3HP6A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus f710y mutant bound to g:t mismatch
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 206
structure length 579
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hp6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hp6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hp6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hp6A01
2BANA 1QSYA 2IHMA 4DOAA 3M9OB 2R8KA 4CJLA 4KMUA 2KTQA 5EU7A 4I9LA 1JXLA 3LANA 4J9SA 4M9HA 4OKJA 4F5NA 5KT2A 2P66A 3KLGA 4Z4CA 4UBBA 4DOBA 4YCXA 3K4GA 2E6MA 4R8UA 4YR0A 4AHRA 1RTIA 4CHOA 4NLKA 1QE1A 1D9FA 1NK0A 4ECXA 2Y1JA 3JPNA 4OLAA 1TL1A 3KKRA 3PNCA 2EHGA 3PO4A 3ZSXA 2KN7A 1D8LA 3TAMA 4CJUA 5J2KA 2JLEA 1RXVA 1Q9YA 1LW0A 2ZUBA 4DQPA 4JV2A 3G0ZA 3FFIA 1YTUA 5KFPA 3NH2A 2ASDA 7ICPA 1RDAA 2HNZA 2I1QA 5J2MA 1BPYA 3MR3A 4F2SA 1HYSA 2BCRA 4G3IA 1ZBHA 3MEGA 2KZ3A 1KLMA 1BPXA 2D0BA 1NJWA 4IRCA 1WN7A 2I9GA 1HYZA 2PI5A 1HRHA 1G15A 4P4PA 7ICUA 1BPEA 2OPRA 3JPTA 1S1VA 1B9FA 2BPCA 3NFAA 3P1GA 4IQVA 1XSPA 4OGCA 4M45A 2GBZA 1SKWA 4BDPA 2PFNA 3DM2A 1WAFA 7ICLA 2DFFA 2Z1IA 4UB3A 4DLGA 4CERA 3SPYA 4QW9A 4Q8EA 4JS5A 4YXJA 1T8EA 1LV5A 3U3YA 3T5LA 4DL6A 2ZJAA 3GILA 4RU9A 3PV8A 4UQGA 4KAZA 4I2BA 5J0QA 1BL3A 4HUGA 3U6FA 4M9JA 4CEEA 4KLGA 4CE9A 4FZXC 3O3HA 1BCOA 5JUMA 7ICMA 2C2RA 5KFIA 3RR8A 4KLLA 3TR8A 1ZETA 2BQUA 4PGYA 4PHPA 3EPIA 4FW2A 3HWTA 3QETA 4DSLA 3ZDCA 2OPQA 3AVCA 4CEAA 3P83D 2Z1HA 4ELVA 3BJYA 5E41A 3QEAZ 3KK1A 3NE6A 2JEIA 4PH5A 4CK3A 2V4RA 4DF8A 3V9XA 3Q8MA 4PY5A 3BQTA 5DBBA 1BI4A 4CECA 4UB4A 4RPYA 2PYLA 3K57A 1N6QA 1SZPA 3HK2A 3HPHA 2W9BB 4I29A 3AVKA 3RJKA 4IDKA 4EP4A 4IQTA 1CXQA 4J9PA 1QS4A 4NM1A 1JXEA 4YD2A 3AVIA 3V6DA 3H7IA 4R64A 1NJZA 2AGOA 3LWLA 4QZCA 4DL3A 1Q9XA 5DBCA 4IQUA 5DQHA 1CZBA 1A77A 2OPSA 3WNEA 2G8HA 3QE9Y 4F4XA 2FPLA 2FLPA 3KLEA 4IG0A 2FLLA 3OSPA 7ICEA 4PA1A 1XS9D 4FJHA 3UPQA 2PFOA 1CEZA 4P4MA 4GW6A 5KT6A 3TARA 2C2DA 1HQEA 1B9DA 4FK2A 2ZUDA 5DGAA 4DFKA 3AV9A 5CZ2A 8ICCA 4M2YA 4RUCA 1B22A 2R8GA 4RNMA 3MDCA 4MQ3A 1LAWA 1X1PA 4JLHA 3NGZA 2OZSA 3AVMA 5L1IA 2DPJA 2JGUA 2H5XA 4I2JA 3OY9A 4DTRA 4LH5A 3GIJA 4N5SA 5J0YA 1TL3A 3NF9A 5DDMA 3LZIA 1XSLA 8ICAA 4O3NA 1ZBFA 4KHSA 7ICIA 4KFBA 3PX6A 1GOCA 4J2EA 9ICPA 5KG0A 5FRNA 4C8LA 4BE0A 4FO6A 4O5BA 3SQ0A 1DLOA 5KG1A 5J0PA 9ICVA 3Q8KA 5DG9A 1U47A 3L8BA 2KFNA 3TAPA 4BGDA 4KB0A 1IKXA 4CGJA 4O0IA 3VA3A 2DFLA 3DLEA 2ATQA 4Q5VA 4GXKA 3LPTA 3AA2A 5KG6A 4B08A 4WE1A 4Z6DA 5J29A 1UAXA 2ITGA 1JN3A 3NHGA 5DKWA 1ZQLA 4DSJA 4Q43A 5DB9A 2DY4A 3CFRA 4F93B 1S6PA 3OYJA 2A1RA 2P5OA 2PI4A 2PZSA 4UB1A 3T5HA 4BWJA 9ICLA 2HNDA 3L2UA 4CEFA 1T05A 4I2EA 3UQ0A 1SKRA 4KPYA 3V72A 2KQ2A 4FM0A 3ZCMA 1Z3EB 1D9DA 1WAJA 2BPGA 3AUOA 3AO3A 3HPGA 4RNOA 2IDOA 4BE2A 3MXMA 3KLIA 1NKBA 4XIUA 1IG9A 5KFRA 4BACA 4FK0A 2XCAA 4KLOA 4KREA 3DRRA 4TUSA 2NRXA 3NF7A 3RJIA 3K2PA 4J2AA 3AVAA 8ICJA 3ZSQA 4W5TA 1LWCA 9ICHA 5KT4A 1K1QA 4ELTA 1VRUA 5KFTA 9ICGA 2C28A 1BIZA 3H40A 4B9UA 4B9MA 2W9BA 2Y1IA 4P2HA 3Q8RB 1JLEA 2YKMA 3KHLA 1D8YA 5HLFA 1O1WA 4F92B 1N48A 1JKHA 3QO9A 1B43A 3HP6A 1JLFA 1RTDA 1BCMA 1BPDA 5D46A 3OSNA 3G6YA 1NOZA 4E7KA 3KD5E 3M8PA 4NLNA 4RZRA 4NCGA 1ZYQA 1ZQDA 5KFBA 3M8SA 3THVA 3B6OA 3D0PA 5J0RA 4GMJB 5KGWA 2FPKA 3MXJA 4M3YA 2B5JA 2RF2A 1TAUA 4F4YA 2HVIA 5I3UA 5BPCA 2P5GA 2R8IA 5DBAA 5J0OA 5J0TA 4FJ5A 4FCYA 4RT2A 4MFAA 9ICBA 1Y88A 4M6WA 4DMNA 4B3OA 2HHWA 4ZTJA 4TUPA 2PYJA 1VSEA 1EXNA 4LD0A 4R8UB 4EYHB 3HP9A 4RW9A 5KFUA 5C24A 1ZQBA 3GIIA 4LSNA 1VK0A 4BDYA 3ZT0A 4MFFA 2DFHA 1XI1A 4FJIA 8ICTA 3L2VA 3TQ1A 3VA0A 8ICPA 3OVNA 4Q8FA 1UT8A 4B9NA 3QNOA 3TABA 2A1JA 2JEGA 4RQ0A 5J2IA 2HHTA 1DTTA 1ZQVA 4RW6A 1TK8A 1S6QA 3TANA 1L3UA 4FM2A 1ZBLA 4P4OA 5L1KA 4Z4IA 3JPPA 1T4GA 4RQ7A 1HQUA 2R8HA 1KFTA 4QZEA 1SV5A 4J9NA 3PW7A 3DRPA 4QOZB 1RDBA 3BQ0A 1TKZA 1NKCA 8ICIA 2FBVA 4H4OA 4I2FA 3MR5A 5CYMA 2O4GA 1EP4A 3WNHA 4F50A 4W5RA 1BIUA 4Z0UA 2UVWA 1IKYA 4I27A 2X6NA 4M3RA 4ECYA 1W9HA 9ICEA 3OYHA 2JEJA 3AVGA 3ZT3A 2G8VA 3RJFA 2Z1JA 4CJ5A 1KDHA 1QLNA 3HXMA 3IHQB 4W5OA 4BWMA 4L8RB 4O4GA 3M9MB 5CJ7A 2IHNA 1RT4A 3VQCA 4FS1A 1ASUA 1R0AA 3S3OA 4AILC 3PX0A 2F1JA 2IGIA 2A1SA 1JLCA 4O5EA 5CP2A 1S5JA 4JV0A 2MUTB 1ZQCA 5KFHA 4GXIA 1XO1A 1BGXT 1YT3A 5J1EA 1JL2A 2IA6A 1KEJA 5KFCA 1RT2A 4E19A 3QEIA 5HRRA 4HTUA 3DMJA 3RMAA 3HPOA 5KFMA 1TK5A 1C7YA 1VSMA 7ICNA 3HW8A 3I8DA 2YNFA 4CESA 3TFSA 4YD1A 2X74A 3JPRA 3NTUA 5KG7A 4HYKA 3JSMA 3TAFA 2P51A 5KG2A 5F9LA 2HHSA 4PGXA 2IS3A 4KLTA 2XY7A 3V9UA 1HJPA 2UVVA 4MEYA 2XY5A 3EPGA 3QZ7A 4DS5A 4CJRA 5J0SA 4RW8A 5J2EA 3NBPA 1ZQSA 2HVHA 5KGXA 4AHUA 1J5OA 3PW5A 1VSKA 5KG4A 1RTJA 3QLHA 4RW4A 3UQ2A 4H4MA 3DLBA 1S0MA 3AA3A 4FLZA 3UXPA 4F5QA 1KRPA 3NF8A 1XU4A 4ED2A 4M3UA 3V6JA 2JEFA 3ISBA 2LSNA 1IO2A 3VQ6A 5FROA 1BISA 3LP1A 4I28A 4HUFA 2HHVA 7ICHA 1SUQA 3DLHA 1RILA 4YR3A 3DOLA 3OJUA 2BE2A 3C95A 3A2FA 1S10A 1ZJMA 3UXOA 1I3AA 4XUSA 3OYNA 4FS2A 4JWNA 4KLDA 5D4BA 4E1NA 2AGQA 4EBDA 4F5PA 1I39A 2RDJA 4AHSA 3KJVA 1ITGA 5J2AA 4TURA 2BR0A 1VSFA 1HUZA 3SQ1A 3P5JA 3HVRA 3AA5X 3SJJA 4N41A 2YV0X 9ICKA 3C21A 2VWKA 4I2DA 2NRZA 