 2QSUA 2HRQA 2OE2A 2R2AA 1M67A 2V6BA 1P2UA 3JRXA 5BUQA 4COKA 2G17A 1D1QA 4RS4A 3GUVA 4D9IA 3ODGA 1UMDB 1OC2A 3ORHA 4FC7A 3HCEA 4U1RA 4Y8VA 1CEEA 2QQ0A 1NR5A 5DHSA 5ILGA 3WLOA 2XOEA 3AR2A 4WTOA 1XB2A 1KZ4A 1QSGA 4R3UC 4RTMA 3NRBA 1M7HA 5SZKB 1CUBA 2X76A 1CZHA 1EE1A 2VJCA 2P77A 5GQSA 4PPFA 5JLAA 1L3BA 4DLNA 1YCFA 2JLBA 4F93B 1EX6A 4EG0A 3RO7A 3AOGA 4DKJA 1DBVO 1QCCA 1I6KA 3FLMA 3I83A 4KVZA 3NBMA 4WNAB 3RRXA 3W7BA 1CUUA 1SXGA 2BOVA 3NDBB 1MVLA 4MLPA 3EHEA 2I4OA 4O4HF 2P0YA 2Q7OE 1IG0A 5AI0A 2ERYA 3MJVA 1SOWA 2WM3A 3X1YA 3USZA 3MOIA 3KT8A 4PZZA 1C9MA 3VSCA 1LDMA 2I9PA 4ED9A 5JS6A 2DPXA 3THYB 1Y9EA 1Z6ZA 2PV0A 3P5SA 4K6FA 5DTJA 4TMZA 3GJ0A 4OI0A 5J2TB 5BQXA 1TK2A 1SM4A 3GA5A 4DSZA 2CB0A 4JHLA 5IT9A 1T5SA 3K30A 4HDAA 3F7NA 1NRXA 3WRXA 3BA1A 1FQWA 3UKOA 3ZWPA 1REQB 1SULA 4HDSB 4MHSA 3L8GA 1Z12A 2JGAA 4PSUA 4HFMA 3W6ZA 4MS3A 4X93A 3K1AA 1WVGA 3BMQA 4IPTA 4B7UA 1K7CA 1SU6A 4QDOA 3WLSA 4C4RA 3WGYA 2XSZA 2NQTA 1HTTA 1VFPA 3IAXA 2R1TA 3DEIA 2V1XA 1XRMA 3KDAA 3A3KA 3RKSA 3LCCA 3WB2A 3QE3A 3S0JA 4X61A 3AR9A 5KDOA 1NW4A 1EWRA 3QUSA 4OH1A 4XGIA 3G8CA 1PQYA 4IVRA 3LWBA 1A8QA 1XLVA 2GBPA 3FGPA 5FHRA 3TIXB 3VTAA 3W7AA 4KI0A 4B71A 2X86A 3E9QA 5ITZA 4UHHA 5JTUA 5A5VA 1U6JA 4QTUB 1FXUA 4RSMA 1U8FO 1J2EA 1JGTA 4IUYA 5H68A 3W6NA 3HV0A 5DIZA 1AGPA 3QVJA 3ZLTA 3TTTA 2NUAA 2UXCB 4GRIA 1QHNA 1XTUA 2XMDA 2VK1A 1EH5A 4GI1A 8AT1A 4C7XA 2QORA 2BM9A 3OMLA 4KC0A 2P1ZA 2R6FA 3UV7A 4LJKA 5ICSA 1NLZA 1VL6A 4K9KA 5LN1A 2QRGA 5INTA 3G9UA 3LAWA 4GT1A 5LLSA 2ID9A 2XQJA 3SIPA 2QTCA 4CCYB 1W35A 1J1IA 1EP2B 1ZD9A 2UYQA 4S0ZA 5K45A 3VUEA 3RW9A 2IODA 2O54A 1FU7A 2YV5A 1VLHA 5E7JA 3JZDA 4WV3A 2BGLA 1O08A 1CJVC 3V1UA 1E5TA 3RARA 3OIGA 3GLUA 1A4XA 4XX0A 1FNMA 4LZAA 2HBQA 1N8KA 3AIOA 1G4AE 2WAMA 1G9XA 1AX9A 3CJTA 3ETCA 4K7JA 2HXYA 3CNHA 1I2MA 3INNA 3P9IA 1O77A 3Q9SA 4MJ7A 3S70A 5JEEA 2DQ4A 2P67A 1EINA 1SQ6A 2W93A 3GLFE 2E5WA 