3HP1A

Crystal structure of human dck r104m/d133a in complex with l-dt and adp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
226
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQGGNVLQMMYEKPERWSFTFQTYACLSMIRAQLASLNGKLKDAEKPVLFFERSVYSARYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
molecule tags Transferase
source organism Homo sapiens
publication title Extending Thymidine Kinase Activity to the Catalytic Repertoire of Human Deoxycytidine Kinase.
pubmed doi rcsb
total genus 81
structure length 226
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hp1A00
2AWNA 1AS2A 1PLLA 2QBYA 2AWOA 4YXWA 3THWA 1GVNB 3ZZ0A 3FGNA 2DFNA 4B76A 2XZOA 1RE0A 3PCRB 2RH5A 3NH9A 4HB2A 1KMQA 4Q7KA 2F55A 3NEJA 2VQSA 4JLDA 1FPMA 3I3SR 3UANA 2C99A 3LBIA 4U00A 1WP9A 2ZXUA 1A2BA 4DB2A 1KO4A 4QKQA 1ZVQA 2ZR7A 3WMFA 3HU2A 1PLJA 1ODFA 2VH5R 3T61A 3WNBA 4FMCF 2H92A 4P4SB 1XD8A 1O3YA 3GFOA 1E2FA 3TUJC 4GOJA 1QVAA 4KYUA 3GJ0A 1E9CA 1WDTA 4A0GA 2GVZC 3JZAA 2ORWA 3VAAA 4LJ6A 1UKZA 2F43B 3FVQA 2QORA 2ZTSA 2J41A 2VP9A 3BAFA 5E95A 1OHHA 1D9XA 3L0PA 3B1ZA 3SYNA 2ZEJA 3VR5A 1D2EA 1X6VA 3B7GA 3EIEA 1EGAA 2CJWB 4C7OB 1KAOA 2ZRAA 2EWWA 3O8RA 1YE8A 1QHHA 1P5ZB 2WVJA 1W4AA 1W1WA 1R8SA 2BOVA 3CPEA 5TDHA 1TMKA 1YR6A 2W2VA 3H1TA 4LHVA 4QG7A 3SFZA 4TTRA 3T1TA 2P6RA 1OFHA 3LD9A 4NHOA 3BFKA 1G3QA 1KI8A 2J0VA 2EQBA 1FZQA 1GNPA 4LHWA 3SU8A 2XX3A 3NWJA 1K6MA 3U4QB 1JR3D 1SZPA 3B13B 2FOLA 3L8YA 4RZ2A 5EXTA 3QPUA 2XSZA 3ZD7A 1HURA 4GMDA 5FOUA 1FW6A 1FQKA 2A5JA 1E3MA 1GL9B 3LQRA 1ZM3A 5CB8A 2ZYVX 4H1VA 3VX3A 1R10A 2EW1A 2CLDX 1SVSA 4Q7MB 3GJ7A 1N6HA 4M1MA 2P67A 1P61B 3CPHA 1KSHA 1KAGA 1Q44A 2AR7A 4MQBA 4EJSC 3OF5A 3KKQA 4LI0A 4B3BA 3SQXA 2A2ZA 2Q21A 3LBHA 3ZQ6A 2AN9A 1CR2A 3MSXA 1G4AE 1V5WA 3MLEA 5KPDA 2JLWA 4A2PA 4XSHA 2GJKA 1XEXA 2GNOA 3EC2A 4GOXA 4AWXA 4ZPXA 1KI4A 4II7A 5CJPA 1COWA 1ZNZA 4UXJA 5G40A 4ZCIA 3BORA 4TQ9A 4EPWA 4YMUA 3RS2A 2WWHA 2XAUA 2JAQA 4M53A 4DLRA 1SXJB 1VECA 2P6UA 4Q47A 1TEVA 2RGNC 2ZRMA 4X8MA 1H8EA 4B74A 2CEAA 2GJ8A 4GRAA 1VCMA 3B78A 5F3WB 4CIDA 3VHLB 1Z3IX 1G7SA 4JYBA 2DBYA 4HAVA 4URZR 3TSOA 4DIDA 4IDPA 3W3ZB 2C95A 2ZR9A 4US1R 1O87A 2DY1A 3I5YA 4UNPA 3U4QA 4NTZA 4QJ3A 3U7FB 2VP4A 2J9RA 5K8LA 2VBCA 3IPYA 4WXRA 2W0MA 1N6KA 1CJKC 3U6BA 3OE7D 1HYQA 4JT2A 4IRUB 3ECCA 1LFDB 3TSWA 2XNDD 3IIKA 3CONA 3MJHA 2QROA 4L9SA 4LV8B 3QI2A 5CK5A 1MO4A 4QGFA 4EAQA 4C30A 1G18A 4N0DA 3SBEA 4LJ4A 1OXUA 1J8YF 5KO2A 1NRJB 4HDOB 1Z0IA 2QAGB 3QKRB 2WM9B 3PEVA 2OBLA 2F9LA 3RVBA 5M04A 2QGZA 2W6JD 1E2HA 1T8TA 2BCJQ 2WJYA 4P4TA 2ODNA 5TVKA 4N1AA 2ZRFA 4ZCLA 3THXA 4KFRA 3EA5A 2V7QA 3AP2A 1XTJA 1E2JA 1N3BA 2IYVA 3K0EA 3CW2A 3RWOA 1H8HA 4S2EA 3DZDA 5EUMA 1QRAA 3I32A 1GNRA 3CRMA 3EZ6A 1FP7A 4URUR 2V9PA 1U8AA 1EFUA 4CVNA 1DELA 1UBCA 4JL8A 4OHXA 3SNHA 4IFBA 3Q7QA 3QPVA 4Q21A 3TUZC 3X1WA 1XCGB 1K5DA 3CF2A 3OFND 4RCYA 2MSDB 3AKEA 2XOKD 3FHTA 3TNFA 5ANRB 1XNJA 2NGRA 3NXSA 5D3QA 4CDGA 1D5CA 2JJ2A 3VTKA 3WP0A 2RB4A 3CR7A 3SOPA 3UWOA 2H57A 3WYAA 1FX0B 1Z28A 3HPRA 4I1SA 1BKDR 5FUVA 1W0JD 3UATA 4W5HA 4DZZA 4C0AC 5FR1A 2YV5A 5FUYA 2B8WA 4RD3A 1UBEA 3T35A 5TARA 1G3UA 3U60B 2O8EA 3KJHA 1DG3A 2QM8A 4MGZR 3B1YA 3LA6A 1S1CA 4JZKA 3B1WA 1T0JB 2YJTD 3HU3A 3K0AB 2E9SA 2IYRA 4JLMA 4QBGB 4O0MA 5HZHA 5SZIA 4A9AA 2QI9C 1VKJA 3Q9LA 3GJ6A 2P0EA 5FH9A 1U0JA 2ZYUX 1EFTA 1MT0A 1GM5A 4C7OA 2O8DB 2BC9A 1NVVQ 1E2EA 1NI3A 1IXRC 2ZJAA 4OKSA 1N6RA 3PQCA 3D7MA 1G5RA 4PO9A 5BYJA 5KNDA 2I4IA 2VL7A 4LY6A 4Q02A 3NDPA 1GIAA 1X8JA 3T06B 2ZU0C 5CM9C 3RS0A 3U44B 1CTQA 3PIRA 4B75A 3UG6A 1DARA 5L3QB 2VF7A 2GETA 1VG0B 1IXZA 4KJZA 4XD7A 4ACAA 5JHGB 1BMFD 3EXAA 4LHZA 2PLRA 3RAPR 1XEXB 4HLCA 1VCIA 1XMJA 1YR9A 1M6NA 2RCNA 4B43A 5B2ZA 4LV5B 1Z08A 1IBRA 1M7GA 1Z2CA 2JASA 2JLQA 3KJGA 3ZIAA 4U02A 3FMIA 2GXAA 3AVXA 1GOTA 4C0LA 2JIZA 3OEED 4BLPA 4P33A 1NG9A 2Z5FA 3IIMA 1JB1A 4HATA 2FPKA 2HT6A 4IEIA 4HAZA 1E0SA 2O8BB 5IT5A 1IXSB 5C4MA 5JEDA 1XB2A 2OV2A 1NVUQ 2IYXA 4DLTA 4PTLA 2XTZA 4WA7A 4IDHA 5C4GB 3DL0A 4DSOA 3V9PA 4A8JA 2FWRA 4NYIR 1S0UA 3FHCB 1JR3E 1T9HA 1TPZA 4DT1B 1N6OA 1W0KD 4KYIB 5P21A 1E4VA 4EPYA 3FFBA 3NBFA 1VYTA 2VHUA 1W5TA 3LW7A 1N2CE 1ZINA 2A30A 4BUJA 1FP6A 4D4JA 3QOFA 1KO5A 1TEXA 2AFHE 4GNKA 4F4IA 2VF8A 3KXKA 3CLVA 2F1JA 1SHZA 4RJLA 3CZPA 4B32A 5F98A 1M74A 1HT1E 1XXHA 3VR3A 4W5JA 3TE6A 2OEPA 4BLSA 1UBGA 3EARA 1ZCBA 3QJYA 4NCIA 1S2MA 2ZSEA 4YQFA 3H0KA 1OIXA 3PEWA 3GLGA 1BOFA 2PMKA 3AVQA 4A2WA 3QXSA 2HLDD 2G1KA 3AP1A 4V0KA 3ZYCA 5IK2D 4Q9LA 4Q4AA 2OCAA 2XTNA 5EE9A 3TKLA 1E2DA 4YMWA 4URWR 3RRNA 1E99A 1XPRA 1FTSA 1SVIA 1XJQA 1LV7A 2I3BA 4JBXA 2IS2A 1C9KA 3AVUA 2C78A 3A8TA 2GA8A 3EAQA 4LRWA 4TMTA 2PH1A 2AD5A 5DHAA 3EC1A 4I1VA 1OH6A 2D7DA 1KHTA 4ASUD 1P3JA 1Q3TA 1HY3A 3BH0A 4IOMA 4RZXA 3ZS8A 3KXLA 2CCGA 3H2YA 2VP0A 1PLKA 3THXB 2FJUA 2QP9X 3SYKA 1JXMA 2QY9A 4XJXA 4KBGA 3LRPA 1L8QA 4AK9A 2ANBA 2WKRA 3BB3A 1NLYA 4L4UA 1A2KC 1IY1A 1KZGB 4LCBA 4D2IA 2CL0X 4TLAA 4DCNA 4NU0A 1TADA 1VIAA 1XF9A 2O52A 2X1VA 5KUTA 5LDDC 1NL3A 1PJRA 3EZ9A 3GPLA 4NYJR 4D80A 1IN8A 1CP2A 1YRAA 4BGDA 4HZUB 5KYKA 1WA5A 2IYUA 4PX9A 1OXXK 1XMSA 2NTYC 3SYLA 4LUCA 2CK3D 