5L1JA 4DFMA 5DDYA 3SPZA 1UOCA 1RPLA 3C5FA 9ICRA 1RYSA 1VSJA 2KZMA 4OKEA 5C25A 4R65A 4ED0A 4QZHA 3O3GA 9ICNA 2FBTA 1KTQA 3DLGA 4DU4A 1HYVA 3NGIA 1U4BA 4YMNA 2G8IA 4FYDA 1FK9A 2BCVA 3RAXA 4LVSA 4QWAA 5HHHA 4QZ8A 5KRSA 2OYQA 1LB2B 1UA1A 4Z4FA 4HVJA 7ICRA 1NK9A 1WSGA 1K1SA 9ICAA 3ITHA 2RN2A 1RT6A 4I2QA 1C0MA 1ZQTA 1WSEA 2IMWP 3LDSA 1MC8A 4FJJA 3SV4A 3OYLA 3IAYA 3FDSA 8ICXA 3VQ8A 1JLQA 2NRWA 4KB1A 2NUBA 3C1ZA 4FLTA 2HMIA 2BPFA 5J0XA 3LP2A 2FBXA 2MUTA 3OYDA 3ZDEA 4CJKA 3QEWA 1S97A 2WOMA 4OJRA 5DLGA 4DQRA 4EBEA 2YKNA 1RT5A 3MABA 1S9GA 4JK1A 4YNQA 4RNNA 2FPMA 1TKDA 3HSTB 4H8KA 4ED8A 4DTPA 4PUOA 5KT7A 2OA8A 2ZJ8A 2D0CA 2E4LA 4I2CA 4FJ9A 3TFRA 3SI8A 5EWFA 3QEXA 4BXOB 3AVFA 4KHUA 4Z4HA 4XA5A 2V4QA 3AVHA 3H4BA 4W5QA 2X6SA 4IFYA 4KLUA 1T03A 4GC6A 1VSLA 4KLFA 4DTNA 5KFYA 1ZQNA 5KFXA 1COOA 7ICQA 2W42A 4PGQA 4ED7A 5DB7A 4Y1CA 1YVUA 4CJSA 4JUZA 2XC9A 4ED1A 3ZT4A 3M8QA 9ICOA 4GVMA 3TAQA 4M6WB 4ECSA 1J9AA 3K75D 5CHGA 4F4KA 4ZTFA 5KFOA 4YXMA 3ISNC 3QIPA 4KRFA 4QWEA 7ICGA 1KVBA 3AO1A 4CHPA 3E2EA 3ISCA 5EWEA 3HM9A 4MF2A 3AVBA 3IS9A 2A1JB 4CHZA 3LK9A 3K58A 4E3SA 3KIOA 1S9FA 2BGWA 1TV9A 2AJQA 3KHHA 1MU2A 3CFPA 3H8SA 1PZNA 3CM5A 3RJGA 3C6UA 1J53A 4CGDA 4LH4A 4DFPA 3MR2A 3GV5B 3TAGA 3RB3A 3NGYA 3K5LA 2P1JA 4KHYA 4CK1A 4E7LA 3HT3A 4ECQA 4ED6A 4E89A 4F4WA 4QWBA 1SKSA 2GV9A 3C1YA 2YNIA 3OYAA 5KRTA 3V4IA 4Z6CA 7ICVA 3OS2A 4GC7A 1RBVA 3LAKA 2PFQA 5KT5A 1A5VA 5J2QA 2YHBA 1JX4A 4RQ8A 3DRSA 1QSLA 3RH5A 4PHEA 1RTHA 9ICJA 3Q8PB 4HHTA 5DGBA 2C22A 4DQQA 1GOBA 1NJXA 2D5RA 4Z6FA 4K8XA 5KFSA 2BDPA 2B21A 1ZQKA 3BGRA 3VQ7A 1Z25A 3H4DA 2MAXA 4QZAA 3S3MA 2XCPA 4E7HA 3MAQA 1JLAA 3H8WA 3RB6A 8ICVA 3MFHA 1RBRA 5DB8A 4J2DA 3PUFA 4YG2A 4KHQA 4Y1DA 4EZ9A 2BKEA 4CJEA 4FJNA 4CFBA 2GWSA 3T19A 3QERA 3EYZA 3C2KA 2W9AA 1RXWA 4C8OA 4Q44A 4KN7A 5KFLA 4Z6EA 2FMQA 4DFJA 4E1MA 3WNFA 5KFVA 4PPXA 3VQQA 3KK3A 4DTMA 4CJVA 1X9MA 1NJYA 5JS2A 4CEQA 9ICQA 1AROP 4LSLA 3GV8B 4MEXA 3T5JA 3OGUA 1BHLA 4N47A 3C2MA 3MBYA 4KLQA 4BE1A 5JS1A 4YFKA 1RBUA 4QW8A 4EP5A 2QXFA 3ZSYA 1XWLA 4MFCA 2W8LA 4CIEA 9ICSA 3QEBZ 4RPZA 1Q8IA 1IKVA 4ECRA 3VN5A 2P6UA 3V9ZA 4I2AA 5J2PA 5DMRA 3JPQA 4O0JA 2FC0A 3L2QA 4BXOA 2RKIA 3PVXA 3BDPA 3DYAA 4IFVA 1IM4A 4GLXA 4IR9A 2XGQA 3RJHA 4K8ZA 3C2LA 3T1AA 4O3OA 1ZBIA 4FLWA 2HW3A 2ZE2A 3O4NA 2X78A 3PX4A 2F1IA 4CJPA 4DQIA 4RPXA 1RDDA 2FMSA 4F3OA 4FK4A 4KLEA 3VQEA 2JZBB 4I9QA 4I2GA 3G10A 1IXRA 2AQ0A 4FLYA 3CG7A 2I5JA 1TKTA 3ZT2A 3GQCA 4PQUA 1UWBA 5J2GA 3SZ2A 3KLHA 5IIOA 2ZD1A 4AH9A 3MXIA 2XO7A 4CIGA 3K5NA 1ZQMA 3OHAA 4EZ6A 5HP1A 4CEDA 2DTUA 3AU6A 1HNVA 1CZ9A 5KFZA 3G6XA 4OPJA 1H38A 1HMVA 1QQCA 3ALYA 3C6TA 4K4HA 1NK8A 1JMSA 1ZJNA 1ZQZA 9ICXA 5KI6A 4KI4A 2M9NA 8ICGA 1WCNA 5DB6A 3V9WA 4M3TA 3ZSWA 4CJ4A 1X9SA 1N56A 4RQ4A 1C1AA 3EWAA 9ICTA 1DTQA 3RTVA 4DU3A 4NCAA 2OWOA 2BCUA 3MEEA 3PY8A 4UBCA 3NAEA 5HRSA 1IKWA 1KLNA 3ZDAA 4OKKA 3M9NB 4LZDA 9ICFA 3U3GA 5CZ1A 3C94A 1XC9A 4CCHA 2HHUA 1NK6A 4TSXA 2AGPA 1HUOA 5J0WA 4HCBA 3SYZA 4CEBA 4KLSA 4EEYA 5KFKA 1ZQIA 4KI6A 4M3ZA 4C8KA 2E6LA 1U04A 4DL2A 4DL7A 3LDAA 5I42A 4DSFA 5IIJA 2BQ3A 4I7FA 3MR6A 3D45A 4DWIA 1WCLA 4M9GA 4RQ2A 5SZTA 4CGFA 3MDAA 4JRPA 3V1RA 4JV1A 3QINA 5KFGA 3CYMA 1ZBUA 1Z00A 4YMMA 5CA7A 1S0VA 4NCBA 2QKKA 1S0OA 3O3FA 1VSIA 2W8KA 8ICKA 3LPUA 1VRTA 4ZHRA 4YR2A 3I0SA 3MGHA 3SUOA 3T3FA 3RRGA 1RBTA 4IRDA 3RMBA 2W9CB 8ICHA 4UB2A 1ZQPA 2V9WA 1NK4A 3QZ8A 2UVRA 4TQRA 1TAQA 4XRHA 1MQ2A 4J2BA 3KHGA 1J54A 4ECTA 4CFDA 4M04A 3L3UA 2Q0ZX 2AQ4A 5J2JA 4W5NA 5KFDA 3K5MA 2KW4A 4DS4A 1CLQA 3CQ8A 4UAZA 5C42A 5KFAA 3V7LA 5IINA 4PWDA 4YQWA 4YMOA 4TUQA 2HB5A 1UT5A 2NRTA 4N76A 1QHTA 2VA8A 4QZBA 2DPIA 4B9VA 3QEPA 1TVRA 5HROA 3C23A 1S1UA 4CJTA 4J9QA 4ECVA 2BCQA 2HHQA 3HYFA 2JZBA 1X2IA 4CF2A 5TZVA 3OYMA 4C8NA 2ALZA 1HPZA 5J2DA 3ZDDA 2GUIA 1CUKA 1BPBA 1WSIA 4LZGA 1HJRA 1NOYA 4FZZA 4M42A 3DLRA 3HL8A 4AHTA 2IAJA 3RB0A 1RBSA 3FYHA 2F8TA 4ECUA 2DFEA 1RZTA 4DSKA 3SUQA 3TI0A 4DL4A 3ZD8A 1RT7A 4QWDA 8ICBA 1ZQJA 1S77D 7ICTA 1KCFA 3GIMA 4I2IA 1JIHA 4KHNA 4E7JA 3WNGA 1QTMA 2UVUA 1WSFA 4KV8A 1ZQGA 3OYEA 2VANA 4CF8A 8ICQA 4DTXA 4KITB 4BDZA 1JLGA 4DSEA 1XHZA 2VA2A 3I0RA 4YP3A 3F9KA 3DLKA 3GDXA 3VQBA 2ZQBA 1S1WA 8ICRA 3OJSA 5HRPA 3S3NA 4FBTA 4IKFA 5KT3A 4YVZA 3DOKA 5J2HA 5J2FA 3GFKB 4C8MA 4KLHA 3KHRA 1UA0A 4PHAA 4R63A 3VQ9A 5J0UA 4NY8A 1C0TA 4RQ3A 4RQ1A 3PW2A 5BOMA 4ECWA 4IBNA 3KK2A 1RDCA 1V9PA 1TK0A 3ZSRA 4AHCA 5IIKA 1L5UA 1T3NA 4B9LA 3VQDA 3G6VA 3K59A 8ICWA 3B6PA 4Q45A 4DF4A 3AVNA 2XHBA 5KFNA 4DO9A 1F21A 1ZQQA 4FLUA 4XQ8A 3PR5B 4NYFA 3SI6A 2KZZA 2KFZA 3SUPA 3ISDA 4CGGA 1ZQRA 1TV6A 8ICFA 4B8AB 1LAVA 3GV7B 1BVSA 1S0NA 1ZQXA 5CR0A 3ZDBA 3SNNA 4OGEA 4QZIA 4R5PA 3RJEA 2G8UA 4NYNA 3OYFA 3QIOA 4FVMA 4DTOA 1NKEA 3EZ5A 2ATLA 4DU1A 3HX0A 4ID1A 3C5GA 4J9MA 3Q8SB 1FKPA 1WLJA 1EETA 3PW0A 4ED3A 1ZQYA 4ICLA 5F9NA 2W9CA 2OZMA 3K5OA 4CFAA 3V6KA 4GXJA 1T7PA 4B9SA 2OPPA 4KO0A 1TFRA 3OYCA 4FJMA 1WNSA 5D3GA 5T7BA 4FLVA 1TKXA 2F1HA 1Z26A 3IRXA 1W0HA 2RPIA 1FXXA 1JLBA 3PW4A 4FW1A 5J2CA 2VG7A 3LZJA 3RR7A 2HHXA 1QSSA 1HNIA 3RRHA 4DTSA 2LYHA 3E01A 3SUNA 4M9LA 3O4QA 4ECZA 3RJJA 