3HP6A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus f710y mutant bound to g:t mismatch
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
579
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
total genus 206
structure length 579
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3hp6A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3hp6A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hp6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hp6A01
4TUPA 1C6VA 5KFRA 4M3YA 3TABA 5CZ2A 4B9SA 3AO2A 4IRDA 2IAJA 1SL0A 4YR2A 4RPZA 1S0OA 4KAZA 1U4BA 4OVLA 3ZSXA 3UXPA 4DS5A 2R8JA 5TZVA 2KFNA 2DFFA 3DRSA 2QKBA 4RPXA 4P2HA 2I9GA 4TSXA 3RH5A 3C2LA 1VSLA 5HRNA 3KLGA 2BQUA 5KFJA 4UB2A 4AHTA 3LDAA 4ED0A 4B9TA 2V4RA 3JPRA 3SUQA 5SWMA 5HMLA 4CJQA 3SZ2A 3MR2A 1CZ9A 2G8KA 3AO4A 4RPYA 4J9RA 1KEJA 2X6NA 4CEDA 4IG0A 4HCBA 4J9NA 4M6WB 9ICFA 4O3PA 4LSLA 4M9LA 1HNIA 2BQ3A 5J2JA 2ASLA 4LZGA 3HSTB 5KG5A 3ZCMA 1T05A 2PYJA 8ICHA 8ICWA 1HJPA 3NTUA 5DG8A 4PHPA 5DBAA 1ASVA 4DTJA 4BE0A 1UA1A 4ECTA 3V9WA 5HRPA 3H40A 1EKEA 5SZTA 1Z00A 4DF8A 3BQTA 3RB6A 1ZQEA 1TKZA 1ZQQA 2DFHA 4X5VA 4I7FA 4B9UA 3WNFA 1UOCA 3T3FA 3L2UA 5IIOA 1RXWA 1J54A 3JPNA 4HUFA 3RJKA 4QZAA 2A1JB 3ZSRA 3TFRA 4J9SA 4GMJB 1QHTA 2B21A 2R7YA 3AA3A 7ICJA 3HK2A 1IH7A 1JMSA 5DMRA 4IQUA 4W5OA 4UB5A 4I27A 8ICGA 4CGGA 3PNCA 5DB9A 2P6UA 1KFDA 4YD1A 1HYSA 2JEGA 2UVWA 3FFIA 4RQ1A 4E7IA 4Z6EA 2BCUA 8ICIA 1VSMA 9ICXA 1QE1A 3L2RA 1RT6A 2W9CA 5KT2A 1NKEA 1RBTA 4O4GA 4I2PA 4M3WA 4J9LA 4CK2A 4CGIA 1ZBLA 3PV8A 5J2AA 9ICNA 3HVTA 4Z4FA 3AVKA 2BHNA 4DL3A 4Z6DA 1T8EA 1NJYA 4MFFA 1A77A 1RT3A 1KRPA 5DGBA 5KFZA 1T4GA 3EZ5A 3DLKA 1ZBUA 1X9WA 4RQ4A 4PUOA 5J0SA 4O0JA 2PY5A 3CQ8A 3SPYA 4OKKA 9ICTA 3H8JA 9ICVA 5CY4A 4JRPA 1HNVA 2R8HA 2WONA 2E4LA 4O0IA 1JXLA 4Y1DA 9ICJA 4FJLA 1UT5A 1HYZA 5DK5A 1WLJA 3V1QA 2HHVA 3NF6A 1W9HA 3MR6A 2IS3A 4PHDA 4DFJA 2V9WA 3RJGA 4AHUA 1NJWA 4J9QA 2BCRA 4M9GA 1Z00B 1Z26A 4GC7A 3AVJA 1RT5A 4IKFA 5HROA 2NRZA 7ICVA 8ICFA 1ZBIA 4MEXA 3OYFA 9ICHA 3RMDA 2YNIA 4N5SA 3TI0A 2HNYA 4FLZA 5EWGA 4RQ8A 3QEPA 1RDCA 2B5JA 4FW2A 3NH0A 1KDHA 5I3UA 1N48A 4Q44A 2FPKA 1CZBA 5K14A 4MFAA 2ZUBA 1BIZA 2UVRA 1BISA 1NK9A 3AVLA 4KN7A 5J2HA 5IIJA 2BCVA 3QLHA 4Z4GA 4ECUA 2NRWA 5J2DA 5KG1A 3KKRA 4Z0UA 5KT3A 4KLMA 5BOMA 4KHYA 2XGQA 4MQ3A 3SNNA 4UAZA 3MBYA 4TUSA 1G15A 3I0RA 4QAGA 1ZJNA 1HUOA 4KLLA 1BPDA 4E1NA 2GWSA 2ZJAA 4CHOA 4DU4A 4OPJA 4J2BA 3JYTA 5C5JA 3OS0A 4H4OA 3ZT4A 3ZSWA 3C1YA 5KFGA 3JPOA 2C2DA 2WOMA 4OKJA 3V9ZA 4DTMA 4KTZA 2DTUA 2YKMA 4F5RA 3C23A 8ICQA 4LVSA 4LH5A 2BCQA 1U49A 4R65A 4ELVA 1X9SA 4F91B 3NAEA 3AVFA 2Z1HA 3O3FA 5J0PA 3AVCA 1TKDA 2XO7A 2ITGA 5CA7A 3V9XA 3HPOA 3MXIA 1NK6A 4I2AA 4EZ6A 1JLEA 2OPRA 5EWEA 3M9OB 3ZD8A 9ICAA 4YD2A 1CXQA 1RBSA 3L3UA 4MEYA 3T19A 2ATLA 2FLLA 2ZUCA 3HPGA 3OYJA 1XSPA 3QEWA 1HQEA 1S1VA 4DL2A 4J9KA 2IOCA 2JEFA 2FC0A 2E6LA 3NFAA 3AO1A 3OYCA 3V4IA 4NLNA 4FLYA 1JL2A 5CWRA 2VA2A 2D0BA 2NUBA 4DSIA 1W0HA 4DFMA 1SL1A 1XWLA 2AU0A 3NF8A 3RMAA 4IFYA 3OHBA 1S6PA 1VSIA 4Y1CA 1L3TA 3T5LA 1J53A 4M47A 2HVIA 1K6YA 3B6OA 3SUPA 2FLPA 4CJTA 2H5XA 5FROA 3K5NA 3NBPA 2AGOA 1WCNA 1UA0A 4Z4CA 1HUZA 3K2PA 4W5RA 4E7KA 1EX4A 3RTVA 4HHTA 4UQGA 1KSPA 2PFQA 1NJXA 1RT4A 3RAQA 2W9AA 1QS4A 3NH1A 1S0VA 4CJEA 4DTSA 1XI1A 1KVAA 4RW8A 3VQEA 1LW0A 4FK4A 2JZBA 1FXXA 3LP1A 5DLFA 3BDPA 3OYIA 4CFBA 5KGWA 3MFHA 4AHCA 4NCGA 1Q9YA 5J2FA 4PWDA 3TARA 4KI6A 4CHQA 4O44A 5KFHA 1GOBA 4CE9A 1YTAA 2GV9A 4KB0A 4P4PA 4QZEA 4RQ0A 2IHNA 4BXOB 4BGDA 1ITGA 1DTTA 5KG4A 2JEJA 3EY1A 4RNMA 1EXNA 4IQVA 3RAXA 1S6QA 1ZQJA 2J6SA 3PW5A 1MQ2A 1PZNA 4EBEA 2BPFA 1QLNA 4DTPA 1UAXA 5KRSA 4FJGA 1S5JA 3VQQA 8ICXA 4E3SA 3OVNA 1NK8A 3VQ6A 5DB7A 4O3NA 3VA0A 3AO3A 3ZDAA 9ICRA 4ECQA 1RTJA 4BDZA 4M9NA 3VQPA 1XU4A 4F3OA 2PI4A 2BDPA 2RDJA 4I2EA 3EWAA 3SUNA 1BGXT 4F4KA 1U45A 3LANA 3NGZA 2QKKA 5KFKA 4QZ8A 4DMNA 2WTFA 3Q8RB 1NK7A 1S9FA 5KFDA 3A2FA 4JS5A 1UT8A 5HRRA 4N76A 5KFYA 2A1RA 3ZD9A 5IIKA 3CYMA 3RR7A 5CYMA 4Q8EA 1X1PA 3OYHA 4NM1A 3RJHA 4CF2A 4XUSA 2ZTCA 1CXUA 1ZQWA 1LB2B 3ZT3A 4I2JA 3LP0A 2D0CA 1HPZA 3GV7B 3TAPA 1C0UA 3T5KA 1RPLA 3M9MB 3S3OA 2HVHA 4ED7A 2HNDA 2XHBA 5JUMA 4N47A 2Y1IA 4FW1A 4XA5A 4ECSA 4OGEA 3RBDA 4DSKA 3AO5A 3N97B 5DQGA 4B8CA 2W42A 4DTUA 1ZYQA 2UVVA 5C25A 1S76D 3RMBA 1L3UA 2KZ3A 3C5FA 2R8KA 8ICPA 2G8WA 3S3NA 4EBDA 3DRRA 1LWCA 1CLQA 2R8GA 1RNHA 4BWMA 3HM9A 3C94A 4F50A 4CFDA 1S9EA 3ISBA 4OLAA 4RNOA 4KTQA 2D5RA 1VSFA 5IINA 5KFPA 1NKCA 5KFNA 1RXVA 3DI6A 3H7IA 4CJFA 2VG6A 3G6XA 2BGGA 4R63A 4M9HA 1QSLA 3ZDDA 1BQNA 1WSFA 2YNGA 1RBRA 1TL1A 5KRTA 2ZUDA 3QERA 4MF8A 4JS4A 5F9LA 3H4DA 2OWOA 3VQ5A 4FLWA 3V6DA 3PW0A 4M04A 4UB3A 3TAQA 2XCAA 3C2MA 2F8SA 1BPXA 4CF1A 4CFAA 4DU3A 4TQSA 1RBVA 8ICRA 5EU7A 4YXJA 4F4WA 1ZQRA 1JLAA 3RJEA 1ZQOA 1RT2A 3NGDA 7ICTA 3NGYA 1TAQA 9ICUA 4DFPA 4KLIA 5J2GA 5HRSA 1U04A 3V7LA 3RJFA 3S3MA 5DG9A 1RDAA 5J0UA 4DSEA 3Q8MA 3QESA 5J2BA 5KFIA 4R5PA 2W9BB 4FJ9A 2KZZA 1VRTA 4NM2A 4QZIA 4KLEA 4B8AB 4GXJA 3CFRA 4OLBA 5HMMA 4E7JA 3HP6A 4JV0A 4Q8FA 3MR5A 1VSHA 4ID5A 3QEIA 4UAWA 3C5GA 4DQIA 3RR8A 5DGAA 1Z3EB 