3HPGA

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCQENKMGIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
molecule keywords Integrase
total genus 66
structure length 194
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hpgA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpgA02
1WJBA 1A5XA 3OYKA 4C8OA 1C6VA 4XIUA 3NGZA 1O1WA 3K5NA 3L2UA 3DLGA 4M3ZA 4LH5A 4DG1A 1WSIA 3NGIA 4KTWA 4ZHRA 2FBXA 4BWMA 1BQMA 3C94A 1UOCA 3DMJA 3KKSA 4IG0A 4DTXA 4OLAA 4BE2A 4HCCA 3S3NA 2VWJA 3VQ5A 3PX4A 1QE1A 4N5SA 3L2WA 3C95A 1TL3A 3PO5A 5JS1A 4BE1A 4DFJA 4FM1A 4NYNA 3DI6A 3M8QA 4N47A 5KGXA 1C0MA 4FXDA 2BANA 1Y97A 2KTQA 3MXMA 1KFDA 4L8RB 3TR8A 3HP6A 3O3HA 4I9QA 3OYBA 4CEQA 4F4KA 4LSNA 1L5UA 1JLFA 2ITGA 4DQRA 3TWHA 3NH2A 1KONA 1YTAA 4CJQA 3SUOA 4B9LA 4FLTA 2JGUA 3QEIA 1RDDA 4OJRA 3VQEA 3F73A 1TKDA 4J2AA 3IRXA 2IAJA 4FJLA 4LD0A 4K8ZA 4OGCA 5DK5A 1YT3A 3ZT0A 4HUFA 4BACA 4DTNA 5KI6A 3ULDA 2RN2A 1N6QA 3ZSVA 4DWIA 3QLHA 3NF8A 1FXXA 2NUBA 4CHOA 3CG7A 2WOMA 2RKIA 1TL1A 1RBTA 2DFEA 1QSLA 4F2SA 4BDZA 4B9TA 4J2BA 3V9WA 3T19A 4CEAA 3P5JA 4Y1CA 4CHYA 4DTSA 2OPPA 4DTMA 3OYMA 4FZZA 4FJJA 3LP2A 3DRRA 1U4BA 1X9SA 4CECA 1FKPA 3V81A 4DSFA 4M45A 3OYFA 2XY7A 1IKWA 4E7IA 4DQIA 4KV8A 1SKSA 3M8SA 3SCXA 3MEEA 2F8TA 1EETA 3CFPA 4Z4GA 4DFPA 1C1AA 4CEOA 3VQBA 4CF0A 1J54A 4Z4IA 2VG6A 1D8YA 2E4LA 3ZT2A 1BIZA 1C1BA 3O3FA 1LAWA 4H4MA 3V6DA 5HLFA 4F8RA 3TAGA 1C0UA 3PX6A 3M8RA 3PUFA 1RBRA 1U45A 4FJHA 3WNHA 4DTJA 2HHUA 1TGOA 1VSDA 4C8MA 3SZ2A 5CZ2A 2YNHA 1IKVA 1REVA 4M42A 1VSLA 2FC0A 4FJMA 2XO7A 3V1OA 3QETA 2OYQA 3UIQA 2OPQA 3MXJA 4CFBA 4NCBA 3ZT4A 3C6UA 1XHZA 4WE1A 1FKOA 3WNGA 3CQ8A 1WJDA 4JRPA 1XI1A 5J2NA 2BGGA 2YV0X 3ZSRA 4FLZA 1KFSA 3RR8A 2HVIA 1UWBA 3E01A 1S1XA 2HNDA 4CIFA 3TAPA 5I3UA 3LAMA 3HSTB 4NYFA 4DFKA 3BDPA 3QIOA 4N41A 3KLGA 4CF8A 3V1RA 1HYSA 4DLGA 4OGEA 1T03A 1NK6A 2OPSA 3LWMA 1UAXA 3DLRA 1BL3A 4FCYA 3QEWA 1JXBA 3CM5A 3P1GA 1RDCA 1SL1A 4M3WA 1J9AA 4W5OA 3SI6A 4EP4A 4N56A 1HQEA 3HPGA 4FLVA 1Z25A 2HNZA 3THVA 2G8UA 4BDPA 1RT3A 1KTQA 2E6LA 1S1UA 3FFIA 3OVNA 4FW1A 4QCLA 3OS0A 2KZMA 3AO5A 1NKCA 1LW0A 1EKEA 1WSHA 3NFAA 4ID5A 2DFHA 3JYTA 4Z0UA 1T05A 2HHXA 1TKZA 3SUNA 4CK1A 4CEFA 3OYGA 2X74A 3KK1A 4HTUA 1KVCA 4DQPA 1WJCA 4DS4A 4DSLA 4KB1A 2DFFA 4FK0A 2F96A 3NH1A 3C6TA 4O0IA 3AVGA 1BIUA 5HP1A 1HQUA 3K5MA 3RMCA 4FJ7A 4AHVA 4DU1A 4KI4A 4AHSA 2YHBA 1LWEA 1WAJA 2FBTA 4O0JA 1RT5A 1N5YA 1NJXA 1BQNA 2G8VA 2KZZA 4B9UA 2Q3SA 4ID1A 3OJUA 1HMVA 2PYJA 4AHUA 2B5JA 1T7PA 3DLBA 1BCMA 3RMAA 4I2QA 3HVTA 4AHTA 1QSYA 3OYNA 3PV8A 1BI4A 2IOCA 4E1NA 3VQ6A 3LZJA 1MW7A 3HT3A 3V9SA 4E7LA 1CXUA 3LALA 2Z1GA 4KTZA 3IAYA 4ELVA 4KB0A 4LH4A 4DSIA 4DTOA 2XHBA 4I9LA 5HRRA 4CJ4A 3V9ZA 1QTMA 3SPYA 2YHAA 4DFMA 5SZTA 5CZ1A 4M3RA 1RT1A 1RBVA 3LPUA 3O4QA 4E7HA 4DTPA 5EU7A 4M3XA 2VG5A 3AA3A 3LP0A 1BCOA 2Y1JA 1T8EA 1WJAA 4CFAA 3K2PA 5FROA 2QKKA 1RTDA 2F8SA 3KK3A 3I8DA 1L3SA 4IKFA 3HPOA 3V1QA 2QXFA 2Z1HA 3L2VA 2XY8A 5CYQA 3SQ0A 4RW4A 2KQ2A 3KJVA 4R5PA 4FM0A 1XC9A 4E0DA 4FJXA 1JLEA 5I42A 1E0EA 3F9KA 4RW6A 5KGWA 3KK2A 3SYZA 3NF9A 1GOAA 4FJGA 4FZYA 2HW3A 3VQCA 3AVBA 1EP4A 1CLQA 4CK3A 4KHYA 2G8WA 1VSFA 3KTQA 3SPZA 3VA3A 1ASUA 3P83D 3T3FA 2B4JA 4DSKA 1U49A 1HRHA 1A5VA 1RT4A 4CFCA 1VSMA 1I3AA 3DYAA 1RBSA 1WSFA 3NGYA 5HRNA 2BDPA 4ELTA 4QOZB 1XHXA 2I5JA 4O4GA 1SL0A 1ZBIA 1Q9XA 4CJSA 4ZTJA 1X1PA 1C0TA 1WN7A 3ZSWA 1GOBA 4CIEA 2HMIA 1NKEA 4FJIA 3NF7A 2G8IA 1A5WA 3TANA 1VSKA 2YNFA 5FDLA 3KD5E 1DTTA 4IDKA 4CESA 3VQ9A 4DTUA 2IS3A 3OYEA 3NE6A 1TK5A 3K59A 3HP9A 2GV9A 3WNFA 4KO0A 3G0ZA 3NHGA 4JLHA 4UQGA 2D0CA 3KLFA 3LP1A 2BE2A 4FLXA 1NJWA 1S9GA 2B6AA 3QINA 3AVIA 2ATQA 4CGDA 3K5LA 1FK9A 5KRSA 2HHQA 4GW6A 3SQ2A 4PA1A 4CJRA 4KHSA 3OYJA 1J53A 2D0AA 3RRGA 3L3UA 3ZSXA 4CIGA 4N76A 4KHNA 3RRHA 1TK0A 1CZBA 3OJSA 4IFVA 4CGJA 3NDKA 4DQQA 1RILA 3KLHA 5J2MA 4Y1DA 4PUOA 1KVBA 3DRPA 4CJFA 3I0SA 3QNNA 2RPIA 3ZSQA 4JS5A 5HRPA 4FJ9A 4I7FA 5J1EA 2IC3A 1NK0A 1S9EA 2Z1JA 1VK0A 3QNOA 1NK8A 1SKWA 4FZXC 1GOCA 4KREA 3VQDA 4OKJA 5C25A 5HBMA 2DY4A 4FW2A 1ITGA 3A2FA 3AVFA 4AHCA 3LZIA 4DU3A 1NKBA 4CJLA 2VWKA 1IH7A 1F21A 1WSGA 3AO2A 1QSSA 2P5GA 3DLEA 1BHLA 4O5BA 2HVHA 2HHSA 2PYLA 4B9MA 1IG9A 3VQ4A 3HL8A 2ZE2A 3OYCA 2X6SA 4M3UA 3SNNA 1JLGA 2JLEA 1TKXA 1KRPA 1BI4B 5CYMA 1JLCA 1MU2A 4F3OA 4KTQA 4KKOA 5JS2A 4KHUA 5KTQA 3S3MA 4C8LA 3VQAA 1KLMA 2DTUA 1RTIA 4DQSA 2EX3A 1RCHA 3G10A 4CEBA 1IO2A 4CHNA 3ZSZA 5HRSA 4RW8A 3HJFA 1IKXA 4HHTA 4KRFA 5KRTA 1NOYA 3AVAA 5C24A 2OZMA 4PWDA 1JLAA 4G1QA 2YKMA 4AHRA 3CFRA 1LWFA 3QO9A 1BGXT 4CJUA 1TV6A 3LANA 1NJYA 1D5AA 3OYDA 4OKEA 1HYZA 4EZ6A 1KSPA 4MQ3A 3OYIA 3LDSA 2KFNA 3KKRA 3MAQA 3VQ7A 3TAFA 1BISA 1S5JA 4CJVA 1G15A 4DSEA 4GMJB 1YTUA 3AV9A 1KVAA 2OZSA 1EXQA 3CM6A 3MEGA 4QAGA 3EZ5A 1WSEA 4BDYA 4CGFA 2Z1IA 4DU4A 1VRUA 2PZSA 2QK9A 4O55A 3QEXA 3ZSOA 1HJRA 1HPZA 5T7BA 4HCBA 2D5RA 4CJKA 4OPKA 4Z4FA 2XY5A 1WSJA 3AVNA 4YNQA 4W5TA 3DM2A 4E89A 3AO1A 3OYHA 1L3UA 4FM2A 3NAEA 3HO1A 2XRIA 1C1CA 4E7JA 3QERA 4DMNA 1NK5A 1VSHA 3O4NA 1S6QA 1ZBUA 3LWLA 4FK4A 3B6OA 1WNSA 5K14A 4CGHA 4E3SA 3SQ1A 2PY5A 4B9SA 4B3OA 