3MEDA 3MFIA 1WSJA 1KFDA 3PO5A 7ICOA 1DOQA 4M0AA 4CHNA 2J6TA 4TQSA 2AU0A 5DLFA 4YN4A 4DLEA 3PMLA 1JXBA 4O5CA 4CJFA 3V81A 2RDIA 1S1XA 4Z4EA 1RYRA 2R7YA 1LW2A 3V1OA 1SL0A 4IG3A 4NXZA 1U9LA 4CGIA 4CF9A 1EKEA 2NRVA 4JS4A 1TVAA 8ICZA 3LP0A 3ZT1A 1S1TA 4KKOA 2BHNA 4HUEA 4J9LA 1KFSA 5C5JA 5HBMA 3B0YA 2ISPA 8ICUA 4QCLA 4UAWA 3RWUA 1L3VA 5DG8A 3RBDA 1NOMA 3ZSVA 1U45A 4RG8A 2VG6A 2ISOA 8ICOA 2R8JA 3RB4A 3RBEA 1XSNA 1C0UA 2O4IA 3RMCA 4R66A 2B4JA 3V7JA 2XY8A 4RW7A 4FJ8A 1C1CA 4DL5A 5KG5A 2FLNA 3OYBA 5HMLA 2PY5A 4ELUA 3V7KA 1BQMA 3H08A 1S9EA 1ZQOA 2G8FA 3HO1A 2Q3SA 4CGHA 1WSHA 3RH6A 2IBKA 5J2BA 3H8JA 2WTFA 2IC3A 4UAYA 4KLMA 5KFWA 2PFPA 1X9WA 1RT1A 1C6VA 3QNNA 2D0AA 4QZ9A 4O3SA 3OYGA 4QZFA 5HRNA 3SQ2A 4FM1A 4IR1A 5HNKA 3QEVA 3NGDA 3Q8LA 1BPZA 3UXNA 1Z00B 5HP4A 4YFUA 4QAGA 4CIFA 3GIKA 5HHIA 1YTAA 3OS1A 2ZTDA 3AU2A 5KFQA 3QESA 1XHXA 3NF6A 4FJKA 3CM6A 2F96A 2FMPA 3AA4A 4FBUA 7ICKA 7ICSA 4KN4A 1KVCA 5IILA 5J2NA 1RCHA 4RQ6A 3RMDA 4N56A 4M47A 3N4MB 4Q0BA 3ZSOA 2ZUCA 4F5OA 5BOLA 4I2PA 3VQPA 1A76A 3IG1A 2B6AA 4RT3A 1S76D 8ICSA 1EX4A 4QZDA 3MGIA 4EYIB 1N5YA 2QKBA 7ICJA 1L3SA 3NH0A 4NLGA 3MECA 9ICUA 2WONA 4IRKA 4CHQA 1TGOA 4F4ZA 3V9SA 4E7IA 3HJFA 3EY1A 5CYQA 3F73A 1ZQAA 3PR4A 1VSHA 2VA3A 3V6HA 3OHBA 3VQ5A 2FBYA 1RNHA 4KTZA 9ICIA 3RH4A 3Q8QB 3ULDA 1SL1A 3ETLA 3AVJA 4F91B 3AO2A 4G1QA 4DG1A 4QZGA 3TAEA 1CXUA 1GOAA 1MQ3A 4M3XA 1MSWD 2BQRA 4CHYA 4O55A 4OVLA 1ZQEA 2ETJA 3ORYA 5DQGA 1BQNA 5HMMA 1EXQA 4ZH4A 4O3RA 1NK5A 2YHAA 3NH1A 4KTQA 4KLJA 1LWEA 5DK5A 4CFCA 3UIQA 7ICFA 3BQ1A 2ZTEA 1L3TA 4HCCA 4CK2A 2IOCA 4UB5A 3PMNA 3JPOA 1FKOA 3L2RA 2G8WA 4FJGA 5SWMA 3NCIA 2P6RA 3LP3A 1JL1A 4LY7A 4FJXA 4I2HA 4CF0A 2YNGA 1ZQHA 3AO5A 4CJQA 1ZQUA 4DQSA 4O5KA 3HVTA 3LALA 4DTJA 9ICMA 4FXDA 1ASVA 4O3PA 4RUAA 5EOZA 1SL2A 2ASLA 1NK7A 4MFBA 3ZD9A 4DTUA 1DGSA 4F8RA 2ZJ5A 3L3VA 4E0DA 9ICCA 1LWFA 5KTQA 4EBCA 1VSDA 2VG5A 2J6SA 4F2RA 3BQ2A 4FJ7A 4O9MA 8ICLA 2J6UA 1KVAA 5IIIA 2C2EA 4M9NA 3JPSA 5CY4A 3CFOA 5L9XA 4AHVA 4FLXA 5L1LA 4F5RA 3RAQA 3L2WA 4PHDA 5KG3A 2BCSA 3DI6A 1D5AA 4MF8A 3KKSA 2BGGA 1ZQWA 4O3QA 1Y97A 4KTWA 1RT3A 4CEOA 3VQ4A 4DOCA 3JYTA 1IH7A 1U48A 8ICEA 4ID5A 2VWJA 3ZSZA 5DG7A 3AVLA 4DSIA 4K4GA 3SCXA 1A5XA 1B92A 2HNYA 3TWHA 4NLZA 3V1QA 4CF1A 5IIMA 3NDKA 2G8KA 4M41A 8ICNA 3OS0A 4KLIA 1U49A 4FJLA 9ICWA 2F8SA 3M8RA 3EW9A 4K4IA 5FDLA 2Z1GA 3SQ4A 4KHWA 5FRMA 2ASJA 4B8CA 5KFJA 3ASMA 1ZQFA 2EX3A 4X5VA 5KFEA 3IM1A 4CJ3A 5K14A 4B9TA 4JWMA 1ASWA 4O44A 4IQWA 3OYKA 1REVA 4OLBA 4J9OA 4J9KA 1K6YA 5EWGA 1BI4B 4M3WA 2XY6A 3LAMA 8ICMA 3AO4A 5CWRA 2ZTCA 5CB1A 8ICYA 2QK9A 4CEZA 4DEZA 3KD1E 3KTQA 4NM2A 1C1BA 5KFFA 4Z4GA 3T5KA 2XRIA 2XGPA 3N97B 4J9RA 3VQAA 2PXIA 4CJWA 4FZYA 1KSPA 4QWCA 4JRQA 4RQ5A 5DQIA 3S9HA 5D49A 2W9MA 3B0XA 4OPKA 2YNHA 3OYIA 3SV3A 3LWMA 1A5WA 4F3TA 3KLFA
chains in the Genus database with same CATH superfamily
2BANA 4WJBA 1ZOLA 2ASPA 1HQEB 2H48B 2R8KA 4KMUA 4XAKA 2CQGA 4LF8F 3NMRA 5HBMB 3RW7A 3KLGA 4PHTX 1XEZA 4DOBA 3U8XA 2H54B 2E6MA 1YLXA 4R8UA 4YR0A 3PXGa 3WK5A 2J0WA 3VQTA 1QE1A 3OA9A 1R59O 2Y1JA 3W8GA 3R5AA 3QJJA 1LK5A 2MJUA 5GTIU 3BSAA 3UR3C 1TL3B 1CJTA 1HW9A 1X31C 1N63A 4ZCLA 4DR1K 2ZM6F 1XJWB 2RDDA 3B4MA 3TAMA 3ZC4A 2DHXA 4P0PB 1S22A 4C9DA 2ZUBA 3ED5A 2A3ZA 5DJBA 3W2VB 3LPYA 3MK6A 4CNYA 2BKOA 2CQCA 1SJ4P 1RDAA 1HYSA 2K06A 4ENOA 4CZJA 3A4TA 2KZ3A 1KLMA 1BPXA 2MU2A 1EQ0A 2DNOA 4Y2IA 4PL8A 1IWGA 1BPEA 2F9DA 1Q4RA 2AEJA 1S1VA 1B9FA 3T9ZA 3LM9A 3NFAA 1KDNA 2PA3A 1IBLK 1XSPA 4OGCA 4DR3J 1RK8A 1SQEA 1UPHA 3T1HF 5BN9A 1UZHA 4DI6A 4OI2A 1H72C 1WAFA 3H46O 3BP8A 3SPYA 2HNDB 1T05B 1T8EA 2MHNA 2WUSA 4Y2TA 4YOEA 4JKEA 3OL8A 1N8RO 4JI4F 3GE1A 5IQ6A 1BL3A 3SK3A 2GZOA 5JUMA 7ICMA 4KLLA 3RR8A 2BQUA 1O03A 2GMHA 4PGYA 3EPIA 3IG1B 4FW2A 3HWTA 3QETA 2FJBB 3DRRB 3ZDCA 1F5BA 1GLEG 1LWCB 2Z1HA 3RF9A 3L95X 3QEAZ 5F1XA 1ZM2A 4PH5A 5THWA 4DF8A 3V9XA 4BS2A 3TUJC 4DV1K 3BBFA 1BI4A 2DISA 2VB6A 4B3TF 1M5SA 2NXCA 4GVBB 2G1DA 3RJKA 3BSNA 4IQTA 1CXQA 2R2UA 4YD2A 3F5EA 4BC2A 1R27B 3AVIA 3V6DA 3H7IA 4R64A 4LRAA 4HAIA 4OJGA 3LDPA 3SCJE 4YS2A 4EHTA 3G8SA 3M8PB 1Q9XA 1CZBA 2FB0A 1OJ4A 3QE9Y 1WORA 4F4XA 3KLEA 2D6FC 4RNHA 2EAMA 2FLLA 4OHWA 2B0CA 1T3VA 4OO1J 1AT1B 1SGGA 5BJRA 4FJHA 4B3MK 3UPQA 4EEKA 4P4MA 2V2KA 1IN0A 1RLCL 2IFXA 3UW1A 1CULB 4NXNF 1MMDA 5CZ2A 2YVSA 2HBMA 3BBBA 2GO8A 2FVPA 2XNRA 2P9SB 3M8ZA 2O8DB 3H8YA 2W2QP 4GV9A 2KE7A 1NGDA 1LAWA 3K9KA 4LF6K 4X62J 4JLHA 2O1PA 4F26A 1F2HA 5AQNA 2JGUA 4I2JA 1V5VA 2YHXA 5I3QA 1F9FA 3F2KA 2MKKA 1QVFM 4CTAB 1A9NB 2LKZA 3N7SC 2P9KB 1KC8T 1RKJA 3D1HA 4OJ3A 1FEHA 1HQUB 3CIZA 2DF4B 4J2EA 3ET6A 1WOOA 4C8LA 1KQSR 5EX0A 2VG5B 5KG1A 9ICVA 1B0PA 2ACMA 1HNZJ 3L8BA 2KFNA 3TAPA 1QVGR 3QBXA 2UUAF 4KB0A 1Y7PA 2HK2A 5KPTA 4CGJA 4CH1A 3VA3A 2IM0A 4NI2B 3GCWP 1C0GA 5CAAA 2DGTA 4DUYK 5G5GA 1IKYB 4AUKA 1VQON 3AFGA 4Z6DA 3MM9A 2ODGA 4AL6A 3NHGA 2AYBA 5D0RA 5C7PA 4LF7F 1KR4A 3MGJA 2VQFF 3HFVA 1OO0B 3DV9A 4USMA 3KMSA 2A1RA 5BR9A 2PI4A 3MCAB 2M52A 1N0UA 1DT9A 3NWRA 1BA1A 2PZSA 1SB3C 1TL4A 3OBYA 1HBOB 2RQMA 4BWJA 2BABA 9ICLA 3FSXA 1VQ4S 4I2EA 3N6MA 3V72A 1R8CA 2E5IA 