1SKWA 3AU6A 4B9NA 3NF9A 4KHWA 3AVHA 1IKVA 4FLTA 4YR0A 1ZQPA 1WN7A 3GFKB 3K5MA 4FJXA 3V9UA 3KD1E 1KFTA 4YCXA 8ICLA 3TFSA 2RPIA 1IO2A 3NHGA 2BKEA 3ZDBA 4FZZA 4O3OA 4KTWA 1BCOA 1Y97A 4EP4A 1H38A 1BIUA 2GBZA 3AVMA 2LSNA 1MSWD 4GXKA 4QZCA 7ICPA 1S77D 2NRTA 4DL6A 5HP1A 5CHGA 4KITB 1NJZA 4YP3A 2BR0A 3MGIA 3RH4A 2BPGA 4RW6A 3PW2A 4F4YA 1J9AA 3LK9A 3WNGA 3MFIA 4O9MA 3DOKA 4UB4A 1TK5A 1IKWA 4ELTA 3AA5X 4HVJA 1K1SA 4CJRA 3KLEA 4P4OA 3PO5A 2OPPA 4Z6CA 1SL2A 4CJWA 4F5PA 1U9LA 4GXIA 4PGXA 5CP2A 1BL3A 5FDLA 3LZJA 4YMNA 1ZQGA 2YKNA 1LAWA 3QNOA 1GOAA 5KFAA 5BPCA 2AGQA 3U6FA 3KLHA 1RTDA 2G8UA 4BE2A 1XSLA 4QW9A 2HHQA 4KLUA 5L1KA 1MC8A 4EYHB 3C6UA 4HYKA 3DM2A 3K57A 2IHMA 2Q0ZX 4DL7A 2YHAA 4K8ZA 4ZHRA 3OYKA 4J9OA 3NDKA 4M45A 4RW9A 4KRFA 2F8TA 4DQSA 2OZSA 3MABA 3M8PA 4ECXA 1IKYA 4N56A 3P83D 4B9MA 1VSEA 1ASWA 2ZTEA 3S9HA 3VQAA 2XCPA 5KFXA 3GIJA 1S10A 5EWFA 1ZJMA 2C2RA 1XSNA 4QWBA 4J2AA 5J29A 3FYHA 3AUOA 4PGQA 3QZ7A 5KT4A 1WSHA 3PR4A 1O1WA 3ZSVA 4I9LA 4CHYA 4ED2A 1SZPA 1IKXA 4ECRA 3L2WA 5KFBA 3M8RA 1TK8A 3SPZA 4IG3A 4W5QA 2ISPA 3AV9A 4Q5VA 3OGUA 3DYAA 3C6TA 1JL1A 4BWJA 4CHNA 5L1LA 3SI8A 1B9FA 4I9QA 3JSMA 1LWFA 3UQ0A 4ECZA 4NYNA 1JXBA 3ZDEA 3GIIA 3K5LA 4CJKA 3LPTA 3MAQA 2PZSA 4R66A 5BOLA 4FBTA 7ICNA 3CG7A 1TFRA 3EPIA 1TK0A 5KT5A 5DQHA 9ICKA 1D8YA 1ZQFA 4DL4A 4IQTA 5DQIA 9ICOA 3KKSA 5J0WA 3MDAA 1A5XA 1NK0A 1ZQKA 3G10A 5J0OA 4QZFA 3PUFA 5J2NA 1EXQA 2RN2A 3SI6A 4LH4A 4YR3A 1A5WA 3VQDA 2QK9A 5J2IA 2Z1JA 2VG7A 4DFKA 5IILA 4TUQA 3SV3A 2HHSA 1KVCA 1S97A 4OKEA 1TKXA 3GQCA 4AHRA 4PH5A 4DG1A 2BQRA 3VQ8A 4FJKA 3LWMA 1BPZA 4FLXA 4R64A 3O4QA 2KTQA 4F92B 8ICKA 4B08A 4C8NA 9ICLA 3H8WA 3NE6A 5E41A 3MR3A 4L8RB 4KLFA 5KFTA 4I2HA 4RQ7A 4F4ZA 3KTQA 4FZYA 5CJ7A 4E7HA 7ICFA 3RB3A 2M9NA 4NLZA 1T3NA 3KHGA 4CCHA 1UWBA 4PY5A 3RRHA 1DOQA 3AVNA 5J0TA 3G6YA 4FS2A 4RUCA 2FLNA 4CHZA 3SQ2A 3T5HA 5J2PA 2C2EA 3RB0A 3K5OA 3OS2A 5KFOA 2FBXA 2ZJ8A 1DTQA 4F2RA 4ED6A 2DFEA 4ZTFA 5KG6A 3EYZA 3IAYA 1T03A 3Q8SB 3VQ7A 3DLEA 1D5AA 4Z6FA 5J2MA 4M3ZA 3Q8PB 5HP4A 4GVMA 2W9CB 3TAFA 4Z4IA 4XRHA 4QZBA 4UBBA 4YMMA 4JWMA 4QCLA 3UXOA 3RH6A 1WSJA 3HP9A 1IG9A 3GDXA 4DSFA 3H8SA 3HPHA 1YT3A 3LDSA 1VRUA 4C8MA 3HX0A 1RTIA 4ICLA 4FJMA 4FXDA 1Q8IA 4H8KA 4Z4EA 2C22A 4FYDA 1ZQDA 3L3VA 3EW9A 7ICIA 4DOBA 4QWCA 4I2GA 8ICCA 3CM6A 1FKOA 4IBNA 1NOZA 1QSYA 1JLGA 1S1TA 4O5BA 1BPBA 1RCHA 1WSGA 1ZQSA 4PPXA 4J2DA 9ICSA 2FMPA 5L1JA 2ZTDA 1TL3A 5DB8A 4CK3A 2X6SA 4NCBA 3AVIA 4CF8A 3QIOA 4TQRA 1D9FA 2FBYA 3G6VA 4M3XA 2Q3SA 1L3SA 1U48A 4DOCA 3M8SA 3OYBA 3SQ4A 1ZQYA 3HYFA 3KK2A 9ICMA 3JPPA 4QZDA 5KGXA 4CK1A 5D46A 9ICCA 1WAJA 3U3YA 4YG2A 3HT3A 4R8UA 4ED3A 1RTHA 4I2BA 1FKPA 4KO0A 1VSDA 8ICVA 3GV5B 5DB6A 4FJIA 1RYSA 4RW4A 2B6AA 1ZQNA 1ZQZA 2YNFA 5KI6A 4I2FA 3AVAA 3RB4A 4RG8A 4K8XA 3OSPA 1IXRA 4IR1A 1ZQCA 1BHLA 1VSKA 4AHVA 4DF4A 2PFOA 4KLJA 9ICGA 2P5OA 1S1UA 1ZETA 3VQ9A 2ZD1A 2G8VA 1BPEA 3PMLA 3CFPA 3ZSOA 3KK1A 1B43A 2VWKA 4AILC 4PGYA 5DG7A 2DY4A 4ZTJA 4E7LA 4KLOA 2O4IA 4CEBA 4F8RA 4CJSA 3OYNA 3TAEA 1C1AA 3V6KA 4EP5A 3NF7A 2RF2A 2XC9A 2P66A 4K4HA 2AQ0A 4G3IA 3OYDA 3PX4A 2G8HA 3AA2A 1AROP 4EEYA 5L1IA 3P5JA 1EP4A 3PY8A 7ICKA 3KLFA 4KLHA 3KK3A 3V9SA 3HJFA 4OJRA 2ASJA 3AA4A 2HHXA 2JZBB 4M9JA 4DTOA 5KFQA 1ZQXA 3RBEA 1COOA 3F9KA 3NGIA 2RKIA 2XY6A 4CERA 4M3UA 2F96A 4F93B 2J6TA 2NRVA 4F5NA 4CIEA 4OPKA 1NOYA 3E01A 1ASUA 1S0NA 4TURA 3K75D 2F1IA 4FM2A 1C1CA 1JLFA 1C7YA 4CJ5A 5HHHA 3H08A 1MQ3A 3AVBA 1TAUA 4FLVA 3WNEA 4QZHA 3MEEA 5J2CA 4YQWA 4KPYA 2IBKA 4W5NA 3CFOA 3ZSQA 3B0YA 4M3TA 2ZJ5A 4MF2A 1SV5A 5KFUA 2W9MA 2XRIA 3RJJA 3QIPA 4YN4A 4YXMA 3PVXA 5FRNA 5KFFA 4I2QA 2P5GA 3PW4A 2PI5A 1ZQIA 4FJ7A 2BE2A 9ICPA 2GUIA 2DFLA 3M8QA 4ECWA 1XO1A 5CR0A 3ZT2A 2XGPA 2P51A 4KHSA 5I42A 3UPQA 4KHNA 2VWJA 2UVUA 4ECYA 1MU2A 1B22A 3HXMA 3LWLA 1XC9A 3HL8A 4B3OA 2JEIA 1JIHA 1JN3A 3IG1A 1ZQUA 1N6QA 1KLMA 3IHQB 1Y88A 1ZQHA 7ICGA 1KVBA 3D45A 3P1GA 4JK1A 3HWTA 4DEZA 1LWEA 3JPQA 1S9GA 1HYVA 2IA6A 3V81A 3VN5A 2PXIA 5J2KA 4JV1A 1FK9A 4PQUA 4ELUA 8ICTA 1LAVA 3DLRA 3CM5A 1SKRA 2AGPA 4E89A 2P6RA 1A76A 3PO4A 2OYQA 3IM1A 3MEGA 1D9DA 4CGJA 4CEZA 4DQQA 3TQ1A 5DKWA 9ICWA 3O3HA 4RUAA 4I28A 1JLBA 4IRCA 4O5KA 3U3GA 3HW8A 2KZMA 3ZSYA 4UBCA 3ALYA 1IM4A 4ECVA 4UB1A 4DLGA 2ZE2A 2X74A 2PFNA 5C24A 3C95A 4CGFA 1WNSA 2XY8A 3PW7A 4E19A 3SQ1A 4F3TA 1N56A 1R0AA 3ISDA 4CF9A 4JWNA 5DBBA 1L5UA 3V7JA 4WE1A 1XS9D 4DTXA 3OJUA 1ZQAA 3QINA 2X78A 4Z4HA 5KG7A 5CB1A 1JXEA 1KLNA 4LY7A 4M41A 3KLIA 4NLKA 4KN4A 4B9LA 3SCXA 3NH2A 2F1HA 1WSEA 4RT2A 1GOCA 4RW7A 2IMWP 1YTUA 4KMUA 3PX0A 2KN7A 4I2IA 3UXNA 4BDPA 3DLBA 8ICSA 4GC6A 5HHIA 4RU9A 4I29A 4CESA 8ICMA 8ICUA 4LSNA 4DTRA 4QWDA 3K4GA 2G8FA 5HNKA 1TGOA 2VG5A 5J0XA 2YHBA 2W8KA 4HUGA 3ZT1A 4F2SA 3MXJA 1B92A 4R8UB 3KJVA 3KIOA 4KFBA 5JS1A 5IIIA 1N5YA 2R8IA 3Q8QB 8ICAA 1ZQLA 2EX3A 4BDYA 5FRMA 3SQ0A 2G8IA 1LV5A 1JKHA 3TANA 3DOLA 4YNQA 5KG2A 2Z1IA 3SUOA 5KFSA 3LZIA 4DQPA 3QEVA 2V4QA 3LAMA 2IDOA 4CJ3A 1XHZA 9ICBA 2KW4A 2P1JA 3RMCA 3TAMA 2HMIA 2O4GA 2FPMA 4PHEA 3OHAA 1I39A 3OYLA 1U47A 4FJNA 4IDKA 3OY9A 3PMNA 2PFPA 1DLOA 1TVRA 5CZ1A 3OS1A 4FZXC 4CJPA 3BQ0A 