3HP6A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus f710y mutant bound to g:t mismatch
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
579
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 206
structure length 579
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hp6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hp6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hp6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hp6A01
4ECXA 2WOMA 4F5PA 4IQTA 4IBNA 3MDAA 4RQ5A 1CUKA 4CHOA 4CJPA 1XSLA 2HHUA 1H38A 2YNFA 2EHGA 4I29A 4E7JA 2DFEA 5J2AA 1EX4A 2IGIA 2Z1JA 1BI4A 3PW5A 9ICBA 4FJ7A 5IIOA 4ED0A 5CR0A 3AVMA 4JK1A 9ICQA 1TVRA 4DTNA 3V4IA 3ZDEA 3TAQA 1HUZA 2DY4A 4UB3A 3M8PA 4UB1A 3Q8PB 5J0SA 4KV8A 3HSTB 1NK6A 2PXIA 5KGXA 3C2MA 2J6SA 5D49A 1ZQNA 5EU7A 4BDYA 5J1EA 3M9OB 4KTZA 4FJLA 1TFRA 5FRMA 3HT3A 3H4BA 1J54A 3SCXA 4Y1CA 2G8HA 4KHYA 4J9RA 1S0NA 3PNCA 3C6UA 1W0HA 5DQIA 1JMSA 1B92A 4P4PA 4IKFA 4HYKA 4KB1A 1ZQVA 1LB2B 1NOYA 1S1VA 4O3SA 3TWHA 1JIHA 5CWRA 1NOZA 4ZTJA 3Q8QB 1QQCA 1NJYA 1BGXT 4AILC 3CFRA 2AGPA 5HLFA 3RAXA 4ZTFA 4BDZA 4O3RA 1SL0A 4ED8A 4KKOA 3K2PA 8ICKA 4ZH4A 2GV9A 2QK9A 1JKHA 3PVXA 4DSLA 5DGAA 3SI8A 4OVLA 1FKOA 1JXLA 2F8SA 4O44A 4DFPA 4MFFA 4E3SA 4YCXA 9ICWA 5JUMA 3KKSA 3QO9A 4IRCA 2BPGA 3O3GA 4PWDA 4OPKA 5KG0A 1WSIA 2Z1HA 5FRNA 5IINA 3V7LA 4FLYA 3M8QA 4C8MA 7ICPA 4QWAA 1XWLA 5BOMA 4CE9A 5JS2A 3MAQA 4CK2A 2BQRA 4KB0A 4KI4A 3AA3A 3V9ZA 3VQQA 4YNQA 3AVCA 2HW3A 1B9DA 1QSSA 1RBTA 5L1JA 3AVNA 3ZSQA 1ZETA 2PY5A 2X6SA 3KJVA 2YNIA 1BPBA 4KLSA 1ZQFA 3RB4A 3IRXA 3OYAA 1RBRA 3MGIA 4XQ8A 3K58A 4KLDA 5J2KA 4CJUA 3HW8A 4YR0A 5J0TA 1XSPA 3OYEA 1CZ9A 3OYBA 4I2BA 4RW4A 1PZNA 2HVHA 3KLGA 3RR7A 1S97A 4JWNA 5KRTA 1RDCA 3MR6A 4FJHA 4QZ9A 2UVUA 3K5LA 4F5QA 1ZQRA 4M3ZA 5KFPA 3ZSWA 2JZBA 4CJLA 4I9LA 2P1JA 2J6TA 3S3NA 2BQ3A 2JEGA 2HHQA 1BPZA 1RNHA 1ZQKA 1EKEA 4OGCA 4QWCA 3OYFA 5KT3A 4TUQA 3ZT3A 4DL7A 5KFEA 1RBVA 2XGPA 1FXXA 2EX3A 1QHTA 3K5MA 1S0MA 1JLGA 1ZBHA 1C0TA 3KTQA 3TARA 4B9UA 3C21A 4Z4IA 3H7IA 3N97B 5KFAA 4DU1A 2BDPA 4AHVA 4CGFA 1IH7A 1JLAA 3DRSA 1ZQIA 4F4ZA 3QEBZ 9ICRA 4W5TA 3L2VA 3I0SA 4YD2A 3M8SA 2ISPA 4N56A 3PO4A 2FBYA 4LH5A 2ZTCA 3OYCA 4CJQA 4FJ9A 4O3OA 3QEIA 2AU0A 3KK2A 1KVBA 4ECTA 2V4RA 3RH5A 2IS3A 4KHNA 4LSNA 1JLEA 1TL1A 1S9GA 2HVIA 3L2UA 4ECUA 4QZAA 3NF6A 3WNHA 5EWEA 4EP5A 2ZUBA 2IHNA 1ZQLA 2D5RA 1DGSA 3OS1A 3AA4A 4CEAA 1NJWA 1ZQWA 2FBXA 4GXKA 3D0PA 1BPEA 5DB9A 1RXWA 3PY8A 2ETJA 8ICVA 3ZT0A 4F2RA 1XI1A 3K75D 3T5LA 4B9MA 9ICNA 1T03A 4R65A 3ZDAA 4G3IA 4F4YA 3E2EA 1SKWA 1WN7A 3S3MA 3FDSA 1BIUA 3ZT4A 1TV6A 2NRZA 3H8WA 1D8LA 4QWBA 4Z6EA 2IBKA 4CJEA 3O3HA 4NLGA 1ZQUA 4RG8A 4B9NA 3AO2A 4B9TA 4K8XA 3NF9A 4QZFA 2F96A 1RCHA 3TR8A 3RWUA 4ECSA 4B9SA 5HMLA 3ZSXA 3F9KA 5HMMA 4F93B 4DG1A 5J29A 1VSHA 4CFBA 5L1IA 1WSEA 2E6LA 2RKIA 5KI6A 2P5OA 2XRIA 5D46A 1UWBA 4CK3A 7ICNA 1NKEA 4YMNA 4KLGA 1Z00B 2ZTDA 3OJSA 4I2GA 1WSHA 2AGQA 1IM4A 1YTUA 1S0OA 4ID1A 4NM2A 2BQUA 1NK7A 3GV8B 7ICJA 1C1AA 3JPRA 1ZQGA 4M9JA 2FPKA 1XHXA 2XY6A 4CJFA 5CYMA 1NK0A 3LDAA 4QZCA 2JEIA 2XCPA 5HBMA 4FLZA 2YNGA 3UXPA 1VSEA 2BCSA 1IO2A 4KLTA 4E7HA 4FK4A 4Z6FA 4RPXA 4TUSA 4JUZA 4CHQA 1J9AA 4FLXA 3LPTA 4ED1A 3TFSA 1S77D 1F21A 5CJ7A 5DQGA 5J2DA 2VG7A 4M3YA 3P5JA 4FJXA 3HWTA 4G1QA 2OA8A 4C8OA 3C2KA 2GBZA 4KLEA 2F1HA 1TKXA 4ECQA 7ICHA 2OWOA 4IQWA 4MF2A 3LDSA 4RQ6A 3Q8SB 3SZ2A 2M9NA 5KFZA 1WSJA 4DSKA 5DBAA 1CLQA 3RJIA 3QZ8A 1BIZA 1TAUA 1KFTA 3T5KA 4KN7A 3VQPA 3GIJA 1S0VA 2XC9A 2A1RA 4CJ5A 2DFHA 2LSNA 3TI0A 1YT3A 3RR8A 3TAEA 2GWSA 3VQ6A 7ICTA 1D8YA 1DLOA 1V9PA 3GQCA 3L8BA 4J9OA 3C2LA 3ZT2A 3VQ5A 3N4MB 2PFOA 3NGYA 4LVSA 1X2IA 1K6YA 7ICEA 3LAKA 3SQ0A 4YVZA 3DOLA 1ZQEA 4Z4CA 2NRXA 3AVIA 4IG0A 1ASVA 4R66A 1ZJMA 5J2HA 2ZJ8A 1S1WA 4B9LA 4DMNA 2NUBA 3OSNA 3V1QA 3H4DA 4I2HA 2IC3A 5J2JA 3OHAA 4I27A 5KFDA 5J2QA 2QKBA 5DB7A 2BE2A 4W5NA 1ITGA 3JPSA 3KIOA 3OYGA 1YVUA 4QW8A 4Z4HA 3T3FA 9ICUA 4DTXA 4YD1A 8ICXA 5KFQA 3LP2A 8ICPA 1ZQCA 4F92B 3JYTA 5L9XA 1RYRA 2R8KA 4M9LA 4KHUA 3M9MB 2IA6A 3E01A 3VQ8A 4RUAA 3QE9Y 5J0RA 5KFFA 1ZBFA 3CFPA 5KFVA 4JS4A 4RW9A 4CF9A 4CEZA 1G15A 4CHNA 3C23A 4MFBA 4KREA 4DOAA 9ICHA 4QZGA 4QWDA 3OYKA 5J0YA 1D9DA 3U6FA 4B9VA 5J2EA 4I2DA 2NRWA 3EW9A 1RTDA 3BQTA 4J9NA 2P51A 3QERA 3AVJA 1X9WA 2BCRA 1WCNA 4NYFA 2I9GA 3T5HA 3RJGA 4CF1A 4QZ8A 3KD1E 2G8KA 4DS4A 2R8JA 4CIGA 3LZJA 1T7PA 4FM1A 2HMIA 2BKEA 4MFCA 5KFNA 3OS0A 1L5UA 1Y97A 1KLMA 3PUFA 1RT2A 4KHQA 2VWKA 3K59A 1KFSA 3PMNA 3C1YA 2AGOA 4O4GA 8ICUA 1TK0A 3AO1A 5L1KA 1U04A 1XU4A 4BWJA 4M9NA 4Z4FA 2MAXA 4ELTA 3NH0A 7ICRA 1HJRA 4K8ZA 3ZD9A 2B5JA 3AA2A 4UBCA 1S1TA 3QINA 2PFPA 4AH9A 2MUTA 3SYZA 2FMSA 4P4OA 4I2IA 1HQUA 4DSIA 3ZSZA 4DQRA 3TAMA 2OYQA 3S9HA 4GC7A 2C2EA 8ICOA 1U4BA 3KHGA 2JEFA 4FJIA 3DLBA 3ITHA 4YR3A 2BCVA 3SUOA 4E1NA 3A2FA 2BHNA 4NYNA 4F5RA 4X5VA 8ICSA 3GDXA 4NCAA 2BCQA 4Q43A 2B4JA 4QZBA 3ISNC 4CGHA 5C24A 3ISCA 1TVAA 4PQUA 4GVMA 1ZBIA 1A76A 5KT7A 3JSMA 1A77A 3PX0A 2ASLA 4AHCA 5DLGA 4CGIA 1FKPA 4DQIA 3IS9A 3PR4A 3OY9A 1Z00A 1JXBA 1EXNA 4RPYA 3P1GA 4FBUA 4O5KA 4FLUA 3PW0A 4ECRA 1XC9A 