3HPGA

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCQENKMGIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
molecule keywords Integrase
total genus 66
structure length 194
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hpgA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpgA02
4O44A 5C42A 3NAEA 2DFFA 4KTWA 3ZSQA 3AO4A 3LALA 4KTZA 1EXQA 3LZIA 3H08A 3LP3A 3S3MA 4C8OA 2IC3A 2EHGA 3MAQA 2HMIA 2VG5A 1LW2A 1BCMA 1KFDA 4KHQA 2P51A 4ELVA 4FJ5A 3NH0A 2FBTA 3ZSWA 4N76A 2WONA 1RT6A 1XI1A 1U4BA 4FJJA 3VQ9A 1NK0A 2Z1IA 1Q9XA 4FJKA 3S3NA 1LAVA 3RR8A 3P5JA 1DTTA 1IH7A 1Z26A 2FC0A 1BISA 3OYHA 2HHSA 1U45A 4N47A 4CF2A 3OYEA 4CEEA 4OKEA 4BDYA 4M3UA 2D5RA 3PV8A 3NFAA 2QXFA 1KLNA 2PZSA 1NK4A 2BGGA 4ZTJA 3K5OA 4LH4A 3L2UA 3VQAA 3KJVA 1RDAA 1YTAA 3KLGA 4CJRA 2RN2A 4MQ3A 4M3RA 2FBYA 4PWDA 4DSLA 4FYDA 3VQEA 4B9LA 3SQ2A 3IS9A 4AHRA 3FFIA 3VA3A 2HHVA 1NKBA 3OYFA 3RRGA 3LPUA 3QLHA 4IFVA 2YHAA 3RMDA 3KLIA 1RT2A 1WJAA 1BI4B 4CGGA 5T7BA 4AHUA 3U3YA 4E0DA 1DTQA 4JS5A 3SNNA 3QNOA 1TGOA 3VQCA 4CGHA 3DOKA 3OYAA 3DLRA 3ULDA 3OS0A 3LAMA 3SQ0A 3VQ7A 3OYIA 1UA1A 1QTMA 4ID1A 4E7JA 3NGZA 3DLKA 3TAMA 5KGXA 3RMBA 1ASVA 3DLBA 4FVMA 3ZT0A 2YKNA 4Q0BA 3AO2A 4DSIA 4BWMA 4FLYA 3OYKA 4CF0A 3HPHA 5HBMA 4KV8A 4BACA 1A5VA 3OYJA 3KD5E 2B4JA 3NF7A 3SUOA 4M3YA 1MU2A 4CF9A 4ELTA 4PY5A 3DLGA 2HW3A 1A5XA 3PUFA 3SPYA 1ZBLA 1CLQA 1KLMA 4XIUA 3AO1A 2O4IA 1RDCA 2ZQBA 3TAEA 2OPRA 3V6DA 4AHSA 1RBTA 1FKPA 3SUQA 2G8VA 4M41A 2ZD1A 4CESA 3ZT2A 4R5PA 4F4KA 4J2EA 4FK2A 4B3OA 4B9MA 1NKEA 3VQPA 4CEFA 1NJWA 3A2FA 1TK0A 3T3FA 3L2RA 4E7LA 4E7IA 3NHGA 1LWEA 3WNHA 4DTMA 1N5YA 1RTHA 2Z1HA 1L3SA 4KHWA 1RBRA 4CGFA 4IDKA 3PX6A 4M45A 1NK6A 3U6FA 1KVBA 3OJUA 3HVTA 1WSJA 3OY9A 2BE2A 4BE0A 3CM6A 4CJQA 4DG1A 2HHUA 1CXUA 4OGEA 3B6OA 3ZT1A 4QCLA 1UAXA 3HYFA 3VQ5A 3MXJA 4I2QA 1X9WA 4KAZA 5KTQA 4B08A 3EY1A 4CJ3A 4HTUA 5HROA 2I5JA 4B8AB 4DLEA 4J2AA 2YNHA 2KTQA 2P5GA 3TARA 1IKXA 4W5RA 1BL3A 4H4OA 3RMCA 5K14A 3HVRA 2KZMA 1VSMA 4CHPA 3ALYA 4CEQA 1KCFA 1KSPA 1NJZA 1EP4A 1LAWA 1E0EA 2GUIA 3KKRA 1BIZA 5CZ2A 3O4NA 4ICLA 1WJBA 4BE1A 3CFOA 4C8MA 1FXXA 4I2PA 4RW6A 2OPPA 4O55A 3T19A 4L8RB 4FJ8A 4Z4EA 1C1CA 1NK8A 5FRMA 4B9VA 1NK9A 3P1GA 1SUQA 2RKIA 4KHSA 4Z4GA 4FLWA 1K6YA 4CFCA 3KLFA 4CEZA 3CQ8A 3ISNC 3VQDA 4M3XA 1GOAA 4EZ6A 1W0HA 4Z0UA 3O3FA 3V9UA 1VRUA 1T8EA 1XHXA 3AO3A 4HUGA 1RTJA 3VQ6A 3IRXA 4FLXA 1JXBA 1TK5A 2O4GA 1XC9A 3KD1E 4K8ZA 4AILC 2E6LA 1Q9YA 1C1AA 3DMJA 2YV0X 4RG8A 2HHTA 2PYLA 2EX3A 4E7HA 4CK1A 3K59A 4E7KA 1C6VA 1RILA 4CFAA 1WSFA 1TAQA 4E89A 3B6PA 3KK1A 1WJDA 2W42A 3NCIA 3AV9A 3K5MA 1KFSA 2QKBA 4PQUA 3BGRA 3AVGA 2PY5A 4B9UA 2IAJA 3AVNA 4DF4A 3NBPA 4Z4HA 4FJXA 4DU4A 2YNGA 5HRPA 4DSJA 3TAGA 3AVKA 1D9FA 4FLTA 4KFBA 3QIOA 4ID5A 3SUNA 3QINA 1J5OA 1RT3A 3LANA 1DLOA 1CZ9A 2B5JA 4H4MA 1GOBA 1I39A 4RW4A 4DQQA 3M8RA 3LDSA 1KONA 1WJFA 1J53A 4H8KA 4W5QA 4FCYA 3SYZA 3IAYA 4KRFA 1QSSA 1SV5A 3AVHA 4AHTA 5DK5A 3KK3A 3V9ZA 2XY8A 5HRNA 3PX4A 3V1QA 2KQ2A 4YNQA 5C25A 1S5JA 3NGYA 4F2RA 4ZHRA 1TKDA 3NF6A 4FW1A 1RT4A 3HT3A 3HPGA 3TI0A 3U3GA 3EZ5A 2YHBA 4PUOA 4OKKA 4O0IA 3LWLA 1BQMA 1QHTA 4OKJA 2Z1JA 1JKHA 1W9HA 2JGUA 4LD0A 4NCBA 4CGIA 1LWCA 1Y97A 1QE1A 1ASUA 3AVBA 3MEDA 4CJSA 1HYSA 4FJLA 4KHNA 2QK9A 1JLEA 3VQQA 4LY7A 1VSIA 4YFUA 3NGIA 1RT1A 1MW7A 1HQEA 4JS4A 4DWIA 1L3TA 1RDDA 2XO7A 1L3VA 3PY8A 2VG6A 5SZTA 2ETJA 4CERA 4CF1A 1CXQA 5KI6A 4FJGA 3KKSA 5J2QA 4FZYA 3SI6A 4Z4CA 1B9DA 1WSGA 5DMRA 4DQRA 1TK8A 1XHZA 1LV5A 3CFRA 1J54A 2X6NA 3L3VA 4N5SA 1NKCA 1TVRA 3NH2A 4IG0A 3F73A 1HQUA 1LW0A 3ZSVA 5E41A 1FKOA 3HP6A 3I8DA 3QETA 2KFZA 3WNFA 3C94A 4O5BA 3KTQA 4GW6A 4CFBA 1WJCA 2G8WA 3AVAA 5J2PA 1ZYQA 4FJMA 1JLAA 4CJVA 3HJFA 1J9AA 2OZSA 3ZCMA 4E1MA 4DTSA 4CE9A 4HHTA 4DFKA 1NK7A 4DTOA 3V4IA 3QIPA 1VSFA 4CFDA 3SV3A 4RW9A 4EZ9A 4FJNA 4CHYA 4OJRA 4FJ9A 3HM9A 3RR7A 1VK0A 3AVFA 3DOLA 1TV6A 1YT3A 3QO9A 1B92A 3ZSOA 3RMAA 1X9MA 3QEVA 4F8RA 4FJ7A 2YNIA 3V1RA 4MFBA 4OLBA 3EYZA 1TKZA 3JYTA 3ITHA 3AVIA 4CECA 3K5NA 3OYGA 3MXMA 2G8KA 3HSTB 3ZSZA 2HVIA 3I0RA 1TKXA 4AH9A 1BGXT 3DRSA 4CHOA 4PA1A 2DTUA 2XRIA 1X9SA 4CEDA 5I3UA 1SKSA 4LH5A 4DU3A 3OYNA 1QSLA 3HPOA 4KTQA 4HCCA 1KRPA 5CZ1A 3CG7A 3M8SA 1VRTA 1G15A 3M8PA 4G1QA 4DQIA 3E01A 4QAGA 2HVHA 4FK4A 3L3UA 1TAUA 1JLGA 3ZSRA 3K58A 1T05A 2A1SA 3KLHA 4O0JA 1YVUA 3SUPA 2IOCA 1WAFA 3MEGA 1ASWA 4M3TA 5EU7A 4N41A 4F3TA 3LZJA 1RTIA 1HNVA 3WNGA 5SWMA 3AA3A 4FM2A 3WNEA 4HUFA 4IBNA 1IKVA 1JLBA 2IGIA 1S1WA 4DTJA 3M8QA 3L2VA 3IG1A 3AA2A 1BHLA 3DYAA 1BQNA 3NH1A 4DSEA 2XY6A 3VQBA 2PYJA 4Z4IA 4BDZA 4W5NA 4DSKA 2IS3A 2VWJA 1FK9A 1VSHA 3JSMA 4EP4A 3SCXA 3LP0A 5CYMA 1S1VA 2NUBA 4DSFA 2DFHA 3LWMA 2G8UA 1CZBA 3OYDA 4DFPA 1TL3A 1WN7A 3G0ZA 1NJXA 1HJRA 3QEXA 4CJUA 4FJHA 1UOCA 1LWFA 4BDPA 1JLQA 4B9TA 1VSDA 2KW4A 4NCGA 4OLAA 4DQPA 4CK2A 2E6MA 1YTUA 1QSYA 1U04A 3KK2A 4CGJA 4N56A 3PX0A 2OYQA 4QOZB 1IKWA 4CIEA 2FBXA 1HMVA 3O3GA 3OS1A 4J2DA 2G8IA 4RW8A 3OVNA 1D9DA 4FLVA 1D5AA 3OYLA 4NYNA 4CEOA 4CHNA 3TAFA 5C24A 3D45A 2OPSA 5KRSA 1SL0A 5HP1A 3BDPA 4DTNA 4I9QA 4I7FA 1A5WA 4KKOA 1C0MA 1RCHA 4JRPA 4DQSA 