1XRSB 1IBKB 2RGRA 5EY5B 3H11B 1N9KA 2C4UA 3MWDB 5IHPA 4WKBA 1EB8A 4UATA 4CM9A 1FFWA 4O4JB 2XMCA 1IMJA 1WS6A 3SFVA 3WIOA 3WIVA 4OHYA 1QYRA 3SLKA 1J1UA 2GZDA 1XLWA 1OI4A 5TNXA 3VU8A 4EP1A 3CXRA 1XSEA 2C3PA 3KNZA 3GIDA 4TYPA 4UU1A 1P2GA 1OFHA 4PPGA 5ERYA 1F06A 3A6GA 3PNBA 3T99A 4QM6A 1VKJA 2F43A 3LXRA 4XEUA 2ZXEA 4OP1A 3MF4A 4DZRA 5DNDA 2GA9A 2W2XA 3HCFA 3VKFA 4DJJA 2IYYA 3B20A 3HDYA 3PVCA 3RSCA 4WEOA 5G1PA 3WLFA 5AOBA 4Q3OA 1NNSA 3SS8A 2Y6UA 1JAHA 1PWEA 2RIRA 1PL8A 4OSPA 2VJQA 2PGNA 1CX9B 4PC6A 2PH1A 4DIBA 2H9YA 4XFJA 1DXOA 2VPZA 2ZI6A 3NGLA 3TWOA 5I7AA 4KHPB 3RODA 3EQ2A 1K98A 2X1MA 3Q8WA 4YT4A 3K8QA 5P21A 1KSGA 3V8MA 4NR0A 1TF7A 4Q3EA 3NHSA 2V9ZA 1LJLA 2J9FA 4RH0A 1T5OA 3H2IA 2V5UA 4IY1A 1ZUD1 5FQOA 5MN5A 4N18A 2XB6A 3G02A 1GTMA 2AN3A 1ZZEA 3D5QA 2WP0A 3OOWA 4PSCA 3RSGA 1YB4A 2KM1A 4PR3A 4PYKA 2NU7B 4JP1A 1WMSA 4YJKA 4RMIA 1U3WA 1UOPA 2J0VA 1BXRA 2IEGA 1GKIA 3GH1A 3K09C 4HYQA 3DAHA 4JA2A 4X85A 4F9EA 5KX5F 2CMDA 4HWGA 2AHOA 1YU9A 4JROA 3RD5A 1WE2A 1BE6A 3AIIA 4C2TA 5JHHB 3RUDA 4E88A 1SXJE 2GBLC 2QTVA 2B61A 1VLLA 3LX4A 4YRDA 1ZW6A 4E4RA 4OOEA 2G7ZA 2OBNA 4JU8A 4TLDA 2XECA 2ZT8A 4CEHB 1CS4C 1E2FA 1MFZA 1Q1EA 2W6PA 3L0DA 4HO1X 2BFFA 4N3NA 3IQWA 4J6FA 5K05A 3NIWA 3GLHE 4IVQA 5I7SA 5IF3A 3IDSA 1ZESA 3E18A 1A5BB 1KVSA 3WHIA 5CEEA 4N0EA 3ZQ4A 5DRYA 4QQNA 3LLMA 4RLSA 2BGTA 1BRTA 1A5AB 4EHJA 4C0LA 1Y63A 3L05A 4I5IA 3CZCA 1EK2A 4O1HA 5AK3A 4BNHA 1ORDA 1IJBA 3T4UA 3CT6A 3P9PA 4MW2A 4Q12A 4MR7B 4QYXA 2O59A 5AW0A 1EJ2A 2GAOA 1H2XA 4CF5A 2J4FA 5CVJA 2NMVA 3AQIA 1QZ3A 4GH5A 4G0UA 3I2JA 1C3JA 2ZSAA 5AK6A 1JG3A 2IYAA 1I32A 3FYCA 4TLEA 2VSFA 3SQOA 5K0CA 4BS9A 1KFEB 1R4NA 5IDVA 4EATA 5DOVA 3OE7D 3STVA 1IONA 3VR6H 1Z0AA 5A1TA 2OMKA 1EGHA 2ROQA 2D2IA 3GNLA 1PR5A 4PZUA 2VKQA 1I33A 4BJ1A 1M2GA 2CEKA 5F5XA 4BVAA 3V2UA 3EVNA 4D80A 3PCRB 1EBBA 1U0OC 1KEEA 4HADA 4RZXA 1C4XA 5IYZA 4MYSA 1LJ8A 4GR5A 5FOUA 