4EPTA 2IBMA 2ZREA 2IEZA 2ZRGA 2OAP1 3AF4A 1AQYA 4TYWA 2ZS8A 3K70D 1W2GA 2HJVA 4LSGA 3F8TA 2ZI6A 3X1YA 1Q1BA 2A3RA 2QP4A 2JLSA 3C7KA 3FB4A 5KSYA 2OCYC 4BPBA 5A5GA 1KDTA 4JSTA 3JZMA 2A7QA 4A6PA 4E5UA 1ZUHA 4BEJA 5KSZA 1YZTA 1GRQA 1GSIA 4F7WA 2VTKA 2N1BA 2FDCA 1AN0A 1LF5A 2XJ9A 4JL5A 2QNRA 5JWHA 3DMDA 4URXR 1I4DD 2B92A 2L0XA 5HCNA 2VA8A 4HB3A 1T6NA 4HLUA 1NVXQ 2RHMA 2ZQ5A 1DEKA 5AJVB 4LYHA 2QUZA 2F3RA 3KZ1E 5FOVA 3T5DA 2DFTA 3BH6A 3CKLA 1DAIA 4YC7A 5AJWA 2RAPA 4XOIA 1AZSC 2K5UA 1E1QD 2KWIA 4OI0A 4KSCA 4FCTA 2WSSA 2I1VB 3NVAA 3W34A 2C5LA 2BDTA 3WRYC 2OESA 1Q12A 1Y63A 3B2EA 2QM7A 3ND9A 5B58C 1E1RD 4GL2A 2VLIA 5LB2A 1R0XA 2C77A 1G8HA 2WPDD 4B3XA 2O8CB 3WY9A 5F9HA 3IQWA 1TQ4A 4LYJA 2HT1A 2QMEA 3GJXC 3PXGA 1DAMA 4F91B 4QNRA 3BWDD 2XB2A 4C0KA 1NKTA 3WMGA 3KUDA 5DGXA 3O47A 4HAWA 1WBBA 4O2LA 1E0AA 4IOJA 3HJNA 1KIMA 1P9WA 5KDLA 2IUUA 4A6XA 2JLYA 2J59A 1KO1A 5IDVA 4F4CA 5K8TA 1W7AA 1Z5ZA 4CZ2A 2ZM5A 1P2TA 4UNSA 2J46A 4DDUA 3PUXA 3N70A 2HXSA 1Q20A 2ZRIA 4JLOA 4JL6A 5EXSA 1ZD8A 4LJ9A 4CT5A 1G17A 2WAXA 4I4LA 4PANA 3T1VA 3A4LA 4I81A 2H17A 1SVOA 2FGKA 1FOEB 4Z54A 2QTHA 2OFWA 1L7VC 1IQPA 2IYYA 5J47A 4MKGA 3PEYA 1S3SA 4PSVA 1N5LA 3M6AA 4P0TA 1F48A 3K70C 2G0TA 2PX0A 1G291 2QTVB 4ZDIA 1XXHB 3ONWA 2QT1A 4G5SA 4TMKA 1GFIA 3LNCA 5JCZA 2WWGA 1U0LA 1S8FA 2F1IA 3EPJA 5LB4A 3R9WA 1G3RA 1YVDA 3EASA 2NMVA 1QG4A 3AGQA 4KU4A 4LJ7A 3A36A 5FPKA 1LW7A 1OFIA 1GUAA 2IT1A 1G4UR 2ZSFA 3LLMA 1G6HA 2JLRA 4MYCA 3HU1A 1JXOA 3LW8A 1LF0A 4V02A 2D74A 3U3RA 3TMKA 4TL8A 2QP3A 1E2PA 3KQHA 4Q03A 4C3ZA 1Z6AA 2XSZD 4HB4A 1JEDA 3R8CA 3L0IB 4CF7A 1MO6A 3MAAC 5HTKA 1YR8A 5CIQA 2NPFA 2JDIA 2A5DA 4B3CA 3LV8A 2F7SA 3GLFA 5KDOA 2OAQ1 3UK6A 4UQOA 4V0NA 2GEDA 4RFSB 5J4YA 4A36A 2BBOA 3NBXX 1T8UA 1OV4A 2DFLA 2IUTA 3W5IA 1AA9A 1UKEA 2ZAMA 5B57C 1KI3A 1M2OB 1IHUA 1N0UA 1NVWQ 3T1QA 2Q9CA 2OILA 3R9IA 1F2TB 1TNDA 2NO9A 4EJSB 2EFHB 2CVFA 2WWXA 3LAWA 1HQCA 1SHKA 1QHYA 4RD2A 4KHZA 1DADA 3CX6A 3ZDQA 1G41A 1R8QA 2J5XA 4ESVA 3WBKA 1C1YA 2TMKA 2ODBA 3OIWA 1X1RA 3P32A 4K8OA 3TK1A 1TAGA 1JQJC 4AD8A 3OIVA 3WNDA 5L3SB 1KSJA 1NN0A 3K0CC 4M1YA 5KNCA 4RKFA 3C15C 3IO3A 3RNLA 1G9XA 3R20A 1W36B 1U90A 4PC2A 2ATVA 1CJMA 1Q0UA 3OAAA 3I61A 3K9NA 1NJFA 1RKBA 2WSMA 2QU8A 4XSGA 4BFUA 1E79D 2BJWA 2XZLA 2MSEB 5EXXA 5JLJA 3THYB 1VHTA 4LBVA 2QAGA 4BQSA 2H5EA 3OE7A 3UXMA 4LWZA 3GLIE 1F5NA 1HH4A 1FNMA 3CNOA 4IOKA 3WRXC 3CRVA 2XTMA 2BEKA 4Q18A 4UKDA 2ZRHA 1G19A 2X8AA 4Q4HB 1JJVA 2ZI9A 5TY0A 2HYIC 5FBWB 3KKMA 2DR3A 3AVTA 2W6JA 4P4SA 3GD7A 2D3WA 3AB3A 3CZQA 5EZ5A 2ZE8A 5BN5A 1R6BX 1J90A 3P1JA 1E9FA 1KDPA 2P6NA 3GJ5A 3J81k 1N6LA 4JIMA 2ONKA 3FMPB 4KVAA 1AS3A 3N2IA 1XP8A 4IDNA 3SDZA 5FI0B 1F2UB 3QF7A 1G5PA 2QRNA 1AS0A 1U9IC 1GTVA 3TIFA 3LX8A 4ZIRB 2CHQA 5C1BA 2UZIR 3T5GA 4QNMA 3V4FA 3ICQB 1RPZA 1A1VA 1GG2A 1E0KA 1SKYE 2IS4A 5FBRB 1Z6TA 5EP3A 4LZZA 3EZ7A 1S1MA 5AWFC 2BJVA 2FV8A 3OFNA 4BLTA 3V4RA 4Z1MA 2JLZA 4C0BA 2O8FA 4C4PA 1J8MF 3U44A 2Z4RA 2ANCA 4O25A 1HUQA 1ZNXA 2JJ2D 3K8YA 4D4KA 1G7RA 4JMPA 2C04A 2G77B 1ZUIA 1IJEA 2WWWA 3VFDA 3WBJA 3CH5A 4D0LB 3IBGA 2PZGA 4ARZA 4DLZA 3C4JA 3IPXA 4Q5IA 4WVFA 3BXZA 2AD1A 1IN7A 4JYCA 1IN4A 2P3SA 1QHNA 1X1SA 2VHCA 4P3YA 1KJYA 2WWFA 3WHKA 5AUPB 5JRZA 3NHAA 5JSZA 3A1SA 3SE0A 2WTUA 3BJIC 4PC1A 4XVRA 5LBIA 3CX8A 4EUNA 2ZI7A 4D0NA 2DHRA 1AZTA 3U3JA 3VNVA 4B33A 2NO7A 2WOOA 2V54A 1P4SA 3U6KA 1GAJA 5L3QA 1X8LA 1NBME 3MWJA 3SS8A 5G3YA 1Q3HA 1FNNA 2GF0A 1Q57A 2GKSA 3TR5A 2GBLA 2PZFA 3DVLA 4TQAA 3W8RA 2R9VA 1FQJA 4JVMA 4DCTA 4QGHA 3F5FA 4OI1A 1OXVA 2GESA 1D9ZA 1G6OA 2VHQA 3QG1A 3HPQA 3BBPA 2GJSA 3EA0A 1II9A 3L0SA 1XMIA 4NE2A 4DSTA 2UZ3A 3B1XA 3M4YA 4QJ4A 1G3IA 1BMFA 4YLGA 1W4BA 1JALA 2VP5A 3T15A 1GKUB 3QF4A 1RJ9B 5TMPA 3NC1C 3EIHA 2KJQA 2REBA 3VU9B 1P2UA 5DO9A 1KI7A 3BS4A 2FEOA 4B44A 4BFZA 4IW3B 2JIZD 2ZRJA 4OQMA 5GJBA 5HKKA 2P5TB 2GRJA 3L82B 2X2FA 1VYVA 2V55B 4IVPA 3G0HA 3QEOA 4V0ME 4B2LA 2G0NA 3KB1A 1E9AA 3GJ4A 5DI9A 4JVSB 3RC3A 3I5XA 2FX3A 4DCSA 1W47A 3FKSA 3AH8A 3FFAA 3CPJB 1CIPA 2Z6VA 1KI9A 2LWIA 2JA1A 3T12A 3PUZA 1P75A 5KDDA 8OHMA 4JS0A 3PUYA 5CYOA 3GLIA 4KBFA 1NVVR 5FPHA 4HZUA 3W90A 2YZ2A 3EIQA 4WXPA 3E1SA 2RGAA 2IXEA 4Q7JB 2J3EA 2VP2A 4A8JC 1JR6A 4DLSA 4R71A 3CX7A 1H8ED 3NC0C 4RZ3A 5EE0A 4BE7B 4JLPA 4R2IA 1F3OA 4OJKA 4DLVA 5BWMA 4XWKA 2CJWA 4DJTA 2LCFA 2BMDA 1S4QA 3PG5A 2GZAA 4RSGA 5E3HA 4KODA 1KNQA 1XJ0A 2EYUA 3B9PA 2ZROA 3BK7A 4MGYR 1VTKA 1OLOA 4MYHA 1ZM9A 1SKQA 1D2MA 5EE3A 5HE8A 4JVNA 3ZVMA 2IL1A 3ND8A 5IK2A 3U7EB 3UPUA 2RGDA 4EQ6B 3LXRA 1XD2A 3QQ5A 4GMXA 4F92B 2IF0A 2H18A 1E4YA 3QIAA 2BM1A 3O8DA 4UXHA 2XNDA 1Q1QA 5BQ5A 2EFGA 1E9BA 4MGKR 4MRSA 1L4UA 4M9ZA 1G1MA 1TU4A 3TLXA 3MFYA 3ZD6A 2IS1A 1KKMA 1G8PA 4A8JB 3RDPA 3K09C 1T3LA 1S3GA 4MRRA 4PPNA 2HXYA 4RKEA 3KTAB 4MDFA 4QC2A 4NDZA 2IXFA 3NBZC 4QL3A 4UJ5A 2FSIA 5JFGA 2PT5A 3U2QA 1P73A 1RRFA 4Q4JA 2BBSA 5DNYB 5CLLA 1MRNA 5A4JA 2WJIA 1EX6A 4A82A 2AFIE 1G8FA 2PX3A 1AIPA 1VCOA 4M4SA 2F1HA 1S96A 3AKDA 3ADBA 4OHYA 2PMDA 4W5WA 1ZC3A 4ZV4A 1QF9A 1KNXA 3ZS9A 4D4LA 2HF9A 1JEEA 3K9LA 1KMHB 2W6IA 4XVQA 3RYTC 3UMRA 1LB1B 3QE0A 4KFTA 4ZDKA 1B23P 1Q1EA 1J7KA 3P20A 3VKGA 