1NJYA 4EP5A 3LAKA 4FM1A 3CM5A 3I0SA 3NDKA 2D0BA 1RBSA 2OPQA 1JLCA 4F2SA 1WLJA 1RT5A 3KLEA 4OPKA 4CGDA 1BI4A 4FW2A 5FRNA 1IG9A 3LP1A 1QS4A 1B9FA 1U49A 4FJIA 1RBUA 4NYFA 2D0CA 3AVLA 4CJLA 3RRHA 3HK2A 1WSHA 3TWHA 4FZZA 4LSLA 2OZMA 1VSKA 1Z25A 3L8BA 3V9XA 4CEBA 3O4QA 4E1NA 2ITGA 2JLEA 1SKWA 2X6SA 2P1JA 3PO4A 1TKTA 5FROA 1EETA 4OVLA 3QEIA 3AVMA 1F21A 1I3AA 2YKMA 4Z4FA 5JS1A 1ZBFA 3OS2A 4KHYA 4DLGA 3QERA 2OA8A 1WSIA 1IKYA 1EKEA 3LP2A 3ZSYA 3ASMA 1ZBHA 1HRHA 3VQ4A 1JL2A 1GOCA 4DTUA 4CJTA 5D3GA 3S9HA 3SV4A 4DTRA 2XY7A 3DLEA 1VSLA 1L3UA 1S1TA 2GBZA 1C0TA 4FLUA 3C6UA 4CHQA 4DFMA 2Y1IA 1UA0A 3C95A 4DS4A 3K57A 4BE2A 1S9GA 3VQ8A 1WAJA 2B6AA 4WE1A 4AHCA 4CIGA 3DM2A 3HL8A 4CF8A 2D0AA 2XY5A 4C8LA 3TANA 4BWJA 3TR8A 2IDOA 1UWBA 3C6TA 1JLFA 4GVMA 4AHVA 4Y1CA 3QEWA 4CJ4A 4CCHA 2F8SA 4FXDA 1TL1A 3KIOA 4JRQA 4KREA 2Y1JA 4DFJA 2WOMA 3HO1A 4CJWA 1O1WA 2RF2A 3VN5A 3HXMA 3DLHA 4O4GA 4HVJA 3ZT4A 4M3ZA 1KVAA 3AVJA 1R0AA 2A1RA 1XWLA 3AVCA 3OJSA 3MXIA 1HYVA 3F9KA 4CIFA 3QNNA 2G8FA 1ZBUA 1C1BA 1NOZA 3K2PA 3MEEA 4ZTFA 4CJ5A 5HLFA 1N6QA 4KB1A 4C8NA 3D0PA 4ELUA 1U48A 3RTVA 4DS5A 4DU1A 4OGCA 4Y1DA 1BIUA 1RBVA 1WSEA 2ATQA 1S6PA 4IFYA 4JLHA 1HYZA 4B8CA 4CJFA 4UQGA 2XHBA 3RWUA 2RPIA 4GMJB 1ZBIA 2F8TA 2P5OA 3CYMA 4KHUA 3OYBA 4KB0A 5J2NA 2GV9A 2X74A 4DMNA 1SL2A 1NOYA 1SL1A 4HCBA 3DRPA 4W5OA 4E3SA 1NK5A 1Q8IA 4CHZA 3CFPA 1T7PA 3QESA 3NF8A 3PO5A 2HNYA 3V81A 3VA0A 2FBVA 3SPZA 4KO0A 5JS2A 2BDPA 2AJQA 1S1XA 1S1UA 4CJKA 4KI4A 2HHWA 3HP9A 1JL1A 5HRRA 1SKRA 4W5TA 3SJJA 1ITGA 4J2BA 2DFEA 1X1PA 5KGWA 3ZT3A 2YNFA 1IO2A 1REVA 3LPTA 1WJEA 5KRTA 1RTDA 2E4LA 1KVCA 5J2MA 4TSXA 1RNHA 3DI6A 1KTQA 2Z1GA 3THVA 3G10A 1JXEA 3ZSXA 4DF8A 3V1OA 4M3WA 4M42A 3OYMA 4FLZA 2KFNA 1BCOA 1HNIA 1RT7A 4DTPA 4FK0A 3NF9A 4I9LA 1EX4A 5HRSA 3DRRA 3OYCA 3NE6A 4C8KA 1S9EA 1QQCA 4E19A 4CK3A 4F3OA 4OPJA 3TAPA 2BANA 4DTXA 1RDBA 1D8YA 1C0UA 3MECA 4FM0A 2QKKA 3UIQA 2HHXA 1T03A 4F3QA 3AO5A 4LSNA 3AA5X 2HB5A 4RW7A 1WNSA 3K5LA 5I42A 4FZXC 4K8XA 2VWKA 4KPYA 2HNDA 2X78A 2ZE2A 1L5UA 3O3HA 4B9NA 3T1AA 3TAQA 4CJPA 2HHQA 2DY4A 1VSEA 2Q3SA 4KI6A 1HPZA 4IKFA 5J1EA 1S6QA 3AA4A 5CY4A 2VG7A 4HUEA 5CYQA 3V9SA 3SQ4A 2LSNA 5FDLA 3TABA 1U47A 4CEAA 4Q5VA 3P83D 1VSJA 4IG3A 3L2QA 2KZZA 3SZ2A 2HNZA 4CJEA 3QEPA 2G8HA 4NCAA 2R7YA 3L2WA 3V9WA 3S3OA 1LFPA 3SQ1A 2F96A 4B9SA
chains in the Genus database with same CATH superfamily
3E1YA 4O44A 3NQOA 3IH2A 1J0RA 4KTWA 4IHTA 1XSDA 2BHYA 5L3DA 2X1CA 5C0YA 3P9CA 1WI3A 1LW2A 4LOCA 4W1UA 4A3EJ 3R3LA 2JK3A 3GFLA 4GFBA 3H3VK 3CC7N 1YW9A 2FBTA 3ZPLA 3NH0A 4IPAA 3J7AP 3CDHA 3LA2A 2WAQN 2JJ7A 2Z9OA 1FNNA 2JA7J 2WAEA 4GO1A 4A0YA 1LAVA 4U88A 5FB2A 3DXKB 3FZVA 4RB1A 3HL2A 3QBWA 1IH7A 1Z26A 3OYHA 3QYEA 1BISA 1V5EA 3ABMH 1MA9B 4CYCA 4M3UA 4I99C 3HGGA 4H0TB 4LJZF 1KLNA 1NK4A 2WV1A 2QSGX 4DKWA 3ZOBA 2Q0UA 5HLGA 3B8AX 3E6CC 4LH4A 3HHGA 4MO4A 2X6OA 5FFXA 5E1ZB 3KLGA 4CJRA 4M3RA 4KA4A 3D2EA 3L09A 3JTHA 4Q47A 2E7XA 5CHIA 1QQNA 4B9LA 3SQ2A 3WQUA 4AHRA 3BT9A 3VA3A 2HHVA 1REPC 1LQ1A 4JBAA 2FSJA 3T0YA 3HBTA 1XDUA 2IP2A 4CGGA 4M3FA 3U3YA 2V52B 3ZEUB 4A5AA 1JTYA 3VSKA 3J7YJ 4LFUA 1RDUA 1MMNA 2VGMA 3KP2A 4ZYAA 2FA5A 3ULDA 2M8GX 3MD2A 3TP0A 3RQ4A 1UAAA 1ITYA 2TRTA 3KWGA 2QW9A 4B3XA 4S05A 5K5OA 4E7JA 3H9QA 4ID1A 3D7EO 3DLKA 1ZTRA 3PL8A 4PL7A 1ASVA 3M8JA 4FVMA 3NGZA 3RMBA 3HZ6A 2YKNA 3F5TA 4Q0BA 2L3DA 3E6BA 1R59O 1W97L 4KH5A 4X64K 1LE8B 3O1BA 2W84A 3OYKA 2GA1A 3G3ZA 2VQFK 4FLYA 4CD3A 1VQ7N 5C3EJ 4YOWA 4BACA 1EO1A 2B4JA 3CCLN 1Z6RA 2RNJA 2IXSA 1O7FA 4A6DA 3ZQLA 1OVYA 3PUFA 1A5XA 1GV5A 1ZBLA 2P7VB 2PBIA 2CW7A 1DGWY 2Q2EB 2VC1A 2PEXA 4A3CJ 4CBUA 1RDCA 3ZN1A 1NGIA 2YJFA 1VQ8N 1FKPA 3SUQA 2X51A 3P7NA 4M41A 3I58A 3R6SA 3B6AA 1IZ1A 5B3SH 3GF2A 4B9MA 3W3CA 4C9YA 2KIFA 4WWCA 4RM3A 3OW2M 1FTZA 1JI8A 3VQPA 1NJWA 3E6MA 3T3FA 3OR1C 3L2RA 5LGUA 4E7IA 3NHGA 1SMTA 4J8FA 3CDIA 3MKWB 3QODA 3RJPA 1C0WA 1ETVA 5ICEA 4NLCA 4CO8A 4EV0A 3LFKA 4M74A 5F0CA 3SZTA 5JS2A 1NTCA 4CGFA 3BG6A 1NGBA 4MTEA 4M45A 1SANA 2WAQA 3GW2A 3DBLB 3RZOJ 2DT7B 2M7AA 2XPVA 4P1WA 3OJUA 3CM6A 1S3JA 1Z1DA 3IL2A 4YOTA 4QCLA 3CC4N 2FU4A 1UAXA 2FRHA 4BY1J 2GX9A 3CJCA 4BKXA 4L18B 1W7AA 3N05A 2HYFA 1F5TA 2ZJRL 4B8AB 3U9ZA 2MSYA 2J5PA 4RLQA 1K61A 2NVYJ 3OWTA 3ZCOA 3LA3A 3GMEA 3GTKJ 1HC8A 2E2QA 4H4OA 4G12A 4K43A 5K14A 4MGRA 3DXJF 5CE3A 2DPDA 1J59A 4XKBA 3IH3A 4IHYA 1KQ9A 4CHPA 4CZMA 2CSOA 3WEEB 4CEQA 3ML6A 3THYB 1XTAA 1LKXA 2IGOA 4CCKA 2ASPA 2ZFWA 1WI9A 2LF8A 4M3GA 3MQ0A 4ZDPA 1MMSA 4HQMA 2A6HF 4GYIA 1OCOH 5LLQA 5L3BA 4GNIA 4LFAK 3CFOA 4JKBA 1R1TA 1LFUP 1FXXA 4I2PA 4O55A 4RW6A 4IHXA 2OTJN 2VBZA 4KHPK 3OSFA 2RDPA 3QU3A 3MEXA 4B3AA 1O3QA 1YJNN 2ZGYA 1NK9A 1SVOA 1SUQA 3O9UA 4B9VA 4KHSA 5JLWA 3QOPA 4FLWA 3W0LA 3A0IX 3IKVA 1A6QA 3F6VA 1S72I 3ISNC 4CZCA 4EZ6A 3TO7A 3D2EB 1WKMA 4YHHK 3O3FA 4UB6C 1L3LA 2NS8A 4ENJA 1XHXA 4DV7K 1RC9A 3O9SA 3V42A 4FWLA 5B8HA 2O4GA 2XVCA 1OH6A 4K8ZA 2L7ZA 4DZJA 2VKDA 1C1AA 2W82A 2QXLA 3WXLA 4KI4A 4JV5K 3CJQB 1T2KA 3WG9A 1TNSA 4X66K 2VCPA 4E7KA 3KK1A 2NRWA 4CFAA 4FJIA 3K5MA 1WJDA 3WE3A 5LJWA 2VXZA 2QKBA 4PQUA 2ESHA 4I0BA 1B1BA 