3HP6A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus f710y mutant bound to g:t mismatch
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 206
structure length 579
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hp6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hp6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hp6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hp6A01
2HVIA 1WSHA 5J0PA 5KFYA 5BOMA 4UAZA 4LZGA 7ICFA 3VQ9A 4UB3A 1RTIA 4KV8A 4NYNA 2ZUCA 1HJRA 4PGYA 5KFNA 3NCIA 4KLHA 4FJ8A 4TUSA 5KFXA 1Z00A 8ICQA 4BE2A 5J0UA 4JLHA 3BDPA 5JS1A 1NJZA 1ZQVA 4Z4IA 4G3IA 1KDHA 1J54A 3TAEA 4F92B 1QSLA 2G8IA 4M3WA 4KKOA 7ICVA 4OPKA 3C23A 4YVZA 2AGPA 1ZQPA 5E41A 3OYGA 4KHQA 2AJQA 2HMIA 3HK2A 2D0CA 1H38A 4W5NA 3DMJA 3PX0A 4YXJA 4M6WA 4QZAA 4KLFA 1HRHA 3VQEA 4AH9A 3BJYA 2D0AA 3S3NA 2R7YA 3N4MB 4OKKA 2PFNA 1TKTA 1XWLA 1NKBA 1RBSA 7ICJA 1COOA 5J29A 5KRSA 4ZH4A 5CA7A 4FCYA 5DB7A 1AROP 2FLPA 5J2JA 4F2SA 3FDSA 2FLLA 2XCAA 5J0WA 3MXMA 1TL3A 3QIOA 3MFHA 3G0ZA 8ICCA 2BCQA 3NGZA 3ZSXA 3LAMA 1K1QA 3EY1A 4IQVA 3U6FA 4FZYA 4F3TA 2UVRA 1CLQA 4H4OA 1SUQA 4NCGA 3SQ4A 3JPSA 3RWUA 3DLRA 1UT8A 1BL3A 3ZT2A 9ICUA 2QKKA 3Q8LA 1LB2B 4TUPA 3HPGA 3NHGA 1WSFA 1Z26A 5J2HA 3PMNA 4CJVA 1L5UA 2FMQA 9ICXA 1XI1A 4IFVA 4CHPA 4RNMA 4QZBA 5K14A 4DSKA 1IG9A 2JEGA 4RQ8A 4DF4A 4FJIA 4ECXA 4MFBA 1TAUA 5HRPA 3AO3A 4NLZA 4HUEA 3HWTA 4QZEA 1JLEA 5KG2A 1S0VA 4FZZA 3MEGA 1EETA 4F4YA 1U48A 1QLNA 9ICIA 4CF1A 1NJYA 3VQBA 4CFBA 3UXNA 3HPHA 4F5OA 5J0TA 2F8TA 1W0HA 5C24A 4CIGA 5DB8A 5KFPA 4FYDA 1YVUA 3WNEA 4RQ6A 5J0YA 3OHBA 4EBEA 1ASVA 4ED7A 2BPFA 2W8LA 4F5NA 3DLEA 4Z6EA 3LDSA 1RPLA 2JGUA 4DL7A 1QTMA 3T5HA 2HNYA 4FZXC 4OLAA 4DL6A 2C2DA 1ZQUA 3KKRA 4E1MA 4KHSA 1BPYA 3KJVA 5KG5A 4CJLA 5D46A 3Q8KA 3O4NA 4KLOA 4N47A 1XS9D 5J2GA 4FK0A 2EX3A 3NF9A 4AILC 1ZJNA 2ZJ8A 4QCLA 2Y1JA 3PX4A 4I9QA 3HXMA 1MQ3A 5DK5A 4GXJA 1K1SA 4BE0A 7ICIA 1WSGA 4DQIA 5EWGA 2ZTCA 3RB0A 2GV9A 3TFRA 1KCFA 4NM2A 9ICHA 4AHVA 1BPXA 4M3UA 4DO9A 2BQUA 4O3SA 4YR0A 1VSIA 1ZQDA 2FPMA 4CGHA 4EYHB 5CB1A 1XU4A 3H4BA 4CF9A 2XCPA 4I2DA 5DGAA 3KLHA 4M9LA 4DFKA 4RPXA 1BHLA 2ASJA 1VSEA 2E4LA 3Q8QB 1KSPA 3V81A 2W9AA 4ECTA 3QERA 1F21A 3SI6A 5KG6A 4ZTFA 4UBBA 1GOAA 2ATQA 8ICWA 1ZQXA 5KFSA 1RILA 3NF7A 1TKXA 4J9OA 3AVAA 1HQUA 5FDLA 4MQ3A 3CFOA 1RDDA 1JKHA 4E7IA 3HO1A 2JZBA 2DFHA 1XC9A 5L9XA 4F5RA 1TK5A 3C5GA 3T5KA 4NM1A 4RQ1A 4QW9A 4DU3A 2RPIA 2IDOA 8ICKA 4HUFA 1LAVA 4R5PA 4LVSA 4RZRA 1S76D 3DYAA 1Q8IA 3VQ6A 4AHUA 3LPTA 5HRNA 3F73A 3KIOA 4JS5A 2I5JA 4EP5A 2VA8A 4MEXA 1DTQA 1L3VA 2KN7A 4UB1A 2I9GA 4B9VA 4NLGA 1CUKA 3EYZA 3QEPA 2KW4A 4JRPA 2C28A 2A1SA 4OKEA 1S6QA 3MDCA 1ZQLA 1TK0A 2J6SA 3L3UA 4YMOA 4H4MA 4O3QA 1VK0A 3ZSZA 1SZPA 1C0MA 4KLMA 3ALYA 4F2RA 4JWNA 3ETLA 1C1BA 1NOYA 1RBVA 2HHQA 2PFQA 2P1JA 4I28A 4RQ4A 4K4GA 2ZJAA 5FROA 3PR5B 5IIOA 3OS2A 4ED0A 2W9MA 1Q9YA 4CEFA 4NLNA 2WOMA 3SUNA 3G6YA 8ICHA 4KRFA 3SQ1A 7ICTA 5HBMA 2V4QA 3V1OA 1RXWA 4JV2A 3E2EA 1LWCA 4QOZB 3JPNA 2ZE2A 3RRHA 5HROA 1ZQRA 5CJ7A 3AVHA 2AGQA 4P4OA 3V1QA 9ICVA 4CF2A 3ORYA 4FLYA 3AVFA 1BVSA 3AV9A 3H40A 5HHHA 1D9FA 2IC3A 4TUQA 2BE2A 2VA3A 1NK6A 7ICSA 3AA5X 3GV8B 1DGSA 3V7KA 5IIMA 1WAFA 3HX0A 2X6SA 3RH4A 7ICRA 3OJSA 3QINA 3HJFA 1SL1A 5BPCA 1C0TA 5J0RA 4FLUA 1EXNA 4AHCA 2OA8A 2IA6A 1MQ2A 2OZMA 1Z25A 2RDJA 5KTQA 9ICAA 4HVJA 2QXFA 2G8VA 2ISOA 2IMWP 3BQTA 3LP3A 4Y1CA 1UOCA 3GILA 3H8SA 4PHPA 4DS5A 3RJGA 2XY6A 3QEWA 3D45A 1JMSA 3AA4A 2P5GA 1KVBA 4E0DA 1EP4A 2FBTA 3ZT3A 4E1NA 4CHZA 7ICOA 4M3RA 1RTHA 3LWMA 5L1JA 5HRSA 1U45A 2VA2A 4KITB 4YR2A 4C8LA 3BGRA 4FO6A 2RN2A 5HLFA 3RBEA 5HP1A 2HHXA 3CG7A 3TWHA 4CCHA 4OPJA 9ICNA 1ITGA 3LPUA 4HUGA 1CZ9A 1C0UA 4Z4FA 2VG6A 4KLGA 2W9BB 2DPJA 1KFTA 4RU9A 4E3SA 3SYZA 1ZQMA 5HHIA 1TL1A 3L2VA 2ALZA 1VSLA 1TKZA 2LSNA 2OPRA 4KB1A 4IR9A 5EWEA 4BXOB 4FJ7A 7ICMA 1J5OA 2YNIA 3OYNA 1NJWA 1MSWD 1T05A 3K4GA 1U04A 3MGHA 2XY7A 4GW6A 4O4GA 4QWBA 1J53A 3TAGA 4CGJA 5DDYA 3KLEA 5F9NA 1FKPA 4QZ8A 1D8LA 4ECUA 4YP3A 4IR1A 3V72A 1EX4A 2NRZA 3H7IA 5J2AA 3V9ZA 4R65A 4CJKA 1U49A 2HNZA 4E89A 4FS2A 1WLJA 3SUQA 5DMRA 4NXZA 5J2QA 4N41A 2P66A 5DB6A 4DL3A 3PW2A 4J9QA 3AU6A 4J9LA 4ECQA 3V6KA 1I39A 4CEZA 3RR8A 4G1QA 3K75D 5KFVA 3HYFA 3PUFA 3C2KA 3THVA 1V9PA 5J0SA 4KLLA 5CYMA 2J6TA 3T1AA 3MXJA 2G8FA 4YD1A 4R64A 4TQSA 2AQ0A 3AO1A 4ED2A 3OSNA 2P6UA 2A1JA 1RYSA 3V9WA 4F3OA 4RNOA 1S6PA 3KLFA 4FK4A 4YFUA 4R8UB 4J9NA 1QE1A 3ZT4A 4J2AA 3U3YA 3TAQA 2FMPA 4M04A 4Z4CA 3VQ8A 1RTJA 4DEZA 4EP4A 1IH7A 3ISCA 5KFCA 1RT4A 4I29A 4I27A 4JUZA 4ELUA 3VA3A 4M9HA 3IHQB 1NK5A 4CGFA 4AHTA 3PVXA 3RH5A 2OPPA 1FKOA 4EEYA 3MXIA 3TAFA 1GOBA 4ELTA 1X1PA 3ZD8A 2DPIA 2ETJA 5DLGA 3A2FA 5HMMA 1K6YA 1WN7A 4IQTA 2ASDA 4I2CA 4YQWA 1BPDA 2BR0A 3O4QA 1EKEA 1S77D 4M3YA 5IIJA 4MF8A 2IBKA 3MECA 4CHQA 2HHSA 1CZBA 1NOMA 3VN5A 4YR3A 4O9MA 1A5VA 4CJWA 4GVMA 4OKJA 1QSSA 4FW2A 1LW2A 4F5QA 3RAQA 5I3UA 3EPIA 3UPQA 1S1TA 2HW3A 5KFOA 1JXLA 2V4RA 2F1IA 1WCLA 4F4WA 2IHMA 1RNHA 4DFMA 3ZDCA 4DQQA 4XUSA 1T3NA 1ZBUA 5FRMA 4YNQA 3V7LA 3D0PA 1XHZA 3RRGA 1B92A 3O3FA 3BQ0A 4QWAA 2JEIA 3QNNA 