1RP7A 1U90A 1XJ5A 4UHDA 3RBAA 3RTBA 4KXVA 1NURA 2PIAA 2ZP1A 3MVEA 4IIJA 3OZGA 4RTKA 2W11A 4LCBA 1UBOS 4UTOA 1TQDA 3VOSA 3A3NA 5KKCA 3PC2A 3OCXA 2EGHA 5AHOA 4Q19A 1AGRA 4RULA 2WMYA 1OLUB 1TM5E 1DX9A 3M5CA 5JDIA 3DKPA 4P4TA 4MYDA 1RQ2A 1VHTA 1YVPA 3IPXA 2Y92A 4D96A 2YY5A 4UBIA 4E94A 3EX7C 1K3FA 4A6DA 4RTSA 4Z3OA 2AJBA 5AXCA 1F7VA 2XXJA 5E0KB 1T3TA 2ZYDA 3QV1A 2XUOA 1U3TA 1VA4A 2ZI9A 4GI3A 3WJ2A 2G80A 4DIFA 2QXTA 5DHTA 3DE7X 4KOEC 16PKA 3OJEA 1Q7RA 3S99A 2H4YA 4BC1A 1BS2A 3H2BA 1XMIA 2ZLBA 3OQ1A 1SXPA 2CXQA 2J7KA 3OX4A 4I46A 4IBOA 5ICGA 3UMGA 1E32A 4FZRA 5AK5A 2JASA 3DQZA 5J3JA 4PX2A 1TAGA 4H31A 3QKSB 3DO8A 1GUBA 3COWA 3DUFA 3O2JA 4Q4LA 5T8KA 1L1FA 4AYWA 5LQKA 2OHVA 4N65A 3FWNA 2PLWA 4KZPA 2DTEA 5DN6D 3AHIA 5AHKA 2ZE7A 4KXLA 1ZMRA 6NULA 5IT5A 3OX3A 3GN1A 4UKDA 4KIUA 4E33A 1XALA 3L4JA 3HN6A 2R5WA 1KTVA 3VMMA 1W1UA 4EGAA 4BOYA 3HB4X 1A97A 4INAA 2COEA 1ZSVA 3K9WA 3BM5A 3KBOA 3FE2A 3M4JA 4R8RA 2FKNA 5DHQA 8GPBA 3IDOA 1TDJA 2XA1A 3RHTA 1XRJA 4PG7A 2DFVA 3T1NA 4CCAA 2Q0SA 4X54A 1H0KA 2Q2NA 1XEFA 1ZOPA 4TL8A 2UUOA 1DXYA 2QVZX 3IQDB 2VWGA 3JD2A 1Z8HA 4JB0A 4Y2UA 3PC8A 2GDZA 5HMLA 1TPZA 3ZWKA 4O2BF 5CBKA 3B3QA 3ZCRA 4C9BA 3ECAA 2NACA 3H4IA 1G16A 1YVDA 2G1JA 1UK7A 3BMNB 4JMPA 2PZJA 2AQ8A 5EJIA 4P3XA 4H7HA 3TG2A 3N74A 1MCZA 3GNTA 2FUKA 3CNOA 1Y89A 2IU3A 2WJYA 3GDHA 4MKHA 3SSMA 5A4IS 4V38A 1FLVA 4RK1A 4RE5A 1M33A 3X2SA 4FLEA 1I30A 5E6UB 1T2DA 3MYYA 1G98A 2P7IA 3ZE7A 2J0SA 1XE3A 3EXG2 1JA1A 1CUXA 4MRRA 5L45A 3JZAA 1RAHA 2OBYA 3TDKA 1NASA 3PQ5A 5A2GA 5JQGF 3R0QA 4PLWA 5E0OA 1RXVA 4IINA 1R4ZA 4IS3A 4PG5A 1NPYA 3BMXA 4KO1S 2WFMA 4NXMB 3ROZA 4ND8A 1WAMA 1YZUA 1JHVA 5THKA 3IPCA 2DTXA 2F00A 2J9YB 1JNYA 3ZJVA 5C8YF 1LBIA 2O2GA 1RSZA 1SC4A 1M72A 2VJKA 4MKRA 4A0FA 4Z4HA 1I2ZA 1L0BA 4YV1A 4MQEB 4UD2A 5DHFA 3RBVA 4L07A 3QYPA 4O3FA 5GM2A 4G5YA 2FZVA 2Y0EA 4B47A 4Y2JA 1JXOA 1UC5B 2X9QA 4RZSA 3ROFA 5H9WA 