4CJEA 1NJZA 1KLNA 3QIPA 4E7KA 3V9UA 4HUEA 1ZYQA 3I0RA 3AVHA 4CF1A 3LP3A 1SUQA 3RMDA 3L2RA 1J5OA 1VRTA 5SWMA 2YNIA 4ELUA 3DLKA 1ZBLA 4DSJA 3HYFA 4EP5A 5C42A 4DF8A 4NCAA 3BGRA 2HHWA 4CE9A 1TAQA 4AILC 4CEDA 4CCHA 2LSNA 1Q8IA 1XWLA 2GBZA 3M8PA 3MEDA 1Z26A 4MFBA 3VA0A 3S9HA 3SJJA 1TK8A 4F2RA 4RG8A 4KAZA 1DLOA 1Q9YA 3LAKA 3HVRA 2OPRA 4H4OA 3K57A 4KHQA 1RNHA 4Z4CA 3OYLA 4CF9A 2O4IA 5J2PA 1ZBHA 2KW4A 3VN5A 1R0AA 2G8KA 3HK2A 3AO3A 5J2QA 1UA1A 2WONA 2ZD1A 3EYZA 4C8KA 1LV5A 4DLEA 1HYVA 1WJEA 1I39A 3ISNC 3OS2A 1CZ9A 3L3VA 3U3GA 4B08A 1SKRA 4W5NA 4KI6A 4JS4A 3D45A 2G8FA 4CGIA 4CF2A 3VQ8A 4GVMA 1JLBA 3OYAA 1LWCA 4PQUA 2HB5A 4RW9A 4E19A 3SUPA 2P5OA 3HM9A 4CJPA 3CFOA 4Z4EA 1TVRA 2W42A 3AVJA 1NOZA 4M41A 4CHPA 3LPTA 1TKTA 2HNYA 3KD1E 2OA8A 3D0PA 1K6YA 3TAMA 4FJ8A 1S1TA 4FLWA 1VSJA 4M3TA 3IG1A 3NBPA 4W5QA 1D9FA 4OKKA 1RT2A 3DOLA 3K58A 3TABA 1B9DA 4B9VA 2QKBA 1X9MA 3MXIA 3SUQA 2O4GA 1RT6A 4B8CA 4Q5VA 4BE0A 3SV3A 1ASVA 4CJ5A 4YFUA 1RBUA 1HNVA 3JSMA 5HROA 5D3GA 1S1VA 3PO4A 3QEVA 1S1WA 5DMRA 3RMBA 4IBNA 3ZSYA 3VQQA 1LW2A 1U48A 3RR7A 4J2EA 2HHTA 4AH9A 2IDOA 3DRSA 3V4IA 3VQPA 4E1MA 4PY5A 1WJFA 3S3OA 3KLEA 2P51A 3NH0A 3EY1A 4CHQA 4J2DA 4LY7A 4CHZA 1JL1A 1X9WA 4DTRA 3U3YA 2FBYA 4IG3A 3HPHA 1B92A 3TARA 4CFDA 4I2PA 3HXMA 4HUGA 4CERA 4K8XA 4M3YA 4KFBA 3AVKA 2X6NA 1W9HA 4OVLA 3MECA 3NF6A 3KIOA 1UA0A 4FVMA 3V9XA 4CEEA 4CGGA 3TAQA 3TI0A 4IFYA 5FRMA 3ZT3A 1SL2A 1VSIA 2E6MA 3CYMA 1L3VA 4W5RA 3AA4A 4Q0BA 2D0BA 2G8HA 1RTHA 3SQ4A 3U6FA 1DTQA 1SV5A 4FLUA 1JL2A 1VSEA 1LFPA 4B8AB 4H8KA 3ASMA 1YVUA 4CJWA 4FLYA 1JLQA 5E41A 2X78A 3IS9A 4B9NA 1IKYA 3TAEA 1W0HA 2EHGA 1NK4A 2ETJA 2RF2A 4CJTA 3OY9A 2VG7A 4O44A 1NK9A 4TSXA 4RW7A 3WNEA 3AVMA 4OLBA 3AA2A 4Z4HA 4ZTFA 4FK2A 2KFZA 3H08A 1HNIA 3PY8A 3AVLA 1QS4A 1WLJA 3ZT1A 2YKNA 1QQCA 4DS5A 3ITHA 4C8NA 4HVJA 3L2QA 4DF4A 3AO4A 2P1JA 4FJKA 2ZQBA 3SV4A 4OPJA 1D9DA 4KPYA 3ZCMA 2XY6A 4CEZA 2AJQA 2R7YA 3DLHA 4CJ3A 1LAVA 1RT7A 1TAUA 1S6PA 2FBVA 3QESA 2HHVA 4FJ5A 2GUIA 3DOKA 2IGIA 3AA5X 1JXEA 3AVCA 4JRQA 2Y1IA 1KCFA 2A1RA 1L3TA 1U47A 1RDBA 3B6PA 3PX0A 4FJNA 1ASWA 3OS1A 1U04A 3O3GA 1NK7A 3ALYA 4FYDA 4BWJA 3RTVA 4KHWA 5FRNA 1B9FA 1CXQA 2A1SA 2YNGA 3L8BA 1RDAA 3K5OA 4F3QA 4F3TA 1ZBFA 4CK2A 1RTJA 1WAFA 3QEPA 4ICLA 4LSLA 3T1AA 5CY4A 1JKHA 3KLIA 4EZ9A 3RWUA 1QHTA 4NCGA 1EX4A 3NCIA
chains in the Genus database with same CATH superfamily
5JI6A 4UVBA 1V4SA 4XH4A 2DT5A 4K2EA 2X6XA 2EFWA 2KIFA 2VPRA 5FD5A 3JAMK 4XIUA 3DLGA 2LY2A 2J4RA 3QDKA 4KH6A 4LG0A 4DG1A 4M3ZA 4BRFA 1QA6A 3JRHA 4PK4A 5KPZA 2EH3A 1U6ZA 3KP4A 1UOCA 2W1OA 1VK0A 2OPRA 4IG0A 1ZG3A 5HNFA 4ENJA 3BC8A 4HCCA 3VSKA 4IHTA 2VBXA 2ZXHA 1N32K 3RSEA 2EWSA 3UB5A 1GLEG 1TL3A 3PO5A 4DNCA 3BROA 2L0KA 4ZJZA 4PUSA 3L6QA 2XAFA 4YIFA 2KMUA 4NYNA 3U2RA 1QZZA 4JX5A 5KGXA 1LOTB 5FGMA 2KTQA 2P9NB 5GAGJ 3WE2A 3TR8A 1TL8A 1Z1DA 3A2KA 2QQ9A 4CEQA 4HOBA 2V1DA 5IYBJ 4IOAF 3BQZA 3IUOA 4K43A 1ZRCA 1GLFO 2ITGA 4DV6K 3KVGA 3D2EA 1OCCH 4DUZK 5HODA 2A40A 3TW6A 3ZQLA 2E2HJ 1HDDC 1TKDA 3ZQHA 4M71A 3BUZB 4D5FA 4LD0A 4CZEA 3GFJA 3IAM2 2EFOA 4IOXA 1JKPC 4C3IJ 3KP7A 2O61A 1HKSA 2QA4N 5EEHA 5H6RA 4DBQA 2QLZA 2VKEA 3D0SA 3DCFA 3F8CA 3KZIC 1JHFA 3H0DA 2O8KA 1DU6A 1X1DA 2RKIA 3SMPA 4IOCL 1V5EA 1F36A 1RBTA 4BDZA 5EZGA 4WWCA 3K9JA 3FK6A 4EM0B 4DTSA 1POGA 4XQFA 4CHYA 4KRFA 3CF5L 4FZZA 3LP2A 1DP7P 3CMEN 2YHWA 2E34A 4LF8K 1BN5A 5FKOA 1FKPA 4CECA 4NQWB 4IRGA 1E2XA 5GADP 4BRIA 4E7IA 3WXIA 5H2FC 5IYCJ 1ZR4A 1SAUA 5C2FA 3MEEA 3SCXA 2HXOA 4Z4GA 4MTEA 1XMAA 3CCQI 2YS9A 2AHQA 3BDDA 1T33A 2H3GX 1I1GA 2VG6A 3ZT2A 5D5UB 1OMIA 1TT0A 3V6DA 4F8RA 1HOMA 2MD0A 2OAZA 4CICA 2XROA 3DTIA 3GTPJ 1RBRA 4K41A 3OOPA 4FETA 2F6CA 1TGOA 2YNHA 4ITVA 3QRFF 3W6KB 1REVA 1HW5A 4HG2A 1BOTO 2QZ8A 4IO8A 1AWCA 4NCBA 2IEKA 4BG8A 1GVDA 4FHTA 1YAGA 2R5ZB 4LK1F 3C6UA 4WE1A 3WNGA 1Y0UA 4EJTA 1IUYA 1T6SA 1XGOA 2KJBA 1RIOH 1VZ0A 5DD4A 2E1YA 5D6EA 3ZX2A 4JI7K 5FB2A 1G6NA 2WB1A 3TAPA 5I3UA 2D5VA 2OQRA 1Q86O 2HDCA 4RLQA 2M7AA 3BDPA 4N41A 1T95A 4CZGA 3PM1A 3S16J 4BC2A 5IOZA 1JT0A 4R79A 1ERDA 4ANJA 5ERIA 2OPSA 2DMUA 1BJZA 2XGDA 2R7XA 3LWMA 1DDNA 3LFUA 1AU7A 1D3YA 3OA9A 3P1GA 4IOCF 1P4AA 1O13A 4FWOA 3CCQN 3SI6A 2FA5A 3I64A 2M30A 4FPAA 1YHQN 3NMUA 3THVA 4XLAA 5JHUA 3IH3A 3T69A 3QPTA 4RB2C 1KTQA 4CZFA 1MMAA 3FFIA 2IVPA 3QOPA 3HB9A 2XPUA 4QCLA 4WFAL 4PCQA 3DQVC 1IF1A 1W1WE 1LW0A 3FXUA 2P5LC 5D5VB 3NFAA 3OHRA 1IN7A 4Z0UA 1BIAA 3ZYYX 2IA1A 1FSEA 1FEXA 1TKZA 3SUNA 2HHXA 3OYGA 1MKMA 4CEFA 4DQPA 1KVCA 4YFNF 1WJCA 2V9PA 2HWVA 3BG3A 5J3LA 1AHDP 3PNYA 5DV5A 3UNGC 3M1FA 3NH1A 2H6BA 4PL7A 4O0IA 1BIUA 1CGPA 3SK3A 2GUPA 2JQ7A 3EKSA 4G8XA 1HQUA 1QHGA 4S05A 4LF9K 2DO7A 1FY7A 5BRHA 1W4MA 4O0JA 1DT9A 1N5YA 1T38A 4AM7A 1NJXA 1VQ9N 2OUMA 3ROUA 4L5EA 4B9UA 1BDGA 3A0IX 1ETKA 3OJUA 4FPBA 5ICFA 1KU3A 3DPLC 4EEFG 1HMVA 3DP7A 2V4JC 3TDZC 2NRVA 3RMAA 2Z33A 2W25A 4IX7A 5HL7L 2PG4A 3HVTA 4HWIA 4MDBA 4AHTA 4XRMA 3EQLF 3TGNA 1QSYA 3QWLA 2VL8A 1YFHA 1R1TA 4E7LA 3HT3A 3V9SA 2DK5A 3QOEA 2JTVA 2QEXI 3IAYA 1O3RA 2ZMEC 1O3SA 1ZXOA 1JCGA 1LE8A 2JWLA 2VC0A 3H1QA 4DYRA 1UMQA 2ZM6K 1ZTRA 