4N76A 3AO2A 3LP2A 7ICNA 4J9SA 4W5TA 4O3PA 2Q0ZX 3KK1A 1JL2A 4IRCA 3VQDA 8ICOA 3FFIA 1HYSA 4MEYA 4RW7A 3OSPA 1XSLA 3KD5E 2ATLA 1ZQCA 2J6UA 4YG2A 5KG0A 1BQNA 5KFQA 4CJQA 3AVIA 1EXQA 7ICLA 4F8RA 4DOAA 4FBTA 1LV5A 1BI4A 3ISDA 4YFKA 1YT3A 5D4BA 3AVNA 1VSJA 5KFZA 1U9LA 2AGOA 4J2BA 4M6WB 2VG7A 4CEQA 3AVKA 5DDMA 1Z00B 2WTFA 3OYLA 2RKIA 4LD0A 4Q5VA 5J2IA 2YHBA 4B8CA 4KLUA 1ZQIA 4RW6A 3MR3A 4Z6DA 3Q8RB 3M9MB 4DLGA 2HB5A 4FVMA 3NF6A 4E7JA 2NRVA 2BCRA 1NK9A 3JPOA 3ZSQA 4M3XA 3B0XA 1YTUA 3JSMA 4HCBA 5KFTA 3GIIA 4HTUA 4DSLA 4KTQA 1S0NA 1CEZA 5KFAA 3S3OA 1O1WA 2ZJ5A 5KT6A 4UB4A 4DTRA 4BWJA 4QZIA 2QK9A 3QEXA 4DS4A 1VSDA 1ZQBA 1S1VA 1UAXA 5KFJA 5J0OA 4I2HA 1QS4A 3OJUA 3ISNC 5IILA 4CHYA 3VQPA 4LH4A 7ICKA 4RQ5A 5KGXA 2F8SA 2BGGA 2DFFA 3L2WA 4RPYA 4DG1A 4F4XA 1ASUA 3M9OB 5CZ1A 4PA1A 3RJIA 1JL1A 4CJ5A 4I2GA 4NCAA 1MC8A 3HM9A 4FJXA 1HQEA 3DLGA 4FLTA 4DU1A 1DOQA 4IRKA 5KFDA 3OYIA 2ASLA 2HVHA 2VANA 4I9LA 4K8ZA 4GMJB 4M9GA 3AVGA 1TKDA 4KI6A 2ZQBA 4RT3A 1G15A 3V9SA 1KEJA 2UVUA 3DLKA 2VG5A 3MFIA 7ICEA 3C2LA 3PW0A 4QZGA 5JUMA 2PFOA 1A5WA 4J2EA 2XRIA 3KLGA 3KHHA 1LW0A 3KD1E 2WONA 1RZTA 3V9UA 3MAQA 5KFKA 1JLGA 2NRXA 1ZYQA 4J2DA 3AU2A 4CK3A 3G6VA 3PV8A 1IO2A 1BCMA 4Z4HA 3LP1A 4ECYA 1L3UA 4RG8A 4TSXA 3QETA 4CFDA 5DBCA 3QIPA 1S1UA 2DY4A 4RPZA 1L3SA 3HPOA 1IKXA 2YV0X 9ICKA 4JWMA 4DOBA 4K4IA 3AO5A 2IAJA 4DTXA 1ZQWA 2XGQA 4KLIA 1ZQGA 4MFAA 3SNNA 2PY5A 1ZBFA 2BCSA 4IDKA 4PQUA 5HMLA 3PNCA 3C94A 1REVA 4M42A 4DTOA 3JPRA 5I42A 5KFLA 4FLZA 1TGOA 4PH5A 1ZQQA 4PPXA 4NYFA 3NH2A 3T3FA 4QZFA 3F9KA 7ICQA 4KLJA 5KT7A 2B4JA 4P4MA 1X9SA 2O4IA 4KTWA 1QSYA 1RCHA 3CYMA 5CP2A 1LAWA 3ZSVA 4RQ3A 4M45A 3IAYA 5DG7A 3LK9A 4QWDA 1IKVA 1C7YA 2FPKA 4F91B 4FJ5A 1FXXA 4BACA 4I2JA 4BGDA 1KVAA 3KK3A 4ED1A 2P51A 4ECVA 3GV5B 1KLNA 1HPZA 4M2YA 4IQUA 1J9AA 4O5BA 4FM2A 3OVNA 3OYCA 1N48A 3UQ0A 2KZZA 4LZDA 4J9RA 4FJMA 5SZTA 4FJ9A 3C21A 4KLQA 4FM0A 1NOZA 4QZHA 2BCUA 4OGEA 4TQRA 3RJJA 2BCVA 1ASWA 3NGDA 1VSMA 3OYMA 3P5JA 3U3GA 2G8HA 3QESA 3PR4A 4N56A 3G10A 3DRPA 2MUTA 3HT3A 4NY8A 1SL2A 3ZT0A 1U4BA 4CJSA 1BPEA 3RJEA 1RT6A 2FBYA 4CFCA 1MU2A 5DQGA 2C2EA 2W9CB 4CIFA 3HVTA 2E6LA 4W5RA 3IRXA 4ED6A 1T8EA 4QZDA 3GFKB 3TAMA 3NGYA 4CEDA 1CXUA 1KTQA 4DTPA 1ZQFA 3OGUA 4FJLA 2H5XA 3DLHA 4CGGA 4MFFA 3RMDA 2D5RA 1DTTA 3SPZA 4DTNA 4J9KA 1BI4B 5KT4A 2R8GA 9ICRA 3AUOA 1RT5A 3LALA 5EU7A 4B9LA 4ED8A 1BGXT 4JRQA 1X9MA 2JEJA 9ICLA 1WNSA 4PWDA 4YXMA 3QE9Y 1HUOA 1JLCA 4Z6CA 3ZDDA 1BCOA 4M3TA 4B9UA 3QEBZ 3L2QA 2KQ2A 5KG3A 4PHEA 3SQ2A 4BDPA 5KG4A 1JXBA 2DFEA 4EZ9A 4O5EA 3L2UA 3GIMA 2Y1IA 4GXKA 2VWKA 3RJKA 1LWEA 2FMSA 4DOCA 4O5CA 4PY5A 4E19A 1ZQEA 4PGXA 3TAPA 2B21A 1S1WA 2ZTDA 2X6NA 4JV1A 5C42A 4Q43A 4XIUA 1W9HA 3WNHA 4YN4A 4KHUA 1TVAA 3OYHA 3SPYA 8ICNA 4CERA 3M8RA 9ICTA 4M9NA 4M41A 4CGIA 1KFDA 1WSJA 4O55A 3EWAA 4I2IA 4DL4A 4YCXA 3RMAA 4DU4A 4O3NA 2BDPA 4DF8A 8ICLA 3QLHA 2KZ3A 3IM1A 4RUCA 3AA3A 3MABA 2R8JA 1VSHA 4I2AA 4MF2A 3RTVA 3KHLA 4O0IA 1UA0A 1RBUA 9ICEA 1RT1A 3MDAA 4FS1A 9ICGA 1BIZA 4CEEA 9ICMA 3P83D 2RDIA 4YMNA 4DQPA 1D5AA 7ICPA 2ZD1A 4F5PA 4RW4A 1IM4A 3ZSYA 4UB5A 1SV5A 1N56A 1KFSA 4KPYA 8ICZA 4CECA 3QEVA 1RDAA 4C8NA 4Q8FA 4IG0A 4O3OA 1NK4A 1HJPA 5IIIA 2OWOA 2R8IA 4CEAA 3DOKA 2C22A 4RNNA 3ZDEA 1UT5A 1PZNA 3JYTA 3IG1A 3OYFA 3SZ2A 2F96A 3UXOA 4DL2A 3V4IA 1UA1A 3JPQA 3LWLA 4OJRA 3AVMA 3S3MA 1RDCA 4B3OA 1SL0A 4B9NA 8ICGA 3ZSOA 3RJHA 3ZT1A 3M8PA 4JV0A 4CIEA 9ICOA 2KFZA 1UWBA 2YNGA 2A1JB 7ICUA 2ZUBA 4KLEA 4LY7A 5J2EA 5HNKA 2V9WA 4NLKA 3TI0A 2MUTB 3VQQA 4P2HA 4CE9A 2FBVA 5CWRA 5DQIA 4FJKA 2RF2A 3ZSWA 1LWFA 1VRTA 2Z1JA 2BQRA 4ELVA 3OS0A 3M8SA 4M47A 5DQHA 4CJ3A 4FXDA 1BPBA 4AHRA 1A5XA 4CHNA 8ICPA 5CYQA 4ID5A 5FRNA 3NF8A 2PFPA 4RQ2A 4BDYA 3TABA 5DBAA 4DLEA 3C2MA 2P6RA 9ICPA 4GXIA 3KHRA 4Z0UA 5J1EA 1Y97A 3K5MA 1ZBLA 3CQ8A 3B6OA 4E7KA 3Q8PB 4B9TA 1BPZA 3QEAZ 5KI6A 3TFSA 5KFBA 3UIQA 1S1XA 2IHNA 4W5OA 4PHAA 2DFLA 2B6AA 4B8AB 2XC9A 4UAYA 4CFAA 4DTJA 3OHAA 4Z4EA 3ZDBA 5KFUA 1T4GA 1HMVA 2HNDA 3SJJA 3GDXA 2HHWA 5CZ2A 1T7PA 2C2RA 4Q0BA 1S10A 1Y88A 4FLVA 5KFHA 1JLAA 4EBDA 1XSNA 3GQCA 4KI4A 4K4HA 3C1ZA 4R8UA 1TK8A 4DTSA 4FW1A 2W42A 2BHNA 5KT5A 2DTUA 3M9NB 1JLBA 3CM5A 1ZQOA 1YTAA 4H8KA 4KN7A 3EPGA 4CJRA 2I1QA 5KGWA 4ZHRA 2BQ3A 3ITHA 3SUPA 1I3AA 3QO9A 4GC6A 3OYKA 3KHGA 3Q8MA 4NCBA 3RR7A 4OLBA 5DKWA 5DG9A 3UQ2A 2XHBA 4HYKA 1D8YA 4HCCA 4M9JA 1B22A 2A1RA 2G8WA 2D0BA 1JLQA 1HNVA 4XQ8A 3CFPA 1S5JA 2R8KA 4Q8EA 4R63A 4UAWA 9ICSA 4I2FA 1IXRA 1X2IA 3RB6A 4ID1A 4K8XA 2ZUDA 3GV7B 1SKWA 1IKWA 3T5LA 1NKCA 8ICJA 4YMMA 3B0YA 3N97B 4CEBA 3HSTB 1ZETA 2JZBB 4Z4GA 4RQ7A 1TVRA 4UQGA 4FJNA 5KFWA 5KG1A 5J2BA 2FPLA 3NGIA 4CHOA 1NK0A 4C8MA 3DRRA 3V1RA 1S0OA 2EHGA 2Z1GA 2PXIA 2MAXA 3MEEA 5EWFA 4ECSA 3K5NA 5KFMA 2Z1IA 4FLXA 3PW7A 3PY8A 4KMUA 3MR5A 2ITGA 1HYVA 2FBXA 3ZSRA 2Q3SA 4KB0A 3NDKA 1XO1A 4KLTA 4TURA 2W8KA 4QW8A 2PI4A 5CY4A 2G8KA 4ED3A 4IKFA 2BKEA 4UBCA 2YKMA 5KRTA 2OPSA 1TV6A 5BOLA 3K2PA 4HHTA 4DSIA 3NFAA 5J0QA 4KLDA 1ZJMA 1QQCA 3I0SA 3KTQA 1Z3EB 5EOZA 9ICWA 1A76A 3KK2A 2VWJA 4F93B 4ZTJA 5JS2A 1KLMA 2NRTA 5C5JA 3HP9A 3SCXA 4I2PA 3L2RA 