3HP1A

Crystal structure of human dck r104m/d133a in complex with l-dt and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
226
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extending Thymidine Kinase Activity to the Catalytic Repertoire of Human Deoxycytidine Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 81
structure length 226
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hp1A00
4JIMA 4M4SA 1DAMA 2WWXA 4POAA 1RKBA 1ZNZA 2IXFA 5A4JA 3LDAA 4X8LA 4GP7A 1UADA 2ONJA 5JI3E 5F9FA 1JXMA 4W5WA 3PEYA 3L0PA 5L8VA 2BWJA 1ESNA 3PUYA 3CWQA 1N6LA 1SVIA 2EVWX 2Z4RA 3K8YA 2VSXA 2RGAA 4QHSA 3U60B 4C7OA 1E94E 3TRFA 2B6HA 4BRUA 1E79A 1M6NA 1LVGA 4LBVA 1VDZA 4Q1DA 1K6MA 3GCGA 4LHZA 2OBLA 1KZGB 4KYIB 3H86A 1YZNA 2EFGA 3B60A 3NBXX 4HAVA 4UQOA 2IX3A 5BYJA 1QHNA 4M8NE 4XWOA 4E03A 5JBQA 3ZLJA 2VIIA 1L4YA 1RRFA 3ASZA 4JLJA 2J0SA 2RCNA 2QP3A 3VAAA 3SHFA 1OXXK 4JSTA 3TH5A 3EZ7A 1M8PA 2CVFA 5DISB 1X1RA 3VR2A 2HJGA 3RS2A 3ZZTA 1UDWA 2OFWA 2AD5A 2CL0X 3CKLA 3IHWA 2QTVB 2ZJAA 1ODFA 4DCVA 3X1ZA 2X8AA 3QJYA 1P4SA 3EWSA 1KKLA 4BFUA 4AWXA 1W2GA 1FFHA 1Z3IX 1UPTA 3GLGE 3KXKA 1E9DA 3T1VA 1U0LA 1DO0A 3CPHA 3NBYC 1XEWY 4DSOA 4NCKA 3VQTA 4AK9A 3GQBA 3HDTA 5FL3A 1G8YA 5G53C 1XCMA 2OT3B 2HXYA 5KSPA 1ZC4A 4LJ5A 1CBUA 2FZ4A 2HDNB 4QRHA 3TW8B 2DFLA 2ZU6A 5HZKA 2ZM5A 1TQ4A 1TQDA 1M1YE 3OE7A 3RVBA 4B2PA 4M9XA 2PEYA 4NE2A 4DLRA 4EQ6A 2WWHA 2WKQA 4NONA 2HV8A 3T1OA 1EG7A 2VSFA 2PLRA 3OF5A 4BWYA 1X8KA 1KJWA 2QAJA 2QN6A 2JIZA 2QP9X 4M1WA 1CR1A 2XXAB 5H1YA 4JT4A 1X8JA 2CHQA 4HUTA 2F9LA 4YONB 3VTKA 4TYNA 4OK3A 5EUMA 4J0QA 3T15A 1DAEA 5KNCA 2GJKA 1FP7A 3CX7A 5CK4A 2WZQA 1OB2A 4ASUA 4E5UA 2D2FA 4GOXA 1HA3A 4FD2A 4GPTA 4M1SA 1UBFA 4G3XA 4EDHA 2XSZA 3SYLA 4DJTA 2G3YA 3BRWD 1Y63A 1FQKA 4CVNA 3V00A 4DUGA 2QBYB 1D6JA 1T5LA 4B2LA 1IONA 4H9GA 3IEVA 1G16A 2QTFA 4LGMA 5EQTA 3C5HA 4TL9A 5KYKA 1XTJA 4FMDF 4KLZA 4PZYA 4EKDA 1SXJB 2IYYA 5SZJA 1KZ7B 3KFVA 1U0HC 1Q0UA 5AUOB 2N1BA 5LBIA 2IYWA 1NJGA 1U94A 2RMKA 2L0XA 3DO6A 3NBZC 2W0MA 3AP1A 3OEHD 4RSGA 1KY3A 1UBEA 3AKYA 3RRZA 1E4YA 4TMZA 2IS2A 4B32A 4U5XA 4FMCF 4HATA 4QL3A 2BBTA 1N6NA 3VU9A 1A2KC 2QSZA 3OAAD 1BS1A 3U4QB 3KJIA 4Q9LA 2CXXA 5AWFC 2WTUA 1T3HA 4RD2A 5AJZA 1LNZA 5HCIA 3FOZA 4JVLA 3TIFA 1FMLA 1FMJA 2GXUA 5EJEA 1DADA 3SZRA 1N5KA 2FFBA 4NP6A 3VHLB 2W2VA 1U8ZA 1KYIA 1NLZA 2QMHA 1XCPA 2ZRAA 3LVQE 1KMHB 5AR1A 2OSBA 3PEWA 1W0KA 5EXXA 4NCNA 4ZDJA 5FH9A 4PZZA 1E0SA 1VMAA 1W5TA 4KAXA 4AY2A 1XMJA 2XITA 3SC3A 1OLOA 3W34A 3HJNA 4HLUA 3WNDA 2ORVA 1S0UA 4D0LB 2OXCA 4TLBA 1HY3A 1IXSB 2ZIAA 4JL5A 3IDQA 2GJSA 1OXSC 5EXPA 4N0EA 3V4RA 3K0AA 2ZAMA 4BZPA 3LLUA 4LBZA 2XX3A 3T1TA 4UNSA 1M2OB 2DFNA 1CS4C 2F43B 1MV5A 3CNOA 4WVFA 4PAOA 4PSVA 5DGXA 3FHTA 2A3RA 2QMUA 2YOFA 3RSOA 2MMGA 3FDIA 2KB0A 2JLVA 3WYAA 4A0GA 3T35A 4D0GA 3U7GA 1E1RD 4HB0A 3CW2A 2ZSAA 4DRZA 4ZCIA 1RIFA 3ZVLA 4AYXA 3R8CA 2QU8A 2D4HA 5LD2C 3QXSA 1S9HA 2Q9BA 2ZRMA 1N6RA 1T9HA 2BHRA 3ZS9A 5FI1B 4BLSA 1CRPA 4DIEA 1J8MF 3TSWA 3E5HA 3PCRB 2PZGA 5JEEA 1HQYE 4KV9A 3MLEA 3C41J 1EGAA 1VG8A 1NL3A 1P2TA 1NBME 3CH4B 3AB3A 3QXXA 1EWRA 2WV9A 5AK0A 4TMKA 5EXTA 4NYJQ 4ZDWA 2PX3A 4KYUA 4PXAA 4TT3D 5E7MA 1WXQA 1EX7A 3EZ9A 1HYQA 3W3AA 2W83A 2BOVA 3D6TB 3QNUA 4MGYR 1CF4A 2RGXA 3RWOA 3T1QA 5JRJA 3DMNA 1G1MA 5EP1A 4EPRA 1E0JA 4BFSA 1Z6YA 3QEOA 2BM1A 5AJWA 4MRVA 4IEIA 1KNXA 2G0NA 2J7KA 2CLSA 1EXMA 2DY1A 3EA0A 2F1HA 2NZJA 2WHXA 2AXPA 1Z07A 3CH5A 4NYIR 3VFDA 2R9VA 3OFND 4PX9A 4CT4B 2JJ1D 5BWMA 3D8BA 4QGHA 2ONKA 5CJ2A 1TU4A 4Q4AA 5CDFA 1JBKA 3VR6A 2NO6A 3KFXA 3U3KA 1MT0A 4UJ3A 4CW7A 1MOZA 1KO8A 821PA 1IJFA 3RABA 2GBLC 2PZEA 3BH7A 4FIDA 3LBIA 5DHAA 4X8HA 2C04A 1IJEA 4QGFA 4LJYA 2GZDA 2PJZA 4LHWA 2FSFA 2O5VA 2WAXA 3HYRA 4FN5A 4W7SA 1G3IA 1ZD9A 2QORA 3ZYCA 2FMXA 4LOAA 2ZSFA 4A4DA 2AFIE 2D62A 1TU3A 2OG2A 2O8FB 4FWIB 4RZUA 1QHYA 3THXB 4RCZA 4BLQA 1Q21A 2CMKA 2OM2A 1NJFA 1AZTA 1H8ED 1J2JA 2A9KA 3PUXA 5FOWA 1COWD 1G64A 3ZD6A 4DLTA 2FDCA 4KI0A 3NHAA 3IIMA 4LHVA 1FX0A 2ZI6A 4ACAA 3I73A 2ZJOA 4AG5A 1NG9A 3AVTA 5B64A 4AYWA 1YZTA 4YMSA 2C98A 3OIVA 1R10A 3GLHB 5IK2A 4RZXA 4NYJR 1ELOA 2OXRA 2W6ID 1OFHA 4BLPA 3FVQA 3DOEA 4IFBA 2DFKB 2OBMA 5FPYA 1SVSA 2ZI7A 4C2TA 1Z0FA 2C03A 2YNMA 1LTQA 1OJLA 5EE5B 3RLFA 3SU8A 4MUAA 1E96A 1L4UA 2ANBA 4MGKR 2C95A 1W47A 4PQFA 3G0HA 2CBZA 1DAIA 3B7GA 1AGRA 2ZU0C 4Y0AA 3N70A 1U90A 1MH1A 1D9ZA 2CCGA 1OPXA 4RY2A 5GJWC 4OQNA 2BBOA 1KMQA 5JFGA 1P5ZB 4E22A 4V03A 1W2HA 4JL6A 1AQUA 3M4YA 2CJWB 1N25A 1LF5A 3PUWA 1PUJA 1MRNA 1TQ6A 3JVUA 3K0SA 2ZRIA 3KKNA 1KK3A 3W9YA 3AQ4A 3SJZA 5JCZA 3SR0A 5DN6D 1CR4A 1NF3A 3B1VA 3ZIAA 5FPKA 3U3MA 2P0EA 2BBSA 2GCNA 3F8TA 2BKUA 1NVVQ 4YDHB 1KJZA 4DCSA 1EFCA 2F3RA 3WHKA 1OF1A 2HLDA 4C7OB 4DKXA 4ESVA 5CK5A 1FTNA 2VP6A 1XMSA 4BFTA 5IHPA 4UNRA 5KTYA 1T8UA 1A1VA 3U2QA 4ARZA 3EG5A 3LO5A 2VPPA 2DFTA 3PFIA 5C18A 2NQ2C 3PVSA 4TYWA 3LWNA 3FGNA 2GCPA 4XD7A 5JMTA 2QPAA 4HZUA 1J8YF 3L0OA 1Q1ZA 2B92A 3SNHA 1OXVA 3FYHA 5JJIA 4RFSA 4GZLA 2J0VA 3EA5A 4O3MA 4KVAA 1U99A 4CDGA 2IUUA 3TGPA 2XB2A 4PC6A 3WBKA 4FWTA 1EFHA 1UAAA 3F0TA 3QVUA 1GL9B 3LD9A 3BFVA 3QXJA 5DSZA 