3PR5B 1BPYA 5KFCA 1S1WA 4IR9A 4DTNA 1RDDA 5J0RA 3UQ2A 1B9DA 3DMJA 4FLUA 3M9NB 1XHXA 3GILA 1ZQBA 4Q43A 2XY7A 4BE1A 5KFVA 8ICBA 1F21A 2LYHA 4C8KA 4PA1A 1ZQVA 1KCFA 4JRQA 2QXFA 4I2DA 3QZ8A 1BI4B 4AHSA 3MEDA 3L8BA 1C1BA 3O3GA 4CECA 1DGSA 8ICOA 4C8LA 1LW2A 3FDSA 4DL5A 4DSJA 4QOZB 3THVA 5EOZA 1S1XA 3OYEA 1J5OA 3QO9A 2FBVA 4F4XA 4FM0A 2DPJA 4FO6A 1QSSA 3Q8KA 4CIGA 3LP2A 2HNZA 3OYAA 4OGCA 4KLDA 7ICMA 3LAKA 4KI4A 5KTQA 3C21A 3V1RA 3Q8LA 1REVA 4F5OA 2AJQA 4P4MA 3K58A 3GV8B 5D49A 4KKOA 1NK5A 1JX4A 4Q45A 4RQ5A 4YMOA 4CEEA 8ICYA 4JUZA 2IGIA 4FK2A 7ICSA 4O3SA 4KLSA 1VK0A 4YFKA 1X2IA 2J6UA 1BI4A 4QWAA 4NCAA 4CJUA 1WSIA 2OPSA 3KHHA 3K59A 5DDMA 1HMVA 5J2QA 4LZDA 3RWUA 3EPGA 2DPIA 4C8OA 2PYLA 2ALZA 4FJJA 4QWEA 4RQ3A 5HLFA 4CEQA 3IRXA 4EBCA 1SKSA 2HHWA 3T5JA 2VA8A 1HJRA 1NOMA 9ICEA 3D0PA 2YNHA 3F73A 4NY8A 4CEAA 2HB5A 1RZTA 4XIUA 3JPSA 3T1AA 2ISOA 4M2YA 3GIMA 7ICUA 3MXMA 2YV0X 1C0TA 4E0DA 3ISNC 4ED1A 1RT7A 3QEAZ 4ZH4A 3V7KA 4KHQA 3IS9A 5DBCA 4GW6A 5J0YA 2A1JA 3VQCA 4KREA 3H4BA 3G0ZA 5F9NA 1S0MA 7ICLA 4IQWA 1ZBFA 4RZRA 3I0SA 4M42A 2MUTB 3V6HA 1EETA 3BJYA 5KG3A 2ETJA 2XY5A 4RT3A 4JV2A 2KQ2A 3ITHA 4QZGA 3C2KA 4EYIB 3ETLA 1I3AA 4M6WA 7ICHA 3L2VA 3QEBZ 2E6MA 1K1QA 3TAGA 3VQ4A 3QETA 7ICRA 4MFBA 3V72A 4KLQA 4BXOA 4GLXA 1BVSA 2BCSA 3SV4A 3DRPA 7ICQA 2HHUA 3ORYA 5HBMA 2RDIA 5D3GA 4AH9A 5J0QA 3KHRA 3MDCA 4N41A 1RDBA 4K4IA 5CYQA 3BQ1A 3DLHA 3GIKA 4DWIA 2IC3A 3QE9Y 4FJ8A 9ICIA 4FJ5A 2AQ4A 5IIMA 4O3QA 3MGHA 8ICZA 4I2CA 2BGWA 4NXZA 1VSJA 4FCYA 3NCIA 1JLQA 1NKBA 4M0AA 5DDYA 1A5VA 4G1QA 1D8LA 4IFVA 4W5TA 1NK4A 5T7BA 4H4MA 4DS4A 5KT6A 1TVAA 4O5EA 4CEOA 8ICNA 3N4MB 8ICJA 2VANA 2KFZA 4DO9A 2MAXA 4FS1A 3ZDCA 4O3RA 4FJHA 2BANA 3HVRA 5KFEA 2W8LA 3DLGA 3TWHA 2FBTA 5KG0A 4QZ9A 4CJLA 4J2EA 1RT1A 3ASMA 1JLCA 3OJSA 4HCCA 9ICQA 4RQ6A 1BQMA 2VA3A 4B9VA 3UIQA 1WAFA 5C42A 5KFLA 2JGUA 1C0MA 4DQRA 4ED8A 2OA8A 2F1JA 4HTUA 3V1OA 3SJJA 2MUTA 1ZQTA 2FMSA 4KV8A 2FMQA 4CHPA 4J9PA 1QTMA 4DSLA 5J1EA 4RQ2A 4JLHA 4ID1A 3LPUA 4DU1A 4Q0BA 2Z1GA 2Y1JA 4FK0A 4NLGA 4M3RA 2EHGA 4FVMA 3ZT0A 4PHAA 4NYFA 1WCLA 3BGRA 4IRKA 3JPTA 1HQUA 3KD5E 4CF0A 3SYZA 3QEXA 3OSNA 5L9XA 5DLGA 5KT7A 3VQBA 3WNHA 3VA3A 3E2EA 3ULDA 1CEZA 4CGDA 2NRXA 8ICEA 1TKTA 1YVUA 2I1QA 1TV9A 3LALA 3QNNA 4KB1A 4CFCA 2ASDA 3B6PA 4QW8A 2BPCA 4KLGA 4J9MA 3ZSZA 1ZQMA 3LP3A 4CGHA 2JLEA 4DLEA 4MFCA 1RILA 3L2QA 4YVZA 3I8DA 3HO1A 4KLTA 3AU2A 3RRGA 2OZMA 2FPLA 1BCMA 2C28A 3MECA 4EZ9A 4O5CA 4CJVA 2I5JA 7ICOA 3TR8A 3B0XA 4O55A 4UAYA 1RYRA 3C1ZA 7ICEA 4K4GA 2A1SA 4RNNA 1L3VA 1T7PA 1Z25A 3O4NA 4XQ8A 2HHTA 3BQ2A 1RBUA 3AVGA 1V9PA 3KHLA 4BACA 2HW3A 4DOAA 1X9MA 1QQCA 4CJ4A 4YFUA 3V6JA 2B4JA 4CEFA 1HRHA 3OYMA 4CIFA 1ZBHA 1CUKA 5KFMA 5KFWA 1KFSA 3OYGA 2D0AA 4FBUA 3RJIA 4LD0A 4F5QA 5JS2A 4KHUA 1Q9XA 1KTQA 4E1MA 4FM1A 2OPQA 2W9BA 5D4BA 2ATQA 3ISCA 5J2EA 1SUQA 3PX6A 1TV6A 2ZQBA 4HUEA
chains in the Genus database with same CATH superfamily
3G82B 4B3RJ 5KFRA 5CZ2A 4B9SA 3AO2A 1YBUA 3J7ZO 3LA0A 5AI5A 3IC1A 3W66A 4OVLA 4DS5A 1JNRB 1VGYA 1HLWA 2DTJA 2CNKB 5E79U 2OPPB 5TZVA 3K8WA 2QFJA 3PLAA 2KFNA 2QMWA 5AZIB 2QKBA 2J9DA 2KI2A 1HMVB 4ZHRB 4TSXA 3TEGA 4G1PA 1VSLA 3ED5A 1BNOA 3I33A 5AZIA 5DM6L 4B9TA 1F2GA 5SWMA 1X9JA 5AQVA 3NG8A 4CTAB 2RDDA 1VQ5S 4ZS6A 2HGNA 2UUBJ 4RPYA 1BNPA 2X6NA 4CEDA 4H5VA 1AQ6A 9ICFA 4O3PA 1X5PA 3AAQA 4DCHA 2DIUA 2WBMA 3OR2B 5J2JA 3QX7A 4LZGA 4F36A 4RW8B 3HZ6A 3DJCA 1T05A 4EUVA 1HJPA 5JLFA 4PHPA 5DBAA 3FQKA 4U8VA 1TR0A 2QO3A 4BE0A 1SJ3P 1N60A 5HRPA 3UPFA 1EKEA 2ZGYA 3VWSA 5SZTA 1Z00A 5ALZA 4DF8A 3BQTA 1S4EA 3D6HB 1TKZA 2Q6CA 3D6FB 2DFHA 5E84A 4B9UA 3CB4A 4FVUA 1UOCA 3T3FA 3L2UA 2D8CA 5IIOA 1I3OB 2GELA 2YQ0A 2XLJA 1HEKA 3JPNA 2UUCJ 5AQGA 3QGGA 1VQNS 3DV9A 2WK4A 5HLFB 2YKOA 3ZSRA 3B8HA 4J9SA 2HNDB 4ED5A 3O9SA 4IOCQ 3BB5A 4KX3A 3QJLA 3AA3A 7ICJA 2VJUA 4FFDA 4OV6A 3G96A 2DGOA 2VDHA 1T3QA 5DMRA 5M1QA 4IQUA 4UB5A 4CGGA 5DB9A 2DGZA 1U0SA 1U1OA 1HYSA 4O4GB 1FJCA 2JEGA 2LI6A 3TZZA 4XEIA 2ASYA 1O5JA 4DR7F 9ICXA 1QE1A 1NGHA 1RT6A 2W9CA 1YRXA 3L2RA 4O4GA 4I2PA 4J9LA 4MJKA 2F9JA 4I6MB 4CK2A 4CGIA 2P9SA 3TA1A 9ICNA 2JFKA 3AVKA 3CCEN 1NJYA 4MFFA 4KB7A 2B0GA 3WBZA 1KRPA 2YNIB 2A2CA 2XEXA 3VF0B 4U7UD 3EZ5A 3ENWA 4RQ4A 4O0JA 3MPUB 2PY5A 2ES6A 4OKKA 2VONA 4TLRA 3H8JA 9ICVA 4Y2VA 4J90A 2XZWA 4QIFA 2H9ZA 1HNVA 4IOAL 4CO3A 1RZMA 2HLTA 4O0IA 2B7BB 4Y2KA 3R5AA 3SDEA 3OQ2A 4FJLA 2GQ2A 3ZX0A 2DNNA 4PKGA 3BH7B 1XEZA 3NF6A 1W9HA 1Q86T 3MR6A 2FSNA 5EE0A 4KQZA 3KD3A 2H5EA 4AHUA 4M9GA 1WF2A 3A8JA 5F3TA 2X1BA 1Z00B 1T11A 5C12A 4QNLA 2E9RX 4JI7K 1KN5A 7ICVA 4HH1A 2Z2MA 5MAOA 2DO4A 3RMDA 2YNIA 4N5SA 3BZQA 4Z2XA 4FLZA 3GJTB 4DX6A 1RDCA 1NMEB 2CQ3A 2E5IA 5IQQA 1Y5NB 3TUJC 3F2BA 3K9JA 2X3DA 5HMWA 5I3UA 2V4JA 1CZBA 3U26A 3AA9A 4A8YA 1B0XA 5J2NB 1A0OB 1BIZA 1FRIA 5AQNA 2QLXA 3TX8A 1NK9A 4JI0K 4KN7A 1AZSA 1VBXA 4BHQA 5IIJA 5J2DA 4YMEA 3PHTA 3VF6A 1KC8T 5KT3A 3C8YA 5AZJB 4MQ3A 3SNNA 1G15A 1SB3C 5JLHA 1KW4A 1PK1A 1R89A 4RBVA 1XTZA 2VC0A 2HBMA 4DN9A 1JJ2R 2DKXA 3JYTA 5E3AA 2GJIA 3OS0A 4KHRA 3ZSWA 8ATCB 4U67Q 3DU5A 2C2DA 2WOMA 1VQMS 4EX6A 3L4BC 2DTUA 2R18A 2AD9A 