3HPCX

Crystal structure of snx5-px domain in p21 space group
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
SVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Snx5 protein
publication title The Phox domain of sorting nexin 5 lacks ptdins(3)p specificity and preferentially binds to ptdins(4,5)P2
rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 52
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 3hpcX00
2AR5A 2RAIA 4PQOA 3HPBA 3HPCX 2REDA 2ETTA 1GD5A 3P0CA 4ON3A 4P2JA 2V6VA 4AZ9A 2RAKA 2YPSA 2REAA 2I4KA 3IQ2A 4PQPA 2RAJA 1XTNA 2CSKA 2V14A 2IWLX 4IKBA 1OCSA 4IKBB 4BGJA 1KMDA 4PZGA 2WWEA 1O7KA 2L73A 3LUIA 4HASA 1XTEA 4AKVA 4OXWA 1OCUA 1H6HA 2CZOA 2DYBA 4IKDA 3DYTA 4P2IA 1KQ6A 3FOGA
chains in the Genus database with same CATH superfamily
2AR5A 2RAIA 4PQOA 3HPBA 3HPCX 2REDA 2ETTA 1GD5A 3P0CA 4ON3A 4P2JA 2V6VA 4AZ9A 2RAKA 2YPSA 2REAA 2I4KA 3IQ2A 4PQPA 2RAJA 1XTNA 2CSKA 2V14A 2IWLX 4IKBA 1OCSA 4IKBB 4BGJA 1KMDA 4PZGA 2WWEA 1O7KA 2L73A 3LUIA 4HASA 1XTEA 4AKVA 4OXWA 1OCUA 1H6HA 2CZOA 2DYBA 4IKDA 3DYTA 4P2IA 1KQ6A 3FOGA
chains in the Genus database with same CATH topology
2AR5A 2RAIA 4PQOA 3HPBA 3HPCX 2REDA 2ETTA 1GD5A 3P0CA 4ON3A 4P2JA 2V6VA 4AZ9A 2RAKA 2YPSA 2REAA 2I4KA 3IQ2A 4PQPA 2RAJA 1XTNA 2CSKA 2V14A 2IWLX 4IKBA 1OCSA 4IKBB 4BGJA 1KMDA 4PZGA 2WWEA 1O7KA 2L73A 3LUIA 4HASA 1XTEA 4AKVA 4OXWA 1OCUA 1H6HA 2CZOA 2DYBA 4IKDA 3DYTA 4P2IA 1KQ6A 3FOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AR5 A;  2RAI A;  4PQO A;  3HPB A;  3HPC X;  2RED A;  2ETT A;  1GD5 A;  3P0C A;  4ON3 A;  4P2J A;  2V6V A;  4AZ9 A;  2RAK A;  2YPS A;  2REA A;  2I4K A;  3IQ2 A;  4PQP A;  2RAJ A;  1XTN A;  2CSK A;  2V14 A;  2IWL X;  4IKB A;  1OCS A;  4IKB B;  4BGJ A;  1KMD A;  4PZG A;  2WWE A;  1O7K A;  2L73 A;  3LUI A;  4HAS A;  1XTE A;  4AKV A;  4OXW A;  1OCU A;  1H6H A;  2CZO A;  2DYB A;  4IKD A;  3DYT A;  4P2I A;  1KQ6 A;  3FOG A; 
#chains in the Genus database with same CATH topology
 2AR5 A;  2RAI A;  4PQO A;  3HPB A;  3HPC X;  2RED A;  2ETT A;  1GD5 A;  3P0C A;  4ON3 A;  4P2J A;  2V6V A;  4AZ9 A;  2RAK A;  2YPS A;  2REA A;  2I4K A;  3IQ2 A;  4PQP A;  2RAJ A;  1XTN A;  2CSK A;  2V14 A;  2IWL X;  4IKB A;  1OCS A;  4IKB B;  4BGJ A;  1KMD A;  4PZG A;  2WWE A;  1O7K A;  2L73 A;  3LUI A;  4HAS A;  1XTE A;  4AKV A;  4OXW A;  1OCU A;  1H6H A;  2CZO A;  2DYB A;  4IKD A;  3DYT A;  4P2I A;  1KQ6 A;  3FOG A; 
#chains in the Genus database with same CATH homology
 2AR5 A;  2RAI A;  4PQO A;  3HPB A;  3HPC X;  2RED A;  2ETT A;  1GD5 A;  3P0C A;  4ON3 A;  4P2J A;  2V6V A;  4AZ9 A;  2RAK A;  2YPS A;  2REA A;  2I4K A;  3IQ2 A;  4PQP A;  2RAJ A;  1XTN A;  2CSK A;  2V14 A;  2IWL X;  4IKB A;  1OCS A;  4IKB B;  4BGJ A;  1KMD A;  4PZG A;  2WWE A;  1O7K A;  2L73 A;  3LUI A;  4HAS A;  1XTE A;  4AKV A;  4OXW A;  1OCU A;  1H6H A;  2CZO A;  2DYB A;  4IKD A;  3DYT A;  4P2I A;  1KQ6 A;  3FOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...