1JHFA 4KIBA 4GXOA 1HKCA 2P5GA 4E7ZA 2VJIA 3EUAA 3HHHA 1MH4A 2EZHA 2YNGA 4BGBA 4LFBK 1LUJB 2EBIA 2VI6A 4R8HA 2FF3B 5KPRA 3TAGA 2UXXA 1D9FA 1VQ5I 4DSJA 4KIGA 2ZJQF 2I7PA 3MECA 3K0SA 2D1VA 3DPTA 4TV7A 1VHXA 1J5OA 4RCHA 3BR2A 1RT3A 3Q3SA 5AIPA 2CGLA 1CZ9A 2B5JA 1K4TA 1I39A 3VPRA 2H1KA 3K1NA 2UUBK 1FOYA 2P9LA 1ONVA 3SYZA 1J53A 4HG2A 3FE1A 4IRIA 1BIBA 2DTZA 4B43A 1TQIA 4XKCA 3AVHA 1XMOK 4OINF 4MLEA 3RPQA 4A3IJ 2I8DA 2KKZA 3KWIA 3D6RA 4H5TA 2CV0A 5HRNA 2CV1A 5GINA 3IUCA 1N34K 2AHQA 3V1QA 1V54H 5D6FA 2YUSA 5DEQA 2GWKA 3WHCA 1S5JA 3VF2A 1WWXA 1CF7A 4YNQA 2ZMEC 4XOPA 5CLSA 3CIPA 2VQEK 2PMHA 3NF6A 3HT3A 1RT4A 2ID3A 2E20A 3TI0A 2Z2SB 5B1AH 1P4WA 1P4XA 3K10A 1VFCA 4JD2B 4JN4A 4O0IA 3LWLA 3WEEA 5IP6A 1R58A 5AQJA 2UU9K 2IGKA 4NCBA 1U2WA 5DS9A 4UV8A 3PQKA 4RMNA 2NXNB 3QPHA 1QE1A 3AVBA 5JLFA 5EY4A 1JLEA 4LY7A 3JRBA 1VSIA 4HNVA 1HQEA 1FP2A 5GAEJ 3PY8A 4XONA 3SMSA 2ETJA 2HF3A 3REOA 1FOXA 4CERA 4Z2YA 5B66C 4BG9A 1ZR2A 5KI6A 1FC3A 4WCEL 5J2QA 2IJLA 3IUOA 2V6EA 3MWTA 1UJ8A 2VKEA 2XB5A 3ZETB 1D4XA 3CJNA 3A5NC 3NWSA 1LV5A 2X6NA 1XCBA 3QPTA 2HYGD 2ID6A 3U2RA 4FSVA 3QETA 5CVVA 4A2UA 1FKOA 3HP6A 2KFZA 4PKHA 4QPOA 5KVRA 3ULQB 4GW6A 2LK2A 4F93B 2IGNA 1RESA 3S14J 2HVRA 1WBBA 1IXCA 3PQJA 3ZMZA 2JWLA 2BY0A 1YAGA 2FEZA 2VXDA 2NAZA 2TCTA 4CJVA 1J9AA 5A2QO 5AJ3K 5LMUK 2K9NA 3T8TA 3G73A 2DOFA 4CE9A 2ISYA 4HHTA 3FF5A 1KA8A 4LD5A 4V2FA 4HZFA 4EZ9A 4BRAA 1TV6A 2A40A 1DEJA 3RMAA 1U9OA 2JVGA 5ICGA 3AARA 1V4SA 4OLBA 1V5GA 3GCMA 1ZLJA 5K7HA 4QTRA 3VYRB 3CO6C 3AVIA 3A1YA 1T3VA 5LL6Z 3HSTB 3TL4X 2FOKA 3VEYA 2DTUA 3BC8A 1TKXA 2KHOA 2P9LB 3PNVA 2KKOA 4B3TK 2JPBA 3BLYA 2EFQA 5DV5A 2BVLA 1FOWA 2E5ZA 5JI6A 5LGNA 2PJPA 2HDWA 3DKYA 1Z7LA 5F04A 3K70C 3I4PA 4G7ZF 3FZLA 4KTQA 3HPOA 3U4LA 1KRPA 3JRFA 3P38A 2JRTA 2Q1NA 1XGMA 3HC7A 1QHAA 3VEVA 1XG1A 2V7ZA 2P9IB 5EF6A 4IEEA 3TO9A 2DAOA 5L3CA 2QWNA 4MO7A 3K58A 2LY9A 4FT8A 2A1SA 3CQYA 2J4RA 1MBEA 1YVUA 4XRMA 2QI2A 4JHDA 3SUPA 1N36K 1OCPA 4DNCA 5EU7A 4EJOA 3LZJA 2GXBA 4FM2A 2XAJA 3LSIA 4M63C 4HUFA 4XMYA 3H35A 1JLBA 2NNNA 2IGIA 4A2AA 2V79A 2PBDA 3IG1A 1BQNA 4W5NA 4Z4IA 3VQBA 4FOIA 1FK9A 3ZLJA 2GM4A 2DQRA 2A61A 5BPIA 5FO5A 1N77A 4DSFA 2DFHA 2BY1A 4YIFA 3VENA 3EO3A 4KITB 1RR7A 2I5UA 3BPXA 2KFDA 2DBBA 4F52A 1TL3A 3H46O 1WN7A 3E9OA 1JTXA 3FKIJ 3VERA 4M3DA 5KQDA 3H92A 2GZWA 4OPAA 1A04A 4C30A 1BJZA 2IRFG 1AWCA 4X65K 3S93A 5J1RA 2JQ7A 3ZX2A 3LDLA 4CK2A 2QCOA 3CMMA 1V4TA 3OS1A 2STTA 1BOBA 5BNGA 4PSWA 4CIEA 1GHCA 3IMXA 2R7ZJ 1W7PD 3M07A 1P7IA 2O8XA 3PIOF 4GKJK 4FWNA 4JI2K 3MCZA 4CZIA 4CHNA 3DAWA 5C24A 3D45A 1SL0A 5KRSA 1Y0UA 2MABA 5HP1A 1OH7A 2LKXA 1IRFA 3HSCA 1ZREA 3E1SA 2P5KA 3BDPA 1NJYA 2LF7A 2HS5A 3CJAA 1I94K 2R92J 1B59A 1P2FA 3M1CA 1TYQA 3CM5A 4LF7K 3P9KA 1RBSA 3DLAA 1RT5A 4RLFA 3KLEA 4CCJA 4L0ZB 4FW2A 1S22A 4AIKA 3LP1A 3FXJA 4BXFA 1QS4A 1U49A 3J7AY 2PG4A 1ZGAA 4CJLA 3H45C 3S15J 1M1KO 2GEMA 4CZGA 3TDUC 1SAUA 3RQIA 4RWTA 2HWVA 3KK7A 1QVUA 3L1PA 3FBNB 2CG4A 3F3XA 4HNTA 3T1BA 4YFXF 1VTNC 2R7UA 4ILHA 4ENKA 2ITMA 1T33A 4E1NA 4HLXA 2P1JA 1SKWA 3CCEN 5AQWA 3ABTA 3CJRB 4JK9A 3K4CA 4OVLA 1VQKN 1VQPI 3L00A 1NLVA 1XPXA 1WH5A 1WPKA 1RNLA 2YKMA 4P55A 1OCCH 2ZKZA 2EV6A 2CGPA 3OHRA 4C23A 2HHHK 2P5VA 4KHYA 3DPLC 5A2QK 3NAUA 3JAMZ 2O03A 4BR7A 4BEHA 4NC8A 1MNDA 1IRXA 3CLQA 4G94A 2E2OA 2LNBA 1B8IB 1QNTA 1HRHA 4XKVA 1JL2A 4DTUA 3HOSA 3S9HA 3I3LA 2K3FA 3QU6A 3Q9VA 1VSLA 3ZMUA 3RSEA 4DTRA 3FXOA 4QSHA 3ERMA 1V5FA 2K3PA 4IXCA 4HLYA 1VQLN 1T8IA 4C1NK 2PN6A 4KJZA 1HJOA 2P9IA 4CHQA 4DFMA 2E19A 1PP8F 2ME6A 2QF7A 2QGUA 4P96A 4AHCA 4RAGA 3DM2A 4CF8A 4UVCA 2ZXHA 4XR6A 1HDDC 4D7MA 2IDOA 1WUAA 1JLFA 4DYRA 2WC2A 2B9SA 2Q2RA 3Q7CA 2LKSA 1TL8A 4GVMA 4Y1CA 3ZYYX 4CJ4A 4GV3A 1TL1A 3ASOH 1X1AA 3KIOA 3L7WA 4JRQA 3HB9A 4FXDA 3RZDJ 1U5TB 2LLKA 4ZJZA 2IT0A 1YXQA 2BY2A 3I71A 5HOOA 3QB0A 3TP3A 5GTHC 4G6QA 1YHQI 1OMIA 1MJ9A 3VN5A 1SMYF 2XKPA 4O4GA 3F6OA 5AQHA 4HVJA 3EETA 2JRMA 3R60A 4XH1A 3AVJA 2ZC2A 5ELZA 4BG8A 2A1RA 1YITN 2HQRA 1QPMA 3Q0WA 2Q31A 3GYHX 2FMLA 3BG5A 4EGYA 2LY1A 1HYVA 3UE5A 1X4PA 2VBYA 3AG2H 1VQMI 4JKHA 2H09A 2RC4A 2P4WA 1C1BA 1ZBUA 3SAHA 4IOXA 2YS9A 4BHBA 1N6QA 4I7HA 3R6MA 3MFKA 2P6TA 1NG9A 1J6ZA 1NWKA 1WSEA 1D8KA 1S6PA 2FF6A 4H0OA 5GADJ 2EWSA 4IFYA 1Z91A 4JLHA 4UQGA 3SLCA 2XHBA 3RWUA 2QZ8A 5KQ8A 2VBXA 3W6KB 5AQKA 3F8CA 3GOIA 2KMUA 5IT9Z 4WFAL 4KB0A 4LF5K 1RUNA 5IY5H 5J2NA 3CQZJ 5GPAA 5HLTA 4NB4A 1SL1A 3CUQC 2RAEA 2E2NA 2D0PA 5AIQA 4CHZA 5FLVA 1T7PA 3KP6A 1LDKB 3QESA 4A3GJ 1MMGA 4AM3A 2HNYA 4P5OA 3T5XA 3VA0A 3O9TA 2FBVA 3CPEA 3OBYA 1KYZA 3RDIA 2H8RA 1VQ7I 3Q0UA 4NB5A 4DBQA 3W2WA 1YX3A 1ETWA 1U2VA 3E0JB 1VAZA 4CJKA 3PX0A 2AJQA 3HP9A 2GLOA 1JL1A 1SKRA 3QFPA 2V9KA 4IWVA 1HPMA 4UVAA 3FK7A 5KGWA 1X1PA 4HSRA 2KRFA 1U78A 4GDFA 3ZT3A 2GOMA 4A62A 1IO2A 5A2QZ 1QQMA 2EK5A 4BEHB 1QPIA 1WH7A 1KVCA 2A5XA 4Q4ZF 5J2MA 3HUGB 3DI6A 3QP6A 5FPEA 1OQYA 1JXEA 1J5EK 3V1OA 3ZQCA 3BJAA 3CO7C 1E3HA 2WY8Q 3CTAA 3F8NA 3KEOA 3ZMDA 4J01A 1WZ2A 2H6BA 1ERDA 1NMDA 3ULEA 2O8DA 2MH9A 5DM6F 1U8RA 4FPBA 3F23A 2ZF5O 1EX4A 1G3WA 1FMVA 1CF7B 2E1ZA 5H6RA 3S41A 5E20A 5JLXA 4CK3A 2EFPA 