2P9SA 5J47A 4N4NB 2JT1A 4OPHA 1IBMK 3FZHA 1WBDA 2O8CA 4DFMA 1WJ5A 1W97L 5GAEP 5CZ1A 3LPUA 1L3LA 3Q0UA 2VYPA 2HOAA 4FL9A 2JPBA 2Y1JA 5JLHA 1T8EA 1WJAA 5IP9J 3BCAA 4UY8I 1DPRA 2HTSA 3K2PA 3A4CA 1FMWA 2JPCA 4KB1A 1KU9A 2F8SA 3KK3A 3H3ZA 3HSRA 3S1RJ 1YW7A 3MZ8A 3L2VA 4CZJA 4KUMA 4ZYHA 4U7DA 3FM5A 5K5QA 4CHNA 4PJMA 4R5PA 1EV7A 4FM0A 3OBWA 3THYA 4FJXA 2WFBA 1E0EA 2GBYA 4G9YA 4CO8A 5KGWA 3ZETB 3KK2A 1ATNA 3CLQA 2E7XA 2L9NA 2RC4A 3AKZA 1A31A 4LIVA 4CK3A 4KHYA 2EINH 3TU5A 4X62K 2Y2ZA 1VQMN 3KTQA 3MQ0A 3J7YJ 5KHDA 1MJ9A 1ASUA 3RKQA 4DSKA 2RDPA 2FRHA 4KISA 4CJ7A 3BJ6A 4KN7X 5L3BA 1RT4A 1R22A 2NRTA 4XL9A 3PFIA 4JK8A 3WODF 3NGYA 3LSMA 4DR3K 5L3DA 3A5OC 1PP7U 4WYBA 5BN8A 4CJSA 3ERED 1C0TA 2HMIA 1NBWA 4FJIA 1HDPA 3LSGA 2VJIA 3NF7A 4WF9L 1ZQ3P 3TANA 4CESA 3OYEA 5FKNA 2D4WA 3RDIA 1TK5A 4A5NA 1FP2A 3AG4H 5LHGA 3GZNB 1RGIA 4BS9A 3G0ZA 3NHGA 2VE9A 1K73O 1IN4A 2BE2A 4FWLA 5E1XA 3HTSB 2ZJQF 2FD5A 2B6AA 1YJWI 5HDKA 1UB9A 3ZQFA 1FK9A 1TUUA 5KRSA 2NYXA 4PA1A 4CJRA 3IUCA 1ZBSA 1BI3A 1J53A 4HQMA 2D0AA 3ULEA 3RRGA 3ZSXA 4CIGA 4P1WA 2L7MP 3RRHA 1CZBA 1HQCA 1VQNI 3EZWA 3W3DA 3RYRA 1DGWY 3ZQQA 1B8IB 1KQ9A 2HDWA 4H5TA 3CPWM 5C2DA 3S14J 5SWMA 3K69A 1YW8A 2BBYA 3A0BC 2E8AA 3JTGA 2KLAA 4JKFA 2IC3A 5EXWA 3VENA 2VJJA 2Z1JA 1F4KA 3G1MA 1RESA 2P6SA 3RZDJ 3FZFA 3N4QA 4K42A 5AQSA 1IRXA 4LFCK 3OIPA 1BC8C 2GQQA 2CW8A 2B63J 2NVQJ 1SQKA 3UKGA 1ITGA 3AVFA 2V51B 4YOVA 4BRCA 4DU3A 3EE9A 5ED4A 1WSGA 1QSSA 1V54H 3H3UA 1BHLA 3CCUN 2V7FA 2VI6A 1XQSC 4H0XB 4CBWA 3Q9SA 1SFOJ 3O6WA 3HL8A 3OYCA 4BHPA 4FWRA 2NRRA 1JLGA 3AGRA 1DQUA 3G4SI 2XV4S 2UWMA 3R4KA 4PJNA 1KRPA 3ENOA 5CYMA 4KTQA 4IOAL 2HVRA 1JXSA 4JKGA 3TPQA 3K6GA 4PJ0C 2L7FP 4B43A 3MN9A 1WGXA 5EF6A 3GCMA 1U5TB 1XC5A 3MAJA 3VQAA 1KLMA 2P9UA 4DQSA 3VF6A 2CUJA 2EX3A 1GLCG 2QQBA 3DTEA 1JT6A 4M73A 4ESFA 5EGOB 3Q5FA 5K7FA 2BGCA 2DPDA 2GX9A 4RW8A 4DV7K 2ZNZA 5KRTA 3AVAA 1IN8A 2NVXJ 4H0OA 4LG3A 1HBXG 3BF3A 1YG2A 3T8RA 3FXQA 2E1CA 4A3BJ 3EN9A 3LANA 2D0PA 3NEUA 2V9KA 3PIOL 2P9LA 1S22A 1XCBA 5F0HA 2CUEA 2CV1A 4I76A 4WF2A 2QBYA 4MQ3A 3OYIA 1VQ4I 1R5GA 3KKRA 3MAQA 3OIOA 1MNDA 1VQON 4HA8A 2GXAA 3BR5A 1JUMA 4DSEA 4GMJB 2M87A 5D6FA 3KP6A 3PFYA 2VONA 1EXQA 3HHHA 1OISA 2OZSA 1HW1A 3LSTA 1WSEA 3C2GA 4ZYEA 3FHZA 1RDWX 1D1BA 2UUCK 4WCEL 2PZSA 2FF3B 1BI2A 1SD7A 3QYEA 1R36A 3Q9VA 3BY5A 4DZPA 3PUBA 4CZIA 3LSHA 5FFXA 5D4SA 3HOTA 4Z4FA 1SEUA 1K4TA 4YNQA 1EH7A 4W5TA 3PL8A 4BY1J 2JJ7A 3AO1A 5JLFA 3B73A 3HO1A 4DV5K 3QERA 4V19S 1Z7LA 2GWKA 5GPAA 4FK4A 1Z67A 3B6OA 1YQAA 1WNSA 5K14A 4JKEA 2EV5A 2XRLA 3SQ1A 2HHUA 3U3GA 2MG4A 3HJEA 5F0FA 4HUEA 1U2VA 2UUBK 3PQJA 1VQ9I 4I98B 3I0RA 2L5QA 4JKBA 3D7EO 5K1YA 3BTCA 3LSIA 4G7OF 3FZLA 4B3SK 3O1BA 4RA2A 2IRFG 3C0BA 4I02A 3IWZA 1A36A 3M3ZA 1J5OA 1TBXA 5KCMA 5ILVA 1VRTA 1BU6O 1KQ0A 3QU6A 1GLBG 3FXKA 4LK0F 2QSFX 4CEDA 4L9NA 4Y7NJ 1ZK8A 4QS9A 4XOTA 4A3FJ 2NZTA 3E1YA 1K9MO 3SJJA 4KAZA 4I99C 4UUVA 4RG8A 2NOJB 4QS7A 4YG2F 1DLOA 1IRGA 1R9TJ 3VODA 3HVRA 4I09A 1O3TA 3KEYA 3U9DA 1FBSA 3VOEA 4KHQA 1YTYA 5FPNA 4XIDA 1S72N 1Z3YA 1ZBHA 4MIMA 2KW4A 4IHXA 1WSUA 5GTHC 1ZYRF 2I7NA 2WONA 5B1AH 1YHQI 1FJLA 4NHJA 1WJEA 3OS2A 4W5NA 3L3VA 3TP0A 4B08A 3ATUA 3J80Z 4JS4A 1QRYA 2G8FA 3J7YP 3B8AX 1K7AA 1R23A 5ILUA 3OYAA 3FBIB 2FQ3A 4IO9F 1ZG1A 2W82A 2EZLA 1LWCA 1J2XA 5LEKA 3NAUA 3SUPA 1BR2A 3CFOA 4CJPA 4Z4EA 1ETWA 3O9QA 1FJGK 1LJ9A 2E60A 2P4WA 4P55A 3LPTA 4HV5A 4CHPA 3ATVA 1V4RA 2QQAA 2W24A 3EUHA 3IP4B 3BLYA 1TWFJ 5K5RA 3HTVA 2JRMA 1DP3A 3F8NA 1Z6RA 4W5QA 3WGIA 4DR1K 1B1BA 4N4OB 2Y9ZA 4A3KJ 1TWAJ 1U3EM 1RT2A 4GY2B 4B1VA 4CZMA 3HRUA 1U5TA 2VASA 3MN7A 2QKBA 4UHTA 4D9JA 5ADXA 3SUQA 2XC7A 5FLXK 3GTKJ 2BYVE 1VQ7I 2AP1A 2O4GA 4B8CA 2I5UA 3K70C 4YFUA 1RBUA 3JSMA 2QXLA 1S1WA 4CZHA 3ISPA 1TT5B 3H0GJ 4A3JJ 3VQQA 3ZSYA 3D6RA 4J2EA 3DXMA 5IY5H 4S0HB 3ZEUA 3WXKA 4BR2A 9ANTA 2HHTA 3OMYA 2E2QA 3CP8A 2E1ZA 3DRSA 5CYVA 5BPMA 2G0EA 2ASOA 2P9PB 3S3OA 2CRGA 2UXNA 1U8BA 2GM4A 1T3VA 3CCUI 3NH0A 3BJOA 3KCCA 3W6VA 1GLLO 2W00A 2PMZA 1WOQA 5M1FA 1LFBA 1NM1A 1ILYA 1K6OA 1MSEC 4LD5A 3BR6A 3CUOA 4G6TB 3U3YA 4I6MA 1XX5A 3F8MA 4K8XA 3H1CA 5F6FA 3CMEI 4HUGA 5IT9O 1P7IA 3KPHA 3MWPA 3AVKA 3OV8A 1SC7A 4HX4A 1TP4A 1YUWA 4MFDA 3MECA 2V6CA 3KIOA 1HX1A 3NF6A 1N8RO 2FBIA 3E6CC 4CEEA 4CGGA 3TI0A 2MGQA 4B3TK 1UZCA 2E6MA 1L3VA 1Y1VJ 3VDXA 2JWKA 2UXXA 1HJOA 5DTDA 2UXBK 3SQ4A 1GLDG 5HLTA 1K8KB 2ZGZA 4UUTA 3AL0B 4FLUA 3LA3A 1XGMA 3JRDA 4JNEA 3BT9A 2XPWA 4H8KA 4A0YA 3CC4I 4D0PA 4YORA 1TWCJ 4CJWA 1S7OA 1JLQA 5MLCQ 2HVQA 3LM2A 3LL3A 4B9NA 4MLEA 1SD6A 4FWPA 3L1PA 1XNRK 3D5RC 1BI1A 1FTZA 2RF2A 4QS8A 1QQIA 2WADA 5DM7F 4O44A 4MLHA 4XKVA 3AVMA 4RTFD 2VQEK 4ZTFA 3I0TA 4OLBA 2YHXA 2HOTA 2O03A 3AVLA 3J8AA 1IGNA 2VQHA 3FKJA 5HDNA 2NNYA 4DR7K 2IJLA 3K4MA 3ITHA 4HVJA 2RQPA 5LJWA 2P1JA 5E1ZB 5FLXO 3A8YA 2MYSA 4AWXB 2YUSA 1D9DA 4KPYA 2DYSH 3SZTA 3AAFA 4M63C 2R7YA 2X85A 4CJ3A 2RAEA 1CF7B 3MCAB 2VBZA 4GVEA 2O8CB 3QP5A 5HDGA 2ZJQL 3WQTA 1CQTA 4KFCA 3H3NO 3AA5X 1JXEA 5LY3A 2A1RA 3O9SA 3DXMB 1XGNA 3O80A 1OFCX 4LMYA 2OZUA 3B6PA 3PX0A 3I5UA 3FXLA 1YITN 1NK7A 4U87A 1B59A 5E3OA 1V4TA 1JUSA 