2FE4A 4GMDA 1W44A 2R8RA 2NO7A 2WVJA 4IVRA 2IHBA 5EP2A 1ESMA 4A8JC 4M53A 2J5XA 5TXGA 3SBEA 5BN5A 4GBMA 5KDLA 1CULC 1YZGA 3B85A 3AEZA 5FTNA 2F43A 1IBRA 4W9MC 4HDOB 1K5GA 2E1RA 4C0AC 2O8DA 2BMDA 2WPDA 3K9NA 3IIJA 5J5CA 3UWKA 3B9QA 2OEPA 3I61A 1V43A 4RD0A 2BV3A 1S96A 2OHFA 3VU9B 3HR8A 3AUYA 5BN3A 1A2BA 3GLIA 2JA1A 4Z54A 4B71A 4DLXA 2IUTA 5SZIA 2P67A 2MSEB 2OAP1 2XZOA 2DPXA 3A6PC 2QY9A 3SE0A 4BFXA 4UXHA 3TSZA 2D7DA 4KFTA 3DM9B 4NCIA 3SN6A 3W8NA 5JCPA 3IBGA 3CRQA 2EYUA 3GEHA 2A5DA 4LPKA 4DC9A 1OKKD 3NG1A 2BMEA 2ATXA 4D4KA 3NDBB 5JLJA 1T5IA 3R8FA 2OCPA 3ADBA 3PIRA 2I4IA 3FWYA 2ZE5A 4BZQA 4G1UC 2WWGA 1XJCA 2ERXA 4I81A 5GADl 1FOEB 1XTRA 2AHOA 3G82C 1QHSA 2Q6TA 5FUXA 2J7PA 4XVRA 4UNNA 4K46A 2I1VB 2Z83A 1JEDA 2CNWD 3KX2A 4HAXA 4RD6A 1ZM2A 2IHYA 2WSSD 1G3QA 3FKSA 3B1ZA 2W00A 1NKTA 1XMIA 4G5RA 3TUIC 4JKIA 4A6PA 2VF8A 2VYFA 4FCTA 3WY9A 1SXJA 1XTQA 1W1WA 2R6GA 1FL9A 1XDBA 2ZJBA 3KDSE 3MUFA 3QOFA 2RGCA 2RHMA 3EWAA 1HV8A 2V7QD 2F3TA 1G5RA 1ONBA 3K9HA 1G17A 3JZAA 4LZZA 5GJCA 1DG3A 3W8RA 4D4LA 2F1RA 3LRPA 1LW7A 5FOVA 3CM0A 4OI4A 2JLZA 4IOMA 4C0LA 3SJAA 2OBNA 2O8CA 4QJ3A 1FX0B 1U8AA 1G19A 4P4SB 1BYIA 3EC2A 4JLAA 1MO5A 3A4LA 5KNBA 2ZR9A 3AVXA 4G0NA 2F6RA 2D2EA 2ZUBA 2OESA 1T91A 1E98A 2P6NA 4C0SA 3BIFA 4L9SA 1JQJC 2RGNA 1WBBA 4CGZA 2C2HA 1ZAKA 4OHVA 4TLAA 3DVLA 4JMPA 3ADCA 3DL0A 5GJBA 1QHHA 2FGJA 3V9PA 4NYMQ 4E09A 4HDQB 4GP6A 3IUYA 3ZDQA 4PFSA 2G88A 3C15C 2XTZA 1W0JA 1XEFA 1QDEA 2PCLA 2ZE7A 3ADKA 3P20A 4TL7A 1DEKA 2W6JD 4ITRC 2C8VA 4PC7A 1Z22A 2FEOA 4GOKA 4TTPA 1E2LA 5KOYA 4G01B 4RKFA 3SS8A 4F91B 3FKQA 4ZIRB 1S9DA 1MO3A 1N6OA 1YKSA 2GRJA 2IC5A 5L3RA 4FMCB 3QG5A 1GRRA 2QE7A 2P2LA 2ZYWX 4URYR 4Q1FA 2C99A 3H1TA 1H8HD 1XFAA 5KSZA 1IXZA 1I4TD 1SULA 4F38A 3GJ8A 2WWYA 2CHVA 1CTQA 1E2HA 5EE0A 1US8B 1TL7C 3T5GA 2HYDA 2B21A 1AQYA 5L3QA 3GJ7A 1CJUC 1QF9A 2QGZA 4QNMA 3TR0A 4D2IA 1DAFA 3LXXA 4UXJA 4DEYA 4ZV4A 1E2QA 1E9SA 2ZQ5A 1OHHD 2BCJQ 2VL7A 1US8A 4X8MA 1P72A 3AP3A 1C9KA 2FF7A 2ZI5A 3F5FA 4QGGA 1GKYA 1E2KA 1KI8A 1OFUX 2B8WA 3I32A 3I8XA 2WMNB 4FCWA 4MH0R 4TYYA 5FL7A 1SHKA 3EXAA 3GLFB 1Z28A 3BB1A 4OQFA 3VR4A 4Q4JA 1OT3A 3X1DA 1VG9B 3K70C 2WOJA 5E3HA 2BVNA 4DBLC 4JLOA 4ZKEA 1P3JA 3THYA 1FUUA 2J3EA 1IN5A 1GL6A 3BBPA 2IYSA 4DEXA 1NMZA 4EJSA 2IT1A 2JDIA 1IN7A 1I4LD 3GP8A 2JLSA 1CU1A 4LJ9A 4NYMR 5FOXA 4OHWA 1FNNA 2ASEA 2C77A 4PAQA 4PAMA 3UMRA 4AIIA 3ZVNA 2X2EA 4PPNA 1UBCA 5FBRB 2QPOA 4PZLA 3KXIA 2Z43A 1NVXQ 3DHWC 1HUQA 1P2SA 3Q5DA 1WCV1 2VBCA 5DO9A 3ZD7A 2O0JA 4QC2A 3QPWA 3RANA 3FMIA 4MA4A 4XVUA 3IO5A 4ERNA 4XSGA 4NKRA 4Q19A 3LV8A 4QG7A 1S8FA 2DHRA 4Z8XA 3GEEA 4Q18A 3GLGA 3SJCA 4A8JA 2O0HA 3GFOA 1GNPA 4Q9HA 1IN6A 3B1XA 5LPNA 5DH9A 3U7HB 1LFDB 2GEDA 1F2UA 2KBFA 3M6AA 2Q21A 1W4AA 3I8SA 4B2IA 1XD2A 3Q3JB 5EZ6B 1YR6A 3KKPA 4BE7B 4OHXA 4Z51A 5GVSA 4LYHA 3UG6A 3LH5A 3CRMA 4JS0A 1XX6A 2EFHB 1M7BA 3RHFA 1M7GA 2HEIA 2IA5A 5J4HA 5AJVB 1B23P 4AKEA 2CHGA 2MSCB 2YWGA 1W49A 2AXNA 4GFDA 2V1UA 4AI6A 2GESA 4HDCA 1NBMA 1TF5A 2WJIA 2B8TA 1WA5A 5LB2A 3KQUA 2QRNA 2WM9B 4JJZA 4M9QA 3WYFA 2QBYA 1ZNYA 2NG1A 5J40A 1EFRA 2BBWA 1HE1C 4FMBB 1E6CA 1LV7A 2ZRNA 3ICEA 3GEIA 5HPYB 4KVGA 2WJJA 1DAKA 1DS6A 4B75A 3I5YA 2VRWA 1ANKA 2ZRBA 2RGBA 2QSYA 3CZQA 3D3QA 2R6CA 1FPMA 2PCJA 1KDTA 3DMDA 3NWJA 4YMUA 1VYVA 1Y3AA 5FTJA 4ESHA 5FPSA 1NRJB 3GLHA 3PUZA 2GXSA 4WOPA 5EE1A 3KJEA 1ZP6A 3GFPA 1ZU5A 1XF9A 4JYCA 1YQTA 4O0MA 4C0QC 4RVCA 3CX8A 4XVQA 2C9OA 4WAUA 1SQ5A 1CJKC 3KB1A 3LLMA 1RJ9B 1KI7A 2IW3A 1DARA 1KI6A 2GVDC 2QP4A 2QT0A 3KZ1E 3CPEA 3PEUA 3MJHA 4FW9A 1QVRA 4HLUC 2Z5FA 1G6OA 3A4MA 3U3RA 4HUQA 1SXJC 4C30A 3SHWA 1ZNXA 2V1XA 1NSFA 4RZ3A 1YR9A 2OAQ1 3SI7A 3D7MA 1BMFA 2XGJA 1WB9A 2YC4C 3IILA 1XRJA 5SZKB 3TE6A 3U7EB 4F92B 1DVRA 2OLJA 1XNJA 3VX4A 4TLCA 4A0RA 2ODEA 4B3XA 3LX8A 4ZCMA 1RPZA 3AM1A 1FTSA 1VTKA 4DXAA 3KQNA 1KI3A 1YZUA 3L8ZA 4Q03A 1Z6GA 1F60A 3UG7A 5BYKA 3EC1A 4LSGA 1ZYUA 3UK6A 3EPJA 3X2SA 2G9NA 1G4UR 1E69A 3Q7PA 4YC7A 2LKCA 2ODNA 5TV2A 4WZBE 3I72A 1EFTA 2FFHA 2QAGB 1IHUA 4L9WA 4V0NA 3NTUA 1KGDA 1P9RA 1IM2A 2SHKA 1Q22A 221PA 1TMKA 1VIYA 2FGKA 1P9WA 1OYWA 3MCAA 2A5GA 1P61B 4MYTA 4NPHA 1U8YA 4TMWA 1U98A 4WBSA 4ZCLA 4TMTA 4YXWD 1D2MA 1G20E 5ELXA 3KQLA 3H2YA 1KDOA 2P5TB 3OEEA 4IJMA 2GJAA 4Q5IA 3M1IA 1OXUA 1CKEA 3I1FA 3RNLA 2FOLA 4HUQB 1OFTA 2ERYA 421PA 1CEEA 1UF9A 3CWZA 5DIFA 2XAUA 1JECA 4K8OA 3FFAA 4HAZA 5FUWA 4JLNA 2JASA 4C0BA 2ZETA 5JI2E 2IYTA 2ZEJA 4JBYA 4IDQA 3QVVA 4TSFA 1YR7A 3A1UA 2H18A 2IEYA 2ZSDA 1Z0DA 1E2EA 2VF7A 2F55A 1XXHA 3RS4A 5FPHA 4A2QA 4Q02A 1MO4A 2W0SA 4ASUD 1GNQA 3SJBA 1KDRA 1U9IC 2QROA 1S2MA 5JRZA 4ZKDA 3UPUA 1R5NA 1UJ2A 1T3SA 4PC3A 3LBNA 4YMWA 4EUNA 4IXMA 4KO8A 2J45A 4MKGA 5L3VA 1KI9A 1W4CA 1RRGA 4LX0A 4B3DA 2R6FA 1ZU4A 1IAQA 1KI2A 3AVUA 3KB2A 2RGGA 4Q7KA 3BE4A 4LYJA 1X1SA 4LV5B 1JQLB 3A1VA 1QG4A 4PTLA 1JALA 3K0FA 3TW4A 3BB4A 2EWWA 4Q9JA 2RGDA 4B47A 4ZIRA 3MWYW 4OJKA 2FFAA 2X1VA 5FFMA 2GKSA 1OH7A 4EJSB 4OK5A 3TJZA 1VECA 4DSNA 5JWOA 4CYMA 2UKDA 2YC2C 2REBA 4OQXA 5J4VA 1GG2A 2H92A 4Q1CA 1Q44A 1XBTA 4Z1MD 5JECA 1Q57A 4MRRA 4DT1A 3BORA 1ZUNB 4IEEA 4NHOA 1MABA 3U4QA 4L5BA 