3JRHA 3JS6A 4F3OA 4GYGA 3LAJA 1JJ2M 2EZKA 2ETHA 2HTSA 3TBIA 2A5YB 3COAC 4IF4A 3PSFA 1R23A 2ZXJA 1U6GA 1K8KB 5AZJB 5M1OA 1D8YA 2QKKA 2HHXA 2VPRA 3AA5X 5AQOA 2ME0A 2D2WA 2DQLA 2KLOA 2O8EA 3KZIC 4U7DA 2QQ8A 2VWKA 4AF1A 4K8XA 2DDBA 4JAXA 2CQXA 2HGCA 2F5FA 3C7JA 3R8EA 5AQVA 3HOVJ 2O8FB 4IHWA 2W41A 2MBFA 2NVUB 3AAQA 2Q3SA 4IOAL 3L9FA 4IKFA 5FPDA 5GADP 4A5MA 3AA4A 3CC7I 4A3DJ 2DN0A 4DGWB 2UUAK 2N8GA 1U47A 2FLOA 5DM7L 3DTIA 5AQRA 5BPMA 5GIPA 1T0FA 3CCJN 1QSYA 1XMAA 1GLDG 2G8HA 3QEPA 1YS7A 3QQAA 2XDVA 2P9SB 4A61A 3NARA 2OA8A 3DQVC 4BRDA 2WV0A 3D5SC 4DUYK 3KYDB 5CJ9A 2XAHA 2KDZA 2DPNA 3JRIA 1FW6A 2M2EA 4BGDA 4D7NA 2KLAA 4KTZA 3ZSQA 5HNFA 1ZARA 1EXQA 2UYTA 5AQYA 1S9HA 4HDVA 3S3MA 4G9YA 4CZLA 3J81O 4C8OA 1F4KA 4KHQA 4MTDA 5FKKA 2PI0A 2P51A 4ELVA 3TOAA 3HKZA 1SZ2A 3MN7A 3BTIA 3LSKA 3THYA 3QWLA 3ZSWA 2RNGA 2Y75A 3IH4A 4M3BA 2R5YB 5IOYA 4Y7NJ 2H27A 2OZUA 2HVSA 1RT6A 5KHDA 2MC4A 5E1XA 2O61A 3FWEA 1KZHA 5DTDA 2P9UA 4I6MB 4BR4A 4FJKA 1C0FA 3UR3C 4FWPA 3P5JA 3I8BA 3ECHA 1X3ZB 2QSHX 4G8XA 4N47A 4BQLA 1ZYRF 3B02A 3OIPA 1VQNN 4IXAA 3ECOA 1HW5A 2WC9A 5ADXH 1IN4A 2JSPA 1UG0A 4B1YB 1WJ5A 4H03B 4ZTJA 5FLXO 2PZSA 2BGGA 4GV6A 3ZQ7A 3L2UA 3KJVA 4I2OA 1GLNA 1BBYA 2RN2A 4P9UA 2FBYA 4PKGA 4N4OB 3EUKL 4MEXF 1RGIA 3A5LC 3VQEA 4CJ7A 4Y4RA 2X6WA 3IS9A 5GAHJ 3E6DA 2WY7Q 3BF3A 5CQGA 3RMDA 1S6LA 3KLIA 4E0DA 1BI4B 1QVFM 4AHUA 1DTQA 1NM1A 4JS5A 2MD0A 2F5CA 3EPZA 3M3ZA 1R9TJ 3VQCA 2E5NA 3RKXA 3WU0A 4ENNA 3DLRA 5GAHP 2Y0SN 1Y1WJ 3LAMA 5D5UB 4BRCA 1QTMA 4DUZK 5IYCJ 1I6XA 4A3FJ 3TAMA 5KGXA 4RAYA 1TWAJ 3LQQA 4L9NA 3RKWA 3J81Z 3ZT0A 4K42A 2AQFA 2HZDA 5F0XA 5DDGA 3AO2A 3GLLA 1QHGA 3DCFA 5ILVA 1AOYA 2QQAA 5HBMA 4KV8A 3GDQA 4BYYA 1A5VA 2OANA 4EHUA 5C44J 4H5RA 4CF9A 5JVHL 2CQNA 1NG7A 5D5VB 3LNQA 2VLAA 5MLCQ 6PAXA 2JWTA 3J81K 2ADUA 1FZPB 4FWOA 3SPYA 4LFCK 3CCRI 2VT2A 2XGDA 4DOZA 5M3MJ 2PLYA 2A3ZA 5AZIB 2FBHA 3DKWA 4JKEA 4UV9A 4WQ5A 4B3OA 2ZD1A 4FK2A 1KAYA 2VJJA 4N0BA 3LOCA 3TTDA 4AIDA 2JUCA 1DGRM 4DR5K 4E4HA 1ATSA 4HRIA 2B0LA 3UKUA 4HQEA 3EYIA 1NBWA 1L3SA 1IBKK 2EZLA 4KHWA 2Q8KA 1BU6O 2YI1A 2QWMA 1Z9CA 2MD5A 2V1DA 5E3NA 5FD5A 3I59A 3ENOA 4AIJA 5TISC 2R5YA 1KVBA 3OY9A 4BE0A 1WSJA 3V9WA 2HHUA 4DG1A 1IV0A 3BJ6A 1CXUA 3QMLA 1KC8O 5BS6A 2M45A 2O6GE 1X9WA 3DTEA 2V9PA 5D4RA 4B08A 3X2QH 4YELA 2CUJA 2FF4A 1IG7A 4KN7X 1YJNI 3SZPA 1GUUA 4IOCF 2E2JJ 2I5JA 2NZTA 4HTUA 1I3QJ 3MZYA 1IKXA 3AL0B 1IRGA 5H1SQ 2WADA 1EH6A 3VOEA 2NRZA 3HTVA 2W40A 3BEXA 2R7VA 2AS5F 3B6CA 3ALYA 2DLLA 1KCFA 2VASA 3P4IA 1EP4A 1LAWA 2JT1A 2GUIA 3KKRA 1LEAA 2HKXA 3WTXC 3OSGA 3N97A 4BXUA 4BROA 1NNEA 1E3MA 4I6MA 5CVRA 4UUSB 4KDPA 4JP0A 1WJBA 3E3VA 4BE1A 4MFEA 3THWB 4FJ8A 4L8RB 2WBMA 5C15A 4EM2A 4Z4EA 5FRMA 1AU7A 1NK8A 1B72B 4KBOA 4Z4GA 3P1GA 2RKIA 2QBYB 2D45A 2A6EF 4EATA 3FHZA 3WGIA 2YHYA 3VQDA 3W6JB 3THXA 1BW6A 4Z0UA 4A3LJ 4EGZA 4XSZF 5D5XB 3DV8A 1VQ5N 1ZRDA 4WXCA 3UNGC 1ATNA 5J47A 4M3EA 3CCQI 3AO3A 3M8EA 1TTYA 4DIQA 1JXBA 3IRXA 1SVMA 3VQ6A 2ZSHB 3V7SA 3CJ1A 1Q9YA 5HVQC 2V4JC 1XC3A 1FTTA 4HF0A 4BH9A 3CCSI 2BH1A 4O8KA 2OC6A 2VBWA 3KFWX 4PK4A 3HTSB 3MCAB 1HUXA 3HOUJ 2EX3A 2HF4A 3LL7A 3C7NB 3VTIA 5GAEP 1C6VA 1RILA 2CUEA 3RTRA 3B6PA 1KFSA 1P4AA 2CV2A 3NCIA 5IYBJ 3BPVA 5AZIA 1YIJN 2Z1DA 1R4NB 1GLFO 2RHKA 2K27A 1ZQ3P 5DUIA 3S17J 3NBPA 3VGLA 3VF6A 4FJXA 1IUFA 2FUG2 3EY1A 1ZBIA 4NBQA 3AVKA 1R00A 3FFKB 3TPQA 4CW7B 4KREA 1S8NA 4PUSA 1GLCG 3BOQA 5J4VA 4ID5A 3SUNA 3QINA 1PYVA 3OL3A 5EZGA 1FJLA 4CICA 2DMPA 3LAPA 2AA4A 4H4MA 5TKYA 4DQQA 4F9OA 3LDSA 2GXAA 2V51B 1WJFA 4A0ZA 2YCHA 2X4HA 4AHTA 2F5VA 1IRZA 3RI4A 1XCVA 3O6BB 3QICA 2BY3A 3MZHA 2W4SA 1RR8C 3DPUA 2DDAA 3IC7A 3SMPA 4H5VA 5LFAA 3WT0A 3AG1H 1F36A 2O5RA 3WGGA 2DI3A 2PFBA 3JSPA 1NGCA 2GELA 1OH5A 2KRHA 2W85A 4L9VA 1F1ZA 1FY7A 2RN7A 3TGNA 4HV6A 5BREA 5KPTA 5L3GA 2DMUA 1BQMA 3FXMA 3J80K 1QHTA 4MDBA 4IHSA 2NRTA 5AQNA 2DOAA 2KIQA 2F7TA 4JK8A 3MEDA 4KHNA 2HSTA 1VQMN 2HQNA 2KJBA 2VE8A 2WB1A 3NGIA 1ILYA 1RT1A 5HS9A 1O3TA 2JMWA 1UFMA 2L2OA 4HF2A 2QWQA 2XO7A 3LSMA 5CQEA 4PJNA 2VG6A 1JKQC 3HGYA 1B72A 4CF1A 1T6SA 1YQAA 2Y9ZA 4XIDA 4FJGA 4KFCA 1ZHFA 2CFOA 4JX6A 5DMRA 3K7AJ 2L9VA 3V8KA 3M1EA 3C3WA 3R61A 4IO9F 1NKCA 3L3VA 1HQUA 3S1RJ 3HOYJ 4JK7A 1T08B 2J5OA 2LY2A 2X6XA 3KP4A 1O57A 5M1FA 4LG3A 2W48A 4DV3K 4A69C 1ETKA 1FLIA 4O5BA 1O3SA 4H0PA 5FJ8J 5FLXZ 3I56I 4OU0A 2G8WA 1XN7A 1YS6A 3AVAA 4FWMA 4LF6K 1Z0XA 1EF4A 4CDGA 4U0WA 1KAXA 4CUGA 2O8CB 1TWCJ 1MBJA 2Y31A 4DTSA 3V6DA 4UUVA 2RKHA 1VZ0A 3P9IA 3V4IA 4LK0F 1MH3A 3TOBA 3IHUA 2YX4A 4RW9A 2QUFA 4CFDA 5F0HA 4FJ9A 1W5SA 4JX4A 2JSCA 1I6HJ 1VK0A 3QO9A 4FO0A 5J4YA 3HM9A 1Y39A 1IAWA 4HW0A 3QEVA 1GLJO 4EFHA 2CS3A 3UB5A 3ITHA 1EH8A 4CECA 3CD6N 3OYGA 3CI5A 3CCVN 3MXMA 1K78B 1TP4A 2G8KA 1G59A 2A41A 3VETA 2FBIA 3T1YK 3HOTA 1A35A 3V7RA 1BGXT 3DRSA 4CHOA 4PJ0C 1X9SA 3ABLH 4ZYGA 1FBUA 1Y0NA 5EGOB 1J7KA 1IBMK 3HM8A 3BR3A 4DU3A 2CJJA 4HCCA 3S1QJ 5CZ1A 1HNZK 4JI5K 2K9SA 3M8SA 2K85A 5M5WJ 4G1QA 4QAGA 3D1NI 2G7HA 4FK4A 3L3UA 2O8BA 3F2KA 4IEIA 4FOEA 4CEBA 1T98A 4IEJA 4O0JA 4IZ9A 4EIAA 1QVGM 4U0VA 3CCJI 1VQON 4Z6YA 5TGTA 5IOZA 2IOCA 3MEGA 3L4IA 