4N0EA 2FE4A 2R65A 2JLUA 4C2UA 4LDJA 3UKDA 4W7SA 5GJWC 4GP7A 2ZJ2A 3LFUA 4PPGA 4TMXA 1KO7A 4POAA 4C0JA 3I1FA 5J4HA 1E9EA 2XB4A 4H9GA 2V3CC 2QAGC 1A5TA 2IWRA 1NMYA 5FOWA 5H68A 2WJGA 4NCKA 3FPAA 2GAAA 1K8RA 4Z8XA 5J5CA 4N3NA 2HCBA 3A1WA 3CO5A 1A4RA 2GXQA 1IAQA 1JECA 2CCKA 2ZSAA 1GITA 3CRW1 1F6BA 1CR1A 2YINC 1N5KA 5JWOA 4M1KA 2IC5A 1UAAA 1OH5A 1VPLA 2OZEA 3GJ8A 3MRSA 4RD4A 4DVGA 3NKVA 2F1RA 1G5TA 2FFQA 1ELOA 5AUQA 1RZ3A 5AUNB 1I2MA 4FIDA 4ERNA 2Q3FA 1XTIA 5F9FA 5CK4A 2FPLA 2VPPA 2WJHA 3GLIB 3JVUA 2GXUA 4NONA 1EFHA 2VYFA 5KOYA 2VSFA 2WJJA 3H86A 3AVVA 1Z22A 1BS1A 2BMJA 1G21E 2XEXA 3JVVA 1M34E 4F38A 5AR1A 1E1RA 4DRZA 3H84A 4AYXA 3AKYA 4XD7D 3QG5A 1Z0DA 1GNQA 1ZNYA 4DSNA 3IEUA 4H1UA 3GFTA 3RRZA 3AV0B 2IWHA 1L4YA 3O8BA 4OBEA 1US8B 1U98A 1ZD1A 4X8OA 5F2EA 3I72A 4GOKA 1IY2A 4PPQA 4HAYA 5EXPA 3ZVLA 4AY2A 2Z43A 1KI2A 1KI6A 4OQNA 4JT4A 5GJVC 2HV8A 5CDFA 2BEJA 3MWKA 1U9IA 2ZU6A 1WQ1R 3CM0A 2KI5A 3P27A 2ORIA 3SZRA 1AM4D 2VRWA 1A82A 1ZP6A 1P60A 2DWPA 3OHMA 1M7HA 1NIPA 5JWRA 4FCVA 2ZI4A 2A5GA 2GCOA 1II0A 1ZM2A 3QSYA 4HDCA 4TYNA 3GMTA 4Q9HA 2BHRA 3X2SA 4CT4B 1XTSA 4B3DA 2MSCB 4B73A 2ZI3A 1KI1A 1Z8FA 2A9KA 4QGAA 5JMTA 4KAXA 1M7BA 2ZYTX 1G7CA 4M8NE 3SQWA 1ZC4A 3WYFA 1VG1A 3KFXA 2CLSA 1UKYA 1ZAKA 3UMSA 4M22A 2ZI5A 1YR7A 3AKCA 3BE4A 3EWSA 4IFEA 2NPIA 1NLZA 1N6PA 4G01B 5D3MB 5FFMA 1W49A 2IYSA 2ZE7A 1NN3A 4XWOA 2HLDA 4LYAA 1XDBA 1XD2B 2XXAB 4OYHA 5E7JA 4LV6A 2XXAA 5A0FA 3M0EA 5JI2E 4OI4A 3KXIA 1G7TA 1G8YA 2JJ1A 1XU4A 5H70A 1J70A 2ODWA 2QPAA 4IJMA 4TMVA 1CJTC 3OIYA 4D4MA 4RCZA 1OIWA 2J1LA 4LC1A 4DLUA 4RY2A 4BZPA 3RWMB 4CEJA 4CEHB 4XWAA 3IHLA 4CEHA 4KV9A 2GF9A 2WOJA 4L8GA 1UM8A 2B21A 3AEZA 1JBKA 4ZI2A 1R0ZA 4LBWA 3S1AB 3D6TB 1E69A 3GLHA 3T34A 4EQ6A 5KNBA 2QRZA 4ESHA 2O8BA 2JGNA 2GTPA 3D31A 4LPKA 4ZIRA 4RD0A 4D25A 2FPMA 4BFTA 4MUBA 2BIFA 4ARZB 5CLQA 1OW3B 2OFXA 2IYLD 4PZZA 4JLVA 2OSBA 3LBNA 1QZXA 4WW0A 3DMNA 4TZ0A 5SZJA 1DAGA 1Z0FA 3RS5A 4Q7LA 3KTAA 3KKNA 3VR6A 4TTQA 2AX4A 1X3SA 4OQXA 3VHXA 5EJEA 2J7PD 2NZ8A 2N46A 3CBQA 3L2OB 4PHTA 2CHGA 1RRCA 3B8HA 5DISB 3V00A 4B2PA 1Q21A 1E2NA 1OXSC 2OBNA 3GQBA 2YHSA 3B9QA 1P2VA 1XFAA 3QXHA 2BV3A 4MYTA 3QBVA 4G1UC 4DB4A 1NP6A 2BKEA 5GVSA 3OAAD 4CEIA 3QY0A 2B8TA 4PPFA 1BIFA 2IF2A 5JS7A 4GP6A 1N25A 4YMSA 1DTSA 1FUUA 4MH0R 2BCGY 2PT7A 1MRSA 3I4LA 2V1UA 2V8OA 2F6RA 1G16A 1HV8A 4XIGS 1CF4A 2IYTA 1OH8A 4KSBA 1E32A 1DG1G 2ZJZA 4A2QA 4M2LA 1VG8A 2GAOA 2DWOA 3B6EA 2G6BA 1NBMD 2BMEA 2WMOB 4AKIA 1W46A 4TQUS 3S1AA 4PSAA 2DB3A 3VKHA 3TAHA 2J7KA 3SJCA 3PJRA 3CIOA 4DLYA 3K0SA 5JJIA 2O8EB 2Z4SA 3A1VA 1K5GA 4FMCB 1DPFA 5DI3A 2OT3B 2ZANA 2ZPTX 2PZEA 3RABA 1YHNA 2WSSD 5L3RA 1I4TD 4BFSA 3PUVA 3NDBB 1QVRA 4PC7A 2JEOA 1U8ZA 3THOA 4UJ3A 5JECA 1RC8A 2FFHA 1V43A 3BOSA 4FMDF 2JJ8A 1PZNA 3GEIA 2G1JA 4PHGA 4DEYA 2Y8EA 2R44A 4JKYA 1Z0JA 4DHEA 3EPHA 1W36D 1TUIA 3MCAA 3A6PC 3ZVRA 2WZQA 1XEFA 3VU9A 3X1DA 3VQTA 3RSLA 2D2EA 3EG5A 4LBZA 4FINA 4Z1MD 2WIAA 4D26A 1KI6B 1Z2AA 4DDVA 2C98A 2BVNA 2I1QA 3W6PA 2BBWA 2Q0HA 1R0YA 5C18A 4IHQA 2O0HA 3U5ZB 4IVQA 4TLCA 1RYFA 1HE8B 1JPJA 3WHLA 2WKQA 1F2TA 4HSEA 3AP3A 2H8KA 4YDHB 3OEHA 4OK6A 5C2JB 4FWTA 4JLKA 1CLUA 1E2GA 4HB0A 2WJVA 4JJZA 5DYIA 5IRCD 2ZJ8A 4FMBB 4B35A 5DE3A 3KX2A 3HP1A 5IHPA 1RRGA 1MKYA 4LX0A 4IXMA 1OPXA 1D8TA 2VP6A 3QPWA 3TQFA 5CJ2A 3B82A 4A4DA 2IW3A 4Q4HA 2IX3A 4IOLA 1GKIA 2RHDA 3HWSA 2FA9A 2CE7A 2AHOA 1TF2A 3SHFA 3NHBA 4KO8A 1AGRA 2GJAA 3DM5A 1R0WA 3EWAA 5GJCA 1LS6A 3ZZUA 1ZD9A 3LXXA 4M1WA 3ASZA 5CM8B 2KB0A 3I8XA 1BO6A 1DAHA 1TX4B 5EE1A 4AYWA 3LWNA 5JRJA 221PA 3C41J 3A37A 1GL7A 3X1XA 3WP1B 4HUTA 1GRNA 2ZS9A 4GT1A 1G64A 1EFCA 1KGDA 3R7WB 4AKHA 4Z51A 1NF3A 5G3ZA 4NCJA 2C9OA 1ZM4A 1NNEA 2O8DA 1D2NA 2ZRPA 4HZIA 4OL0A 4PO8A 1QDEA 4JBYA 1NG1A 1Z07A 1U94A 4GFDA 1FMJA 5HKKD 1T5IA 4AC9A 3W9YA 2F43A 3BFVA 4Q1AA 4DDWA 1E2QA 2G83A 4AI6A 4E07A 3IEVA 1QHIA 3QNUA 3KQUA 3HYRA 1DS6A 1OKKA 1IJFA 2QA5A 4L5BA 4PAMA 4D81A 2JLXA 1KSGA 2WKPA 4EFLA 4M9XA 1WCV1 3K1JA 3B85A 4CW7A 4EDHA 1KK0A 1OYWA 3AUXA 1LS1A 1Z0KA 4PSKA 2WWYA 4NPHA 4QHYA 2QPOA 2XJ4A 2ZVPX 5KTYA 1EWQA 4GI7A 4QBIA 3TAUA 2DYKA 2ZRLA 3DOFA 1CJVC 3TR0A 1RW4A 1EESA 2ECKA 1NMXA 1I2DA 3E5HA 4BZQA 1Z29A 3SR0A 2R2AA 2UKDA 4AYTA 1GKYA 4M1SA 4QBFA 1CEEA 5J4LA 5KU1A 3R7WA 1E79A 4EPVA 2P2LA 4OK5A 1E2MA 1XD9A 1XX6A 1YZNA 3GP8A 3CR8A 4LJAA 2QTFA 5DHFA 4NKRA 3GLGB 4OK3A 1JI0A 4RVCA 4B6FA 1FTNA 1ESMA 3LX5A 3QEJA 4MA4A 4DLXA 4Q9JA 2BWJA 1FX0A 1N0VC 4RD1A 4BRUA 1ZNWA 3ZJYA 4Q1BA 2WICA 1SVWA 4KXFB 1RYHA 1XTQA 5DYGA 3MG9A 3RS4A 4CYMA 4DBLC 4OHVA 4OQFA 3QKRA 2J0SA 4RZUA 1TQ2A 1IN5A 3RS7A 1N5IA 5BYKA 1A7JA 5JS8A 4M9SA 1HQYE 1XCMA 1D6JA 3GEEA 3UWKA 1CRQA 5DI3B 5KSPA 3L0OA 721PA 4PHHA 1N6NA 1NN5A 2J0UB 3TW8B 3K09A 1XTKA 4YDSA 4BWYA 1UDXA 1BYIA 3LDAA 2ATXA 3BB4A 3KL4A 4TL9A 4URYR 3ZGXA 1P6XA 1G8GA 2W58A 1E2KA 5FTNA 4YMTA 2CMKA 1VCNA 2EU8A 1GRRA 3VR4A 1X86B 4QHTA 1XZQA 4LYFA 5FTLA 1TQDA 3T1OA 4BLQA 4PQRA 2RGNA 3AM1A 4BFYA 5CITA 2BM0A 2MMGA 5JI3E 2FFBA 2FZ4A 2ONJA 1E98A 3CB4A 4TMZA 4A92A 2HEIA 3CRQA 5FUWA 3UIEA 1EG7A 1U0HC 3CWZA 4ZDWA 2FNAA 5KHOC 1UADA 3E70C 2HF8A 4DCVA 2XGJA 1KKLA 4MITA 2GVDC 