5KFIA 4O9MA 4QCLA 1JL1A 4NLNA 1B43A 5KGWA 1AROP 4J9MA 2ASJA 1QSYA 3AUOA 4QZEA 2R8HA 4ED6A 3Q8RB 1VRTA 3QEWA 4NLZA 5KG1A 4CJKA 3RMDA 2LYHA 3ZD8A 3CG7A 4JLHA 5HHHA 1S10A 3EY1A 1HUOA 3AVAA 3MR3A 2IDOA 4R8UA 3QZ7A 2VWJA 1KVAA 4RT3A 3KK3A 4N41A 1JL2A 2HHWA 1T05A 2W9MA 1BISA 1UA1A 4Z6DA 4LY7A 2W9CB 3UQ2A 4FM0A 3V9WA 4DTOA 3EPGA 5KG7A 2VA8A 3B0YA 3VQ7A 4CJ4A 3NF8A 3SQ1A 1HYSA 3DLKA 2Q3SA 4YP3A 3KLEA 1Z3EB 3ALYA 4K4IA 1RBUA 4YFKA 4Q45A 5L1LA 2VG6A 4DFKA 2YV0X 4UB2A 4RW7A 4KFBA 2V4QA 4KLFA 2FLPA 1VSMA 8ICCA 3OYIA 3C95A 2RDJA 1HMVA 4EBDA 2FPMA 4CFDA 1IKVA 2OPPA 5KFOA 2X6NA 2ZUCA 1ZYQA 4F2SA 4KN4A 2ITGA 1S9FA 3ETLA 5HRSA 5C42A 4DL2A 8ICJA 4H4MA 5SWMA 3HM9A 1VSLA 4M0AA 3HVTA 4HTUA 3UQ0A 1TV9A 5HRRA 8ICAA 2PYLA 2XY5A 5KFCA 1GOCA 2RPIA 4EYIB 4GXIA 3VA3A 2BANA 3HL8A 4E7KA 3SI6A 5KFLA 5DKWA 1JLCA 1C7YA 1VSIA 1KFDA 5KT4A 3OSPA 1ZQYA 3QNOA 4DFJA 2O4IA 4DO9A 4JWMA 2E6MA 3PX4A 3G6VA 3UXOA 2BPCA 1DOQA 1NKCA 3MXJA 4F4XA 4PHAA 3ZSVA 2OPQA 3PO5A 3JPNA 9ICEA 4CF0A 1RBSA 4I2JA 4PHPA 1S1XA 3SJJA 3TQ1A 8ICLA 4Z0UA 4YQWA 3EWAA 1SL2A 4DTRA 4FJ8A 1S5JA 4O3NA 1TKDA 3OYMA 5DDMA 2C22A 2RDIA 1MQ3A 4CJRA 1NK8A 4WE1A 3UPQA 1JX4A 5I42A 3Q8KA 2FMQA 3TANA 9ICKA 4I2AA 4J9SA 1RT3A 5DK5A 3LWLA 4CHZA 3G10A 5KRSA 4FO6A 1UT5A 4CHYA 3T5JA 3KHRA 3PV8A 1HNVA 4M2YA 4FLVA 1IKWA 1C0UA 1XSNA 1GOAA 4R64A 4FK2A 4FS1A 1T8EA 3HX0A 3AO5A 5J2GA 3AV9A 2WONA 8ICMA 2Z1IA 2F8TA 2HB5A 1JN3A 4CIFA 3GIMA 3V1OA 3ZSOA 3MBYA 2QXFA 4B08A 2B6AA 2W8KA 3MDCA 4OLBA 4F50A 2X78A 2RF2A 2F1JA 1HNIA 1LW2A 3M8RA 4H4OA 1RTJA 3OYLA 5JS1A 1ZQZA 3OJUA 3Q8MA 5DGBA 1IKXA 3V9XA 4I9QA 5DBBA 3MFIA 5DG7A 4YFUA 4M9HA 3RBEA 3NTUA 2W9AA 5FDLA 4FJ5A 2A1SA 4M41A 2G8VA 3CFOA 4FLWA 1ZQMA 5J2NA 4MEYA 4RPZA 2FBTA 3P83D 4J9QA 4F3TA 5DDYA 3QNNA 4DF8A 5CA7A 5HRPA 2YHAA 3OYHA 4IR1A 1C6VA 1K1QA 2I1QA 4CERA 2Y1JA 5J2IA 4DF4A 5HP1A 5J2PA 5DMRA 5FROA 2HHXA 1BPYA 3LAMA 4KHWA 2DPJA 3K4GA 3L3UA 2HHVA 4CGJA 3TAGA 2IAJA 4BXOB 3DRPA 1ASUA 3GIIA 5D4BA 5J0XA 5IIJA 4BACA 3RB3A 3NGIA 1RT7A 2W9CA 4DLGA 4JV0A 1MSWD 1WAJA 3KLHA 3ZCMA 1ZQAA 3RH6A 4C8KA 4KI6A 1SV5A 3QEAZ 2A1JA 5KT6A 3PW2A 4DTPA 1NKBA 2DFFA 4LH4A 4ECVA 1SKRA 3IG1A 5DG9A 4KLQA 3RB0A 2PI5A 4UAYA 2WTFA 3AVHA 5IILA 1RYSA 1UAXA 4ELVA 3LK9A 3RJHA 1HQEA 2X74A 3C94A 1HYZA 1ASWA 8ICRA 1NOMA 3LZIA 3ZDBA 1KSPA 4IFYA 3QIOA 5KFYA 4E0DA 1VSDA 2IHMA 2AQ0A 4FW2A 4CEDA 2W42A 4FBTA 4ECYA 3CQ8A 5IIIA 2V9WA 2ISOA 3OGUA 3HXMA 2BPFA 2XHBA 3VA0A 5CZ1A 3V6DA 5KFUA 3K5OA 4O5CA 9ICVA 4UQGA 3OS2A 4KAZA 4HVJA 3MEGA 2ATLA 4W5QA 3SV3A 3SUQA 1JLQA 4IQVA 2FLNA 1LWCA 1S76D 3DRRA 4N47A 4EZ6A 4IQUA 2C2RA 4B3OA 4HUFA 4Z4EA 2XCAA 3RAQA 8ICWA 4PGXA 3MEEA 2BR0A 4BXOA 4FW1A 3WNEA 1ZQSA 2IMWP 4Q0BA 1CZBA 4ED7A 2BGWA 4UB5A 3GV5B 1LWEA 3VQ9A 3GIKA 3DLGA 4XIUA 2OPRA 1ZQHA 1X1PA 4QWEA 2KN7A 2VA3A 3VN5A 4RQ2A 1ZBUA 4Z6CA 4FYDA 3NFAA 1WSFA 2KW4A 3PX6A 1EXQA 1J5OA 4FZXC 4YN4A 1ZQDA 3ZDCA 1C1CA 1S9EA 4XUSA 3MGHA 3D45A 3FFIA 3SQ2A 2JZBB 5KFWA 8ICBA 2XY7A 4EZ9A 1X9MA 5C25A 3G6XA 4ECZA 1ZQTA 8ICTA 4Q44A 1ZQBA 4LZGA 4UAZA 3BQ2A 4M3WA 2YHBA 1NJXA 2OZSA 8ICZA 4M6WA 4IDKA 1GOBA 4PGYA 1T3NA 5CB1A 2ZTEA 4OJRA 5HP4A 4FJGA 4BWMA 4QZIA 1RDBA 2R8IA 1U9LA 4J9PA 3OHBA 4DFMA 1TKTA 3C1ZA 4F5NA 2AQ4A 4TSXA 4CFAA 4QZDA 1COOA 4FM2A 5CZ2A 1U45A 4C8NA 4BE0A 5KFHA 5DLFA 1J53A 4E7LA 4R63A 1L3UA 3HO1A 4HUEA 4CJTA 4FVMA 2FC0A 2E4LA 4P4MA 1FK9A 9ICXA 4IRKA 3THVA 4KLHA 3WNGA 4PH5A 1QSLA 1DTTA 3C6TA 3V7JA 1HJPA 1VK0A 4DSEA 3RJKA 2P6RA 5KFSA 3Q8LA 3LWMA 1NJZA 4CEQA 3PW7A 4Z4GA 5BPCA 4KITB 4PHDA 2FMPA 5DBCA 5IIKA 1X9SA 1N48A 4FJNA 4HUGA 1LW0A 8ICQA 4LD0A 8ICYA 3SV4A 4H8KA 3I8DA 2UVWA 1BQNA 4GXJA 2PFNA 4OKKA 4O3PA 5KG5A 3SPYA 3VQEA 4CGDA 3DYAA 1WLJA 9ICAA 3RJJA 3IAYA 1A5VA 1NK9A 4RQ7A 2Q0ZX 1HPZA 1L3VA 2UVVA 3AO3A 2VA2A 8ICFA 8ICGA 1RDAA 4DQQA 1O1WA 4PY5A 1SKSA 4E7IA 5HRNA 5KFKA 3HPOA 4DL3A 3GILA 3H8JA 4NXZA 2JEJA 4PUOA 3PR5B 3QEVA 1IXRA 3MR2A 1N5YA 1I39A 2KFNA 3L2WA 4O0JA 1JLFA 3NF7A 4O3QA 4GLXA 2W8LA 4F4WA 1N56A 2OPSA 3ZSRA 1RZTA 5SZTA 4ELUA 1LV5A 9ICJA 2ZD1A 9ICSA 4F4KA 1KCFA 2BGGA 5KFRA 4RU9A 4OLAA 5J2CA 4YMMA 3M9NB 4ID5A 4FZYA 3V7KA 2JGUA 3KD5E 7ICKA 4LSLA 1ZQPA 4DSJA 4O0IA 4F3OA 3AO4A 3PMLA 3L2QA 1HYVA 5T7BA 3NE6A 1Q9XA 1BCOA 4M42A 3QIPA 9ICPA 2G8WA 2XGQA 4DTUA 2ASDA 1B9FA 1LAVA 3DOKA 1RDDA 1WSGA 2VG5A 4CJSA 3G6YA 3HPGA 2PFQA 9ICLA 3U3GA 3RMBA 4DOBA 1QS4A 4TQSA 1KRPA 2GUIA 1CXQA 1D5AA 4JV1A 3TAPA 4W5OA 3KKRA 3RRGA 4AHTA 3QETA 4N5SA 8ICEA 2O4GA 4DQPA 4RQ1A 3F73A 5E41A 4CK1A 1WAFA 3HJFA 3BDPA 4DOCA 4I2PA 4ICLA 5CHGA 4FJJA 4OPJA 1U48A 2F1IA 3ZDDA 3VQDA 3T1AA 3OYNA 4RQ4A 2OZMA 1U47A 3LP1A 1Z25A 2Y1IA 4DS5A 3CM5A 4I7FA 3MXMA 4BE1A 4FXDA 3AVBA 4KHSA 1SUQA 5EOZA 4R5PA 4GC6A 7ICIA 3KHHA 5K14A 5HROA 4M47A 4KO0A 2ZUDA 2R8GA 5KFJA 5F9LA 4I28A 5EWGA 5KG6A 2HHSA 3JPPA 7ICLA 3MFHA 1VSKA 3AU6A 4L8RB 2R7YA 3JPOA 4KLOA 4YXJA 4YR2A 4CGGA 1REVA 1WCLA 3KLFA 3AU2A 1WNSA 3LP3A 2KQ2A 3QEPA 4MFAA 2A1JB 1BPDA 2W9BA 4BE2A 4CJWA 3PW4A 3NH2A 3L3VA 4CEFA 3DI6A 1KTQA 1DTQA 2KZ3A 1U49A 5KFGA 2HNZA 1KLNA 3RJFA 5KG2A 1BVSA 1D9FA 4ED3A 9ICFA 5KT5A 4PGQA 2MUTB 2PYJA 