5KG7A 1KVCA 2HHUA 4DTMA 4JK1A 3K58A 4KLSA 5J2FA 3LZIA 3HP6A 3EZ5A 2JLEA 5KFFA 4P4PA 1JXEA 3VQAA 1ZQKA 3WNGA 3HVRA 1JLFA 2KTQA 3HW8A 2X78A 3I0RA 1TFRA 4C8KA 4CGDA 3ZDAA 1D9DA 2BANA 4DMNA 1S9FA 3OY9A 5CR0A 4O5KA 2G8UA 4CJPA 2M9NA 4QZCA 4F4KA 3PX6A 2BGWA 1WCNA 3DOLA 4KHWA 5J2DA 8ICMA 4CF8A 3GIKA 1ZQTA 1VSKA 2O4GA 3NH0A 3AVLA 2E6MA 5L1LA 1VSFA 3DI6A 4UB2A 3UXPA 2AQ4A 3V6JA 3NBPA 3RAXA 3O3GA 3K5LA 2F1HA 3RMBA 3H8JA 3SV4A 1SKSA 9ICQA 3OYEA 2GBZA 5IIKA 3DRSA 2X74A 5J2PA 4KFBA 8ICAA 4RQ0A 1S97A 3PO4A 1B9FA 1KRPA 4I2BA 5J2KA 2UVWA 3TANA 4I7FA 3VQ7A 3NH1A 3QEIA 4OGCA 5J2CA 1BISA 8ICSA 4PGQA 7ICGA 3MGIA 3V6DA 3NAEA 3AA2A 1N5YA 8ICFA 2ZTEA 1C1AA 8ICEA 3TARA 4DSJA 2XO7A 3G6XA 1FK9A 2YNHA 1RBTA 2HHTA 5L1IA 4KHYA 4L8RB 7ICHA 9ICJA 3PW4A 4KHNA 3QZ8A 2UVVA 2XGPA 3V9XA 4QZ9A 4FJJA 1C1CA 2BPCA 4CJ4A 4LSLA 2QKBA 5T7BA 1ZQSA 4KO0A 3MR6A 4Q45A 8ICYA 3OYAA 3ISBA 3CFRA 1RYRA 5L1KA 3TQ1A 3DLBA 4KREA 1ZQNA 1S0MA 3JPTA 5J0XA 3I8DA 4IQWA 5DB9A 3T5JA 3NE6A 3QZ7A 4PUOA 9ICFA 4RUAA 4RW9A 5KFEA 3QNOA 1ZQJA 3ASMA 1RT3A 2W9BA 1L3TA 4ICLA 3RJFA 5D49A 3K59A 4DTUA 3KLIA 3L8BA 4F50A 4E7HA 1ZQHA 1WSEA 1QHTA 4JS4A 1RDBA 2IOCA 4FJGA 1HYZA 9ICCA 2KZMA 4N5SA 3V6HA 4QWEA 1TAQA 2PI5A 4DFJA 3RBDA 3MEDA 4CJUA 3PMLA 3M8QA 1U47A 4M3ZA 3RMCA 3AVCA 4RW8A 1DLOA 4DQSA 3DM2A 2XY8A 3JPPA 5DLFA 4Z6FA 8ICIA 2F1JA 4WE1A 8ICXA 1RT2A 4W5QA 3B6PA 2W9CA 1A77A 3LP0A 3O3HA 4ECWA 3CM6A 4FBUA 1RXVA 1HNIA 1SKRA 2NUBA 4X5VA 3SI8A 4BXOA 3OYDA 2OYQA 3ZCMA 3ULDA 5HP4A 5D3GA 4DQRA 4BDZA 2PYLA 2FLNA 3KKSA 1ZQZA 3SV3A 4RT2A 4QWCA 1R0AA 3L3VA 4I2EA 2GUIA 4J9MA 1NJXA 4ECRA 4BWMA 3PW5A 1TV9A 4CJTA 3OS1A 5SWMA 3OYJA 4OVLA 4IFYA 4CESA 3VQ4A 8ICVA 1X9WA 3IS9A 4IBNA 2LYHA 8ICBA 3VQ5A 4DSFA 4Y1DA 4EYIB 9ICBA 3E01A 3RB4A 3LZJA 4LH5A 3H8WA 2XY5A 3SQ0A 5C25A 4CK2A 1C6VA 2AU0A 4CK1A 5KFGA 5J2MA 2OZSA 4GC7A 2YKNA 3TR8A 3LDAA 8ICUA 3C5FA 5CHGA 4ECZA 3NTUA 5DBBA 1RBRA 4FLWA 3Q8SB 4CJEA 1ZBHA 4B9SA 3PO5A 5DG8A 3K5OA 1NK8A 1WSIA 2HHVA 3AVBA 4Q44A 2IS3A 4BE1A 1BQMA 3MBYA 1S9GA 3BQ1A 3VA0A 3C6TA 4O0JA 4MFCA 3T19A 1CXQA 4KTZA 4AHSA 3V7JA 1XSPA 2IGIA 3K57A 4CEOA 1ZQAA 4YD2A 2Z1HA 3LANA 3AVJA 4GLXA 4I2QA 2R8HA 1HUZA 1RT7A 8ICRA 4IG3A 4FM1A 3SUOA 4CF0A 4R66A 4F4ZA 1B9DA 2OPQA 1GOCA 3LAKA 4O44A 4KAZA 4FK2A 4B08A 3OYBA 1ZQYA 2BPGA 3C6UA 3GIJA 8ICTA 4QAGA 2P5OA 4PHDA 4DSEA 4DL5A 3FYHA 5F9LA 3EW9A 2JEFA 3ZD9A 3HL8A 3C95A 3H4DA 1NK7A 4M0AA 4J9PA 3MR2A 1WAJA 3S9HA 1B43A 1T03A 1ZBIA 1XHXA 1JIHA 4DWIA 3C1YA 4EBCA 5IINA 4C8OA 5KFRA 4XA5A 1NKEA 5DGBA 5KT3A 4EZ6A 2KFNA 2B5JA 1JX4A 2FC0A 3P1GA 5J2NA 4LSNA 1BIUA 4DFPA 1S9EA 4E7LA 1JN3A 1IKYA 5KT2A 1Q9XA 2YNFA 2ISPA 3RH6A 4FJHA 3H08A 1RTDA 4XRHA 4B9MA 5HRRA 2PZSA 5KFIA 4O3RA 2YHAA 2NRWA 3BQ2A 3RB3A 2PYJA 3WNFA 1VRUA 3VQCA 4KN4A 4IRDA 5TZVA 2GWSA 3AO4A 1N6QA 4CJFA
chains in the Genus database with same CATH superfamily
5J0PA 1KKHA 5KFYA 4YY3F 2D9OA 5BOMA 4YDUC 4LZGA 4B3OB 1Q82T 2ZUCA 1LNQA 1HJRA 4ZPDA 3CQXA 1N5WA 4KLHA 4NLRA 4FJ8A 4C6AA 3PEHA 2LM4A 4NYZA 4B9QA 4YOTA 4BE2A 5DO2A 4H5WA 2XZTB 1X4CA 4RQNA 2KXHA 3UDVA 1U1KA 5A2QY 2BE2B 1J54A 4WQ4C 3TAEA 4F92B 4I6AA 2G8IA 1WDDA 4M3WA 4NLCA 2YH1A 3C23A 4YVZA 4DR1F 2AJQA 3DMJA 3FEZA 1X9XA 1A9NB 1DHMA 1HRHA 4KLFA 3BBCA 3D67A 3TP2A 4A8QA 4DV5J 1N34K 1I5OB 1KTVA 2R7YA 4CO5A 1BUPA 4B1UB 3CPEA 4OJGA 3P38A 5CA7A 3P39A 3NGSA 2VL1A 3IBCB 5AXMA 1AFJA 4X64J 4ZP8A 5BPLA 2ZC3A 1FESA 2ZHBA 4OMFG 4DG1B 3G0ZA 5GIPA 3UR0A 3LAMA 1K1QA 5E3RA 3U6FA 3A12A 2MZRA 1P9QC 4L72B 5GADI 3CO9A 2H54B 3M05A 3RWUA 2V0NA 2NZCA 2KICA 4DV1J 3HI0A 5KPRA 2QKKA 3OTQA 4TUPA 3NHGA 3DRXA 1PJ5A 1Z26A 2OM6A 3CJ2A 1L5UA 1PYTA 5HQLA 4CF4A 4CHPA 1WWVA 4QZBA 2QTWA 4AL6A 3G2XA 4JK9A 1GFWB 4DSKA 1U1OA 4A5AA 3ENHA 3MN5A 1QUPA 1U2CA 4EU0A 2HBQB 1KHVA 1FO1A 1BY9A 3AO3A 2EAMA 4HL9A 1JLEA 2OPQB 4CO4A 4K4WA 3FGVA 4FZZA 1EETA 1QLNA 2CPZA 4WQ5A 3FSYA 3R7SB 1K8AO 3QO9B 3MPVA 2QA2A 3BGOP 1UJ6A 1WWHA 3WNEA 1PK3A 3OHBA 3M8WA 1D09B 3CSKA 1BXNA 4G1PA 1N63A 4Z6EA 1YWXA 2AIRB 2HNYA 4OLAA 5F8JA 3J7YP 4BC9A 3L7OA 3KJVA 1QQOA 5KG5A 3TVKA 4HT7A 2FF3B 2MJNA 4A59A 1X5TA 7FDRA 1N34F 2E2OA 4XH5A 2KSOA 1RGIA 3QX7A 4M5JA 2RIJA 4B3TK 3O1WA 1JXVA 3JAMY 5LSRA 3KMSA 1JMTA 2ASPA 1SH3A 3KZXA 1FD8A 3HXMA 4LF1A 5DK5A 2W7OA 4JI1K 4GXJA 2FJEB 2HQIA 4BE0A 1NDCA 4DQIA 5B0FA 2ZTCA 2HIQA 2GV9A 1S57A 5KPZA 1GLAG 3ILOA 3FQLA 3MF5A 4M3UA 1RT7B 3BZCA 3ILJA 4DCJB 4DZDA 4H4MB 5D77A 5IM0B 3OR2B 4AQYF 4A8MP 4YR0A 1CPZA 3T1YK 1ZQDA 4CGHA 3I8BA 3H4BA 2YWHA 1RDWX 4I2DA 1EHWA 3VTHA 5DGAA 3VHQA 4DFKA 4RPXA 1REGX 1RSCA 3JXUA 3ONQA 3CW2C 2E4LA 2FVCA 1KSPA 2PSZA 1QHAA 3KK2B 1KAXA 1C0GA 1WKJA 4ECTA 4NMLA 3QERA 1F21A 2E8OA 4JAXA 1LK7A 1UEUA 4Y2KA 1GOAA 1RILA 4IOXA 1TKXA 4TVAB 2XULA 4J9OA 1R8AA 2OD4A 3FMBA 5FDLA 1P6TA 3M7DA 4E7IA 3UQSA 1HWIA 1XC9A 3MAAA 4LR8A 4FXWA 5L9XA 5CXTA 1TL3B 2YHYA 2JLFA 1ELOA 3BGLA 5A0YB 1HHTP 1EP4B 8ICKA 2VDHA 2ZF5O 4BC5A 3MUVP 3DYAA 2CQ3A 2HNZB 1YBTA 4AHUA 5IOLA 2HWTA 3KIOA 1FDAA 2I5JA 4M8LA 4MEXA 4ZITA 3UPFA 2X1BA 4PWUA 4IFVB 2MZJA 2JWKA 2I9GA 4OHXA 1OH6A 3QJJA 1N36J 4NLGA 4L3QA 3GIRA 2B5JB 2CQ2A 