1IBKJ 2B5JB 3UVJA 1BDGA 4R65A 1M1HA 2WOMB 1N0UA 4WCEQ 3HKZC 3AVFA 2E44A 2Z1HA 5J0PA 1KAYA 1N52B 4LSNB 4PG8A 4USWA 3KKFA 1XMQF 3QUTA 4C2MA 3MXIA 3NMAA 3IRWP 2H3FA 2CYYA 2HHPA 4ZVOB 4LF9K 3DLJA 3L3UA 4CH7A 1M5SA 2ATLA 3QEWA 1KOOA 2DEIA 2P9LA 2O8DA 5D4OA 4AM7A 4DL2A 1HI1A 1HBMA 3VAHA 3AO1A 3OYCA 4NLNA 4FLYA 3VF2A 4JYAJ 4UTGA 5KQ8A 5FLXO 2VZ9A 5F0XA 2G9OA 2D0BA 4DSIA 1MWYA 2W2PP 2RIJA 1SL1A 1I5OB 5JJBA 7FDRA 3H5XA 1FA0A 3BKUA 3CJTA 4DPYA 1XWLA 2F8LA 3NF8A 3JTOA 3RMAA 4CDGA 3J7AN 4RW7B 4Y1CA 3K0JA 3RSEB 3CEDA 3AAPA 3NGRA 4OYPA 3PRDA 4K4ZA 2P5VA 3J7YP 1K8KA 2CPFA 2ZZMA 3ZO7A 1UA0A 2H3GX 3CCLN 5AZJA 2OTJS 1ZA1B 4D3HA 3N4QA 3NWRA 4E7KA 3RTVA 2JJ4D 1KSPA 4PKHA 3P6YC 2NRRA 1Y4ZB 3RAQA 1IJEB 4DV5J 2HVEA 5DM6Q 2KVIA 1HNIB 1YVFA 1Q4RA 1FRHA 1S0VA 4QS7A 3H0MB 4DTSA 1KVAA 4FK4A 2GO8A 3EN9A 1C4AA 5DO2A 5DLFA 2CJKA 3BDPA 3IDHA 4C4SA 1NPKA 5B0CA 2W03A 3QB0A 4BG8A 4LUBA 3PJXA 5L46A 2V69A 3WXJA 1OPZA 1WKJA 1FE0A 1KP6A 1W2BR 1X60A 1SQFA 4DUZJ 3M5RA 1PO6A 4QZEA 4OYAA 5D0EA 4BGDA 4BLGA 5KG4A 3EY1A 2GO9A 4URQU 1EXNA 4IQVA 4Y3CA 1LVHA 5M2UA 2J6SA 1MQ2A 1PZNA 2KE7A 1UAXA 2NXUA 5EE9A 4HACA 5LJ3Y 4OX9J 1HNWJ 4UB8U 3CMQA 3VA0A 5JVHL 3CJKA 5EE3A 4ECQA 2ZIVB 2DCUB 2CQDA 3VQPA 3HFVA 4ZCMA 2D3O1 2F9TA 1Q82T 2RQ4A 1W2BM 4AYBF 3OXGA 2BDPA 1N5WA 2IY5B 4I2EA 3VOVA 4F4KA 3BEXA 2QKKA 2E5LJ 4C98A 4LF9F 1WDDA 1NK7A 1S9FA 3SQIA 5LMNF 4ZKAA 3RZAA 4N76A 4X84A 4DCJB 4LSZB 3VVTA 5AIBA 4Q8EA 2OLWA 3QJPA 4EMDA 3UI3A 4NM1A 1KR4A 4DR5J 2ZTCA 3R7NB 2GLEA 2L9DA 4NLTA 2B4UA 1LB2B 2BH1A 3SAHA 3GV7B 1HHQA 3T5KA 3P39A 3S3OA 2HVHA 5IC4B 1IV0A 1G7CB 3M6GA 1UL3A 4WFYA 2P9SB 4FW1A 4XA5A 4ECSA 3VCDA 4NI2B 3I96A 2J7WA 2BV3A 2QA4G 3P31A 5ALGA 4LF7K 2DNRA 4PWDB 4DV4K 1KDNA 2QLFB 5CYJA 5F41A 3THTA 1RGVA 2K8AA 2UVVA 5C25A 1L3UA 1SWWA 2KZ3A 3C5FA 3WZ0A 5AJ3F 3UQSA 4PRFA 3CDBA 2FC8A 3P45B 2KJ9A 3DRRA 1LWCA 1H0HB 4AL6A 3HM9A 3R5GA 2D6FC 1E3MA 2DNHA 4JI8F 2RHQB 3ATVA 4CZKA 3FC9A 4TKTA 1MA7A 2QIFA 5FLXY 5T41A 2QEXS 2WAQC 1VSFA 5KFPA 1N5VA 2C2KB 4FPBA 4M5KA 4WXOA 4KH4A 3OL9A 4RR5A 2W4DA 4PXBA 2VG6A 3I82A 3HVWA 1B0VA 1SXEA 2ASMA 3QNMA 2YNGA 5C24B 5KRTA 1XNQK 3RF9A 4FLWA 1PBUA 2LKZA 3KG1A 5KPRA 3JXOA 2XCAA 3C2MA 2B4OA 1SZ2A 4CF1A 1RT5B 2CAJA 2YKMB 4DCCA 1ZQRA 1JLAA 4CJ7A 4C4TA 1RT2A 5AKHA 4L76A 7ICTA 4FZLA 1S7HA 2VF3A 2JOQA 4DFPA 4TN2A 5HRSA 1GLLO 3V7LA 3HJEA 3S3MA 4IO1A 3FBCA 1IBMJ 3CQXA 2E8NA 5J0UA 5ALLA 4DR4F 3EE9A 3QESA 5KFIA 3GJSB 1WEZA 1VRTA 4QZIA 1IG8A 4OYMA 4P0QA 2AJFE 4C3MA 1WC5A 2WF7A 1BA0A 3C7NA 1KBRA 4E7JA 3BM7A 2YX1A 4BQLA 3HILA 3GFHA 4S0MA 4JV0A 3MR5A 2JC0A 5C25B 1UJ6A 4ID5A 3M8PB 3QEIA 2E1EA 2J7KA 4FOEA 3TEHB 4LFAF 3NF9A 1Z3EB 5JTIA 3AVHA 4Y2UA 1KD1O 1IJJA 3RUBL 2KT2A 1IKVA 4FLTA 4BREA 5ALUA 1ZQPA 3IR6B 1SI9A 3Q7CA 1Z6RA 3K5MA 3MWBA 2KIWA 3MUTP 3ZTOA 2DITA 2ZZTA 1IO2A 3ZFVA 2ROGA 1QZ6A 3CP8A 3HKZF 1LFPA 1Y97A 4EP4A 1H38A 2GBZA 4HWIA 3AVMA 3IMXA 3CXCM 2GTDA 1RK8A 3WEEB 2P9UA 5J1EB 5J8YC 4QZCA 7ICPA 2J0XA 5CHGA 2ZH5A 2QLWA 1NJZA 3LM2A 4NLYA 2OPRB 2QSFA 2BPGA 1U1PA 2Y3YA 3A5MC 4RW6A 3PKYA 4W4MA 2V7YA 2EC2A 4ED4A 1CLFA 3LK9A 3THYB 1VJQA 3H0PA 3J81U 3WXLA 2FHJA 3CCZA 3TTFA 4CJRA 2VQEK 3T1HF 1X5TA 4IZ9A 2ILZA 4PGXA 5CP2A 1BL3A 1IBMF 4P7TA 3CVKA 3MDQA 4CRJA 4F9OA 5M2RA 2D1KA 4ZPCA 1TL4A 2E1YA 2ZJPQ 4BUGA 3W9IA 2AGQA 1CBKA 4F4AA 3M32B 3P96A 5AE3A 2F4FA 1RTDA 3LPEA 3ET6A 2MQNA 4ZLJA 3BF3A 3MK6A 4GKJK 2L41A 2MHNA 2XICA 3JTPA 2I5JB 3N7PD 2HVDA 1NAQA 1P1TA 2DCLA 1TUYA 5F0WA 4EYHB 3C6UA 1HWIA 2Q0ZX 2YHAA 3DXKA 2B4PA 4ZHRA 2YMQA 4FXVA 3M8PA 5A0YB 1KEKA 2PFUA 4LJXA 3IFRA 2XCPA 2V8VA 5EWFA 1XSNA 2UXBF 4QWBA 3FYHA 1S4FA 2BJEA 5A8KA 1WSHA 1O1WA 5K9FA 1BD6A 2LXUA 2FDNA 4ED2A 3IGNA 1H74A 4CLWA 3L09A 4ECRA 4XDDA 3I9ZA 4PXEA 4IG3A 5BPNA 2EPIA 2ISPA 4Q5VA 3AV9A 3OGUA 2DJWA 4OV1A 1S99A 1V9OA 3CIZA 3SI8A 3RBZA 1JK9B 3JSMA 2H3VA 3T1HJ 2YX6A 1MMLA 4NYNA 3PEHA 3PIPQ 5C2CA 3K5LA 4IO9L 1C0UB 1DKGD 4RL1A 5AM3A 2PZSA 3HZGA 3KLEB 2N7YA 1ESVA 4B3SK 4OL8A 1TFRA 2KLAA 4PL7A 5K8OA 3H42A 4LF7J 1D8YA 1ZQFA 4JHDA 3LQVA 3EGZA 5F8JA 1X31C 5ETRA 2ZJRL 3BBBA 1NK0A 2A1BA 3EGWB 5J0OA 1XMOJ 1VJWA 2M52A 3ADAC 2AJ4A 3IRXB 1CJUA 2RN2A 4LH4A 2FDRA 3EXYA 3QMLA 2BE7D 4ITSA 1MWKA 5IILA 3KUEA 3OTOF 1KVCA 1S97A 4KHPF 1TKXA 3GQCA 4PH5A 1HWJA 3L4IA 1WUUA 5KOXA 3VQ8A 4FJKA 5T14A 3WQUA 2O6KA 4OZ2A 2KTQA 1R0CB 3GE9A 4DR1J 1RAEB 3ENVA 4B08A 3L7UA 4BC3A 4DN0A 3NE6A 4FVCA 1GT8A 2F8HA 1GO3F 3PSFA 3CJRA 4JI7F 3P5BP 2YI1A 2WW4A 3QU4A 4BR4A 4RQ7A 1MMNA 2EI5A 3MM6A 5ETKA 1BXNA 4NLZA 2XG8A 1UPPA 1UWBA 4KGXB 3KK7A 4PY5A 4FSVA 2JLFA 5IQ6A 4U96A 1FW6A 1CVJA 1KVJA 3BUZB 4JKFA 3RB0A 1M1GA 3PFEA 2D41A 2FBXA 4WWSA 4I69A 2ZJ8A 1PVQA 5KG6A 3Q8SB 3VQ7A 3GYXB 3MAAA 1EQYA 1H7XA 1KQSR 3HF5A 3Q8PB 2VWBA 3UWTA 4H0YB 4Z4IA 5ADZA 1WF0A 2CJAA 2F3JA 3UXOA 4ICLB 4LFAK 1FNOA 3HP9A 4BQZA 1IG9A 2OO4A 3GJQB 3U02A 2IM2A 3MOJB 3EX7B 3CCVN 4ICLA 3NVYA 3CJ1A 2WAQD 2DNPA 3EW9A 5F3XB 2R2TA 3FMBA 2WTUA 4DOBA 4F26A 3Q8VA 3CM6A 3H5UA 1FKOA 1CJVB 3D2SA 4AFFA 3MAAB 1ROFA 5AI0A 1S1TA 2QMXA 4DV2F 2FZGB 3G8SA 2XLKA 3TJAA 2PMZD 3CJCA 1WSGA 5JVHQ 1S9EB 2K8BB 1T3VA 2CPHA 9ICSA 