3HPGA

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
194
Chain Sequence
b'NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCQENKMGIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 66
structure length 194
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hpgA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpgA02
3LP1A 4O0JA 3VQ8A 3QEIA 4NCBA 2HHVA 2OZSA 4RW6A 3OY9A 4BDPA 3HPOA 1KONA 3G0ZA 4LSLA 3AO5A 4FLUA 4KKOA 4OKEA 4PY5A 1GOAA 4DTSA 1RDDA 3K59A 4OLAA 3PO5A 2ZD1A 1JXEA 2BE2A 3ZSXA 1QTMA 3NF9A 1WSIA 4CJ5A 3V9XA 4CEBA 1IKYA 4KTZA 3QEPA 4CJRA 3VQ7A 3ZSVA 1EKEA 4B08A 1J9AA 2IAJA 1UWBA 4CK3A 4YFUA 4DF8A 4CCHA 3V1RA 4KHWA 1WJDA 3L2VA 1I3AA 3KK2A 3V1OA 3QO9A 1C1CA 1S9EA 4CIEA 2FBTA 5FRNA 3L8BA 2HNYA 3KKSA 3DRSA 3ZT4A 4EP5A 4IFYA 4E19A 5HROA 3PUFA 4Q5VA 4M3UA 1ZBLA 1KLMA 1FKPA 3OYDA 1X9SA 4N5SA 4M3YA 1CZBA 2O4IA 4GW6A 3DLRA 3DRRA 3T19A 1KFDA 3TAMA 2AJQA 3THVA 5KGWA 3I0RA 3QINA 4DQIA 1WAJA 4F4KA 1QS4A 2IS3A 3VQ6A 1CZ9A 2B6AA 3ZSQA 3NCIA 1NKBA 2YNFA 1WAFA 3CM6A 3HK2A 3TARA 1NKCA 2D0BA 4FJMA 4IG0A 3MEDA 5I42A 1NOYA 3CG7A 1TL3A 3VQPA 3I8DA 4Z4EA 4PUOA 5C42A 1NK0A 3SV3A 3AO2A 1SKRA 2YNHA 2B5JA 1RT6A 3OYCA 4CGFA 4GVMA 4LH5A 4KV8A 3U6FA 3TAGA 3HSTB 4FJ8A 3HL8A 1FKOA 4DTPA 3AVJA 3LANA 4CF2A 4OPKA 1EXQA 2P5GA 2G8UA 4DU1A 3C6TA 4F3QA 1S5JA 1S9GA 3SCXA 1RBTA 1SL2A 1ITGA 1HRHA 2OPRA 3MEEA 3WNEA 3EY1A 3QNNA 1L5UA 1QSYA 4CEAA 1G15A 1KVCA 2ZQBA 3RMBA 3BDPA 2QK9A 3B6OA 4NCAA 4HHTA 3SQ2A 1U45A 3DYAA 4OLBA 1VRUA 4Z4CA 1LAWA 4CJ4A 4Q0BA 4KRFA 3ISNC 2HW3A 2HHUA 2HHQA 2D0AA 2OPQA 3ASMA 1WJBA 3NGZA 3CQ8A 2FBXA 3I0SA 4DS4A 4KHUA 4IG3A 4BE0A 1JLGA 3NBPA 2XY8A 4IBNA 2YKMA 1EP4A 4K8ZA 3KLEA 4DLEA 1TL1A 3C95A 1TAQA 4E1NA 3SJJA 3SUQA 5SWMA 3LZIA 4EZ6A 1HJRA 1SKSA 1RT5A 3ZSWA 4CIFA 1JLAA 4E1MA 4DTJA 2VG6A 2Z1JA 4N41A 3OYJA 4RW9A 4DSKA 1RTIA 3OYFA 1L3UA 2D0CA 3A2FA 3LWLA 1TKDA 4HCCA 1U49A 3SQ1A 1C6VA 4FZYA 