1S5LU 3AUOA 3M7VA 4QJVA 1JQGA 2ZZTA 1ZS6A 4L75A 3NGKA 3DGPB 2F4VF 1IG9A 2AIRB 4PXCA 4Z7CA 1J27A 4WP3A 1N33F 2NRXA 3NGTA 8ICJA 2QTDA 2FY1A 3EGNA 9ICHA 3BZKA 5AKKA 2X3DA 2RH3A 5JLHA 3UKRA 2A2DA 3NGSA 2NZCA 3P4IA 1Y5IB 1UJ6A 1S72S 2K3IA 3ENAA 1COKA 3D67A 4JB3A 4R79A 2OM6A 2RP5A 2B0GA 5AM3A 1U09A 2GIFA 3O9TA 2BBEA 1UHUA 3PJXA 4YHHJ 3EX7B 1ZOTA 4WYWA 2O8BA 1VYAA 1JLEA 1H73A 3KHLA 4DR2K 3AQOA 2AEFA 3BF3A 1O1WA 4ZVQB 4LSZB 1BCMA 1REGX 3UR0A 4BRKA 3OSNA 1NOZA 2AH5A 4E7KA 3THVA 3KLFB 5J0RA 2OP5A 5KGWA 3MM5B 4CP5A 4HL9A 5JVHL 3MTJA 1I6JA 2ALYB 5BPCA 1H7XA 4U95A 1U1MA 5GAEI 4DR7K 4FJ5A 2KHVA 4NMXA 4MFAA 3W8PA 1NXIA 4M6WA 2HLUA 4DMNA 1SUQB 2MLYA 5G5HA 4B3OA 2YWKA 4P9SA 2B56A 4RW9A 2MEWA 1IQZA 5CQGA 1WKJA 4FJIA 1PKUA 1RSCA 2HQGA 4Y2AA 4EK2A 3L2VA 1V38A 3TQ1A 8ICPA 3OVNA 2DJWA 3CCLS 3NNAA 4B9NA 2V8GA 2GELA 5J2IA 2HHTA 1ZQVA 4RW6A 1S6QA 2DRBA 2K4IA 3FFIB 4FM2A 1VCTA 5L1KA 4Z4IA 1UVIA 4DX7A 2CADA 4PEOA 1B64A 1KFTA 4J9NA 5HVGA 3HKZF 3PW7A 3H8MA 2CDQA 4UAUA 2HI0A 3H2VE 5AZJA 3GR0A 2DKOB 5CZVA 4OZLA 3L7UA 4QOTA 1WSVA 3PKYA 3ZYYX 5FLXY 2ZWOA 4RR5A 5ETSA 4F50A 3TKAA 3IGNA 2UVWA 3A13A 3E0FA 4KHPJ 4XEIA 4LF4F 3IWXA 5B66U 1U2VB 3QAEA 4D3GA 3MCOA 4DPTA 2EAPA 4PYDA 3ZT3A 2G8VA 1WHXA 1N54B 2MGZB 2HBRB 1JJCB 2NXUA 3FZKA 3IFEA 5TKYA 4DV6K 3DXSX 2YPZA 1RT4A 5AK3A 1WWVA 1ASUA 3IBPA 3J7AN 2CNNB 2UUCF 2C1EB 1N33J 1I94F 2IGIA 2V8VA 2BV3A 3LP2B 2RS2A 5ALEA 3CWJA 1YT3A 3PYDA 3MOJB 5J1EA 2IA6A 1KEJA 1ZXOA 1RT2A 1RT5B 3GFHA 4Q2MA 3C29A 5CE3A 1TK5A 2I0XA 2WSEC 3HW8A 2YNFA 5GTHU 5AIAA 2W7OA 2BJEA 4H4KC 4LFBF 1N6QB 3S41A 2JGAA 2B51A 4I56A 4EWTA 4CZMA 1FJEB 4PGXA 2GX9A 1S3XA 2UVVA 2B43A 4MEYA 3BBCA 4CJRA 5LMNF 4WFAQ 2D3OR 5F3TA 3LTOA 2QT7A 4BQLA 5LJVA 5M1KA 2G9OA 1NU4A 8RUCA 3G82B 4FPIA 3C14B 3DLLQ 3UN3A 1RTJA 1ZTWA 4LJXA 1NM2A 4QU6A 2MZRA 1FRJA 4G65A 4KYZA 3AA3A 4FLZA 4F5QA 2WVCA 2O8FA 3TSQA 4WXWA 1DJ0A 1HL6A 3IWLA 4ILLA 4UATA 2LSNA 1EJ7L 4MN4C 4ICAA 3GMGA 3P5BP 1M1KO 4I28A 9ATCB 3QU2A 4HUFA 2R7TA 3D2NA 3DLHA 2GWJA 2M9KA 5A8RA 3FZLA 3C95A 3A2FA 1S10A 2BYCA 2W11A 5AE3A 1KAZA 2EQYA 1BU6O 2JX2A 4FS2A 1OH7A 3FZHA 4JWNA 2HGNA 2EC2A 4AP9A 4E1NA 3K5PA 4EBDA 4F25A 1B0XA 2EFQA 2EFOA 1JROA 4WP9A 3KJVA 1SV0A 3ETRA 3TO8A 1B4FA 5J2AA 1ATNA 3HULA 2DGUA 4TURA 2DB1A 2QWQA 4KFBB 2OHFA 3DU6A 3HVRA 1K8AO 2F9JA 2BJ1A 2JH1A 5AXNA 2P9PA 2VWKA 3CQYA 1U8WA 3CCQS 1PC4A 3SPZA 1T9YA 1RPLA 4AQYF 9ICRA 3OTOF 2HFSA 4LF4J 5J2QB 3EDQB 4HDHA 1VSJA 2KZMA 1K8KB 3X3UA 3EZWA 4AYBC 4C3KA 1C2PA 4QZHA 2ZEJA 1K9MO 1UTAA 3L4IA 1GX5A 2MY8A 3ENOA 2FBTA 3R3TA 3UKUB 2CVEA 3BUZB 1VMBA 3G71S 1HPMA 3NGIA 3I32A 1YZ7A 4MKBA 4LUBA 3F41A 2CQ3A 2JXJA 2G8IA 3RAXA 2UUCJ 4IQMA 1FXLA 2KRBA 4QZ8A 3FAHA 4ZKAA 1AZSA 4LBHA 4HVJA 2HFOA 7ICRA 1KOOA 1NGGA 3VAHA 2R7SA 3HHKA 5AK5A 2ZBRA 3R9LA 3EGVA 3FDSA 3VQ8A 1CS4A 3MUTP 1JLQA 2VQEF 4QIGA 2NUBA 4KB1A 2DR9A 3C1ZA 4FLTA 3M6KA 1ZZFA 2HMIA 2RRNA 2RJZA 4LSLB 4JI0K 2BPFA 5J0XA 2FBXA 3PHEA 2MUTA 3OYDA 1VFJA 3DAWA 4CJKA 3ZNUA 1EKSA 3R6GB 1UEKA 1K0VA 1GAOA 2WOMA 3ZEUB 5DLGA 1YQHA 5F8NA 2YKNA 4LFAF 1VRUB 1ZC6A 4BRGA 3BREA 4DTPA 5KT7A 3Q22A 2R2SA 2D0CA 3TFRA 4IO1A 4JKHA 2XQCA 1HWUA 3A1YG 4XA5A 1J5EJ 2VC0A 4LF5F 5RUBA 4GV3A 5HLFB 1JLFB 2LDYA 3R8YA 1LFPA 4FDFA 1T03A 4CQ1A 2VD3A 2LPEA 2AJFE 2UXCK 3JSBA 1NDPA 4YDXA 2GFFA 4ED7A 5I3UB 3OT9A 5F8IA 2YJEA 1SJFA 4ED1A 2I5JB 3RU0A 4NZ6A 1J9AA 1P9QC 3K75D 4F4KA 1T9TA 1E6VB 4YXMA 4FKXA 5C24B 1URRA 1J2NA 7ICGA 1KVIA 1NPRA 4DV7F 5HP1B 4LREA 1HNVB 3AVBA 2GUPA 2LP4A 1HMVB 3C66A 5AK4A 4CHZA 1U6ZA 3LK9A 5B0EA 5IS2A 3K58A 4E3SA 1S9FA 2BGWA 1TV9A 2UYTA 2ZIUB 3KHHA 1WG5A 4CI6A 1MU2A 3OTOJ 1PZNA 3CM5A 5AR0A 1WKKA 3NRWA 1M90O 3G6ES 3MR2A 1S49A 4CYUA 3TAGA 4CT9A 2NNWA 2PFDA 2P1JA 4E7LA 2QFIA 1X4CA 4J8FA 3HT3A 4E89A 4QWBA 1SKSA 4OI6A 3MWPA 3OYAA 2MQMA 5KRTA 3OS2A 1NNLA 2KDOA 1RBVA 2WAQD 1UP1A 3BF1A 1JX4A 4JB8B 2I7NA 3PSFA 4RQ8A 1Q5VA 3J80O 5KPZA 3I82A 3RH5A 1O0PA 4USUA 5F8MA 1RTHA 3Q8PB 5ETMA 1VQLS 2HLTA 2OFHX 4L74A 4C1NI 4K8XA 1VQ4N 5EX5A 4QBUA 2VQEJ 1BC6A 3VCDA 4E7HA 2EWHA 4O4GB 3SDEB 2NPIA 3PUFA 4KHQA 4H54A 5AK6A 1R0AB 5A8WA 2KI2A 3CJ4A 2ZOMA 5C0YA 3D2EB 1TQLA 2W9AA 1JNZB 4Z6EA 1X66A 1JLCB 3D68A 4IO8A 5E33A 3N4QA 4CDGA 2XHWA 4OHYA 4OYBA 4LFAJ 9ICQA 1QUPA 1U02A 2KJ8A 2LXIA 1XUPO 3T5JA 3KDOA 5B8HA 3SCLE 4KB7A 2M0NA 3GG1A 4CLUA 2KYXA 3D6MB 2OMLA 4WFBQ 4BE1A 1Q7YO 1S72N 5JS1A 5AKLA 5FP0A 4QW8A 4EP5A 3ZSYA 1XWLA 1BA0A 5AKHA 3TWZA 5KOWA 3GIRA 4JI1K 4LF5J 4RPZA 5TISU 2K7JA 4DUZK 1BUPA 3R27A 3SEIA 4O0JA 4BRMA 2IMOA 4ZA1A 2YKOA 1KN5A 5AI6A 2CZ9A 3BDPA 3DYAA 3FC4A 3NP5A 2ZWPA 2IY5B 4FWSA 4GLXA 1NDLA 4CO3A 4A62A 1R6YA 2DHGA 2CQIA 1PVRA 2KHQA 3O4NA 1C20A 1TE2A 4DR3K 4RPXA 1RDDA 3TVKA 1HD0A 1LEOA 1NGJA 1VBXA 3VQEA 4MK9A 2JZBB 2WVEA 4F9OA 4I2GA 3TVZA 3RW6A 1IXRA 3CD0A 3LP1B 1IR2A 2HSZA 4FLYA 3CG7A 1U1OA 1UWBA 3RG6A 5GIPA 1ZD4A 4NWBA 4USHA 3CCLN 4AH9A 2DTJA 1PAUB 1SJRA 4DPOA 2A3VA 4USIA 3HILA 4EZ6A 2ZC4A 3AU6A 1CZ9A 2IOFA 2MZQA 3G8QA 5KFZA 3G6XA 1JXVA 1QQCA 3C6TA 3W5ZA 4B3RJ 1ZQZA 5EOYA 9ICXA 1ROFA 4KI4A 4KV8B 1JJ2M 4M3TA 3H45C 4C7ZA 3ZSWA 2XM3A 1X9SA 