5G0RA 2E1MC 5L1JA 2IRXA 3TVYA 4B3TJ 2V94A 2W7OA 3FC4A 5H1SV 1HNWF 3EZOA 2H48B 3AVIA 3QIOA 4TQRA 4X4VA 4ZITA 3ALRA 3G6VA 2Q3SA 5M1PA 1U48A 2ZJPL 4DOCA 3TACB 1N8RT 3OYBA 2QX0A 4B1VA 3OR2A 3HYFA 3KMQA 3N79A 2ODGA 3DXMA 2HMXA 4QZDA 1PAUB 4RX6A 3WXMB 3IG5A 4CK1A 1X3MA 1HKAA 2X51A 1RCXB 5EY4A 2GAHC 2QLJB 4I2BA 2KRBA 1G4CA 4OJ3A 3VALA 8ICVA 3TAMB 3NVMA 3EM1A 1RYSA 2LP4A 4H5NA 3I32A 1F5BA 5BN8A 4CZFA 1VSKA 4DF4A 3ZETA 1U0HB 1ZETA 2CVIA 4OHYA 3LYSA 3VQ9A 2G8VA 1BPEA 4C0HA 2ALYB 3H1VX 1B43A 4DUTA 4KT0C 4AILC 4PGYA 3CCQN 3DLLQ 3KOAA 4E7LA 4F8RA 1W7WA 3MN9A 4ZK7M 1KN6A 4EP5A 3TTDA 3CMAN 3NF7A 2XC9A 3BR9A 3PFOA 2K3IA 5DDPC 2G8HA 3NY0A 4EEYA 1Q8LA 5D77A 1MN9A 3PTWA 3H90A 3KK3A 3A13A 5CYMB 4OJRA 2ASJA 2VH7A 4DL0C 1RHKB 3CC4N 2IVPA 4IO9Q 1ZQXA 1COOA 5GAEU 3S8SA 4RKUC 2KV2A 1PJ6A 2XY6A 2RKIA 2C1EB 4MO4A 2F96A 1D3WA 3WKCA 4HLBA 2KG5A 3KJNB 3NEKA 3MEKA 2HFNA 1GLJO 3IM8A 2FLOA 5M1OA 4UQTA 4FM2A 4JBCA 3NMUA 4HT7A 2BRKA 1U6BA 5AK4A 2V2ZA 2W6LA 4U67L 3MEEB 5HHHA 3H08A 1WHVA 4BGAA 4X66F 1RISA 3HSDA 2HK2A 4OJPA 1AB8A 1RT6B 4ERDA 2FIUA 2XNRA 4QZHA 4HR2A 3HRDD 3A1YG 3O9UA 4CF5A 5F8IA 1P7DA 4M3TA 2ZJ5A 1HNZJ 1VIOA 1XO0A 3ETMA 2XRIA 1XNSA 4YXMA 5FRNA 3ZX3A 1KQGB 5KFFA 4ACOA 2PI5A 3IN5A 2GHWA 4RCHA 2GMJA 1HX1A 4A46A 2BX6A 3M8QA 5IS2A 2DH8A 4HH0A 1TELA 4OMFG 2W43A 3AD9C 1K44A 5CAAA 2V5HG 2I6WA 3EVOA 1E4FT 4WQ4A 3CPWM 2UVUA 4DOZA 2JLGA 4JKGA 1MU2A 3HLUA 1B22A 1YBAA 1XC9A 2BM1A 1NGDA 4XAKA 4B3OA 3UCZP 1WYGA 1JIHA 3QAUA 1ZQUA 3O1LA 5MLCQ 3IHQB 5HSPA 1RT7B 1KVBA 3D45A 2YHWA 4DEZA 3W61A 2IA6A 5J2KA 4JV1A 1FK9A 1Q8KA 3E51A 3H5YA 4PQUA 1HNZK 3MURP 5L39A 1S5LU 4V1Ak 3CXCR 3SCKE 2V68A 2N7CA 2FJEB 5AKKA 3CJSA 3D4JA 3CJBA 4IS7A 3OFHA 3WQTA 4BRHA 4DI6A 4US9A 4YDDB 1SIZA 2E2NA 3O3HA 4RUAA 4I28A 1JLBA 4LF5K 4O5KA 2KZMA 4M5JA 1Q46A 4C8YA 5T7LB 4F7VA 2Z2LA 1IM4A 1EWQA 4UB1A 4O8KA 3GJRB 3R5JB 3TUZC 3B6BA 4P6QA 3VGSA 1RA6A 2NZCA 4HT5A 1UP1A 1QUVA 2VDIA 2FZCB 5IWAF 3RG6A 2A10A 4LF5F 1CJVA 2P9NB 3PW7A 2KHCA 5IC6B 1YRUA 2OD4A 3FAHA 1FK9B 1XR5A 3ZEUB 4DUYJ 2DGUA 5DBBA 1HKCA 3K1ZA 3V7JA 4WE1A 2JNJA 1XS9D 1Q3VA 4WYLA 4ZPBA 1ZQAA 3QINA 2O8CA 4Z4HA 4M41A 3DLKB 1RABB 3LL3A 2KG1A 4B9LA 1YIJS 1G1XA 2F1HA 2DR7A 4CLSA 1Y7PA 3ONQA 1UVKA 3AXKA 1GOCA 4RW7A 1BMQB 2CNLB 1ZTWA 3DGPB 2F77X 3OL6A 3H2VE 3UXNA 5H2FU 4NLWA 2QWNA 1S8OA 4B9QA 3ULEA 2KSOA 1YDLA 1JJCB 1W2IA 1P27B 4GC6A 4I29A 4RU9A 3NAIA 3MM8A 2CQ2A 5AKEA 4DTRA 1KL9A 3MN6A 5HNKA 1TGOA 5J0XA 3WX8A 1LWEB 2KNJA 2OTJN 3UFCX 4M5LA 2VU5A 2LXFA 3N0VA 3U8XA 2P9LB 1E6YA 5FRMA 3SQ0A 2G8IA 4DR6K 3D2QA 2RP5A 1JKHA 3TANA 5KG2A 2Z1IA 3VR1A 2V9KA 1T9VA 2QV6A 1U0HA 4CF3A 2HF3A 5GMKa 3C65A 1P8GA 4KH0B 5AHXA 9ICBA 3JQKA 4WK1A 2P1JA 3RMCA 4NLDA 4K0KJ 2JH1A 3VCBA 1DTQB 3BYRA 1H2UX 3PMNA 2VD3A 3ZX2A 2PFPA 1DLOA 3WK7A 1TVRA 2MQOA 5AR0A 3BQ0A 5KFCA 1S1WA 2DUYA 3DCAA 3G8TA 2HQDA 4IR9A 2MXYA 4QS9A 1G6BA 3UO0A 5J0RA 2HS3A 5AQKA 4Y2PA 1ZAVA 1TKZB 3VESA 2NYVA 1DY3A 4RWWA 3QDKA 4C8KA 1ZQVA 4JRQA 3KLVA 2DISA 3CPWR 2RF2B 1SC3B 3MEDA 3IG8A 1MWQA 3L8BA 4CECA 5JVGQ 3A8IA 4AYBC 1LW2A 2B56A 4P2SA 5IWAK 3OTQA 4RW6B 5EOZA 2ZBPA 3T6JA 3OYEA 3HHNB 2CRLA 3BV8A 4DUZK 3ILLA 5G4DA 2ZH3A 2P6SA 4QIGA 4ZVSB 3Q8KA 3W2VA 3W2WA 3OYAA 1F5AA 1RAOA 2KSOB 2KVQE 4C4WA 3HI0A 3W8PA 4KI4A 4WTOB 1U26A 2HHHJ 1REVA 4NEYA 4F5OA 4P4MA 1IQZA 2XMWA 1TUWA 2BUPA 2XTJP 4BRNA 1JX4A 3C15B 1PJ5A 4YMOA 8ICYA 5B0EA 2CPEA 1FDDA 3E9PA 4JP8A 5AE2A 1TYQB 2OTLS 4OX9K 2BJ8A 3ETRA 5E3PA 1RHRB 2ZBQA 1QCKA 4QWAA 4CJUA 5AQJA 3K59A 1F5CA 1HMVA 4JV5J 4HVZA 4FO0A 1TYQA 1TL7A 2HIYA 2DXEA 3RWUA 3EPGA 4UASA 1NUEA 1S6PB 4NYOA 5HLFA 3QU5A 3MPDA 5AXKA 4NLSA 5LY3A 9ICEA 5AQQA 2OSRA 2VFVA 3F73A 4DV5F 4CEAA 5LT5A 5AICA 1RZTA 4CNZA 3T1AA 1V5IB 4C8ZA 4O4RA 4M2YA 2JFDA 2B6AB 4LFCJ 4JI0J 2F1FA 3ISNC 1C0TA 4E0DA 1RT7A 3W3SA 4K41A 2GX9A 5B0AA 1NSPA 3I6PA 4C80A 4KHPJ 4B17A 1OS5A 3Q86A 4C97A 1ZBFA 4RZRA 5CCLA 2LPEA 2MUTB 2FVQA 4JV2A 2UXCJ 2NYIA 1QQ7A 3NXZA 4F0KA 2DNYA 4KYZA 1U6FA 4EYIB 3ETLA 3M6ZA 4XH4A 4GMKA 3L2VA 1PGZA 2HVZA 3TAGA 3VQ4A 2RUSA 2KJ8A 2HLUA 4BXOA 4USUA 4MO5A 1BVSA 1B0PA 3SV4A 4DR6J 2WC9A 1QQMA 2VFRA 2K4IA 1N34J 5AFUH 3ZZPA 4K2XA 3KJFB 1N2XA 1U25A 2IC3A 2YY6A 9ICIA 4FJ5A 1EKRA 2IPOB 3MGHA 8ICZA 2BGWA 1DBDA 2GMHA 3N01A 1YSJA 3VENA 4NXZA 5D4NA 4DPWA 3NCIA 3NASA 1SZHA 1VRUB 1FRXA 2RJZA 1NK4A 5T7BA 5KT6A 1TKXB 1QAIA 4E1JA 4IL6U 2YHXA 3MD1A 1H98A 1X4HA 3GFXA 2KFZA 1NBEB 4YOXA 4O3RA 2BANA 4OD0A 2P2CB 2RVJA 3AEVA 2ZF5O 4QIWD 2HNYB 3UMCA 4J2EA 1RT1A 1XMQJ 2BJDA 2BW7A 4JI6F 3TSPA 3HHLD 4PQAA 4B9VA 4YS2A 1L7OA 4EU0A 4FF3A 3M1FA 5KFLA 2JGUA 2GEMA 4J5OA 1C0MA 4DQRA 2F1JA 2ZHAA 2I7PA 3I28A 4HTUA 1XNRF 4LF8J 1WUAA 2MUTA 3CCRS 1ZQTA 2FMSA 4PAAA 1GMWA 2A3JA 3KKAC 4KV8A 1T94A 1HR0F 4J9PA 5J1EA 2PGCA 4RQ2A 5FLXU 3KK2B 4ID1A 4NMLA 3PSPA 4DU1A 4FK0A 3DGVA 1MROB 4HDHA 4FVMA 2GVDA 4IRKA 3JPTA 3I55N 3SYZA 3QEXA 4WKRA 3VQBA 4GVBA 3VA3A 3WNHA 2FD2A 3E2EA 3ULDA 1CEZA 3HTVA 2VBYA 2NRXA 8ICEA 1RWNB 5GIPA 4K8RA 2RHSB 3HSCA 4KB1A 2ASDA 3B6PA 2BPCA 1WACA 4J9MA 3QU7A 2IC3B 4CGHA 3L2QA 4YVZA 4NOHA 5LXYA 2HYIB 1RWMB 5ALRA 5ALHA 2ZH4A 3AU2A 