3D2FA 3M5RA 1A35A 4C30A 3LA2A 5HLGA 2DI3A 4BRHA 1RDAA 1MJBA 1RUNA 1R00A 2CYYA 4F3QA 1ZBFA 3QEPA 4FQGA 1VQ8I 3T1AA 3ERMA 2K7LA 3G1OA 4RAGA 3V42A 2ZXIA 4E4HA 1JKHA 3KLIA 3ULEB 4A57A 4EZ9A 3DV8A 4NCGA 4CK1A 1X3MA 3OOUA 2QSHX 4IXCA 1WJBA 1XB4A 3OYKA 1Q82O 2DK8A 1C6VA 4A6DA 1IRZA 1M1KO 1VQ8N 5AQZA 1JKQC 3K5NA 4RDUA 2FF4A 1OLTA 2A3SA 1WQ2A 5CHIA 1F43A 3NGIA 2HSTA 5FLVA 4JOMA 3H3VK 4BRKA 4DB3A 3O4WA 5BR9A 5BPIA 3AY9A 4HNUA 1TQMA 5HS8A 4BQZA 2DA3A 2F4OB 2ZJRL 3LAJA 2TDXA 1TQIA 3Q0VA 3PX4A 1QE1A 5AQJA 2DOFA 1MWKA 1FNNA 4XR6A 5EY4A 3G4SN 5JS1A 2O5RA 4C2TA 1E3OC 3I53A 3MZYA 3DI6A 2Y48A 1C0MA 3I4NJ 5E3LA 1Y39A 2PMZN 3CJQB 2FBHA 1D8JA 1BW6A 2I10A 2LY9A 3FMSA 5TRDA 4F4KA 4M74A 4YFXF 1A6IA 1FP1D 3BR2A 1HKGA 3WEEB 1JLFA 3P9IA 2LREA 1OQYA 3HOWJ 5TGTA 4NC8A 4A0XA 1FIAA 2Z3YA 3GTMJ 2YJFA 4IRHA 1T39A 4CJQA 3NH2A 2Q31A 3QP6A 1XDUA 4CA0A 3EYYA 1JJ8C 1HF0A 1RDDA 1AA7A 4Y3OA 2JGUA 4OJRA 3TSPA 3F73A 3DKXA 3LDPA 4OGCA 4K8ZA 2K9MA 2CH5A 2HTJA 1J75A 5KI6A 3ULDA 1Z6TA 4P96A 3BCBA 3F3XA 2K5CA 4CYCB 3QLHA 1N33K 1ZRFA 3PNTA 4V2FA 4FOEA 2BHYA 2F5DA 2P7CB 5KQ8A 2DFEA 1PYVA 4B9TA 3V8JA 2R7SA 2J5PA 2CU7A 3SYTA 3SAGA 3T19A 3HGYA 4Y1CA 3V9WA 4DTMA 3VWBA 2OPPA 3OYMA 1X9JA 1RPWA 2OZ6A 3FF5A 4BHCA 4DQ8A 1U4BA 2R4GA 3L4QA 1X9SA 3V81A 4DSFA 3HM5A 1IV0A 4M45A 4XLEA 3RIRA 3V8LA 4XSZF 4DQIA 4BXFA 2Y0SN 1U8RA 1NGJA 4KMFA 2E7WA 5TISC 1STZA 2WV1A 3R60A 1EETA 1QQOA 2BY3A 4WQ5C 1WB9A 4DFPA 3VF2A 4N9HA 4XKBA 3N4MA 3S2DJ 1D8YA 5B1BH 2HF3A 2E4LA 1C1BA 1HKBA 4B3XA 5HLFA 4H4MA 3R61A 4GYIA 2K9LA 3UKUA 2ISYA 5D5XB 2WAQN 3JXUA 1ACIA 4O5VA 5GAHP 1U45A 2E1MB 2VJ5A 1QZ6A 1PJRA 1FIPA 1RFQA 1IKVA 3Q0WA 1PUFA 4M42A 3RPUD 2K4JA 3CCMI 1JJ6C 1HPMA 4FJMA 4RMNA 1C0GA 4HBLA 5HVQC 1HSTA 4JD2A 2XO7A 4U0YA 2Z2SB 3FLCO 3FXOA 2OYQA 1OCRH 4L9VA 4CFBA 3RSNA 4YELA 3P31A 4Z2YA 3T0YA 4CD1A 1XI1A 3AFHA 2YV0X 3RR8A 5F0CA 2XGCA 3E01A 2NRHA 1S1XA 3I55N 2EWNA 2LDUA 1AOYA 4CIFA 1SVLA 4DFKA 2XPVA 1TNSA 4R8HA 3QIOA 1OH8A 3H36A 1TLHB 2BW3B 5BQTA 1E4GT 3NVMA 2B9SA 4DLGA 4G9ZA 2OQGA 4OGEA 1P90A 2DMPA 1SFKA 1T03A 1NK6A 2ZJPL 3KFWX 1BL3A 4FWMA 1H9TA 2JRTA 3QEWA 4B48A 5GINA 3GTOJ 2XF7A 1RDCA 4O5FA 4W5OA 4M3WA 1VQLN 4LLNA 3WXMB 4A69C 4FX0A 4HLYA 4N56A 4F55A 3TOBA 2LK2A 4I6MB 4AHRA 2PN6A 3DKYA 5AQYA 2KZVA 3CF5F 2IIRA 1YJNN 4IVNA 5IWAK 3CCEN 2AXTC 4BQNA 4BDPA 2R7ZJ 2E6LA 5KNLA 2P5VA 3HKZN 3CP2A 3KE2A 3L00A 5DD8A 2NRXA 1WKMA 3GX4X 2GWRA 2R7UA 3AO5A 3GBTA 1NKCA 3KYCB 3ZP5A 2V7YA 3FWEA 4ID5A 3JYTA 3QICA 3EUKL 3HRSA 4XLHA 2F4MB 4DIQA 3CCVN 3E0JB 4ON0A 1VQOI 4IO9L 4ISFA 2WY8Q 4DS4A 2DFFA 3GW2A 4UXNA 5AZIB 1U2VB 2R7DA 3E6BA 3TO6A 1K61A 4FISA 3RMCA 1FT9A 2DOEA 4G6QA 2ZSIB 3BJAA 4AHVA 4DU1A 4KI4A 1S7AA 4YEJA 4A5BA 3R1XA 3M8JA 5C10A 1IXCA 1OR7A 2Y31A 4A12A 3K70D 2MC4A 4A3DJ 1C0FA 2G8VA 4X0GA 2KZZA 3LNQA 4U88A 2HVSA 5AQTA 1EA3A 2DCEA 2CQXA 5JVGF 2QUFA 1QZEA 2ZO4A 3EL2A 4BR0A 3T1HK 3DLBA 3VEYA 2EIKH 1BWFO 4I2QA 3GLXA 4HPQA 2HDDA 2KIUA 3OYNA 3J7AO 2GA1A 4E1NA 2GIZA 3LFKA 3VQ6A 4CW7B 2UU9K 4CCNA 1CXUA 2GXGA 1W7AA 5JHFA 3LQRA 2Z1GA 2K85A 4XKWA 1RKWA 4X1EA 3VEVA 3HBTA 2YX6A 2EV0A 3DXJF 2IGNA 1IC8A 2R92J 3JCUC 1GLAG 4MO5A 3QQAA 1QTMA 4MEXF 2DA7A 2WC2A 1TTYA 3P7NA 5SZTA 2VQGA 4KIGA 2E36A 1RBVA 1RT1A 2CGJA 4DTPA 4M3XA 4B47A 3DLAA 3N4PA 2BY0A 2E5ZA 2CV2A 3MMVA 1T0FA 3DEEA 2IA0A 1W7PB 1Y64A 2STWA 2ZXJA 4FWNA 1RTDA 4BRMA 4IKFA 2EILH 3HPOA 1L3SA 1MD0A 4U67L 4ZH4F 4YOYA 4AYBN 4W1UA 2QXFA 1ULYA 3T1BA 3ZMSA 2Z1HA 4OAZA 2XY8A 3CC2I 1OVQA 3KJVA 2M2EA 2CFXA 4E0DA 4LFUA 3SFZA 4YHHK 3BZKA 4IQ4A 4PL8A 4RW6A 3QBWA 3SYZA 5D4RA 4IZZA 3D1NI 3EUHC 4X64K 1EP4A 2BXZA 2KRHA 1K78B 1QHHD 3SPZA 4AM3A 2YI1A 3TO7A 2DU9A 1ETOA 1U49A 1HRHA 1U9NA 2W84A 2K4BA 1FOKA 1A5VA 5M1NA 4GV9A 4NBQA 3CCSN 2BDPA 4DCHA 4ELTA 2JVGA 1XHXA 4OU0A 4O4GA 2XKOA 2P0WA 4RGUA 3M3YJ 4ZTJA 3LM9A 3OTOK 2V26A 2I7PA 3SXYA 2W6KA 5JVGL 1ZHFA 4CIEA 3HZ6A 2FX0A 2O8DB 1A5WA 5BN9A 2COBA 4L9JA 5D5WB 2FQ4A 4X6AJ 4DTUA 2CSOA 3W3CA 3FHNA 2L2OA 2PJRA 3HP9A 3K59A 2ASMA 1N36K 4FX4A 4I2OA 2IP2A 1W36D 4JLHA 3DEWA 4B1YB 3LP1A 4J01A 3O9TA 2IS2A 1NJWA 1S9GA 3GF2A 1VQMI 3AVIA 2ATQA 3C2BA 4CGDA 3F21A 3O2PE 3SQ2A 4HZFA 2O3FA 1D0XA 2GA2A 4A3EJ 3R0JA 2QWWA 3WGHA 2HKXA 4M3FA 4KHNA 1TK0A 1OCZH 4ZDPA 3OJSA 3RKXA 3ZXSA 3NARA 6PAXA 3NDKA 3WU0A 5F1RA 1RILA 3K9KA 4DQQA 5J2MA 4Y1DA 1KVBA 3I0SA 4UB8C 3EO3A 3ENBA 3GOIA 3QNNA 2RPIA 3X2QH 3GE1A 4RCHA 4BC5A 5HRPA 4FJ9A 4I7FA 3S15J 1KU7A 3ZMUA 4GNIA 5AZIA 5TKYA 1SFEA 1SKWA 1NGDA 3N05A 5E3NA 4D1QA 4HYEA 2QENA 1GOCA 1O7LA 4Y4RA 5HBMA 3S1MJ 2E1OA 2CQQA 1APLC 3RSEB 4DKWA 5M1OA 3PIPL 2BH1A 1IH7A 4BRPA 4DTJA 3GTQJ 5EZHA 1XSXA 1ETXA 4MQ9F 4C1NI 3J81O 3TP3A 5AQWA 1IG9A 3VQ4A 1ZREA 5JLWA 1MBGA 3SNNA 1MGTA 4M7XA 3K4KA 4I0BA 1UHMA 1BI4B 2ZKZA 3UKUB 2M9HA 2QWOA 3SFIA 2X6OA 3CJBA 5BRDA 4ZZDA 1RC9A 5JS2A 3C7JA 5LD2C 1R71A 1W5SA 3S3MA 2O8XA 2HR3A 3GFMA 2UXCK 2HBKA 4EAHD 4H4KC 1JKOC 3IL2A 1NMNA 3G10A 2FNAA 3ZSZA 3T7ZA 3HJFA 5C0YA 1ZGWA 4HHTA 2OZMA 4I6ZA 4FT8A 3WTVC 5C24A 4PWDA 2B0LA 2QWMA 2M4KA 2A6TA 2YKMA 4G1QA 1O4XA 2P9KA 3R9PA 2W48A 2Q1ZB 3ZQ7A 1BGXT 2VQCA 3BF1A 5EEGA 