1W7PA 3LSGA 4M3TA 4Q5SF 3ZGKA 2BYVE 1HNVA 1RTIA 1XGSA 4CH7A 1S72N 3WNEA 3R0AA 4W97A 1EJ9A 4IBNA 3CJTB 1S1WA 2LRDA 5FKLA 3AA2A 3V4GA 1BHLA 4OMZA 2L7FP 3J7ZO 2YHXA 4BDZA 4X1EA 3CLOA 4PZJA 3FXQA 2HBMA 3O08A 2DT6A 2DCEA 4EP4A 3SCXA 3FM3A 3LP0A 2NUBA 2VQCA 4BC5A 3LWMA 5J40A 1CZBA 1TT5B 1FSEA 3RYRA 4DFPA 4CD1A 3ABKH 3QEXA 4CJUA 4WFBL 2EQRA 1LWFA 1YJWN 2CO5A 4BDPA 4B9TA 2F5EA 1F9NA 1BWFO 1DP7P 2KW4A 3FKJA 4DQPA 3FR0A 3RKYA 2E6MA 2OYQA 2K40A 1YRNA 4BNCA 3CF5L 1IKWA 4YY3K 2G8IA 2JA8J 1BIAA 3K2ZA 4JOMA 3A2KA 3E97A 3OYLA 1QZ6A 4NYNA 4FLVA 2K02A 1UZCA 5LRSA 4CEOA 2O8CA 3N4PA 3WODF 2Z5UA 5BRFA 3J8AA 3ENBA 4JI3K 4KKOA 2L9RA 4DQ2A 1DU0A 1C0MA 1RCHA 3H1QA 1P6RA 4EP5A 3DEWA 2QQBA 3I0SA 1VQOI 2OPQA 5EXWA 1JLCA 2VQHA 5DCMA 1ZG5A 2EINH 1UCRA 2PMZN 2QKMB 1BR1A 2ZJ2A 4AUXA 4QLCU 1HLVA 4EAHD 4OPKA 1VQ6I 1BI4A 4CGDA 3U1KA 1DGKN 3ISPA 3ZX3A 4ZDLA 1YI2N 1RBUA 4NYFA 1MDUB 2L9SA 1QO0D 1W36C 2E2PA 4MEYF 2VWJA 4B3RK 3HUGA 4MFDA 3VEOA 4F92B 4NHJA 2YHWA 4FZZA 1VSKA 3O9RA 2L01A 1UHWA 3L8BA 1Z3XA 1HF0A 1FBQA 3GUDA 5FPNA 4LLGF 2DK5A 3K0LA 4B8XA 4ON0A 1S5LC 4AVPA 2ITGA 1TKTA 2X6SA 5KAFC 2ZGZA 3BDDA 2R7QA 5ED4A 1MDMB 1EETA 5AQXA 1TBXA 3CD6I 3CDLA 3KZYA 3ZN0A 3LDPA 2NRHA 2A68F 1Q7YO 4HYEA 3VGKA 1OJLA 4LIUA 3ZP5A 4Z4FA 1HNXK 1B9NA 4LIVA 4M73A 4NQWB 3E7LA 2VONA 1HLUA 4M6YA 2ZO4A 3KZZA 1WSIA 1EKEA 1TWHJ 3LMMA 1MGTA 5BQTA 2P9KA 4JKDA 4FWKA 3GTOJ 2LSOA 3VQ4A 3DLLF 4Y52J 3ATUA 1DU6A 1L3UA 2O8FA 1X1CA 2EIMH 5IPAA 3CJBA 1ORKA 4CCOA 2P8TA 3H5RA 3VEXA 5K7ZA 1H8AC 1S1TA 3ZR8X 1C0TA 1TUUA 1OFCX 3AAPA 3EEQA 3FGUA 2Y1IA 1DPRA 3DWLE 4A5BA 4BE2A 1VQKI 3WXIA 3P39A 2Q0RA 2GWRA 2GUPA 2WB1N 4IX7A 5TKWA 3TR8A 1O4XA 4AHVA 3D0SA 5BOXA 4QPQA 4H4KC 3GWZA 1A31A 3IP4B 4CCHA 3HIFA 5H2FC 2F8SA 2Y2ZA 1EH7A 3KPHA 1R6RA 2Y1JA 1BUPA 1TW2A 1XSXA 2IVNA 3VGMA 2LBFB 3ZQHA 3O8MA 4BR2A 2L7KA 3BP8A 4H5WA 3BR1A 5AQMA 5HLHA 4CJWA 3E5UA 1K7AA 3VFZA 3VDXA 2RF2A 1YLFA 5HL7L 5LD2C 1HKQA 1ESVA 4RAFA 1QU3A 3I55I 3KP7A 3MN2A 4HTLA 3FX3A 4IJNA 1SD4A 3QPSA 3AVCA 2VOPA 3VWBA 3F9KA 4DB3A 3O3KA 1ZC6A 3QNNA 4II3A 4ZTFA 1NOZA 4BVPA 3FK6A 4BY9C 3VYSB 5HLFA 4G6TB 2L0KA 4FE4A 4CA0A 3GTLJ 4C8NA 3RTVA 1U48A 1OH8A 2FJ1A 4OGCA 4Y1DA 1ETQA 1XS9A 4X0GA 1BIUA 1NJZA 1RBVA 3HRSA 2Y9YA 1BG3A 3GG4A 1SD5A 1IN6A 4GMJB 2FNPA 1W5TA 4Y3OA 3RIRA 1K8KA 5DM7F 3ASNH 1NOYA 3DKXA 4JHDB 1D3YA 3DRPA 5H20A 3CCYA 4E3SA 5LEKA 2M9HA 4OO1J 2LREA 3UKGA 1Z3YA 3SK3A 4JK1X 1HXDA 3PO5A 1I1GA 2XHKA 4BRLA 4P9FA 2CH6A 4XORA 3U21A 1K79A 2O8DB 4KO0A 4PKIA 5BR8K 4ANJA 1MBFA 2LFBA 4NC6A 4B1RA 3IDHA 4U0YA 3K6GA 2H8WA 1H89C 2GAUA 1S1UA 1HKTA 3RVCA 5HRRA 4HX8A 4NLBA 2CUFA 4QIWN 3CUQB 5EG0A 3CJ7A 3CF5F 1OVQA 1JHHA 2YNFA 3R1XA 4PL8A 4BRGA 2XIGA 3LPTA 1RTDA 2CW0F 5AQIA 4XLEA 2UXDK 1YX5A 3A8YA 2ICWG 1SAZA 4F7ZA 4ENMA 1KTQA 1RNHA 5E3LA 4TSXA 5M1QA 3G10A 3THVA 4DF8A 3CMAN 4MNUA 2YR2A 3NMUA 3RSEB 3HXLA 4FK0A 2L9NA 4K2EA 4WXDA 1RT7A 5DM6L 5CYVA 3A5OC 4C8KA 3DTKA 2COBA 5CVUA 1QQCA 5FKMA 1BL0A 4JKAA 5ICFA 3WTUC 4OPJA 3FMQA 4JQFA 4DBRA 2NOJB 4XLPF 2HOSA 3S2HJ 1Y64A 1Q82O 1BI2A 4RB0A 4XRSG 1C0UA 3K9JA 3ELKA 1WFXA 3BF1A 3L6QA 2OZ6A 3SEZA 4NQWA 3AO5A 3CESA 1FIPA 4BR9A 4YOYA 3K4NA 2QWWA 4I6ZA 2OU2A 4ILJA 3LSJA 4RM2A 1WNSA 1MNEA 2F9TA 1N8RO 4FZXC 2LBFA 1Z05A 3O9QA 3O5BA 4PFPA 2P9SA 2X78A 1KAZA 2ZE2A 1L5UA 4B9NA 3WXKA 4UY8I 5D4SA 3MX2A 2K7LA 3DWLA 3ZQGA 1NGGA 2DA3A 4HSTA 1O13A 4LF8K 4XLCA 4BRPA 3HRMA 5CY4A 2HDCA 1VNDA 2AXLA 2R7DA 4RB2C 2CGJA 3RSNA 1RUOA 4Q5VA 3L2QA 2KZZA 2VOOA 1JGSA 5IP9J 3BR5A 3E5XA 1DDNA 1GVDA 1TWFJ 5BPDA 3WUHA 3KLOA 3HOXJ 4DV6K 3SQ1A 3C2HA 1SEUA 1Q1VA 2F96A 5C42A 1BA5A 3NAEA 2DFFA 1GLBG 2CW8A 4GV9A 3RCOA 2VJ5A 3LZIA 3LP3A 5EEGA 2XF5A 3V8JA 1KFDA 2VG5A 4BR5A 1E2XA 3TO6A 1IJJA 2BE5F 4BJ6C 5C12A 3IRRA 4D5FA 3IKTA 1B8IA 2WONA 1U4BA 4FJJA 1MJBA 2E1YA 3LSTA 3W3DA 1NK0A 1Q9XA 2LR8A 3MX5A 1R1UA 2ELKA 3RR8A 4DR6K 3WTYC 1ZRCA 2K86A 3BR6A 3WU1B 3OYEA 4MO5A 4CF2A 3C2GA 4BDYA 4OKEA 3GXOA 2D5RA 4CCLA 3PV8A 3NFAA 2QXFA 2WFBA 3MKLA 3AGKA 4FTHA 3VQAA 1RDAA 4OOIA 1YW8A 1BC7C 5AFUH 1R36A 4XICA 4MQ3A 2UWMA 5M1KA 1KQSM 3L2CA 4BBSJ 4DR3K 1JUMA 4OAYA 1RPWA 2X1EA 2W00A 5B1BH 4FYDA 5IYDJ 3FFIA 4M72A 1KGSA 1NKBA 1XB4A 4HA8A 1XD7A 5LHGA 1MWKA 1AKHA 1QQIA 1NGJA 2E60A 4L9JA 4IFVA 1RT2A 4NO7A 5C2DA 5T7BA 4DLEA 3DLBA 1NHAA 1ODDA 2Q1ZB 4ABZA 3LM2A 3SNNA 3QNOA 1TGOA 5EEHA 3O4WA 3HG9A 4BS9A 4CGHA 2QVOA 2JTVA 2DA6A 3OS0A 2QM1A 3M8FA 3OYIA 3VQ7A 1BOAA 2WA0A 2Z33A 2IVMA 2HOEA 2WAFA 2E2IJ 3CP8A 2IW5A 2UUCK 4PGHA 3HRUA 1NG6A 1M1EB 1X9JA 1B9MA 2NLXA 4NC7A 4BWMA 1ACIA 2QYOA 2KRCA 1X1DA 2FMYA 1USSA 5D5WB 4EMSA 1E4FT 2GWJA 2OCEA 3H1CA 4BRQA 2DTRA 2R7RA 2KJCA 1CZAN 3KD5E 4M3YA 1ZGJA 4ELTA 3ID8A 2NRVA 2HW3A 3SJMA 2HBKA 4YDUC 2GBYA 1R4MB 2E8AA 1CLQA 1O3RA 4BXXJ 3AO1A 2XAQA 1V55H 3SYTA 3LM9A 3RPUA 1P9QC 4JI0K 1XDSA 4KI6A 1KQ8A 4KT5C 3ZT2A 4F4KA 4BVOA 3L0QA 3MMYB 1MSFC 3CMEI 2K5CA 4KICA 3KYLA 1E17A 3MK6A 4FL9A 4A59A 1YRNB 1NKEA 1XNRK 1QZ5A 1W4MA 4MHGA 1TK0A 4E7LA 1ZBSA 3GBGA 3R4KA 4ISGA 1LWEA 4BQNA 3WNHA 4IFEA 3SZGA 2ZJQL 1YIJI 2Z1HA 4JKGA 3L4QA 1HKSA 4RA2A 4A3BJ 1RBRA 1IDZA 2Q2EA 