2BD0A 3AJRA 4D1YA 4DJDC 1GTL1 2VYND 4G9GA 1K9VF 5HQJA 1Z15A 4P8RA 3EQ7A 1YZTA 2W43A 3DKIA 3EIEA 2PKXA 3CRVA 1KPIA 1HE1C 1LVHA 3NHKA 4WKCA 1H2HA 1AM4D 3NBZC 3JPYA 4FVTA 4TPKA 1K2WA 2V45A 2G06A 1J8MF 1SHTX 1BX0A 3JAKA 4WKOA 1S2GA 4DR1B 2O2IA 2JKVA 2HRRA 4ZALA 3O3MB 4V0OA 3L7IA 4I6JA 5ALSA 3SBOA 4LZWA 3UJHA 4L6CA 1IUKA 1QKKA 4ZPXA 5KYUA 5GMOA 5TGDA 4O2BB 1X9HA 4YMIA 3TMAA 2MCFA 4QPPA 4OFBA 1WEHA 4Q16A 4RESA 5BWLA 4DYHA 1FNSA 4RCZA 1QX3A 1QZXA 3CFYA 3EXEB 2P79A 5AXBA 5BR8B 4YY3B 3THWA 3AF4A 3O4HA 2NVOA 2MTBA 4MKGA 4BMSA 3T5PA 4R81A 1U7PA 2DHDA 4P4UA 5IM4F 4DV7B 3MJ4A 1M2KA 4TL9A 5ICCA 4KFSA 3BT7A 3MERA 1RPTA 4MS4B 3W5UA 4RKYA 5B3JC 2Z08A 3ABQB 2A59A 1W4BA 3IP1A 4R1UA 3SZMA 2OXIA 1NZDA 2MJLA 4DV3B 3T54A 1WPQA 3W1VA 2CVOA 3CX4A 3DZIA 2J6IA 3S2ZA 3A4NA 2VHCA 1HE8B 2A0UA 3BWVA 3WY9A 4DV5B 3LBFA 5EJ2A 4GKJB 4NCHA 3UWSA 2I9KA 3RS0A 3X2FA 3KQPA 4RZUA 2OXFA 1XTZA 2WILA 1PLJA 5C8YB 4X66B 3K9HA 3OBBA 4KRGA 3BZWA 3PLRA 4XGNA 3IBFA 1AIPA 2BKAA 1ENZA 1DG9A 2NG1A 3DGFC 3QYJA 1OKKA 3QUAA 4UZSA 2DMRA 5B55A 1E98A 4IQ0A 1DRJA 2H5IA 2XCLA 1BMQA 5JZVA 2YN0A 1VHLA 1Y3BE 2CNOA 3INRA 4Y9SA 5KREA 3KWLA 3AEUB 1TVKA 2QLNA 4RIFA 2RG1A 4FK8A 3DT8A 3V34A 1OAOA 3DSRA 3I92A 1SIBE 3C0KA 4G26A 5ISMA 1DJQA 2VT2A 2GETA 1I0LA 1K7EB 1ZVQA 2OC9A 5E1BA 3STYA 4OF4A 3O2QB 2XZPA 4AJOA 3GEPA 4PE5B 2BMEA 2GESA 2BTQB 1N5DA 1ZMTA 1P74A 1F8GA 1YRAA 1GZ3A 3WL6A 3S4YA 3ZDFA 4CEJB 4W5HA 4DMCA 2IOFA 1JMKC 3IH5A 1HM5A 1LTQA 1B0ZA 3BBPA 2I91A 1U3FA 2Q1TA 4BTVA 4LN1A 1XQWA 3RRFA 1GGMA 4QXOA 3F6CA 3QOFA 1GADO 2OORC 1U0EA 3OPMA 4ZP1A 1D2MA 4NDNE 3DDOA 4MIOA 5F12A 3GDOA 3S6JA 1RI3A 2ZI4A 2PZBA 4BNIA 1COZA 5M5BA 1PEAA 3RRMA 2FRDA 1HLFA 1MO6A 1P0CA 3BJEA 1QP8A 3WR5A 1KI1A 1PEYA 4WEQA 2JJ2A 5CB0A 2EWMA 4CU2A 2XT6A 3BE6A 1RYMA 3VNAA 1GGJA 3OCUA 2A0XA 2JJ1D 3H9BA 4GECA 5BNIA 4UQLA 1PR9A 4V0MA 3TZCA 4A5OA 2PY6A 2F3SA 4DCTA 2IX3A 2E4VA 1JMYA 