3RRGA 4MKAA 2OZMA 5FPMA 4QYZK 2KL8A 4LSLB 2OCEA 1BU6O 2FSKA 2ZUGA 4RWXA 4CJVA 4DV2K 3HT0A 4OHZA 6FD1A 3BSNA 1Y0HA 4CRXA 4O55A 3CCTA 2I8EA 3EDRB 1RYRA 3M2UB 3O08A 2A1SA 4H0TB 4RNNA 1NGFA 1XNRK 5LMNJ 5CD4H 3RSEA 4OPAA 3THXA 1T7PA 2FGOA 3GG0A 3O4NA 4I56A 2H4YB 3KVGA 2HHTA 2E1PA 2LDIA 1RBUA 3AVGA 1V9PA 4AF1A 5EHHA 1SV4A 2KG0A 4DOAA 4YFUA 3KLHB 3V6JA 2BE9B 1CUKA 5KFWA 2MKCA 3DDNA 2B9YA 3OBWA 5AQFA 5JS2A 2I6XA 1Q9XA 1KTQA 3C6UB 2OPQA 1RTIB 5AK5A 3PX6A 1H73A 3IR7B 3WDOA 3OTBA 4FZVA 1UTAA 3NVZA 4IRDA 3KWMA 4G65A 2VIHA 3JSMB 3JS6A 1S0OA 2WB1F 3ILIA 1U4BA 4JD2A 4YUDA 1O08A 4Y2JA 2R8JA 3A8EA 3PYGA 1ZTTA 3C29A 2DFFA 1Y5LB 4RPXA 2I9GA 2YX7A 4USHA 3WK6A 4GV6A 2FQQB 1SBRA 4AHTA 3LP0B 3KK1B 4GV9A 4CJQA 2ADBA 4P0PB 3SZ2A 1WOPA 3MR2A 2OTLN 1CZ9A 2G4BA 1JWWA 4P9SA 3AO4A 1KEJA 4M5IA 2W01A 4J9NA 1EETB 4UY8O 2ILYA 1YIJN 2MGZB 2CDRB 5KG5A 4X4PA 1OY9A 2XS2A 1IWAA 5AM1A 3QBCA 3NTUA 5DG8A 3C7NB 2CNNB 2KFYA 2HWTA 2JMGA 4ECTA 4QS8A 3GIRA 4DPUA 2BZFA 4UZCA 3TJ9A 1J5EK 2D0OA 1ZQQA 2QWLA 3ITHB 1RQNA 2JX2A 1RKJA 1Q81O 1RXWA 2LXIA 3BPSP 4W92B 2CQ0A 2XYPB 4BRLA 4B3RF 2ZH7A 4K25A 2XI3A 1HKGA 4CO2A 2Y1LB 1S72S 5L1MA 3Q2TC 3TFRA 4CLPA 1X4FA 4DG1B 3GE1A 4OFZA 5DDOC 8ICGA 1S59A 3VHQA 5JXSA 3BPDA 2ZH6A 3DLGB 3J81Y 3SENA 3SSRA 3HULA 4E7IA 4EIAA 1OWXA 8ICIA 2GIRA 1H2TZ 2JH7A 5AI8A 1ZBLA 5ALNA 5J2AA 5HOOA 2HS0A 1WC0A 3HVTA 4PPDA 1YJUA 4Z4FA 1N36J 1JCFA 1U1NA 3TNVA 2AP6A 4QU7A 3UR3C 3W5YA 5CD4A 5KFZA 1T4GA 5E5NA 4OZLA 4CLFA 1ZBUA 2PKEA 1R6VA 5J0SA 1BUPA 2LEAA 3CQ8A 3SPYA 4NJ8A 4ILHA 3N4WA 4C1NK 1FX2A 3PM9A 4F04B 4JRPA 2OEMA 4NWIA 2DEJA 1LCUA 9ICJA 1JLGB 4CLUA 2F40A 5A6WA 1N61A 5DK5A 3DLLL 4Y0WA 3EGNA 5IZHA 3NRBA 1WJ9A 4JI3J 5C42B 1WLJA 3UKRB 3V1QA 1ZD4A 1URRA 2W4PA 1BY9A 3K1RB 4LF2A 1NJWA 4J9QA 1PILA 1OKJA 2F2AB 3FZBA 1WWHA 5A0YA 4KH6A 2H51B 4ZVQB 4GVBB 1OVQA 5HROA 2NRZA 4PJ0U 4MEXA 3DRRB 1BQNB 3H46O 4CVNE 2HNYA 4RQ8A 5HMZA 3L7OA 3QEPA 1BQMB 4XPCA 2YWEA 1A6SA 3CD7A 4BC2A 2FPKA 2MHEA 3MWPA 4KHPK 3WKBA 5K14A 5SUHA 1FFVA 4MFAA 3AXMA 1OH8A 1RKIA 2ZUBA 1JMTA 2R7XA 4YOWA 1N8RO 3IWXA 3OXFA 3QNWB 1OQ6A 4C1NI 2YWGA 2UVRA 4WFAQ 3AVLA 5AJ3K 1SXDA 3O9RA 3R6LB 1Q79A 4Z4GA 2IVOA 2BUNA 2PT0A 2ZBIA 3AOBA 3NOGA 5HBMB 1N6QB 1MWZA 3O9TA 5BOMA 3M30B 3BP8A 2XGQA 4ZJOA 3MBYA 3MXHP 4WQ4C 1ZJNA 3EUNA 2AX0A 2YN4A 2KDOA 3PYFA 1XK8A 3PACA 1AFJA 2J7UA 3ZT4A 4KGKA 2J0QD 5KPZA 3V9ZA 4JI5K 4RUHA 4KTZA 5FDLB 2VHGA 4ZPWR 4F5RA 4DR2J 1W26A 2UXBJ 4LH5A 1JQGA 1UPHA 4HI1A 4ELVA 1RT2B 3QT7A 2XSFA 3ICLA 1HIWA 2BACA 5D78A 3O3FA 1YJRA 5HAOA 4EI2A 3AVCA 1EJ7L 3D1QA 1MMDA 2AEMA 2ITGA 2HHHK 3W64A 2BW2A 1NK6A 3ONNA 2WF8A 2QYCA 5HP1B 2Q3PA 3BF1A 1V38A 2OPRA 1S1UB 5EWEA 4OYBA 4YD2A 1RBSA 5AI9A 1NU4A 5BYQA 2FLLA 3UR0A 4NASA 1XSPA 5CXTA 5JICA 1CJKA 3KG4A 2ZG6A 4OCZA 4J9KA 1NLVA 1IKWB 5CE3A 5A76A 2FC0A 1WTBA 5BRFA 3CCQS 1UKUA 5A8WA 4R5PB 3ID6A 3H45C 2RQCA 4IEIA 2VA2A 2IHR1 1RTZA 2RHFA 2HIQA 5HQ8A 3ET6B 2QLBB 1VQNN 2DIVA 5ETQA 2LQ9A 1J53A 4M47A 2ZJQL 1VQ7S 3B6OA 2E1FA 2FLPA 1EHWA 2F7TA 4CJTA 3WK4A 2H5XA 3UE5A 2KKZA 1SIJA 2ATCB 1WCNA 1HUZA 3TZWA 1CS4B 4HHTA 4ZCKA 4TY8A 3EZUA 2YJFA 2PFQA 1RAGB 3E66A 2BJ9A 2DGQA 5DJBA 4CLKA 4JB8B 2G0JA 3NH1A 2H3QA 1HBOA 1NZPA 3GB0A 2CXYA 1V5VA 4RW8A 4I7FB 2B8PA 2H54B 2JZBA 2B9EA 1FXXA 4JI7J 4AXJA 2NLXA 1RQ0A 2IJNA 5EUHA 9ATCB 3OYIA 1VHIA 4CFBA 1M90O 1U2CA 5KGWA 2KICA 4NCGA 4BCAA 5D0HA 5FP0A 4KI6A 1DTTB 3J81j 2D3OR 5KFHA 1GOBA 1YTAA 4KB0A 3VTHA 1WD6A 4RQ0A 2IHNA 1RHMB 4GKJJ 4HL9A 1GLFO 4DPTA 2Q66A 3RAXA 3EVWA 4QOTA 2BPFA 5HO4A 4DTPA 5KRSA 3VQQA 1U24A 5CYQB 3VQ6A 3FCVA 3CCWA 3AO3A 2H4WB 5GAHP 4BDZA 4M9NA 1PSDA 3A0BU 3IWNC 3T1YJ 3RRKA 4F3OA 4FPAA 2H3EB 4NXMJ 4DCPB 1JJ4A 1F1BB 3BREA 1WKLA 2ITMA 2HFSA 2HOIA 3LANA 4CIOA 2DKOB 4DMNA 1I1GA 3DHWC 5AQRA 4TU8A 2KEYA 1KD1T 1KKHA 2GW8A 3A2FA 4A2BA 3QWPA 4WIIA 2O01C 2QZ8A 3RR7A 5D0RA 5CYMA 2CZ4A 3AARA 4JI1J 1FJGJ 2YKAA 2MA1A 4P10A 3TPQA 4P7VA 3RJHA 1VQ8S 1S79A 2ZOGA 2B8QA 2OGUA 3C3LA 2YVSA 3HOTA 4I2JA 2KVSA 2Z56B 3JS9A 2M5YA 3TAPA 2PBDA 1C0UA 1RPLA 2HNDA 3BR8A 2GX8A 1IKXB 5JUMA 3V2UC 4PG4A 1P1LA 3U27A 4B3OB 2MY7A 3US5A 3HVTB 4B3MJ 1UZHA 1AUSL 1O51A 3A0IX 2RMLA 3Q0AA 2GNKA 4BX9C 1TUUA 2EG1A 5DQGA 2W42A 4DTUA 1ACMB 5AKGA 3DRPB 1VDHA 5AT1B 3NGKA 4Y2RA 3HX9A 2R8KA 8ICPA 3FR0A 1N32J 3S3NA 1NBWA 4EBDA 3O0FA 1RADB 1RJJA 2OFGX 1DQ9A 3ISZA 1NM2A 4IH6A 2VFUA 3OTEA 2DHAA 5AQZA 4CGZA 2GWKA 1S9EA 4LBPA 4DKWA 2CJYB 3KZBA 3ISBA 2KD1A 1Q7LB 2AMCB 3KZXA 3H2UB 3RJMB 5IINA 1X7VA 2MB0B 1TFYA 5KFNA 4H4OB 1M0SA 4LVOP 4WU2A 3MM5B 5AKZA 3TWZA 2WUSA 1FO1A 5AQWA 2MMYA 3QFUA 3VERA 5HL7L 3DEEA 1JCGA 4CI0B 1VQ4S 1TL1A 1RBRA 4ILLA 4MF8A 5F9LA 3VQ5A 3PW0A 1HNZF 4CQ1A 3R1HA 3TAQA 1Q78A 4LVNP 3FQLA 2ZM6J 4DU3A 5B0DA 2OFHX 8ICRA 5EU7A 3QRRA 5G5GA 2NO5A 4F4WA 1CQMA 4ZA1A 1EIYB 1QVGM 3RJEA 2F9DA 4NZ7A 4YOYA 5D15A 3NGDA 5E7OB 4X64F 1RM6C 4KLIA 5J2GA 2ZNYA 1U04A 3CNHA 2WVFA 2QWQA 3RJFA 4M8LA 1RDAA 2GAGC 2LU2A 5DDRC 3R9PA 4DSEA 2UV8A 3TKAA 2ZIWA 5J2PB 4IFVB 2KZZA 4KLEA 4B8AB 4GXJA 3QAEA 1UHUA 1JROA 5LMUF 3MM8B 1RLCL 4GV3A 3NRWA 2Z58B 3PKMA 4Q8FA 1T95A 3DDIA 4HKQA 3AU6A 