5AI4A 3L4PA 2KE7A 2J6SA 4YOEA 5H9EK 4YMOA 3BUZB 3CQYA 1VK0A 4P71A 3ZSZA 1SZPA 1MNEA 5AQSA 1ZH5A 3IDHA 3K2YA 1NDLA 2HHQA 2PFQA 5ETLA 4OPAA 2P1JA 4NWBA 3HCXA 4K4GA 2E5IA 1TL4A 4M7YA 4K50A 3PR5B 1HUXA 1TUYA 4H0PA 5GAGU 1TU0B 3SUNA 1QE1B 3J7YU 8ICHA 1RTJB 4KRFA 4NXMF 2QMXA 1L6NA 2LMIA 4CTAA 3I32A 4DJBA 3R5CA 4JV2A 4RPFA 1J2VA 4MK9A 1LWCA 4IG0B 2ZH9A 3A13A 2ZE2A 1SB6A 4CZJA 4CLWA 3IWNC 2LI6A 1GX5A 5HROA 4JYAF 2GGPB 1ZQRA 3DOKB 4KT0C 4U67Q 2HOFA 2AGQA 4P4OA 9ICVA 3C15A 3MM7B 1BVSA 3H5YA 3AV9A 3QU5A 3H40A 5HHHA 2FUG9 3TZYA 1GH8A 1UP1A 1XMOF 4TUQA 3W65A 3AA8A 4F25A 1J5EJ 2AYBA 4EX7A 2CWXA 5IIMA 1WAFA 1RHRB 7ICRA 3ENVA 1F0MA 3UKUB 4GVBB 1OPIA 3IFEA 1RT2B 4AQYJ 1WI8A 1NPRA 3G96A 5J0RA 5AQQA 4P2XA 2RU3A 1MQ2A 2DF4B 4HVJA 2HQGA 1M0SA 3DU5A 5D3GB 1UOCA 2Z2YB 1XERA 4IH6A 2O8FB 2D8CA 3HTVA 2KJ5A 2A3JA 3B82A 2P5GA 2LU2A 2GMJA 1EP4A 2WF8A 1HX1A 4MYTA 1U45A 1VCTA 2E88A 2LQ8A 3BGRA 2RN2A 2W55A 3N9UC 3EDRB 2WUSA 4KGZB 4X4QA 4OPJA 2NREA 5CCMA 2EC0A 2CH5A 4Z4FA 2W9BB 1RHUB 3CXCM 1FRIA 1UVLA 2ALZA 1VSLA 4I64A 2OPRA 2LM1A 1S8OA 1R31A 3GB0A 5EWEA 4FJ7A 3ZEUA 4OZLA 2VJUA 2OIHA 2GLEA 2QN6B 3NGRA 5CZVA 4DX6A 3OYNA 1NJWA 1SXEA 1Q3VA 2HOIA 2FJ6A 4OI0A 1MSWD 4OX9F 2VQFK 3H3NO 4CWBA 1U04A 2NQPA 1C4AA 3MGHA 3BSOA 2QLFB 4O4GA 2RF2B 1J53A 4H54A 2CXYA 4M5KA 1CSJA 2B9XA 4W4MA 4V1Ak 1D8LA 3DYAB 4OYMA 2FYXA 3I55N 3D4JA 4YP3A 3V72A 3OR1A 1UHUA 3H45C 3M4XA 4UB6U 2G0CA 3F5EA 2FTRA 3F9MA 5HQ8A 1NGJA 1Q5VA 2QJ3A 4WTOB 2MQLA 3AH6A 1HR0J 4E89A 4NXZA 4BRQA 4DL3A 3MAAB 3J7Z5 1I39A 2ZITA 3RR8A 4X65J 3QU4A 1BNPA 3C2KA 4AT1B 4WFNQ 3UM9A 3PZPA 1SJFA 3MXJA 2G8FA 4YD1A 5H9FJ 3B8HA 5K8NA 4TQSA 2GWKA 3OSNA 3CCES 2EK6A 4YFUA 3I1YA 2A3ZA 4J03A 2WBMA 4GMKA 1BA1A 3HT0A 1NSPA 4OYZA 3PSIA 1T9XA 4M95A 4Z4CA 4FXVA 1YAGA 1HWLA 1ZBSA 1HNZJ 3LA0A 1TTHB 5AKYA 4UASA 3VA3A 4WYBA 3IHQB 3ZNJ1 3LGNA 1QDUB 3RH5A 2KLAA 2CVEA 2OPPA 4EEYA 1C0UB 2B9YA 2G1DA 2D7SA 3AODA 2DPIA 2O6KA 3KLEB 1K6YA 1S49A 1VAZA 4DR4J 1WN7A 4I2CA 3F41A 4LFCJ 1RHQB 1B4FA 2QL9B 2YX7A 2DJWA 1S77D 5IIJA 4MF8A 2V6AA 2UXBK 3WK8A 4JI7K 1SIZA 4N77A 2YWFA 4X66J 3MUMP 1CZBA 4O9MA 3DC2A 1RE1B 4DOZA 1HQEB 3CCZA 2H3VA 1QSSA 1AUSL 2E29A 1LW2A 3RAQA 2ZZMA 3EPIA 4ID5B 1RWXB 5TISU 1S1TA 5B0DA 5KFOA 5IV4A 4F4WA 2F1IA 4JKBA 2IHMA 4DFMA 4WF9L 2QYCA 2BW2A 1UZHA 3NLCA 1HLUA 2QWQA 3V7LA 5BR8J 4PL8A 3D0PA 3CCEN 3LP2A 4CRJA 2Q0ZX 8ICOA 1B7FA 4MEYA 1TFWA 3S6JA 1ZQCA 1S3XA 1NGGA 3OPXA 2CADA 4UOGA 4HHUA 1HNWK 1EXQA 4F8RA 2OPSB 3TTDA 1QH9A 4FBTA 1YRUA 3KJNB 2HQFA 1U02A 5KFZA 4M6WB 4WIIA 2VG7A 4YHHF 2AP1A 4V19X 2F8MA 4WFZA 3ULHA 4A62A 3OYLA 4Q5VA 1ZQIA 2E7XA 5BYQA 4USAA 3J80O 2OFHX 2UUAK 2PA8D 3PJWA 1NM1A 2HBJA 4L75A 4DUZF 5EE3A 2BCRA 2UUAJ 2KNJA 1U1QA 4BVPA 1BNOA 4JI0F 1WJ9A 2A10A 1PAEX 3QU9A 2YB4A 4JKCA 1JLEB 2KN4A 5KT6A 4QR1A 4UB4A 1GLJO 3PRVA 2XQCA 4NASA 4NA1A 1VSDA 2JV3A 1ZQBA 2GVDB 1S1VA 1UAXA 2C2KB 1VISA 1WEYA 2CN1A 4JI0K 5KFJA 4I2HA 4L3NA 2YY6A 5IILA 4CHYA 3PACA 3VQPA 3RFAA 4JI6J 2B43A 4ID8A 7ICKA 1JJ2M 3WBZA 1BUXA 3QT5A 3HFZB 2W24A 1WDTA 3BYPA 2KIVA 1CJVB 4RPYA 4PKDB 4F4XA 1ASUA 3M9OB 4PA1A 3OUYA 4CJ5A 3UB5A 3H7HB 4DR1J 5A8WB 1FW6A 2BKOA 3J80Y 1G4CA 3HM9A 3UWTA 2EFGA 3M6WA 1BQNB 2IDLA 4X84A 4JI3J 2DTJA 4Y2MA 2DNYA 2VIXA 4GMJB 1O51A 1HA1A 4USVA 1XMOJ 4A8FA 2JHEA 3PJXA 2CNKB 1HQ2A 4RT3A 3TTFA 3NRWA 1N8RO 3KHYA 2Y0SF 3D3CJ 5JUMA 3WK6A 4IH5A 2PFOA 4JI7J 4HTIA 3Q8UA 1T95A 1A5WA 3OR1B 5G5GA 1D9AA 2G2ZA 3D1OA 3L3CA 2G4BA 2FC8A 4DV2K 4X62F 3D66A 3KD1E 1RZTA 3MAQA 5KFKA 4C3KA 4N8OA 3CC7S 1JCGA 3IR5B 1ZYQA 3GDQA 1KOHA 3TSPA 4BRDA 1FNOA 3A8IA 4Z4HA 2WF9A 3A5NC 1YJTA 1WSVA 2D4WA 2XVTA 5AIAA 3QIPA 4RPZA 2YV0X 1XNQK 2HBRB 2AF6A 4PL2A 3F53A 4DUYF 4DTXA 2OELA 4KLIA 1BA0A 3G9CA 2PY5A 1ZBFA 3H1QA 2G9OA 2E8PA 3I6PA 3OVSA 4PQUA 2W3SA 1FVSA 3SQIA 2ZIUB 1U2VA 4JKAA 4MO4A 2VJVA 1HFEL 3I96A 5AXLA 3MMBA 3Q7CA 1GQEA 1UWAA 4I7FB 2CPFA 4A8WA 4I68A 2JWLA 4LFBK 2GX8A 4FLZA 4FKXA 3POTA 3F9KA 2AW0A 1RWMB 1N54B 2VC1A 1YRTA 3CCLS 1AZSB 2DISA 2M0GB 3H5UA 4KTWA 3W66A 2RS2A 3CWJA 4DR2J 1LAWA 2E8NA 4PXEA 3PCOB 1F5BA 3J7AP 4NLUA 3W2WA 2FPKA 3ELHA 5ADZA 1FXXA 1PO6A 1KVAA 3BO2A 4IZ9A 1KLNA 1HPZA 3JS6A 3D68A 3QFUA 3SDEA 4DV1K 3GU3A 3OVNA 3OYCA 1N48A 2O8CB 3UQ0A 3CMEN 1X60A 3M6VA 3EL2A 1CJKA 1WWUA 4RKUC 5A2QO 2HBMA 3C21A 4FM0A 4C4WA 2RHSB 2LKYA 1XIQA 2R7UA 1NZBA 1R3NA 3D1QA 3R97A 4CDIA 3P5JA 2BYCA 2UXDK 5JMNA 2QWPA 1VHXA 1V6HA 2WSCC 4NLDA 1SL2A 3CIPA 2L08A 4IEIA 3CCQN 1Z6RA 2D3O1 1BPEA 3RJEA 4TU9A 4CZFA 1S59A 5ELZA 3FFKB 4CFCA 1SIJA 1S12A 5DQGA 3DAWA 3HVTA 2P9NB 2DH8A 3SQGA 3VEXA 3QGIA 1N4LA 2KJ9A 3MDFA 5KL1B 2ZIUA 1U2VB 4QZDA 1RQNA 2KHDA 4CEDA 1CXUA 4AE5A 4CH1A 4UOCA 2H5XA 2DNNA 1XNRJ 1DTTA 4NLBA 5AQZA 4WJBA 3D0HE 4ES3A 3CJ7A 4NLXA 4JK7A 3MM6A 5D6GA 5THWA 4PXBA 1CJVA 1HBUB 1X9MA 1S1XB 2JEJA 2PO4A 2ZUGA 5K9FA 3Q2TC 4PWDA 3L4QA 4AYBD 4EK2A 4M3TA 3PIOL 3QEBZ 4LF8J 1P7DA 1S4EA 3L2QA 4YOUA 4BDPA 3T7ZA 2HOQA 1WOOA 3BQ7A 3GIMA 3E01B 2NZTA 4DR2K 1OY6A 2ROGA 1N33K 4FNHA 1S72N 2H5EA 4E8UA 1RISA 4LJMA 3TAPA 5DZ6A 3EGNA 2ZTDA 2Q1LA 1UFLA 1W9HA 8ICNA 3S8SA 5C0YA 3UW1A 4OO1J 4OYWA 