3ASMA 3BJYA 4GW6A 3B6PA 3MXIA 2W9BB 4W5RA 4XRHA 4MF8A 9ICOA 2PI4A 3VQ4A 4E1MA 4KLIA 3QEXA 4CF8A 5KFMA 4RZRA 4PHEA 3O4NA 1Q9YA 1YTAA 3L2RA 3KK1A 4M3TA 4C8LA 5KFBA 3BQ0A 1BCMA 4JRQA 4KLMA 3OYJA 3TABA 4RNNA 4IRDA 4DTMA 5J0UA 4KTWA 4DU4A 2KZMA 4ZHRA 5KT2A 4DQSA 2PZSA 1W9HA 4RW6A 1ZQQA 1LAWA 4NCGA 4JV2A 4I2QA 9ICMA 4J2AA 1IKYA 1HRHA 4J9LA 4DEZA 4RW8A 2NRVA 1LWFA 4I2CA 2D0AA 4J2DA 4UBBA 4M04A 1XS9D 4OKEA 4EYHB 4BGDA 4XA5A 4RNOA 2DFLA 3ISBA 2ZJ5A 3SUNA 4DSFA 3HP9A 1KDHA 4HCCA 4F8RA 5J2MA 4RQ0A 3AVKA 4IG3A 1Q8IA 1C1BA 4KLJA 3TAFA 3HYFA 5KG3A 5J0WA 2G8FA 4I2EA 2I5JA 4RUCA 4GMJB 9ICGA 4CJ3A 4I2FA 4JS5A 7ICUA 2DPIA 1R0AA 2FLLA 1RPLA 4PA1A 3SPZA 4CCHA 1NK5A 4CHPA 4Q5VA 3NGDA 5BOLA 7ICFA 3DLEA 3MR5A 4YMOA 3WNFA 1Y88A 3FYHA 3AVFA 2H5XA 3HP6A 1L3SA 1NK4A 4ECWA 1BPXA 4YXMA 3B0XA 1TK8A 2XY8A 1B22A 4B8AB 5I3UA 3K5NA 4J2BA 4MQ3A 4DL5A 4QOZB 3RB6A 4AHSA 4CESA 4E19A 4TQRA 4IFVA 3V1RA 4QW9A 2AJQA 5J0OA 1JXEA 4IR9A 4LZDA 5DB8A 1QE1A 4F5OA 2YNHA 9ICCA 3SUPA 4OKJA 4KPYA 4O5BA 4FLTA 2Z1GA 5J2BA 3NAEA 1TKZA 1S6QA 1RT4A 1I3AA 3DLRA 2G8UA 4FCYA 3ZT1A 2ZE2A 1TGOA 5CP2A 3AVGA 2ZJAA 1EETA 1CXUA 4E89A 4RNMA 1XHZA 4NLKA 1ZQOA 3RJEA 3I0RA 5KFTA 3G0ZA 3OVNA 4CEBA 3HVRA 3NH1A 9ICTA 5J0PA 3DM2A 2KZZA 4KTQA 3NCIA 1N6QA 1QTMA 4FZZA 1C0MA 4Q8FA 4M45A 2P5GA 3HK2A 4O55A 4DWIA 2RN2A 2ZQBA 5EWFA 3O4QA 3K57A 1UOCA 5J0QA 3ISDA 9ICIA 1VSJA 3JPQA 7ICQA 4RT2A 8ICNA 7ICMA 1QLNA 4TUPA 1VRUA 3H40A 3RTVA 3LALA 5IIMA 3UXNA 4FK0A 2UVRA 3BGRA 4ED2A 3QESA 4KLLA 4DTSA 3V81A 2IOCA 3MEDA 4O5EA 4DL4A 8ICHA 4KMUA 2NRTA 1ZBLA 3TFRA 3V6HA 1RT5A 3JPTA 3GV7B 4KRFA 1BL3A 3LPUA 4QZHA 3V9SA 1RXVA 3VQCA 3V72A 2VANA 1SL1A 5DB6A 2D0CA 2HNYA 2FBVA 2HNDA 3C5GA 3RBDA 7ICSA 3H8SA 3KLIA 4FJKA 2KTQA 4AHRA 3NHGA 3MECA 5DQHA 4M9GA 1MQ2A 1KEJA 4PPXA 7ICGA 4NM1A 4P2HA 1MU2A 4HCBA 1A5XA 1K1SA 3IM1A 1ZQXA 4F91B 1UA0A 1RTHA 1TL3A 2XO7A 4JRPA 4EEYA 2C28A 4EBCA 3ULDA 3UIQA 3VQBA 3HPHA 5HNKA 4HHTA 5DG8A 3ZSYA 3V9UA 2JLEA 3MABA 4DL6A 3C5FA 5KTQA 1TAQA 1VSFA 3EYZA 3RMCA 3EPIA 7ICOA 2KFZA 3V6JA 3QLHA 3NGZA 3IHQB 3SNNA 4MEXA 3V6KA 7ICVA 4CFCA 2D0BA 3S3OA 1RTIA 4J9KA 2BCUA 3B6OA 1RT6A 4J2EA 2G8IA 5F9NA 3AVLA 3VQAA 3DMJA 3NDKA 4K4GA 2ATQA 3GFKB 4RQ3A 4FS2A 4EP4A 3O3FA 3H08A 4DLEA 4B8CA 1BQMA 1IG9A 4M3XA 2P6UA 4M6WB 1JLBA 3SQ4A 3T19A 4EBEA 1Z26A 3CYMA 3EZ5A 2DTUA 3LANA 4TURA 4RQ8A 1TK5A 4FJMA 4Y1DA 5CY4A 5D3GA 4CF2A 1BI4B 3BQ1A 1ZQJA 4DU3A 1CEZA 5J2FA 1T4GA 2J6UA 1L3TA 2YKMA 5TZVA 3LP0A 5CYQA 4K4HA 4NCBA 1S6PA 4M3RA 3OYDA 3RMAA 4UB4A 4NY8A 4CIEA 3DLHA 2FPLA 4CEEA 2QKKA 3NBPA 4OGEA 4BDPA 1BHLA 2B21A 1ZJNA 4UAWA 2YKNA 5C5JA 1MC8A 1SZPA 4CECA 3U3YA 1UT8A 4AHUA 2C2DA 3KHLA 1A5WA 4M3UA 1EP4A 2ALZA 4DTJA 2HHTA 1RILA 1S1UA 3RH4A 5KG4A 4YG2A 3AA5X 8ICIA 1XO1A 4CJVA 4Q8EA 1KVCA 4N76A 4CEOA 2P66A 5KFXA 1RT1A 3CM6A 4R8UB 4QAGA 3RRHA 3ORYA 5HHIA 4KLUA
chains in the Genus database with same CATH superfamily
4ECXA 3E9LA 4IQTA 4XK8C 5F3XB 4IBNA 2KYZA 1C2PA 1GX5A 2HFNA 1VBYA 4CHOA 1A7GE 1XSLA 4OJLA 4ILLA 3HOSA 4KH0B 4I29A 4E7JA 1UKUA 1FXRA 2Z1JA 1BI4A 2D1KA 5JXSA 4FJ7A 4ED0A 3PHEA 3AVMA 1X4HA 1HPZB 1N60A 5DM6L 1Q95G 4UB3A 5AZJB 4UB1A 3MWPA 5KPTA 4BCAA 3DRYA 5I9EB 3M1VA 1P1TA 2IY5B 4BR0A 2W4PA 5J0SA 2GUPA 4KV8A 3HSTB 2PXIA 2J6SA 1N52B 1RWKB 2OLWA 2G06A 1ZQNA 4O4RA 1J5EF 3W9IA 4OIXA 5J1EA 1RP5A 2RP5A 4Y65A 4DV3J 5AI9A 1KN6A 2NPFA 5FRMA 3H4BA 2DK2A 1JRPA 4JB8B 2A40A 1S0NA 5HQ8A 3H2UB 3O2IA 5C0YA 1L7MA 3O6WA 1W0HA 1TL1B 2R4FA 1WG8A 4P4PA 2V67A 3X3UA 4ZVFA 4OD0A 4BR5A 2CXYA 1JIHA 4AXIA 2CPFA 3GP9A 4Y2SA 1QQCA 2BYCA 4OJ6A 1BGXT 3F2CA 1U8WA 2ALYB 2J7WA 3CFRA 4AILC 4ZTFA 1Z4OA 4WPAA 1KVIA 4QNLA 3CETA 3VEXA 4M5DA 1L7OA 2XB2D 8ICKA 5I4MA 4BLGA 2GV9A 4ZPVR 3A3OB 4ZCKA 4WQ5A 2QK9A 4I4BA 3THWB 3OXLA 5DGAA 1BQXA 3SI8A 4OVLA 4P52A 4JI4K 5F3TA 3MM6A 1X4CA 3N28A 3THYA 4FYVB 3EZUA 2HSTA 4X4PA 2BPGA 4X66K 3O3GA 3F2DA 1A9NB 2FZKB 2YWKA 3QU7A 1FO1A 2ZIXB 4P75A 1WC0A 4DR4J 2Z1HA 2W3SA 2HIYA 3M2RB 1PIEA 4FLYA 3GG1A 5C15A 2GVDA 3JSBA 1HR0K 2QLXA 1P8ZA 2JDJA 2HAIA 5JS2A 3QO9B 4ZOHC 3AVCA 1NM1A 1N0UA 1H1VA 1GLBG 1BUXA 1F44A 1WDDA 3WIVA 4Y2KA 3AVNA 4BRNA 1SJ3P 3CJ3A 4ILMA 1BHNA 3TR5A 3RB4A 3N5FA 3DYAB 3UNGC 3MGIA 4XQ8A 2LEBA 1T3VA 2ROEA 5J2KA 2GCFA 4OX6A 1XNQF 1XSPA 5J0TA 2WVBA 1D3WA 5AZJA 4RW4A 4IH6A 2ZBPA 5KOWA 3R7SB 2P9LA 1WC4A 2BKNA 3HFKA 1S72S 1RDCA 3MR6A 1ED1A 2M8HA 2J9CA 4FJHA 3VENA 4CH7A 2RH3A 3K5LA 2E8MA 1ZQRA 2GC8A 3HF5A 4Y28C 2YY3A 4CJLA 2WW4A 4QPTA 2CJBA 2FJEB 2MY7A 4QZVB 5ETPA 2AJFE 2BQ3A 1WEYA 2VF3A 3K0JA 1EKEA 3QT5A 5BRFA 2H5JB 2EFOA 3FSYA 3HFVA 2CNLB 3PM9A 1RBVA 2MA1A 1V9OA 2HKEA 1FXXA 3AQEA 5ETNA 5B0FA 1VISA 4DR1K 1B64A 1JLGA 4ZA1A 3J81j 3KTQA 1KS2A 4PAAA 3TARA 2AIRB 4EUVA 4PZOA 3GE9A 3UCGA 1I94F 2FSKA 3NS5A 1YITN 1UVKA 4AHVA 2R7RA 5GADU 1IH7A 4U95A 4PL1A 2G0JA 1R8CA 3UDLA 3M8SA 3MXHP 1WB9A 1FDDA 2ISPA 4ALZA 1N88A 1XMOJ 3I31A 3W3SA 2FBYA 1T3OA 4JI8K 3GSDA 3LTOA 2ZTCA 3OYCA 4CJQA 5KAKA 2QWOA 2AU0A 2IS3A 4LSNA 2XO6A 2QMWA 2YNFB 4QZAA 3O4WA 3O5TB 2WHEA 1IJFB 5LJVA 2JHDA 3R5CA 4OZJA 4EP5A 1NBWA 4MKYA 1ZQLA 3DMJB 2KHQA 3H8YA 1SI9A 