4GY2B 1N56A 2DGOA 3I0RB 3GSIA 5AQYA 1R0BG 4EGLA 5CR4A 4DU3A 1WJ9A 3OQ2A 4OX8A 2CFXA 3HVAA 3DOKB 3A12A 2BDUA 1HFEL 1YUWA 1KLNA 4ZJLA 3ATVA 4RKUC 4USVA 3OFHA 3C94A 1UVLA 1BO5O 2POKA 4LF8K 3DOMA 5J0WA 5AZIB 4CEBA 1FK9B 4ZK7M 3W9IA 4EEYA 1FIQA 1ZQIA 4KRWA 4HHJA 2L48A 2N4DA 4M5DA 1HEKA 3NXZA 3H20A 4DL2A 4UOGA 2KKPA 3H90A 2BQ3A 3VESA 3Q7CA 1YZ6A 3MR6A 3QRQA 4NLQA 4XPCA 4RQ2A 1MLAA 2JVRA 2ZM6K 5M1OA 4JRPA 4BRPA 2RHKA 3TJ9A 3QINA 5KFGA 2MYFA 3CYMA 2YQEA 4IEEA 4NCBA 2QKKA 3D54A 1S0OA 2AWZA 5K4LA 5F41A 4YOUA 3I96A 4FWRA 3MCSA 2UXBF 3M2UB 3HJEA 2R7RA 5CHCB 1F3VA 3I0SA 3J81O 2DNGA 4NA2A 3C16B 2W9CB 3OR2A 3P45B 2KB2A 1VQ6S 5J8YA 4M94A 1QDUB 1SV0C 4TQRA 4PUOB 3L4QA 3CF5Q 3RRKA 1MWZA 2Z2MA 4NL9A 4AYBF 1UEUA 3MMJA 1RB0A 3L3UA 2Q0ZX 4KMOB 1Y5NB 2WW8A 2K89A 3WQTA 2GO7A 2HOQA 4QR1A 4A59A 3QXGA 1OY9A 5KFDA 4OJPA 4IFYB 2ZIWA 4UAZA 5C42A 5KFAA 2VDIA 1N32F 2LA6A 5IINA 3T1HK 3AMZA 4YQWA 3ZZ0A 4K5SA 1XNRK 1UT5A 2NRTA 4A8QA 2BH1A 2QL7B 1BXNA 4P71A 2HYIB 3AD7C 1GLLO 4BR2A 3AAWB 5D4PA 3KFUF 2BTFA 3DC2A 2CPIA 4MDAA 4JI4K 4J9QA 4CF4A 2HHQA 5ALQA 1HJOA 4EHUA 2R2RA 3V81B 1Z2ZA 3MAHA 5M1FA 3OYMA 1C4CA 1HPZA 3ZDDA 2GUIA 1CUKA 2HEKA 1Q53A 1VQNS 4LZGA 5KL1B 4IG3B 1HJRA 3DLRA 5AQVA 1FNMA 3M1VA 4AHTA 3VEXA 3FYHA 1ZD2P 5AI9A 4ECUA 5CXTA 1LKYB 1S77D 7ICTA 2QARB 3K17A 3W60A 4DV4J 4DV5J 2UXDF 4I2IA 5K9FA 3CJ0A 3EVMA 2E20A 4EUVA 4B3TK 2AX1A 3C6UB 3CCQN 1IWAA 1WSFA 2E5JA 4Y00A 4BDZA 1JLGA 2VA2A 2JJ4D 2YNIB 3CD5A 4EO6A 3V5RA 1RA6A 4PG5A 4BRCA 3GDXA 4MKYA 4B02A 8ICRA 5HRPA 3G71N 3CJAA 3TJAA 4UW9A 2XWXA 4KLHA 3DDHA 1UA0A 1BWVA 4HVZA 1RHJB 5HANA 2DNKA 2O6KA 3NNCA 4RQ1A 4IKAA 5HSPA 1Z19A 4ECWA 1PIEA 3ULHA 4NXNK 3KK2A 1DQ8A 3ZSRA 2IC3B 2DGWA 1VDHA 4JI8J 2W25A 2P6TA 3DRXA 5C2CA 1S8OA 3G6VA 3Q86A 3K59A 4O5FA 2G4BA 4N77A 4Q45A 4XO0A 4DF4A 3AVNA 4P2XA 4V19J 1ZQQA 3IMXA 5HMZA 4OZNA 4UASA 3M7DA 2E9RX 3I55S 2HBYB 2BW2A 3PR5B 1ESVA 3THXA 2EZXA 1ZQRA 1YBAA 2YH0A 4CJ7A 8ICFA 5ALLA 3KOAA 1LAVA 4UW2A 3SNNA 4MKAA 4R5PA 3MMCA 2CAJA 5E79U 1EARA 1NGFA 3GJRB 2CJBA 3D6TB 3VOVA 1KN6A 3E9PA 3C5GA 3Q8SB 1Q86O 1HD1A 4ED3A 1ZQYA 4K4WA 5IT9U 1YIJS 1IKVB 2UUAK 3ILIA 3CXCR 2HQDA 4WFAL 1B3TA 1JJHA 2I6XA 4NYPA 4CE6A 3OYCA 4UUXA 1HBMA 4DFDA 3UCZP 1RAHB 5D3GA 2ES6A 1N5YB 2RKIB 4OI0A 2AYEA 4LF7K 2VQFK 4M5IA 2DO0A 3IRXA 1W0HA 3MR7A 2GA7A 4B1YB 4JI2F 3PW4A 4C4SA 1KTVA 5J2CA 2BE7D 2E1AA 3U26A 4A8OA 4FWPA 3BGUA 1VQPS 1HR0F 1B7YB 3O4QA 3CJKA 3HKWA 1RU1A 1KFDA 3TEGA 2E8OA 4B1VA 1ZA2B 7ICOA 1DOQA 4TQSA 1B4SA 2Y0SC 3I28A 5DLFA 4YN4A 1D0EA 2BM1A 1JXBA 2GVZA 4CJFA 1TKTB 3QU7A 5D77A 5CYJA 1X0PA 3FZMA 2K4PA 1X8DA 2RDIA 1S1XA 3WT0A 2GMLA 4FNHA 3B78A 1KC8O 2F4VK 3GL1A 3GLJA 4QQBA 2FZKB 1FHTA 4CGIA 1N33K 1LK7A 5E26A 1MG7A 3CMES 2NRVA 5LJ3Y 4KGMA 1O6XA 3LP0A 3ZT1A 2PEBA 3G6EN 3FM9A 4HUEA 5HBMA 1KFSA 2W7PA 2PC6A 3B0YA 2JHDA 2HBJA 2FDNA 1GXTA 2ISPA 3J7AP 2MSTA 2FY8A 1KQFB 1FKOB 2BRLA 4OJHA 4NX9A 1BG3A 1NOMA 3HHNB 4NXMF 1URNA 3CC4S 3RBEA 1DTQB 1V3ZA 3BKUA 5EE3A 2F9TA 4ER8A 4G9BA 3VV2B 1K73O 1NGHA 2B4JA 4RW7A 1C1CA 1VQLN 2CKWA 3IR7B 3QPIA 1VGYA 1JMTA 3OW2M 1ZRMA 1NBWA 3V7KA 1L7MA 4LR9A 3MTKA 3W2VA 3H08A 2MKSA 1ZQOA 1A0OB 1LWFB 2G8FA 3UQSA 3OBIA 2RNEA 1OW5A 2CIMA 2CH6A 3QMQA 5BREA 5C2DA 4BRQA 2F2AB 4HH0A 4QPTA 3SCIE 4L73A 4I69A 4QZ9A 1WWHA 4DCJB 3OYGA 1WG1A 2F40A 5HRNA 2LXFA 3SQ2A 4Q2LA 2PMZD 2YMLA 5AKYA 1GK8A 1QD1A 3NGDA 1QZ5A 3JYTB 1Z00B 5HP4A 1FVQA 1AA1B 3GIKA 1KQQA 3OS1A 1QQMA 2ZTDA 4BX9C 3I6PA 5KFQA 3QESA 1VRTB 4ZHRB 3L4PA 3CM6A 2F96A 2KM8B 7ICKA 7ICSA 3H42A 1SCJB 2LM4A 1R0CB 5A2QU 2GLEA 5FDLB 1WHYA 4OMFG 2HS0A 4N56A 3AOCA 4OJ1A 4JI2J 1LNQA 1MMNA 3IG1A 4EAHD 4RT3A 4WFNQ 3Q83A 2EC0A 4EYIB 2HKEA 1VC5A 3DXBA 4LF4K 1X9JA 3NH0A 2A6OA 2RUGA 4X66J 1YGYA 9ICUA 2ASOA 3TZZA 3JAMU 1YF5L 3JSYA 3P96A 4XTTA 5A0YB 5HROB 3EY1A 1BY9A 1NGCA 5CYQA 2PDAA 5AKGA 4Y2MA 3QT8A 3V6HA 2PMHA 4YMEA 4MH8A 3RH4A 4DJBA 1I94K 3C6AA 3AVJA 3CCVS 1NGAA 2UU9F 2ZGYA 1CXUA 5SUHA 2BANB 2W43A 3MWBA 2BQRA 2KMDA 3CCES 1FJ7A 3OHRA 3ORYA 3D2FA 2NSCA 2VODA 2E9TA 3KJQB 1ZAXA 3JB9k 4OI1A 3NH1A 1CULA 3KLGB 1HHQA 4CH7A 7ICFA 4IFEA 4LFBK 3PRDA 1ZRNA 2RE1A 3AJ2A 1JWWA 3GYNA 2P9EA 3MCNA 8AT1B 4JI5K 1X6JA 1L3TA 4ED5A 4BY9C 2E5GA 2FVCA 3LA0A 2Q31A 4FF4A 5K8NA 1XIQA 4ISEA 5LMNK 2ZH1A 3TACB 4JKCA 5SWMA 1CJTB 3NCIA 2P6RA 2G5IB 3DLKB 1H2TZ 4LT6A 1JL1A 2MHEA 4LY7A 4I2HA 5J8YC 1OSCA 2NCKL 1P7DA 2YHWA 5CHIA 2DNMA 1N60A 1M5OC 2P9KA 3RSEA 4DR4F 1ASVA 5LJ5Y 4O3PA 2NQPA 4B3SF 2E88A 2ASLA 5H9EK 3G25A 4DTUA 1DGSA 4F8RA 2ZJ5A 3A5MC 5HJYA 1QTNB 1KLMB 2QRRA 2VG5A 3SEOA 4F2RA 3A5NC 1D8BA 4LIRA 4K2XA 5C12A 3CJ2A 1EQYA 4NI2A 1S1VB 1RE1B 3BSCA 2K2PA 4DR6F 3LGHA 4AHVA 2DGVA 3MMAA 3I9V9 1UQVA 5L1LA 2BCSA 2AEMA 2RSQA 1DURA 2VBWA 4ZMMA 2FHOB 3KKSA 3IWNC 4KSEB 1OYEA 2EG2A 4ID5A 1X4AA 3M6VA 1VQ6N 3N01A 2OEHA 2QSWA 1HBOA 4CF1A 4M41A 3QMLA 4RLEA 4ICLB 4AQYK 3M8RA 3EW9A 4QJFB 1BLUA 3HHLD 8ATCB 4C48A 2EVZA 2GQ2A 2X1BA 1T6DA 3OVAA 2WCXA 2W1BA 1FO1A 4DDFA 5LL6Z 4IQWA 1FA0A 4OZ5A 4J9OA 1D3WA 1RM6C 3SFGA 4YUDA 1L3KA 2DXEA 1BI4B 4NLDA 1GMVA 2H4WB 1JRPA 4OX6A 5CWRA 2ZTCA 5CB1A 2DK2A 