4DFJA 4FJIA 4KI4A 4M45A 4C8OA 3L2WA 1BI4A 4CEDA 2O4GA 4O44A 2OPPA 1KCFA 1S1XA 4FW1A 1ZBFA 3VQ5A 4CHYA 1S1TA 4DU3A 3UIQA 1JLEA 4LH4A 5SZTA 3ZT0A 4OPJA 3HVTA 3PX4A 1TK8A 3TABA 3LP2A 3OYEA 3KLHA 3ZSOA 3U3YA 4B9VA 1CXUA 1Z25A 3LPUA 4I2PA 4Z4HA 1NK6A 4Z4GA 2QKBA 3V6DA 3AVHA 3QIOA 4XIUA 1MW7A 3OYNA 4W5TA 3KIOA 3MXJA 3RWUA 3AVIA 4RW4A 4KFBA 4CHNA 4M3XA 2RKIA 1KSPA 1BIUA 2EHGA 3NF7A 4LSNA 4O4GA 3VQEA 3SV4A 1QSSA 2KZZA 4FJKA 1TKZA 3IG1A 4E7JA 3AVFA 2KZMA 2DFHA 2D5RA 1U04A 3SZ2A 4CFAA 3M8PA 3VQBA 2YHAA 4W5OA 4BE2A 4DQQA 1TK5A 1SV5A 1YT3A 1WJEA 2YHBA 2E4LA 3U3GA 3SPYA 5HRSA 3RMDA 1S6QA 4DTOA 1LV5A 4C8NA 1WJAA 3KTQA 3FFIA 4PQUA 4FLZA 1KFSA 5CYQA 1D9DA 3P83D 4KB1A 5EU7A 2WONA 1LFPA 3HPGA 2RN2A 4WE1A 5C25A 3D0PA 2A1SA 4BWJA 1ASUA 3ZT3A 1NJYA 1CLQA 1T03A 1W0HA 3LDSA 4J2BA 2XHBA 4B8CA 4E7KA 3DLEA 4E0DA 5DK5A 4FJNA 2YNIA 1T05A 2VWKA 2F96A 1XI1A 4F2SA 4CJVA 1NK5A 1T7PA 4CF0A 3OYBA 4CE9A 4Z4FA 3D45A 3KLIA 4CK1A 2XRIA 4DFMA 1NK7A 5JS2A 3QEWA 1KLNA 1BCMA 4N56A 4ELVA 4FJ7A 3S9HA 1C1BA 3IAYA 5HRRA 3PY8A 1NJWA 2Q3SA 3LPTA 4DTMA 3K2PA 4FJGA 1TAUA 1RT2A 2FBYA 4BE1A 4CECA 4DS5A 3M8QA 1YVUA 4CGJA 3TAFA 4B9MA 3TR8A 2HHTA 2X74A 3RTVA 1VRTA 1TVRA 1VSKA 1BGXT 1LW0A 4JS4A 5C24A 3K57A 4ID1A 3DI6A 1BCOA 2Y1IA 3PV8A 1B9FA 4JRPA 3RMAA 1J54A 4F3OA 2KTQA 4CHPA 4PWDA 4KHQA 1TKTA 4CJLA 4FJXA 3DLGA 1HYSA 1HYVA 2ETJA 3AVLA 3T1AA 1N6QA 3DMJA 1TK0A 4YNQA 3LZJA 3CFPA 5T7BA 4HTUA 1LWEA 3AVGA 3JSMA 3QESA 2HHXA 3MAQA 2Z1GA 4DLGA 4FZXC 1RDCA 1VSEA 3EYZA 4FJ9A 2A1RA 4FJ5A 4E7IA 2JLEA 3VQ4A 4DTUA 1HQUA 3NE6A 4FLTA 3CM5A 2FC0A 3AVMA 3ZSRA 1RTDA 1TV6A 4KHYA 4DTRA 3AVAA 3L3UA 4M41A 4AHUA 1RBRA 3H08A 1VK0A 3RR8A 3M8SA 4MQ3A 2HHSA 3HYFA 2ITGA 4FK4A 1L3SA 3NH1A 2IC3A 3QETA 3VN5A 4BDYA 1T8EA 3V1QA 4DTXA 1VSJA 2HVHA 1BISA 3BGRA 1KRPA 3T3FA 4B9NA 4O0IA 2IDOA 3O3HA 1TKXA 3WNGA 4LY7A 2BANA 3L2RA 1QQCA 3TI0A 1UOCA 4J2EA 5CYMA 3IRXA 1KVAA 4CFCA 2IGIA 2PY5A 1MU2A 