9ICTA 3D6JA 5ALYA 4M9NA 4QS7A 1Y11A 2RHQB 5F0UA 2CJQA 2KH9A 1DEJA 4KGKA 3M6GA 1W2IA 1WSJA 4DUZK 3ITHB 1N5QA 3EWAA 3S6EA 4YCXA 2W25A 3D0IE 4O3NA 5AKEA 2IC3B 2YI1A 1V97A 2KZ3A 3FZLA 2E1CA 2GHVC 1Q53A 3CJRA 1KNZA 4Y6IA 5FD1A 5JJBA 3QU2A 1N62A 3VERA 4ZMMA 3I9ZA 3IR6B 4YORA 1UA0A 3P8BB 1RBUA 9ICMA 1RFQA 1QAJA 2YWKA 2RDIA 1HLWA 3EMTA 1D5AA 3TNVA 7ICPA 3BR9A 1UEKA 2ZD1A 3O9TA 4RCHA 3UN3A 2BOPA 4ZPCA 2I1RA 3WQUA 4P2FA 3ZSYA 4FWRA 4UB5A 4JI2F 2MLXA 2RH3A 4X4VA 4KPYA 4DR4F 8ICZA 1Q78A 2OWOA 2R8IA 2ASYA 3OXLA 3CCMS 4CLYA 1TUVA 4HLBA 2HNDB 4M5LA 2OTLS 4RNNA 2RSQA 1OXJA 2MKYA 2NR0A 3C14B 1X8DA 3DXBA 5D0HA 1F3VA 1EIYB 4JHDB 3V4IA 1UA1A 4DL0C 5AQXA 2E5JA 4B3OA 2Z4PA 3ZSOA 1FK9B 3M8PA 1JLBB 4NEZA 1UWBA 2GJFA 2UUBF 2E7VA 4WIQA 4PEOA 4YY3J 4IOCQ 1NHKL 4WFAQ 3TI0A 1NB7A 1A6SA 1B0TA 3VETA 4YOWA 1LCUA 3LDPA 4CE9A 4IJAA 1TL1B 4FJKA 2QMUB 3CJ4A 4J5OA 2RF2A 2GIQA 1X4AA 1JLFB 2BQRA 2ZH2A 3IMXA 4S0MA 4ZVQB 3VAKA 2YWEA 3J7A1 2C3YA 5SUHA 4FXDA 1IQTA 2OHDA 4J9VA 4AHRA 4CHNA 3PHTA 1ZM4A 4ID5A 4WCEQ 5FRNA 3RVCA 2PFPA 3BY5A 3FQKA 5DBAA 3C2MA 2P6RA 5L38A 9ICPA 4GXIA 5HR7A 4A61A 2HCFA 1SGGA 3K5MA 4IO8A 1ZBLA 3ZX2A 5ADXA 3NEKA 3TRGA 5D78A 4NI2A 1S1XA 4F0MA 4FYVB 2XMTA 2F4VF 2F9WA 2XC9A 4DTJA 3OHAA 2KIWA 2HNDA 5LOQA 1RWVB 3SJJA 5CZ2A 4WFBL 1S10A 1V9OA 1Y88A 2MJUA 3E58A 5K14B 5F0XA 2ESEA 3OXGA 3D6RA 3OA9A 5AM0A 1C2PA 1WSRA 1FFSB 4LREA 4ZLJA 3IWXA 2AX0A 5AI0A 4R8UA 1TK8A 3HSGA 2IY5B 4H4KC 3JQJA 2W42A 1L7OA 3M9NB 4UOFA 3CM5A 2L9WA 1VBYA 4H8KA 5BR8K 1SJ4P 3EPGA 2MZQA 3BB5A 5L8RC 5AI6A 1LW2B 2ZHAA 1I3AA 4P10A 4ISEA 1Z4UA 3I5CA 5DKWA 2QSWA 4RW8B 5DG9A 1MMLA 2XHBA 2R7WA 4PXCA 3VV2B 3IKMA 2D0BA 2Y3YA 4DN9A 4LIRA 1URRA 1M90O 1IXRA 1P8GA 1RLCL 1CZAN 4LRCA 1K44A 1MWYA 4Z37A 2JC0A 3I56S 1IKWA 1UETA 4FF3A 5CABA 3HJEA 2LP4A 2JZBB 1TVRA 3D2EB 2DRDA 4FJNA 1OMSA 2DHXA 3SMZA 2KI2A 3FBCA 1CVJA 2FPLA 4CHOA 5A0YA 3V1RA 1S0OA 2Z1GA 1PJ6A 1W97L 3ZZTA 5AK6A 2J7UA 4DV6K 2MB0B 4FLXA 3PW7A 2CQDA 5A2QU 4RW6B 5CD4H 2ZDPA 4BRKA 1EAYC 5ITHA 2E5SA 4KB0A 1I1GA 3H2UB 1XO1A 4NLVA 3R6MA 2G8KA 1TELA 3MWTA 1QQ6A 2K7JA 3CB4A 4I6YA 3DV9A 2KRBA 1EKSA 5AZIB 5BOLA 2OHFA 3K2PA 2ZKTA 4DSIA 5J0QA 4KLDA 1ZJMA 2AV5A 5I9EB 2QZ8A 3I0SA 1RUSA 2XYGB 2R4FA 4F93B 1KLMA 3OTDA 1GXUA 3SCXA 5KG7A 1WOPA 2H1YA 3THXB 5DDOC 2JLEA 2ACMA 4NLYA 5J1PA 3WXKA 4QYRA 4W90B 5C12A 4TY9A 2AYMA 4YB1P 1JXEA 4FKYA 2DK2A 5DM7Q 3VEOA 3WNGA 4WPAA 2Y9TA 4MIBA 2HSTA 2BM0A 2X78A 3I0RA 2BACA 3W64A 1ZOTA 4FNIA 2P9UA 3ET6A 4DMNA 1S9FA 2YVSA 1U09A 4O5KA 2IBOA 3QRQA 4CF8A 1VSKA 1ZXIA 3AVLA 2E6MA 3CMQA 1Q3UA 3VGUA 2WAQD 3GSDA 4UB2A 1N33J 3HULA 1DRZA 1YUWA 3QT8A 3NBPA 1XEZA 3O3GA 2E1PA 2J9CA 2K3IA 4YB5A 1V4SA 4WBFA 3H8JA 3SV4A 2ZZNA 1SKSA 9ICQA 5IIKA 2AJ2A 2QA1A 5CZXA 4DMZA 5J8YA 3AD8C 4G1IA 2P9EA 5J2KA 2UVWA 4KE5A 3VAJA 3QEIA 2QA4G 2K1RB 7ICGA 3HFKA 4GNIA 2ERRA 5B0CA 1KAYA 2O66A 2B6AB 1K8KA 2E5LF 4ZVPB 1N5YA 2DNMA 1YBUA 3EZUA 8ICFA 1M5SA 4UAUA 1U8SA 4ICAA 4F3QA 1TE2A 4EFAC 2CAJA 1S22A 1FK9A 1Z05A 1VQON 3MCOA 4O0NA 2HHTA 2GIRA 1MROA 4WP8A 4JI5J 3NS5A 4KHYA 3K8WA 1QQ7A 3R1XA 9ICJA 4Y0FA 4KHNA 3M30B 2UVVA 1SXDA 1JJHA 3MI7X 4HDGA 4FJJA 5FIIA 1C1CA 4CJ4A 2QWNA 4NEYA 4LSLA 4NI2B 1HJOA 5LJ5Y 5ETVA 5T7BA 5IC6B 4DHYA 1ZQSA 3SSRA 4KO0A 2A6MA 4Q45A 2BXJA 1RYRA 4GKJK 1JNRB 2B4PA 4X4RA 3JPTA 5J0XA 2EFNA 3I8DA 1IG6A 4IQWA 1ZTWA 4X66F 3QZ7A 2FVQA 9ICFA 4RUAA 2UP1A 3DRPB 3IBFB 4DV0F 5ETKA 1BOTO 2O1PA 3NCRA 2IIRA 3HOTA 3S41A 5ALUA 2EC2A 2ZM6F 4DR6K 1F9HA 5KNIA 2ZH3A 2BKNA 1YTYA 4DR7K 4P73A 2P9SB 5HL7L 1VQ8S 2F7VA 4EO6A 1WHYA 4QWEA 1R7IA 2JJ4D 1ZS6A 4DFJA 5TKWA 5HJYA 1MWKA 2YQEA 1IBKJ 1KXPA 2DO0A 3RMCA 3AVCA 2LKZA 4RW8A 4JI5K 3KNAA 1DLOA 1TFYA 2ZBPA 4Z6FA 1ITPA 8ICIA 1WC0A 2GHPA 4WE1A 1CQNA 3U8XA 1CJTB 4K59A 4A2AA 2W9CA 1TKTB 3CM6A 4FBUA 2NSCA 1HNIA 9RUBA 1WG4A 3L95X 3AMZA 2J4RA 4HACB 4ANCA 3EO3A 3ULDA 5HP4A 2G5IB 2IVNA 3UDCA 2DNPA 3P6YC 2VYPA 5KL8B 4RT2A 3C0BA 3AQOA 3MM9B 2VUGA 5EXWA 2GUIA 1NJXA 3HRDD 3KXDA 4BWMA 3PW5A 2DCUB 2M88A 2CNOB 1NZPA 2VBWA 3JTPA 4A8OA 4Y2TA 4H0YB 4NLQA 3OLBA 3R6LB 3OS1A 4QQBA 2LQBA 2JRZA 3MTJA 2KVIA 1GX6A 4LFAJ 1KD1T 3VQ4A 2F9JA 2OO4A 5BJRA 5C2FA 3BSNA 5H1SV 4Y1DA 4ZPBA 3RB4A 1H6KX 1AXQA 4IC9A 3AY0A 5ALLA 2YKMB 4Y2AA 5T7LA 3A8KA 2OZSA 3FFIB 1F0XA 1HYSB 1PBUA 1B0PA 1RT5B 3C5FA 1UKUA 1BWVA 1KAZA 3UD4P 2K2PA 2DITA 3PO5A 2VONA 1WSIA 2HHVA 3EKUA 1BD6A 2DR7A 3TACB 2FE9A 3FK4A 2FD2A 1BQMA 3WXJA 2BJEA 1S9GA 4O0JA 4MFCA 1ESVA 3LGMA 4KGVB 2N3OA 2QX0A 3RSEB 2DGOA 1HHQA 2BJDA 2CVIA 2R8HA 1HUZA 2RJZA 3CJ9A 4EEKA 3LUYA 3WXLA 3M8ZA 4CF0A 3LPEA 4KAZA 2JVOA 5EX5A 3SXLA 1JROA 3B54A 1ZQYA 1PJ7A 3M2RB 2G06A 4PZVA 3ID6A 1N5SA 2CGLA 8ICTA 1PC5A 2GNKA 2MSSA 4LFBJ 1OYDA 2Z2MA 4PHDA 3CD6S 3ZZRA 3WEEA 2NPFA 3V4IB 1RZMA 4F0HA 4D3HA 4R5PB 1VQKN 1UTAA 3KMQA 2YB1A 2KOBA 4K5RA 4IWVA 4JB3A 4C7QA 1IR1A 2ACYA 2ZEJA 3ENBA 4IH7A 1ZBIA 2D0PA 1JIHA 1M1GA 5AXNA 4CP5A 2VODA 4C8OA 1ROFA 4XA5A 1NKEA 3K1ZA 3R1LA 4MDAA 4EZ6A 5KT3A 2KFNA 1YVNA 1JX4A 4LSNA 2B3TB 1S9EA 4Y2UA 1IKYA 3V4MA 3VCBA 1LOUA 2YHWA 4DUTA 2MY7A 1J2MA 2KJ8A 3NAIA 1NGHA 2QB1A 5D15A 1WB9A 