4B9NA 2C2OB 1BA1A 2ZDPA 1ZRMA 4UUXA 4A4JA 2A0FB 2CQCA 4U6PA 3OTCA 2HBLA 4AUKA 3CDEA 4LF8F 3KD1E 4X4OA 3QUCA 1VS3A 2OANA 8ICLA 1YBTA 3TFSA 4IH7A 1O6XA 1VQSA 3NHGA 5K5MA 3ZDBA 5LMUJ 5GVQA 3QWUA 3A8YA 4QR1A 1J5EF 3CF5L 3HHKA 2FXUA 3CWJA 3D1OA 4YOEA 3CCRN 4DL6A 2NRTA 2VQFJ 2JL9A 2MKIA 4RW4B 3V5RA 2XQCA 2BR0A 3Q7BA 1HYSB 4YB5A 3O6WA 1DZ5A 2HI0A 4F4YA 4F25A 1CPZA 2KB2A 1VQ7N 3GL1A 4O9MA 2UXDJ 4UB4A 1KAZA 3AA5X 5LSOA 4HVJA 3E3XA 2R2UA 2E29A 1FNMA 4GXIA 2VUGA 5FD1A 3VZIA 1HHTP 3LZJA 1ZQGA 2YKNA 2GA7A 1VQ5N 3MMBB 5ETVA 3QNOA 1RAJA 1PYSB 5BPCA 2CZVC 1IV8A 3OTOK 3X1LB 3ZTRA 5KQDA 3IBCB 2ZC4A 2GQQA 2G8UA 1ZH5A 4JI5J 1H2VZ 2GS8A 1F9EB 3WIUA 1XSLA 1RGIA 4CZGA 3ZZUA 2ADCA 3OFEA 1N5SA 3I55S 3K57A 1TVRB 3I76A 2DGWA 3OYKA 3NDKA 4B1ZA 5FPEA 2MQ8A 2X1AA 3MMCB 1I6JA 3OT9A 1T05B 1X4AA 1NNLA 2V63A 3P83D 2E20A 1VSEA 2W3SA 4LR7A 1I94K 2ZTEA 1HBNB 2U2FA 3B8AX 5KFXA 1S10A 4A8OA 1ZJMA 2C2RA 4BR2A 4JI2J 3AUOA 1LK5A 5KT4A 1ZOTA 2YPYA 3ZSVA 4I9LA 4MN4C 1SZPA 4BRGA 3L2WA 5KFBA 1K5OA 3M8RA 3GCWP 3SFGA 1YVNA 4LREA 1QUPA 4W5QA 3CGIA 1Z2ZA 1X6IA 3C6TA 4L72B 4OJ5A 4OYOA 2Y0SD 2IIRA 5L1LA 4Y00A 4QU6A 1B9FA 3H8MA 2XI9A 3WC0A 1YG0A 2RRDA 3BZKA 1X4EA 2K1RB 3QICA 4NLPA 3UQ0A 3FSYA 4ECZA 2DY1A 1VFJA 2RU9A 3ZDEA 4P52A 4TYBA 1FNXH 1R0BG 1QQ5A 2GGPB 3OTDA 3QGHA 1IXKA 2HWHA 2M8HA 2CH5A 5BOLA 3IAS9 3U1MA 2NPIA 4LC9B 4OX7A 1N63A 3EPIA 4U8YA 5D3GB 1NGAA 1KKXA 5KT5A 3AQOA 1NCLA 1RU1A 2CZ9A 4DL4A 1PYOB 5DQIA 3L9ZA 2W25A 4DUYF 2AKWB 2ZH8A 1M5PC 1ZQKA 4FKXA 4BC7A 1IBKF 3R9LA 1VQ9N 5LM7E 1YRTA 3LGMA 2A2DA 4NLXA 5J2NA 3SI6A 3GYNA 1XNQF 5HL7Q 2R7WA 4GO7X 2QK9A 3E9OA 4OX8A 1N0VC 2YX4A 3SV3A 1NH7A 2BDUA 2VPZB 3CSKA 2ZXIA 1XC3A 4H4KC 1BPZA 4FLXA 4R64A 3TVZA 3O4QA 3CHWA 1CULA 4ZMMA 8ICKA 5I3PA 2Y9HA 4NE9C 1VQKN 9ICLA 3ZTQA 3H8WA 2AJ2A 3FEXB 4BRKA 3MR3A 4KLFA 1OJ4A 2E7VA 5KFTA 4F4ZA 5K8MA 4FZYA 1WF1A 1QE1B 3BO4A 1NZAA 5ETSA 4J37A 2M9NA 4PQUB 4JI6K 3Q2SC 4B02A 3I4PA 1ZM2A 1DOQA 2CQBA 2OAUA 2A6AA 3AVNA 3G6YA 1ZZFA 1RCOB 3EKSA 1RDFA 5J2PA 3FGUA 2FB0A 5KFOA 1IBCB 3CDAA 1YUWA 3S6JA 1DTQA 4F2RA 4ED6A 6FDRA 4I4BA 3MD3A 4QIWC 2XYHB 1Y64A 4Y2SA 1D5AA 5HATA 3ULEB 3BQ7A 4FWQA 1CULB 3KHYA 2W40A 2NXEA 1X4CA 5HP4A 1NH8A 1NJIT 2DK2A 2W9CB 2W2OP 2ZH2A 4I2PB 2H65B 1JB0C 2IM1A 2YY3A 3AAWB 4JWMA 2XVTA 2ZNZA 4QCLA 3EO3A 1IR2A 2DNKA 1MLAA 3H5SA 2F76X 2AYBA 2HAIA 2KYXA 4NLBA 4DU7A 4C8MA 3HX0A 1RTIA 4TYAA 1QAJA 4QPTA 2C22A 3K89A 3MECB 1ZQDA 2HURA 1VQPN 3R6MA 5KOWA 1GFWB 4IBNA 2EQYA 3DLEB 2WB1C 2XSJA 4IO8A 1GMVA 4QJVA 3DWLA 2FY1A 1RAAB 4ZVPB 1W97L 3HSZA 1WC6A 1XIQA 2CPYA 4X66K 2FMPA 5M2PA 2ZTDA 2DNMA 1WDTA 2NUUG 1Z1ZA 2YBVA 2P9IB 4CK3A 4KH5A 4NCBA 3J7YI 3SMPA 3O6QA 2EG2A 4J91A 1D9FA 2IYGA 4IUFA 3H2LA 2YXLA 1ZQYA 3KK2A 2VASA 2VB6A 1R59O 1JKHB 9ICMA 1B7FA 4MTPA 3JPPA 3W7BA 2CJBA 1TP7A 3G86A 2VV5A 4CZEA 3CCUN 1YTYA 4B1UB 3BN4A 4USJC 5KAKA 5E3RA 5HN0A 3U3YA 5IT4A 1N32K 4R8UA 4ED3A 1Q7YT 3D2FB 3HI9A 4KO0A 1VSDA 2HMIB 4FJIA 3QIDA 3VAGA 4K5RA 5BYRA 2B6AA 2OYYA 5GADI 4I2FA 2VL1A 3JYTB 2I2YA 2XWXA 2PFOA 4KLJA 2ZD1A 2DNZA 1HL6A 7AT1B 2GC8A 3PMLA 1VLYA 3FZ2A 4IFYB 3KK1A 3VAMA 3DN9A 2VWKA 4ZTJA 7FD1A 1OSCA 1VRTB 4KLOA 3I56N 2O4IA 4CEBA 5GTHU 1QTNB 4WFBQ 4JKCA 3VEZA 2P66A 1S57A 1IBMK 4V19X 1FJGK 1V85A 2C3OA 3OYDA 3PX4A 4C6AA 1AROP 3PHEA 2VPWB 1QQ6A 7ICKA 3KLFA 2XHWA 3CCSS 3F5EA 3ICXA 2BRLA 3IM9A 4KIAA 1U1LA 5AXNA 5M1FA 4WJ3B 2VODA 2NSBA 4DTOA 2ZIUB 2RT3A 2G2OA 3W9JA 1ITPA 4ZLPA 3UN3A 3F9KA 2LM4A 2VJVA 2VCPA 4IG3B 4HTLA 4F93B 3F41A 3G4SS 4OPKA 3H3NO 3DC2A 2IRUA 2EBEA 1S49A 2HAFA 3PJWA 3D9BA 1FEHA 1C7YA 5HJYA 3AVBA 1TAUA 1ZZNA 2CPZA 2QTDA 3P3DA 4LF8K 4KPYA 2PA8D 2B6GA 2KKHA 1U1KA 1PJ7A 1U09A 3CFOA 3UB5A 3OL8A 3B0YA 1RHJB 4MF2A 2UUTA 1SV5A 4NX9A 5KFUA 3D2FA 1SGGA 2W9MA 2RAQA 2ZXHA 3RJJA 3O5TB 2MLZA 1JXVA 2UUBK 1GXLA 3FCWA 3W63A 1GNKA 4CLYA 2QTWA 2CQ4A 2DFLA 2A19A 2YB1A 4ECWA 3ZT2A 3SSSA 4WFNL 1R8PA 2VBXA 4LF4F 2WVBA 1WBBA 4KHNA 3IBPA 2VWJA 2X3GA 4CF4A 3QMQA 4X4UA 4MLHA 3HL8A 3PCOB 3Q24A 1NPRA 2YNHB 3CJ8A 2JEIA 4BRCA 1UW9A 2XZDB 1N5TA 2K3KA 4V19J 1N6QA 1Y88A 1ZQHA 1A7GE 2VBWA 3P1GA 1ULRA 4JK1A 4NA3A 2E5LK 1YQHA 3MF5A 1IKVB 5F8GA 2I0XA 2KXHA 1HQ2A 1HYVA 3V81A 3VN5A 2PXIA 4YHHJ 5J2MB 5K14B 3CM5A 2AGPA 4N8NA 4USIA 3FBFA 4R0EA 2P6RA 2Q97A 1XUPO 3HCXA 2OYQA 2HEKA 3IM1A 4Y2XA 1VQMN 2UXCK 4ZP8A 3I5BA 1J27A 5L38A 4BR7A 1D9DA 4CEZA 5EN1A 2KM8C 3TQ1A 4JI2K 3R8YA 3NMRA 5ALFA 3DYAB 1VQOS 4IRCA 4EELA 3U3GA 1VI7A 4UBCA 1LKYA 4DR7J 2U1AA 2AA4A 3LVVA 4TU7A 3TTCA 1FDBA 3FGVA 2DYAA 2X74A 1VBYA 4JI8K 3W5ZA 1WNSA 1NGCA 3DMJB 4DV7K 1DK3A 4NMXA 1N56A 2IVFB 4JI2F 4CF9A 4DR3F 4OX6A 3AD7C 2IJFA 3VAJA 3IP0A 1HNXK 2XI2A 3BBCA 2X78A 2HRYA 2PIIA 2MKHA 3U4LA 4KN4A 3SCXA 3N28A 3JAMY 1AXQA 3HRGA 4IJNA 3DXMB 3HJVA 2NR0A 1L8LA 4YDUC 1YTUA 4LRBA 4A62A 5K4LA 3CJ2A 4LRAA 3DLBA 2IVNA 1FVSA 1S3XA 4LIWA 2QL5B 2W3RA 2Y0SC 4LSNA 3M1VA 2OXOA 2G8FA 1K73T 1XR7A 4Y2AA 4NXNF 3KJVA 4LF4K 3KIOA 4KFBA 3OVAA 5IIIA 2R8IA 5IM0A 4DR1K 1VMBA 2ZIWB 2QT7A 1HQUB 2WSCC 4BDYA 1LV5A 2DHGA 2DR6A 4IFEA 1B4SA 3DOLA 4YNQA 3GG1A 4URGA 1RE1B 5KFSA 3A8KA 3F5TA 2A41A 4DV5K 3QEVA 