4DEZA 3O80A 2MSNA 1SWVA 4NM2A 2UU9J 4RUHA 2CQ1A 1UVNA 2DT9A 4Z4GA 3Q8YA 1VQNN 4BGBA 1F0XA 3NG8A 3RYLA 3KFWX 2VQEK 2DH8A 1U26A 4FZYA 4CZFA 4XH1A 1EKRA 2HQIA 4GKKF 2AP1A 1IBMF 2W9MA 1KBRA 3WUHA 3GJSB 2VOPA 4F3TA 3KLFA 4X65F 2CJXB 4L6V3 1T02A 4RWTA 3A3PB 4UY8T 3VAKA 2N7YA 2Q1LA 1PBUA 5IWAF 4LFAK 3OD2A 3LANA 3JTNA 4AE5A 5KT2A 1W97L 4U96A 4FNIA 5DS7A 4Z4CA 1P1LA 3K4GA 2V4JB 3C7NB 4FWOA 4UTGA 1D9FA 1NK0A 2RRBA 2CGLA 3JPNA 4LF5K 2IYGA 4OLAA 2GCFA 3PNCA 3IN5A 2EHGA 3PO4A 3BN4A 3ZSXA 2RT3A 2KN7A 1YTYA 3VF4A 3DDIA 3LDNA 2JLEA 3TTFA 1NM1A 4DQPA 4JV2A 4QR0A 3FFIA 4DMZA 3CJTA 4USJC 3K89A 2I1QA 2BJDA 4MK8A 4A61A 2Y0SF 4MIWA 4TY9A 3MEGA 5FJ4A 3DN9A 3VCBA 1Q81T 3MUVP 4P10A 1WN7A 4KE5A 1HYZA 3I55N 2PI5A 7ICUA 1HKAA 2LQ9A 3O6QA 4DV7K 2DRDA 3MM9B 2MZ1A 4IS7A 4BG9A 4M1KA 4CNZA 3P1GA 3VTHA 4DQ8A 2Z2ZA 5GMEA 2FC8A 3KUHA 4BDPA 1U2VA 2V8DA 4CD3A 4ZN3A 1S79A 3NCQA 7ICLA 2DFFA 3EMTA 2MGZA 4QW9A 4Q8EA 3OVBA 1YIJN 4YXJA 3HRDD 2Y3YA 3H3OB 4R0EA 1HIWA 3CF5L 2HIYA 4DL6A 2UUTA 5AICA 1DFDA 3EVOA 5AXLA 1MWMA 4OCZA 3CCZA 4DV2F 1Y10A 2YTCA 3U6FA 3CT9A 4C11A 4KLGA 5JICA 1KVKA 1CJVA 1Z4UA 2C2RA 3TR8A 2KHCA 4NLYA 3VAGA 1X5TA 3E9LA 2D4WA 2OPQA 3AAQA 2V2QA 1S7HA 4ZCIA 4J90A 1WF0A 3NE6A 2BW7A 2DH9A 2JEIA 3UKRB 1VQPN 4JKAA 3JS6A 4PY5A 5T7LB 3CMQA 2DKZA 4HI2A 3EUNA 1N6QA 3EXYA 2W40A 3FBCA 1SZPA 1SV4A 4I29A 3Q2TC 3ENVA 3E58A 2U1AA 5HJXA 4V1Ak 1QS4A 3P6YC 3V2UC 1JXEA 2BACA 4X65J 5TKWA 3C8YA 5D0HA 3LWLA 1PYTA 1UAWA 2NXEA 3I56S 1FX4A 5IWAJ 2GNKA 2ZFHA 3HTVA 5DBCA 3G82A 3CMEN 2X1FA 4DG1B 2G8HA 3BGLA 4FYXB 3AD8C 2C3UA 4UOCA 3SCKE 1SS6A 2F8HA 3GOIA 3QYPA 1XS9D 4KX3A 1VQ9S 2DR8A 2PFOA 4V19S 2LU2A 3QATA 4GW6A 3PIOQ 3TARA 3HOTA 2C2DA 2JZ5A 1GX6A 3P38A 1UCVA 2WHEA 3AV9A 4MHVA 3F2CA 4RUCA 2OH2A 1B22A 3CC4N 4RW9B 3BO2A 4FVUA 5BYSA 2RAQA 4O3MA 4ZDNA 2M3DA 1DEJA 2B8PA 3EGWB 4F36A 3NGZA 2KK0A 4ZOSA 3AVMA 2DPJA 1RADB 2UUWA 2VIXA 4L72B 2JC0A 4W4MA 1S6QB 4KAIA 3MD3A 1UVKA 1YVFA 8ICAA 4O3NA 2M8DB 2EEYA 1L7PA 4KFBA 2FJEB 2ZHAA 2YB1A 2QLXA 3FZBA 9ICPA 5EY4A 3QFPA 2ACYA 3KWIA 2PFFB 1RYUA 4O5BA 1DLOA 3VAMA 1WDDA 5DG9A 1AXQA 2QA4G 2AF6A 3LOUA 2HAFA 3OPKA 3W9HA 3QRPA 1H1VA 3H5YA 3ZX2A 2R3VA 1MROB 5AFUH 4WE1A 1LKZA 2FYXA 3DHWC 4JI3F 1Q7LB 2A40A 1UAXA 1JN3A 1FESA 2FSNA 4Q43A 4H0XB 1QVFR 4L76A 2XB2D 1N5QA 1NPKA 4DV1F 3OFFA 5LM7E 4X4TA 2IRUA 3PM9A 2KNJA 2B9EA 2A1BA 2Y0BB 1FDAA 3UQ0A 1SKRA 1GLDG 4AT1B 1D9DA 2QJ3A 2WB4A 3A8KA 1Q3UA 1S48A 3H25A 1WAJA 2BPGA 4GVEA 3SMSA 4B6JA 4HHUA 5I4MA 3AO3A 3HPGA 1ZA1B 4RNOA 2IDOA 1YBUA 5J1EB 4F3MA 3FQLA 5KFRA 4JBCA 4RNFA 1RT2B 5AQQA 4FK0A 4KLOA 1BD6A 3EGZA 4TUSA 3K2PA 3ZEUA 1FRIA 3ZSQA 2FSJA 4W5TA 1REVB 1BNPA 5AQTA 1VRUA 5KFTA 3I87A 2VJ5A 4BREA 4DR1J 1LFWA 1YITS 4B9MA 3CCVN 1IV8A 1C0FA 4OHZA 1AUDA 4P2HA 4JP8A 4KGZB 1D8YA 3PLAA 1PJ7A 5HLFA 4F92B 3CCEN 1N48A 1B43A 1JLFA 1RTJB 1BPDA 2C2KB 3KD5E 2NSBA 3VWSA 5KFBA 4PQUB 4OZJA 3DFEA 2UXBK 3UN2A 1RQNA 2O8FB 2AMCB 3PSIA 2QB0A 3LF0A 3ZZYA 2H3GX 2GOLA 5I3UA 1NSQA 3B9JA 3N4WA 3ADAC 3R9KA 5K8MA 1IBLJ 1D9AA 1Q16B 3ZNJ1 1Q82O 1E6VA 2PYJA 1VSEA 1EXNA 4EYHB 3TR5A 5KFUA 5C24A 3RAMA 1VK0A 1S6UA 3IKMA 2E1PA 3OTBA 3D1OA 2WRMA 4JYAK 3VA0A 2E7VA 4Q8FA 1UT8A 3S8SA 1R8BA 1N32K 3QNOA 4OI4A 4K4YA 4MYUA 4RQ0A 3EE3A 4YB7A 2OUGA 1YJ9S 1IG6A 4YB5A 1WI6A 1LW0B 4FF1A 2QWMA 3TANA 2ZIUA 5FD1A 3K1RB 3KJFB 3K8WA 3W62A 1GMUA 3JPPA 5ETPA 2P9PB 4RQ7A 2NZTA 2R8HA 2FTRA 5J2MB 4ZLNA 4NE9C 4QNLA 3SQIA 2KT5A 3DXMA 3E8OA 1RDBA 2HBQB 1NKCA 4A5AA 4RU2A 3HDSA 1NB7A 2H65B 2ZH8A 1FXDA 4OD0A 4NEZA 5M2PA 2NPFA 2KHDA 2FBVA 3MR5A 5CYMA 4DV1J 2HFZA 2E1MC 3PSPA 1BIUA 1N61A 2X3GA 1V4TA 4LFCF 2M88A 2X6NA 2X1GA 1W9HA 4OYMA 4H5NA 2UXDK 1CPZA 3QYYA 3AVGA 1WNEA 2Z1JA 1AZSB 3M2VA 4ZVGA 1S5ZA 1LVHA 4ILMA 1Y0HA 3SSSA 2MKCA 4O4GA 2IHNA 4CO2A 3A0HU 1R0AA 4B3MJ 1CS4B 3CJCA 3S3OA 1JLQB 2D8CA 3D2EA 3SBGA 1XMOF 2OMOA 3F5TA 2UV8A 1JLCA 4F0HA 2WVBA 3UPFA 4JV0A 1VC0A 2MUTB 1WG4A 4UT4A 2WOMB 1JL2A 3CNHA 5KFCA 3D28A 3VEZA 4YY3F 4WK3A 2YKNB 4DV3F 4HTUA 3DMJA 4E8UA 3MI7X 1C7YA 4FVCA 4LF6J 1PJ5A 1H2VZ 4YD1A 2G2YA 1YDLA 2PMWA 4O8UA 2AXTU 2CRXA 4OL8A 2P51A 3BQ7A 2XMKA 5KG2A 2QA1A 3MN5A 3LDLA 4BR7A 3S7RA 2XY7A 4TXSA 5JXSA 1YJ7A 3EPGA 3RBZA 3NUQA 4PYAA 4RW8A 1GH8A 4JKFA 1I1GA 2VBZA 4Y2XA 1TMMA 3T6BA 3CJ7A 1HKBA 5KGXA 2DNHA 4AHUA 2HGLA 3SAHA 1NSKL 5KG4A 2ZIVB 5CA5A 4RW4A 4H5TA 4IG0B 3J7YI 2YQ1A 4FZVA 3R97A 3UQ2A 1DRGA 3IM9A 3DLBA 1S0MA 3UXPA 3NF8A 1HQ2A 2IM3A 3JSRA 5K8OA 4IXCA 4DUYJ 2D0PA 5DM7Q 3M8YA 4GV6A 3KOOA 1IO2A 5DDRC 2LI6A 3HSGA 1BISA 3LP1A 2W2OP 4B9QA 5B5EU 1RBLA 5ALRA 2Q6CA 3VF2A 2QXLA 1FXRA 4YR3A 2JH3A 3OJUA 2BE2A 4EO8A 3UXOA 1I3AA 4XUSA 1OS5A 3WU2U 4ILHA 3KZBA 4CLYA 2MKHA 5D4BA 4F5PA 2PFUA 1I39A 3FBBA 5LT5A 5D4OA 4N8NA 2OCEA 3THPA 1HR0K 3KUGA 2IM2A 4CLLA 5HQLA 3SQ1A 3P5JA 5KAKA 3AA5X 4N41A 1ZM4A 3SJJA 4OJLA 3P39A 4KBOA 2NRZA 4UZBA 4RQMA 3C5FA 3AM9A 2VFTA 3CJQA 1RYSA 3R5DA 1FDBA 2YQ0A 2WAQC 1RG6A 4LMZA 1RTHB 3NGUA 1AYEA 4ZVEA 1Z2LA 1KTQA 3A8JA 1TUVA 2DXFA 3O44A 2V9KA 4BVPA 1FK9A 1S6PB 4DR2J 1AB8A 4QWAA 1XMOJ 2OYQA 5KRSA 1ZBTA 2P6SA 2J9EA 3DCAA 2OEKA 1R31A 2LBOA 