2O52A 1BKDR 4HYYA 4P0TA 4QHYA 2H5EA 3QBVA 1XPUA 3AF4A 2Z0MA 1ZINA 2AL7A 3D31A 3EZFA 4PHFA 4LHYA 2UZIR 4B6FA 3FE2A 3L0SA 3ZS8A 1OSNA 3LXRA 1W0KD 1HE8B 1SKYB 3HP1A 2BCGY 5G40A 3N2IA 4JLDA 3TBKA 1HT1E 4FI3C 1W36B 3K0EA 3OIYA 2QI9C 2CK3A 3AF0A 1IQPA 1KK2A 3E70C 2PT5A 1UKYA 5JJLA 2J0QA 4MUBA 1W4RA 2ZYVX 3SQXA 1O3YA 3C8UA 3HYTA 5KPJA 1P2UA 3B8HA 3LAWA 5HZHA 1RRPA 1QBKC 1Z2CA 2MMCA 3DPUA 2JLWA 3ETLA 2QA5A 2GCOA 1S3SA 2GTPA 1KO1A 1KO5A 1XTIA 2EW1A 4LC1A 5DI3A 1O87A 1R0ZA 4M1OA 4ON9A 4QBGB 4GNKA 4TYQA 3KKQA 1G4AE 5CM8B 3TQCA 4CEIA 6Q21A 3SBDA 4IDOA 2ZI4A 4US0R 1OIWA 5FTLA 3LVRE 2GEUA 3W6OA 3QQ5A 4DCTA 1DELA 4Q48A 3C5CA 2GF9A 3ECCA 1TUIA 3VR3A 2CLCX 4W5JA 4DWJA 3EPLA 2RKOA 4BQSA 1I2MA 3H84A 4O25A 4G5GA 4GT1A 1XCGB 2AKAB 3NKVA 1GM5A 1I4DD 1E2NA 5JHGB 1U81A 2ZS9A 2VEDA 5L3QB 1TQ2A 1M7HA 2FNAA 1K5DA 2FJUA 1D2NA 1OW3B 3R20A 4D6PA 2OILA 1FUKA 5DLQC 1PLLA 621PA 4BFZA 2BEKA 2RGNC 4GRAA 4MRPA 4YQFA 5CB6A 4A36A 1OB5A 3IGFA 1UM8A 4B43A 4XWAA 3UMSA 3PJRA 2QM7A 2A7QA 2X19A 4FMDB 4EQ6B 2XZLA 2YINC 4DLUA 1ZM4A 3VNVA 5FBWB 4B3GA 4Q01A 1N5LA 4ABYA 4N3NA 1WQ1R 3LY5A 4C3ZA 3AKDA 2O8DB 4EFMA 5LDDC 2ORWA 2QAGC 1Z0KA 3HU2A 3N2EA 5IF9A 1OH6A 3TKLA 4A2WA 2VP9A 4Q4LA 1PVOA 4KBGA 4JLVA 3AF2A 1FQJA 3HU1A 1IY2A 1XTKA 4X8OA 3SQWA 1MO6A 2VA8A 5TVKA 1E2DA 4TMXA 4UJ5A 1G21E 4MYUA 4NDZA 3U5ZB 4TQUS 3X1YA 5IRCD 1AIPA 2VTKA 2IXGA 3BC1A 2PMDA 4HZIA 1G6HA 1H8EA 1RRCA 4MKFA 4PHTA 1COWA 1Z0AA 1LY1A 4MRNA 2CVHA 1ZRHA 4ZDKA 1VPLA 2ZTSA 1XB2A 2H1LA 2XZPA 3EZ6A 4JBXA 2GVZC 3QKRB 3PITA 2BC9A 2QNRA 2W6IA 1R0XA 1RW4A 5ANRB 4CF7A 3R7WA 1E9AA 1TX4B 721PA 4A8JB 1XXHE 4GDFA 5CIWA 4KSBA 2ZVQX 1KO4A 4M1MA 2XNDA 4A0FA 2A2ZA 3BOSA 5AJYA 5D3MB 5TY0A 1F2UB 2OCBA 1TF2A 4TZ0A 3L2OB 3P32A 4PC1A 2ECKA 1F2TA 4CT5A 4G5SA 2D06A 3VHXA 2NPIA 5TDHA 2JEOA 3TUJC 3GLGB 1VHLA 1RYFA 2WJVA 1AJEA 1NN5A 5BXQC 2FWRA 3L0IB 4MYHA 3W6NA 5JS7A 4QJ4A 2D74A 2O8BB 1XWIA 2QAGA 3QF7A 2JLUA 2GF0A 4CEJB 4NCJA 2CCJA 3RS5A 1JR3D 4BUJA 2IS1A 1G3UA 3IO3A 3EIEA 3H0KA 1KMHA 4BLOA 2Q3MA 3WRXC 4V0MA 4KLNA 3QKRA 1OE0A 5CITA 1Z83A 5J4LA 1W4BA 3W90A 5CB8A 2PMKA 4DSUA 1JXOA 2J87A 1Q1EA 3QI2A 1Z5ZA 1G8FA 1XZQA 5KDOA 2HLDD 1G7SA 1QHHB 1UEJA 1P60A 4H1VA 2KI5A 3DKPA 3BB3A 2O8CB 5DI9A 4BFVA 2G83A 1G8HA 4BFWA 4HB4A 1EX6A 4LPSA 3DOFA 5EE3A 4JVNA 5L3SB 4A6XA 1WBDA 4BEBA 1R2QA 4N0DA 5G3YA 4WZ6A 1Q3TA 4IOKA 1E32A 3L43A 1A5TA 1AK2A 1IN4A 2Z4SA 5HE9A 2XOKD 4LK2A 4DZZA 4HLCA 2D3WA 1GL7A 1KI6B 3A36A 4LRWA 5KHOC 5KU1A 3K70B 1N3BA 5DYGA 3A37A 4R98A 4V0KA 2CE2X 3KQKA 3O8CA 2GK6A 4Q21A 1ZC3A 1R7RA 3VMFA 1XEXB 4URZR 3NXSA 2IL1A 4DDUA 5CIQA 3QXHA 1NMXA 1GNRA 5HCNA 1XJQA 3EAQA 4HB3A 4IHQA 4QOSA 2WBLC 3SOPA 4UXIA 5C2JB 1D2EA 5FI0B 4B76A 2DWPA 3MWLA 3Q85A 1DO2A 4R7ZA 1SZPA 1JB1A 2V6IA 1XPOA 4Q9IA 4C9BA 3TR5A 4AYTA 3NHBA 3NH6A 4V0LA 3CR8A 1SVLA 3PXGA 1E1QA 1CIPA 3GFTA 4M21A 2VSOA 1NY6A 2IS4A 3T12A 3DZDA 5H8WA 1KY2A 2WJGA 3GD7A 1T8TA 3CF6R 3I3SR 4Q4HA 2FSHA 2J41A 2IYQA 1XD9A 1A7JA 4AC9A 4D26A 4Z8YA 3RAPR 2ZJ2A 2C5LA 1E2MA 1RYHA 4B74A 3O8BA 4QHTA 3WYGA 3BH6A 3EARA 1E9BA 2NZ8A 4YLGA 1KJYA 2RH5A 1X86B 2HF8A 2GEVA 4FCVA 1KIMA 2UVQA 2VP2A 4R9UC 4I1SA 2IK8A 3AKEA 3IHLA 3FHOA 1LB1B 3RDPA 2RB4A 4HSEA 1J90A 1Z29A 2H8KA 2ANCA 3U44A 1JI0A 1XXHB 1PLKA 1TADA 3R9IA 3SYNA 2JJ2A 3K0CA 4NMMA 5HKKA 4IDNA 4EPWA 4US2R 2GXQA 3VKGA 1LF0A 2J7PD 4ZDIA 1OH8A 2N42A 4QBHA 1QHXA 1Q12A 1WF3A 4ZPXA 2P65A 1G5TA 1NIPA 4U7DA 4MRSA 3VKHA 4XJXA 4IXNA 3CX6A 1NN3A 2I3BA 2FZLA 3LW8A 4MITA 5SZHB 1SXJD 4GMXA 1KDPA 4Q47A 1OV4A 4M2LA 4V0ME 3ZQJA 1HTWA 2ZJ5A 2GZHA 4TL8A 5F3WB 2ZRPA 3PV0A 4OQLA 1CLUA 2GETA 2VHUA 4US1R 3CUEF 3NBFA 4TWZA 1NVUQ 1AA9A 3PQCA 1LS6A 3UMFA 5C4MA 4DCUA 2A5JA 121PA 4Q1BA 2K5UA 3W6PA 1G3RA 2EYQA 3ICQB 2RGEA 2P3SA 4IW3B 3FMOB 2R2AA 2ZRJA 1KO7A 4OHYA 3GJXC 2EWVA 2OCAA 1N6IA 2ZSBA 3GJ4A 2BEJA 2HUPA 3QEJA 4LI0A 4AKHA 3E1SA 2EU8A 2FG5A 3BAFA 3R7WB 1P62B 2ZRGA 2V3CC 4BFYA 4D4MA 2JLXA 1X3SA 5KDDA 3ADDA 3EX7C 1YZLA 2NOAA 2AR7A 3AF1A 2DB3A 4FINA 5JWHA 1PV4A 3UANA 3B9PA 4IVPA 2J46A 3RSLA 3B6EA 2BDTA 1SKQA 4YMVA 1VKJA 2BKEA 2JJ8A 2ZYTX 3NC1C 3HU3A 1GITA 1P7CA 2A78A 4LWZA 1BH2A 2YWFA 2ZITA 3BJIC 4ILEA 5J4YA 2CJWA 4V02A 3U7FB 2XB4A 3FHCB 3QKTA 1T4GA 3GLHE 3ZVMA 2ZI3A 4QNRA 4LYFA 1H8HA 2VP0A 1OH5A 5JHHB 8OHMA 3WMEA 5LD2B 2IYRA 3AVYA 2QGNA 2FV8A 2IYUA 5IT5A 1R0YA 2A30A 1ETUA 3TVDA 5JJKA 2J1LA 3PEVA 1G7RA 1AZSC 3UWOA 3W3ZB 2YZ2A 1GRQA 2G1KA 1QHGA 5G41A 2J0UB 4AURA 5F98A 3CZPA 4U02A 4C0KA 1L8QA 4RD1A 1OHHA 3P4YA 3CNLA 1A4RA 4DLSA 3X1XA 2FN4A 2VHQA 2FPMA 4IKEA 4TLDA 4WXPA 1XTSA 4F93B 4JLBA 4NZYA 3MAAC 3ZZ0A 4EPXA 3SEAA 4XTRA 5FL7D 4B33A 2P5SA 4RZ2A 2ZRKA 2JGNA 1TNDA 5IDVA 2EFEB 3TMKA 5AUPB 2XXAA 2G1JA 3W5IA 1FNMA 1S1CA 2LKDA 2CDNA 2IUSA 2HCBA 1Z0JA 4HLDA 1GZSA 4DLVA 5KO2A 4HAYA 1CJVC 2IYLD 1XZPA 2ZSEA 5GVRA 1Z63A 1R8QA 4U00A 2QEQA 1SKYE 1Q1QA 1L2TA 1GTVA 3WXMA 4D80A 2F1IA 5D3QA 1N5IA 4RFVA 5J47A 1W36C 3GJ3A 2PEZA 3ZJYA 3AGQA 4DB2A 2H17A 2WWWA 1E9CA 1TF7A 5KSYA 4HB2A 3A4NA 2NO0A 2WMOB 1XEXA 2CL7X 3O47A 2XJ4A 3VNUA 4UKDA 4CRWB 1E79D 4EFNA 1UEIA 5K8TA 1GP2A 4GI7A 4ACBA 1C1YA 2QUZA 5JEDA 