1X7VA 3RH6A 4FJHA 1S1WB 3IM8A 4H4OB 5LT5A 2DHAA 3EGZA 3CCQS 4DUYK 4O3RA 3BQ2A 1ZA2B 2X1FA 5LMNF 3WNFA 2G09A 2O67A 4BGAA 4IRDA 2J8SA 4C3MA 3AO4A 3HSCA 1IBCB 2AH5A 2ZIWB 1PG5B 1N6QA 1WSHA 3THWB 3TYTA 3VF0B 1FDNA 2ATCB 3VQ9A 4UB3A 4K4SA 2CJBA 2UXCJ 1RI7A 5AQYA 4RUHA 3OBYA 2LMRA 4TUSA 2CJ9A 3C15B 1YHQS 1Z00A 2ADCA 1AT1B 3VGVA 1R0BG 5HMXA 3CPWM 2RE2A 1NNEA 4Z4IA 1KDHA 3BKTA 1M5KC 1QSLA 3CEDA 5IQQA 4FO0A 3KLHB 4KKOA 1O8BA 5E41A 3O2IA 4KHQA 5ETNA 3QYPA 1E4GT 1H38A 1S5ZA 2FJBB 3FR0A 5EOYA 2CDRB 3T9ZA 3HF5A 3PX0A 1MWZA 2ZDOA 4QZAA 3VQEA 2KL8A 2HGMA 5JVGQ 3S3NA 2ZIVA 3N4MB 2Q4TA 1TKTA 5J2MB 4ZVSB 2UUBK 1X31C 1NKBA 4ILJA 8ATCB 1IKWB 5J29A 4ILRA 2HK3A 2UYTA 2XYHB 4LBIA 3PXGa 3BKFA 1RDRA 1AROP 4ZP7A 4Y2QA 3FDSA 1R0CB 3DOMA 2PDAA 2FSKA 5J0WA 1NGFA 3VC8A 4ILMA 3QIOA 3MFHA 2YMQA 1K73T 5L46A 2A3VA 3A8EA 3EY1A 2EKYA 2UVRA 2HFNA 4H4OA 2PMZC 1SUQA 2QV6A 2BBEA 2SXLA 1LB2B 3Q23A 4LF2A 1V5IB 1HNWF 3PSFA 4R25A 2ZOFA 4TLRA 1WSFA 5HSPA 3FKBA 9ICXA 1XI1A 4IFVA 4RNMA 4US9A 1KC8T 4FZLA 1NDPA 4A5BA 1IG9A 4RQ8A 4FJIA 5AKLA 1U8WA 1HNVB 1U6BA 3BPDA 5AHXA 3GPAA 5B08A 1S0VA 2MY8A 2C2NA 3MEGA 4CF1A 1SI9A 1NJYA 1XNQF 2Q31A 4CFBA 2EFPA 3UXNA 4F5OA 4Y2CA 4AXIA 3M8PB 5DB8A 3SLCA 5KFPA 4FYDA 1YVUA 3CJ5A 4ED7A 1W7WA 1XTZA 5HOOA 4ANEA 3SDEB 2W8LA 4H4KA 2FZCB 1RPLA 3T5HA 4FZXC 1MU2B 4JI2J 4URQU 3QIPB 3RG6A 2C2DA 4LF4J 1QVFR 4IOAL 5ETTA 4ALZA 4E1MA 4KHSA 4CJLA 5AM3A 3Q8KA 5HL7Q 3O4NA 1TYQA 5J2GA 3JB9k 4WWSA 2XZWA 3NF9A 2WK4A 3P4UB 5AIBA 3QATA 4YDXA 3D9BA 3GFZA 3D3BJ 3FAHA 1K1SA 1VLYA 1WSGA 4UQTA 2PN6A 2O8FA 1RG6A 5ALHA 3TFRA 1KCFA 9ICHA 3AB4B 2ABYA 1VJ5A 2E5GA 3OUYB 4QU6A 4B1VA 2BQUA 4O3SA 3UCGA 4UZBA 4C48A 3CHWA 3OD2A 4EHTA 4KHPJ 3C7NB 3PSTA 3PTWA 4JV5K 1IKVB 2L9DA 2EXUA 3I4HX 5AI5A 4HR2A 2HMIB 3L9ZA 3CJKB 2ASJA 1VQ8N 1VSEA 1NHUA 1CC8A 1LFWA 2DHHA 4G6VB 3V81A 4GKJJ 2W9AA 5BRHA 4CW7B 5FLXU 5ALNA 3KKAA 1YJRA 2YJEA 1ZQXA 5KFSA 3QFHA 3VAFA 2HAIA 3JAMU 1HQUA 3ATUA 2ZOMA 1JKHA 3VGTA 1B0XA 4LUBA 2JZBA 2DFHA 1Q1KA 4DPYA 2H51B 1HNXK 4F5RA 1TK5A 1HI1A 4AFFA 1IKYB 1FXDA 4NM1A 5KOXA 3CJ8A 4QW9A 4DU3A 2RPIA 1GMVA 1VBZA 1LAVA 4CLPA 4DR2F 3UR3C 1R8CA 4LVSA 4R5PA 2JH7A 1Q8IA 5E3PA 4WFBQ 2I7PA 2RRNA 4RBVA 2QLWA 5HRNA 3C6AA 3PYGA 1FKOB 2VA8A 1X4EA 1DTQA 3QAUA 4EGLA 3BZKA 4KGXB 3NVYA 3CCLN 2KG0A 2YX6A 3M7VA 1CUKA 1WHVA 2KW4A 3Q22A 3QB0A 2VGMA 4I6WA 1TK0A 1RAFB 2FI1A 2D74B 2XMJA 2AJFE 2P9SA 3NVKA 4NXNJ 3ALYA 1JI7A 1YK9A 4X4SA 4JWNA 1NOYA 4EX6A 2HHHK 4GO5X 4B3RF 2WMMA 1RWOB 5IIOA 3OS2A 4ED0A 2W9MA 4C98A 1Q9YA 1HD1A 3MMCB 1D8BA 4CEFA 5AFUA 1FJCA 3NXZA 2E2NA 4BCAA 3SQ1A 1VQ4S 5HBMA 3V1OA 1NH7A 2LDYA 1T3OA 3Q8YA 1V3SA 4QOZB 2EFVA 3JPNA 1YJVA 3CJ3A 3QQCD 3J80U 3TUZC 4GKJF 3ZEUB 1FRXA 2MZSA 4CF2A 4FLYA 4Q7AA 4F7VA 2IC3A 3HHKA 4WKYA 2N1RA 2BE2A 5E2QA 1Y3JA 1DTTB 1DGSA 3V7KA 1QVGM 1Y0HA 3IGNA 3OJSA 1GNKA 2DHGA 2CG4A 5K8PA 3HJFA 1WKKA 1SL1A 2D69A 2FVRA 2WF5A 4PG8A 2IA6A 3VGMA 4OJLA 2OZMA 2EQYA 1CI4A 5MLCQ 2ISOA 1SBRA 2R3VA 1RK8A 2IMWP 3LP3A 2LYBA 2QB0A 1OY9A 4FDFA 2JFDA 2Q97A 3QUTA 5C25B 2DCLA 3CDUA 1M1HA 1JMSA 1N61A 2K1RA 3GMGA 4YEAA 4CYUA 2ODGA 1VRTB 1KVBA 2R2UA 4E1NA 4P7TA 1RTHA 4XO0A 3FEYB 1FDDA 4KITB 4C8LA 4FO6A 1SJQA 3TQEA 2EVZA 3QT6A 3CJBA 2UUCK 5HP1A 4CZMA 2HHXA 3TWHA 5JMVA 9ICNA 1NM2A 3DXKA 1K73O 1ACMB 4EAHD 2QG9B 4PRFA 3CJKA 1FIQA 4KLGA 2OSQA 4IDHA 4I1TA 3FGUA 1FT8A 4E3SA 1SJ1A 2Y8YA 5CYJA 2GAGC 2I6WA 3L2VA 1IUJA 2CPXA 5D0EA 1V85A 2I2YA 3DM2B 2HGLA 2HPUA 1WUUA 4BXOB 2F5GA 4YY3K 2WVCA 2EBEA 4B3TJ 3D6FB 1ZRMA 5F2RA 7ICMA 4QIEA 4ZN1A 2YNIA 2HS3A 1ZTTA 1T05A 1GMWD 4JI4J 3K4GA 1NJIT 4DV7F 4GW6A 2D1KA 2KXNB 1VK8A 3QBWA 4GV6A 5DDPC 5F9NA 1SV5B 2CQCA 1N36F 5D8HB 1H2VZ 2UXCK 2G2OA 5AQUA 1GMWA 3PG9A 5E0OA 2BZFA 1RQ0A 3H7IA 5HMZA 4U9RA 3O5BA 2O5DA 3W9HA 3V9ZA 3LVWA 4MJKA 1MN7A 4FS2A 2EZXA 3SUQA 5DMRA 3PHEA 1JCFA 4O3MA 1TUUA 3PW2A 3AOCA 4X4OA 1LFPA 1KR4A 3WZ0A 1RAIB 3HYFA 3PUFA 4ED4A 2P6TA 1V9PA 1JB0C 5CYMA 4ZS6A 4XK8C 2BTFA 3HOSA 2F76X 2MQQA 5CE3A 4IDKB 3GFHA 1EZZB 1S1VB 4NZ6A 3MEKA 3TVYA 1VQ7S 4ED2A 1VQYA 1YF5L 1S6PA 2NYHA 3KLFA 3MM7A 4FF1A 4FK4A 2ES6A 1MA9B 4LSNB 4R8UB 4LF6F 2RQ5A 1QE1A 3W5ZA 1U1MA 3EZWA 3GWCA 2KB2A 4BC4A 2VKRA 3DRRB 3VZIA 4NLSA 2FMPA 2BZ2A 4M04A 3SK3A 1WEZA 2M9KA 3MM5A 1L3KA 1RTJA 3M1VB 4DEZA 2POKA 4EP4A 2W2OP 1RT4A 2VPZB 3FBEA 3NAHA 2OMLA 4ELUA 4Y2PA 4KHPF 4CBWA 3VQSA 4UUWA 3N6NA 2P6SA 2GQ2A 1NK5A 4HAIA 4AHTA 3AOBA 5C15A 3GJTB 1FKOA 3WEEB 3MGVA 5DLGA 4ETXA 1FKAF 2ZH5A 1KEKA 1EJ7L 4ISGA 3O4QA 2GIFA 4OZJA 5GADU 3MECA 4CHQA 3KFUF 1Q79A 1NOMA 4YR3A 3DFEA 4DKWA 4CJWA 1GT8A 4RBUA 4GVMA 4OI4A 4FW2A 4B1YB 2K8AA 3VEWA 5I3UA 3U02A 2GO8A 3PIPQ 2VU5A 1Z2ZA 4CO2A 1JXLA 1IV0A 1RNHA 2M7SA 3ZDCA 1Y00A 5ETPA 3BO3A 1ZBUA 5FRMA 1SKUB 4CT8A 4YNQA 2F9TA 1WNEA 2ZBIA 3O3FA 3BQ0A 2JEIA 1WHWA 5AZIA 3PYEA 4FWOA 3KK1A 1JL2A 1IM6A 2VQFJ 1LKYA 4IRCA 3I31A 3UE2A 3LM2A 2WSEC 2X1GA 4PQUB 3FFIA 1HYSA 1XSLA 1HD0A 2A2CA 3KD5E 2IVMA 2J6UA 4OL8A 4YG2A 5KG0A 1RAHB 1BQNA 1SV0A 2HGNA 3KLVA 5HP1B 2M0NA 3H98A 2GMLA 3VENA 3MPWA 2P9CA 2WRMA 4HTLA 1YT3A 4YFKA 4HDHA 3AVNA 2Y0SC 1ZPVA 1IBMJ 4FWSA 