4Z4IA 4LD0A 5DMRA 4AHSA 1RTHA 1JL2A 1RT7A 3VQDA 5J2MA 1DLOA 4IFVA 1U47A 3F73A 3TAQA 2OZMA 4FVMA 4M3RA 4J2DA 4B3OA 1RT4A 4W5NA 4FK2A 3NF6A 5FROA 1IH7A 4DQSA 2BDPA 2LSNA 4CF9A 1SUQA 4PA1A 3DLHA 3SUOA 3AV9A 3QLHA 3L2UA 4CJSA 1Q9YA 4KI6A 1LAVA 2DTUA 1GOCA 3RRHA 4OGEA 4RG8A 4Z0UA 3ZSZA 3K5LA 3O4QA 1A5XA 1JLCA 2DFEA 4TSXA 1RNHA 3OYLA 1HPZA 2EX3A 3DOLA 1NK4A 1L3VA 3KJVA 4C8KA 3NF8A 2BGGA 2KFZA 3NHGA 1EETA 3L3VA 3MXIA 3TAEA 1ZYQA 1REVA 4ZTJA 3LAMA 4IKFA 4L8RB 1JL1A 1SL1A 2XY6A 3AVKA 4H4OA 3LP3A 4E89A 3OJSA 4HCBA 3OYMA 4CJUA 4NYFA 3K58A 3V9WA 2HNDA 4DFKA 4I9QA 2RPIA 3WNHA 3JYTA 1NKEA 3S3OA 2ATQA 4FK0A 2YV0X 4E7LA 4FJJA 3AO4A 2Z1HA 4CGIA 4DG1A 3OS1A 1X9MA 4KTWA 1UA0A 1XWLA 1VSHA 1Z26A 3HO1A 4RW8A 1RCHA 1ZBHA 3DOKA 3DM2A 3LP0A 3DLBA 4KPYA 2P1JA 3V9SA 2GUIA 4M3WA 4G1QA 2FBVA 3MXMA 4EP4A 1VSIA 3VQ9A 4KAZA 3K5MA 1WN7A 3E01A 3V9ZA 5HP1A 2XY7A 4C8LA 3K5OA 4ELTA 4CFDA 4J2AA 1XHXA 2I5JA 1R0AA 1B9DA 4CJEA 1RDAA 3QNOA 2G8WA 1FK9A 4KTQA 3ZSYA 4KHSA 3AVNA 4BDZA 2QXFA 3KKRA 3AVCA 4OJRA 3KLFA 1D8YA 3IS9A 4KHNA 1X1PA 1ZBIA 4E7HA 1O1WA 3NGYA 4W5RA 4CEFA 4R5PA 1JXBA 1NJXA 4IDKA 4OVLA 4FXDA 2HNZA 4Y1DA 2GV9A 3NH0A 5KI6A 3AA5X 4FM1A 3V81A 5HRPA 1S1WA 2P51A 4QAGA 5CZ1A 2NUBA 4FJLA 1D9FA 5KRSA 3DRPA 1S1UA 3OVNA 2G8FA 4DMNA 1WNSA 4KB0A 5J2QA 4FYDA 1RBUA 4DSLA 3B6PA 1WJFA 4CEZA 3HM9A 2Y1JA 3SPZA 3DLKA 4AHVA 2KFNA 2X78A 1BIZA 1RILA 4FM2A 5KTQA 3MEGA 4JLHA 3PO4A 3KD1E 4UQGA 1J53A 5J2PA 3QEVA 1XHZA 1UA1A 1RT1A 4I7FA 1U4BA 1X9WA 3VQCA 1YTAA 1WSFA 3SQ0A 5CZ2A 1RDBA 5FDLA 5HRNA 4FZZA 3OYAA 3ZCMA 1Q8IA 2RF2A 3CFRA 3RRGA 5D3GA 3OS2A 2E6LA 3SQ4A 3TANA 3OYHA 4CJQA 3ITHA 3QEXA 4AHRA 5KRTA 3P5JA 1C0UA 1VSFA 1WSHA 4CJTA 3KK1A 3EZ5A 3NH2A 5J1EA 3P1GA 4HUFA 1LWCA 4H4MA 2G8HA 2OA8A 4K8XA 4DQRA 4FJHA 3HVRA 2VG7A 3AO1A 4HUGA 2JGUA 1K6YA 3SUNA 4ID5A 4CJWA 4H8KA 4M3TA 2YKNA 1BHLA 3HP6A 1JLBA 1QHTA 4N76A 4CGHA 4AHCA 3HP9A 3KK3A 4OKKA 3OYIA 4AHTA 4OGCA 