2XTNA 4QFMA 4JLKA 4P31A 4IOLA 5EXSA 3EPKA 1OFIA 4HLQB 1J99A 1IN8A 1ZUIA 1HURA 2IF2A 2FSIA 1U9IA 4D82A 2LCFA 3MG9A 1JNYA 1BYUA 3UKDA 3GLIE 3RS0A 4URXR 1YHNA 3TUZC 3MFYA 4MGZR 3X1WA 2NO1A 3WP1B 1KHTA 2FEMA 5E4FA 4B3FX 1XPRA 3GJ5A 2OLKA 4OYHA 3C16C 3CO5A 2ORIA 1B0UA 1YR8A 3PG5A 4HAUA 3NC0C 4L15A 1XD8A 3HPQA 3TSOA 3FFBA 4F7WA 1NVVR 2QTHA 1N6HA 5CDFE 1E3MA 4LJ8A 1YRBA 3AP2A 4DT1B 2EFDB 3K70D 1NBMD 3QY0A 3ASYA 1W46A 4P33A 1WMSA 2IWRA 5HTKA 3UIEA 2ZAOA 2AWNA 2EFCB 4A2PA 2WJHA 1EFRD 1L7VC 3O8DA 4F4JA 5E7JA 4QM7A 4RD4A 4DDTA 2FSGA 4NU0A 1ZD1A 4JL8A 1RE0A 3K0FB 4BLRA 2X77A 5KNDA 2N46A 3BXZA 1SVWA 1XD2B 2C9YA 4URUR 2PJRA 5BQ5A 2IYXA 3OE7D 3Q8XB 2CCKA 4Q66C 3ND8A 5BW8A 1GVNB 3OIUA 2B7BA 3GMTA 3LQQA 4OI1A 2F9MA 4GL2A 2LWIA 3MRSA 1E9RA 2Q3HA 3B78A 2PZFA 1KNQA 4IVQA 2V4ZA 1CRQA 2IYVA 5F2EA 2JIZD 4D4JA 1S4QA 2HT1A 1ZNWA 2XNSA 5D3MA 2XJ9A 4BRWA 3HR7A 1J7KA 1P9NA 4B6EA 2EQBA 4Q7MB 2QMOA 1FP6A 3Q72A 4C0JA 3MJRA 2GHIA 3Q5EA 3L82B 4CEJA 2KBEA 4Q1AA 5EZ5A 5TB5A 2V8OA 1D8TA 4Q00A 1SVMA 1ZBDA 2O8EA 4JZKA 3LX5A 4XWKA 2IWHA 3HPRA 2XSZD 1BMFD 1ZMXA 4RKEA 4AD8A 4PPGA 4TQ9A 2GJ8A 1JAHA 3SDZA 5FTMA 3REGA 3EASA 4DUGD 3CIOA 3LA6A 2NTYC 2W2TA 4Q1EA 1ZIOA 2GDJA 2QENA 2ZR7A 1SHZA 2R44A 1UKZA 4XIGS 3NH9A 1NLYA 3P26A 1II0A 2JLYA 1Z2AA 2YWEA 3IPYA 4V0OA 4TTRA 2ZRCA 4DSTA 1HEIA 2WKRA 4OI2A 3NEJA 4LJAA 4P4UA 2GNOA 4G5OA 4QXAA 4M1KA 4MDEA 1Z08A 1ZCAA 3J81k 3OEHA 4IRUB 4QM6A 1CR2A 1EK0A 2PL3A 3GJ0A 2GCOB 3PUVA 4Q7JB 1II8A 1MR3F 5CYPA 1A82A 2OUKA 1BIFA 2TMKA 3CONA 1HQCA 1ZUHA 2R65A 2AX4A 3OAAA 4QBFA 4EPVA 4YXWA 3A8TA 1YRAA 2JCSA 2ZI9A 2BIFA 4Q7LA 3OEED 4BEJA 1VYUA 3NIBA 3ZGXA 3T61A 3QKSA 3THYB 4KFUA 4PQYA 2C9CA 1V5WA 2GAAA 4AKIA 1WRBA 2IF0A 4WZAE 3RRMA 1DG1G 1YJ5A 3U6BA 1TTTA 4DB4A 1GWNA 3QIAA 3B5JA 1QRAA 4URVR 3WNBA 4EPTA 2VO1A 1KSJA 2ZR0A 1E2IA 1ZD8A 3PENA 1PLJA 4MYCA 2PX0A 4TSFD 1E0KA 5CLQA 2ZE8A 3H4MA 5JSZB 2VP4A 5AUNB 4A15A 5H70A 3I4LA 3T06B 3QF4A 2IS6A 1VCMA 3BFXA 3TAUA 3OZXA 1AGPA 2RHDA 2P6UA 1W5SA 1UDXA 1F48A 4QGAA 5F9HA 4WXRA 3E2IA 5K8LA 3RYTC 4KHZA 4LV6A 1RZ3A 5K8IA 3KJGA 2JLQA 1E1RA 2ZS7A 5EP3A 2ODBA 3THWB 3CPJB 1E2JA 4A9AA 2DYKA 3VR1A 3WBJA 2ZANA 2ZRLA 4II7A 1GKUB 3CF2A 4ZI2A 4AKGA 5UKDA 2KE5A 5DNYB 4S2EA 5HR5A 2GAOA 3DKVA 2ZYUX 2ZPTX 4JBWA 2W2XA 1NNEA 1YU9A 2VHCA 5TARA 1DE0A 4YDSA 3U44B 3IQXA 2QMEA 3QE0A 3V4FA 3THWA 1P75A 1TPZA 1CXZA 4KFSA 2YKGA 1R4AA 3K1JA 3AH8A 2HCJB 4TT3A 3DDCA 1S1MA 1QHIA 4Z1MA 4W5HA 1C4OA 4Q4AB 5CJPA 3B1WA 2X2FA 3DM5A 1JJ7A 5KPDA 3CNNA 5B57C 5B2ZA 5JZVA 1KOFA 3QXCA 4EAQA 4DVGA 3WP0A 4NBSA 2HF9A 3K09C 2GBLA 4R2IA 3REFA 1Z06A 3NVAA 4EPYA 2J0UA 4LYAA 4KSCA 4DLZA 1R6BX 1QZXA 3KJHA 1F2TB 1GUAA 3F3YA 3IPXA 2YOHA 5EE9A 3OIWA 5DHFA 3LBHA 1NVWQ 3MSXA 1KI4A 3VKWA 4BLTA 5CM9C 4PPFA 3ZQ6A 2CK3D 2Q9AA 3S1AA 521PA 3OFNA 3MWJA 2FX3A 1AKEA 3QBTA 4NYIQ 1VCIA 2JJ1A 3AVVA 4LJ4A 4TZ6A 4I4LA 4URWR 4BASA 2QG6A 1OIXA 4NH0A 2R62A 4HZUB 4LCBA 1KI1A 1CJTC 1N6KA 3O8RA 4LJ6A 1N0VC 2IEZA 1KKMA 4D25A 3AUXA 4XOIA 4CEHB 3QUSA 1VG1A 5JWRA 3MD0A 4XTCS 4OJQA 1AKYA 1KSHA 4KJZA 3RRYA 5L3SA 1NIJA 3A1WA 3DZ8A 1LS1A 2P6RA 1G3MA 1GFIA 5DYIA 1VHTA 2IBMA 4L4UA 4KBFA 2NMVA 3EPHA 1M34E 3CRVA 1NMYA 3FB4A 1SGWA 1HT2E 3FPAA 1J70A 4I1OA 3LW7A 3CRRA 3KUCA 1T0HB 1PJRA 5IK2D 2UZ3A 4B3BA 4KXFB 1F5NA 4PHHA 3P4XA 3WMGA 1EESA 3RRNA 3GPLA 4C0HA 1G41A 1GIAA 4HAWA 1N0WA 3AVWA 1TEVA 4BPBA 1IY0A 4L16A 4PPQA 3S1AB 4M1YA 1KSGA 2FFQA 4MDFA 1OIVA 4QBIA 3OESA 4M0LA 2G6BA 1ZM3A 1EFUA 5FBLB 1QG2A 4Q4JB 3WNCA 2V54A 3K09A 3EZ2A 2YVUA 1NSTA 2JATA 2VHJA 4LHXA 4PSAA 5DE3A 4KCGA 3R9WA 1E9FA 1E2PA 5FUVA 4OHZA 5FOSA 4H1UA 2QPTA 2VQSA 4JT2A 3IKJA 2GWHA 2DCUA 2HYIC 3K0AB 4MGIR 4C4PA 1VG0B 1E2FA 2Y8EA 2WIAA 5P21A 3HWSA 2PBRA 4Q9KA 4I99A 4CZ2A 4JKYA 1JPNA 3EIHA 3LNCA 4TQAA 2ZRDA 3WMFA 3WRYC 1F3OA 2HT6A 2E9SA 4RFSB 1JJVA 2OE2A 1MKYA 5FOUA 3VR5A 5FBVB 1DAHA 1KAOA 3BK7A 1S3GA 2BJWA 4JYBA 4KFRA 1Z6AA 1N2CE 4GOJA 5DN6A 4A92A 1E99A 3K9GA 3ZIAD 3Q9LA 5E95A 5EP4A 1M74A 4GZMA 1Q20A 3LFUA 2JLRA 1GRNA 3OHMA 1RC8A 1GAJA 2OV2A 4NTZA 3ZH9B 4F4IA 4Q4HB 5B30A 4XD7D 3WHLA 5BN4A 3CF0A 2WKPA 2R6DA 1K8RA 1GDDA 1ZVQA 3K0CC 4UNQA 2ZROA 3T34A 2MSDB 3SYKA 5JSZA 2Q3FA 1PUIA 5C46F 3I5XA 1Z0IA 4LC0A 2AD1A 2XNDD 3B2EA 3L8YA 2GJ9A 4CIDA 4P4SA 4P32A 3I92A 3THOA 2AK3A 4DDVA 4RJLA 4CEIB 3U6KA 5FBQB 4QJ5A 5M04A 2DR3A 4I1UA 1KK0A 1GSIA 2ZJYA 3FMPB 1VYTA 2AFHE 2VP5A 3RS3A 4D81A 1FW6A 3ND9A 3KQHA 2C78A 2XEXA 4R71A 3ONWA 2ZJZA 3C4JA 3UATA 1II9A 3IEUA 3QG1A 4L8GA 1E0AA 2CL6X 3G5UA 3QPUA 2WPDD 4IDPA 4D0NA 2QQ0A 1DTSA 1SXJE 3U61B 2GA8A 1MABB 3THXA 1KSFX 1G291 1IY1A 1GILA 4M22A 4PC2A 2GK7A 2ZRHA 3LQRA 1CR0A 4A0HA 1E2GA 2CE7A 4B35A 3KL4A 2OFOA 2O0KA 1ZCBA 5FR2A 1XU4A 2ZJ8A 1JR3A 2H57A 3GLIB 1NKSA 1NI3A 2ATVA 2WWIA 4LV8B 4TTQA 3SFVA 3VX3A 4IFEA 1ZIPA 3BGWA 1GKIA 1N0UA 4O2LA 2YHSA 4E07A 4B34A 2KWIA 5A0FA 1WP9A 2WJYA 1CP2A 2OCYC 4TLEA 1P2VA 2ZUDA 2V55B 2Q0HA 2AN9A 5AUQA 3TAHA 5FUYA 3JVVA 3R9XA 1OXTA 2ZVPX 1XJ0A 4I1VA 2REOA 5EUQB 1OKKA 1NN1A 1F6BA 2HXSA 4OBEA 4OKSA 2WSMA 1BO6A 2G0TA 4O2RA 4RD3A 1Q3HA 4YMTA 3MGCA 3KTAA 4WA7A 5FOTA 4B44A 1DOAA 