4XGQA 3C3BA 4JJZA 5K4GA 4YXFA 4GHWA 2CJWB 1Q95A 4IUDS 3GP8A 4D45A 2EERA 3K6KA 1RKVA 1GPH1 4FXOA 5EHNA 2E2WA 2QPLA 4NS4A 4FDTA 3Q41A 4BRWA 3D6VA 5FDFA 5DN9A 2KLHA 1ZUNA 2DR3A 2PX2A 2QV7A 1EDZA 3T7KA 5E9WA 5FLYA 2RGBA 5KNBA 4U8HA 3MTDA 1P0MA 4YUVA 5K0FA 4CT4B 1UMBB 2ZUUA 4K9NA 2Q49A 2CUNA 3SQDA 4LI3X 5LMZA 3OQMA 4MGZR 2QV0A 3C7AA 4HS4A 1Q57A 4ZD6A 1B76A 1XZEA 4P7FA 4U0JA 4YJGA 4B2YA 3CLSD 2ZRGA 4WFQA 4ZV7A 3T41A 5EWMA 5K8UA 1L6RA 1JEOA 1R0BA 1Y8QB 4LXYA 3I62A 1UADA 4KJXA 5JAZA 3KSBC 4DAEA 3ZWXA 1X42A 5CPFA 1I4DD 4N3AA 1WO8A 4RD1A 2XNDA 1PEDA 4XJSA 5KOHA 2Q27A 1KGSA 3HCAA 1DXHA 1JR3A 5LOVA 3Q4GA 2ZIEA 1BXKA 1K66A 1QV6A 1KH2A 2DBQA 3PEFA 1EWTA 3VYRB 2A0WA 4QFDA 5KC8A 1MXFA 2C57A 1BX1A 2IYEA 4HR7A 4HX2A 4DW8A 5KINB 3EZ6A 1BROA 1KYTA 1SVMA 4R8KA 3AI1A 1YFJA 1P17A 4GKBA 3MINB 4PYIA 2D1QA 4FFVA 4KXUA 4A0GA 4EJSB 3OP4A 1K75A 4MOWA 3KQNA 1JX6A 2EWVA 2ISSD 2ID7A 4RX1A 1GKYA 1VKOA 4RD6A 1L9XA 3VZSA 4XLZA 1OR8A 2OLEA 4WZ6A 2CKDA 4KO4S 3H1FA 1E2JA 1SCUA 3TLEA 1FVFA 2OB1A 5JANA 2MT9A 721PA 5LQRA 1EMDA 2FFAA 1BIFA 2JZCA 3D64A 3UIEA 2NTEA 1OLSB 2PQ2A 2JLVA 1E9DA 4K3UA 5CW2A 3HQ4O 1BGVA 2Q2QA 4C7JA 3WTCA 1N3LA 1YRWA 4QD3A 1QFSA 1V5WA 1Y4UA 3VPSA 1SQSA 4KN8A 2QYOA 3SQXA 2Q3LA 4HQFA 1LLFA 3O8OA 3W8FA 4F3CA 4GDMA 1Q11A 5C53B 1IN4A 3HDQA 2AXPA 2NADA 3V3TA 1B73A 2QRHA 1U31A 3PF8A 4IX1A 3TZKA 4V1CA 2WVGA 3VR0A 5FLEX 4E09A 2C2GA 1HE5A 1HFEL 2TRSB 3LUAA 2JFUA 5B1HA 4B3IA 3NHZA 1ACJA 3A6HA 1LPAB 1TOAA 4KQEA 4JXKA 2PL3A 3RVDA 1PDWA 2FPGB 4RTJA 4E2XA 3RB8A 4HDMB 1ODSA 4I14A 3OT1A 1K88A 1HURA 5CTAA 1ZKMA 5E9QA 4OHZA 1L7RA 1RM3A 5L6MB 1QU3A 5IU6A 4MVXA 1XVLA 2DHQA 2VHWA 3B7PA 3DONA 2YZNA 1SD2A 1CE8A 4NHEA 5ALIA 4UNSA 4RJTA 4KAAA 3N2KB 4CKCA 2VQEB 4X3OA 1W93A 4LTDA 3EGCA 1ZVMA 1I9CA 4HPJB 1BVRA 4JB3A 4LJLA 3NM5A 5IVDA 2XUHA 4J8PA 4ND7A 3WKAA 2ZJZA 2Q1YA 4QELA 2VNAA 4TT3A 1DPGA 3N39C 2BE7A 5DKFA 4LBYA 4RZHA 