5DSZA 4ZKEA 3AGPA 1FFHA 5BN3A 5SZKB 4NBSA 1R7RA 1NN1A 3F3YA 2PJZA 4V0MA 2PBRA 4FMDB 2ERYA 1OF1A 3NH6A 1H65A 4NMMA 3NEYA 4MKFA 1QHXA 4MGIR 2NOAA 2FFAA 4NCNA 3VNUA 1J99A 4KLNA 4DUGD 1Z63A 1NMZA 2W2TA 2Z83A 2QMHA 2W00A 3IQXA 2Z0MA 3TJZA 1F2UA 2C03A 4WBSA 3DPUA 1OB5A 2OM2A 3B5JA 3OESA 4L15A 3AVYA 2C8VA 5ELXA 4PAOA 1IONA 2PJRA 3K9GA 1EFRA 3KJIA 1KYIA 4TYQA 1BYUA 1HEIA 2VSOA 4NYMR 5DN6D 4US0R 4E09A 1XMVA 3GEHA 5TXGA 2RKOA 1FUKA 5BXQC 1PUIA 2F9MA 1L2TA 3LLUA 2CHVA 1T3SA 4ON9A 5LD2C 5AJXA 5BW8A 2YWGA 4PZYA 1FL9A 2QE7D 2NQ2C 2VSXA 4ILEA 5FL3A 2ZJOA 2FMXA 5HZKA 4EPXA 3LH5A 5KSOA 2GCOB 2ZSDA 4F93B 1QBKC 2P5SA 3CNNA 3W8NA 1OH7A 1T5LA 2ZJ5A 3BH7A 2PL3A 3I92A 3IIJA 4KFSA 3IKJA 2QQEA 4A0HA 1CR0A 1DBSA 3HDTA 3NG1A 2BKUA 1LY1A 2FGJA 2ZVQX 3PEUA 4V0OA 3UMFA 3WNCA 2QENA 3EPLA 4GZLA 5GVRA 5FBQB 1WF3A 1SXJE 1KK3A 3RS3A 2R6DA 3R9XA 5FL7D 5LD2B 2LKDA 1R5BA 2MMCA 4FXPA 4TMWA 2W0SA 3KUCA 2NG1A 1NSTA 3ADKA 4TL7A 3EW9A 3IILA 2IHYA 1ZUNB 4KITB 1W5SA 1OJLA 5FBLB 1XEWX 3AF0A 3EZFA 4P32A 1KO8A 1TF5A 1BH2A 1ONBA 2VHTA 3TQCA 4Q00A 2R6GA 3BB1A 4PC3A 3FKSD 4S35A 4PR0A 1HT2E 3W6NA 2QGNA 2WMNB 5FOXA 2ZE6A 1LTQA 1MV5A 3FDIA 4CRWB 4G5QA 2NO6A 4ZI3A 1QG2A 2OHFA 1W2HA 1Z6GA 1OHHD 1SXJA 3DZ8A 5CB6A 2AXPA 1GDDA 2X2EA 3IGFA 4HDQB 3D8BA 5D3MA 3TVTA 4W9MC 3MGCA 4K46A 4O3MA 1NSFA 2REXB 3CH4B 4L9WA 1VYUA 2PCLA 3OZXA 2CDNA 2QT0A 4Q1FA 1EK0A 1DO0A 2DCUA 3C14C 4JKIA 3RRMA 3CNLA 6Q21A 2O8CA 3IDQA 1T4GA 1ANKA 2FEMA 2IYWA 4EPRA 2ZITA 2HCJB 1FMLA 1XCPA 4Q4AB 4UXIA 2WAYA 2ZRCA 4UNQA 5BN4A 3AF1A 1OFUX 4AIIA 4LC0A 4TYYA 5H1YA 5HCIA 3ZH9B 2FSHA 2Q9AA 1JR3A 3PENA 1Q22A 2ZUBA 4K81B 4QHSA 3X1ZA 1G20E 2FN4A 1YU9A 3LO5A 4NYJQ 4C9BA 2GDJA 4BZXA 3PVSA 4LJYA 4TN1A 3FMOB 5H8WA 1SULA 3QBTA 4MKIA 1N5JA 4FW9A 1Z0AA 2GILA 2KE5A 4MUAA 4MRNA 1KDRA 3M1IA 3N5CA 4PXAA 5CYPA 4OQLA 4TSFD 2ZRBA 5FBVB 4A15A 2XZPA 4ZKDA 3SFVA 3VX4A 4CEJB 1GZSA 5IF9A 1QHHB 5FTMA 3C5CA 3W3AA 2FSFA 3PITA 4QFMA 2E87A 2X77A 3EZ2A 5L8VA 3AF2A 4JLBA 3SI7A 2W6ID 3W6OA 4XH9B 1CKEA 1E94E 4TLEA 3P26A 3DO6A 1E6CA 4B34A 2GCNA 4BRWA 3AVWA 1T0HB 1HTWA 1E96A 2ZAOA 3MD0A 4ITRC 2CNWD 4Q1CA 2D62A 4R9UC 2IHBA 2REOA 2V4ZA 3AVPA 1NIJA 1SGWA 3EPKA 1ZU4A 3E2IA 1DVRA 2CCJA 3A58B 2RMKA 3LQQA 2EFCB 5LPNA 3THYA 2OUKA 4J0QA 1WE2A 1R2QA 2OLKA 4LJ8A 3SHWA 3TGPA 1US8A 2DFKB 2JCSA 2P65A 5JHHB 2ORVA 1II8B 1SXJC 3FKQA 3QXCA 3PV0A 1TQ6A 1MO5A 4TT3A 3CRRA 5K8IA 1CXZA 1J2JA 2PCJA 3K70B 1UBFA 3P4XA 4LBYA 2D06A 4PZLA 2GZDA 4KVGA 4PFSA 1YZKA 1NBMA 2VEDA 3IHWA 2QPTA 4TLBA 1S9DA 1NY6A 4PAQA 3RHFA 4QM7A 3ZLJA 3DOEA 3BD9A 4D0GA 3CF6R 1AQUA 2RGBA 4AURA 4LHYA 4FD2A 3U7HB 5JJKA 2VHJA 1KZ7B 4QOSA 4R7ZA 4EFMA 4KFUA 4G5GA 3G82C 4ZCMA 5EP4A 3ICEA 2R62A 1TTTA 4G3XA 4KLZA 1AKEA 2V7QD 3BERA 3IUYA 121PA 2H1LA 3KKOA 3UG7A 1OSNA 4Y0AA 1EXMA 4WZAE 4DIEA 3R8FA 2Q3HA 2UVQA 1IN6A 3NTUA 3P4YA 4PHFA 1U2RA 2XITA 3VMFA 1AK2A 1UEIA 4Q01A 4DSUA 4YXWD 2YYZA 3AF3A 1Z06A 2GCPA 4AKEA 5FI1B 2RGGA 1ZIOA 4IDOA 2QN6A 4WIAA 1NKSA 2ZE5A 4WOPA 2FH5B 2N42A 3SBDA 4DLWA 4KCGA 1GILA 2O8FB 2XOKA 2YWFA 2AKYA 4G0NA 1R5OA 2WWIA 2KBFA 3QVUA 1IOZA 2QQ0A 4B6EA 2QMUA 1WB9A 4PQYA 4ZDJA 2J45A 2O5VA 4AKGA 3SJAA 1OYYA 4QBHA 2YOGA 2GWHA 3D3QA 4F4JA 5HPYB 2AKAB 2HJGA 4C0QC 2RGEA 3MUFA 2OCPA 5JEEA 3PR1A 1OIVA 1W36C 5EP2A 2DPXA 4M1TA 2R6AA 1LVGA 5AJZA 1T3HA 521PA 4Q48A 1OFTA 1KK2A 1Z6YA 4O2RA 2YOFA 1UKVY 4US2R 4B71A 3I73A 3BGWA 3U3KA 5KPJA 1CRPA 1XPUA 4JLJA 4PO1A 2Q6TA 1PV4A 2V6IA 3PUWA 3GLFB 4HUQB 1KJZA 4HUQA 4TYPA 4V0LA 2QMOA 4EFNA 1VIYA 3ASYA 4U7DA 1PVOA 3G5UA 1AGPA 1KDOA 4XTRA 4Z8YA 3C16C 3QKTA 3K0FA 3MJRA 1JNYA 1TF7A 4TLDA 3HR8A 2W2XA 2Q3MA 2PLFA 2JJ1D 2Q9BA 4DXAA 4I99A 3ADDA 1SVMA 3Q3JB 3QKUA 3Q5EA 1XTRA 5E7IA 2IS6A 5J4KA 1HE1C 4A0FA 1Y3AA 2EFDB 3OEEA 5G41A 4WZBE 1MR3F 4HI0E 4C0HA 1JJ7A 1U99A 4MDEA 2V6JA 3L43A 3MWYW 1VMAA 5FPYA 4HLUC 1KK1A 4LK2A 1ZMXA 1MOZA 2RGXA 1OKKD 1XZPA 4QJ5A 3VKWA 4XTCS 2HYDA 2RGCA 3EX7C 2GEVA 2YC2C 3W5JA 2GK7A 4JVLA 4Q19A 4EIWA 1VG9B 1COWD 1EX7A 1WBDA 1DAEA 1UDWA 5EQTA 5TV2A 4C2TA 5SZHB 1W0KA 1DE0A 2BBTA 4JSYA 4B47A 1P9NA 2AL7A 2J7PA 1ZM7A 3BRWD 1Q1ZA 2ERXA 4NL4H 3RRYA 1ZJ6A 3SEAA 1QHSA 4C0SA 3REGA 1XWIA 1ZBDA 3ZZTA 821PA 2WBLC 1W48A 2H7VA 4FCWA 4WZ6A 3DKPA 4UNRA 5E4FA 2A5FA 5UKDA 1RIFA 2FF7A 4YMVA 4LPSA 3KKPA 1AKYA 2SHKA 1RFLA 3GJ3A 2OBMA 2ZYWX 4I1UA 2J87A 4OHWA 3U7GA 3AUYA 3FOZA 3A1TA 4BFXA 1YRBA 4NYMQ 2QL6A 4CGZA 2PEZA 4QGGA 1W44A 3DKVA 4QXAA 2QAJA 1E2LA 3Q8XB 3Q85A 1W4RA 2H16A 2VIIA 3BIFA 1VDZA 4TZ6A 3KQLA 2ZRDA 4Q1DA 4TWZA 4E22A 1E9SA 2CBZA 1CBUA 1RVDA 2GHIA 3GFPA 5AK0A 3RSOA 2GBLC 3FMFA 4DCUA 2WHXA 1LNZA 2GJ9A 5FOTA 2IEYA 2O0KA 4ASUA 2WV9A 4GDFA 1B0UA 3PFIA 3RLFA 1YZLA 2B6HA 2CVHA 3GLHB 3LVQE 3Q5DA 2WIBA 4Q4JB 5DIFA 3SC3A 2OXCA 1WMSA 1YZQA 2EWVA 2ZETA 1H8HD 4YONB 4HAUA 1NLFA 2YKGA 4PC6A 4A0RA 1XXHE 3LVRE 1ETUA 3LY5A 1YZGA 2QG6A 4DEXA 2YVUA 1TL7C 2ZRNA 2IXGA 1GP2A 1ZIPA 2OXRA 3C8UA 3FHOA 2NZJA 5FR2A 1WXQA 5C46F 2GXSA 4FI3C 2AK3A 3DEFA 3I62A 4GPTA 3FE2A 3A1UA 5EZ6B 1AJEA 5HR5A 1JQLB 2R6CA 2R8RA 4QM6A 1SKYB 2IUSA 1E9RA 1JAIA 1MABA 1NJGA 2NO0A 3KQKA 4B3GA 2O0JA 2QZ4A 2YNMA 3OIUA 1RRPA 1JPNA 3WMEA 