2O8BA 3C14C 4LBYA 1BOFA 3BH0A 4PQRA 3AVQA 1AS3A 1W36D 4IOJA 2A5FA 3SFZA 1AS2A 5KUTA 5E7IA 2XOKA 2YOGA 4PHGA 5KSOA 2CNWA 5DI3B 4PR0A 4Y0VA 2BMJA 2CLDX 1G18A 1JAIA 2WSSA 3FKSD 3GLFA 4LBWA 1D9XA 5AJXA 3U3JA 1ZW6A 2H16A 1TAGA 4WIAA 4NL4H 1MRSA 3KUDA 3RC8A 2C96A 2FU5C 2J9RA 2VHTA 3C7KA 2QRZA 1P6XA 2H7VA 3PR1A 2O8EB 2V7QA 4PSKA 1RFLA 3TK1A 1FZQA 1NN0A 2NGRA 5FPTA 4KU4A 1Z47A 4K81B 1N6PA 1H65A 2WWFA 3U3OA 1N5JA 2I1QA 2PH1A 3FTQA 4OL0A 3RWMB 2ODWA 3AF3A 4S35A 1E1QD 1GOTA 1KTVA 3QENA 5J4KA 4DHEA 1TEXA 1NY5A 4BGDA 4B73A 2PLFA 2NIPA 3A58B 4MQBA 3QKSB 1ZM7A 2G77B 5HE8A 1G9XA 4PO8A 2E87A 3AKCA 1YE8A 3IIKA 5TMPA 4B3CA 2J59A 1AM4D 3CBQA 1TUEA 3ZVRA 2ZUCA 3A1SA 2XTMA 4DLYA 1IOZA 5C1BA 1XMVA 1JR3E 1W0JD 4ARZB 5JS8A 2V6JA 2W6JA 1DPFA 3T5DA 4LJ7A 1G5PA 1T6NA 2AK2A 4A82A 4KODA 4QKQA 2D7CA 1P73A 1E9EA 1G8GA 2REXB 3MWKA 2FPKA 2AKYA 2GILA 4JJKA 4P4TA 1NG1A 2JJ2D 2QQEA 1ZM9A 5HKKD 3P1JA 2VH5R 1XEWX 2QE7D 1T3LA 4LY6A 3AVPA 1U0JA 1R0WA 2NO9A 1R8SA 3AGPA 4TYPA 5C4GB 1ZJ6A 4OK6A 2R6AA 4P3YA 1G7TA 2WOOA 3B82A 4JLPA 4CEHA 1W48A 2JAQA 5K8UA 4DDWA 1JEEA 2QT1A 3M0EA 2BM0A 1D5CA 2OZEA 4UNPA 3I62A 1SVKA 4F4CA 3GLFE 3QF4B 2W58A 2CEAA 1X6VA 3TVTA 2VLIA 3KXLA 3NEYA 4EJSC 1AN0A 4WW0A 4XH9B 2WIBA 3BD9A 2QM8A 1PZNA 3A1TA 4MKIA 1Q1BA 5FR1A 1CJMA 4DCNA 3RC3A 1Z6XA 2IYZA 5CLLA 1Z8FA 4DLWA 5CYOA 1U2RA 1VIAA 3BERA 2PT7A 1QVAA 2DWQA 4JVMA 1KAGA 3TLXA 1WDTA 2RAPA 2DWOA 2YWHA 3CRW1 1UBGA 2BJVA 1NLFA 3GJ6A 4EFLA 2Q9CA 1EWQA 3QSYA 1YVDA 4HEJA 3MMPA 3AVOA 3BS4A 2F1JA 4ZO4A 2GXAA 2KSQA 2QL6A 2YYZA 4TL6A 1UKVY 1VCOA 3QKUA 1DBSA 3IBYA 3AV0B 4A1FA 2QZ4A 1G8PA 1WE2A 3CR7A 4LUCA 2JDID 4DIDA 4JSYA 4JVSB 2ZE6A 2ZXUA 2FH5B 1AS0A 1VCNA 2KJQA 4TN1A 1UKEA 2AWOA 4M1TA 2O8FA 4ZI3A 4OI0A 1OYYA 1R5OA 4NCHA 4G5QA 1I2DA 1E4VA 4B48A 1DAGA 4FXPA 3RS7A 3Q7QA 4PO1A 3ZZUA 3TNFA 1NP6A 3UXMA 1YZKA 2A5YB 5H68A 4HI0E 3K9LA 4RCYA 4EIWA 2HJVA 3W5JA 4MKHA 4PANA 3B13B 2GZAA 3QPVA 1JR6A 1G7CA 5GJVC 1HH4A 3CB4A 4IDHA 4PO9A 2NPFA 1R5BA 2ZS8A 4TMVA 1W7AA 2WICA 3IQWA 2OO7A 2YJTD 2ZREA 4XSHA 2FPLA 3KKMA 3DEFA 3NDPA 1RVDA 5A5GA 4KITB 3EW9A 4C2UA 3JZMA 1XP8A 2IXEA 3BWDD 3FMFA 2YV5A 4BECA 1UFQA 1KK1A 2Z6VA 4R2HA 1X8LA 1II8B 2OFXA 4AG6A 3EIQA 4GSYA 3N5CA 1SVOA 2ZRFA 2V9PA 1RJ9A 4OQMA 1IXRC 5LB4A 4LDJA 2WAYA 4M9ZA 3P27A 4BZXA 4M9SA 2BMFA 2FA9A 3CLVA 3B1YA 1YZQA 3KTAB 5G3ZA 1JPJA 4JLMA 5B58C 2DBYA 1T0JB 2F7SA 3BFKA 3TQFA 1Z6TA 2B7CA 3KKOA 3K53A 5FTKA 4N1AA
chains in the Genus database with same CATH superfamily
4D56A 5CPBA 4Y6OA 1DAMA 3EXFB 3D6UA 5BYAA 3IP7A 2XXAA 1RKBA 1E7WA 1H2YA 2W6QA 3LDAA 2ONJA 1JVNA 3TOXA 1JXMA 3DMRA 3LDUA 1YH3A 1W34A 2C29D 2QQFA 1Y3CE 4JHXA 5DRYA 4ARUA 4DQUA 1ESNA 1W88A 1O96A 3CWQA 1DT3A 9LDBA 1T4BA 1N6LA 1SVIA 2Z4RA 4KQCA 4H2DA 3W9SA 3U60B 2C4HA 4L4XA 3V8QA 4LZPA 1E1KA 5EN4A 1DKPA 2ODPA 4EG7A 2B6HA 3FR7A 5KB3A 1ZDMA 2HPZA 2K4MA 2OHJA 2OLEA 2PLWA 4LBVA 4YUVA 3ZCTA 3L77A 4P08A 4Q1DA 1K6MA 2F1OA 2VUUA 5CH5A 1LDEA 1LA2A 3GCGA 3I2YX 4LHZA 3IVMA 4J0CA 5IFKA 1YT5A 4E0BA 5B6PA 1R0BA 2BFCB 4A16A 5IASA 1NXSA 2IHTA 1Q95A 5IMSA 4ALNA 3UAVA 4C4XA 5BYJA 4FEGA 4NBLA 3ZDDA 5BN5B 1UBSB 4OYYA 3DJFA 2MHCA 3HCFA 2W6NA 4FFSA 1B14A 1WDWB 2GA9A 4J75A 4JLJA 4X7PA 1Y3BE 3H8VA 2RCNA 2CXTA 3O92A 2ORED 3UA4A 4PQGA 4H08A 3OQOA 4E6PA 4YCSA 1BWQA 2Q1TA 4I4CA 1OXXK 1YNSA 3R74A 3PUKA 3EZ7A 1M8PA 1PL0A 5DISB 1RLIA 4ZGWA 2HJGA 1L7OA 2HC9A 2PX8A 1CUXA 1JZTA 2AI3A 4I5EA 4P2GA 5EGNA 2P79A 1GCAA 3LYLA 1UDWA 3JD0A 2XDWA 4LNHA 2D8MA 3CKLA 2W98A 1CQWA 3IHWA 3QVMA 4AY5A 4BTEA 3D9QX 3II6X 1DDGA 1JIIA 1FNDA 2A9PA 4NAHA 1CHDA 3R0VA 4UHDA 2X8AA 5LCXA 3TOSA 3U7RA 2GUGA 1IULA 2HCFA 1KKLA 4LA4A 3WYEA 4AWXA 1FZTA 1Y7PA 1W2GA 3MIIA 2NYAA 3P9IA 2HRCA 1U0LA 2AN1A 3CPHA 3PLNA 4G26A 5ITZA 1HDOA 4O08A 1USVA 2HWUA 1X1AA 3VQTA 2PFKA 2I1LA 3HDTA 3DMPA 1G8YA 1AY0A 1JXQA 1XCMA 2HMAA 1NBIA 3BREA 3ED5A 3LPLA 1FFGA 4G24A 3H2HA 3OZIA 1QDLB 5CVEA 1Y6GA 3DUFA 2ID7A 4GM0A 1K7YA 3TW8B 4GLLA 1UC9A 5THQA 4ZYUA 2J4CA 1ZK4A 4M9XA 4C07A 4EQ6A 4PG8A 2IPXA 4TRNA 2WWHA 2WKQA 2HV8A 4MWCA 1KJQA 3ZJVA 2AMFA 2VK1A 3NT2A 1X8KA 1KJWA 2PSFA 2JIZA 2C3PA 2R84A 4M1WA 3RVSA 4Q05A 2Q2WA 5YASA 1Q3KA 2ENUA 2QUKA 2WZCA 2I6XA 4QTUB 4KQ6A 1QB8A 4EH1A 2VI5A 3SMQA 5BY2A 3PE4A 3MOSA 1GFWA 3VTKA 4TWIA 4RTLA 1DTEA 5C8YB 3E22A 4OK3A 1A5AB 4MV9A 1DAEA 5KNCA 1NP3A 3DAFA 2B34A 4M76B 5CK4A 1S2OA 4QBTA 4E5UA 3B5IA 2D2FA 3A6KA 5HILA 3ICVA 3LGSA 2ZZNA 2QYOA 2Z09A 4G3XA 4MRAA 2AQIA 2PBLA 4DV1B 2XSZA 3IUPA 1NX6A 3BRWD 4Y1FA 1VSVA 1FQKA 1A88A 2ZUEA 1MC4A 3JRWA 5A6SB 2YDXA 3UH1A 1V9CA 4AMUA 3JAWA 1PR4A 2J3KA 3P2OA 4X6YA 1DX9A 1PBNA 2O2HA 1IONA 2CEKA 3NM5A 4H9GA 2HF2A 3QU5A 3QRWA 3C5HA 2ZTHA 4HLNA 4LGMA 4UCQA 3FNIA 2EQAA 4FMDF 4CGYA 4EKDA 1F8FA 1OY1A 3FVRA 1EVZA 1QCYA 2N1BA 2IYWA 3LK6A 4GWGA 1DL5A 5AW5A 1QOQB 4GPAA 3DO6A 1XELA 4EHAA 4C7MA 2IKSA 4JI2B 3AP1A 4WQMA 1PBTA 2ZJ7A 4F04A 1VZ3A 2WJ3A 5E2BA 5I7WA 4ND4A 3OT1A 4B6SA 1JHPA 1GUZA 1U9JA 3CLUC 3R6WA 3U62A 1I2CA 2VPYA 2BBTA 2WE8A 4HQOA 2P9ZA 2K7FA 4QOEA 3VU9A 1I4OA 1NQWA 1A2KC 4HZGA 3RTCA 1MPTA 1LLDA 2X7HA 3GPIA 3T95A 2R5NA 4FC6A 1RI1A 2CXXA 