3HPBA

Crystal structure of snx5-px domain in p212121 space group
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
154
structure length
154
Chain Sequence
VSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snx5 protein
publication title The Phox domain of sorting nexin 5 lacks ptdins(3)p specificity and preferentially binds to ptdins(4,5)P2
rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 46
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3hpbA00
2REDA 3HPCX 2YPSA 3FOGA 2DYBA 3IQ2A 1H6HA 1GD5A 4OXWA 4AKVA 4ON3A 4AZ9A 4PQPA 3HPBA 2RAKA 2AR5A 2RAJA 2V14A 1OCUA 4IKBA 2CSKA 2CZOA 1KQ6A 2V6VA 1XTNA 1XTEA 4P2JA 4PZGA 2ETTA 4BGJA 2WWEA 3P0CA 4HASA 4IKBB 2L73A 4IKDA 2RAIA 1OCSA 2IWLX 3LUIA 3DYTA 4P2IA 1O7KA 2REAA 4PQOA 1KMDA 2I4KA
chains in the Genus database with same CATH superfamily
2REDA 3HPCX 2YPSA 3FOGA 2DYBA 3IQ2A 1H6HA 1GD5A 4OXWA 4AKVA 4ON3A 4AZ9A 4PQPA 3HPBA 2RAKA 2AR5A 2RAJA 2V14A 1OCUA 4IKBA 2CSKA 2CZOA 1KQ6A 2V6VA 1XTNA 1XTEA 4P2JA 4PZGA 2ETTA 4BGJA 2WWEA 3P0CA 4HASA 4IKBB 2L73A 4IKDA 2RAIA 1OCSA 2IWLX 3LUIA 3DYTA 4P2IA 1O7KA 2REAA 4PQOA 1KMDA 2I4KA
chains in the Genus database with same CATH topology
2REDA 3HPCX 2YPSA 3FOGA 2DYBA 3IQ2A 1H6HA 1GD5A 4OXWA 4AKVA 4ON3A 4AZ9A 4PQPA 3HPBA 2RAKA 2AR5A 2RAJA 2V14A 1OCUA 4IKBA 2CSKA 2CZOA 1KQ6A 2V6VA 1XTNA 1XTEA 4P2JA 4PZGA 2ETTA 4BGJA 2WWEA 3P0CA 4HASA 4IKBB 2L73A 4IKDA 2RAIA 1OCSA 2IWLX 3LUIA 3DYTA 4P2IA 1O7KA 2REAA 4PQOA 1KMDA 2I4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RED A;  3HPC X;  2YPS A;  3FOG A;  2DYB A;  3IQ2 A;  1H6H A;  1GD5 A;  4OXW A;  4AKV A;  4ON3 A;  4AZ9 A;  4PQP A;  3HPB A;  2RAK A;  2AR5 A;  2RAJ A;  2V14 A;  1OCU A;  4IKB A;  2CSK A;  2CZO A;  1KQ6 A;  2V6V A;  1XTN A;  1XTE A;  4P2J A;  4PZG A;  2ETT A;  4BGJ A;  2WWE A;  3P0C A;  4HAS A;  4IKB B;  2L73 A;  4IKD A;  2RAI A;  1OCS A;  2IWL X;  3LUI A;  3DYT A;  4P2I A;  1O7K A;  2REA A;  4PQO A;  1KMD A;  2I4K A; 
#chains in the Genus database with same CATH topology
 2RED A;  3HPC X;  2YPS A;  3FOG A;  2DYB A;  3IQ2 A;  1H6H A;  1GD5 A;  4OXW A;  4AKV A;  4ON3 A;  4AZ9 A;  4PQP A;  3HPB A;  2RAK A;  2AR5 A;  2RAJ A;  2V14 A;  1OCU A;  4IKB A;  2CSK A;  2CZO A;  1KQ6 A;  2V6V A;  1XTN A;  1XTE A;  4P2J A;  4PZG A;  2ETT A;  4BGJ A;  2WWE A;  3P0C A;  4HAS A;  4IKB B;  2L73 A;  4IKD A;  2RAI A;  1OCS A;  2IWL X;  3LUI A;  3DYT A;  4P2I A;  1O7K A;  2REA A;  4PQO A;  1KMD A;  2I4K A; 
#chains in the Genus database with same CATH homology
 2RED A;  3HPC X;  2YPS A;  3FOG A;  2DYB A;  3IQ2 A;  1H6H A;  1GD5 A;  4OXW A;  4AKV A;  4ON3 A;  4AZ9 A;  4PQP A;  3HPB A;  2RAK A;  2AR5 A;  2RAJ A;  2V14 A;  1OCU A;  4IKB A;  2CSK A;  2CZO A;  1KQ6 A;  2V6V A;  1XTN A;  1XTE A;  4P2J A;  4PZG A;  2ETT A;  4BGJ A;  2WWE A;  3P0C A;  4HAS A;  4IKB B;  2L73 A;  4IKD A;  2RAI A;  1OCS A;  2IWL X;  3LUI A;  3DYT A;  4P2I A;  1O7K A;  2REA A;  4PQO A;  1KMD A;  2I4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...