3VA3A 5HLFA 1Q9XA 3NGIA 3V4IA 4CEQA 3NDKA 4CJPA 4KREA 1ASVA 4CHOA 1TGOA 2DFFA 3TAPA 1RBSA 4I2QA 3QERA 3KD5E 2VG5A 3QIPA 4GMJB 4M42A 3SUPA 1A5WA 1LWFA 2IOCA 3RMCA 2PZSA 5KGXA 4W5QA 3LWMA 3SNNA 4AH9A 3AA4A 5HBMA 1NJZA 4EZ9A 5K14A 5FRMA 3K5NA 1WSJA 2G8KA 4ELUA 4M3ZA 4F3TA 1QE1A 4C8MA 4E3SA 2W42A 1B92A 4RW7A 4O5BA 4I9LA 3VQQA 1J5OA 3WNFA 2G8VA 1DTTA 1VSMA 1XC9A 4CFBA 3AVBA 5CY4A 2PYJA 1JKHA 2YNGA 3OYKA 4N47A 4OKJA 3SI6A 3HPHA 4HVJA 1SL0A 1IKXA 5I3UA 3C6UA 3ZT1A 4BACA 2X6NA 3HT3A 4HUEA 1WSGA 4F2RA 3RR7A 1WLJA 1BI4B 1BL3A 4AILC 4CEEA 2F8TA 1VSDA 1I39A 1DTQA 3TWHA 2Z1IA 3LALA 2HB5A 3SYZA 4JS5A 4DQPA 4CF8A 4B8AB 4FLVA 4B9TA 4QCLA 4CEOA 3O3FA 4CF1A 2DY4A 4DSIA 5E41A 3C94A 4BWMA 3OYGA 3F9KA 2HMIA 3L2QA 2HHWA 4DSEA 2WOMA 2XO7A 3KLGA 4DTNA 2X6SA 4ZHRA 1C1AA 1N5YA 1NK9A 4QOZB 1HNIA 1RTJA 1KTQA 4MFBA 2GBZA 3AO3A 3CYMA 3MECA 4FW2A 4KO0A 4O55A 3OS0A 1UAXA 1U48A 4DSJA 2XY5A 1YTUA 2KQ2A 1HQEA 2KW4A 2VWJA 4DSFA 1BQMA 1JLQA 4FLYA 1E0EA 2QKKA 1CXQA 1D5AA 3O3GA 3M8RA 2HVIA 1SKWA 3ZT2A 3NAEA 4ICLA 1C0MA 1KVBA 4CESA 4CGGA 1EX4A 3LAKA 1FXXA 1Y97A 4CERA 1S6PA 3HJFA 1HYZA 5JS1A 2OYQA 1IKVA 3VQAA 2PYLA 4DWIA 4FLXA 4B9UA 3ULDA 1RBVA 4FLWA 5J2NA 2OPSA 3O4NA 4Y1CA 4CIGA 1QSLA 2P5OA 3ALYA 1HNVA 4CJ3A 2B4JA 4B9SA 1ZBUA 1W9HA 2E6MA 3CFOA 3PX0A 1WSEA 2ZE2A 4DF4A 1S1VA 1A5VA 1ASWA 1JLFA 1LW2A 1VSLA 3AA3A 4FCYA 1IKWA 4FM0A 3HXMA 1HMVA 1F21A 3OJUA 3V9UA 1L3TA 1BQNA 4NYNA 3AA2A 4DU4A 3G10A 2G8IA 4CHZA 2F8SA 4DFPA 3NFAA 1NOZA 3S3MA 4CJFA 4CHQA 4CJKA 3VA0A 1IG9A 4F8RA 3S3NA 1C0TA 1WJCA 4NCGA 4CGDA 4B9LA 1IO2A 1GOBA 1RT3A 4CK2A 1NK8A 4ZTFA 2R7YA 4JRQA 3PX6A
chains in the Genus database with same CATH superfamily