3AIOA 1PGOA 3KPJA 1T3HA 4PINA 5AWFC 4ZVPA 5C8YF 1LNZA 1ZRSA 5HCIA 3FOZA 2Q4BA 4RKWA 1C0KA 1YDFA 1DADA 4MMZB 2NVBA 3SZRA 4YPVA 1U8ZA 1KYIA 1ZI9A 3FSRA 2ZRAA 3IV7A 4U63A 1FUEA 1KMHB 5AR1A 2HTEA 5BNWA 3GVCA 5EJ8A 1W0KA 2A7XA 4NCNA 3N8DA 2A8YA 5E6RB 4ZDJA 4KGZA 4FYKA 3D0RA 1M34A 5C52B 5TPZD 3IAS6 4E33A 3ASVA 4NNJA 3JQAD 1ORRA 3O4FA 4YBRA 4TLBA 1QONA 3TWOA 1A8QA 1T8YA 2H29A 3IDQA 4JL5A 1OXSC 4KN8A 3IURA 1CZOA 4DCPA 3K0AA 1H1LB 1BJTA 1NW8A 3C3JA 3H5NA 2XX3A 3T1TA 3JZIA 5KC9A 4GMFA 1RM3A 1CS4C 3CNOA 3SHTA 1CW2B 1DQRA 1P2GA 2AQ8A 1WUYA 3CZAA 1EIWA 3CSDA 4QPZA 3RSOA 4MPTA 4ARCA 3CRZA 1FNBA 3FDIA 3FTCA 1PJZA 3RK1A 3M9XA 2PD4A 4MO2A 3T35A 4YGYA 3QE3A 5JBNA 3HXPA 5BQXA 5I9SA 1VJ1A 4DRZA 4ZCIA 4L0QA 1WULS 3R8CA 5TLSA 2D4HA 4KQXA 3AY3A 1HT3A 2I3GA 3QXSA 5DK4A 4CM1A 2ZRMA 1TKBA 1B74A 5DDIP 5A4KA 1J24A 1J8MF 1WF6A 4DS3A 3W5HA 1T8PA 2XA9A 3MINA 3U3ZA 2B4QA 2QLJA 4KV9A 3MLEA 3O84A 3MRVA 4G2NA 3AJEA 5HMMA 1EGAA 2OFFA 4DIUA 5JNTA 5K0ZA 1LVHA 1VG8A 3P9CA 2O7RA 4Z2YA 2QRQA 3OA0A 4J1SA 5CHYA 2WV9A 4TMKA 2X0RA 1W8DA 5A5EA 4H15A 4PS0A 4EB6B 1ZZEA 2JZOA 4J29A 5D6OA 5LJIA 4CKWA 1EX7A 2YJ3A 5DHSA 1GHTA 4GOLD 4TM8A 2Y6VA 4MWDA 3BMCB 3CLRD 4MUGA 2XWPA 3RR2A 2P8SA 1ZRMA 1Z4LA 3KR1A 5ECWA 5K3BA 2LPMA 3GCXA 1FYEA 5AK3A 4D96A 2DR2A 4MGYR 2RGXA 4WCFC 3EBOA 3MA0A 2Q7OE 3RWOA 3A05A 3C3EA 3T1QA 1FFXA 3DPIA 2QXTA 3O3MB 1ZK1A 3ROEA 3TQTA 4BFSA 5H59A 1R50A 1WCIB 4E13A 2UZ4A 3VPBA 5KEIA 1UANA 5AJWA 2GJ4A 2PWAA 2A88A 3ZW9A 4D8WA 5GAJA 5JSFA 1BZYA 3TFWA 1U5AA 2J7KA 1BFKA 1VYHA 4M89A 2DY1A 2QV0A 3EA0A 1VHWA 3AUAA 1F9AA 4NBWA 4NYIR 1TK2A 1HKUA 4FFBB 1CS0A 3CUSA 3RHSA 1U9ZA 2JJ1D 3PEFA 4HOYA 3GG9A 5BWMA 5HVNA 1ZLXA 1NQVA 1VLMA 4Z9XA 2H85A 1TU4A 1ZH6A 4MWTA 1JBKA 4Q4AA 5CJ2A 3EXHC 2GZ3A 2IDZA 4RAOA 3TRHA 1MOZA 2VNSA 3HO6A 1RZRD 2WM2A 1GGNA 1I24A 1LNSA 2H00A 4LHSA 4YQEA 2W9XA 1T5BA 5LMNB 1DMRA 2D0PB 1FA9A 2PV0A 1SB9A 1PJCA 2GZDA 2Z3VA 4WD3A 4CM4B 3NEPX 4DREA 2DECA 2W43A 1UZNA 3VZSA 4OA8A 2RK6A 2FZ5A 3D2AA 2OG2A 3CQ9A 3PVCA 5COQA 1LZKA 5LQRA 2O8FB 2HI0A 2QK4A 3AU8A 4RCZA 3NV9A 2ZK7A 3F4BA 2CMKA 1QLHA 2FZVA 1QE5A 3ND5A 3LKDA 4MV7A 3S40A 4W9NC 1RYZA 1J2JA 2A9KA 2C94A 3N86A 5FOWA 1X7WA 4B1FA 1JIUA 1JIVA 3H4VA 4AJKA 4DPKA 4F6RB 4DLTA 4KI0A 1KTIA 5BV2P 2PMWB 2RHRA 3EVDA 3FPGA 4B6GA 1O5IA 2O3TA 3E9MA 2ZJOA 4AG5A 1AA6A 1ZVKA 2FUG6 5U4QA 1U0EA 3A1FA 2FTKE 4AYWA 4B3JA 1HBJA 5AVXA 2P41A 3VJRA 3G6KA 3MSCA 3GLHB 4W6ZA 5IK2A 3HJAA 3K8QA 1K9SA 3NOXA 2W6ID 4OBWA 2AA3A 2F90A 3K15A 1FC0A 1KEWA 4HO1X 2F3PA 3G5TA 2NTVA 2FZWA 1X14A 5FPYA 2A67A 5TJHA 4CN8A 4BRZA 4DJJA 3AFHA 1FJGB 1CUIA 1WP4A 2OYRA 2YNMA 1OJLA 5LYJB 4Q3BA 2VYQA 4P0QB 2PRJA 3JVIA 3M33A 2NZVG 1L4UA 1JEOA 2CKDA 3DL2A 5I7FA 1HFJA 3AILA 2CBZA 3DQZA 1ZMTA 3B7GA 4II2A 4LZLA 4X44A 4BMYA 3R3ZA 1R4NB 4O4JF 1L8XA 3EZXA 5ALJA 2IHNA 3N70A 1AGXA 4Y1GA 3A9VA 1XDWA 4I55A 3IKLA 3SYTA 1JFVA 2AXQA 1JBQA 4X1IB 4RY2A 5GJWC 2C83A 3P9NA 3PR2B 3RSQA 1JG3A 1VHJA 2BBOA 4OATA 5JFGA 5KNBH 4PY2A 4BB6A 4BPRA 3G79A 4M38A 2LP4Y 2VQDA 4EOGA 3N0XA 4V03A 5GIOE 2NVOA 1AQUA 4JEHA 3A1CA 4WXHA 4YV2A 3CE6A 2P2ZA 3L7YA 1NNSA 3HFGA 2JGRA 1LF5A 3PUWA 2CFRA 4CU2A 5GM1A 2FSVC 2ZRIA 1QGOA 3H04A 3R5KA 1KK3A 4CF3A 1C9YA 2O54A 2YHIA 3SR0A 3B1VA 3FPBA 3U3MA 3KXPA 1JHVA 3FSGA 4DCSA 1NVVQ 3TZCA 1KJZA 1TCCA 1W88B 2FSPA 2F3RA 1YJBA 2P6MA 1QIHA 3R7FA 3WHKA 3IP8A 4BQIA 5K09A 5K4GA 4C7OB 1CZKA 4NS1A 4NFYA 3DVAB 4ESVA 2VP6A 3TPCA 2WTBA 4BFTA 2D6FA 2J9FA 1TKAA 1BE6A 3TSCA 1R0KA 4UNRA 3U2QA 2C7QA 2ZYIA 4E5MA 2VPPA 2DFTA 2QYHA 2NQ2C 2BFBA 4XJVA 4IIFA 5CDTA 3KSBC 2WU8A 2HB6A 4OGWA 1M6VB 4QTXA 2XDQB 4HZUA 2CXRA 1CE8A 5FYDA 4DQKA 2BGJA 4DCOA 2JC3A 1ID1A 2ZB3A 3L02A 2B92A 5HS4A 1VPWA 3DHYA 1EVKA 1L3BA 2XAAA 4OHBA 4RFSA 3EA5A 3OE4A 1XRRA 4CDGA 2CXUA 4R1QA 1OMOA 3OOJA 3WBKA 1C7IA 1EFHA 4QQNA 4C0WA 3TG8A 4EZIA 1UAAA 2F8SA 1FSZA 5F52A 3ZHBA 2PX5A 3P0IA 2BL4A 1YVEI 3GIWA 2FE4A 4GMDA 2AOWA 2OBBA 2R8RA 4LY0A 1HDIA 5KTNA 1SC3A 1ADBA 3O2NA 4F5DA 2ZYGA 2J5XA 3GARA 4C29A 3EVCA 3JXEA 1CULC 1YZGA 2DGDA 3AEZA 2CNKA 3OJOA 4UMVA 5FTNA 2WHYA 3RM3A 2QX9A 4YJFB 3IODA 3KOOA 4W9MC 5K3EA 2E1RA 4RDHA 3T3NA 2BMDA 3HLKA 5GOTA 3UWKA 1WS6A 1PIWA 3W4IA 1H1TA 2C00A 3GU3A 1V7PC 1V43A 1YQEA 1UIRA 3JR7A 4GLBA 2RBEA 2BV3A 4MS4A 3R23A 3DEAA 1YFKA 1ZN8A 1U8UA 2QTCA 4P0PB 2A0YA 1Q0ZA 4FD3A 1X1EA 2BEWB 4LSZA 3GLIA 1N1EA 3H2KA 4DLXA 1NFFA 4TKLA 4D4HA 1X87A 2MSEB 2XZOA 3SXJA 5CLIA 1PJLA 3A6PC 3BWBA 5TQVA 4DQDA 4B09A 1YR3A 5ALTA 1CJBA 4GZ5A 4L5AA 5BWLA 3OZFA 4J49A 3EXIA 3SN6A 3W8NA 4D74A 4V38A 1L5YA 3IBGA 3LPAA 5DGTA 4U8HA 2AX3A 4LPKA 3NG1A 3DLTA 2ATXA 5EJMA 2DETA 1T5IA 1KQPA 3IJRA 3ADBA 2WI8A 2ZSUA 2CV2A 3N8NA 3EGVA 1FTQA 1Y34E 1TO6A 2WWGA 3AHEA 1HWYA 3DC7A 4JT8A 4RVOA 4KR6A 1S7CA 4U6NA 1FOEB 1AKMA 2GKOA 3O2QB 2AHOA 1Z34A 1TC1A 4UAJA 3VYTB 2J32A 1NSYA 4U2EA 3UOWA 1RYDA 4K46A 1JHDA 1IG3A 3OZSA 5ELMA 2GYWA 1JEDA 2I6FA 3IP6A 4HAXA 4BV9A 1H2XA 1G3QA 1NGSA 1Y1LA 1ZI6A 2W00A 4I5DA 1DRUA 1PSDA 1AQIA 1S5PA 1QR6A 3IUMA 3JTEA 3K1TA 4FGWA 3DEYX 3KQPA 3DMHA 3S7ZA 1U2GA 4U0KA 4DXHA 5HRAA 4BE4A 2VF8A 3G8AA 4O4IA 3ZEAA 3WY9A 4ROSA 