4IDKA 2D5VA 1NK6A 3TW6A 2PX9A 3H3NO 3HVTA 3CMAI 2BE2A 1K8AO 3AFHA 4CJQA 4UY8O 1U8BA 3BR0A 1B6AA 4NDLA 3ROUA 1YFHA 1GXPA 3D2FA 3HYFA 3ZT1A 1FBSA 5M1NA 3VYUB 5K5QA 1EWRA 3IRQA 2KTQA 5AQLA 2BW3B 3LFUA 3KP3A 4AQYK 1SVLA 2VB6A 3DEEA 4W5RA 1RKTA 3RMCA 3G2BA 2OPTA 1K73O 1G2HA 3IAS2 2KZMA 3GE1A 1VSMA 2GOXB 4CCNA 3PJRA 2ACJA 1KSPA 1HX1A 3FIWA 3K1PA 3CCLI 2R7XA 1E0EA 4V19S 3SDBA 1N32K 3EKUA 2XGXA 1BIZA 1NU0A 4HF1A 3O4NA 4E70A 1IW7F 2JUGA 3PIPL 5CVJA 1ZGWA 4C8MA 5J1UA 3T19A 3KE2A 2OPPA 4FVUA 4F3TA 1YJWI 4O5VA 2FX0A 2HFHA 4BRHA 2DA4A 3HZJA 2OTLN 3CC2I 2EA4A 4BY7J 3F21A 4I01A 2A5WA 2HI3A 3KLFA 3SQNA 3W6VA 1GLLO 1CGPA 3DLLL 4M3XA 3AG4H 3R9PA 3VESA 1B4AA 2CQKA 2BXZA 4HAMA 1W0HA 2IS2A 1VRUA 2EJRA 3V9UA 1T8EA 3A03A 5DYMA 2O0YA 3KX2A 1BR4A 2CMPA 2R4GA 3ZRGA 1W5CC 2W1OA 5M3FJ 3EL2A 3EQLF 3O2PE 4ASNA 4HBLA 4RB3C 1ZRFA 1XC9A 2XUBA 2E6LA 1XQSC 2VGNA 1D1BA 3DMJA 3QOEA 3WTWC 1OR7C 2XSDC 1YTYA 1IN5A 3MAJA 3O8GA 1EQYA 2ZJRF 2YV0X 1RKWA 3I9V2 3FLCO 3VEWA 1SL2A 3K59A 2M30A 2YX7A 5ADXA 1WSFA 2W42A 1NMNA 3TU5A 3BZKA 4IVNA 3TMOA 1TC3C 2PY5A 4B9UA 2K4BA 3EDPA 2IAJA 4DF4A 4Z4HA 3VMFB 3OBWA 4M6VA 1VQ9I 5HRPA 1IDYA 2CWEA 2E35A 2OQRA 3D5RC 1S7OA 1GDTA 5FFZA 1IUYA 4KFBA 4FLTA 4JYAK 2HEOA 2FNAA 5K5RA 3TSUA 2VT3A 3VEPA 4XN0A 1I27A 1D0XA 3BY6A 3NRVA 1DLOA 3FZMA 2M1BA 2VODA 2B7EA 3K4KA 1GOBA 2CGKA 1JUPA 4RGXA 2WBNA 3J7ZI 4RW4A 4A2BA 3M8RA 2EFNA 2VQLA 1BW5A 1ENHA 4FCYA 1T56A 4H8KA 4RGRA 2EILH 4CCMA 1QSSA 5JR3A 2NS7A 2ZB9A 3R0JA 3KK3A 4WQ4A 2XPUA 1K6OA 2M4KA 2KQ2A 3ZEUA 4JKFA 5C25A 5AQTA 4M7YA 1L0OC 5AQGA 2VYPA 3PLAA 4F2RA 1TKDA 4PUOA 3WGHA 4PJLA 2AQEA 3WTTC 1U3EM 3EZ5A 5FKOA 2X85A 5DUKA 3IAM2 1WVRA 4KUMA 2I7NA 2FOWA 1R5ID 4BU2A 2EA2A 2UXNA 1QGPA 2E71A 2HDDA 1JKHA 1SFKA 2JGUA 4LD0A 2LTPA 1Y97A 3C0BA 1ASUA 1HYSA 4CJSA 2MYSA 1NH3A 1WBDA 4FJLA 2QK9A 3N4MA 1J5YA 4O6JA 3VQQA 5F1XA 4GKKK 2ASOA 4YFUA 4C2MJ 2ZJPL 3J7YP 2JVHA 4MDAA 4JS4A 1L3TA 2HU9A 1RDDA 4JI7K 1L3VA 4CXFA 5FLMJ 4HX4A 2RQQA 5F1JA 1YE9A 4L3QA 1HKBA 2ZNYA 4OMYA 2GIZA 1PP7U 3GTPJ 1CXQA 3LSHA 3SHFA 2NRXA 3KKSA 4KISA 4L5JA 3A01A 4AM6A 4DHYA 3SI6A 2X1DA 3VSLA 1WSGA 4Z4CA 4DQRA 4ITVA 4EM1A 5EGOA 3THXB 4A3KJ 1QHHD 3EUHC 1G4DA 5F0FA 2EFOA 2H1LA 1S3XA 3OA9A 4N5SA 1XHZA 1NK2P 4DV4K 3F73A 2EPFA 2W57A 1LW0A 1HW1A 1Q1HA 3ZSVA 1S7AA 5E79C 3PNTA 3I8DA 3CC2N 1G8XA 2HKOA 2K9LA 5E26A 4ZYHA 1ZH5A 2DJNA 3C94A 4BC4A 3KTQA 4U87A 4WF2A 1WJCA 4FJMA 5J2PA 4YFNF 4JI8K 4OX9K 4A12A 3ZMTA 3H0DA 4NXNK 1OKJA 2OZSA 3ZCMA 3NEUA 4DFKA 1NK7A 2NNYA 4IO8A 3QIPA 4DTOA 3SV3A 1OPCA 4CHYA 4OJRA 1SAXA 1IN7A 2KIUA 3ZSOA 4R79A 5BR9A 1AKHB 4DYQA 4JI6K 3I54A 4DR2K 1X9MA 4FJ7A 3V1RA 4MFBA 3BG3A 3DFGA 2RV8A 4M9SA 4A0XA 5BRDA 5IWAK 1VQPN 3K5NA 2MC3A 4FETA 4FWRA 4FE7A 5F1RA 3ZSZA 1UG2A 3CUOA 1C0GA 3FZFA 3I0RA 1X3UA 2QQ9A 2XRIA 1W7PB 3WE2A 3VPZA 1X2NA 3QFUA 2KT0A 3GZ6A 3F22A 1H9TA 1MMAA 1Z6TA 3BTJA 1J9IA 1QSLA 3GO5A 3CG7A 5F2RA 3H3ZA 4ZZLA 2R5ZB 2OV7A 1WQ2A 1G15A 4M6XA 1VRTA 2HVHA 3E01A 1OR7A 1OCRH 3I55N 4B3MK 1GV2A 3FXLA 4XNFA 5C4JJ 3WTVC 4FWQA 3ZXSA 3U8XA 2Q36A 2BOLA 3ZSRA 4LF4K 3VB2A 3U1DA 1KU3A 1LPQA 1ASWA 5AQSA 3B73A 4N41A 3BQZA 4OWRB 3MN9A 4LGWA 4XOTA 3AA3A 5SWMA 2RQPA 4DR4K 3T1HK 1IKVA 1DUXC 1Q81O 5EX5A 1U9NA 1SD7A 4Y13A 2HHTA 3M8QA 2ZBKA 5FD6A 2XY6A 3DYAA 2VWBA 3DBHB 2P5LC 3PX4A 2E5LK 2CQQA 1FYMA 3OL4A 1MNMC 4WK8F 1HCRA 1VQ8I 1FJGK 3JSMA 4JKGB 3J80Z 2PQ8A 1ATRA 2NVTJ 5CYMA 1MZBA 2ZJPF 2YX6A 2Z99A 5E18F 3LL3A 2G8UA 1M90O 2M8EA 4XLNF 3OYDA 3C2BA 4ETSA 5BN9A 3GZ5A 1FPQA 4B4CA 4DJAA 1HJRA 4FJHA 1UOCA 2V1UA 1UMQA 1JCEA 1VSDA 1T6DA 1HSTA 1YG2A 4WYBA 5AQZA 5JVTA 2STWA 4Y0WA 3VOVA 4OLAA 3BZCA 4ZYEA 4ZDOA 3CCMN 3FMRA 2DO7A 3JSOA 1RI7A 1RZ4A 2VE9A 2A42A 4N56A 4QOZB 1BJAA 5CVIA 4J2DA 1S7EA 4YORA 1BA1A 2BV6A 3OVNA 1D9DA 3K2AA 1D5AA 1ZR4A 1R5GA 3TAFA 2E34A 4BJ5C 4Q48A 2HBJA 1I50J 4N9HA 3BG7A 1A5WA 2DYSH 5DD4A 4ESBA 1HR0K 4CZEA 3LAKA 4FM1A 4S04A 1AA7A 3NDKA 4I76A 4LLNA 4B1VA 4F2SA 2KZGA 2UXBK 2Y0MA 1WLJA 1X58A 4WX9A 1YI2I 4M9XA 4DZPA 1VQNI 1JJ8C 3RKQA 1ZLKA 4CZHA 4XQFA 4Z94A 5FRNA 1H1VA 1OYYA 1B9FA 5LMNK 3EKSA 2JPCA 4RGUA 2YU9J 1QA6A 1WSHA 1TQPA 3BUZB 4BQZA 4M9ZA 4WF9L 2V6CA 3M5RA 5FPMA 1W2BM 2CYYA 4LSLA 1LNWA 5L3EA 5D6EA 5KK1A 2L4AA 1Z25A 1LCUA 1IGNA 2XGCA 5IT9K 2M0MA 2P9UB 2EV0A 2XF6A 3C6HA 3O4QA 4RGSA 2JLEA 3Q7BA 1WOQA 3GTJJ 4CJ3A 2LH9A 5FROA 3QPLA 3I4MJ 3MCPA 2FXAA 3S32A 4OIQF 5E1WA 2H3GX 2QWPA 3C18A 1I3AA 4II2A 2L4MA 3AVMA 4BBRJ 2WUSA 1ZN2A 3WG7H 1ZBFA 3OS2A 1UHMA 3SFIA 4EVIA 4LB5A 4DLGA 3GEZA 2VPLA 3QERA 1IKYA 3JW4A 2OTLI 3ZSYA 3LDOA 1JKPC 4CZFA 1ZBHA 1GOCA 4BC2A 4CBXA 5D3GA 2XY7A 3DLEA 2CFXA 2G7UA 2NYXA 3FXUA 3W2VA 5HS8A 4IHVA 3K9TA 1G3SA 2BW3A 1X1BA 2W25A 2HOTA 2OD5A 1E3PA 1XGNA 1XMKA 3K4BA 1W36D 2JA6J 4JI4K 4IDHA 3QP5A 4JYKA 3C95A 4UNOA 4B48A 2QKLB 5C10A 1S9GA 4XBFA 3VQ8A 4WE1A 2B6AA 4CIGA 2L5QA 5GP9A 1ETOA 3TANA 3C6TA 2EFWA 5F08A 2K9MA 3WU2C 2VC0A 1LVAA 2W24A 3BROA 1S29A 4KH4A 1OLTA 4DFJA 1YVNA 5C2FA 2VQGA 2KZVA 5KAIC 1U2VB 1R7JA 2QM3A 4XRFA 2VUMJ 4MIMA 4LLLA 4H0XB 5HRSA 1MD0A 1JT6A 1O1WA 1J75A 4M3ZA 1KVAA 3G6EN 4O5FA 2UV1A 1XWLA 