2FBXA 3ENQA 1EIYB 3E58A 5DB9A 3JTOA 3H0LB 4Y2TA 3PLAA 2LKZA 5GIOA 3V4IB 1XI1A 1KBUA 3K75D 3H1VX 4M5JA 5F8HA 1LW2B 3ZDAA 4X4RA 4Q7AA 4F4YA 1GLAG 1QQ6A 1MWKA 5CD4H 4CBUA 1LNQA 1AZSB 3H8WA 3FGVA 3O3HA 2WVDA 2FHJD 4H4OB 1UVMA 1DQAA 2ZIXA 1F2GA 5AQPA 1NMNA 2AHOB 4MDBA 1HBMB 3TR8A 4ECSA 3B4DA 3F9KA 3MPVA 3H45C 5KI6A 4O0NA 4X66F 2IPOB 2LECA 3R2CJ 7ICNA 1NKEA 1HLUA 1VQYA 4BX9C 3OJSA 4I2GA 4OJPA 1D9AA 2AGQA 1ZBSA 1NNEA 3UQSA 3J7YP 3HVTB 4OHYA 4NM2A 1FJGF 1LWCB 2VPYB 7ICJA 4JI5K 3M6VA 1C1AA 2VFSA 3THXA 4L3QA 2HMXA 3I56N 4I7FB 1DEJA 4JV5K 2DNMA 2XYHB 2UUWA 4Y2XA 4LMZA 4QZCA 3P3DA 1Z05A 3O5BA 2VQFK 4LF8F 3H2LA 4XO0A 2BCSA 4FK4A 4Z6FA 5AICA 2WB1F 4FLXA 3LPTA 1GLLO 2YQ0A 1S77D 1F21A 1WKLA 1OY6A 4CLUA 5DQGA 3NLCA 4MJKA 1NSKL 3MEKA 2CG4A 4NLDA 2Q97A 3HWTA 1N34F 4C7YA 1MLAA 1TV6B 3C2KA 4C3MA 1ZRMA 2DITA 4IO9L 1FD8A 1SC6A 5JMNA 1ZQ1C 4JHDA 1CJUA 4MF2A 4NL9A 3LDSA 3SZ2A 2FJAB 2PA8D 4ZCLA 2IRXA 3LW5C 1WSJA 2JFKA 4DSKA 3DRSB 2N3LA 1HR0J 5HROB 1CLQA 2E29A 1RWNB 1KFTA 3VQPA 3GIJA 3CDAA 2AW0A 3TI0A 2GWKA 1T9XA 3GPAA 1X5PA 5ALGA 4B6JA 4KGVB 1GTEA 3NVYA 3VQ6A 7ICTA 3R5BA 2X3DA 5B8HA 4J9OA 1O08A 3ZT2A 2CN1A 3RGIA 3HX9A 3Q23A 1BQMB 3RYLA 1X2IA 4X62F 5K8NA 1K6YA 3JYTB 4LFBK 3OT9A 2NRXA 5ALFA 3N4PA 1S1WA 2NCKL 3I5BA 2VGNA 3I56S 4CVNE 3OL7A 1XMQK 2K8AA 1H72C 4I2HA 1N54B 5LJ3Y 4U7CA 2GAHC 4I27A 5KFDA 2QKBA 5DB7A 4C7ZA 1BE4A 4MIAA 5AM2A 3D0GE 2FHMA 3CW2C 3T3FA 4DBQA 8ICXA 3LP2A 3Q24A 3VGSA 4AYBD 4LF6J 1CBKA 4KR0B 3HI9A 3WDOA 2HHPA 1WOSA 4AM7A 4KHUA 2J0WA 1ZRNA 5KFFA 1HBUA 1RT7B 1ZBFA 2VASA 3TVZA 4PG6A 3KMQA 3CC2N 4A46A 3EE8A 4DV4J 4CT8A 1G15A 2CRLA 4CHNA 3C23A 1KONA 4NZ7A 5E3CA 1C4CA 4UATA 2W2QP 4B3SK 4KREA 2JXJA 4QZGA 4P7TA 5GTIU 3ONQA 2FXUA 1D9DA 2LEPA 2A6OA 1CLFA 4DCJB 3SD7A 3TEGA 3P31A 1AQ6A 3UM9A 2I1RA 1SQGA 4I2DA 3L7OA 3CJ0A 3BQTA 4FN5A 2EDUA 1FRIA 2P51A 3QERA 4DUYF 5E79U 5ALDA 3AVJA 2LCWA 2IJFA 1WCNA 3OBIA 3T5HA 4QZ8A 2IVMA 2OELA 3L7UA 2UU9J 1T7PA 4MFCA 1Y97A 1KLMA 3K8VA 4G1IA 3K59A 1QH9A 3K8WA 4EELA 2WVEA 2QWLA 2PN6A 3E51A 3M2UA 4Z4FA 1NBEB 3HD1A 1X9JA 4ELTA 4UB8U 2FLOA 1HJRA 4NLTA 1QCKA 4K8ZA 3ZD9A 2HZVA 1YRUA 3AA2A 3IN5A 2Q3PA 2MUTA 2RUGA 3G87A 1BDGA 4IG0B 1HQUA 4OX9J 4DQRA 1DRGA 5AXKA 2WB1D 4IFYB 4KFBB 2VICA 1N61A 4GC7A 8ICOA 4BRLA 4CZJA 3V5RA 2OYQA 2UXCF 4OJOA 4PXBA 4WZQA 2JEFA 2QWNA 3ADAC 4J9VA 4KYZA 2K8CB 4NYNA 3NVZA 2ZM6J 4IO1A 2K89A 3W2VB 4Q43A 4ZLLA 2VPWB 2FVPA 2HS4A 2LA4A 4QZBA 2HDOA 1WUUA 2UXCK 1Z4NA 4CZMA 2CA9A 3JSMA 2ASLA 4AHCA 2VIXA 1Y5NB 3DN9A 2E5JA 3NVMA 4CGIA 3FZHA 1VQ4N 3J7YU 2QTWA 1SUQB 4Q0BB 2ZIWA 2N7CA 4FBUA 3AOAA 3PW0A 1CJTB 3EE9A 5D15A 2CPZA 3S8SA 2RD5C 1B43A 5ETLA 3OTCA 5KGWA 4ZIWA 3VAJA 2HBYB 4CO1A 4QZEA 4GMKA 3H59A 2W7PA 3D2EB 3VETA 4MKVA 3QEWA 2GELA 1Y11A 5GVQA 4KH5A 4JLHA 5HHHA 1S10A 3EY1A 3QX7A 1UZDA 1FK9B 2W2OP 3H98A 3CI5A 4C4WA 3BUZB 1JL2A 2CDQA 5IS2A 4BQLA 3H8MA 1SJQA 3FZKA 3R9PA 4OX8A 5T7LA 3KLGB 4JKHA 4LY7A 2W9CB 3UQ2A 2P9NA 3N01A 1U1NA 3J80O 2RT3A 4JI3J 3GWCA 4F0MA 4KHRA 1UHUA 3ENAA 2DIUA 3SQ1A 2ADBA 4NLBA 1S7HA 1HYSA 4US9A 2Q3SA 4HLBA 5AQJA 1MWZA 3UN3A 3M5RA 2KRRA 1RBUA 2KB2A 4Q45A 5L1LA 2BOPA 3KVGA 3PFEA 3NUQA 5DZ6A 3VEVA 2L9DA 5CQGA 2HRTA 1NGBA 4E2FB 3IV6A 1NM2A 1EX8A 1RWOB 3C95A 2RDJA 2M5YA 4LF2A 4DL0C 4UARA 2AF6A 2ZBIA 3J80U 2OPPA 2H3QA 1S5ZA 2J76E 2JL9A 5AE1A 5ETOA 3TOQA 4F2SA 5A8WB 4UUWA 2YPYA 3U26A 2O3DA 4HR2A 5C42A 2V2KA 3O9TA 5CHIA 4KGMA 3A0BU 4H4MA 3HM9A 3ENHA 1NSAA 2VQFJ 1P1LA 2QX0A 1VSLA 4M0AA 3G8TA 3IAS9 3LGNA 4LF5F 2LQBA 3UI3A 4U7BA 1PUZA 3DDHA 4UY8T 1VLOA 2J9DE 3SI6A 4YOVA 5KFLA 1HL6A 1C7YA 2H65B 5GAGI 2HOEA 1S57A 1ZQYA 2GO9A 2NZCA 2ZIWB 2HZAA 4DO9A 1UFWA 1T0TV 4BG9A 4UAVA 2E6MA 1S9EB 4P0PB 3G6VA 2A1AA 2VYPA 3TSQA 3MCSA 2BPCA 3IWNC 5JVHL 1YKWA 3MXJA 3IBCB 3ZSVA 1UPMB 5BR8F 5AQOA 1XNQK 1AFJA 1XBWA 3LP0B 4FZVA 1BNOA 4MLEA 1S1XA 2E8OA 2DEIA 5CZVA 4DR6J 1SZHA 5HANA 5E7OB 4DTRA 3CCES 4ZKAA 3EVWA 3M6UA 5A6WA 2RDIA 1MQ3A 2C1EB 3OPKA 4CJRA 1NK8A 1YJ9N 2XI9A 2PT0A 1SWVA 1JX4A 3KNGA 4CZGA 2FMQA 3TANA 1JLQB 1TP7A 4C0OC 4Q2LA 5K8MA 1BO5O 1H2TZ 5DK5A 4CHZA 4FO6A 1SC1B 1U7LA 4CZLA 3KHRA 4A62A 2AEFA 4GY2B 4FLVA 1IKWA 3CJ2A 4Y00A 1C0UA 4OPAA 4LRAA 3QB0A 2VFTA 2P9EA 1N8RT 4R64A 4FK2A 3HSJA 3GYXB 3MN9A 3HRGA 4HVZA 2BJ3A 4WFNQ 3HX0A 2VJ4A 1QTNB 3CQYA 5HQLA 2WB4A 3O1LA 1DT9A 1RQ0A 2WONA 2KE7A 2O8BA 3L0QA 1CULA 2IYGA 3V1OA 3MBYA 2QXFA 3VZHA 4X4OA 3A8IA 4NLUA 4NCGB 1TQLA 2RF2A 3IDWA 1T03B 5C2FA 3MCOA 5DJBA 1IBLJ 3OYLA 4KSEB 4ZPWR 2G5HB 2HBZB 4YFUA 1WKKA 4QU6A 2W9AA 2E1AA 2G8VA 4U9RA 2KKVA 1ZQMA 4RPZA 2GJIA 2RS8A 4CLFA 3C6HA 4WJ3B 3M4XA 5DDYA 3MEEB 5HRPA 2YHAA 4ETZA 3I55S 4CERA 3MMJA 2Y1JA 4ED4A 2GGPB 5J2IA 3BBCA 1UPPA 4KHWA 1Q0NA 3CCQN 3U1MA 5CA5A 3K4GA 3L3UA 1J5EK 4CGJA 2IAJA 4YUDA 1F2HA 3OTOF 3NGIA 3MN7A 2ZM6F 4DLGA 4JV0A 3KLHA 5HMYA 3E8OA 3CEDA 4KI6A 4GKJJ 5I3QA 2Z2ZA 1SV5A 3TAMB 4DOZA 1C1BB 2DGOA 4DTPA 2DFFA 3ZI4A 1U0HB 4ECVA 1SKRA 4KLQA 2WTFA 1ZA2B 3AVHA 5BRDA 1ZAXA 1QY7A 4FZNA 5THWA 1UAXA 3WXLA 3G6EN 2OMLA 1M5HA 3AAQA 2BH1A 1KSPA 3AQFA 2FVCA 4M5LA 4OYWA 3TTFA 3MMCB 2AQ0A 4FW2A 4FBTA 4LJMA 1NEEA 3CQ8A 