1U9LA 4J2BA 4PQAA 5CEHA 4FWMA 2M4MA 1G2EA 4JYAJ 2E5LK 3JQMA 3C6HA 4H5NA 3BKUA 3GBTA 2RP5A 4LD0A 3D6TB 4KLUA 4RW6A 3Q7BA 4LF4K 3DU6A 4IG3B 4Z6DA 3Q8RB 1A7GE 2HB5A 1RWUA 3TO8A 1VMBA 3NF6A 3KFWX 3JPOA 3MN7A 1JUDA 4CLTA 4X64K 4BC7A 1QQNA 4HTUA 2MDAA 3GSIA 1WD6A 3WC0A 2ZJ5A 1NI3A 1KW4A 4Y2YA 3RYLA 4LF7J 3PYFA 3K89A 1VBXA 3QEXA 4EELA 5KAFU 3SSSA 1UW9A 5IT4A 5J0OA 1QS4A 3G6EN 3OJUA 4O4RA 2FB0A 4WF9Q 2X7IA 3W2VB 4EMDA 2BRKA 4RQ5A 5CQGA 4OCZA 2UXDJ 2BGGA 1BWEA 2A40A 3HSJA 4DG1A 2G5HB 2JOQA 4NA2A 2ZIXB 1UQVA 1NZAA 1MC8A 4OX9J 3DLGA 4FLTA 3ZTSA 3LPYA 2VIHA 5LMUJ 4JI8F 3W8PA 3CD0A 3OYIA 4KX3A 4ER8A 5HLFB 3DOLB 1T05B 3OBIA 5ALPA 3CCWA 4K8ZA 2NXCA 5AM2A 3AVGA 2E7WA 2ZQBA 1G15A 3V9SA 3CC7N 7ICEA 2HQDA 1DK2A 3PW0A 2L3MA 4EIAA 5JLHA 3AJ1A 2QA4S 3ATVA 4XPEA 1LOTB 2ZH4A 3KJVB 2VPWB 2WONA 4H0TB 3V9UA 4ZCIA 1JLGA 1GMUA 4J2DA 1FWLA 4CK3A 2I5HA 3TA0A 2QFJA 3PV8A 1IO2A 3CJTA 1BCMA 3M30A 2GJIA 1L3UA 2CIMA 4RG8A 3M2UB 5IQ6A 2JLGA 3QETA 3K17A 4CFDA 2HRYA 2FLOA 4JHDA 1BLUA 2C3MA 1VR6A 3W5XA 9ICKA 1NRKA 4X4UA 1XMOK 5AJ3K 2IVYA 3H46O 2KRRA 2IAJA 2V63A 2JSXA 1XMQF 1ZQGA 4MFAA 2P9LB 3D1HA 1PUZA 3F5TA 2F4VJ 5HMLA 4OFZA 4KFBB 4J90A 4M42A 4BX9C 4DPWA 1JALA 4KJIA 2FDRA 1NU4A 1Y5NB 1JJCB 2MLZA 3OFHA 4MKVA 2J7WA 5T7LB 3CCVS 2GEMA 3CIMA 3O5TB 3SCLE 4NYFA 3NH2A 3T3FA 4QZFA 2CPJA 2ZIXA 4ZPTR 7ICQA 3BS5A 3HHLB 4JI6K 5M1NA 2K8CB 1GEHA 1FRLA 2CZ4A 3CCUN 1KQGB 1VQPN 1X9SA 3FSIA 3MM6B 5CYQB 1RCHA 3G25A 3IMQJ 2J76E 2QWOA 4CNYA 4M5GA 4G9BA 3LK9A 4DX8H 1IKVA 1C7YA 4BHQA 3GV5B 3DGPA 2W54A 5IC4B 5HVGA 2F40A 2ZM6K 3CD5A 2A1BA 2KZZA 3NRBA 4J9RA 2YKNB 3WUHA 4FJMA 1R8BA 3NY0A 1I51B 2J9DE 1NOZA 4Y2SA 2FHJD 4QZHA 2H9ZA 2XSJB 2Q36A 5LMUF 3LP1B 2YMLA 4TQRA 2Q0RA 4DR3K 1ASWA 1H2UX 3NGDA 2YNGB 3MCSA 1GLCG 3O1BA 3MM9A 1KQSM 2PEBA 1YHQN 3DRPA 3CGIA 3BO4A 4NJ8A 5GTHU 3O80A 1MU2A 3RRKA 2W9CB 4CIFA 5AKGA 2C2MB 1OPZA 3IRXA 4Y2VA 1H0HB 3NWGA 1YIJS 1KTQA 4DTPA 3OGUA 3M2RA 2NRHA 2MHEA 3BN4A 2E1MC 4UW2A 4ZLLA 1BWFO 4X65F 2D5RA 1KONA 2P9IA 5LSLA 2KM8B 3SPZA 2I9SA 1T44A 4B3MF 1BI4B 1N0UA 2R8GA 4HH0A 4DV6J 1RAAB 3LALA 4K4UA 4ED8A 1BGXT 9ICLA 1WNSA 4YXMA 4OQJA 4B9UA 2W40A 4DQ8A 1FERA 2DBBA 5E3AA 1NWKA 3EKSA 4PHEA 1JXBA 2UV8A 4OI1A 2CQ4A 2RHKA 4EZ9A 4O5EA 3RAMA 1B70B 5AQPA 3D2EA 3R9PA 3OTBA 1VOMA 4GXKA 4J9UE 4LFAK 1A6LA 3RJKA 1LWEA 4HH1A 3US5A 1WG1A 3H8YA 2FMSA 4IOAQ 5AE1A 4DOCA 2IJRA 2AYGA 3VAMA 2MMYA 3AD7C 4B3TF 4D3GA 4JP8A 2B8PA 2CQHA 1ZPWX 3WNHA 4YN4A 2DR9A 3OYHA 4I2QB 2P8IA 1VQ6S 2EEYA 2P9GA 1X6IA 2CYYA 2JX2A 2Y1RI 4M41A 2B7CB 1KFDA 1BC6A 1T9WA 4BRGA 4I2IA 4DL4A 2HMXA 1SC1B 4LR9A 3D5MA 2CQPA 4FWKA 4DF8A 2WF6A 2XYPB 1UVJA 4USJC 4R0JA 5B5EU 2IM1A 4FZMA 3AA3A 3MABA 2W01A 4LIWA 2EWHA 1NPKA 3KHLA 4O0IA 2PC6A 2LCWA 2EZYA 4FS1A 1BIZA 4CEEA 3SCKE 2HURA 3G4SN 2PEHA 4YMNA 3OPKA 4DQPA 3THXA 1WKLA 2XI3A 1IM4A 1N56A 1RT6B 2CFXA 2VFRA 2O8DA 1KFSA 3G8QA 3RW7A 4CECA 3QEVA 1PSDA 4C8NA 4Q8FA 1NK4A 5IIIA 3FVYA 5FLXO 2Q43A 4B3SK 2CA9A 4DN0A 4HTJA 1R8HA 3ZDEA 1UT5A 4ZOSA 2CJKA 1UVIA 3IG1A 2BH1A 3O44A 2GZOA 2V50A 3OYFA 2O8EB 1XBWA 1U2RA 3DI6B 4DFDA 4UY8T 3MEGB 1NGIA 2XS2A 2MKIA 4C4SA 1ZA1B 1SL0A 1RBLA 2QFIA 3W3SA 3RJHA 1M6YA 1RAEB 2PFUA 2XMKA 4CIEA 2VBZA 2YNGA 2UXBJ 7ICUA 1R43A 4N7TA 4OJ3A 4QIWC 4LY7A 2XBPA 2GGPA 5J2EA 5HNKA 2JC1A 3VQQA 4P2HA 3QSIA 2Q6CA 2GMHA 4YOXA 4X65K 2FBVA 3KD3A 5DQIA 2H4WB 1LWFA 1X4DA 4PHTX 3QUBA 3OS0A 1H74A 3L6QA 4NXNF 2VFTA 5DQHA 4LT6A 3A0BU 4CJ3A 4UATA 1TUWA 2V8DA 4NL5A 2RUGA 1HR0F 4RQ2A 4DR6F 4BDYA 4OJ5A 3WX4A 2EW9A 3KHRA 3QJPA 3UFCX 1QVFM 2I0XA 4DCHA 3B6OA 2HNYB 2GW8A 2YQ0A 3QEAZ 1WTBA 4NCGB 5KFBA 2VQEK 4PHAA 2B6AA 4PKGA 2VBYA 2IRXA 4CFAA 3LF0A 4WKRA 1HMVA 4IL6U 1D3WA 3GDXA 2HHWA 2MGZA 1S7IA 3TPQA 1RU1A 1JLAA 1KHWA 3HHNB 1K47A 2QSFA 4CD3A 1RP5A 3QAEA 3ZETA 1VLBA 4KKOB 3GQCA 4KI4A 2KEYA 4CI0B 4UTGA 2QL7B 2BHNA 4KYZA 1SUQB 2G07A 3IV6A 2DTUA 3MPYA 4YB7A 1JLBA 2NUHA 1T3VA 1ZQOA 5AQGA 5C2GA 3NVWA 2OJ3A 4CJRA 3EXYA 1Z2LA 2V2KA 2A41A 5LMUK 2GVZB 4ZHRA 3T79A 4GC6A 3OYKA 3KHGA 4NCBA 1A0PA 4F04B 4OLBA 2G1HA 2NRRA 3UQ2A 4BRLA 4XAKA 1D8YA 3CJAA 2A1RA 2G8WA 5BPMA 1HNVA 3VQTA 2YMPA 3C28A 3I56N 3UDEA 4CF5A 4Q8EA 3WKBA 9ICSA 1KS2A 2M5YA 3KK7A 1L7NA 2YKPA 3RUBL 4Y0WA 3LQVA 3RB6A 2N4CA 1PVRA 2DYAA 1E6YB 2BW7A 4NMXA 4WU2A 3GV7B 4AL7A 3N97B 4CEBA 3CC4S 3WDOA 3CO0P 3PLAA 2ZD1B 2YTUA 3AXMA 4Z4GA 4RQ7A 2UUWA 4EENA 5M2UA 1FO4A 1S5LU 5HVFA 1X5OA 4OYIA 2IFXA 1Q5YA 1XC3A 3K5NA 5KFMA 3R3LA 2ZJQL 1RDUA 1ZD4A 3PY8A 1DGKN 1T02A 3NS1A 3O0FA 1NPPA 2Q3SA 3RU0A 1PYSB 4PG7A 5JXSA 4LMZA 3NDKA 3GYXB 4TURA 5GAHU 3L4BC 5HBMB 5F8LA 4UBCA 2OPSA 5DDQC 3LP2B 5AT1B 4HHTA 4DXLA 2KJWA 2GO7A 3GTYX 2K8GA 1LWXA 3QUQA 4IFEA 1M1KT 4BRCA 3CE8A 3KTQA 3NKYA 1A76A 5DJBA 2VWJA 5AM1A 1APSA 3ETMA 4MKAA 2VQEJ 2V7YA 4BRNA 4ZTJA 1YBAA 5C5JA 2DEIA 1RDFA 1IR2A 3Q0AA 2HHUA 5HJXA 3G71N 2E2PA 4JK1A 3K58A 3WKDA 4Y2IA 4J8FA 3HP6A 1EQMA 1S48A 5KFFA 5JVGL 4IJNA 1ZQKA 3HVRA 2KKHA 1BQXA 3R6GB 3HILA 2GOLA 1TFRA 4ZVEA 4DR1K 4C8KA 2IOFA 3H25A 1FRHA 3ZDAA 1QD1A 3NVZA 3OY9A 2DT9A 4U8YA 2XEXA 2BGWA 5J2DA 1RWPB 1ATNA 2MQMA 1RU2A 3NH0A 3BGUA 1FTCA 