3OYDA 4CZZA 3JR9A 1J5YA 4CDGA 1G59A 2RV8A 2O6GE 1D5AA 1HYZA 2MH2A 1KSPA 1FSHA 2HBJA 2EQRA 2FSWA 3HYIA 3SBTA 4XKCA 1NHAA 4YDUC 1S5JA 1T98A 4BY9C 2ZMEB 1XS9A 2HNHA 4TV7A 1U6GA 3CJ7A 2YJEA 3AV9A 3CJNA 4F93B 4B1RA 2JA6J 1YTUA 3ABUA 3M6GA 2E2JJ 4MO7A 4QAGA 4OIOF 1OR7C 1WUAA 3WE3A 1EWRA 3AGKA 3ZMDA 4BC4A 3C3WA 3G1LA 1LDJA 5FKLA 3ZSOA 2MA3A 2KZGA 5T7BA 1FYLA 3LSJA 4OIPF 3U1KA 2F48A 4QTRA 4IHSA 3AVNA 1IV8A 1YIOA 3SZPA 5IP6A 5LFAA 3OYHA 4L0ZB 1WH7A 3B02A 4RB3C 1VQ6I 4Q5SF 1C1CA 2QTDA 3S2HJ 3H45C 4XM3A 3V7RA 4KN4X 1BUPA 3O4NA 4DMNA 3LWLA 5GAEJ 3ABMH 2QWLA 2GZWA 3I8BA 4CGHA 3TKYA 4QPOA 4E3SA 2VODA 3S17J 2IS6A 3REOA 2VKHA 5C15A 4B3OA 4A2UA 3UKRB 2FNPA 3DWLE 4O8KA 2DA5A 4FM2A 1FPQA 5C44J 1R5ID 2LY1A 2LBFB 3LP3A 1BBYA 5J6XA 2X4HA 3CESA 4J8FA 1DGRM 2K40A 3RYPA 2XHKA 4IEJA 2DW4A 4KIFA 2KKOA 4ELUA 2O8BB 2C6YA 3R6SA 1NGCA 4EP5A 1NMDA 2MC3A 1X1AA 5FD6A 4AILC 3WG9A 1OJLA 4AYBA 4AIJA 2KISA 2NS0A 3RKWA 1QZYA 4M72A 3MEDA 1VQPN 4MFBA 2R7FA 4OIRF 1ZLKA 4NB4A 2R5ZA 5AONA 3S9HA 1TK8A 4F2RA 4CZLA 1FYMA 1Q9YA 3LAKA 1T08B 3KP5A 5HOOA 3L09A 5ILSA 4H4OA 4OPAA 4WFBL 1YJ9N 2EPFA 5E26A 3O3KA 4NUBA 3E9LA 3OYLA 2H8RA 1Z9CA 4BAYA 4MDAA 2IGOA 4II3A 4CF9A 5J2PA 4BRQA 2ECCA 1VQLI 2G8KA 2RHKA 2LR8A 5AZJA 1UA1A 1TWHJ 3CDLA 3VSLA 3M07A 1IJWC 2ZD1A 3EYZA 1LV5A 4C8KA 1WBBA 1HYVA 1K4SA 4LIUA 5F1JA 4L3QA 1VQ4N 3PJRA 3MKYB 2J5OA 2KHMA 5HLHA 1ZLJA 2YX4A 3J7ZI 4OO1J 1XCVA 3ASOH 4EATA 1YF5L 4PFOA 3KK7A 3VQ8A 4CF2A 1XGSA 2KQRA 2EK5A 1S9HA 4WFNL 3CC7N 2IGMA 4F91B 2ESNA 4DV4K 1M1EB 2QYOA 1B9MA 3SJHA 2KFNA 4Y33A 4BG9A 2EZKA 1JTXA 2XF6A 3TAMA 5AQKA 4FJ8A 4QWQA 1BA5A 3ESWB 1KYZA 2BOLA 3ML6A 3S1QJ 3BTJA 4M3TA 3K1PA 3IG1A 1X3UA 3OWTA 1D9FA 2K86A 1UHWA 4RM3A 1T6DA 2IVOA 2OTJN 1H1VA 2AS5F 3MXIA 5F04A 1A5JA 2P9UB 1RT6A 4JYAK 4Q5VA 1ASVA 2L7ZA 4CJ5A 1HNVA 1IAWA 3TTDA 1S1VA 3PO4A 2DYRH 3QEVA 1J0RA 2UUZA 3F8FA 2JVHA 3Q3SA 1GVJA 2VT2A 5DMRA 4L5IA 1LW2A 3CCMN 3A01B 2LC2A 4DV2K 3FM3A 4F9OA 1HNXK 4A5AA 2JSCA 3E97A 3EUAA 2P9IA 2X48A 4E1MA 1X4OA 3BPXA 2N8GA 2XKPA 4RAYA 4RWTA 3EY1A 3OBYA 3MWMA 2LF7A 1Y0NA 4O8UA 4J2DA 2I8DA 1QU3A 1OYIA 1MBKA 4DUYK 3HOZJ 5FO5A 1TUYA 1X9WA 3GO5A 3GXOA 4IG3A 2W4SA 4PKGA 1B92A 3CETA 4I2PA 3HXMA 4M3YA 4CERA 2O7OA 4KFBA 3AG2H 5LHHA 4OVLA 2V1XA 3Q7BA 1S72I 3F23A 4CCKA 3V9XA 4UUSA 3UR3C 3TAQA 4IFYA 1HR0K 1OH6A 4DW6A 3HSCA 1VSIA 3ZT3A 4GDFA 4H5WA 3EKUA 4LGWA 4F52A 4UB6C 3HBLA 1U9OA 2RREA 3ZMZA 5EDNA 1DTQA 1SV5A 2XSJC 3OR1C 4GO1A 3HOSA 2VOOA 3C65A 5EOYA 4B8AB 3HHGA 1Q1VA 3ASMA 1ON1A 3GFIA 1YVUA 1D0YA 3H92A 2EIMH 3IS9A 1ZRDA 1IKYA 2VGMA 4B1XB 2EHGA 2KLOA 3ZETA 1UAAA 1NK4A 3GVAA 3OY9A 2ETJA 4CJTA 2LSOA 1XN7A 4GRIA 1JI8A 4TSXA 4QLCU 2CV0A 3WNEA 1KU2A 4HEA2 1GV5A 2P9NA 3H08A 3RR7A 4FK2A 2KFZA 1B9NA 4DV0K 3PY8A 2RVCA 3DWLA 1JKRC 1WLJA 2YKNA 2AXLA 2ZF5O 4B1ZA 5F1XA 5KPRA 4DF4A 2Y75A 5M5YJ 5EG0A 5LEJA 2F4IA 1W7PD 2E1NA 3CD6N 3SV4A 2V6EA 4BRAA 3HEFA 5GIPA 3CJCA 3ZCMA 3T1YK 2VXZA 2R7OA 4CCLA 4EGZA 4Y0WA 3DLHA 4RS8A 3SQNA 3EPZA 2FBVA 5IT9Z 4RBOA 5B8HA 4IHYA 3MKWB 2GUIA 4JP0A 3G71N 4CYCA 4CI6A 4JRQA 1ZGAA 4XSXF 3PO3J 2X1CA 2XB0X 5M3MJ 2FSJA 3O8HA 4ILHA 1HC8A 2GEMA 5F64A 4BRDA 4IQJA 3J7ZO 5BR8K 4BEHB 3M4OJ 2V1NA 4IFEA 4FYDA 5DEQA 1CXQA 3L8BA 1GT0C 5BMZA 4WQ4C 1E3PA 4H0VB 3JTHA 2L4MA 4F3TA 1WAFA 4ZZLA 4XN3A 1U5TC 4BHBA 4EVIA 3CFRA 3G25A 1YJWN 5CQGA 4UNOA 3LDQA 2K3PA 2E1MC 5BNGA 1P6RA 1S8NA 4BJTA 1EX4A 4C8LA 1A5XA 4BVOA 4IHVA 4N9IA 4C8OA 2R7QA 4YOUA 3NGZA 1XMKA 2EIJH 1O1WA 4NXNK 4LH5A 3PIOF 1WSIA 5JMVA 3F22A 4XH1A 2L01A 3DKWA 3HGGA 1NK3P 1BQMA 3C94A 3DMJA 3KKSA 4OLAA 3E5QA 4MO4A 3CD6I 4XRFA 3S3NA 5JVHL 2MSYA 3TO9A 4FASD 1WH5A 4N5SA 4OIQF 2M45A 5B66C 3A02A 4BE1A 2F7TA 4DFJA 1VQ7N 1YRNA 3M8QA 3QB0A 3I4MJ 2A41A 4N47A 3SZGA 1Y97A 4FXDA 2VUMJ 3MXMA 4L8RB 5M5WJ 3RKYA 3E5UA 1SANA 2P6TA 4LSNA 3NWTA 5BOXA 1LEAA 3H9JA 5F08A 1VQ5I 5E8GA 4ZDOA 2R5YA 4DQRA 2LF8A 1L3UA 3RZOJ 1RDUA 1KONA 1U2WA 1ZELA 1YTAA 2PFBA 5ICCA 2P9KB 1Y8QB 4C2MJ 4AIDA 3HZJA 3MEXA 3J81K 3MFKA 2Q0OA 4CGZA 1HLUA 4J2AA 1LDKB 2IAJA 4FJLA 4A0ZA 2CH6A 1Q18A 5DK5A 1YT3A 5AQHA 3SDGA 3TSQA 3VERA 3ABLH 3ZT0A 4HUFA 3K2ZA 4BY7J 5E18F 5AQPA 1N6QA 4AIKA 4DWIA 1YS6A 3VOVA 2ZMEA 1ITYA 1FXXA 1R4MB 4CHOA 3CG7A 3MX5A 2F5FA 3MN2A 1LQ1A 2QW9A 1UCRA 1U78A 1IRFA 2OU2A 3M8EA 3SEQA 4J2BA 1OCOH 2QI2A 2CS3A 5AQLA 1XC3A 4FJJA 5CQEA 2ELHA 2WBMA 3HRGA 4BC3A 3HTUA 3JW4A 2FJ1A 4NXMK 1O57A 5J4YA 1N34K 3OYFA 2XY7A 2MABA 1IKWA 2G7UA 3BZCA 5IT3A 3DXKA 2HQ5A 3RPQA 1TC3C 4KV8A 4R1HA 2K9SA 2F8TA 3CFPA 2O9LA 1XDSA 4Q4ZF 4C9YA 1C1AA 4A61A 3VQBA 3IKMA 1SFUA 4CF0A 4Z4IA 4OAYA 2A42A 4JI6K 3F0CA 3FISA 3WHCA 3MZHA 3TMOA 1NGEA 1LAWA 3VB2A 3O3FA 4MNUA 4EM2A 5AQVA 3TAGA 3N97A 4JKGB 2LD5A 3QYFA 5C12A 3PX6A 4AUXA 3M8RA 1J09A 3PUFA 3TTFA 4RGSA 3WNHA 4IJNA 1JTYA 2CQNA 3CCJI 1HCRA 2L02A 3KLNA 1MIJA 1VSDA 2UZKA 3P39A 4C8MA 5EJCA 4BR7A 1Y56A 1NGBA 2HXIA 2VPLA 1GV2A 4B3RK 2DDBA 4C3HJ 3V1OA 3QETA 5E1WA 3UIQA 5BPDA 3OSFA 2CGKA 2OPQA 1NG7A 2IBDA 4O3MA 3ZT4A 2WB1N 2LBFA 2OCEA 5H20A 3ZQIA 1FKOA 2EB7A 1WJDA 4BREA 1RZ4A 2DA2A 3HKZA 4GXOA 4NC7A 4YY3K 4JRPA 4FLZA 5J2NA 