2UXDB 1UOPA 1XTQA 2C92A 3OQMA 1FL9A 1AUXA 3MUFA 2C5SA 4GBJA 4QTZA 2HJWA 1EG2A 1BVRA 2D5LA 5JTTA 3ZCSA 2O2EA 1QFYA 2O48X 1JEJA 2PO7A 4RF3A 1QU3A 1G5RA 5H16A 3ITEA 3K9HA 3MTQA 3IEKA 3HC7A 4DZTA 4LZZA 5JCPA 4JV5B 1DG3A 1Y1KE 3W8RA 3DBIA 3N0VA 4D4LA 3STVA 5FFNA 1KAMA 5AW7A 5I45A 5FOVA 3FTNA 3GJYA 1PG5A 2QZJA 3HG7A 5K8JB 4RTNA 4RJ2A 2FW6A 2GPSA 4Q3LA 3GMSA 3SJAA 3U0BA 1FJXA 3UJPA 2ZSHA 1KU0A 1NW4A 3CWCA 4IQ4A 1N4AA 1U8AA 1G19A 3LU1A 3N2KB 4RHUA 4MP3A 4JLAA 4F3YA 2C8JA 1FYVA 3A4LA 5KNBA 2FPIB 3AM3A 5SY4A 4G0NA 5ISMA 2QSJA 3AJRA 1EFVB 1T91A 3EUWA 3NCTA 1I10A 3A4TA 1OXMA 1MGPA 5JC1A 4QU5A 4JITA 2RGNA 1PWXA 1KOLA 4G1VA 4NK5A 4IV5A 1R8XA 1ZAKA 2X8WA 1PT8A 4QJIA 3DVLA 3W79A 1U0RA 4JMPA 3DL0A 1EBBA 1EUDB 3DO5A 2V0GA 3KE8A 4R05A 1PJSA 4QPPA 1SXIA 4PFSA 2NACA 2QRJA 2XUQA 2ZE7A 2YHUA 3ADKA 3TXYA 4L0DA 1DEKA 4ITRC 4PC7A 2AC2A 1UPAA 1UZAA 1V95A 1Z22A 4LSWA 4TTPA 1VI6A 3SS8A 1YOBA 3FKQA 5E9JA 3C97A 2D4AA 3N0WA 4JZYA 1N6OA 3WHPA 1S02A 4F2WA 1E7YA 5I8WA 4HS9A 3ESBA 5K20A 2P2SA 1IDN1 4DJEC 1RTKA 1G2PA 2QW1A 5IC5A 4UM5A 5KSZA 1MJGM 1IXZA 4KH1A 1QG0A 1SULA 1F4LA 1DKOA 1SPBS 1YU6A 2L42A 2W71A 4BJ3A 4DYDA 2WWYA 2QV7A 3EAGA 4L8WB 1J9GA 3IIEA 4HRXA 1TL7C 2DCMA 2CHEA 2OK7A 3CUYA 4IWYA 4TMFA 2HYDA 2B21A 2RHLA 2D1YA 4NIMA 4DXDA 5KWSA 5AESA 2RAVA 1KEEB 4H7JA 1ND6A 4ER5A 4G0OA 4MKRA 4QNMA 2WFZA 2YJ4A 2C8LA 2XMBA 2PUDA 5AICA 3F4LA 2GLXA 1DAFA 2E37A 2V8BA 2OGTA 2QRPA 1MRZA 1YBHA 4DEYA 1A8HA 1BEEA 1E2QA 1E9SA 1MX1A 2OB1A 3INRA 3MAJA 4I5FA 5C81A 2WWTA 3WIVA 3FTEA 1H05A 3EG9A 2O2JA 4JJEA 1AOXA 1Z0UA 2R47A 2VL7A 3EYWA 4P3KA 3QWBA 1RYEA 4X8MA 1T25A 1KR5A 2FF7A 1D4ZA 1SBYA 2Q6LA 3V8RA 1GKYA 4AKTA 2B8WA 1OFUX 4F3CA 4D9KA 1O0SA 2OSVA 3KR9A 4ND1A 4Y2QA 2LGJA 5FL7A 1DC4A 5BPFA 3IELA 1VPEA 1K7XB 3BB1A 3CB2A 5E3IA 4OQFA 4DLNA 5C8DA 3K70C 2ZAGA 1PTKA 1K0UA 4YAWA 5EJ9A 1HL3A 3X1MA 1RKUA 3PDUA 4UDXX 1L7NA 3DQPA 2FXVA 2J3EA 4B7UA 4JI8B 3QU9A 4MVJP 2RHOA 3KZVA 1OGYA 2JL1A 5JH7A 5EWJB 2IYSA 3UKJA 3UMBA 4DEXA 4GGMX 2FP4B 3KCQA 1IN7A 4S24A 4CETA 5ICMA 1Q7GA 4CKCB 5FOXA 2WEKA 1C30A 2R85A 4OHWA 4DBLE 3SAJA 3GRAA 2Q7DA 3R7BA 4AIIA 5FORA 2J33A 4ETIA 1LLFA 2X2EA 3QLVA 1FRVA 2Q3JA 4LZOA 1RMYA 4P53A 5FBRB 3BCUA 1NVXQ 3TNDA 5BW5A 5EQJB 1R9NA 3RGGA 3RSSA 3U26A 4B8YA 2RH4A 1P4GA 4UUNA 1P5JA 2I2AA 4HFMA 1PEAA 5DBIA 4QC2A 3FSEA 4ODIA 2B94A 3RANA 3UMGA 3V33A 1DJLA 3PYMA 3DXXA 4BKRA 4H7HA 3FMIA 4GC9A 1UBLS 1S2IA 3G6WA 1TGYA 3UPTA 2GUWA 3G8DA 4D8UA 4NKRA 3BWEA 1LVUA 5HTOA 1SG6A 1GT6A 2DHRA 3ITDA 3HI4A 1G8KA 4RZIA 4UEWA 1VGRA 2Z9CA 4AXBA 1G55A 3IC5A 1H5QA 4M8IA 3KYJB 3TNYA 4A8JA 4MB2A 3C85A 3IESA 3V5NA 3KV1A 2Y1EA 3PNLA 4X66B 1IN6A 1QIMA 4G37A 4ILKA 4MWBA 1VJDA 2A4KA 3DUWA 2FUKA 4YRPA 5DH9A 1Q0SA 1KVRA 1U1IA 1EVLA 1LFDB 4BO7A 4M0FA 1M2EA 5F23A 3MJTA 4FFVA 1XD2A 5EZ6B 4QOIA 4OHXA 3INTA 1VE6A 2G9VA 4MQEB 5DP1A 3CRMA 3PHBE 1FRFS 1VRWA 4D9CA 2B2CA 3KYDA 1J06A 4K1LA 3JWJA 1M7GA 2HEIA 1DJQA 1GFZA 3E7DA 4HDKA 4MYSA 5AJVB 3RHFA 4DLAA 4AZVA 5IYZB 1B23P 2BN4A 2FE1A 1XGKA 4O33A 4PSDA 4JI7B 3N53A 3KQYA 5K6RA 3VH2A 4AI6A 1D7OA 4YRBA 1MVOA 3MLBA 4HDCA 2B4YA 2I2FA 2I4NA 3LECA 3WLJA 4B4VA 1BJKA 1TF5A 5CRIA 5E9WA 1GTJ1 3IX7A 1W73A 1ZIXA 2QRNA 3WYFA 3ESRA 3ODPA 4NICA 3MS7A 5EJ2A 1SK9A 4IDGA 1HE1C 4FMBB 1EVQA 2N47A 4FE7A 5HPYB 4KVGA 4Q3EA 4I1YA 1NWHA 3I5YA 3O26A 2UXCB 2VDOB 3F5DA 5CFPA 2RGBA 2P3QA 3WQHA 4CM3A 5JANA 4UU8A 1FBNA 1W87A 2PUJA 1VYVA 2WTMA 5FTJA 3UO8B 5B4VA 4D9IA 2GXSA 4OM7A 4JHLA 4G97A 3OJ0A 1EE9A 1QYIA 3CLRC 5JNSA 1XNHA 1SRRA 2GFQA 4KLAA 1XJ5A 4KXQA 4O0MA 4O4IB 4V39A 3ZWPA 3CX8A 3WL6A 3NHRA 1M1UA 4WAUA 5IVKA 4DEVA 1CJKC 2NAPA 3QQPA 3HDJA 4OHFA 2IW3A 3L7OA 1DDIA 1KI6A 1RBYA 3K73O 3VZBA 5FDFA 3OTOB 2QP4A 3K5WA 1CZLA 1SC9A 3KZ1E 1F12A 4IMRA 3MJHA 4FW9A 1XNRB 4ETNA 4Y8VA 4YCNA 4JUCA 1IC6A 3U3RA 3V2GA 4FFWA 4HUQA 1SXJC 3SHWA 3ZLVA 3SSOA 5K6TA 2Q8QA 4LJKA 1VBNA 1VXRA 3JU3A 3CUWA 1M6YA 2VTDA 3D7MA 1UPXA 2WF9A 4B84A 2IGTA 5BSGA 2XGJA 2O06A 4ZI7F 5FEUA 2YC4C 1BD4A 3TE6A 4AF8A 3U7EB 1DVRA 3N28A 3AC0A 3NPMA 3VX4A 4EVSA 1RPZA 3U3DA 2HMUA 3FUUA 4DWWA 5K2OA 3KQNA 1YZUA 4CE6A 2PRZA 2RI6A 4DNPA 4AY6A 4LSGA 3WZMA 1BWPA 3EFOA 3NDJA 3JQBA 3K2EA 1K2VN 1L6IA 3HGQA 4O2BF 3EPJA 4XGNA 1DKNA 1V3TA 1DC3A 1G4UR 3V1KA 1CZRA 2NUPA 2CYAA 2JFVA 4IGEA 4WLVA 2JGMA 3V1NA 3OF3A 5KWVA 1XZFA 2QR3A 3GFGA 2LIPA 2JLCA 3LPCA 2NUAB 2OM6A 1P45A 1UPUA 4WZBE 3WGTA 2XEDA 2FETA 3L84A 2QAGB 1LBIA 2IHKA 3NHUA 1J5EB 2NYVA 1IM2A 1T1JA 2SHKA 5L7WA 2QUHA 3KKZA 1P9WA 2OFPA 1Z7YA 4HDRA 1U98A 5ELXA 5CVVA 3KQLA 3H2YA 1KDOA 1CNMA 2BZGA 3OEEA 3C45A 3VR4H 4Q5IA 1L7EA 1Y7LA 5ALRA 1KMMA 3E53A 3P7MA 2YIVX 5JMOA 1YA6A 4UQLA 1CJSA 2FOLA 1ZS9A 1NVKA 2ERYA 1CEEA 1G63A 1RHRA 4YQYA 5ALHA 1M5UA 2XAUA 4LVNA 4MDHA 4JUBA 2WT8A 4TRRA 4ZQCB 5KOIA 1V2HE 1DIGA 2JASA 1OYVA 2VJMA 1WCIA 3FCOA 4MRMB 3WFJA 4C0BA 3O7MA 5A3RA 1CUEA 2HTFA 1K68A 3G2NA 5BO5A 2Q5OA 4IDQA 2J3DA 1N33B 1NR1A 2EFJA 1KQNA 4AZ3A 1J8FA 3HKCA 3P0HA 2IEYA 2HRQA 2HDHA 2BEVB 3SC4A 4ASUD 2W0SA 2Y9MB 3RYFA 3E2MA 1SQ0A 1PR3A 3BIWA 2BHTA 5J2TA 1UK7A 5JBIA 2I29A 1OWPA 3SZLA 5BRJA 2N9UA 1ZXLA 2H4HA 1CRWG 1T3SA 