5L1LA 2NLWA 4JI0J 2D9PA 3UXPA 4C1NI 1CQMA 3HZEA 1P27B 3TX0A 2MGZB 3M3ZA 1XK8A 2GBZA 2WHEA 5BN9A 4DV5F 4KFBA 3R9LA 4RQ0A 1S97A 3PO4A 3TVZA 2HWIA 2B9WA 1SZ2A 3IS9B 3GCWP 4CZIA 4I7FA 4QIGA 3GJRB 4E2FB 2FHJA 3MOJB 1BISA 3LO3A 4TKTA 4BR5A 4JKGB 4C23A 4GKKF 2DRBA 3UE5A 3NAEA 3AA2A 2AT1B 3SFGA 1XNQJ 4C9DA 2ZTEA 3AQFA 4QYZK 1ZAVA 3H59A 2QYGA 8ICEA 3BR8A 3TARA 4DSJA 3TOQA 4GKKJ 2HG4A 4ZPAA 1FJ7A 1RBTA 1OY8A 1ZD3A 2X51A 5MAOA 4RL1A 5L1IA 3UKRA 4J7CA 3IP4B 3MC1A 1FEZA 4DV2J 3IXQA 3DHXA 1B4SA 3IGVA 4K43A 2W2NP 2KG1A 1XJWB 2AKWB 2YJFA 2CUYA 5L1KA 4P72A 3TQ1A 2AD9A 4DR3J 1RTDB 4KREA 4PG6A 5IS2A 3I4PA 5E33A 3MMBB 5LJWA 1TVRB 4JI3K 4BUGA 2XMMA 1FFGB 1RACB 4RW9A 5KFEA 3DMJB 1ZQJA 3LH2S 3ASMA 4FYXB 3QWPA 1TL7B 2P5VA 4ICLA 3T1YJ 2IIHA 5ALVA 3K59A 1I3OB 4G65A 3TADC 3L8BA 4E7HA 1ZQHA 2NXEA 5FPMA 1G1XA 2DIUA 1QHTA 3L0QA 2KG5A 2ROEA 4JS4A 5ALIA 4K4YA 2E9RX 4FJGA 2HMPA 3MMJA 4UY85 1FX4A 4ZHRB 4BQZA 3DJCA 1TAQA 3T41A 4BRIA 4C2MA 3RBDA 4CJUA 1ZM3A 1VBKA 3IR7B 4W98A 3L7UA 1FJGK 2IOHA 3EE3A 2EH9A 4UF4A 2XY8A 3JPPA 1RBAA 2HBLA 4U8VA 4HVZA 8ICXA 2HKEA 2H3FA 4W5QA 1Y7PA 4MK7A 3O3HA 3SI8A 2MQOA 1DY3A 2Z58B 2W2QP 3OXFA 3M5RA 2GX9A 1TMMA 5D3GA 1C4CA 2HS0A 2PYLA 4CRXA 3KKSA 1ZQZA 3SV3A 4K7QA 2QLXA 1UVNA 1U6FA 3JS9A 2DGQA 5ALJA 3WC2A 1NH8A 4CIOA 4EO8A 3PIOQ 1NGEA 3NBPB 2A6OA 1CLFA 3I0SB 1TZ0A 1V3RA 5SWMA 2HS4A 5TKYA 2VPXB 3OYJA 1N34J 5BREA 4DV5K 1QJHA 4DU8A 4CESA 2J0WA 3SENA 2LYHA 5C2DA 4DSFA 1RWNB 9ICBA 1UPPA 3LZJA 1QAXA 2C2OB 3MCMA 3HRGA 3SQ0A 5CRXA 4CI6A 2PGCA 5M1OA 4PKHA 1LQ9A 1H7XA 2DGTA 2QLBB 5J2MA 3WXMB 2P9NA 3LDAA 2JWNA 5DBBA 1RBRA 4CJEA 4B9SA 2CZVC 1U7LA 2BJ9A 1XQSC 2XSJA 4CZCA 2ROPA 4XH4A 1NK8A 5C24B 4BE1A 3MBYA 3UCZP 3BQ1A 3BF3A 2R7OA 1SVDA 4DV0K 1CXQA 3LTOA 4KTZA 4PKIA 3OTOK 1XSPA 2IGIA 2CJXB 4CEOA 4YD2A 2Z1HA 1Z4NA 4I2QA 3LOUA 2BUNA 2B4UA 1TKXB 1Q16B 2QW9A 3SUOA 2HZCA 4R66A 5A8KA 1GOCA 2YCHA 4NXMJ 1IR0A 1QAIA 3W63A 3OYBA 3TZWA 3L4IA 2BPGA 2ILZA 3ZX0A 2A6AA 4WP3A 4QAGA 2XM3A 4TLQA 3FYHA 1F3FA 5F9LA 2BJ8A 1P90A 3SEOA 1X9JA 2KO1A 3ZD9A 1NMDA 3HL8A 3C95A 3H4DA 4GFJA 2YKAA 1XNSA 1NK7A 3AM9A 4DX7A 3AFGA 4PCQA 2GVDA 1WG8A 3NVVA 3S9HA 5C10A 4WK1A 4GRSA 1YGYA 2FHKA 4BG8A 4NWIA 3OR2A 3AGKA 2D3ZA 4YUDA 3C1YA 3HKZC 4EBCA 5HN0A 3BS9A 2EG2A 2QIFA 5KFRA 1FEHA 5AE3A 2EPIA 5J2NA 3P1GA 1BIUA 1S1TB 2FIUA 4E7LA 1FFUA 4ZP6A 3EEQA 2HSEB 5KT2A 5JICA 1Z4OA 1WBBA 4R0EA 3SCIE 3DXMB 2YNFA 4Y2JA 2DXEA 5AQTA 3H08A 3EE9A 4LF7F 1B99A 2E1EA 1EX8A 1TP7A 1XR5A 4B9MA 5HRRA 2PZSA 2M8DB 4JKDA 1X4BA 3GR0A 3VQCA 2LQ5A 1J5EK 5TZVA 1F5AA 4CJFA 3LVVA 3V5RA 3RSEA 2HVIA 3JYTB 3E9PA 3VAIA 1H1VA 3P4IA 4NYNA 4ATNA 1L7PA 1ECWA 5KFNA 3T6JA 3ETOA 1I94J 2A5XA 4LQ3A 2MSTA 3THYA 5JS1A 3BDPA 1NJZA 4JI8J 1TQLA 4G3IA 3D7EO 3MWPA 2VKQA 3I82A 2XHWA 7ICVA 4WZQA 3N28A 2AGPA 1ZQPA 3OYGA 3D2WA 3HK2A 4W5NA 2E1ZA 3UKRB 2BEFA 5AQIA 4YXJA 5F8GA 4M6WA 3NGUA 1S72S 4JKHA 2UXDF 4ZIVA 4LSZB 2D0AA 1P8ZA 5A6PA 4QBUA 4OKKA 3QGGA 1G7CB 2DNGA 2VV5A 3F44A 1XWLA 1RBSA 1COOA 3AT1B 1NLVA 5ALDA 3EICA 4ZH4A 4U7UD 1GTHA 3R7NB 1VQ9S 3R5GA 4FCYA 4A8KA 4U96A 5DB7A 3TKAA 2BJ1A 1U0HB 3O1LA 3HJVA 3UD3P 2DWQA 2CGKA 5J2JA 4DV0J 1NXIA 1N36K 5T14A 4GVEA 5BN8A 8ICCA 3ISND 2BCQA 3NGZA 3ZSXA 4IQVA 1CLQA 5FPEA 3DLRA 3ZT2A 5ETMA 1SCJB 3HPGA 4FWPA 5EVZA 5J2HA 1VI7A 2F63A 3PMNA 3DLGB 3R8YA 2UXBF 3HZ6A 4CJVA 2VG6B 2P9KB 3IN5A 5FDLB 5K14A 2FDNA 2N7YA 4ZN3A 2RD5C 4DF4A 4MFBA 1R6VA 1PVQA 1YKWA 4NLZA 4HUEA 2VG5B 4QZEA 5KG2A 1RWKB 3BF4A 5B0AA 4F4YA 1U48A 3T1HJ 2Y8WA 1HKBA 9ICIA 1FXRA 1PC4A 2QEXN 4H0VB 2KDOA 4OZ5A 3HPHA 5J0TA 2F8TA 2L5YA 3CJSA 3LP0B 1W0HA 4P9SA 3IAS9 4QYZJ 4KB7A 1NGDA 5B8HA 4MKBA 5KAKA 4RQ6A 5J0YA 3TJAA 1ASVA 2JR5A 1FTRA 3ZZOA 4WCEL 4RU2A 5F8HA 3LDSA 2ZUAA 2JGUA 2B0GA 4DL6A 2OP5A 3SQGB 3KKRA 1BPYA 1OO0B 3RF9A 3MN9A 2QB0B 3QRPA 4PWWA 4KLOA 4N47A 1K0TA 2P9LA 1MN8A 2EX3A 5E79U 3TADA 1ZJNA 3BSCA 4QCLA 3ENQA 5E26A 1YJUA 1MWMA 3CD6N 1MQ3A 2DQNB 3FZKA 4BR7A 3RB0A 4FWQA 3GLJA 2O8CA 1VQMN 2VASA 2XSFA 1VRQC 4AHVA 3IO1A 1VGYA 5A76A 2QWMA 4DO9A 2P9UB 1VSIA 2LYVA 4NRTA 2FPMA 4L3KA 4CBUA 4EYHB 5CB1A 1DGJA 3P3DA 2XCPA 2MRLA 4A2BA 3QICA 2BE7D 2WW4A 4M7XA 4ZVGA 2JL9A 3G8TA 1K8KB 2KVCA 1T9TA 1NDKA 2PIIA 5MLCV 3HSZA 4M94A 5F1XA 1BG3A 2LVWA 5ALGA 4NLOA 2XWYA 3HVTB 5KG6A 4UBBA 2V5HG 3Q24A 2JRSA 4MQ3A 5LJVA 3CFOA 2VJ4A 3HO1A 5BR9A 3FM9A 4YDUA 3RGIA 3C5GA 1URJA 3T5KA 3FCWA 1NZ8A 3DGVA 4B3MJ 2LFVA 3U1NA 1ZAXA 5JU5A 2WVDA 2G2YA 3E8OA 1S76D 2LU1A 1X40A 5K4LA 3PKYA 2QI2A 2DVIA 1OW5A 2U1AA 4ZCKA 3FZFA 4EP5A 2WBRA 5F41A 2E8MA 2V8VA 5DM7L 2KN7A 4B9VA 2EZZA 3J81Y 1N32F 3U1LA 3OL8A 3W62A 1KC8O 3IDWA 3X3UA 1Q81O 3MGJA 2VF3A 2A1SA 1S6QA 3L3UA 4H4MA 5IM0A 4O3QA 1NMNA 1HI8A 1C0MA 4KLMA 5GVQA 5H9FK 1V38A 4NL9A 3CCSS 3ETLA 2JHDA 2HHHJ 5BYSA 4I28A 1OS5A 4PYDA 2GS8A 4BR2A 4DV4K 5LJ3Y 2ZJAA 5FROA 2YNHB 1MDUB 3QGHA 1WACA 3ZX3A 1H3DA 1NB2A 3CDWA 2UUAF 3J7AN 4JKEA 2OTLN 2HI0A 2F8KA 2RDDA 3W60A 2VB6A 4R79A 4K4XA 5GTIU 1OYEA 1UFWA 2WOMA 3J7ZO 1IBLK 3G6YA 3UD5A 2V9KA 3A1YG 2HVEA 3GFXA 1C1CB 2GA7A 2YWWA 3WHIA 1RXWA 2W4PA 3QU7A 2F77X 4LRDA 1HWUA 5HVHA 3RRHA