3LAMA 3MN5A 1K47A 1T9UA 2DNQA 2IDOA 3SMVA 1JALA 3SIPB 1QJHA 4IYQA 2G0AA 3OHAA 1VLBA 4DX5A 4XH1A 2PMHA 4CJPA 3PR5B 2K4EA 1IWGA 3ZETB 3L95X 1UVJA 1RDDA 4DTNA 3UQ2A 3DMJA 1B9DA 4FLUA 1CC8A 3BKFA 5D8HB 2CNOB 1OIAA 3WKEA 3EUB2 4BE1A 4CO5A 2BTFA 1F21A 5E2QA 2LYHA 5GAGP 4OX9F 4PA1A 3MMJA 1KCFA 1BI4B 3GWCA 2ZKUA 4LRFA 4DSJA 2EVZA 1X40A 3UD3P 3IO1A 4IQXA 1NMNA 4FM0A 2DPJA 3L0QA 4ZPDA 3L5KA 4BRDA 4F71A 2WVDA 4B6JA 2OPQB 1QSSA 4OZ5A 2MGZA 2ROEA 3CCES 4ZDNA 2B0CA 2PEBA 4PHTX 5KTQA 2Y0SF 3C21A 3V1RA 3H7HB 4H54A 1D1UA 3K58A 3GV8B 3QSIA 1NB7A 1CQNA 3G6ES 1RI7A 4KKOA 5EX0A 1NK5A 3ELHA 4Q45A 4RQ5A 3P4IA 4JUZA 2IGIA 4FK2A 4O3SA 4DR7K 2FJDB 4YFKA 2J6UA 4C3KA 2FHKA 4NCAA 1T3OA 3D3CJ 1GMWD 1N54B 4USMA 4DUYK 5GAGU 2R2SA 4MAKA 2EZXA 4FYXB 3J80O 2H5IB 4IXCA 1UJ5A 2DPIA 3AJ2A 2RQKA 4CD1A 4RQ3A 4H0OA 1LNQA 3IRXA 4EBCA 1E6VB 4NA1A 2E2PA 3QUQA 3T5JA 1ZOLA 3QPIA 1NOMA 1WC1A 3R1LA 3H98A 4MFBB 4OYZA 2QMUB 1GXUA 3QT5A 2HB5A 4M5GA 4XIUA 3JPSA 2ISOA 2B4VA 1K9MO 4WTYA 2WHOA 4LIRA 3F56A 3BGUA 2RNEA 1GLAG 3AT1B 2YV0X 1REGX 3QEAZ 4ZH4A 5ETNA 3IS9A 4GW6A 5J0YA 2RSQA 2A1JA 3SEOA 1VCTA 4UAVA 3G0ZA 3L7PA 5F9NA 1S0MA 3KUHA 4BG9A 3BS5B 4M5HA 3I0SA 3SMSA 1IUJA 1IM6A 5DRKA 3V6HA 5HQMA 4Y2MA 4O0NA 5KG3A 2ETJA 1HIYA 4CBUA 3ITHA 2V8HA 2K2PA 2Z8QA 4E2FB 4LMZA 4M6WA 2QA4N 2DR9A 2E6MA 3CD6N 1H6KX 4L3KA 4UB6U 3QETA 2WF9A 2ESEA 1H7WA 3LDNA 3LM9A 4KLQA 3J7AP 3DRPA 1S12A 2HHUA 3AQPA 2W04A 2V2QA 4G1IA 5HBMA 1SJFA 1ZD2P 5D3GA 2DNGA 3S6EA 3T1YF 4NLRA 3MDCA 3CMES 4JKEA 1R3NA 3T7ZA 2DHHA 3DLHA 4C11A 2KHOA 3GIKA 4QR2A 3LUYA 5E3CA 5C2GA 4BR9A 5IIMA 2VGMA 3NGUA 1L6NA 3BS9A 4I2CA 2ZJQQ 4AM6A 2FHOB 4KX5A 1JLQA 1NKBA 3CO0P 5F8NA 4G1QA 5DDYA 2XMVA 1A5VA 1D8LA 1ZBSA 2E88A 4H4MA 2P9GA 1ZM4A 5AM2A 4ZCLA 3ZNUA 8ICNA 1OSDA 3G8QA 2VKRA 5CHCB 3UCUP 1CSJA 1GAOA 4DDFA 4Q0BB 1RP5A 4DO9A 2MAXA 3ZDCA 3ZI4A 5KFEA 3IFEA 1SH2A 1UCVA 2QYGA 2FBTA 1VQPS 4LRCA 5KG0A 4NA2A 1DGJA 2HGMA 2D0PA 4HCCA 3E58A 4RQ6A 4LF6F 2VBZA 4FWKA 1B64A 4FWRA 3SAGA 5D0GA 2VG5B 1WAFA 4NXMK 5C42A 2ZHBA 1DRGA 2EFGA 2OA8A 2JSXA 4YY3K 3EDQB 3O5BA 1P9QC 2E5LF 1A9NB 3SJJA 3BY5A 3PJ9A 1PYTA 2C2NA 2FMQA 1TMJA 4DSLA 2FSJA 1S6UA 3LPUA 4Q0BA 4EAHD 2Z1GA 2Y1JA 4NLGA 3KJQB 2R9LA 5CABA 4NYFA 2YHYA 4TXSA 4CZLA 1EWRA 2D3DA 3U1NA 4PPZA 4CF0A 1UVNA 2IOFK 3Q22A 5LMNK 4WXWA 1CS4A 2X7IA 2I1QA 4CFCA 4ER8A 3IMQJ 3DKDA 1J97A 3ZYYX 3ZSZA 4A8MP 4P2FA 3PSTA 3K2YA 1RQLA 4ILJA 4BRPA 1J2NA 2FPLA 2KVCA 4FWPA 4EZ9A 4D3GA 4USTA 2GJ2A 2IVYA 2M7SA 4JI3F 3N4PA 2D4WA 7ICOA 3B0XA 4XO0A 4UAYA 4ILGB 1CJTA 3RYLA 7ICEA 3GTYX 2KO1A 2OMOA 4MK8A 4JKDA 1RWOB 4WFXA 2H3ZA 2KKVA 1DGKN 4YHHF 3HSGA 1VQON 1FXRA 1LWXA 2JZ5A 3KHLA 4DV3J 1X9MA 1RWUA 1QQCA 2OHDA 4CEFA 1XNRJ 2Q6BA 4EENA 2KXNB 3AQEA 1NGEA 4PG6A 4ILMA 2C2MB 2UU9J 4JI0F 2VFSA 4XTTA 4FM1A 5D4BA 2LA6A 1F0XA 3ZZOA 2XMKA 5J2EA 1HD1A 3T79A 2DPNA 3I56S 2ZQBA 4DV1J 4TUPA 3KFWX 3DGPA 3TUPA 3TABA 1SL0A 4A8WA 5EDWA 4RPZA 1NSAA 2ZZNA 4KAZA 4K42A 3WT0A 4X66J 5BPMA 2CGKA 3VGUA 4I6AA 2AH5A 2EFOA 2EWSA 1NGGA 2ZWOA 2M88A 3RH5A 2VYPA 5HRNA 5F2RA 3KBBA 4MKVA 1T02A 3FKBA 5KFJA 3ENOA 5AQSA 3QXGA 2EW9A 3LDAA 1DXSA 4ED0A 2JHEA 4I68A 3T9NA 2V4RA 4NRUA 4QYRA 3WKDA 3CJ3A 3KUGA 3OFFA 1ILYA 1TMMA 2C3PA 4DR2K 4IG0A 3QT8A 1K0TA 4A8SA 3WKAA 4M9LA 2IOFA 4NEZA 4PL8A 3W2WB 2ASLA 2L3MA 3HSTB 4ALZA 2PYJA 2WCXA 8ICHA 8ICWA 1WHXA 1URJA 1UA1A 3NVWA 5KAFU 4L73A 3WHIA 1ED1A 3SFUA 3RB6A 2ZM6F 4OIXA 1SCJB 2UUBF 1WTFA 5BR8F 1EQ0A 3AHPA 5EOYA 4LR9A 2J4RA 3WNFA 5I9EB 1XQSC 4I67A 3OHRA 1P6TA 3MPYA 4HUFA 4WZQA 4H0XB 4JAXA 3ZZ0A 4IG0B 1RBAA 2E3TA 2A1JB 1Q16B 4CYUA 3D28A 2CPRA 3M2RA 3CI5A 2CPXA 3MPWA 3O3LA 2B21A 3HK2A 5BR8K 4O3MA 5B08A 2E5HA 4I27A 4TVAB 3PNCA 1HR0J 2P6UA 1KFDA 4YD1A 3SBTA 2UVWA 1LXNA 4RQ1A 1REVB 4BS2A 2MU2A 3DHXA 2YH0A 4Z6EA 3CF5Q 3NS5A 4M3WA 1RBTA 5KT2A 2K4HA 1U1QA 1KWMA 1VQLS 2OKQA 2E2OA 4M5DA 1YLXA 2OSQA 1SJ4P 4H4KA 1SJRA 1YHQS 1PBAA 3S01A 1U2VA 4Z6DA 2HBQB 5GTIU 2VC1A 5DGBA 3DLKA 3UN2A 1X9WA 1WHYA 4H0VB 3S1TA 1U2VB 1YJ7A 9ICTA 1MU2B 4DR2F 5CY4A 1SS6A 4YY3F 2V2VA 2YTCA 4F72A 1FRJA 1LEOA 1JXLA 4Y1DA 3EE8A 3BGLA 4DR4J 2XSJB 1C20A 3SR6A 1T6CA 1WB9A 3CD6S 5JRTA 4KRWA 1NGJA 1I94J 4USKA 2HHVA 2MZQA 3J8AA 4DFJA 2V9WA 2R7UA 1QHAA 2OD6A 1SC1B 1Z26A 2E1ZA 2FF6A 1IKYB 1YJNN 3VEYA 4GC7A 4FF4A 5A8RA 5AI6A 2C3MA 2VKZG 4IKFA 8ICFA 1ZBIA 3OA9A 4AYBD 3R1XA 2RD5C 9ICHA 5ALVA 3UDEA 5EWGA 4MDAA 3DU6A 2B5JA 2MZSA 4KMOB 3NH0A 3FSXA 1KDHA 2CXEA 1N48A 3FEZA 1RWPB 4UY8T 2AW0A 1GMUA 1U2RA 3EZWA 3D6TB 2G07A 1FESA 4AL5A 2ZKTA 3SQOP 1BISA 1EQMA 3UKUB 3GR1A 3LOUA 2FUG9 2HNZB 1KBUA 2BCVA 2MZTA 3QLHA 6AT1B 3CPEA 1YF5L 1QQOA 4DX7A 2NRWA 1DLOB 3CCUS 3C6AA 3V4MA 3SXLA 1KLMB 4KLMA 1S48A 3GCXP 2QE5A 4KHYA 2NSCA 3J7YU 5ALIA 4UAZA 2R7TA 4TUSA 1TU0B 4ID8A 1TZ0A 1IBKK 3AH6A 3H25A 3ZEUA 1BPDA 2DWQA 3GFYA 5AQYA 2ZJAA 4OPJA 2HSZA 4J2BA 3C16B 3B78A 2F3NA 3FBBA 4UY85 2HZVA 3KMSA 1NDPA 1YJWN 3JPOA 5KFGA 4OKJA 5J1NA 1FIQA 4JI3K 8ICQA 1LFWA 2DT9A 4NYPA 3IR5B 4NZ0A 1U49A 3NP5A 3GG4A 5G0RB 5C2DA 2HQIA 1DQ8A 3D1HA 1NB2A 1QY7A 2LQ8A 1TKDA 3OTOJ 3BKTA 3TSUA 3W65A 1NDKA 4UARA 2BJ1A 4ZIVA 3QUBA