5AJYA 4OJQA 5CIWA 1W0JA 4UNNA 5DH9A 4RD6A 3WYGA 3OEHD 3AQ4A 3GLHE 4IXNA 3N2EA 3C5HA 4DUGA 3F0TA 4G5RA 5B64A 4IVRA 2KSQA 4MKHA 1OT3A 5B30A 4TL6A 4R98A 4MRPA 5K8UA 2JLVA 4ABYA 5JSZB 4LJ5A 1M8PA 4FWIB 4HYYA 3TBKA 5L3VA 4X8HA 3Q7PA 2YC4C 4AG5A 2OG2A 3RC8A 2G88A 4JLAA 5DN6A 1TU3A 4DWJA 3QKSB 4NZYA 1ZRHA 1EWRA 3ZVNA 2EYQA 4X8LA 2C9YA 4DC9A 4RFVA 3U3MA 2GZHA 4G5OA 3SN6A 1VHLA 3K9HA 4M21A 4HLDA 2QE7A 4Q1EA 4Q9IA 1HA3A 2ZJBA 2J0UA 3BFXA 4GSYA 1C4OA 3K0FB 1DO2A 1E0JA 4ZO4A 3TUIC 4BECA 2GK6A 1GL6A 2ZUCA 3MMPA 4Q4LA 3THWB 1GWNA 1Z47A 3NBYC 1YQTA 5FPSA 2WPDA 5JBQA 3SJBA 4EJSA 4Y0VA 1RJ9A 3B1VA 1U81A 2AK2A 2QSZA 2ZIAA 3QKSA 4E03A 2J0QA 1IM2A 1OXTA 2ODEA 4NYIQ 3TSZA 1CS4C 1ZYUA 3ZIAD 2D4HA 1KTVA 4IEEA 2ZRKA 5FOSA 1U8YA 4KI0A 3VR2A 3REFA 1CJUC 421PA 5FL7A 5JJLA 2YWEA 5L3SA 4MRVA 4B48A 2X19A 2XNSA 1N0WA 2HDNB 3K0CA 5JCPA 2G9NA 3WXMA 4Q66C 1UEJA 1XBTA 1IY0A 2A78A 1CR4A 2NIPA 2B7CA 3KDSE 2QBYB 3U3OA 2ASEA 621PA 5DLQC 1NY5A 4I1OA 3A4NA 4XVUA 4WAUA 3TW4A 2OO7A 1KJWA 5G53C 1KSFX 1R5NA 3QF4B 4NCHA 3L8ZA 5CDFE 5J4VA 1R4AA 1P72A 2BMFA 2ZJYA 5J40A 4M1OA 4LHXA 1QHGA 2C96A 3TRFA 5EE5B 1YZUA 2PEYA 1XJCA 4M0LA 1SXJD 3QXJA 2QEQA 3ADCA 4HLQB 4NP6A 2D7CA 2OE2A 2ZS7A 2KBEA 1DAFA 2CE2X 4R2HA 3O8CA 2E1RA 2IYQA 5GADl 4GBMA 4LOAA 1ZW6A 3DDCA 4HEJA 3CF0A 1P2SA 2IYZA 2YOHA 3HYTA 1SQ5A 1SVKA 1E2IA 2NO1A 2IA5A 4MYUA 4DKXA 1SVLA 3CWQA 3NIBA 3GCGA 4P31A 4Q9KA 3KQNA 1TUEA 4BASA 2CL7X 5TB5A 1YJ5A 3GLFE 4HAXA 2YWHA 4DDTA 2CL6X 2QSYA 2FZLA 1UFQA 4P4UA 4PQFA 3FWYA 4AG6A 1XEWY 3IO5A 2OLJA 1CU1A 2ZUDA 3DM9B 3TVDA 4EKDA 3IBYA 2W83A 3ETLA 3I8SA 1M1YE 4L16A 2JDID 3QVVA 3QXXA 4BFWA 3TH5A 1KY2A 4D6PA 3MWLA 4OI2A 1CULC 5FUXA 3SJZA 5FTJA 3KB2A 3DHWC 1ZCAA 4GZMA 3GLGE 1XRJA 4TSFA 1F60A 1II8A 1S9HA 1Z6XA 2FU5C 2D2FA 4U5XA 1Z83A 4A1FA 1UF9A 2VO1A 3K0AA 2C2HA 3KFVA 4LGMA 2HUPA 1XPOA 1KY3A 2IK8A 4JBWA 2CLCX 4V03A 1G3MA 4JJKA 4ACBA 3KJEA 2OCBA 5EP1A 1OB2A 3K53A 1KMHA 3H4MA 2OFOA 1ESNA 1P9RA 3FYHA 2R6FA 4QRHA 2ZSBA 3ZQJA 2CNWA 2CK3A 5E7MA 1W4CA 3VR1A 1PUJA 4BLRA 1YKSA 1MH1A 3Q72A 5FTKA 4CEIB 4IKEA 4BLOA 2DWQA 1P62B 3AVOA 2FSGA 4DT1A 1KOFA 1DAKA 1T91A 1JAHA 2G3YA 4JLNA 2CXXA 2EVWX 4TT3D 2C9CA 4D82A 1UPTA 2FG5A 1P7CA 5AUOB 2F3TA 4NH0A 4BEBA 1DOAA 1EFRD 4TTPA 2ZR0A 1ZU5A 5FPTA 1X8KA 1MO3A 2EFEB 2LKCA 4B2IA 1MABB 5EUQB 4OHZA 3U61B 1N6IA 2A5YB 3B60A 4B3FX 1E9DA 3QUSA 4URVR 4BFVA 2JATA 5JZVA 3A4MA 2V1XA 1UJ2A 1OE0A 2B7BA 3CUEF 3FTQA 1E1QA 4IDQA 2AXNA 3HR7A 4FN5A 4RFSA 2GEUA 3BC1A 4M9QA 1I4LD 1WRBA 3QENA 5HE9A 3RANA
chains in the Genus database with same CATH superfamily
5CX4A 3FF4A 4MVJE 2AWNA 4DQDA 1PGPA 2CNDA 4FYYA 5AW8A 4ZOAA 5JMWA 2UYHA 1VQ1A 1ULSA 4GF5A 2NU6A 1B76A 2RHTA 4QA9A 2ICAA 4ZCTA 3R7DA 5AHOA 1KQGA 2XZOA 1FTYA 3NOXA 5ERYA 3NEJA 4F5YA 4LOLA 4FDLA 3FYUA 4FZVA 3AFNA 1PJSA 1FPMA 1EP2B 3DHEA 5EIBC 3LBIA 5DGTA 3RE1A 1WP9A 2GH1A 1XZFA 2NU7B 1GUBA 4LIPD 2ZXUA 4ZD6A 3GUUA 2HA7A 1FE8A 3FETA 3ORFA 4I50F 4KIGA 1QHEA 2VH5R 2DUNA 3L92A 1F6DA 3WNBA 3X2FA 2GM3A 4P4SB 4NZPA 1O3YA 1YRWA 2FFRA 3GFOA 4YA6A 3V6MA 5AW1A 4HQ6A 4IS3A 1QVAA 1DJPA 4KYUA 4ZEOA 4IIXA 1JDUA 3JZAA 2ORWA 1DIRA 5DP1A 2ZTLA 1UBTS 4RYDA 4P86A 4Y9DA 2ZTSA 1XNHA 1YHYA 4KDCA 5JD3A 3BAFA 3G7SA 5JISA 3HADA 1JDPA 3H1FA 4LN1A 5J5AA 5E3IA 3B1ZA 2FPSA 1CWUA 1GGNA 1RXVA 1ZOOA 1ULUA 4NF2A 3U3ZA 4HPJB 4PZ9A 2EG5A 5ALPA 1D2EA 3BHIA 2D5IA 2B0CA 4KV7A 1U63A 1YE8A 4M89A 1QHHA 3CTPA 4X9XA 2WVJA 4XGIA 3H75A 3WWOA 3CPEA 3AUFA 5BQXA 3T1TA 5CYFA 4LHVA 3SNKA 3HZHA 4TTRA 4W63A 1R15A 1V4BA 3GQBB 1N4AA 1QXSA 4BHTA 1VJRA 4IJ6A 4NHOA 2GBFA 4KR9A 1JLLA 1ACJA 3RBXA 1JIUA 1R6UA 1FZQA 1GNPA 2IUEA 3JYOA 4FUQA 2ES4A 2XX3A 4TV8B 5HF9A 3SFTA 4EG4A 1LPMA 1Y1QA 4G4SO 3L8YA 1SZPA 3Q98A 2AFIA 1TEHA 2WF6A 3QQPA 4LDRA 4NH4A 4OXKA 5EXTA 1U2SA 2RK3A 3ZD7A 4K40A 2W93A 5CVDA 4HNGA 1JEYB 3PKIA 1GL9B 3LQRA 1BOOA 5ALLA 3T54A 3ZHOA 1V3TA 2NO5A 3JVIA 4F97A 5AM3A 4EFDA 2O2SA 1JKJB 3D1JA 3M6UA 4MOWA 1PQUA 3HN2A 1XF1A 4ZYZA 4IQGA 2C7OA 2PM8A 1SVSA 3EXG2 3PE6A 3DTVA 4Q7MB 4PIVA 5F9MA 1AV6A 2HQ1A 1P61B 3IQZA 1Q44A 1DXHA 2VJMB 2OAEA 4MQBA 4LI0A 4MPJA 5ILOA 3SQXA 1JHRA 1GPJA 3WR5A 2AN9A 1CR2A 4ALLA 4FSXA 5ENVA 1HZJA 1WLYA 2G07A 1MGPA 1YDWA 3HWX1 4M0EA 5LFAA 3Q7RA 3PNMA 2JLWA 3CN7A 4D3YA 5J2TA 3DF9A 1HDEA 4ZPXA 2NSJA 4II7A 1DKPA 2PWPA 5CJPA 4IIYA 3DO8A 3IOYA 4YB8A 1Y48E 5G40A 2QLMA 4C7MA 2RD2A 2P9YA 2B98A 5T5QA 4M53A 2I7CA 3KKEA 4YECA 4E5MA 1SXJB 1JR2A 4IHAA 1I8TA 1PK9A 1SZJG 5KBYA 1UPUA 3HJAA 5K7SA 3PDHA 1H6CA 2KS6A 5L6MB 1JMYA 5FWXB 5HNKA 2QS9A 2WHEA 5EL0A 4I3HA 2B61A 2VZEA 5KYWB 4EO7A 2FE1A 2DQSA 2HSDA 1G7SA 2QTMA 2ASVA 1QTRA 1QZUA 2RK6A 2V7EA 3UUEA 4ZOCA 2JCYA 2BHSA 2D0PB 2I5PO 2ZR9A 2DY1A 3A27A 3STYA 4EY7A 4QJ3A 5KYNA 3U7FB 2H0QA 2J9RA 5K6AA 2VBCA 4G0PA 4UBKA 1MRZA 1N6KA 1CJKC 3OU2A 3K9FC 3OE7D 2XUOA 1PWEA 2HQOA 3E0XA 4JT2A 5HFAA 4EBFA 1GAXA 3DCYA 3DR5A 3TSWA 5KYYB 3K5WA 1DB3A 2XNDD 3DAFA 3EMKA 4NU8X 1JMKC 3IIKA 4C4RA 3MJHA 1ATIA 1CC1S 3L7YA 2QROA 4EAQA 1I3NA 1JHAA 1LI5A 1MO4A 4UAVA 2IBSA 2VRCD 3SBEA 1F8UA 4TWAA 2R5WA 4N0QA 5AJUA 1OXUA 1J8YF 4NECA 2B6NA 2B0JA 4TV8F 3FG9A 3FPEA 1Z0IA 3QKRB 