2B98A 2PPVA 3LBNA 4PC3A 1RXWA 2Q45A 4IXMA 3HFSA 1P31A 1J1IA 1KI9A 2DU8A 4MZXA 2ZT7A 4LX0A 5EWLA 3ZCPA 2FW9A 4EL5A 5BOSA 5JJBA 2W37A 3NIWA 2JIPA 3F90A 3KB2A 1YZ3A 2I2WA 1QX3A 1ZSNA 2GN6A 2NP7A 4YROA 2QYSA 4R2KA 1X1SA 1BC5A 1NJ2A 3A1VA 1QG4A 1DLIA 2FOXA 1JALA 1HMPA 3AEKB 2HBQA 4G9EA 1UBJS 4Q3KA 2NX2A 2PZBA 3JQ8A 4XQEA 3TDMA 2FMKA 2DUNA 2RGDA 1NMQA 4ZIRA 3MWYW 5DHTA 1KFKB 3L5OA 3O4VA 4D3ZA 4GHWA 4B80A 1JIJA 3QHPA 4EJSB 2WWRA 5HRCA 3BK2A 4OQXA 4OCZA 1XRNA 2VDRB 5JCOA 1N36B 4Z1MD 1Z2EA 1T36A 2G71A 2OCGA 4IPTA 2QMYA 3MQ4A 4NHOA 4OBXA 4ZVNA 1MABA 3JYQA 3ZV3A 4YQZA 4L5BA 5B4UA 1BKDR 2WJWA 3DBLA 3LRTA 4X93A 5LQJA 3CC8A 2H5EA 3QBVA 3KD3A 3AF4A 4KPEC 2WLTA 5L53A 3SXUB 2AL7A 3D31A 2PUEA 1KBZA 2GPBA 4LHYA 2UZIR 4ZOBA 3AB7A 4C03A 2ZVDA 2QZ9A 3FE2A 1S3IA 3L0SA 2XKAA 1RKXA 3AHGA 5CA1F 1XTZA 1U9YA 3LXRA 1JDJA 2M1ZA 1JLHA 3JQ9C 3BL8A 3PKZA 4IZIA 4ZEVA 4L0CA 2PZ8A 5K0GA 3N2IA 4DJFC 1SQ6A 2YFQA 2Z4TA 1HT1E 2W22A 1U2EA 1W36B 1WCWA 4LTDA 5LUBA 4CM9D 1TJ5A 2CK3A 4X3OA 1PQPA 1ISHA 5ABPA 1EVEA 2P35A 3E70C 2PT5A 2J0QA 3MTDA 4EK9A 4DR5B 4MUBA 1W4RA 2G04A 1PU2A 5EJ7A 5JADA 3F7OA 2BH2A 4OQEA 1P81A 3IQDB 3LAWA 4NZ9A 4AJ9A 1RRPA 1V5IA 3TFQA 2G5PA 4R5HA 4X61A 1JA0A 2JLWA 3EQ9A 4LNAA 5E4JA 4QT4A 3ZK7A 3ERCA 4L6CA 2EW1A 3ZKWB 1O87A 3EXG1 4HGOA 4ON9A 4XDYA 5IYZF 2B2XA 5H9WA 2QSUA 3M6XA 3NYIA 2Y0PA 4HNRA 3HDGA 4US0R 3VPSA 3ZWXA 1NHGA 4B3TB 2XOEA 2Z3WA 3SEQA 3TRKA 3QU7A 4D98A 3QQ5A 3LGXA 1AXRA 4MVJF 4Q48A 2EKQA 2NT3A 1NVEA 3C5CA 3G5LA 3QH4A 2J5BA 3VR3A 2CLCX 3WSWA 3FPEA 4G8BA 5E1BA 2G1PA 1CEQA 1VKRA 3H84A 1C1DA 4X6UA 2W2LD 4BQSA 1LPBB 1SJ9A 1GM5A 2W2KB 1NW6A 4RK4A 1KAEA 3ZDYB 4O1IA 1J0XO 1U11A 5LYYA 5JXIA 1UMKA 4GR5A 2NAFA 1U81A 3HZHA 3W3AD 2VEDA 1TQ2A 3O75A 4JC5A 1Z45A 3BJZA 4EARA 3C8HA 5DHPA 4DNXA 4AJ1A 1ZR4A 2FJUA 5KNDA 1OW3B 4BP8A 2GPYA 2TMDA 1GDTA 5AHKA 3AIKA 5DLQC 9ATCA 4DM7A 1RXEA 4TT8A 4BCBA 1STOA 1VSQA 1YS9A 2BEKA 5D87A 3VR6H 5D5HA 2QN1A 621PA 4GRAA 1SCIA 1ZA1A 1UMCB 2CHFA 2R8OA 2ZRQA 3TZHA 4YQFA 5CB0A 3RV3A 2QM7A 2A7QA 3M1YA 3LC0A 3ETEA 1P9LA 4GE0A 3H1EA 3U39A 4YJKA 3T3MB 3RROA 5FULA 1IBMB 4B3GA 1KE2A 1N5LA 4CTKA 4OLAA 3L7KA 4N3NA 4ABYA 3BHNA 1KEZA 1NOIA 2R8BA 4PLYA 4C3ZA 4NE7A 3DCJA 4XX0A 3KQWA 3HXLA 3IKMB 1R9MA 3DUFB 2B8JA 3FPCA 1H4VB 2ORWA 2WJAA 4JI1B 3B1JA 1Y9JA 3N2EA 3CA8A 3H42B 3AL2A 5FKJA 3WGKA 3U9SA 4OHPA 4Q4LA 1JDPA 2JFQA 4NATA 5H02A 2F62A 2IUFA 1Y33E 1R64A 3OIGA 1HXHA 4X20A 2IP1A 1XTKA 3B7WA 4KNVA 4X8OA 5DEIA 2VA8A 1E2DA 3ROQA 4UJ5A 1G21E 2WC1A 4G89A 4J16C 4KK3A 4MYUA 1EQUA 5DNDA 3R7LA 4BWVA 2JCXA 3I04A 5C1PA 1AIPA 2VDUE 1N2EA 2IXGA 2VTKA 3BC1A 2ADMA 3OF2A 1P0FA 4N54A 2V7TA 1M67A 4HGQA 4GLJA 3UW1A 5AOBA 1F38A 3BFPA 4MKFA 1COWA 2O0LA 3R2JA 1RRCA 1HDXA 4PYOA 3AR8A 2WP8J 2XVZA 1F7UA 2DQSA 2CVHA 3JYHA 2FP4A 2KLHA 3LUHA 4R83A 1XB2A 3BHIA 3EZ6A 4JBXA 2XMPA 2DT5A 3A6LA 3CSSA 3M2PA 2RH8A 3NHKA 3ODGA 3SVZA 3OZCA 3PITA 3DAGA 4B5KA 5A9SB 1NBOA 5EJIA 1M72A 2QNRA 3V8PA 1R0XA 4CF7A 1DIBA 3ELBA 1P1CA 3R7WA 4GDFA 4A8JB 3AR7A 2JJMA 2B3TA 2ZVQX 3GYGA 4EYQA 4D45A 4S1WA 1KO4A 5INTA 1Z68A 3VU1A 1QHEA 4F56A 3L7JA 4Z3KA 5LP6B 3FCUB 1MT3A 2YWCA 1C7FA 3INYA 4TZ0A 2FR1A 4RIGA 3IJ5A 1I7PA 4HDNA 1SUSA 1Y9DA 4NCAA 4CT5A 4G5SA 4KPUB 5H3LA 1L4MA 2D06A 4Y0AA 4ME6A 2JFFA 5EWLB 1G0OA 4YEDA 1YMUA 3ADPA 2WIKA 3D4IA 4RXTA 3V8EA 1RI5A 4D6XA 1RYFA 2WJVA 1NN5A 1PD0A 3AK4A 1FU4A 1Z0SA 1RBQA 2A0FA 5ITWA 2JBHA 4WA8A 4EECA 4YPOA 1HGXA 4MYHA 1A9QA 4HNGA 4JGGA 1K2WA 2FWNA 2HLNA 1P8JA 2PMEA 5JS7A 1KWGA 2WSBA 1RPNA 3CMMA 3KO8A 1XWIA 4W8GA 3OOHA 3V4ZA 6ABPA 2JLUA 2GF0A 4UHHA 2WFAA 3T1NA 3W5CA 2CCJA 3STXA 2JGAA 1MQSA 3P8ZA 3OEYA 4IDFA 4AMVA 1EGMB 3ESCA 1JR3D 3SQDA 4BUJA 1N78A 1CDEA 2VJOA 4RHTA 5KTSA 5J1SB 5A1TA 4BLOA 1VL6A 1Y8AA 3VSBA 1FMFA 6NULA 3FPFA 5E6RA 1P0MA 1OE0A 4FFPA 1GYPA 1Z83A 3OT4A 1EJ2A 3IRVA 2IEDA 3KT8A 3W90A 5B1YA 5CB8A 5J4LA 4N5HX 2A3NA 1KJ9A 3PPYA 4ZYTA 1Z5ZA 1P8AA 1G8FA 3SOZA 4O1HA 1OBOA 4LWOA 1YQ9A 1O94D 1ODKA 3FG9A 4PS1A 4DPLA 1AF4A 4DG9A 3DKPA 3BB3A 1IOVA 5JASA 3K0BA 4XW2A 2ZTVA 2BEUB 3G9TA 1Y8QA 4TQGA 4E7OA 1G8HA 1M2OA 3T7CA 1EX6A 1IZ8A 4ZHQF 3AFOA 4JVNA 4R81A 2W48A 3U17A 3UJ7A 3KPUA 1WBDA 1R2QA 1AB5A 2IPOA 2F3SA 4MAFA 3ZHVA 2C2YA 1IB0A 2EEZA 2VJKA 4IOKA 2PL5A 3WB1A 3I0ZA 3FNQA 4MEBA 1AK2A 1NLMA 5HE9A 4DZZA 1YQUA 1G20B 1H2HA 3U0VA 1KI6B 3L01A 1Z4QA 3EYAA 4RSRA 1N3BA 1HDZA 3A37A 3JQAB 2I65A 4ADSG 3RAJA 1HDRA 2YUIA 4BMXA 3A6JA 1LSSA 5FNZA 1J8QA 2X14A 2XB6A 4ZODA 3S2FA 3C74A 3VMFA 2W6ZA 2C4UA 2BFOA 3MWGA 4F1WA 4URZR 3NXSA 2CSXA 2EL7A 1M1NA 3MMXA 3EK2A 3BCRA 3HEAA 5HCNA 4G1EB 4FIZA 1VA5A 4HB3A 5C2JB 2WBLC 3PQ8A 5KYWA 1ORIA 2FSUA 2VDNB 2DWPA 3MTEA 4R7ZA 4ENWA 3WKCA 4I2NA 3ZOZA 3HJFA 1C9EA 3HXKA 4CKBB 4TKVA 4HQKA 3NHBA 3WYCA 3OQJA 3Q9NA 4CIBA 4LMBA 3IPCA 3HJRA 3RTAA 4YJDA 2DHQA 3SS9X 2ZULA 5CT9A 2NTNA 3HUDA 1PR1A 3H1GA 1I80A 4B6JA 1KQOA 4Z8YA 1SBIA 2ZJ2A 2H06A 2B20A 4LF8B 4XPIB 3F6EX 3DDOA 3O8BA 4B74A 1XRLA 3WYGA 1VJCA 4JP3A 1IAVA 1SHLA 3I76A 3O9ZA 4TUYF 4ZZ0A 3KIPA 4AUEA 1V9SA 3ZY5A 7REQA 4FCVA 2B8NA 3JQGA 5EL0A 2NTJA 3E48A 3QVLA 2UVQA 4XFJA 2VP2A 4GI3A 4I1SA