3GFMA 2Q0OA 3TQNA 3OJSA 2A07F 5LBQA 3HSRA 1XGOA 1Y56A 1APLC 3S1MJ 2Q97A 2PMZA 2X0LA 2P9PB 3MEEA 4CIFA 1W1WE 1ZG3A 2V1NA 4CJ5A 2QWRA 3D0PA 4ELUA 2OUMA 4DU1A 3ZMSA 1RRJA 3ZETA 1FEXA 5E3OA 2M0CA 5HDKA 5IT9O 4HDUA 2ATQA 4CJFA 3BCBA 4LG0A 2RPIA 4OIPF 4J00A 5HDGA 9ANTA 1XSVA 5KCMA 1SQKA 3CYMA 3P31A 3FMSA 2F8TA 2XAGA 4KMUX 2X74A 3SDGA 4AC0A 2VN2A 1J2XA 1MSEC 3JCUC 2UUZA 2ECBA 4BREA 3MWPA 5AZJA 4W5OA 4HCBA 1NK5A 3HOZJ 2BVMA 2ZNZA 2W7NA 1DP3A 3W2AA 2DODA 5JHFA 4DV1K 3V81A 5F64A 2XC7A 2QEXI 1N25A 3JRCA 2I10A 5KNLA 4YIRX 2JA5J 3MN5A 4AM7A 3SPZA 1MDMA 3HKZN 2R0QC 1S1XA 4G7OF 2ZXWH 2P6SA 2XAFA 3A5MC 4KNYA 2HHWA 1I5ZA 1QZEA 1R1VA 1MBKA 3QYBA 4XLFA 4CYDA 4ILGB 4QS8A 4W5TA 2NS0A 3EE8A 3SJJA 1IXRC 1SD6A 3U9DA 3H36A 3I64A 5HODA 1ZAOA 3CP2A 3I0TA 4WQ5C 3GZNB 2F5DA 2NOGA 4CSWA 5M5YJ 3DXMB 4D0PA 1FYKA 4MQVA 3K1MA 2HXOA 4M71A 1LFBA 2FBKA 1PUFB 3OYMA 3F9MA 1LVKA 2L02A 2D1HA 4EQQA 2PJRB 4C2UA 1JCGA 1IV6A 1BCOA 3BTLA 1HNIA 3V7CA 4DTPA 2O8KA 2V9VA 3HSFA 1ZELA 3FZKA 2KP6A 3DRRA 2E7WA 3NF9A 2E1MC 3O6WA 4I9LA 2HQ5A 5GAGJ 4XKWA 3K70D 4KYWA 5ERIA 1NJIO 3TAPA 2RGVA 4HPQA 3LWFA 4A6EA 2DMQA 2ELJA 1EA3A 3A0BC 3UIQA 2M34A 4OPHA 3A0HC 4CBWA 4C3HJ 4F3QA 2QA4N 1J09A 4LSNA 4XLHA 2HB5A 4RW7A 3K5LA 2F6CA 4AIHA 2G0EA 1IV8A 3G71N 5E8GA 3GLXA 4KPYA 1FMWA 2RE2A 2WWYA 4EM0B 3O3HA 5GPCA 5DD8A 1QVTA 3TAQA 4R1HA 1K9MO 4NUBA 4CJPA 4C3IJ 4E1JA 2HHQA 2TDXA 4BRMA 5HS7A 5FKNA 1HPZA 3G25A 2OTJI 2E1CA 3E66A 4HUEA 2VG7A 3SQ4A 5FDLA 5E17F 3TABA 1ETYA 3P83D 5J8CA 1VSJA 2P9NA 2F4VK 2A05A 3N4QA 2GQQA 2HNZA 4CJEA 2OA4A 4NCAA 1ZKGA 3L2WA 2IA0A 3S3OA 2R7YA 5FLXK 5JMVA 3H3UA 1P90A 3GVAA 2BEOA 5AR0A 1R71A 3C65A 2KQRA 1EWQA 3AO4A 3LALA 2R7WA 3U9GA 3I33A 3H08A 4XH4A 2IC3A 2EHGA 3MAQA 2HMIA 5AONA 1BCMA 3WHBA 2V26A 3QDKA 1BN5A 5F27A 4FJ5A 4N76A 2L7MP 2P9PA 2NRAC 1HW2A 1XI1A 3M3YJ 1YJ9I 4MQ9F 3VQ9A 4B3SK 1G3TA 2GIVA 2M3AA 2Z1IA 2XAUA 3S3NA 1OCZH 1T39A 1NGAA 3NVMA 1DTTA 2H94A 2FC0A 2HHSA 2HMPA 4G7HF 1U45A 4AVZA 2AP1A 4CEEA 2IBDA 2CRGA 4IOAF 5JHUA 3PM1A 4A57A 1WSUA 2F4IA 1RDWX 2E1NA 5H6QA 3K5OA 3H6EA 1YIOA 1EV7A 3JAMK 1FIAA 3KLNA 1YTAA 4XLAA 3IFRA 3QRFF 4PWDA 3HOWJ 4DSLA 4Y15A 1HKGA 1D0YA 4N9IA 2OCCH 1T38A 2IA1A 2XKOA 3PIPF 2FE3A 2ZCWA 3JRDA 3OYFA 2D0OA 4K0KK 1H9GA 3LPUA 3KP5A 2YHAA 1HSJA 3QLHA 1WJAA 2LVSA 2CUZA 2XSJC 3GX4X 5B5EC 1G6NA 2IA2A 3DOKA 1FSHA 3OYAA 3CXCM 2K9QA 4L5EA 2FSKA 3SQ0A 4DR7K 4PSXA 3TW7A 1UA1A 4LF9K 2Z3YA 3HJEA 3I4NJ 2YJEA 2LC2A 1YO5C 4FX0A 4DQ8A 1UB9A 3OR2C 2EZIA 4PDKA 4DSIA 1BOTO 4CF0A 3HPHA 5JLHA 2PAVA 3OYJA 5E8IA 1OYIA 3NF7A 3SUOA 1A6IA 2CH0A 3NWTA 1MU2A 1T0FC 3IWZA 3MWMA 2NVQJ 1X4OA 4I98B 4PY5A 2IS1A 3DLGA 1YOVB 3JRAA 3TTCA 3CFPA 1KLMA 4XIUA 1Y8RB 2OBPA 3LDQA 1E3OC 4PCQA 2O4IA 2ZQBA 3TAEA 3ABUA 4PFOA 1E4GT 2BGCA 2DMTA 1JJ6C 1OCTC 1RBTA 2OPRA 2DA7A 4AHSA 4CESA 4R5PA 2G8VA 4J2EA 1GVJA 2P0WA 4XL9A 3E9PA 5D8KB 4FQGA 4AU7A 3CJ9A 5LRRA 1A36A 4GGGA 4KT6A 2KHMA 4CEFA 2K4JA 3A2FA 5JVGL 2E1OA 2AXTC 1TNTA 4YFKF 2LDUA 3FBIB 4DTMA 1LEBA 1RTHA 4JNEA 3F8MA 1N5YA 2IS6A 3VTHA 2QA4I 3GFJA 3PX6A 3LQRA 3JAMO 1BR2A 3U6FA 4AH9A 2A6TA 3JRGA 3CMYA 4OGEA 3B6OA 4OIOF 1A5JA 1MKMA 4E7SA 1UELB 2ZXIA 3FM5A 3VQ5A 3MXJA 3JR9A 4I2QA 4KAZA 1D1CA 5KTQA 3EUHA 4O3MA 3BQYA 4NNJA 5HROA 1IF1A 4WCGA 4J2AA 3GFIA 1ETXA 1TW3A 2O7OA 2YNHA 4FWSA 3TARA 1T95A 2O8BB 3K4MA 1VQ4N 1X19A 1HA8A 1VQLI 2ELHA 1BL3A 3C7NA 3JXUA 1FP1D 2DYRH 3ID6A 3A01B 4WQ4C 3G4SN 3HVRA 1YW7A 4ESFA 4JD2A 3M9AA 3CPWM 3PNYA 3FXKA 4D1QA 2OF7A 3AY9A 4YRVA 2EB7A 5CZ2A 4C1NI 2VL8A 2EH3A 5IP7J 3O80A 4ICLA 2Y0SA 4F91B 4DV2K 3BY5A 4IRGA 4CVNE 1QBJA 3VODA 2JWKA 1C1CA 3BCAA 4K41A 1WB9A 1HQCA 1YF5L 2IS4A 1D5YA 2VIXA 1LDJA 2RVCA 2Y69H 1K6YA 5EYRA 1HBXG 4CFCA 3PFIA 4B9QA 4CEZA 2V7FA 5BMZA 3CQ8A 4BQAA 1GOAA 4FPAA 1LOTB 3T7ZA 1DKGD 2MG4A 2DOEA 1JT0A 4MLOA 4HUGA 1RTJA 3F8FA 3EYYA 4FLXA 2QTDA 4X62K 1TK5A 3KD1E 4AILC 5EDNA 1SC7A 1FX7A 3CC4I 5L3FA 2X6YA 4YIIA 2PYLA 1NGDA 1H0MA 4RG8A 4BR0A 2IIRA 4E7HA 4U7BA 5K1YA 3H1VX 4ZYDA 4CK1A 1IBLK 2DMNA 1PUEE 1X3MA 1NGHA 1TAQA 4GY2B 3ZX0A 4E89A 1K83J 1GT0C 3AV9A 3KEYA 1PUFA 3BGRA 3AVGA 4BRNA 2XB0X 3AVNA 1G3YA 2E36A 2FQ3A 3S2WA 4AYBN 2XF7A 4DU4A 1VQ6N 1U5TC 3SFZA 4IQ4A 2ZFUA 2R5ZA 2A69F 4BJTA 2WTUA 1ON1A 1Z67A 4UHTA 2P81A 2DK8A 1N33K 3QIOA 3D5LA 4V2GA 4UXNA 1BA0A 1FWZA 2BHZA 4HOBA 3BG9A 4Y33A 3LANA 2LG4A 1BI0A 4FASD 1KU9A 4AWXB 3Q5FA 3S1NJ 5CR4A 3SBGA 4BRKA 1YTUA 3ATVA 1KONA 3IAYA 4W5QA 1Y6IA 2ZM6K 2XRLA 4KRFA 1SV5A 3D2FB 4KH6A 3FHNA 2Z16A 4OIRF 3K4LA 4I0AA 5DK5A 3ULEB 2C6YA 1TYQB 3V9ZA 3G4SI 3C1DA 2R7FA 2BTFA 3OIOA 4AD9A 2XPWA 1BC8C 1WHUA 2XY8A 3ONQA 5LGTA 1I1SA 3UKRA 3MN6A 3PIOL 3T69A 1VQ4I 1N78A 1D5VA 4YOXA 3NGYA 4EJTA 3WXJA 2HNHA 2YSRA 4ZHRA 4DR1K 4FW1A 4ZH4F 4QS9A 2DJIA 3HPGA 4XM3A 3ZQFA 2YHBA 4B47A 3CCEI 3PO2J 3FZHA 4OKKA 3U3GA 1FOKA 3MDQA 4BHPA 3MKYB 2P9NB 4OKJA 5LY3A 2Z1JA 3FISA 5CPRB 2QLZA 5JFRA 1W9HA 5J1YA 1PDNC 4CGIA 1LWCA 2P7CB 2QWOA 3MMVA 1FT9A 1JKRC 1KQ0A 4UUTA 2DU9A 4BQQA 2R3SA 2GTDA 1MW7A 4KMFA 4DWIA 2M5WA 3M6GA 5K7FA 2NRRA 5J8FA 4JEPA 4L5IA 4RS8A 5SZTA 3SAGA 1X3WB 1R22A 2IEKA 1NGFA 1V4RA 