2BGGA 2OPTA 2HVIA 1UJ8A 2X51A 3K4JA 1C0WA 1Z91A 4H0TB 4V2GA 3H1VX 3H9GA 4PGGA 3TABA 4B4CA 1J6ZA 3LAMA 4NYFA 3TOAA 3KLGA 1IXRC 4CF8A 5B5EC 4KITB 2PJRB 1BM9A 2QQ8A 5H1SQ 1F1ZA 3M9AA 5EVZA 5BREA 4H5NA 1V55H 4G12A 4FCYA 3MVPA 4MEYF 4EHTA 1JXBA 3CM5A 2VT3A 1SL1A 3CQYA 1J9AA 2R7TA 3KWGA 4JI3K 1QNTA 4M6VA 5CVVA 1G8XA 4HF0A 2GXBA 1Z25A 2IPQX 4HV6A 4H0PA 2G8UA 4NLBA 2IVMA 5FKKA 4U7BA 2MD5A 2VJ4A 1K79A 1T8IA 1NGHA 5D8KB 2DPUA 3KEQA 2ZJPF 3OS0A 4GV6A 2KZMA 1GHCA 3S41A 2D1KA 4FWKA 2PBIA 3ELKA 3HDDA 3KK1A 4DSLA 2X74A 1YX3A 2HPIA 4XICA 3CUQA 1FC3A 5GP9A 2PJPA 1ONVA 1VFCA 2DA1A 1QBJA 2HQRA 2WY7Q 4FWQA 5E84A 5AFUH 3WXJA 4FJ7A 3F5TA 4WQ4A 1YITI 1IZ1A 4BXUA 2V7ZA 4XORA 1LWEA 1WAJA 1RT5A 2TRTA 3BWGA 5HS7A 2VBWA 3I33A 1HNZK 4ID1A 1IG7A 3O5BA 4WXDA 4ETSA 2PYJA 3HXLA 4UV9A 2MFZA 4AHUA 2Y0MA 3R3LA 2JN6A 4Z94A 4HX8A 2BZTA 4DOZA 2IOCA 1F9NA 4EJOA 1T44A 3LZJA 3DLLF 1MW7A 3BZ6A 1LUJB 2VIXA 3C1DA 5C4XJ 3FZMA 4AQYK 4KTZA 2KDOA 4GYGA 5IOYA 4BU2A 2ACJA 4LH4A 4DSIA 1N75A 4FO0A 4DR2K 4I9LA 5HRRA 3WU2C 3LDLA 4A62A 3W2AA 3V9ZA 3VEWA 4CCOA 4XEIA 1N25A 2Q8KA 2P7VB 1SMTA 2LNBA 4E7HA 2JK3A 3DPTA 3DBHB 3S1NJ 5EU7A 4M3RA 2BY2A 5M1KA 3AA3A 3LP0A 4XLNF 4JI0K 4MQVA 4EV0A 3WXLA 3GMEA 3LOCA 3BEXA 4CBUA 4LFAK 1IN5A 3T8TA 1MMNA 3W6JB 2QKKA 1OH7A 1Z3XA 1QHAA 3BPVA 2VCPA 2OA4A 4NDLA 5IPAA 5CYQA 3K7AJ 3SQ0A 2LLKA 1OH5A 1MJAA 4G7ZF 2KQ2A 3I56N 2QA4I 1FWZA 4UUSB 3HIFA 4GCVA 1MNMC 2VBYA 1P8ZA 4B3AA 3F9KA 2CQ7A 1ZC6A 3I58A 3NF9A 1GOAA 2LFBA 2XAHA 4BVPA 2AQEA 3AVBA 2QWQA 1NGIA 2CH0A 1CLQA 2HFHA 4RAZA 4JK9A 1ZN2A 4JI1K 2G8WA 4RGXA 1TYQA 4EMSA 4LF7K 3AG1H 3LWFA 1KQ8A 2B4JA 2ITMA 2FU4A 1S7EA 1FOYA 4CUGA 1TQPA 1MMSA 1VSMA 3IC7A 4JHDA 1I3AA 2LG4A 4EJUA 1RBSA 3QAHA 2EZHA 5HRNA 4OWRB 2HMPA 2I5JA 3U8XA 3P9KA 1ZBIA 1Q9XA 4CHUA 3DPUA 2E2PA 3PSFA 1MBHA 5IP7J 3G73A 1GOBA 4IZ9A 4DGWB 3R8EA 4AC0A 1MBJA 4BR9A 4YOWA 1VSKA 5ICEA 3F72A 2YNFA 1D1AA 2WWYA 3CIPA 3HRMA 3FR0A 1DKGD 4IDKA 5FDLA 3SJMA 3VQ9A 1KXPA 5LHIA 5FPEA 1RRJA 4OINF 2JA8J 3K0SA 1ODDA 2BW3A 5LGTA 5GPCA 2H8WA 3H9QA 2ZJRF 1JGGA 1NGFA 2GV9A 3WEEA 3WNFA 2P9LB 2A69F 2EBIA 2BY1A 4UQGA 1AKHB 2HYFA 4I0AA 2QSGX 2JWTA 1A04A 3K1NA 4GFBA 3EE8A 5L3GA 2HHQA 2WAQA 3QU3A 4GW6A 3FMQA 3LAPA 1BJAA 4KHSA 4ILGB 3ASNH 2CG4A 2DLLA 3MN6A 4N76A 4BEHA 1WZ2A 2DXIA 3F6VA 1VHXA 5BPNA 4CGJA 3VGLA 1BO5O 1K8KA 3KLHA 4KDPA 1KGSA 1WVRA 3CQZJ 4HNTA 3FK7A 4FE4A 4PUOA 4CJFA 2EFQA 1P7JA 2JSPA 4DZJA 3V4GA 1MMGA 5J1EA 1NK0A 2PAVA 4N0BA 1S9EA 5BRFA 1LDDA 2FOKA 2A6EF 3JAMZ 3CTAA 2E2IJ 4JKCA 3VQDA 4OKJA 1QPMA 1MNEA 1X58A 2R7WA 3DF8A 2BXYA 4RB1A 3AL0C 3AARA 3E66A 4FW2A 4AHCA 3THYB 1NKBA 4CJLA 2VWKA 2QEXN 3SDBA 3VPRA 5M5XJ 2KL4A 3K4NA 1CZAN 2P5GA 3DLEA 2HHSA 1R49A 2HVHA 4LFBK 4HF2A 3BP8A 5AQMA 3BR3A 4KREA 4YIRX 1FYKA 1WI9A 1VF9A 1X2MA 2ZE2A 1I3QJ 2ESHA 4MLOA 3LSPA 2NAZA 3BG5A 3CCSI 1DU0A 1TKXA 4X65K 1MU2A 3NWSA 3CHWA 2V1UA 1R1UA 3CMAN 3E6MA 4JYKA 5HS9A 3VFZA 4KKOA 5FPMA 1R59O 5KTQA 3CZ6A 1RTIA 1QVGM 5B3SH 2HHHK 3QPHA 3WGGA 2H27A 3K10A 2QF7A 1RCHA 5LJVA 3C7NB 3E3VA 4JV5K 2ZGYA 2Y0SA 4XNFA 1TZLA 3FDYA 3BG6A 1FZPB 1NGGA 3DU6A 3A01A 1JLAA 3GL1A 3ID6A 2ZBKA 4ZYDA 2CW7A 4ILJA 1MMDA 1PDNC 4CJUA 3EEQA 4ASNA 1TV6A 2FMYA 2W57A 1MDMB 2KKZA 4OKEA 3KETA 4DQ2A 3VF4A 1NJYA 4XONA 4XRSG 3QPSA 2M5WA 4ISGA 1VQ6N 3VQ7A 3W2WA 3FXRA 3KYDB 3CJRB 2BVLA 2FOWA 4IF4A 2YU9J 2Y9YA 3S8PA 1BW5A 4KMUX 2OD5A 4BYYA 1KVAA 4GKJK 3E5XA 3O8MA 3ZLJA 1X4PA 3CO6C 4A3LJ 4BDYA 4CGFA 4DU4A 1A6QA 2LKXA 1V5FA 5E79C 2QK9A 4L0YB 3BG7A 4O55A 4H5VA 3HUGB 1HJRA 3HG9A 1HPZA 2KFDA 4HCBA 1QVFM 4CJKA 4OPKA 1IW7F 1MH3A 2ZFWA 4ZC3A 2CWEA 3ZQCA 2VGNA 2YHYA 4E89A 1SVMA 3K1MA 1O3QA 4ENKA 2ADUA 2O0YA 3GUDA 3K0LA 4JEPA 2PBDA 1OCPA 4ZYGA 2XRIA 3NAEA 1NK5A 2JA5J 2HZTA 1LEBA 1ZBUA 2WBNA 1ATSA 1TWGJ 3C18A 3H46O 4CJEA 2PX9A 1YXQA 1NJZA 3KZBA 3QIPA 3ABKH 2OJED 3CCYA 3M1EA 3KLOA 5K7HA 3V9UA 1ZYQA 1VQNN 1G3YA 2HBLA 3GZ6A 4CF1A 5J8FA 2R5YB 5J1UA 3DEUA 4P9UA 2D1VA 1ZKGA 3G3ZA 1SUQA 3VGKA 2FE3A 2Z9OA 5LGUA 3EETA 3L2CA 1DPUA 1G3SA 2XIGA 4MFEA 4LB6B 1X3WB 2JA2A 2YNIA 3F9MA 2P9PA 4DSJA 4H0YB 1PUFB 3M1CA 3GTJJ 3SMSA 3HOUJ 4M9SA 1R5HA 4DF8A 3PLAA 5HLIA 1D5YA 5E3MA 4Y52J 2HHWA 4M6XA 4F92B 3IHUA 2GBZA 1VQKN 3VYTB 1Z26A 3VA0A 3THWA 3CPEA 2W85A 5DCMB 4G7HF 2JZYA 1NWKA 2KP6A 3PQKA 4EM1A 2ELJA 2ZXWH 2XASA 3MD2A 4RM2A 5C3EJ 3CC7I 1DGKN 3O1WA 2BEOA 2Q0RA 3HSFA 2BUPA 2E2OA 4YDUA 1HKQA 3AAPA 4Z4CA 2O4IA 2KRCA 3CCLI 4HQEA 1R0AA 3MKLA 5J2QA 1FOWA 4E7ZA 4GGGA 1MDMA 1KAXA 4E6KG 3FE1A 2HPMA 3D2FB 3ECHA 4RGRA 1S3JA 2D1HA 3ISNC 2LTPA 4CYDA 4DBRA 1LKXA 3GZ5A 5FJ8J 5TJJA 4RAFA 4GVMA 3BY6A 3IKVA 1G3WA 2VXDA 2PMHA 3K4BA 4ABZA 2KT0A 4XK4A 3BG9A 4CCJA 3D45A 1GUUA 4CGIA 3WTZA 2VWBA 4XOPA 3TTCA 1RNLA 4RW9A 1OKJA 1FW6A 3HM9A 5IT9K 1QZ5A 1VQPI 2A5YB 3FBNB 2ASPA 1J5EK 3ONQA 1TVRA 5ELZA 1EO1A 2WTEA 4JK7A 4LC9B 3AVJA 3H3OB 1NOZA 4J19A 5CVJA 5CJ9A 3HOXJ 1TKTA 2HNYA 4M41A 3O9RA 3LQQA 2CW0F 1EQYA 3D0PA 1K6YA 3SUOA 2OA8A 1Z21A 3U21A 1D4XA 1S1TA 1LNWA 1QO0D 4MGRA 3SAFA 4FLWA 2KJCA 1J9IA 2H09A 2VE8A 3VYRB 3NBPA 3KEOA 2LP0A 4WCGA 1MWMA 4D7MA 3KZYA 3KZZA 4OKKA 1R58A 