1RCOB 9ICAA 5A8WB 4JI6F 1RT6A 4NXMK 2HDOA 3SV4A 4K50A 5AQPA 2GHWA 1U1QA 1TZ0A 2PD1A 3AEVA 3FNNA 2G0AA 1QAIA 3KLIB 5CD4A 1XTZA 3OTQA 4CF5A 3ZDEA 1F3FA 3O8WA 3QWUA 2YWEA 5IT9O 4OJRA 3M2UA 2QYCA 4WJ3B 1RLDA 1SPBP 4FPBA 4NLCA 3AODA 2YH1A 2QLWA 5A6WA 1T9VA 2KT3A 3C16A 3ZFVA 1TKDA 3MN6A 1Z4OA 3P4UB 4PUOA 1X7VA 2OA8A 1WTBA 2Q6BA 3I56N 2ZJ8A 2E4LA 2IVPA 2I9SA 3AVFA 4TU9A 4QR2A 2MRLA 2V4QA 2FHJD 4P7TA 3J7YU 3AVHA 2X6SA 3KHYA 2WFAA 4IFYA 3BO4A 5CRXA 4ID8A 2WBRA 1VQ9N 2DR5A 4ILJA 1VSLA 4NCGB 4CZIA 3NVZA 2M0GB 1VBZA 1ZQNA 5KFXA 5JJBA 4F4AA 2IIHA 2W42A 2RF2B 4WU2A 4WQ5A 2PSZA 1RAFB 1OPIA 3J7YP 4FXVA 5DB7A 4WTOB 4AXIA 2IVNA 1YVUA 5FPDA 1KQSM 2G09A 9ICOA 1UWBB 3HI0A 2RHFA 3K0JA 1SBRA 4ZTFA 5KFOA 4BRHA 3GBTA 1U0HB 3CCRS 2F77X 4KRFA 4QWEA 4CHPA 3E2EA 4DV6J 4WCEQ 2VPWB 1AQ6A 3O5BA 3HM9A 1ILYA 2UUBF 2KOBA 4Y2JA 3VEYA 4FE3A 3C6TB 5IT9Y 1BE4A 1X4HA 1LKYA 2LQBA 5JVHQ 2QARA 4P75A 2JVOA 3O6WA 5ALUA 4X4QA 3FRYA 1ITPA 1SXLA 3WC2A 3C6UA 3D66A 4DFPA 2XS7A 2E8NA 2HOEA 2BM0A 3GV5B 4F02A 4PKGA 2Y9HA 2E2OA 1SV5B 3NGYA 4KHYA 5ALDA 2OHDA 2CDRB 4F4WA 3C1YA 2YNIA 4C0ZA 1TKZB 3CQXA 4Z6CA 3LAKA 2PFQA 1PG5B 4KJIA 1A5VA 1R6VA 2UU9K 2APOA 2YHBA 2BX6A 3POTA 4BC4A 5B09A 4CBUA 3KKFA 3E9OA 1HNWF 2PE8A 4PHEA 4ISGA 5DGBA 3S01A 6FD1A 1GOBA 2Q3PA 2D5RA 4PKDB 4Z6FA 1K47A 3CDAA 4M5DB 3BGRA 3EDRB 3VQ7A 3MAQA 8ICVA 5DB8A 3RUBL 4YG2A 2B3TB 5HAOA 4M5HA 4CJEA 1FE4A 5ALXA 4IH7A 3UDCA 3T19A 3EYZA 4BRFA 1B99A 1RXWA 2CZVC 3SMVA 4Q44A 2H5JB 3Q24A 1GLFO 4ISFA 3WNFA 3KK3A 2COLA 3M32A 1TFYA 1X9MA 5JS2A 3HFZB 1PILA 4FYWB 4CLTA 1XQSC 3QGIA 5ETVA 4DR4K 3TUPA 4B3SK 3EEQA 3I0SB 2QA4S 3C2MA 2H5EA 4KLQA 1VISA 1P27B 5AKIA 1Y00A 1RBUA 3OR2B 1YITN 4OHVA 2HMXA 4C4RA 2QXFA 3S6EA 1UPMB 2MDAA 4MFCA 4GRSA 2W8LA 1NBEB 9ICSA 1PK3A 5IM0B 1IKVA 3SFUA 4HWIA 5AE2A 2QLTA 4CLPA 1VOMA 4ECRA 2W41A 3QT7A 4KH0B 2DCLA 4I2AA 2ZWHA 4DR6K 2V8HA 3RFAA 2F3NA 5DMRA 4ZIWA 3HSDA 4BXOA 2RKIA 3CJ3A 3L2QA 2IYIA 5C42B 3NBPB 3OR1B 3PIPQ 2L41A 1VLYA 1ZH5A 1WACA 4IFVA 5L8RC 1J5OB 5DM6Q 5U47A 3PIOL 4K8ZA 4KPCA 3T1AA 1TUWA 3FEYB 2A42A 4H4MB 3IFRA 2ZE2A 3PX4A 2F1IA 4CJPA 3CCTA 4DQIA 5JRTA 1TP7A 4OYWA 1FKAF 1VAZA 3TJ8A 4KLEA 2H4YB 4OYOA 2OSRA 3G10A 1HPZB 5ALIA 3JQKA 1TKTA 4OHXA 4QYRA 5LMUF 3WQPA 1RACB 3DOLB 5IIOA 3M1VB 2NS1B 2F8LA 1TR0A 2N82B 1YJ9N 3K5NA 1F5SA 4O4RA 4Y2CA 1YRTA 5A2QY 3HJVA 1FERA 3AB4B 4OPJA 1H38A 2ESEA 4K4HA 2NR0A 1JMSA 2KSOA 4DHVA 2AA4A 1WOQA 4LVNP 3CGIA 3G9CA 1WCNA 1W26A 4YOVA 3HHLA 4JI0J 3LVVA 2ZJPQ 3WX4A 4BJQA 4ZLLA 3UN5A 4JD2B 4LF9F 1N5WA 5KQDA 2AP6A 1SQKA 2CGJA 4KH6A 2JHEA 9ICTA 1DTQA 2VFVA 3HSCA 4UUWA 2OWOA 2BCUA 4GKKK 1YJRA 2MQLA 5IC6B 1IBMK 1QQOA 3JAMY 3PY8A 4UBCA 4OZ2A 3NAEA 5HRSA 3K7RA 2C2OB 3J7Z5 3NEKA 4OKKA 3H5UA 4X65K 2CNLB 2Z57B 5CCLA 2HWIA 3AXKA 5J1NA 9ICFA 3G86A 2OLWA 5AQLA 3DLGB 2HHUA 1NK6A 3R3LA 5IWAK 3KK2B 3IG5A 1HUOA 3HBTA 4HCBA 3KLVA 4A46A 1NMDA 4YDUC 3ZX3A 3I1YA 2BJ8A 4M3ZA 4WYLA 4H03B 5GVQA 4DUZF 1WC3A 1CZAN 2CQDA 4DL7A 3LDAA 5I42A 2H3ZA 1RWNB 2LXUA 5IIJA 5F8GA 3SR6A 3VQSA 2FF6A 4DWIA 4IH5A 3THXB 5SZTA 3MDAA 1G7CB 3MDFA 2G0IA 4FL9A 2BKPA 4R5PB 1ZBUA 1Z00A 4YMMA 1FD2A 3ENBA 3SBMA 4YB1P 2W8KA 8ICKA 3I4HX 3W7BA 1VRTA 4ZHRA 3MGHA 3T3FA 1MWQA 1S9GB 2XMMA 1RBTA 2VFRA 4L3NA 5E3PA 2VL1A 3F2BA 1ZQPA 3MX2A 2C2ZB 2ZBQA 3VERA 2UVRA 3BZCA 1MA7A 3O9SA 3NVKA 3EL2A 1HBMB 3TTDA 2WAQF 1XN9A 1HBUB 1RHUB 1F0MA 2F8KA 3QFHA 3W2WA 2M4MA 3IRXB 4DS4A 2CJKA 2P9NA 1SJ1A 1KONA 2D3ZA 4PWDA 2PIIA 4EIAA 3T6JA 4YMOA 4TUQA 4N76A 4WWSA 1VRQC 1RDUA 5A0YA 1JCGA 5LMUJ 3CJKB 5HROA 3LVWA 1VR6A 4ACOA 2CPHA 3JXOA 2MB0B 5BR8F 2MMYA 4ECVA 2C2MB 5DDPC 2GVZB 4DV2K 3TADA 2J5AA 4CF2A 5TZVA 1S1XB 2ALZA 5J2DA 1VHXA 1WSIA 2WBMA 1DGKN 2GW8A 1NOYA 2D3DA 3QUBA 2O3DA 2B6GA 3U1MA 3RB0A 4NL5A 3SAFA 2FVRA 3ZZZA 2L9NA 2DFEA 3AOBA 1RZTA 1JK9B 3LP0B 4DL4A 1MDUB 3I4PA 3GIMA 3VGSA 2HIQA 2HK3A 1N34F 2E7XA 1NB2A 2ERRA 1RTZA 2IIRA 3N5FA 3CB4A 4KY3A 2UVUA 3IRUA 1ZQGA 3OYEA 2VANA 8ICQA 3MGVA 4KITB 2XMTA 1T3QA 1PCAA 1XHZA 2KG5A 2DR7A 4A48A 3T69A 2V6AA 3DLKA 1NNDA 2XZTB 4O0NA 2WBNA 2ZQBA 4RW7B 1C1CB 4JV5F 4FBTA 4HI1A 4JI1J 1TL5A 2CPRA 4YVZA 1RABB 3GFKB 4GKJF 3LQVA 2NO5A 3DRSB 1L8LA 4DUZJ 3VEWA 4NOHA 5J0UA 4NY8A 2H3IA 3PYFA 4OX9F 5HMXA 5BOMA 2IOFK 2WTUA 1V9PA 3NS7B 1U1KA 4B9LA 1JLAB 4C80A 1MWYA 3WXMB 4ITSA 3J7ZO 4WQ5C 3M6XA 4P72A 4B1ZA 2CPDA 2KG0A 2F3JA 1VQKS 3KKAA 4XQ8A 2LFVA 4DV0F 3KVGA 1YAGA 2KFZA 3SUPA 3ISDA 2PMZC 2DGZA 1W2IA 1XNRF 1ZQXA 3ZDBA 3OL6A 3RJEA 1KQKA 4FVMA 4DTOA 2Y9TA 3EZ5A 4HACB 4ID1A 3FQKA 3PRVA 1FKPA 3B8AX 5ALMA 4ICLA 3CC7S 1F5AA 2DIVA 2HAIA 3Q0AA 1NMEB 2HMPA 1H0HB 1VK3A 1SXDA 3M30B 4OLOA 2P8IA 1WNSA 4JI3K 4FLVA 1HW8A 2CQPA 4FF2A 1PK1B 3EM1A 2ATCB 1N8RT 5BPLA 2RPIA 3L3CA 3UMBA 2ZZNA 2Q2RA 1JLBA 1QSSA 1HNIA 3RRHA 1PAEX 4I64A 5CYQB 5DM7L 3UO0A 4LBPA 3E01A 1ZBSA 2AW0A 5AJ3F 4FYYB 3RJJA 3MFIA 4MO4A 1WSJA 4FFDA 5H9FK 5GAGI 3HHDA 1QHAA 2EFGA 4OYIA 4M0AA 2VDHA 3CCRN 3EXCX 4DLEA 4O5CA 4LF8J 1HKGA 4Z4EA 2IJNA 4NZ0A 4LIWA 1VQ8S 1LW2A 3V1OA 4NXZA 3D2FB 4CF9A 3M6ZA 1Y64A 4URQU 1TVAA 1RDWX 3LH2S 2Q0RA 2FE9A 3U02A 4ES2A 3U9ZA 4M5JA 3FE1A 