4RL1A 3R8EA 3CNHA 1UVJA 1T9TA 4ZN3A 2KMDA 3OGUA 4FYWB 2BPFA 3VA0A 3IGNA 2V8PA 3QT7A 2ZF5O 2LPEA 4YHHJ 3J7ZT 4USJC 3QNWB 3SV3A 3EGVA 1LWCA 3I1YA 4ED5A 3U9ZA 1X4DA 2CQ3A 4ZN1A 1J5EJ 2CGJA 4JD2A 4Z4EA 1S1XB 3T69A 8ICWA 4HHHA 1SCJB 2BR0A 4BXOA 5AKGA 4FW1A 3WNEA 2KU7A 1X4BA 3D2EA 1CZBA 3MM5A 3TUPA 3HOTA 4UB5A 3GV5B 1LWEA 4X66J 1YTYA 2ZKUA 1NPRA 4F0HA 1X1PA 2GQ2A 2E2NA 2KN7A 1ZBUA 1IBMJ 2AP1A 3NFAA 1WSFA 1Z2LA 3PX6A 1EXQA 3U1LA 4FZXC 4GKJF 1S6UA 4BR7A 3UO0A 5FPEA 4H5WA 4P2FA 1KVJA 3ZDCA 5F8JA 3IWLA 2QM1A 3FFIA 3F9MA 3VEOA 1IBLK 2QB1A 1VR6A 2ESEA 2OKQA 3KLFB 4ECZA 2O8DA 5AKLA 4YOTA 1EQ0A 2GMJA 4Q44A 1PYOB 5BPNA 3UCZP 3BQ2A 2VC0A 2E8PA 4WTYA 3CJKA 2QWRA 2ITMA 1UW9A 2OZSA 2H3ZA 4M6WA 4OZ0A 4A2BA 5C42B 3KG0A 2KHVA 1OQ6A 2D69A 5CB1A 4RO0A 3PCOB 4A2AA 4JKBA 4FJGA 2R8IA 1D09B 3DEEA 1TKTA 1OIAA 4PQUB 1KC8O 1W2IA 3GFHA 3NGSA 4TSXA 4CFAA 2MZSA 2KVIA 5CZ2A 4R79A 4QS9A 2HIQA 2ZJQL 4BE0A 1J53A 1U6ZA 1XNRK 1L3UA 2HLTA 3VCBA 2FC0A 3FM9A 2E4LA 2JVRA 2OMOA 1QUVA 1B3TA 3D9BA 3CJAA 5GINA 4XDDA 1N6QB 3SQGB 2ZG6A 1DTTA 2QLBB 2GV1A 2YHYA 1CVJA 1NGIA 1HJPA 1VK0A 4XPCA 4DSEA 2P6RA 1LFPA 3NKYA 3PW7A 5BPCA 1RTHB 4ZMMA 2DD8S 5L9NA 2K1RA 2O8CB 2E1RA 4PHDA 4WCEQ 1YLXA 3AB4B 1U02A 4FJNA 2K8GA 1H7XA 4C6AA 4C1NI 8ICYA 1JB0C 4M1KA 4X65K 2CNKB 5AJ3K 2DGSA 1WC5A 4NLSA 3I8DA 2PFNA 4UB6U 3NGUA 4ZP7A 4O3PA 3WKEA 5KG5A 2E7XA 1M1KO 2H1YA 2HZCA 9ICAA 4NE9C 2PAVA 4NXMF 1PBAA 3IAM9 1HJOA 3M7DA 4RQ7A 1HPZA 1L3VA 2LLZA 2E88A 4Y0WA 4WF9L 3ZEUB 2ZFHA 1XR7A 2VA2A 3QXGA 1TKXB 2V51B 1DBDA 4IQXA 3S1TA 1RWPB 4E7IA 2ZH4A 4DPUA 3I82A 3D2QA 2OPRB 4NXZA 2JEJA 4IEEA 3TNVA 4USHA 1N5YA 1I39A 3PJ9A 4LF9F 4J37A 2FY8A 3U7JA 1VC5A 2RRBA 2GJ2A 2IYIA 4KHPJ 2QA4N 4EHUA 3FK4A 3GIRA 1LV5A 4JI5F 9ICSA 1KCFA 1GT8A 4RU9A 2D0PA 5J2CA 2DTJA 3M9NB 1N0VC 4J91A 2OFHX 2DR5A 2QG9B 1U1PA 2IA0A 4IOAL 1SB6A 4DSJA 4EX6A 4O0IA 3KLEB 3AO4A 2IM1A 2UV8G 2YH1A 4DQ8A 4NXNJ 3CWJA 4PCQA 4FWSA 9ICPA 2XGQA 2NYIA 3D6MB 1NSQA 2QW9A 1AB8A 2PFQA 3U3GA 1U2VA 2IC3B 2A5XA 3IGVA 2GUIA 1NG9A 3FSIA 1JCFA 1D5AA 3JS9A 2W2PP 4F36A 2BV3A 3KKRA 4HI2A 4AHTA 3QETA 8ICEA 4JI7F 1RWWB 2FC8A 3QWPA 3H0PA 2ZXIA 2CH5A 5D4NA 3F73A 2GIQA 1K8AO 5E41A 1V4SA 3WC2A 3BDPA 2KEYA 4MYTA 1NB7A 1FRXA 1AFIA 4AL5A 3BZCA 2OEJA 4OPJA 4FJJA 2F1IA 3MGJA 3CPWM 2VQEK 2OZMA 5L1MA 3VV2B 4NX9A 4QR1A 5BR8K 2B9WA 2R3VA 6FD1A 2Y1IA 3CM5A 4BE1A 4ZPDA 4KHSA 3H5XA 5EOZA 4EFAC 4R5PA 1Q7YO 3T6BA 3I96A 2NNWA 4GC6A 2KJ5A 1NAQA 3KHHA 4AYBC 5C2DA 1N63A 4FFDA 4A61A 4YHHF 4XEIA 2EFVA 2LYAA 4P0PA 1KD1T 3PIOQ 1RBLA 3ETOA 4CLLA 2EFNA 4L8RB 5E3QA 4YXJA 2AMCB 2J7KA 4YR2A 4DI6A 2AT1B 4JK8A 2ZNYA 3WK5A 3JSRA 2OIHA 2GZOA 2R7XA 2KQ2A 1BPDA 1K8AT 3CUNA 1WOOA 1XEZA 4ISFA 1FDBA 4CEFA 3DI6A 1U49A 4BRGA 1URNA 5KFGA 4UOHA 4TKTA 3PG9A 2HNZA 3PYEA 4URGA 2OP5A 1FJ7A 4ED3A 1HNXK 4DUYK 3I0SB 2PYJA 3B6PA 3O6QA 4XRHA 4DDFA 3M6XA 4DV5K 3EVMA 4OI3A 5HP1B 4QIEA 3VQ4A 1GNKA 1IBMK 5EGYA 3QMLA 3QEXA 3QRRA 4A5AA 1F5CA 3QGIA 1FRHA 5KFBA 4JRQA 1H74A 1ZM9A 3OYJA 4FWQA 3HD2A 3CDEA 4B1YB 2NZTA 4KX3A 3CJ9A 4MLHA 5J0UA 2C3OA 4ZLJA 3SAHA 4CH0S 2KZMA 4IO8A 2W24A 1ZQQA 1LAWA 1B0VA 4HH1A 2G08A 4PXCA 4J2AA 2DNRA 1IKYA 1FNXH 4J9LA 3M8QB 2EG1A 4RNHA 1LWFA 4UBBA 4M04A 3DM2B 3PXGa 4OZ1A 3KZXA 1S4FA 4FNHA 4M95A 3SUNA 1RM6C 2DCLA 4QIFA 2KG1A 4DV7F 2PMHA 1YJTA 3AVKA 1Q8IA 2MGZB 4KLJA 2DBBA 3HYFA 3OVAA 4X62K 4WFZA 2C3MA 2I5JA 2HWIA 5IV4A 2HWHA 2ATCB 3A12A 2HQFA 4MKAA 4CJ3A 2FIUA 2F2AB 2FLLA 1A6SA 1HD1A 4DV1F 2GW8A 1CG2A 3MECB 7AT1B 4XDCA 1TUVA 3DLEA 5AM3A 2EQYA 3R5GA 1SXEA 3WNFA 3CD0A 3TZWA 4Y2YA 2JWLA 3AVFA 1YJRA 2C3PA 4ECWA 1BPXA 3F44A 4YXMA 1UPHA 4JI4F 3P49B 2E5IA 1B22A 2Z8QA 1YRXA 4JOUA 1H2UX 1RTDB 4K4ZA 1FRJA 4KGKA 2Z2LA 2CQHA 3SAFA 4QOZB 1YWXA 4TQRA 4IFVA 2ASYA 4QU7A 2E9ZA 2Y0SD 1JXEA 2B8QA 5BXIA 1RT2B 4DV4F 1G1XA 1S5LU 1OS5A 2MZTA 4O5BA 3VAMA 2C2KB 3NAEA 1I3AA 2G8UA 3DRRB 2V50A 3ZT1A 3ED5A 1FF2A 1TGOA 1WYGA 2KKZA 3THPA 1CXUA 2OAUA 4DUZJ 4PHTX 3CJ7A 1XHZA 4NLKA 4BRHA 2YMPA 4DR4K 1HBOA 4EO8A 4CYUA 2N1RA 3W2WA 2KZZA 1P27B 1C0MA 2VDHA 1R8BA 5JTIA 4Z2XA 3TA2A 3HMJG 2XS5A 5ALTA 3MN5A 2M52A 1QLNA 2RQMA 3H40A 3RTVA 4NLRA 1V85A 4ED2A 2Z58B 3PTWA 3MEDA 2RUSA 4O5EA 4DL4A 3KKAC 3CRXA 4KMUA 2NRTA 2IFXA 1RT5A 3HFZB 1FX4A 1CJVB 1J2MA 5AM4A 5AFUA 2VANA 3K2YA 1EKRA 3QSYB 5AHXA 1KQFB 2D0CA 4ID5B 2FBVA 2CNNB 3QATA 1NZ8A 2CPYA 3ZZPA 1YRTA 4JI2K 4FJKA 2KK0A 3MD1A 3JS6A 4C8YA 3BS5B 2QC3A 3O3LA 4M9GA 1MQ2A 1ZBTA 2VPXB 5FIIA 4PPXA 5I42B 3LGMA 2DKXA 3IM1A 3WQPA 3D3CJ 4OV6A 1VQ5N 1RTHA 1TL3A 4OHWA 2DNGA 4EBCA 5BN9A 4UF4A 5D78A 4LR8A 2QB0B 2E7VA 1U0SA 4KQZA 2EZZA 2WF7A 5CE3A 3HPHA 4DX5A 2GIRA 3V9UA 3MABA 1ULRA 1TAQA 2EKNA 2E20A 3A5LC 1KQGB 4YDDB 3ZLJA 7ICOA 2WVFA 1CPZA 3NGZA 3SNNA 2YKQA 7ICVA 4FZMA 3AGKA 1FDNA 4RNFA 1RTIA 4J9KA 4CFCA 4JI4J 2BCUA 4IH5A 1FFWB 2E1YA 4DUZK 4A8EA 4J2EA 1QVGM 4YY3J 2W40A 2XS7A 1XNRF 3B6BA 3GFKB 4RQ3A 3VVUA 3CVKA 4DLEA 4DHVA 1BQMA 2E7WA 3K89A 4ZVOB 2E2OA 2XHCA 1KDNA 4EBEA 4TVAB 1Z26A 5GAEP 5FJ4A 2DTUA 4RQ8A 2I5HA 2YWWA 1ZAWA 4FJMA 4EAHD 1YJ9S 2N82B 3Q0AA 3DI6B 1BI4B 3K1ZA 3BREA 4ITSA 2A18A 5FLXO 3DLGB 