1SEVA 3CH5A 1Z5VA 4DCCA 3OAAD 5JAHA 1X38A 3R4CA 1JU9A 4YUZA 4NC9A 3WAGA 2Z0MA 1Q0TA 1TK9A 3IBGA 3HHEA 2CUZA 2J6HA 2FV8A 1E9RA 3EOBI 4LWPA 3RBZA 2QG9A 1Q83A 3EWSA 4KQ1A 5KHOC 3D1VA 3WOHA 1NBOA 1T2CA 1Y5LA 3D3NA 4GX5A 3LKBA 1P33A 1JH8A 3OO0A 3FAZA 5I8PA 3AVXA 1GPJA 3MS4A 3PQFA 4XWTA 5GADl 1GCOA 3VR1A 1RZ3A 3CIOA 3PRHA 4PXAA 4BCDA 3B3AA 3TD6A 4QBTA 3TQCA 4Y6SA 1O0BA 1OWLA 2HMWA 1GSIA 5BP7A 1MC5A 5J1TB 4ESHA 2B5WA 2HQBA 2R84A 3CWQA 5JECA 1C9YA 1LW7A 1E9FA 1EFPA 1SC6A 3BDIA 4FBMA 4NJEA 3R0IA 4NHOA 4XVHA 4P31A 1E9EA 4A5SA 4R0MA 1Y42X 2KYRA 2V3VA 3A1WA 1PG2A 3IR6A 1UXGA 1LGYA 1ZCJA 2W2VA 2XT0A 2ZWMA 5DXAA 4FMDB 3IBTA 3FSJX 1O94A 4OL9A 1KAHA 1RC0A 3MGCA 2OB2A 4QO7A 2DAPA 3QH4A 2AB0A 4KQHA 5AVTA 4HP8A 4M1WA 4RJKA 4YAIA 4H6VA 5LIRA 1K8XB 1T9ZA 4PM4A 4RTNA 4M1MA 3G2QA 5L4LA 5KO2A 2O57A 4GWLA 2HPHA 2R8YA 3FD8A 3ELBA 3QPUA 4MYRA 3G5LA 2IYNA 2B36A 2VJPA 1M76A 5TPZA 3SNHA 4O0MA 4UNRA 4HBZA 1IQRA 5AXDA 3HA3A 2XQFA 3K0CA 3DHNA 2G76A 2WFAA 5DISB 4NEGA 1GITA 3IVMA 3QITA 3GBSA 5T3UA 2FPWA 1A77A 1K1EA 5LQDA 4IQFA 2J3MA 4Z0NA 2W0SA 4MI1A 4UBJA 1QS0B 3PFHA 4DMGA 4EWLA 2AXQA 3GT0A 3CPSA 1YIAA 2QLJA 1W6RA 3WGHA 1BA3A 4CZ2A 3TIFA 4JVMA 4TMFA 1FUEA 1MZPA 5DFAA 5ICEA 4I4TF 3H9GA 1TLLA 2JFNA 1LVUA 2VZ0A 1R74A 4FCWA 4GPBA 5G2OA 3E61A 2ZRBA 4YJ3A 3ZU5A 2W5UA 3AGQA 4BO3A 2BH2A 2YFQA 1PGOA 2OHJA 1HDOA 4RLFA 3D3EA 4B0PA 2NPIA 1MAAA 1TL7C 2GD0A 4QL3A 5J4KA 3N2NA 4B6GA 4J0CA 4RWEA 1KR5A 5AKJA 3EGEA 1LFDB 2OZEA 3F67A 3OWHA 4M49A 3ADCA 4GVXA 1Y8ZA 3BWDD 1Z73A 3Q40A 2JIOA 1YB1A 5D7NA 4HTFB 3LK7A 4OFXA 4UBLA 4MDFA 4EENA 2QJTA 4HN2A 1XRPA 3PC7A 1JSZA 3PGLA 4O1MA 3H6KA 4MR8B 4QBKA 5K0EA 2ACVA 1CU1A 4WCFB 4EH1A 1V7ZA 3NHJA 1Z0SA 1GG8A 4EYEA 4BLVA 1EHCA 2PGDA 3JTMA 4EAAA 3ADBA 2EVWX 1M34A 2Y1DA 3CKYA 5ADWA 1MJFA 3N0RA 4JLNA 3CEMA 2VHZA 3E3MA 4MQFA 1KDTA 3DW1X 5HF5A 5C51B 1GQOA 1N57A 1TJ4A 3OQVA 2P6PA 1DBWA 1VI6A 1UP4A 1LWOA 