2H9YA 3CA8A 4PZ0A 3GOHA 5JCJD 5I47A 3E5NA 2W6JD 2XVZA 1W93A 3MB8A 2AA3A 1C0IA 3L7BA 4UHKA 1XZGA 4FDUA 5C8ZA 5EZYF 3V80A 2HMVA 3TRHA 3U13A 1KPHA 1J5PA 2QM3A 2ZRFA 4XWTA 3THXA 3GP3A 3N8HA 4MW7A 1P7YA 1YC5A 4I8IA 1DBIA 2IYVA 4IP0A 3CW2A 5MFPA 2EKDA 2O4CA 5AVJA 1H8HA 5EUMA 1B8UA 3W7AA 2H4ZA 1Y4UA 3CRMA 4IINA 4ERXA 3AUTA 2PMCA 2FK8A 4BVAA 2E37A 1SIOA 1RKQA 3GRZA 1SMKA 3CS3A 5JSYA 4ZO6A 4CVNA 1DELA 1JKXA 2I7VA 3KVVA 4OLAA 2DVMA 4OHXA 1ZL0A 3LHIA 2AN4A 4ESEA 3TUZC 1T8RA 1P1CA 1AKWA 1RIIA 1OI3A 1NXWA 4JLWA 1WB5A 5TQ2B 4P35A 1BVYF 3QEMB 5YASA 2J9YB 2Q3BA 4JUDX 4HDSB 3S44A 4KN5A 3NFRA 4ZVLA 3FHTA 3TNFA 2YFHA 1CG6A 3KXDA 3NXSA 1SK8A 1Q6ZA 2APJA 1UOQA 3IJPA 1SUBA 4R1NA 4R3WA 4WKGA 4FHZA 3N6VA 3TR6A 3ZCXA 4FZRA 1Y33E 1Z45A 5FI5A 1NNEA 1Z28A 3B3FA 2HU7A 2LVBA 3AHDA 3HPRA 3IKVA 4U0JA 3ZK7A 1F38A 4EI8A 4R1OA 5FUVA 3GN2A 3QX9A 3L02A 3A9CA 1SUCA 5IN4A 4PAWA 3JPYA 4W5HA 3ZDAA 5BN5B 4C0AC 5FR1A 3UY4A 2PX8A 4M36A 2B8WA 4V24A 5KVVA 1V1JA 5L6LB 1CHNA 2PBZA 1G3UA 4BOYA 3KJHA 2YV2A 1D6MA 1DG3A 2M1XA 2QZJA 4WOJA 2CJXA 2W2KB 2GYYA 1WL8A 3B1YA 1S1CA 1RDFA 2Z2IA 3LA6A 4JZKA 3RV3A 2O19A 4BJ3A 1T0JB 2YJTD 2CW5A 2E9SA 4NS1A 1I1NA 3V7NA 4O0MA 5SZIA 3T6KA 3FCCA 4JLUA 4ZVTA 2DULA 4B5LA 3Q9LA 3BWYA 4HVAA 3GJ6A 1NJ2A 4DV3B 1JWLA 2JGDA 2PUFA 3VBCA 2R97A 1MT0A 1E3WB 1R0LA 2O8DB 2LZ0A 1M0TA 4PO9A 2HFJA 4EQZA 3JTEA 2AOUA 2NU9A 1H9AA 3D7KA 3HWRA 4LY6A 4Q02A 1X8JA 4BO6A 3T06B 1X94A 2ZU0C 3V34A 4XCQA 3V2IA 3OZRA 1F14A 3PIRA 1I3OA 3PGA1 1BS2A 4BRSA 1Z25A 5CCBA 3QV1A 4B75A 2DUUA 2EFYA 1VG0B 1OREA 2CLMB 4KJZA 4PYMA 4ENPA 4HEHA 3ONEA 3E82A 2QL5A 4FS3A 2QUBA 3BWMA 4LHZA 4DUPA 5CBKA 3VDRA 2P9QA 4HLCA 3RT1A 1VCIA 4E14A 5I7WA 1Y5NA 2IPXA 3MCWA 4F8EA 3WLSA 3PSHA 5F7JA 4LV5B 2PKEA 5CDGA 1FQWA 1IBRA 1KP3A 1Z2CA 3GJYA 1ZL2A 3MFQA 4L1KA 4U02A 2BP7A 1C7IA 3UGKA 2C5EA 4G67A 1GOTA 4C0LA 3GVCA 1BXZA 4DV6B 1QV6A 1X77A 4QVKA 1JB1A 2ADOA 3IOMA 1BXKA 2EP7A 4NDNE 2XQKA 5EXDA 4HATA 2REQA 3OX4A 4A8PA 1AE1A 2A0KA 1T2UA 4HAZA 1E0SA 4HWRA 5H3LA 4C0WA 2DHEA 4FR2A 2O5RA 2Y4OA 1XB2A 5JEDA 5CVCA 1NVUQ 4E0BA 5ARBA 3ZCRA 3OFSA 3TJRA 4DSOA 2ZLBA 1IRIA 4H3KB 2WT9A 1T6YA 3FHCB 1T9HA 2OZVA 3Q3IA 1Z5NA 3LX6A 4WD3A 5A6VA 4KYIB 5P21A 3T0IA 1WTAA 3DT8A 1VYTA 2YNMC 1L4KA 4BB9A 4BO5A 3LW7A 5K0TA 3Q12A 4BUJA 4BKOA 5BR4A 5CFOA 1FP6A 1J22A 1QZ3A 2NXCA 1TEXA 3QOFA 5IJZA 3GLTA 4D46A 1IWOA 2IQIA 2RI1A 2IEDA 3KTFA 1MQAA 1H2YA 4UUQA 5GONA 1YDMA 3ZE8A 4BP3A 3R7LA 4B32A 1M74A 1HT1E 1XXHA 4I6JA 2Q3EA 2IH4A 3IAS1 3H2BA 3A1CA 3KUUA 4E5DA 2EDAA 3TTTA 3KZNA 3IDZA 1GUFA 2AFIB 4I4IA 4OSPA 1S2MA 3DEZA 2XGGA 3H0KA 4HJXA 3SXJA 1IPEA 1CVRA 1F3LA 1NRWA 3IUEA 3OLCX 4YUVA 2E4UA 2FKAA 4FWBA 4X3OA 4V0KA 2PS0A 2GPSA 5AI9A 3Q87B 1LTKA 2HDWA 4BJ6A 4UFPA 3A70A 4MA5A 1E2DA 3GLKA 4YMWA 1LK7A 3RRNA 2ZTUA 1UL1X 4G36A 5E6RB 5JO0A 1SVIA 1XPRA 1LV7A 4KSYA 2J9ZB 1NP3A 1R9MA 2C78A 3A8TA 3KZVA 2GA8A 2PQ0A 2QT9A 5LQUA 1CQZA 3GCDA 4TMTA 4ZYTA 1S02A 3S3TA 1LH0A 1NE7A 3EC1A 3KCQA 5LBTA 5TMBA 1OH6A 1CT9A 1N8SA 2D7DA 1UXGA 2B20A 3AHJA 3GGCA 4ASUD 1TRKA 1P3JA 1Q3TA 4RZQA 5T3UA 3UT0A 2PG3A 2Q2NA 1SC9A 3GD5A 3H2YA 3NATA 1WMEA 3M5WA 2X0EA 3ANYB 3G2OA 4PPYA 4YRTA 2CXTA 3THXB 1F9EA 1L6IA 1EAMA 4AO7A 1U0SY 4KBGA 4U9HS 1IBSA 4KDRA 5D6OA 1UMBA 2NSYA 3W0LB 1NI4A 2ANBA 2CXPA 1A2KC 1BE6A 4FFVA 1EUCB 1KZGB 1D0VA 5CLIA 2CL0X 3TXXA 4D2IA 1TMYA 3PFFA 2Y76A 5KQRA 1B26A 4HDKB 4PYJA 1TADA 1MUUA 3RLIA 2O52A 1XMPA 4EATA 3SLKA 3WGQA 1PAUA 3SF8A 2PRYA 1QG0A 1T2VA 4OPMA 4F3CA 3ELBA 4YP6A 5FUQA 2P0AA 3DNPA 1IWPB 1BS9A 1YRAA 1OZAA 3AJ8A 1CZNA 2TMDA 3OE4A 4QYSA 1PWYE 4XEHA 2PR2A 4PX9A 3WFZA 1ZCFA 4NMXB 1X13A 4LKOA 2A1UB 2CK3D 2EATA 3EXHA 3D02A 5DBEX 1MVLA 2CNOA 3L7OA 4EB0A 1FRZA 4RGBA 4LSGA 3CMMA 4OA5A 5BPHA 5BVGB 2ZI6A 1U28A 4G1CA 2QP4A 1SD5A 2I2FA 4L5JA 7AT1A 1EIWA 4HEA1 2OD2A 4JSTA 1SXIA 2A7QA 2GO1A 1R0RE 3MAJA 4A6PA 1ZUHA 3DOOA 1LLUA 1M6VB 5H3CA 3SF8B 5C3MA 1GRQA 2PWYA 1YZYA 3TWOA 3KYBA 2N1BA 4F7WA 1WP4A 3D5QA 2FDCA 1RI5A 4O8ZA 3ZV3A 4PZCA 3KRTA 3IB6A 1L5WA 5JWHA 3UJ3X 1JKFA 4XX1A 3DMDA 1ZRSA 3ZHRA 2H1VA 3T3HA 3W5DA 2VDNB 1NVXQ 2CF5A 2RHMA 3LGAA 2QUZA 3F7NA 1EGVB 1QRDA 4JX9A 4EI2A 2GM5A 4DG5A 2C4TA 4M3NA 2AI2A 4DMRA 2OSVA 2A1TS 3CKLA 3G17A 1Q0QA 2O4UX 4B6JA 4DMKA 4A5SA 1M9NA 3M70A 4K9NA 5K3EA 4MLZA 1UJ6A 1I30A 3ZPXA 2KWIA 4G1BA 1UBJS 4KSCA 4QYIB 4FCTA 4J90A 2V0CA 2I1VB 3NJ8A 4JU9A 1RXYA 2BRUA 1E1MA 4W99A 3W34A 3WRYC 2BDTA 5J58A 4DCPA 1Q12A 2KM1A 3HFJA 2QM7A 5IM5A 2IHJA 3WYBA 4DA9A 3QEMA 1K7EB 1T9KA 3IC5A 2GB4A 2WPDD 4LRUA 1A95A 5DNAA 4B3XA 2NZVG 1U4SA 4H59A 1X1AA 1VKNA 4NBVA 3GW8A 5F9HA 4LYJA 2DC1A 1T1EA 2JI4A 3T7SA 4M6WB 4RVFA 2CLHB 3PXGA 1DAMA 1X9IA 3R5TA 1QAOA 2PXHA 4F91B 3V4OA 3C98A 2BTQA 4WFQA 2XE4A 3CF4A 3UA3A 3IMGA 4C0KA 2VBIA 4FU0A 1Z6ZA 3UFXB 4X54A 2I78A 2R8XA 5DGXA 3FIJA 2HAEA 3O74A 3O47A 5EHNA 1NJ6A 3UHOA 1UBUS 4R2XA 3HJNA 3UMCA 4MDHA 1KYTA 4F5DA 2K4MA 3A04A 2ZZKA 3IHTA 2Z09A 2AI1A 2IUUA 4A6XA 4F3TA 2AH5A 4F4CA 3ZOKA 4HADA 2P2GA 3MRTA 4JBNA 1GUZA 1EZZA 2GAJA 4OAOA 2ZM5A 3EGOA 4R1MA 1WB6A 1K8QA 3PI6A 4DDUA 2F1OA 2HXSA 1Q20A 5H9VA 1NBHA 4JCOA 1KDZA 3DLAA 4KIUA 1NYTA 1CD5A 3TBHA 