2B8PA 3EICA 2P9SA 2EEYA 4K4YA 2B4OA 1NXIA 3ILJA 2P9KB 2GHVC 1UFLA 2MZJA 2RSQA 5CYQA 4K4HA 2KYXA 2MSTA 4QYRA 5H1SQ 1S6PA 4URSA 3SCKE 1DTQB 5M1PA 3RMAA 2FC9A 1MMDA 1VS3A 4M5GA 1F0MA 4KKOB 5LXYA 2UXDF 2O5DA 1QQOA 1KR4A 2DQNB 2L08A 1TYQB 2K7KA 4QYZJ 1V5IB 3EXYA 1BHLA 3MHYA 4UAWA 3DU6A 2P8IA 1MC8A 1SZPA 3U3YA 2KD1A 1K9MO 1Y4ZB 3I76A 3C66A 2RILA 1EP4A 2HHTA 4KMOB 1RILA 4RQNA 1R7IA 4LFAF 1KVCA 2CIMA 2QJ3A 2CPRA 3CM6A 4R8UB 4QAGA 3RRHA 2P9IA 2E1MC 3M2VB 4NLXA 2J9EA 5HHIA 3AAPA 2B9EA 4L72B 2WCXA 1RACB 3FUYA 1RTJB 4ERDA 3VAKA 1CUKA 4CJPA 4LFBF 3B78A 2YNFA 1UVLA 3QUTA 1EX4A 3AAWB 2V7ZA 3PW5A 9ICBA 1R43A 2IVNA 3AJ2A 3CCJN 1UWAA 9ICQA 2ZZNA 3KYLA 3V4IA 3ZDEA 3Q8PB 4PZVA 2ASOA 4IOCL 4FPBA 1NK6A 3GFZA 5ALZA 1HNVB 4Z7YA 1SV0C 2PKEA 3C15B 1VCTA 2FJBB 4ZP9A 3KMSA 2LU1A 1J54A 3SCXA 1WACA 4JEPA 3NRWA 4YOWA 4J9RA 2U1AA 3PNCA 3C6UA 2CQBA 1FNOA 2VBXA 1M6YA 3ET6B 4HYKA 1ZQVA 3UNYA 2OSQA 3PIOL 5CWRA 5DS7A 1NOZA 3KXDA 3Q8QB 3CCLN 4DR6K 3W9JA 4M5HA 2AGPA 4WIIA 3RAXA 5HLFA 3W3DA 2CVEA 5IQ6A 3FZBA 4K4WA 4LIRA 2KT5A 3K2PA 1BU6O 4CLPA 3QAEA 2E5LF 4XH5A 4RW6B 3HSZA 4UY85 4PPZA 2EBGA 1S3XA 2X1GA 1VJ5A 3AH6A 5JUMA 3KKSA 5ETTA 2RHSB 3QU9A 3ZZOA 3ZNUA 3SMVA 3HT0A 5E33A 2H4YB 4Y3CA 3BN4A 2VJVA 3V7LA 4Y34A 2VFUA 7ICPA 1XWLA 4CE9A 4LRCA 2UU9K 4FPAA 2X1FA 2M88A 1K9MT 3V9ZA 3VQQA 4IDHA 3T1YK 2HW3A 3PKMA 1B9DA 2VG6B 1XC3A 2DHXA 1RBTA 3CCEN 4LF6K 1NCLA 2LM1A 1ZETA 2PY5A 2R2SA 2X6SA 2IRYA 4KLSA 3IRXA 3KDNA 3BGUA 4QOTA 5AQKA 1BC6A 3BF3A 3H3NO 3HW8A 4YR0A 3TRGA 3OYBA 1MN9A 4I2BA 3E66A 4DB3A 1EP4B 3RR7A 2ZEJA 4DHYA 3QRQA 5KRTA 2LDYA 5CZXA 4X65F 3K17A 1VQ5S 3T1HK 3ZSWA 3N79A 2P1JA 2J6TA 1FVQA 4DCCA 4BR4A 4NXNK 3ITHB 2M8DB 4K2XA 2WMMA 4OGCA 1HWLA 1WHVA 4LF5J 3OYFA 1WDTA 5IM0A 4DL7A 5KFEA 1Q53A 1HI1A 2XGPA 5GMDA 3M6WA 3K5MA 3F41A 2X7IA 2CQDA 1S0MA 4L75A 3BH7B 4LJXA 1KQQA 1ZBHA 4DV7J 2W55A 1YG0A 2QLFB 5GTHU 1EAYC 4B9UA 2KXFA 3H7IA 3N97B 4HKQA 4X2BA 3NCQA 3NBPB 4CGFA 1IR0A 5C12A 1HHSA 1ZQIA 2FYXA 5HMZA 2ERRA 5LJWA 4W5TA 2H5IB 2P9GA 2JH7A 3I0SA 3ZEUA 1D4XA 3CC4S 4N56A 1ICEB 4YMEA 2H48B 5AQXA 2MKCA 3SSQA 5E2QA 1I1GA 4FJ9A 1P7DA 3O1BA 3SCIE 3O9SA 1FE4A 4WCEL 2ACMA 3RH5A 2ABYA 1JLEA 4RUHA 4ZVPB 3HSDA 4ECUA 1VQLS 1E6VA 4OX9K 4ES2A 3OW2R 2DNPA 1S1VB 2HFZA 4K5RA 5EWEA 1VQ6S 2IHNA 2DXDA 2D5RA 1TL4A 1DGSA 3AA4A 4CEAA 2VOOA 2DRDA 1NJWA 1NRKA 3D0PA 1CC7A 2HF4A 2ZJQQ 2P5VA 2MQNA 4TU7A 2N4CA 2QA4S 4F2RA 4U6PA 2HWTA 4F3QA 3T5LA 1JKHB 5EE9A 4B9MA 2CQ4A 2M4MA 3PZPA 3E2EA 1SKWA 1B0PA 3CCRS 3FDSA 2WSEC 4GKKJ 5BRHA 1WG4A 2PSZA 4QIWC 3PIPL 1WHWA 4NLGA 2H4WB 4RG8A 1VLYA 3BKUA 1FESA 5HR7A 1MU2B 1HQEB 4FWOA 1RISA 1YJ7A 4X64J 2ZHAA 2CNOB 3ZSXA 2IVFB 1VSHA 2NRRA 4CFBA 5A8RA 2ROGA 2M0NA 2P5OA 1S22A 3P8BB 2QLTA 3W0LA 2A3JA 5M1NA 4YMNA 1YI2S 1Z00B 2PO4A 2XG8A 1IM4A 1NPKA 3ELHA 1S0OA 3BB5A 2K3KA 2HEKA 2IRUA 1N5XA 5LXRA 4HEA9 3QYYA 3MWTA 3OLBA 2QYGA 3B54A 4DV6K 2VDIA 3M8WA 3OLAA 5D6GA 2XY6A 2W04A 2HGLA 3BYPA 4USAA 1M90O 5H9FK 2W2MP 4DR6F 1NGJA 3LDAA 2KKHA 1Q4RA 2F4VK 1VQLN 2DF4B 2I6XA 1WI8A 2JEIA 3UD3P 2K7JA 1SPBP 2J0SD 1YIJN 2RKIB 3ZZZA 3HHKA 2R2RA 4JUZA 4CHQA 2ILZA 2GJFA 1Q8BA 2NSBA 5CJ7A 1E6VB 5J2DA 4C2MA 2A1BA 4DCHA 2QKQA 4FJXA 3EO3A 3FCWA 2OA8A 5ALJA 4KLEA 2XNQA 2CVIA 2WZ1A 5CYMB 2F1HA 1TKXA 2QARA 3P38A 5DETA 5AT1B 2OWOA 4RQ6A 5DZ7A 2EAPA 3VGMA 2EG2A 3GCWP 3RFAA 2DWQA 5B5EU 4KRWA 3QZ8A 4P0QA 5CABA 1E6YB 9RUBA 3FBFA 4CZCA 4LQ9A 3T5KA 4KN7A 2ZIUB 4EMDA 4UAUA 1S0VA 3DXMA 2A1RA 4CJ5A 2DFHA 2EC0A 4GV9A 1NSPA 3RR8A 3VEWA 1DLOA 1Y00A 1TL5A 3L8BA 1VHXA 1FVSA 3VQ5A 4WK1A 2OFGX 3N4MB 2M0GB 3TP2A 1A6LA 1R3NA 5JICA 2P35A 3HJEA 2D74B 1NO8A 1XNQJ 3SQ0A 4YVZA 3DOLA 1ZQEA 2RVJA 4O5FA 4Z4CA 2XZDB 3CJRA 3PSTA 4IG0A 2ZJ8A 3AEVA 3D6RA 4DMNA 3P5BP 3ZZ0A 1S79A 3BGOP 4CT9A 3FC9A 2IC3A 4B02A 2E2QA 3OHAA 4ZS6A 2UXDK 2V0NA 3N4WA 3V4MA 4JKDA 3VGUA 1RCOB 5KOXA 1SWWA 3B8AX 3KIOA 3OYGA 4QW8A 3OBWA 4DTXA 4ZVSB 1IKYB 1WD6A 3AQOA 3I32A 5L9XA 4YOEA 2RB7A 3M9MB 4HACB 2P6SA 3E01A 1DARA 3GU3A 2BTFA 5J0RA 4M63A 4PG7A 2J0QD 3CFPA 4NLWA 2CPDA 5U47A 1KLMB 3MMCA 2MQPA 4CF9A 4CEZA 3ILLA 3TUIC 4DOAA 3VOVA 9ICHA 4KHPK 4QWDA 3B4MA 3RVCA 4FF3A 5J0YA 2I5JB 4FWKA 3CDBA 3U6FA 2WF6A 2VG5B 2MGZA 5J2EA 4E8UA 2Q31A 4DV0K 3G8QA 4CBWA 3EW9A 1RTDA 2YJEA 4YOXA 3RRKA 4F9OA 3H5YA 3U8XA 3HKZC 3RJGA 4DS4A 6AT1B 5IWAJ 4OZNA 3D7EO 3GBTA 3AJ1A 2QARB 4FM1A 4PL2A 2MZRA 2BKEA 2F3JA 3O8WA 1L5UA 4HI1A 2JFDA 1RT2A 3C1YA 2AGOA 4CI6A 2XIDA 8ICUA 1HD0A 4H0TB 4NA3A 1UVNA 1TK0A 2E66A 2ZJRL 3GR1A 4ZK7M 2DEJA 4HH0A 2F63A 4KY3A 1Q18A 1DK2A 1GK8A 5BYSA 2ZZMA 2MAXA 1QQNA 2QA1A 4FYXB 5HJYA 3SBMA 2ZNZA 4M8LA 3MURP 1E4FT 1SVDA 2XYGB 3NASA 3UD4P 3QINA 3IBPA 2PFPA 3R5AA 4P4OA 4DSIA 5GADP 3O8MA 5CYQB 2H3VA 1KQKA 4CJ7A 1YJUA 2YTCA 3T9NA 3VAHA 3D3BJ 1L7NA 3KHGA 1PVRA 3R7BB 4N8NA 3MCMA 1OY8A 4OYMA 1N5QA 3D2WA 5ADXH 5AK6A 2BHNA 3FKBA 1TYQA 3NS7B 3VEZA 1MWMA 3HVAA 4DV5J 4NCAA 1KAYA 3W5ZA 3V6DB 4E98A 3MUMP 2QYCA 2B4JA 5C24A 3SJHA 1YQHA 2VONA 4PQUA 1PC4A 2DNZA 1R27B 4H4MB 1OJ4A 3IDHA 1HKAA 4R0EA 4EGLA 4J90A 1URRA 1FKPA 3MWBA 2FD2A 1CRXA 2GWJA 1EXNA 5IXUA 2Y8WA 2NXJA 1RHKB 3M2VA 