4NARA 3N76A 1SY7A 2ZXUA 5HRAA 1T36B 1KRWA 2ZE6A 4IJUA 3DEZA 4M1TA 3H19A 3VKWA 3V6LA 2EYUA 4R2MA 3RUIA 3FNGA 4ZVKA 3MT8A 2NUPA 4WOCA 5FUBA 1CZNA 1UP7A 3RUPA 4HVLA 1ST3A 5BY2A 2AK2A 3HYCA 3Q5EA 2D0OB 2FSFA 5BSEA 1BE0A 3ESYA 1MKYA 5JCXA 1YZ3A 3H87A 1TM4E 4QUDA 2ZZMA 1XL0A 3SYKA 5KYXB 2D8AA 2YOGA 4DIOA 5DNWA 2II6A 3M1AA 4PAWA 2H3HA 4IM7A 5EE3A 5EL0A 3AM1A 1BJKA 2ETVA 3EW7A 2YWBA 2AR9A 4OEHA 1XK7A 2OK7A 2WJ3A 4OLFA 1YR9A 3QVLA 1VGVA 3LQYA 4LJ6A 2XRMA 1TADA 2O5VA 1U2GA 3QLEA 1S3IA 1DJPA 4IH1A 2IH2A 3ZXUB 3QYFA 1VZ3A 1ISJA 1NU8A 1EX7A 3DE4X 3QI7A 3W5SA 4TS9A 3TL3A 1TYDE 1T1IA 5K51A 1Z2PX 5CD1A 1HYEA 4IXDA 3R7NA 3D4OA 4OTZA 3LHFA 3RVBA 2GF0A 3K6SB 2IE0A 4ZA2A 5BW6B 3L1JA 1LLQA 4EHIA 2P62A 4IGAA 4JJAA 1PS9A 4O25A 2C59A 1D03A 3BWXA 4S2UA 4TXMA 4TUYF 5A4FS 2O8EA 1E3WB 5KWIA 3BF8A 1Q7CA 1Y8AA 3AERB 6CHYA 2ES4A 3GEHA 1D5WA 2D00A 5DBOA 3TQHA 4C88A 1UJBA 3DFFA 3MQ2A 4OHCA 2VUIB 2BSQA 3FPSA 3HLTA 3TB4A 5J2UB 3W0LB 1VJ1A 1KAQA 2XNJA 2YW2A 4JLMA 4M0PA 2X9NA 2HIGA 3NUZA 1PJQA 4ND1A 1T6YA 1M2JA 2FHSA 2AOWA 4NPCA 1T5TA 3ZZNA 5CVDA 3ZBPA 2YFYA 2F67A 4TSFD 3W2IA 4YAKA 2MINA 3YASA 2G04A 2JHCA 5H0IA 2HBZA 2VDMB 5AFSA 1FUIA 1MMFB 2H3EA 2FETA 4OM7A 4WOPA 4W1SA 1MQSA 1OE0A 3C3CA 1P4JA 3FM9A 3HCWA 3SVLA 4OXRA 3FLEA 4NU8X 4Y98A 3SBEA 3QQPA 2GYVA 4IJVA 3CUYA 1R64A 1ZM7A 1KI8A 5FL7D 3I9KA 3WMEA 4Z7NB 5AM2A 5B7NA 4LJ4A 2AW5A 4BQEA 1XMSA 4C07A 1OAKA 5IAGA 5L7WA 1LDNA 2H0RA 1A2OA 4ZXFA 5B12A 1G3IA 1JEYB 1U9IC 4RDIA 4AECA 1ZBQA 2WDZA 1X1BA 2WKPA 3VNQA 5CD9A 5ARDA 3V8PA 1JALA 2PGJA 4AKHA 4X7PA 2C3YA 4MA5A 4QUJA 2HTFA 4WT7A 5TMEA 4WZZA 2QRLA 3GG9A 1OB5A 3VH1A 2HWKA 3FPGA 3OOEA 2AK3A 2D0IA 1AQYA 2KJQA 3FWKA 3KYDB 2EATA 3F3YA 3O75A 1QIKA 2PKWA 3AF0A 1PQ4A 2FEOA 2X7JA 3MTAA 4PPNA 1H9CA 1M2VB 1QH0A 3VJKA 2Q29A 1S5PA 4HAIA 5FNZA 2VJBA 1QQ5A 1IEXA 1RHMA 2OV8A 1Q12A 3BICA 5L4SA 1R18A 4GQAA 4YECA 5BOVA 4JBGA 4LNUB 5B57C 