2BTFA 1X19A 1E17A 2B7EA 5TKWA 3K58A 4B9VA 4HNVA 4BGDA 5L3FA 4D7NA 4BE0A 2DJIA 3IV5A 4A59A 2GAUA 3SV3A 3CCRN 5DM6F 3L0QA 2L9RA 3CUQC 2A07F 1YIJN 5D3GA 4IWVA 4I01A 1YRNB 2Q36A 4IBNA 1T0FC 2A6AA 2GWJA 4KICA 3RMBA 1U48A 2IW5A 1BA1A 5A2QO 5LRSA 1KD1O 5DUKA 4AH9A 2ZWHA 4PSWA 2M34A 3AG3H 2IDOA 1G2HA 4PY5A 1WJFA 3ZX0A 3WTSC 5JR3A 2PMUA 3D2EB 5GAHJ 3E1SA 5LBQA 3P4IA 1G4DA 4CHZA 4JI4K 4YIIA 2NNWA 1W7PA 5EEAA 3WTYC 3ZN1A 5F2RA 4EHUA 3THWB 2FBYA 3IWFA 3HPHA 4BJ6C 1X3NA 3TARA 1EF4A 5AQQA 1IUFA 4A3CJ 3P9CA 4CFDA 3VESA 2DMTA 2IA2A 2VB6A 3ABTA 4Y15A 5M3FJ 1W9HA 5H6QA 1YLFA 3RI4A 2CGPA 2VKVA 4WX9A 2JUGA 1UA0A 4QPQA 2DDAA 3MCZA 1IBLK 5CR4A 4Q0BA 5J8CA 2RN7A 1YJ9I 3CYMA 1X3ZB 2WUSA 3AA4A 4W5RA 3G2BA 1SL2A 4W97A 2D0BA 3OR2C 2ZC2A 1RTHA 2G8HA 2UUAK 3U6FA 4GV3A 2F4VK 5A2QZ 1UFMA 1JL2A 1LFPA 3VEZA 4A2BA 2FXAA 4JX6A 1IDYA 2IAIA 4HDVA 2OANA 5E41A 4FLYA 3ZMVA 1M90O 3J7AP 2KRFA 3TAEA 1W0HA 5KAFC 1ORKA 2ID3A 1PVEA 1SMYF 3THXB 1NK9A 4RW7A 2XUBA 2AQFA 3G71I 2FLOA 1HNIA 3CXCM 3KP3A 2F2EA 3TW7A 5J40A 3ZT1A 3C2HA 1UG0A 3I59B 4C8NA 3L2QA 3AO4A 4FJKA 2ZQBA 5DM6L 2E71A 1V5GA 2MLKA 3LMMA 3HSEA 3OL3A 1W0UA 5L3EA 3SEZA 4LJZF 2AJQA 5AQGA 1R7JA 5AIPA 1RT7A 5DM7L 1TAUA 2RGVA 2DODA 3QESA 1ETYA 4FJ5A 1Z77A 5KK1A 3DOKA 4IHWA 1OPCA 4O6JA 3OIQA 2IGIA 3AVCA 5M1QA 1B6AA 1KCFA 2WC9A 2Y1IA 1USSA 2A5WA 2FMLA 1QPIA 4YFKF 3HRTA 4KT5C 3E7LA 3OL4A 4K25A 3KYLA 3ULQB 4FJNA 2X6WA 1R6RA 2FEZA 4OOIA 5DCFA 3OS1A 4PZJA 1ASWA 3ALYA 4BWJA 3RTVA 4M9XA 2BV6A 1UHSA 2YNGA 1ZARA 3O6BB 1WPKA 3A5MC 5CLSA 4DYQA 1WFXA 2ICWG 2Z16A 3I71A 3CMMA 2XAJA 2KIQA 3FMRA 4EJWA 3GYHX 5C4JJ 4KT6A 5BS6A 2YR2A 1I5ZA 2IT0A 4LSLA 4HF1A 2HF4A 2R3SA 3H5RA 1XSDA 3J80O 1HXDA 3RWUA 1H89C 1J7KA 3TL4X 1RUOA 1RR7A 2GLOA 3FFKB 3P38A 4BROA 2DTZA 1LB2A 3NCIA 2A61A 4KJZA 2HYJA 5DS9A 2LH9A 2ISZA 3L2UA 4II2A 2Q2EA 1W36C 3CJTB 4Y13A 3PO2J 1EJ9A 2PEXA 2M3AA 5J4VA 1NK2P 4KTWA 2CUZA 2FBXA 4BWMA 4ZHRA 4B3MK 4DTXA 5GADJ 1I1SA 2HS5A 2H1KA 4FLTA 4BE2A 1REPC 2DTRA 3ZMTA 2EZIA 4U0WA 2VWJA 3VQ5A 1NG6A 1S6LA 2QKLB 4L5JA 3L2WA 3C95A 5HNHA 2O8DA 1OKRA 2O8EA 1HKCA 4FM1A 3K4LA 4CH7A 2PQ8A 2BANA 3WTWC 3WTTC 1N78A 3E9OA 3CQXA 1KFDA 2LOOA 3MX2A 3HP6A 2BVMA 4AD9A 3C7NA 3O3HA 4I9QA 3RQ4A 4BQQA 2IXSA 4D5CA 3OYBA 4Z6YA 4B9QA 2UXDK 1L5UA 5M1PA 5E8IA 4OMYA 4XN0A 1NH3A 1SD4A 4IDHA 1Z0XA 3TWHA 3L9FA 4H03B 4HRIA 5L3CA 4B9LA 3HC7A 3WT0A 3QEIA 3VQEA 1P4WA 1D0ZA 2OF7A 1TW3A 2V52B 3IRXA 2XAUA 4NC6A 4DR4K 1XSVA 4DTNA 4BACA 2GELA 3CC2N 5EGOA 4B09A 2RN2A 2OCCH 1FBQA 2DA4A 2M4GA 3ZSVA 2OC6A 4XLFA 3TDUC 3LDNA 3NF8A 4IEIA 4UV8A 2NUBA 1B8IA 2A6HF 1HW2A 2WOMA 4DHYA 3IRQA 2DOAA 5LGNA 3F2KA 3JSPA 1TL1A 2O8FA 2CFOA 1QSLA 4F2SA 1T56A 1LCUA 5GIOA 5LLQA 4CEAA 3P5JA 4DS5A 1XNQK 1IV6A 3IMXA 3DRRA 3JAMO 1Q81O 2WA0A 1JHHA 1JCEA 4ENMA 3FGUA 2K02A 3CUQB 3CCEI 1YS7A 2DQLA 1SAZA 4M3EA 4XMYA 2Q1NA 3M8SA 1SKSA 1T6CA 4BBRJ 4BJ5C 3VMFB 2M0CA 1VTNC 1ETQA 3MDQA 1E3HA 1LVAA 5F27A 3MK6A 4ISEA 5AQRA 4CEOA 3PSIA 1J54A 4PKIA 2X6YA 1XUPO 3CCLN 2A05A 3WUHA 1ATRA 1BIZA 4M9ZA 2FBKA 4S04A 4X66K 1C0UA 2ETHA 3CJ9A 3BR1A 5EG0B 4J00A 4FJHA 1H88C 3RPUA 3SZ2A 1S3XA 4PKHA 5CZ2A 1QVUA 1OYWA 4U0VA 1VSLA 1OVYA 2FC0A 5FPDA 3LSRA 1USTA 3AAQA 3S32A 2HOSA 3E6DA 4DJAA 1DUXC 1J59A 3MXJA 1LE8B 3B6CA 2WTUA 3CQ8A 3VYUB 1G99A 3IDHA 3FIWA 3ZX3A 2FUG2 3ZSRA 3LDOA 3HM8A 1KFSA 2COMA 1Z7UA 3L7WA 3JRIA 1UWBA 2NS8A 4AF1A 1U0JA 1SZ2A 2HNDA 4BBSJ 3MWTA 2EA4A 3TQNA 3KP2A 1B72B 1T2KA 2NRZA 3HSTB 5BPLA 1YE9A 1GXQA 5FKMA 3V1RA 1HYSA 3JRGA 2G9WA 1NNEA 3V7CA 3NVKA 1UAXA 3DLRA 4G94A 3QFUA 3M8FA 1K83J 2LVSA 1ON2A 2JA7J 5E17F 2W40A 3VPZA 4EP4A 1UG2A 1I27A 1HQEA 2FSNA 3HPGA 4FLVA 2HNZA 1Z05A 2E2NA 3O9UA 3KX2A 1RT3A 1XMOK 3ZOBA 1K8AO 1S1UA 3BTLA 4XRSA 3OVNA 4FW1A 2G7HA 2K9QA 1EKEA 1WSHA 2L7KA 2DFHA 3FXMA 4BH9A 1PUEE 2Q2RA 1T05A 2X1EA 3TSUA 4LF4K 2QWRA 4HTUA 4LF5K 2XF5A 4EIAA 4M3DA 4Y17A 4HLXA 1H0MA 2F96A 3C6TA 3QFPA 4FK0A 3IH4A 3B6AA 3WTUC 3AVGA 5HP1A 4BQOA 3K5MA 4MHGA 2ZJ2A 2GTDA 3I9V2 4M7YA 3LSKA 2FBTA 1FOXA 2YHBA 4AHSA 4DR6K 1I6XA 4EQQA 3DFGA 1BQNA 5EYRA 4PGHA 4M6YA 3NQOA 2DBBA 2Q3SA 3DTKA 2E5NA 5FFZA 4AM6A 1YVNA 2B5JA 4JX4A 5KVRA 1BCMA 5AQOA 1ENHA 3CCJN 2BHZA 1T7PA 2P9IB 1P9QC 4RB0A 5AIQA 3QODA 3GTGJ 4BRGA 3PV8A 1BI4A 2YU3A 1AKHA 4H5RA 1MA9B 3LALA 3GFLA 4ELVA 4KB0A 4JAXA 1YX5A 4K0KK 2D2WA 3GDQA 4DTOA 2OV7A 4LLGF 2XHBA 4JI5K 1P2FA 2H6CA 4CJ4A 3SPYA 2YHAA 2W7NA 3J7AY 3RJPA 4I7HA 3FZKA 5JFRA 2QGUA 3O4QA 2P8TA 2Z99A 2VG5A 1UELB 2F9TA 5CKTA 1BCOA 2PI0A 2EFNA 4A93J 5AQFA 3DLLL 1KQSM 3ZPLA 1ZGJA 4CFAA 5FROA 4Q48A 1MBEA 2TCTA 3PNVA 4BGAA 3SBGA 4KH5A 2KIMA 4Q47A 3CJ1A 1QGPA 3I8DA 3IRRA 3CC4N 3DBRB 3V1QA 1R4NB 3RVCA 3NRVA 2VQFK 2ID6A 4FTHA 1S5LC 2QCOA 4RW4A 4JN4A 4XH5A 2BE5F 4DR5K 3CLOA 1YI2N 5E20A 1I50J 1XC9A 1W0TA 3ZGKA 1JLEA 4A2AA 5I42A 2M1BA 1S29A 3HOVJ 4FZYA 1XTAA 4FJGA 3CF2A 2YCHA 2HW3A 5GTIC 5LMUK 2EJRA 1BC7C 3VQCA 4KIBA 1D5VA 1LPQA 4PSXA 1VSFA 2OBPA 5CVIA 2HQAA 3TBIA 2KDZA 2L9SA 3VA3A 3P83D 3T3FA 1EWQA 1HLVA 4JKAA 3A03A 3T5XA 3U4LA 2F5EA 3M7GA 2LRDA 4B1WB 4CFCA 1W5TA 2ME0A 4JD2B 1NGAA 3OW2M 3DYAA 1BOBA 1WSFA 