4RPYA 2FE9A 4LF4K 3UMBA 4O5KA 3IXQA 4FLUA 2EFGA 2KKPA 3C6TB 1RKIA 5GAHU 4QCLA 3J81U 2SXLA 1RAHB 1AROP 4J9MA 2YQ1A 2CADA 3C28A 3CMQA 2DGUA 2BZFA 3CG7A 2ES6A 2A2DA 2B43A 1HUOA 5CYJA 2VBYA 2IDOA 4RW7B 5LM7E 5LMUF 3QWUA 1F9FA 4NMXA 4NXMJ 1WJ9A 4N41A 3WK4A 2VQEJ 1T05A 2W9MA 3FMBA 1BISA 2HMIB 1GXTA 3ZTPA 3V9WA 1ZAVA 3EPGA 3LDNA 3CCUS 2VA8A 3B0YA 2FGOA 4V1Ak 3VQ7A 3I33A 2XM3A 4DV3K 3DLKA 1UEKA 2C2OB 2QB0A 1T6DA 2NQPA 5EUHA 4YFKA 3I87A 4M7XA 2QFJA 4DFKA 3W65A 2I7NA 4B3TJ 2E5HA 4RTFD 1JALA 2YV0X 2G13A 3AMZA 4KFBA 1UEVA 2V4QA 3TJ9A 2RU3A 2FLPA 1WELA 2BW7A 1VSMA 3OYIA 2FJXA 3HM8A 1U1QA 3Q8VA 4NEYA 2HSZA 2QO3A 3H90A 4UY8O 3OUYB 1CJKA 4KH6A 4UT4A 2FPMA 2DY1A 3ZXWA 2KJVA 4LF8J 2ZUCA 4DXLA 2IM0A 5AKKA 4IG3B 4KB7A 1S9FA 5HRSA 4DL2A 3IO1A 2UUAK 2MKHA 1XUPO 3UQ0A 3OUYA 5K5MA 4FE3A 2ZH8A 1VBZA 4HL9A 2H51B 4LFAK 2XY5A 3R5DA 5IZHA 3VTHA 1DQ8A 5KFCA 3VCDA 1AXQA 3C46A 3VA3A 4AL6A 4E7KA 1RT6B 1EQYA 5DKWA 4LVOP 1VSIA 1KFDA 1IV8A 3J7A1 2R7TA 4QJFB 2E5SA 2EANA 5FD1A 1S12A 4US8A 1BWFO 4DFJA 3A1YG 2O4IA 1HNZK 2WB1C 1WHXA 5HVHA 4C8ZA 1O13A 2B4UA 2G09A 1N5WA 3CERA 4KHPF 2YJFA 1X4AA 3JPNA 1RI7A 3TU5A 4C98A 1QVFR 1RBSA 3M2UB 4V19X 4PHPA 1SIWB 2JC1A 2KN4A 1CJUB 4IQMA 4X4QA 1SL2A 4C4TA 4M5DB 4FJ8A 2XLKA 2R7SA 2U2FA 2IVPA 5DDMA 2C22A 3OYMA 1U8SA 3C6AA 2XSJA 3DHXA 1FJEB 2ZDPA 4YY3K 3M32B 1RT4B 1PVPA 5IT4A 1KTVA 4H4KC 2L41A 3M6GA 4FF4A 2Y0SC 2CQ0A 4I2AA 1Q7YT 1RT3A 3CCMS 5KRSA 1UT5A 3AA8A 4CHYA 4F02A 2JX2A 1YXQA 3PV8A 1HNVA 4M2YA 2CWKA 3SQIA 2DRAA 4FS1A 2M7SA 3AO5A 3BF1A 3DOMB 4CLWA 3MM9A 2OTLN 1NGEA 3F2KA 4CM0A 4GV3A 2F8TA 4NI2B 2VUGA 1S49A 3GIMA 3I4HX 1HA1A 2OPPB 3ZSOA 2E5LK 2B6AA 5AI5A 1VI7A 4B3SJ 4OLBA 1X7VA 1C0GA 2RRNA 3HCXA 5CHCB 1HNIA 2JWNA 2PDAA 4H4KA 4MFBB 5JS1A 1ZQZA 3Q8MA 2FZCB 5DGBA 2R2TA 5BYQA 1PJ7A 4I9QA 2GLEA 2G2ZA 2BX6A 3RBEA 2GHWA 3GDQA 5FDLA 4FJ5A 2A1SA 3T1HF 4M41A 2OSRA 3CJTA 5J2NA 1XN9A 4TXSA 4J9QA 3CDWA 3QNNA 5CA7A 2MEWA 3IM8A 4IR1A 2ZE2B 1HBMA 1VQMN 1RU1A 3VALA 5D8HB 5DM6Q 1VC0A 4YDUA 5DMRA 3IR6B 5MLCV 5B7WA 2HHXA 4K2JA 3LAMA 4EENA 1Z6RA 4OO1J 1YK9A 3TAGA 3ZO7A 4BXOB 2IMOA 3GIIA 4IJNA 1DQ9A 3RB3A 2PMWA 4FPIA 2W9CA 1RSCA 3CIZA 1D8ZA 4JP8A 1W2BM 3ID8A 1MSWD 1DGKN 1WAJA 2CUYA 3ZCMA 1RWMB 1VQOS 4C8KA 4OX7A 4C0ZA 2A1JA 3R27A 3MMAA 1QAJA 1N33J 3SCLE 1GAOA 4A48A 1U2CA 1C0FA 4NB4A 3IG1A 5DG9A 1VQ7S 4KJIA 2QEXS 1ITPA 2V68A 2CQGA 2LHTA 2JZ5A 4R0JA 2WFAA 2OHDA 1HQEA 1N5SA 1Y64A 1ASWA 3H46O 2VPZB 3H1QA 1TTHB 3ZDBA 4IFYA 1ATSA 5HOOA 3TUZC 1VYAA 5D0GA 3QIOA 3CC2S 3AT1B 2ZJPL 1RUSA 3M05A 2XSFA 3IC1A 3NL0A 2XYPB 1JJ2M 4GIBA 2V9WA 5D4PA 2ISOA 3NMRA 2WF5A 2DR6A 3HKWA 1QJHA 3IBWA 5CZ1A 3V6DA 4I1TA 2FHKA 2F76X 5KFUA 9ICVA 4KAZA 4HVJA 2ATLA 4KC5A 4I6MA 5CXTA 2NLXA 1FTRA 3PRVA 2JV3A 4GVBA 4WKRA 3IMXA 4IQUA 1RE1B 2XCAA 3RAQA 2DYAA 4B3RF 4NLCA 4Q0BA 2CG8A 2BGWA 4RU2A 5GMEA 3OV7A 3GIKA 2QMXA 2O8CA 4ZDNA 5KPZA 2OJ3A 2IBOA 4QWEA 3CCLS 3OTOJ 5AQFA 4RQ2A 1NZBA 2QT7A 2OCEA 2DNNA 2XZTB 4NXNF 2KW4A 1J5OA 2VCPA 1ZQDA 1GX6A 5IFMA 4XUSA 3MGHA 1G7CB 1SZ2A 1KC8T 8ICBA 2XY7A 3EMTA 2V4JB 1X5TA 3G6XA 5C25A 8ICTA 3W64A 1ZQBA 3QU4A 1NJXA 2ZJRQ 1MMNA 4TY8A 1RWXB 4IKAA 1V5VA 1JK9B 4X4NA 4C11B 1NMEB 4ZP6A 3Q7BA 2VV5A 2FQQB 4OJRA 4A4JA 5HP4A 4BWMA 1DRZA 2YCHA 1RDBA 2OEMA 1QUPA 1RFQA 3J80Y 3OHBA 2IVYA 3HHLC 2AX0A 1TELA 5AIAA 5E3AA 4RW4B 1RWVB 1COOA 4P71A 4FM2A 4B3OB 1EQMA 4E7LA 3LPYA 3CCVS 1BY9A 1F9EB 3WQUA 2R2UA 3HO1A 1WHYA 4CJTA 4FVMA 3D2FA 9ICXA 2NXEA 4IRKA 5JMVA 3THVA 2HOIA 1MN7A 3WNGA 2Q79A 1EO1A 5BPMA 3CCVN 4ANEA 3N7RC 4JKEA 5ALVA 3LWMA 1NJZA 8RUCA 1C4AA 4JI1K 5AE3A 2FMPA 5DBCA 3TYTA 4NWIA 4HUGA 4LD0A 4F7VA 4N7TA 3EZWA 3I6PA 4CDIA 3KWIA 2JH3A 1ZOTA 2FZGB 3DFEA 3DLLL 4GXJA 4OKKA 3SENA 4W90B 1P9QC 1U2FA 5A8RB 4U8VA 2ZKTA 3NXZA 5KL1B 2BANB 1U2VB 5T14A 3UWTA 3IAYA 2GA7A 1A5VA 2WVCA 3GE1A 2Q0ZX 2FUG9 2VWBA 5AK3A 3TZXA 8ICGA 3KG1A 1RDWX 2NR0A 1FW6A 2Z57B 1O1WA 4K41A 4IYQA 3IR5B 1X4EA 4A8WA 2D8CA 5KFKA 1B7FA 4JI0J 3GILA 3QBCA 3M8ZA 4PUOA 3PR5B 3QEVA 3W60A 2B4PA 2KFNA 4BC7A 3H2VE 2LYVA 5E3PA 1B99A 3ATUA 4DUZF 4F4WA 4MK8A 2OPSA 3ZSRA 2E5GA 1RAJA 2BZ2A 4AD6A 4LF6F 1UETA 3WK8A 1W25A 2HVZA 1W97L 4FZYA 3PYFA 5BREA 3KD5E 7ICKA 1IKXB 1KWMA 5AKHA 1C20A 3U02A 1NJIO 4JI6F 3PMLA 3L2QA 2DH8A 1HYVA 5T7BA 3HVWA 3VAGA 1Q9XA 2VJ5A 4DTUA 3DOKA 2G0IA 2ZH1A 2QL9B 1RDDA 2G0AA 2ZH2A 3HPGA 2KNJA 3RMBA 4DOBA 3BKFA 1HW8A 4FF1A 1CXQA 5AIBA 3OVBA 1RGIA 3TAPA 4W5OA 1IBKF 4N5SA 5AZIB 2O4GA 1Y0HA 3DJCA 1YJWN 1UJ5A 3SQOP 3TA1A 3KUGA 4RQ1A 4DX8H 1L3KA 3L9ZA 3HJFA 4DOCA 2QZ8A 2FVRA 2CKWA 1RDFA 2E44A 1C0TB 2F1FA 1SXLA 1VQON 4ICLA 5CHGA 5LMUK 3C3LA 3VQDA 1HUXA 4RQ4A 1ROFA 1Y9OA 3LP1A 5LSRA 3FJ2A 1Z25A 2BKOA 4I7FA 4DJBA 2O8FA 1TE2A 3SSRA 4IUFA 5AJ3J 2IDEA 4YEAA 2DGTA 2MLZA 3P4UB 1C0UB 1GFWB 4JKFA 2APOA 3MM8B 7ICIA 2R7UA 1YI2N 3FAHA 5K14A 4Q2MA 1WC3A 5HROA 2PMZD 4KO0A 4M47A 1PBUA 3DKDA 1B7YB 2CJAA 2FJ6A 2R8GA 1Z1VA 4OCZA 5KFJA 5EHHA 4M94A 5KG6A 4OJ5A 1VSKA 1ZS6A 1S4EA 3FZLA 2V69A 3HILA 1Q16B 4GO5X 1ZD2P 3JPOA 2MRLA 1REVA 1WCLA 3KLFA 4IC9A 3AU2A 1Q81O 2LQ8A 1PILA 4O44B 2A1JB 5HL7Q 3L3VA 1DTQA 2KZ3A 3OQ2A 