4I81A 4QPPA 3A11A 1PJ2A 2G63A 1JDBB 2LD4A 2OFWA 3HCNA 4IMJB 3V2UA 2JD2A 3VA7A 5GGYA 4MKGA 3AYZB 3K9CA 5LU9A 1S3SA 4PSVA 4WUTA 3WBBA 4YAUA 5EJFA 1FBNA 3QXGA 5JFOA 4XASA 3BXPA 1H9BA 3DMFA 3C6KA 3FTDA 4QLAA 4AP9A 4GZ6A 1RM5A 1XXHB 2JFOA 2QT1A 4DWOA 5A3QA 1LA2A 4G5SA 4TMKA 4DG8A 1KXZA 2A4MA 1UOOA 1E6MA 1IM5A 2VWPA 4WZAA 1AVTA 5FRDA 4RO0A 1OI2A 1S8FA 4RQAA 2OHIA 3T5MA 3V7WA 2MJLA 1X7XB 1YVDA 2C4HA 2CFSA 3C6ZA 4FFWA 5JRDS 4R1PA 4Z4FA 4KU4A 1B3BA 2G4VA 5G4LA 4MQFA 3AC0A 1W59A 1G4UR 5DLYA 1P6UA 1EVIA 2AZ4A 2ZSFA 4AJ1A 1PFGA 2VPWA 4PM4A 1LF0A 3K8QA 1ESZA 3I04A 4V02A 4U2GA 3HLYA 1E2PA 3W2TA 4BZZA 4C3ZA 2FRDC 1TK9A 4FILA 1V8DA 3AI2A 1UXOA 2ZP1A 3L0IB 2FSSA 5CIQA 3UENA 3UM9A 2C83A 2HRCA 3HKEB 3G0CA 4HFMA 1AGNA 3IBSA 4B3CA 4M86A 3GLFA 1R9NA 5KDOA 1I2CA 1S8AA 1C3EA 1E3DA 4PG7A 2E5WA 4UQOA 4LOIA 1CZHA 3L6CA 5B4UA 1PL7A 3NBXX 4QXPA 2DFLA 1ISFA 3W5IA 3HEAA 1AA9A 5DLEA 3UHJA 3NHFA 1M2OB 5BWCA 3TXAA 4F84A 3UBMA 4BIMA 5EFZA 3QH4A 3H97A 4D9IA 1CY8A 1NVWQ 3FUTA 3WWPA 4ZK6A 5LZ5A 3BE5A 1F2TB 1LPNA 3RHSA 3PPVA 3ECAA 3LAWA 2WWXA 3BGOS 1HQCA 1TO1E 1Y4SA 4KHZA 1CZKA 4L2IB 1ENYA 1G41A 3FIUA 2GN1A 2PIAA 3VR5H 2DBRA 3P32A 5ESXA 1JQJC 1PZMA 4AD8A 2ZBGA 1V16B 3I0NA 3OUTA 4CM4A 4KWIA 1IQUA 4MPTA 3ZDYB 1IC6A 1GPH1 1XTPA 3NOQA 3KSRA 1R1DA 4RKFA 1QJ4A 2JKYA 3RNLA 3IO3A 3KOZA 4C89A 1G9XA 1YBFA 3R20A 4K87A 3RNOA 2HZ7A 4YV0A 1BRTA 1W36B 1U90A 2P5UA 1WOYA 1CJMA 1NXOA 4R9VA 1NJFA 1RKBA 4XSGA 1XZDA 2AJBA 3M8KA 5DDIP 5EKSA 4IRXA 2BJWA 2FEWB 4N3BA 2MSEB 3G59A 4UTXA 4FQ8A 5DW0A 5JLJA 1VHTA 2PVPA 1YUMA 3M6VA 2JCXA 4WDRA 3S4YA 1T6XA 3SDBA 4BQSA 4DG9A 1X9GA 4UATA 3U3XA 2ZIWB 4FDVA 4QTUB 1F5NA 3VO9A 3GLIE 2W2PA 1BXGA 3CNOA 4LNAA 4HWOA 2DH5A 3A2LA 4QDJA 2OA0A 2JI7A 3G88A 4BQFA 4X6LA 4Q18A 3ZI7A 1SCBA 4GC5A 4GBGA 1Z34A 2IY7A 3A32A 3I30X 1I4WA 1N33B 2X8AA 2J9FA 1TFUA 3FCEA 2ZI9A 3KYCA 3L1JA 2CBXA 4KWTA 4UHCA 2XXJA 5K3FB 3VTAA 3ZK9A 3Q0TA 1D1SA 2W6JA 4P4SA 1QM5A 1ISSA 2I4NA 2D3WA 2WDPA 4M7RA 3ROPA 4B6GA 5KQLA 2ZDHA 1P0FA 2IDJA 4JSRA 1E9FA 1JHOA 3CGGA 4F9FA 4HEA6 5C80A 2X6TA 2ZAIA 2XYRA 3LPDA 3FPBA 4JIMA 3DE0X 4RY8A 4F3NA 1DC6A 4UMEA 4AJOA 1XP8A 3BHNA 3C1AA 3G6KA 3KQWA 1RVV1 3K4QA 1NXSA 4M60A 1RWMA 3U9LA 5T4FA 1G5PA 1AS0A 2JFNA 1U9IC 3I2GA 3KP1A 4Q3DA 5DPMA 4JI3B 3PNKA 1R6TA 2V74B 5C1BA 3T5GA 4QNMA 1T2NA 1XFDA 2QLFA 2AXQA 3BX1A 4LZPA 3D1VA 4Q9DA 3ZEIA 1RPZA 3R77A 2IS4A 4M83A 5FBRB 3TL2A 1Z6TA 4LZZA 5A05A 4LGVA 2COKA 1E3MA 3R41A 2I7DA 3OFNA 5CFMA 4CTOA 3OQJA 4BLTA 1M2VA 4FC7A 1QH8B 2BJHA 2DQYA 4KNWA 2NQ8A 2O8FA 4ATNA 1J8MF 1TJ4A 1JS1X 1SELA 2ANCA 2WG0A 5KIAA 3AF5A 2IEAA 5EHQA 2ORED 4NY1A 3K8YA 3NM6B 5F1KA 4D4KA 1G7RA 5I8PA 3FZNA 5BV7A 1J0EA 3I9V6 1VKOA 1L5HB 3TTSA 2V7WA 2QL9A 2GYUA 4DQKA 5CFLA 3TS1A 4BMCA 3VFDA 1U0BB 3JYPA 4ZFNA 1C9JA 1U2ZA 2VH2A 2HNKA 3IVGA 4OM8A 4Q3BA 1KU0A 2V6MA 3IPXA 4DLZA 4S1NA 4GX1A 1A4XA 4O2BA 4DJDC 4RV9A 3CSUA 4C07A 1QHNA 2ECPA 3EQ9A 3A4VA 2UZ0A 1I7DA 3GG9A 3N53A 1HSZA 1KBOA 2NZYA 4WZZA 3SE0A 3V4SA 2PWBA 3HC7A 1NOJA 3FBGA 4A26A 4XVRA 2WTUA 5IX8A 6PFKA 3FF1A 2V7VA 3DW1X 4EVSA 1BD3A 3IRVA 3U3JA 3KO8A 2AF4C 1T9AA 4ER0A 1R6DA 2P4HX 4LDAA 4MIOA 1P4SA 3U6KA 1GAJA 3SPXA 2DPMA 5L3QA 1NBME 1OX4A 3NOVA 4BVKA 1VBNA 4XR4A 2GF0A 2E4ZA 3X1MA 4ROTA 3W5AA 2PZFA 1LZKA 3DVLA 4TTTS 4I50A 4UQPA 1L5MA 4CDGA 1FQJA 1W5BA 2WI8A 4ZZ1A 1HZZC 2C8LA 4DCTA 4HEQA 2IBTA 1OXVA 3G8CA 1WY7A 2VHQA 2Y1XA 3C3DA 5DHQA 3ELYA 4Q4CA 1E4OA 1EUDA 2GJSA 2PAAA 4B31A 3L0SA 1X1TA 3NUZA 4D8VA 4E11A 3OEWA 4QJ4A 3I53A 1DQYA 1E61A 1G3IA 1B0ZA 1BMFA 2DQZA 2PT9A 3E3AA 3G85A 1XVLA 1W4BA 1YO6A 2D1SA 2D5LA 2VJCA 3LYHA 3JQ8A 4IKPA 1N1MA 4QBTA 2P2NA 2VP5A 4QDKA 5WRFA 6CHYA 3BDIA 3OOSA 5DBFA 3FFXA 4X65B 1YZFA 4E5YA 3EIHA 2I4RA 2RHLA 2SKCA 4K28A 4JKOA 5CFQA 5DO9A 1KI7A 1L5SA 2FEOA 4B44A 5KNCD 3WZMA 3CNEA 2JIZD 4IW3B 2ZRJA 1UWLA 5GJBA 1R0KA 2VDKB 1CUBA 2YHAA 1VMDA 4RLQA 4ZHQF 4ZQGA 3ISTA 1VYVA 2V5UA 3L18A 2JVJA 2V55B 2YIMA 4Q3CA 5L4NA 3G0HA 4BAZA 3KJZA 5JY1A 2EQAA 1G98A 1GYPA 4K88A 1E9AA 3GJ4A 1MA0A 2VJPA 1TM1E 1YA8A 2EWMA 2GWRA 3AXTA 3EDOA 2FX3A 5G1OA 3V4LA 5JATA 4LXYA 5JAPA 4NPCA 2C9MA 1EFVA 2JIMA 3FJ1A 1O7JA 3I6MA 3CPJB 3OH8A 1J5XA 4RH1A 4CLRA 5M7EA 1K63A 3GP5A 1GZDA 3KAQA 3EQ2A 5JH7A 4MARA 3V6LA 2YIJA 3LK6A 3PUZA 4MW5A 1GKLA 3WISA 1NVVR 4HPXB 2C5BA 1XAHA 3RYHB 5HGJA 1FMFA 3E1SA 2RGAA 4PYIA 4QWWA 3W4JA 1I1HA 2J3EA 3OQPA 4Q7JB 1I32A 1JR6A 3FJYA 2G7MC 4M7OA 4ZEXA 4BE7B 2LE0A 1ZGCA 5HOQA 4G5YA 4JLPA 1XO1A 2IZ6A 4R2IA 2PO5A 1O6BA 4C5AA 4DLVA 2A88A 4XWKA 1EB8A 1I80A 4DJTA 1ORHA 3LHDA 3ZC3A 4YMGA 1S4QA 5HJ7A 4WCFA 1OAKA 1T2FA 3PGMA 3EF3A 3A6ZA 3K0BA 1KNQA 4D9KA 2D2XA 2EYUA 2Y67A 2O3SA 4MGYR 4QOIA 1TO2E 4S1WA 3DZJA 1OLOA 4Y9UA 1QQAA 3DFIA 4OMUA 3KVRA 2M6LA 3T95A 2RAVA 3ZVMA 1LFAA 3UPUA 3U7EB 2CEKA 1Y3DE 4EQ6B 3QQ5A 2H51A 3E03A 3LC1O 4JIGA 3HJBA 3PICA 4CU5A 3O8DA 1VLLA 2NX2A 3D2BA 1ZLYA 1Q1QA 3WBFA 1E9BA 3BQNB 4AUNA 1GGVA 4M9ZA 1TU4A 4Y18A 3TLXA 2CV2A 2FFJA 2IS1A 4G9GA 5FEMA 2NAFA 1R8JA 3U49A 3ORHA 3SM3A 1XL0A 1GTSA 3YASA 1T3LA 4MRRA 1DJLA 1PNRA 2VATA 3S7ZA 2BZ1A 4QC2A 4ZEMA 4YMHA 4CQLB 2DERA 4E70A 3KZKA 2A0WA 1FUYB 1X7YB 2AB0A 