5ILSA 2B63J 3WQTA 3CCQN 2CU7A 3OOUA 4FZYA 1TZLA 2VKVA 3DXMA 4IZZA 1B9DA 2DA5A 2IVOA 1YJ9N 3BWGA 1RFQA 2FSNA 1TK8A 4XK4A 1J54A 3CFRA 2F48A 1MMDA 3PSIA 1TVRA 4IG0A 5E41A 3DXKA 3NH2A 4WFNL 2OQGA 2O8EB 3KETA 2VKHA 1TLHB 3KCCA 5HLIA 1G99A 3WNFA 1WGXA 3O8HA 1WRJA 2HZTA 4LC9B 4HEA2 3CHWA 4BC3A 4CFBA 2X9DA 1VI0A 1SFEA 4RBOA 1ZYQA 4WXHA 3H9GA 1JLAA 5IT3A 3RRGA 3F8BA 4G6DA 2LYCA 5FGMA 3HJFA 2R7SA 3LSRA 1ZK8A 5DCFA 1T03A 4E1MA 1O7LA 3E9LA 1D0ZA 1VSFA 1QZZA 4EJUA 4BGAA 4FJNA 4HWIA 3RYPA 3RR7A 3KK2A 1Y1VJ 3AVFA 3DOLA 4G9ZA 1YT3A 4KHUA 1B92A 4BRIA 4F8RA 4IL6C 2DY4A 1PVEA 2IPQX 2DXIA 2YNIA 3Q0VA 3AGRA 3GTQJ 3ENHA 1TKZA 3JYTA 3EYZA 3CCUN 1Y8QB 4ZZDA 4B1XB 3ZQIA 1HNWK 1XUPO 4EJWA 2HVIA 3BJOA 4PGGA 3WTZA 4XSXF 2X48A 4PA1A 1Z7UA 3JTGA 2MFZA 3UKRB 1VQ9N 1KYWA 3I59B 3EN9A 2ESNA 4YOUA 2LKPA 3VYTB 2W6LA 3VF4A 4B1UB 2ZWHA 5BRHA 2D1KA 4GVEA 3A4CA 4LH5A 4CEDA 4LK1F 3OYNA 5I3UA 1SKSA 4J19A 2BUPA 1LE8A 2E1MB 3J7AO 2HOAA 4LMYA 3KHYA 3M8PA 4DQIA 2M87A 2F9WA 5EG0B 3WXMB 1F43A 2FSWA 2HPIA 1IJWC 1TAUA 1JLGA 2XV4S 2DA2A 1T05A 4ISEA 5GIOA 1W0UA 2NVXJ 1U0JA 4V19K 4GRIA 3KLHA 2OJED 1VF9A 3F72A 5D8LB 1WAFA 1BI3A 1D8JA 2XROA 2ASMA 2V1XA 4L9TA 3OTOK 2R7TA 2RREA 1XC5A 2A3SA 5ILUA 3HRTA 4A3JJ 3EZWA 3WNGA 4IO9L 2ZMEB 3TKYA 4B09A 3IKMA 1KD1O 3QBXA 3O1WA 2O3FA 4DTJA 3L2VA 3HYIA 1Q86O 3NH1A 4DSEA 2PYJA 4RAZA 4B1WB 1BDGA 2PMUA 3FDYA 4DSKA 1TUYA 2IS3A 2QWLA 3HRGA 5EOYA 1VSHA 3CUQA 4A93J 1SFOJ 3SBTA 2DFIA 2MW8A 4XRSA 2D4WA 1S1VA 4JX5A 3QYFA 2KISA 3PFYA 3K4JA 5EVZA 4FHTA 3IWFA 4CI6A 2MH2A 1Q18A 4DW6A 1K4SA 3IV5A 1IG8A 1PJRA 3DF8A 3G0ZA 1NJXA 4QWQA 3CCUI 2CH5A 1JLQA 1KU7A 2FXUA 4IJAA 4B44A 4E6KG 4HV5A 4LG0B 3PUBA 3GTGJ 4NCGA 1X2MA 3H0GJ 2LOOA 1ZG1A 3AAFA 1DPUA 2KIMA 2QENA 3SEQA 2DPUA 1U04A 2FD5A 4M7XA 4CGJA 5BPLA 3SXYA 3I56N 3WTSC 1HMVA 4CYCB 2FBXA 3M1FA 5AQQA 3TTFA 2EV5A 3OV8A 4RW8A 3O3GA 4YEJA 1LB2A 2E88A 2P9KB 1SS6A 2OPSA 2EWNA 4BAYA 5J6XA 3TEDA 1MIJA 5BN8A 2O9LA 4DTNA 4I9QA 4I7FA 4DQSA 1XNQK 3H3OB 4JRPA 5JVGF 4XH5A 1LJ9A 2W6KA 4UB8C 1USTA 4I02A 1HOMA 2D0BA 3DJCA 5LJVA 4IRHA 2KPMA 2Y30A 3QAHA 3G6EI 1IC8A 3F0CA 2F4OB 1DT9A 4Y17A 5AQFA 4U67L 1JCFA 3LA7A 2FQ4A 3FXRA 4PHTX 2G9WA 1IG9A 3KVGA 3KEQA 4HX7A 2D0CA 3AVLA 2JA2A 3H9JA 3CF2A 3TWHA 5JICA 3MVPA 3RRHA 3HK2A 1LDDA 3DU6A 4FX4A 2MLGA 3BZ6A 3CERA 2OZMA 4CHUA 1KU2A 2GA2A 4N4NB 3HTUA 4EEFG 4ESJA 3V9XA 2XASA 4KN4X 3G1MA 3PO4A 4LB6B 4UUSA 3TDZC 1BO5O 2GBZA 5LEJA 3QEIA 3THWA 1ON2A 3G71I 1OYWA 3DP7A 5AQPA 1F21A 1RIOH 3GTMJ 5JS1A 2Y48A 2ECCA 2JZYA 4XN3A 4RDUA 3GBTA 2YPRA 4LITA 4YG2F 3A02A 2DW4A 2E2HJ 1V3FA 2QBYA 3K69A 1RETA 3LP2A 2QEXN 1N75A 3ASMA 5C4XJ 1MBGA 2ZMEA 3ZMVA 3GL1A 4CJTA 1TWGJ 4D5CA 4O8UA 5GTIC 3SV4A 2H6CA 3G1OA 1QQOA 4PJJA 2PFUA 4H0YB 2OAZA 2LP0A 4QS7A 1U6ZA 4FLUA 3ESWB 3C6UA 1UA0A 4DS4A 2AO9A 1P8ZA 1X3NA 3K57A 4H5NA 3VEZA 1WAJA 3LDNA 2M7BA 3M4OJ 3HL8A 4C8LA 2D0AA 2XY5A 4I09A 2HQAA 2LD5A 1UWBA 4BWJA 3EE9A 3I53A 3Q9SA 3HDDA 1R49A 2LMDA 3QEWA 3KYCB 1JXSA 3JREA 2QSFX 4K25A 3I5UA 1JGGA 2UXCK 2WOMA 3H5NA 1GXQA 4IQJA 3MZ8A 4CZZA 3OMYA 3HO1A 2HPMA 1R5HA 4A3MJ 4B1ZA 4MLHA 5HDNA 3CCSN 3PO3J 3HXMA 1P7JA 3DLHA 3ZT4A 4A5NA 2V7YA 1K78A 1Z77A 4IOCL 1R0AA 3DU5A 2ISZA 2MGQA 4L0YB 1T6CA 1MWMA 4C3JJ 4H0EA 2HBLA 3S2DJ 3HEFA 2G8FA 3ERED 1YITI 3K2PA 1SFUA 4KB1A 1STZA 1JE8A 2HTJA 2KL4A 1DQUA 4PJMA 5EJCA 3S8PA 2UZKA 3SAFA 4DS5A 3DBRB 3LSPA 5LHHA 3J80O 1HYZA 4B8CA 1NK3P 2IAIA 4BL0B 1XMQK 3RPUD 2JN6A 2MA3A 1FYLA 1GLAG 3OYBA 4DV5K 2P5OA 2HR3A 2GV9A 4DMNA 5GAGP 4GCVA 1QZYA 2MLKA 2R93J 4DCHA 3MKZA 5I9EB 1P92A 2VJ4A 1TQMA 4EJVA 1Q8IA 5KPZA 2CQ7A 3KZBA 1AHDP 1CQTA 4AYBA 1MJAA 2DT5A 3DEUA 5LHIA 3E5QA 5E3MA 3CCVI 3NF8A 3S16J 1XMXA 3HSEA 2F4MB 4BHCA 1YUWA 1W0TA 2WTEA 2PJRA 4BRFA 4CZJA 1OKRA 1U5TA 4CGZA 2BDPA 5HNHA 3CZ6A 2A6AA 1D1AA 1POGA 1TT0A 1ITGA 5TJJA 2DFEA 4J2BA 1QRYA 2F2EA 2NNWA 3UKUB 1REVA 2KDOA 1WJEA 3AKZA 3AL0C 2E4LA 4EHTA 5KRTA 4YOVA 1SFXA 1MBHA 1GLEG 2Z1GA 3HBLA 3BTCA 4RTFD 4YDUA 3ZSXA 4M3WA 2DA1A 4M42A 4FISA 5TRDA 4X6AJ 4FLZA 2KFNA 2BXYA 4H0VB 3ZQQA 4XEIA 3OIQA 4F55A 2R7OA 1BI1A 4S0HB 1YYVA 2GXGA 3M7GA 2COMA 2XGEA 3V8LA 3NE6A 3H5AA 3T8RA 4BUPA 2ZSIB 3OOPA 3OYCA 1HDPA 1S9EA 3HI0A 4E19A 4KIFA 2BANA 4DTXA 1RDBA 1YHQN 4FM0A 5EZHA 3SJHA 2HVQA 2BZTA 4C2TA 5M5XJ 2EIJH 4DYCA 2IVPA 5AFUA 4DV0K 3MXIA 3NVKA 2L54A 4D9JA 2BBYA 3K9KA 5I42A 2XRNA 1JKOC 3CQXA 5F6FA 5AQUA 4OAZA 1KXPA 4JI1K 4BQOA 2M4GA 3CCRN 4UVBA 2HYJA 2HNDA 5DCMB 3G1LA 1IXSB 1WCMJ 3AG3H 4ZC3A 4JKCA 5E84A 1H88C 5M1PA 3T1AA 4CZKA 3CMEN 1VSEA 5ICCA 4NXMK 1JUSA 1OISA 3CCMI 5J1EA 2EIKH 4HNUA 5CKTA 1S6QA 3V9SA 5CYQA 5BPNA 5J3LA 1BM9A 2LSNA 5EEAA 4CEAA 3HM5A 4IG3A 1IN8A 1UHSA 1ULYA 4ISFA 3TSPA 1ZXOA 3SZ2A 3CETA 1T44A 3C6AA 1Z21A 1XX5A 1LFPA 2IGMA 2YU3A 2HXIA 1NGEA 4B9SA 3TSQA
chains in the Genus database with same CATH topology
4O44A 4KTWA 2X1CA 1LW2A 3NH0A 2FBTA 2WAEA 1LAVA 3HL2A 1IH7A 1Z26A 3OYHA 3QYEA 1BISA 1V5EA 4M3UA 1KLNA 1NK4A 4LH4A 3KLGA 4CJRA 4M3RA 4B9LA 3SQ2A 4AHRA 3VA3A 2HHVA 4CGGA 3U3YA 3VSKA 1MMNA 4ZYAA 3ULDA 3MD2A 3RQ4A 1UAAA 4B3XA 4ID1A 4E7JA 3H9QA 3NGZA