2W25A 4P72A 2HFSA 2H3FA 1KLNA 3ENBA 1D9FA 4YDXA 5FPDA 9ICFA 5CH7B 4DR3F 1OUQA 1SC4B 4YHHK 2EFPA 3MXIA 2MJUA 2BJEA 4AE5A 9ICOA 3CJQA 3WXJA 2P2CB 2PI4A 5G5GA 2XS2A 3NOGA 4KLIA 5AQYA 4HDGA 3C7NB 2LQ5A 1X5OA 4CF8A 3LA0A 4JN4A 3RBXA 2CPXA 2R7OA 1B0XA 1SKUB 4FNIA 3KK1A 4YB1P 2G4BA 3ISND 2C3UA 2JSXA 4IRDA 3GSIA 1NZAA 5AXMA 3OFGA 1RABB 3VEYA 3QLHB 1IIPA 1ACMB 5KAIU 5J2QB 3M2RA 4DU4A 4C4SA 1LEOA 4ZCIA 4OX9F 1TUUA 4DQSA 4WFBL 3I55N 5HO4A 4RW6A 3E01B 3N9UC 1VDHA 3SDEB 4K25A 4FWNA 2OHFA 2N3OA 2BA9A 2XMAA 3DXSX 1RA7A 3FRYA 1HRHA 1YHQS 4DEZA 3P6YC 3UMGA 3CCWA 2NRVA 5JU5A 3SXLA 4XA5A 4LIWA 4RNOA 2DFLA 5J1NA 4ZLPA 2HPUA 2HS0A 4AQYJ 3O44A 4ES1A 3H20A 2JLGA 3HP9A 5GAEU 3H0RB 4CGZA 1QAIA 4RQ0A 1C1BA 2FJWA 2RAQA 1RDRA 2UU9F 1XQIA 4ZVRB 5J0WA 4R5PB 2WTUA 4ZPAA 1RHJB 1GLDG 1BMQB 1F9HA 1JLGB 3BSCA 4JS5A 3BDEA 1R0AA 1RPLA 1WWHA 4J5OA 3O9RA 4CCHA 1VHFA 3RAMA 2RF2B 4CHPA 3KKAA 4MH8A 5AE2A 5BOLA 7ICFA 1BUPA 1M0SA 3DLLQ 1DLOB 3SR6A 4NL9C 2H5XA 4YS2A 1CI4A 3TACB 4DZ6A 2VC1A 2AX1A 3HP6A 3DXBA 1S7IA 1NK4A 1I51B 2D9PA 5ADXA 1Q79A 3IP4B 4RPFA 1NZPA 1CJVA 5AI8A 2ZBRA 2AZ3A 2QL5B 4LF7F 4LSNB 3FBCA 1H98A 4Y2QA 3RB6A 1VHIA 1ZM2A 4E19A 2W2NP 4UTGA 2A6AA 2UUCK 5J0OA 4IR9A 5DB8A 4AP9A 4OYXA 1SC3B 4X4VA 2UXBK 3TA0A 2KDOA 5LMNJ 3RW7A 2JWKA 5AQIA 2Z1GA 2EI5A 3MUVP 1VMBA 4OPHA 1TKZA 3AHPA 1S6QA 3B8HA 3G2XA 4KH1B 4ZIVA 2P6TA 1NNLA 3CGIA 2E2PA 5ALLA 2K2PA 3AVGA 2ZJAA 4LBIA 2LM4A 4KPCA 1JUDA 3HLUA 4E89A 3WKBA 2NS1B 3SFGA 3BN7A 4PEOA 4RKUC 2LXIA 3Q7CA 2EBEA 3OVNA 4CEBA 1HHQA 3LDQA 5J0PA 3D1QA 4KTQA 1N6QA 5JVGQ 4X84A 4Q8FA 4M45A 4O55A 4BRAA 3K57A 1IG8A 1Q7LB 4NA2A 3ISDA 9ICIA 3LOUA 4RT2A 1HIYA 5AK4A 1Z19A 3AFGA 2DB1A 2DXFA 1Q3UA 5AM5A 4FK0A 3MF5A 3BGRA 4LFAJ 3JB9k 5B0BA 4HTJA 1ZBLA 2DH9A 1X6IA 3TFRA 3LDOA 1NGHA 5F41A 4JI3F 3JPTA 2Z7JA 3GV7B 3DCAA 5H1SV 1BL3A 2AEMA 4J8FA 2Y9UA 1RXVA 4C11A 4LF9K 5DB6A 4CZIA 2NPIA 1N5TA 3O9QA 4IS7A 5AM0A 4BJQA 1F3FA 7ICSA 4EI2A 3KLIA 3CD5A 4A8OA 2MZQA 3MEGB 1ELOA 1EB0A 4C80A 1HFEL 2V52B 4DPTA 2MKSA 3MM7B 2YN4A 2BACA 4P2HA 1K1SA 3ETRA 2E1PA 4PABA 1ZQXA 1QD1A 1UA0A 2ZJPQ 1VQ9N 4JRPA 3ALRA 3EX7B 1ZA1B 2YY6A 3ZSYA 2JLEA 2Y1RI 3NY0A 1RKJA 1NGGA 2BRKA 1NPPA 2CH6A 5KTQA 1VSFA 2IOFA 3EYZA 4FYYB 4N8OA 1SQFA 3EPIA 4JBCA 4LF1A 4ES3A 4NYPA 2A42A 1YHQN 4NPOA 3WX8A 3V6KA 2B6GA 3S3OA 3B6OA 4MK9A 4BC3A 3MOJB 3D7SB 2CQCA 3DMJA 4K4GA 2ATQA 1S8OA 1V38A 1PAEX 3VESA 4OJ1A 3BPSP 3R8YA 1PK1A 3O3FA 5LMNK 1CQMA 4B8CA 2L3MA 4NLPA 1IG9A 1OW5A 4JMUA 2P6UA 5ETQA 3NG8A 4DU7A 5LY3A 4RBTA 2X3GA 2EC2A 3D2NA 4DV2K 1T3QA 1KKXA 1KD1O 4DR2F 4NEZA 2LU2A 1IBLF 5CY4A 3LUYA 3WC0A 5D3GA 1BD6A 4CF2A 3FSXA 4FF2A 1O0PA 5IOLA 3BQ1A 5A0YB 4A47A 1M1KT 2J6UA 1L3TA 2YKMA 1ZXIA 5AJ3F 1BLUA 4NCBA 4M3RA 3CNQP 4K4SA 2F3NA 4CIEA 1U0HA 2CXEA 4ZVEA 3DLHA 4ZCMA 4D3HA 2Q2RA 3NBPA 2FF6A 2B21A 4EFHA 2FSJA 1MA7A 4CECA 2HFVA 1GTHA 3KHLA 1LKYB 4PWDB 4DTJA 4DZDA 1S1UA 3RH4A 4YG2A 3AA5X 4Z7CA 4I56A 2QV6A 1XO1A 4Q8EA 2B4VA 1BWEA 4K5SA 5J2NB 5G0RB 4N76A 3LGHA 1S1TB 4CO0A 2VQFF 1IBMF 5KFXA 2P9UB 3CJCA 4RBVA 2ZUAA 4OZLA 4KLUA 5F0XA 1DZ5A 4F5PA 2I7PA 2EPIA 3DGPA 1X8DA 3NS6A 3BEGB 2AYGA 3MR7A 2MQQA 1VLBA 3EDRB 1OO0B 2HHUA 1H38A 2EHGA 2YXLA 4MT1A 5J2AA 1JLBB 3RG6A 2IGIA 2VKQA 1SJ4P 3GJQB 1KHWA 4JK1A 1TVRA 3FBEA 4FXWA 3TAQA 2ZH9A 5GAEI 4ZVHA 4PKHA 1GXUA 3MN6A 1HEKA 1J2VA 5KGXA 4MKBA 4ER8A 4USWA 3C2MA 5D49A 5EU7A 2KI2A 2WAQD 4BY9C 3M9OB 4FJLA 3J7Z5 1TFRA 1UJ6A 2K4IA 1MG7A 3HT3A 1WC1A 4KHYA 4CD3A 2RS2A 1WG5A 3BSAA 1TUYA 2ZD1B 5DQIA 2D0OA 3F53A 2YNGB 4PR6A 5A2QO 1HBNA 4HT5A 4IKFA 1C1CB 4B9QA 5BJRA 1NOYA 5EXWA 4O3SA 2XMKA 4FVUA 1N34J 4BC4A 4BVOA 3ZX2A 3TWHA 4ZTJA 2F4FA 1NJYA 3D1HA 2O8DB 1IQTA 1LWFB 4WWSA 5JRTA 2KO1A 3DRPB 4CRXA 3QFWA 2CJQA 1SL0A 4ED8A 4KKOA 5A0YA 4ZH4A 2MLXA 2FJVA 4A8YA 3HKZD 4O44A 5E26A 4MFFA 2RQ4A 3UB5A 3CPWR 4E3SA 3TKAA 2OEKA 2Z56B 2KH9A 9ICWA 3QO9A 4IRCA 4H5VA 4PWDA 4BBYA 2J0XA 5KG0A 1WSIA 3CXCR 3R6MA 1UL3A 5FRNA 3O80A 3U1NA 3LYSA 1HWJA 2QWPA 1FFVA 4C8MA 2R9LA 4QWAA 2BJ9A 7FD1A 3MAQA 4GFJA 4LREA 2BQRA 4KB0A 4KI4A 3AA3A 4YNQA 3R6GB 5H9EJ 3H3OB 4P6QA 4JKGB 3GLJA 3ZSQA 2DGWA 2KHCA 3NS1A 1BPBA 3A3PB 1YVNA 4ZPTR 3G4SN 3OYAA 4KLDA 4CJUA 3OYEA 3TO8A 1CZ9A 1VQKN 4LVNP 1HI0P 2HVHA 2BXJA 4DUTA 3WIUA 3G4SS 4ILHA 2BJ1A 3KLGA 4JWNA 4LBHA 3IWXA 9ATCB 1RQLA 3AD7C 2O8FB 2UVUA 2M9KA 4M3ZA 2X1BA 5KFPA 2W1BA 3WEEA 1EWQA 1KXPA 4M5IA 4JI2F 4NWBA 2PEHA 2O8BB 3S3NA 2KM8B 3C6UB 1BXNA 2HHQA 4USIA 1LQ9A 4PYAA 1BPZA 1RNHA 3G96A 1TMMA 2P9CA 3IKMA 4OI4A 5KT3A 5ALPA 4OZ2A 3ZT3A 2YMMA 2LMRA 1B4SA 1UFKA 2EX3A 2PFDA 3UDCA 2E3TA 1D1UA 1U1LA 3AJDA 1LWEB 1C0TA 1MWQA 5C2CA 4BROA 5GAHI 1ZM4A 5KFAA 4LF9J 4DU1A 2BDPA 2WRMA 2D3ZA 2I2YA 3DRSA 5GAGP 2DNLA 3WKAA 4GKKF 1S59A 9ICRA 1GEHA 1XQSC 4NZ0A 3P45B 4LFCJ 2GO7A 4YD2A 3HSCA 3J7AN 2F7VA 2UUAF 4BGBA 4LH5A 3G6ES 3QBWA 1AT1B 2HS3A 3CCRN 5ALSA 4UOGA 3FVYA 1KVBA 4ECTA 1L7PA 3KKFA 3LM9A 4P2MA 3R97A 3OL9A 1TL1A 2DPNA 2UUAJ 3IR7B 5ALKA 3MPDA 3NF6A 2QGFB 1LK7A 4NZ6A 3WNHA 1KW4A 2D3DA 4Y2VA 4WYBA 1WBDA 2H9ZA 4DR7K 1Y7PA 2O66A 3OS1A 2CDRB 3N6NA 4DR5K 2KG0A 2VODA 3TQEA 1ZQWA 1S99A 1BPEA