3SLRA 1GFIA 1XRQA 4LHWA 3MCZA 4AAYA 1KAGA 2FWMX 5I8ZA 1V2HE 3WYNA 1P4RA 4M7WA 4D46A 4Z4IA 1XVVA 1TA9A 2X5NA 5CT8A 1FJGB 3LY8A 4X1KB 4YMSA 3MGGA 1QHFA 3R40A 4N39A 4B34A 3V55A 3FIUA 4M0FA 3H9QA 3AINA 2EBHX 2CK3D 5LBTA 4U2GA 1B23P 4OKSA 2YIVX 1SCKA 2D8MA 4M9UA 4N7RA 4WESA 3SE7A 4YALA 3O8DA 2WMNB 4BZWA 1UZUA 1CYDA 1FY2A 4AIRA 1DO8A 5F21A 1TO6A 4XCQA 4P83A 3KD3A 3GLFB 4H15A 1OU0A 1ECLA 2QN2A 3G2JA 5KI6A 3QVOA 4QGAA 5DI3A 3AY6A 3RU9A 3A10A 3ZYCA 2R7MA 2ZJ0A 3KWMA 3OTIA 4KYIB 4ID3A 3LF1A 3MG9A 1OJ7A 3ILSA 5ESDA 1CC1S 3ICPA 3GLIB 1EUQA 3BGOS 3HCRA 1FMTA 4F92B 1DBQA 1P4AA 1SA0A 3KJQA 5DCYA 1IK4A 4AT1A 4EUSA 1YC5A 3EFOB 2NX2A 1VJ5A 3KELA 1ZISA 2RDMA 4LXQA 5KNCD 2ZIXB 4R8MA 3ZU6A 2FVYA 4NCBA 6PFKA 4WBNF 5BSRA 4AUKA 1J70A 1W96A 5EWJA 1PJBA 4DV6B 1LC0A 3HFGA 3DTVA 4P1ZA 4DLXA 4QX6A 4J9UE 2CWWA 3IS3A 4H1VA 3UJBA 2CMHA 4DJTA 1RU3A 4U00A 1BOOA 3RLFA 2VC2B 4EZEA 1ZRSA 4L15A 1AQNA 1BDHA 5AI9A 4L9RA 4J1QA 2YDYA 4X71A 1FIUA 1GSAA 3D6NB 3KJGA 4UVGA 4DMKA 1W59A 1EUZA 1QWOA 2BHRA 4E13A 2RHJA 4PX5A 3ZNNA 3I6MA 3ZI4A 3UGTA 1H6CA 1E79D 3HKCA 4O4LF 3I23A 2OFXA 3DO5A 1WMEA 4GLOA 3G9XA 3SXPA 1WCXA 1CR4A 3A11A 4JWTA 4BV3A 1TM1E 1DXQA 4JT2A 5KOJA 3A37A 2NWQA 1HNXB 3VOBA 4V24A 2WM8A 5GOTA 3URMA 2FN3A 4GS5A 4J1TC 2D3WA 2OFFA 2ZR7A 5LZ7A 1OFUX 3ZZMA 1PV2A 2B1RA 1T1SA 2P4QA 5ARCA 1QIGA 3V2GA 2CVPA 1MV5A 5ICMA 2DQZA 1A4UA 1I10A 2KE5A 1RQRA 3EA4A 2CXXA 4H3SA 4KGDA 2PUDA 1I01A 3HHPA 5DV9A 1WMFA 1DELA 4DWVA 2IELA 2C0PA 4PBTA 4DCOA 4QGBA 4EYGA 4GLLA 1CNMA 2XUPA 4XPIA 1YFKA 3PA8A 5K3SA 1RXYA 2X4GA 3GLHB 5C7OO 5HIMA 3SKYA 2GJAA 1QHHA 2YXBA 1SG9A 5I45A 2OCKA 4F2DA 3AWDA 4JI1B 1YIDA 2OM2A 4RA9A 3ZY2A 4E11A 1JG4A 1G9TA 5GTDA 4FKZA 2PS9A 4CDRA 1O97D 1VJRA 4RC9A 3ZU4A 2YZGA 2Q45A 3IT0A 3OF2A 4IH4A 3ZI7A 1LDYA 3FMVA 3DJFA 2PIDA 4JJEA 3HJCA 3SM3A 3TB6A 5AIBA 3PDJA 1HYBA 4EG1A 3WNZA 1OWNA 2AWNA 3BFPA 3QVWA 2JAUA 4XWGA 1OFVA