5AQIA 4QOZB 4B44A 2NVTJ 4XLPF 1SL0A 1Y1WJ 2ZB9A 1X1PA 2HKOA 1WN7A 3COAC 2DMQA 4MTDA 2A3ZA 3ZSWA 2VLAA 2H94A 1NKEA 2VQLA 2G8IA 4A6EA 3QYBA 4YOTA 2O8EB 1DTTA 1YO5C 5CVRA 1DEJA 3BTIA 1MSFC 1ZH5A 3LL7A 3CMYA 2IS3A 2Y30A 1YIJI 2RE2A 3OSGA 3WQUA 3NE6A 1R1VA 2O8BA 4KO0A 2P81A 2ZNYA 2D0CA 3KLFA 1HKTA 1CF7A 4FLXA 1H9GA 3ZCOA 4C23A 4KI6A 2CO5A 3QINA 3RCOA 5JVTA 1JE8A 2NRWA 3K5LA 1YI2I 5J1YA 3DU5A 3ZN0A 2IS4A 3HI0A 4B1UB 4BGBA 4E70A 4PJJA 1VI0A 1X2NA 1BA0A 3WTXC 3OYJA 4FOIA 1NTCA 2XGEA 2ELKA 2FF6A 3L3UA 3H5NA 3RTRA 4IFVA 5AQXA 4L18B 1Q7YO 3PIPF 4IJAA 4AVPA 4QSHA 3DRPA 1TW2A 1HA8A 2Q2EB 4E1JA 5DUIA 2FSKA 3ZSQA 4JS5A 2RKHA 5K7ZA 3I56I 2WAEA 2NLXA 3MN5A 1VNDA 4EJVA 1XD7A 1FMVA 2K3FA 1Q1HA 2NOGA 3S2WA 1E4FT 4P5OA 3I4PA 3U1DA 4YRVA 3QNOA 3I3LA 4FZXC 1N77A 4PDKA 2HGCA 5C25A 4GKKK 2DY4A 5AR0A 2OTLN 3A2FA 4UY8O 3LZIA 3D5SC 1F21A 3AO2A 2CQKA 4F7ZA 3KWIA 3VETA 1NJIO 3WG7H 2HU9A 2Q0UA 4O5BA 1XG1A 2DFIA 2NVUB 2PYLA 4B9MA 4DYCA 1MBFA 5FLMJ 2X6SA 3L4IA 1Y6IA 4M3UA 2JLEA 1HUXA 3CDHA 2W6LA 4M3BA 5IYDJ 1BOAA 1JLCA 4F3OA 4BRNA 4JHDB 4KHUA 4NO7A 1HSJA 3HL2A 2CGLA 2EA2A 2E88A 3F6OA 2FXUA 2DTUA 2ZCWA 1YOVB 2QVOA 3EYIA 2JMWA 4ESBA 2QKMB 2QM3A 4JBAA 4CEBA 1IO2A 5HRSA 2XAGA 1EH6A 2AA4A 3RQIA 1MZBA 2E5LK 1IKXA 3CO7C 1NOYA 4BR5A 3CI5A 3ZEUB 4HAMA 4OMZA 2HBMA 2CUFA 1LWFA 3JREA 3QO9A 2MW8A 5LL6Z 2V9VA 4XBFA 4C3JJ 2KHOA 5JICA 1W2BM 2X9DA 4EZ6A 2W41A 4HTLA 1GLJO 3DJCA 4G6DA 3GG4A 5EX5A 1Y8RB 3ID8A 2E19A 2P5KA 2QWPA 4BRLA 4HSRA 3SAHA 3LDSA 1V3FA 1BISA 3R6MA 4NQWA 1SFXA 3TAFA 4CJVA 1BL0A 1G15A 3J80K 2F9WA 3DXKB 1E3MA 2DT7B 3BOQA 3CM6A 3MEGA 3FKIJ 3EZ5A 1OYYA 4LG0B 3A0HC 2DA6A 2Z1IA 2D0OA 2XGXA 3A5LC 1VRUA 4EFHA 4HSTA 3QEXA 2HYGD 2XVCA 1XHZA 3JSOA 5A2QK 1TNTA 2D5RA 2YX7A 1IJJA 4WXCA 2XY5A 1NU0A 1WSJA 1RI7A 3GEZA 3I54A 3V8KA 2E20A 3DM2A 4UVAA 4KBOA 2K27A 5DYMA 1MDUB 2VC1A 1PP8F 4LITA 4E7JA 2Q97A 4KHPK 1VSHA 4BNCA 3QPLA 1S6QA 2LYCA 3EDPA 3FXJA 5CPRB 3CCRI 2VN2A 3IH2A 4CZCA 5J1RA 3VEXA 2PY5A 4B9SA 5KQDA 2HEOA 4KNYA 1KLNA 4E7KA 3VTIA 2WV0A 1KA8A 2DT6A 4CXFA 4CZKA 3AVHA 2DJNA 5AJ3K 2IVNA 1QQNA 3ENHA 3K9TA 3THXA 3I55I 4NNJA 2ECBA 1ESVA 2M7BA 2ZSHB 1XPXA 1LFUP 3L2RA 2OTJI 5CE3A 3H5AA 3DLKA 3GTLJ 1ZBLA 2E35A 3HYFA 5C42A 4NCAA 3BGRA 4CE9A 1TAQA 4CCHA 2LSNA 1Q8IA 1XWLA 1F5TA 4AU7A 1L0OC 4LLLA 3ZR8X 1OCTC 3M8PA 1WHUA 3HOYJ 1D1CA 3S93A 1QQMA 2WAFA 3KHYA 2RNGA 4C1NK 4IXAA 4FE7A 5CVUA 3MKZA 4BQLA 2EV6A 4P9FA 4A3IJ 1ZAOA 2UYTA 1YJNI 3TEDA 3K57A 3GBGA 1RNHA 4JI2K 3W0LA 2GIVA 1B72A 3H35A 1X1CA 4CD3A 1KAYA 3RMDA 3VGMA 5K5OA 3VN5A 2M0MA 3JS6A 1YW9A 2CMPA 1KZHA 1W5CC 2YPRA 2XSDC 3AO3A 3HK2A 4JK1X 3QBXA 1EH8A 3CJAA 4KH4A 4DLEA 1I39A 3U9GA 2NRAC 4C2UA 1IN6A 1CZ9A 1SKRA 3A5NC 5ICGA 2NNNA 4LB5A 1XMQK 3BR0A 3V7SA 4DV3K 3O8GA 1FX7A 1BR4A 2Y69H 1IDZA 3ZQGA 1JLBA 2NXNB 3C6AA 4FWSA 2HZDA 4PQUA 2HB5A 2RNJA 4ENNA 4E19A 4PHTX 2P5OA 5I9EB 4HDUA 1VQKI 1IG8A 4FSVA 3KD5E 4HX7A 4CSWA 2W42A 1QVTA 4JKHA 3KD1E 4H0EA 3K2AA 1BR1A 3HUGA 2PFUA 4UVCA 2IGKA 2GOMA 1VSJA 3IAS2 1SD5A 1H8AC 1BI0A 3E9PA 4DV1K 1VQ5N 3I59A 4CCMA 4HW0A 4KA4A 2DN0A 3JRCA 3DOLA 2X1DA 2XAQA 2VKDA 3LA7A 4ZYAA 1B9DA 2DQRA 3CMAI 1JUPA 5AFUA 2CJJA 1X9MA 1HNWK 4XLCA 4B8XA 4WQ5A 5HROA 4IEEA 3UKRA 2EFPA 2F5CA 4CBXA 4BR4A 4IPAA 5KPTA 4PFPA 4LF6K 4CVNE 4JKDA 2R7RA 2QWNA 1BG3A 1RKTA 2DMNA 2MBFA 1GXPA 2H1LA 2YSRA 1GDTA 1O7FA 1RETA 2Z5UA 2XRNA 4L9TA 4RLFA 2OTLI 3CERA 3C6HA 3VQPA 3V4IA 3J81Z 2ME6A 2GOXB 2R0QC 2PLYA 5FLXZ 2P51A 1JCFA 3KLEA 2F5VA 2STTA 3JRFA 1IBKK 4CHQA 1NG9A 4A5MA 4LY7A 1WCMJ 1JL1A 1JGSA 4DTRA 1WI3A 2MLGA 4JQFA 5DCMA 2L54A 4LOCA 5LRRA 1SAXA 4IRIA 4WXHA 4WK8F 2X6NA 3FX3A 1SS6A 3JRBA 4V19K 5D8LB 3QMLA 4PJLA 4FVMA 2QM1A 3VTHA 3ECOA 2M8EA 2D45A 5FRMA 5AZJB 2O8FB 4NB5A 1KYWA 1NLVA 3Q7CA 3W2VA 3WHBA 1X1BA 4ESJA 4YOXA 2NVYJ 4IL6C 3R0AA 4JI8K 4BXXJ 2L3DA 1MH4A 1ZG5A 1K78A 2R7VA 3K4CA 1TYQB 1VSEA 1IXSB 1GLNA 4ZDLA 4BKXA 2VOPA 4KHWA 4FVUA 3GLLA 2ZFUA 1FBUA 3IKTA 4EGYA 2X78A 3MCPA 3F8BA 4NLCA 2LKSA 1B4AA 1ZR2A 1G3TA 1SVOA 3UE5A 3H6EA 2XDVA 4BL0B 2DAOA 1FTTA 3D5LA 5JLXA 5DDGA 2LKPA 4AVZA 2VG7A 5ADXH 2Z1DA 1VAZA 1I6HJ 3AA2A 4Z4HA 2L9VA 3G6EN 2M8GX 3FZVA 1QS4A 5LMNK 2XB5A 1P4XA 1QQCA 3WU1B 1YYVA 4M3GA 4BUPA 2MH9A 4BQAA 2HI3A 4KYWA 1ETVA 3IFRA 5AQNA 2L4AA 1NK8A 3U9ZA 3G6EI 4E7SA 4OPJA 2X0LA 3DAWA 1LVKA 2XY6A 1BIBA 2NS7A 4CEZA 1LAVA 2P9SB 5GAGP 4OX9K 1S6PA 2RQQA 2HHVA 2UV1A 1WRJA 1JJ2M 3SLCA 3SHFA 4QIWN 2KPMA 1FLIA 1L3TA 2IS1A 2AO9A 1U47A 1RDBA 3O08A 2A5XA 5KAIC 5AQUA 2HQNA 1U04A 3O3GA 1P92A 1WWXA 3MMYB 5FRNA 2DPNA 1B9FA 2A1SA 3BQYA 3CDIA 4A3MJ 3K5OA 4AIHA 2K9NA 2LMDA 3DBLB 4CK2A 1RTJA 3ZRGA 3VYSB 4ICLA 3VEPA 2HOEA 3A1YA 5F0XA 5CY4A 1KAZA 1I94K 2V79A 3CCVI 3GWZA 2A68F 1D8KA 2QBYB 1KC8O 2JUCA 1XMXA 1QHTA 4A3GJ 1RR8C 3VEOA 2R93J 3JRAA
chains in the Genus database with same CATH topology
4XIUA 2X6XA 3DLGA 2LY2A 4M3ZA 4DG1A 4PK4A 1UOCA 2W1OA 4IG0A 5HNFA 4HCCA 3BC8A 3VSKA 2ZXHA 1TL3A 3PO5A 4ZJZA 4PUSA 2KMUA 4NYNA 5KGXA 2KTQA 3TR8A 3A2KA 4CEQA 3IUOA 2ITGA 1TKDA 4LD0A 3IAM2 4DBQA 3H0DA 1X1DA 2RKIA 1V5EA 1RBTA 4BDZA 4DTSA 4CHYA 4XQFA