3NL0A 4HTLA 1T9WA 2QN6B 3R9PA 2ZM6J 1DK3A 2ILYA 3A8IA 3E66A 1L3VA 2V4JA 3RBDA 4ZVFA 1P1TA 3C7NA 5ALNA 3BS9A 3UI3A 3RB4A 1RAIB 4MIAA 1C0UA 3H2LA 2R7XA 4U7UK 3RMCA 2O4IA 4AYBD 2J0SD 3MEEB 4R66A 5KNIA 3RSEB 1WELA 2A0FB 2OKQA 5KG5A 1OWXA 5DDOC 2MZJA 5HMLA 4A8FA 1RBAA 5LSLA 2JWNA 2QTWA 1NHUA 4ETXA 3W1YC 2DITA 2ZBIA 4AFFA 2XO6A 3D5MA 1X4BA 1FO4A 4CZGA 2MZSA 1L8OA 2IBKA 3BH7B 4DV0J 4K4UA 4IQXA 2XVTA 4UAYA 4P73A 3T1HJ 5KFWA 2PFPA 2RRAA 3BR9A 1XNRJ 4OV1A 1X9WA 1T0TV 1RT1A 3MMAB 4O3SA 1EAYC 2R42A 4I7FB 3M6GA 2WVFA 1MA9B 1Y5LB 4IJAA 3PNIA 4MLEA 2NZ4A 4FM1A 5HNKA 4TU8A 4JI4J 2K7KA 2QA4N 3Q8LA 1H98A 2E8AA 3UXNA 4ID5B 4WZMA 2BZ2A 4QAGA 5HHIA 1GMWD 1GLJO 3OW2R 3AU2A 3CJ5A 3CMAS 2QGFB 2K3KA 3NF6A 4FJKA 2J0XA 3IM8A 2CQ4A 4FBUA 3H0PA 5IILA 2RUSA 1QQNA 1E6YA 4M47A 3N4MB 3TZYA 2ZUCA 3BH6B 1Z4NA 2FUG9 3AB2B 4CZCA 3VQPA 3SMPA 1KKHA 3D3BJ 1OMSA 3FSYA 4B3TJ 3HOSA 3PTWA 4LFCK 3H6EA 4QZDA 2XLKA 5AJ3J 3MGIA 3M2RB 5HR7A 2QKBA 4B1WB 1CBKA 1CSJA 1F9EB 4JK7A 2WONA 4IRKA 2XTJP 3ONQA 3ISZA 5T7LA 4F4ZA 5E3CA 3KG4A 4ZCMA 5EE1A 3R1LA 1TVRB 2B7BB 1KAYA 3QGPA 1ZD5A 3F73A 1S1UB 3IMQJ 3PR4A 3OHBA 1RNHA 4KTZA 5KL8B 9ICIA 1D8ZA 2BUPA 3K9JA 1XMOK 2HURA 1NDCA 3Q8QB 5GAGP 3ETLA 4C98A 1U24A 4F91B 5FLXO 4NXNJ 3VR1A 3QB0A 4WCEL 3AO2A 4DG1A 2F4FA 4DKWA 2M7SA 4YY3K 3MM6A 4OVLA 3BPDA 2KLAA 2ETJA 1WTFA 4DV3K 1Z1BA 5HOOA 5M1PA 2JLGA 1RT7B 1EXQA 4ZH4A 4O3RA 1NK5A 2G06A 2YHAA 4KLJA 3M1FA 5D15A 3AY9A 2AKWB 3U7JA 2YWGA 1FJGF 2JH7A 4TNOA 3BEXA 3FFKB 1AFIA 2IOCA 4UB6U 4JK8A 4FWQA 4ZVSB 2KM8C 4CO5A 2Z56B 1FNOA 3LP3A 3THWA 3M5RA 2YNGA 5EGYA 4A8XA 3AO5A 2HHHK 1ZQUA 4DQSA 4O5KA 3HVTA 2OD6A 2UUAJ 4FXDA 3AN1A 4RUAA 1NK7A 1U1RA 1NLVA 3ZD9A 5L1MA 1C0TB 3NRZA 4E0DA 3MEGB 2XULA 2CWKA 4LF7J 4F72A 4DPXA 3CJRA 2VQFJ 4OJ5A 4US9A 3N6NA 2MA1A 3TOQA 4AD6A 2C2EA 3JPSA 5CY4A 1JALA 2VFUA 1M6YA 1GLAG 2KT2A 1MROA 4U7BA 2Y9UA 3WQUA 4F5RA 2YX6A 3RAQA 3L2WA 4PHDA 1UJ4A 3EUB2 3TADC 4LQ9A 2BGGA 5A8KA 4KTWA 2WF9A 2LDIA 3THYA 1QCKA 4DOCA 3P8BB 1U48A 4W92B 5DG7A 2D0OA 3AVLA 4K4GA 2F4VJ 1A5XA 4K0KK 4JKDA 4KX5A 1O08A 5IIMA 2G8KA 5KAFU 1HHSA 2PO4A 4C11B 3FUYA 2ZZMA 4K4IA 1Z1ZA 1CJVB 2MXYA 2Z1GA 3SQ4A 3HSZA 5FRMA 4B8CA 2WVDA 4KO0B 3ASMA 3PIPL 1TL7A 2OPQB 2EX3A 2ZH3A 5DM6L 1KOHA 3OV7A 5ETOA 1CLFA 1NWKA 2EFVA 2RLTA 4UF4A 1KXPA 1U2CA 1V5IB 4F04B 1REVA 4OLBA 1UFKA 4OPHA 2HZVA 4M3WA 2Y8WA 2VG7B 3FCWA 2K1RA 2YX4A 3AO4A 4JI5F 3MPUB 1T9XA 5F0UA 2QK9A 1WEZA 5C2GA 1RHKB 4JI6K 3MEDB 3D9BA 1OY8A 2P5VA 2QWLA 2KYZA 3N97B 3VQAA 2HRYA 4CJWA 1F9HA 1KSPA 2ZH2A 1NPPA 2PMZF 4G1PA 5DQIA 1VS3A 3S9HA 5GAEU 3RGIA 3HMJG 3OTDA 3TX8A 2YNHA 4PQUA 1TUUA 1XMQF 3NVYA 2D1KA 1QSYA 3M9OB 4BC7A 4DR5F 3KKAC 4BRIA 2KTQA 4BBYA 3T7ZA 2ZJPL 4KKOB 4J9SA 4M9HA 4DUTA 4F5NA 4LC9B 5GAEP 3G87A 1X4EA 2KICA 2RVJA 2EG1A 2MPUA 4P2SA 2HOFA 4YCXA 4CO0A 1IJFB 4CHOA 2ZITA 4NLKA 2VG6B 3SLCA 4CRXA 4PZOA 4UZCA 1UVMA 4JNEA 3H0MB 1N2XA 4Z37A 2QWRA 1M1GA 3TUIC 4H0PA 1WC6A 4WQ4A 1D8LA 1M1KT 1LW0A 4A8KA 3GZFA 3G0ZA 1RP5A 2F7VA 1YTUA 2Z0GA 5KFPA 4EU0A 1ED1A 3NH2A 2ASDA 7ICPA 4FWLA 3B82A 3MOZA 2HNZA 1DLOB 5J2MA 3MR3A 1X4DA 2BCRA 4DX6A 1G1XA 3NGRA 2FHJA 2D0BA 5AKJA 4W90B 4IRCA 1VQKN 2I9GA 1U6BA 2JV3A 1Y3JA 5ALYA 1HRHA 2FGCA 4ERDA 4P4PA 2L08A 4WE1B 3BV8A 2VIHA 2YY6A 4C97A 1ZPVA 3NVVA 1K8AT 2BPCA 3KWGA 2UUBK 5ALKA 3FEXB 4FZNA 1RWVB 1SKWA 4ZP9A 1FEZA 4PL7A 3K1ZA 1I94J 3DM2A 2Z1IA 1IBKF 2JFDA 4LF2A 1S6OA 3IDHA 1IUJA 3CC7N 2XICA 4QIFA 1WOPA 3U3YA 1K9MT 2QFJA 4C7YA 4RU9A 3WXJA 1O13A 4I2BA 1NEEA 2VKZG 3BF4A 4CEEA 4CE9A 2CPFA 3O3HA 2L9WA 1BCOA 4X2BA 4I2PB 1JNRB 4LFBJ 4M5LA 5JMNA 2KJVA 2KVQE 4JI5J 2B6AB 3AVCA 3P83D 1HNWK 2XG8A 3NAHA 1GLBG 4ELVA 1UWAA 3BJYA 5HK4A 3CPEA 5E41A 3W66A 5LL6d 1N36F 5LMNJ 2YTUA 2KKZA 1WOSA 2AJ4A 2CRLA 3EZUA 2V4RA 1KBUA 3Q8MA 2G07A 2YQ3A 3C0BA 1GNKA 2YMMA 3MD1A 4OQJA 4RPYA 2PYLA 4PZNA 3K57A 5AI4A 1D4XA 3HD1A 4RBUA 1M5HA 1CC8A 5HVFA 4PKIA 2XLIA 3R5CA 4EP4A 5ALFA 4NM1A 2VICA 2J8SA 5H9EJ 1VQ8N 1NJZA 2FGOA 3D6HB 4F3QA 1QQ7A 4DL3A 4JK9A 2ZVIA 4IQUA 5DQHA 3WNEA 1A77A 4A8WA 1GTHA 3KBBA 2FPLA 2FLPA 2ZIVA 4DZ6A 4IG0A 3H1VX 2QB0B 2EFNA 2HQFA 4KGVB 3U9DA 2ITMA 2WHOA 5KT6A 4X4RA 2WC9A 4JKGB 2EH9A 5AQMA 1B9DA 4FK2A 2ZUDA 5DGAA 4DFKA 1U8SA 3DXKB 2VJ4A 4RNMA 4C2MA 2DYAA 1GLCG 3B8HA 4MQ3A 2C3MA 2DRAA 2J7KA 4ZPAA 1GO3F 3I5AA 2OZSA 1K5OA 4CLSA 3W0LA 4M7YA 5BRHA 3OY9A 4DTRA 4N5SA 3C15B 3NF9A 5DDMA 2CVIA 4AQYJ 2O01C 2K60A 2WMMA 4WF9Q 3PX6A 4I1TA 3PG9A 5FPMA 5AI0A 5FRNA 3DXMB 2AX0A 2HFNA 4FO6A 5IZHA 2ZXIA 5J0PA 3J80U 4PG4A 1VJWA 3GDQA 2WZ1A 4WFYA 4U9RA 5LMUK 4BGDA 3HCXA 1IKXA 2QYGA 4ZVRB 4KH4A 5CYMB 1RAJA 4O0IA 4YB6A 1XR5A 3EJMA 3DLEA 4KGKA 4Q5VA 4GXKA 3LPTA 3AA2A 5KG6A 2GS8A 4B08A 2D3O1 1M90T 2E5LF 3J8AA 2QM1A 2GHVC 2V63A 3ZLJA 5DB9A 4Y34A 4ZVUB 3CMAN 3M2VB 4F93B 5ALZA 1S6PA 2Q0UA 2P5OA 1CC7A 4H0TB 4MO5A 2A18A 1Q8BA 3T5HA 1PYSB 1ZXIA 3L2UA 4KPYA 2KJ5A 2KVSA 4LF9K 1FRLA 3JS9A 4FM0A 1Z3EB 2RQCA 2WW4A 2F63A 4OFZA 2QL9B 1P6TA 4BE2A 2FD2A 3MXMA 2W4PA 2B4VA 3KLIA 1XC3A 4XIUA 3NRBA 3R2DJ 2YKAA 4BACA 2XCAA 3DMJB 1SC1B 3NF7A 3AVAA 5KT4A 1K1QA 4USTA 4WKRA 3VVUA 9ICGA