2PRJA 3BMQA 3K4PA 4IZIA 4ARBA 4BVBA 5JFGA 1SBCA 2PT5A 5JSHA 1P73A 1RRFA 4Q4JA 4B83A 2BBSA 3DTVB 5DNYB 5CLLA 1MRNA 3B7PA 2FLWA 1NDQA 1EX6A 4A82A 3IAUA 2ZYAA 2XLBA 1YJCA 1G8FA 1Z7YA 4MRAA 2CLIB 2J6IA 2QRJA 4ZT6A 2PD3A 4M4SA 5EQDA 4V1CB 5DLPA 2I7XA 3LOPA 3M4JA 1SBHA 3AKDA 3T7RA 2XKKA 4GU5A 2D2IA 2QW1A 2I2AA 2E21A 1XRSB 3P9NA 2HCTA 4L0MA 4W5WA 4IILA 3OPYI 4BVLA 1EBBA 1QF9A 1E58A 3B89A 1KNXA 1P3Y1 4KGZA 4PX5A 4XIYA 3ZS9A 1KMHB 5M29A 1MC5A 1SUSA 4KFTA 1Q1EA 1J7KA 2GHQA 2UAGA 2XYQA 4G0YA 2SKEA 3AEKB 4JJ8A 2RG7A 4PPGA 5E1OA 3WGOA 1Y98A 4Z6KA 4QWMA 1KO7A 3BXEA 3I1FA 4K2HA 1F8GA 3EVTA 4UE2A 2WB2A 1CY7A 4DA0A 4H9GA 5EPEA 2QAGC 4DC1A 3S2ZA 3DAHA 4DOMA 3O1JC 3UAVA 3GOQA 2FWIA 5FOWA 3DAPA 3KR1A 3NTXA 4E4RA 5ADWA 2JG3A 4NCKA 4QTXA 2QUHA 3K1ZA 4Z8XA 4PCVA 2XNCA 1ACMA 3A1WA 5DXFA 3BSSA 4FEEA 5FBHA 1JSCA 2F9FA 2ZSAA 3DBIA 3ROKA 4N3CA 3WB9A 1XRMA 3CRW1 1F6BA 1CR1A 2YJGA 4PICA 1ISRA 3Q10A 3KNZA 2DOKA 2ZUWA 5JVDB 2ATIA 2PN1A 2WWRA 3HSYA 4EUEA 4RADA 2OZEA 1BDHA 2C2GA 4KG7A 4RD4A 1CUSA 4DVGA 5KJCA 1G5TA 2GLTA 2FFQA 2E4WA 3OLVA 4EF6A 1I2MA 4ERNA 2MTBA 5IN5A 4ZHSA 2Q3FA 1XTIA 5CK4A 2FPLA 5LOVB 3KU4A 4EUHA 4FOTA 5AOVA 1DTWB 1TIBA 1CSEE 2C42A 3BZUA 3A3YA 4FBGA 4JHLA 3U7IA 4Y2VA 2O5EA 4J1TC 1KFKB 1TM5E 4NEQA 3L46A 5CA1B 1PHRA 1G21E 2CHFA 3HNPA 3SZMA 2HEGA 2XEXA 3KEOA 4DCGA 4YQEA 4A0SA 3JVVA 2ZIEA 1Z4QA 3COYA 3E3MA 4ZT5A 3LT5A 3FYSA 3AKYA 3KE8A 4RBNA 4J1NA 1VJ5A 4EJFA 1WAMA 3E3NA 3GFTA 2ZYHA 2HA5A 4FTWA 4J0IA 1I2AA 1PVDA 5ES3A 3WK8A 4JBIA 1L4YA 2GZ3A 2SICE 2PRKA 1OLXB 2GCEA 3C1UA 2GN8A 3QLEA 1PYDA 1TT5A 4JWKA 4R5HA 3MJEA 1IY2A 3PHHA 4I9UA 3VM6A 5AW4A 4LKRA 4PPQA 3GPIA 1NONA 3ZVLA 2POCA 5EJ9A 4FGKA 3QKWA 4UMFA 4UW9A 4BV8A 2E4YA 2Q8QA 2QVYX 1GG9A 2MCFA 3ICCA 3C97A 5GJVC 5CIYA 3Q8KA 2BEJA 4QO8A 1U9IA 1OI7A 3BAZA 3E7XA 4K6OA 2PKXA 4HMQA 2PKYX 5KTPA 2ZU6A 4HQOA 1WQ1R 1MIOB 2PZKA 3NBAA 3CM0A 4NFHA 5IBCA 5M5BA 3ZXXA 1PTKA 3P27A 4LXQA 2HHJA 2ORIA 5BSWA 2JFHA 5D5PA 4EKGA 2TYSB 2VRWA 4MUMA 4E4TA 1ZP6A 2EW2A 5JWRA 3TLCA 4LWPA 4BNDB 3SY8A 3RC9A 2VPYA 4CM4B 4BDSA 3RPEA 2BHRA 3ES9A 2HU5A 4BNIA 4I9HA 3EAFA 4RMJA 1XTSA 3X2SA 4CT4B 1L5VA 1E8NA 4C5BA 2YVAA 3IXMA 4DCJA 1NOKA 5JJKA 2FY8A 1GAQA 1YB1A 1IB0A 3CW8X 3B8EA 3R3UA 4BZWA 1O5IA 1LLFA 2FQXA 1J24A 4K5QA 5A9SB 1G38A 1SD2A 4DV0B 9MHTA 4TWRA 1ZAKA 4FHEA 3UMSA 2B99A 1YFZA 1AZLA 2NPIA 1FS4A 4KL8S 2B4AA 1M1NB 5DTEA 4I5DA 1T3ZA 5FKJA 4KRYA 1DWOA 1XD2B 6YASA 5E7JA 2PS9A 2SECE 1VIDA 4KOAA 4LV6A 3DXXA 4WXHA 5K99A 3KXIA 5JMPA 3ZHVA 4Z0HO 1WXIA 3Q2OA 3KPVA 1KVQA 1G8YA 2JCBA 3NHMA 3O8OA 4PFQA 3SGLA 4CM7A 4EJ2A 1FQOA 3FYCA 3Q0IA 4D4MA 5K8CA 1NULA 1UIMA 2CVQA 2C3PA 4TTJA 4DLUA 1PJBA 1J33A 3O2SB 4PSCA 1L0BA 3RWMB 1XYGA 4P0PB 3I9NA 4CEJA 2BTOA 2OD7A 2DPGA 2P7IA 2XVYA 3AINA 4DUYB 1ULAA 1EM8A 4G24A 5EJIA 1NQOA 3WGGA 1D1QA 1CB7A 3ZY2A 2B21A 2VDUE 2WF7A 4ZI2A 3NYQA 2PUDA 1YE3A 3L3BA 1R0ZA 2IJGX 3PR2B 1SA0B 4NJMB 2Z30A 4WESA 4WLEA 3S1AB 3T34A 4AZVA 1M2EA 1QKIA 4YCBA 2O8BA 2II6A 1Q0TA 2VT3A 2C3UA 4L27A 1LJLA 3B6ZA 4RM3A 1K3FA 3OZGA 4YJGB 4AECA 3TRIA 5A4MS 1BVRA 2BIFA 3ZJTA 4CKEA 3LK7A 5CLQA 1FYXA 2OFXA 4YQZA 4LZLA 2W6QA 3WLJA 1O9BA 1BRMA 1HEUA 1QZXA 4WW0A 1JIIA 2GI4A 1T9BA 3DMNA 5DTIA 3U7JA 3PTAA 1DAGA 1Z0FA 3M5PA 3LT0A 2AN1A 3D8NA 3BGDA 2VK1A 2AX4A 2X0IA 3RODA 5BV2P 2I66A 3QVJA 1XIVA 1N75A 1WV0A 3AOEC 3H5TA 4QYTA 5JUWA 2FRVA 2OHXA 4DJAA 4EB6A 3EGXA 4MUEA 5DISB 1HDOA 1GU0A 5JAHA 1Q21A 4PGFA 1E2NA 4GICA 4NICA 1T29A 5JR3A 2HSEA 1O1YA 2YHSA 1XFAA 3DEKA 3DNFA 1NQ5A 2CUTA 1PTJA 3VYWA 4WHMA 1YSCA 3LQ4A 5GVSA 3A6LA 4L7QA 4PPFA 3GT7A 3GPCA 2IF2A 3QFRA 3WGVA 3HP4A 5JS7A 4DR7B 4KK4A 4YMSA 1SCKA 4BB0A 5LA6F 4DLAA 5J23A 2V8OA 3L0DA 1FLDA 4GI1A 5ER6A 4ENSA 4BNTA 3HJCA 4DN6A 3AW9A 3Q1KA 1T1IA 3IMEA 3FPGA 4ZJZA 4KSBA 4R0NA 1E32A 3A1NA 2ZJZA 2B78A 4IHJF 4A2QA 1QJCA 3H7IA 3TLAA 3BE8A 3BPSA 2G6BA 1AY0A 2GD0A 3H2GA 5DBGA 2BMEA 2PFKA 5L4SA 4AKIA 5DXJA 3DE5X 1Q19A 4TQUS 5EWJB 2P35A 4PSAA 3VKHA 4B9AA 3TAHA 2J7KA 3SJCA 3PJRA 3CIOA 5F7ZA 3K0SA 1M8FA 2Q6KA 1NUAA 1V1MA 3DLPX 2Z4SA 3ULKA 3AB8A 3VSDA 3WA6A 5HKBA 1K5GA 5JD5A 3ZLBA 1H2WA 3IR5A 5DI3A 5JBIA 2PSDA 3O21A 1U4NA 3D3KA 3LDUA 1E5XA 1NF8A 4Q6WA 1MPTA 5L3RA 3F96A 4BN0A 1XQWA 2VBFA 1IE3A 3PUVA 3NDBB 3WLNA 4PC7A 2JEOA 3THOA 4B3TB 2LGJA 3I45A 1RC8A 2FFHA 3WLHA 2BUBA 3NWEA 1HKHA 5F3RA 5A02A 3B48A 3FFWA 3E05A 2PNJA 3IDSA 2G1JA 4MP3A 1MW9X 4DDKA 4DKJA 3FOWA 1Z0JA 3D3WB 1KYQA 3F47A 3KUKA 4MPDA 5ALTA 1A4UA 1OJ7A 4WBNB 1PFKA 3MIZA 1SHUX 1W36D 3VVLA 4CF5A 4Y9RA 2QSJA 2ABWA 1X7WB 1A50B 2D2EA 1FRNA 4KKXB 4Z1MD 1W30A 1KI6B 3TL6A 1MZPA 1E1CA 3BXGA 2C98A 3I58A 2BVNA 4INOA 5DGHA 4RQBA 5A9RA 3F9CA 1GQSA 2AQIA 4EMBA 3K6SB 3U5ZB 4IHQA 1WXDA 4UE6A 3OZ7A 4JYAB 1JKMA 1ZISA 2VUIB 5CB4F 1RYFA 1H66A 3BIJA 3MJTA 2QTNA 4HVLA 1HE8B 3R5JA 1JPJA 1YFJA 5ALRA 2GN0A 2WKQA 1RLMA 3SZLA 2SCUB 1YDEA 3TZLA 1A5SB 3OEHA 1UBLS 3P0HA 4O4JB 4RS4A 1VC2A 4JLKA 4EG5A 4YRAA 2O9JA 2YMLA 4BL5A 1TTHA 3IOEA 3O7MA 3R5KA 3NIDB 1PIWA 5JIBA 1EFLA 1I6MA 2EKZA 5DE3A 1NVKA 3V3KA 4BCBA 4C7VA 2CXQA 5CVEA 2WQ7A 1RRGA 2VUSA 2W2MA 5CVUA 4MUGA 3FWKA 4LMBA 5ALVA 2G25A 2I6XA 1K06A 3T0FA