2OZSA 1KONA 4JD2A 4HW0A 3PO5A 1R1UA 1XSXA 4BJTA 2E2IJ 2HOTA 3KWIA 2QW9A 2QSHX 3WXMB 1S9EA 4X66K 2YHYA 1YYVA 3LQRA 1K73O 1FKPA 5ADXA 2E88A 3FXRA 2O8XA 2V1DA 2B6AA 3Q9SA 2D0BA 3MX5A 2CH0A 3UB5A 3VSLA 4UUSB 3NWTA 5JVHL 4D5FA 1IW7F 3TAGA 4GKKK 1SQKA 2X6OA 2E35A 3KZZA 5AQUA 1E3PA 5KNLA 1S9GA 1OR7A 1KVCA 1XC3A 2HHQA 2JA2A 2VJJA 1BR2A 3ZETB 2W00A 2XRNA 3SJJA 1SAXA 4MEYF 1BWFO 4E1MA 1WWXA 5GIOA 3CQZJ 4FJIA 2NS8A 1C6VA 3DXKB 5CHIA 4CSWA 1JLEA 1PP7U 2L01A 4ESJA 2XAGA 3LPUA 5ICCA 3TPQA 3EUKL 4CHNA 1QVFM 3LDNA 4HDUA 2BOLA 4HDVA 3ZQQA 1U04A 3BPXA 2HMPA 2UXDK 1JTXA 3GFMA 4AVPA 3QP6A 1NJYA 4FPAA 4J00A 5ED4A 2MSYA 3R0AA 4HX8A 2E5LK 3PFIA 1NK5A 5GIPA 1ON2A 3C2BA 4BRPA 3RSNA 3AAPA 1OH8A 2DCEA 2HQNA 5AZJA 3GX4X 3AAQA 4KA4A 1RETA 2NOJB 4ID1A 3BC8A 1TKTA 4FJXA 2O8DA 4ZH4F 4CCLA 1KAYA 3JSMA 3QESA 1SAZA 2WFBA 1AWCA 3ECOA 2YS9A 1QQOA 4XLPF 4DTUA 2IS1A 4CZGA 3H08A 1ZHFA 5H1SQ 5GAGP 2JZYA 3IKTA 4BRQA 1S7OA 2DMUA 3K1NA 2STWA 5JICA 1BA1A 5LRRA 3EO3A 2QWMA 5J2MA 4B8XA 1U3EM 1S7AA 3NF6A 4G8XA 3KP5A 3ZOBA 4GV3A 1GOCA 2BY2A 2HYGD 1OVYA 2HKOA 4FE4A 3QWLA 3KJVA 2ZGZA 1A04A 3ZYYX 1JKPC 3DTEA 3R6MA 4AIJA 2HVRA 3OYMA 2QENA 2Q97A 1IBLK 2L7MP 1IXCA 1T0FC 1LCUA 3WTZA 4DV6K 1VSHA 2GIVA 3F8BA 3HSFA 1ZBHA 3LP0A 4LG0A 2V52B 3V9SA 4YFNF 4JI7K 1WN7A 3V9ZA 4J2AA 3F0CA 2DOFA 3C6AA 1FT9A 4EGYA 4LFCK 2YHXA 2NRTA 5KI6A 4KH4A 2GM4A 1D9FA 1G2HA 5EY4A 3R3LA 5L3DA 2A07F 1RILA 4KFCA 1U4BA 2Q0UA 5FB2A 4ASNA 1X1CA 2K7LA 4BS9A 1E3MA 2BE5F 1IJJA 5DS9A 3FR0A 2PN6A 3LL7A 1GVDA 2I8DA 5EX5A 2ZGYA 1YJNI 1ZREA 2PG4A 4RDUA 3ZP5A 2CGKA 1CQTA 2ZKZA 3DFGA 3HP6A 3FMRA 4G9ZA 2KZVA 3DF8A 4U0WA 2QKMB 3VA3A 5HLFA 1LQ1A 1TGOA 2CG4A 1W7PD 2RQPA 1Z67A 5EZHA 2PJRB 3CMAN 5EYRA 1M1KO 4AF1A 3I58A 4EZ9A 5FRMA 2XIGA 4EJUA 1VQKN 4R1HA 4C8MA 2V9PA 3FGUA 1PUFA 2G8VA 3KLNA 2N8GA 2CUEA 3AVBA 2VQHA 2NNNA 2XV4S 2KIMA 4AILC 3DLAA 2F8TA 4DQ8A 3LSGA 1F43A 3CC2N 3REOA 1YRNB 4JI6K 3VERA 4CF8A 2CQNA 4FLVA 2F5EA 5E41A 4JN4A 3HI0A 5BS6A 4GGGA 3O3KA 4PJMA 1MH3A 3A8YA 3VESA 5AQXA 5FKNA 2XPWA 3O3GA 3NAEA 4YY3K 1EX4A 2X48A 1T33A 3HJFA 2CU7A 4I98B 2VN2A 1VQPN 2ZE2A 1KQSM 1V54H 4OO1J 4DV0K 5IP7J 4WQ4A 3DAWA 4F8RA 1C0TA 5KQ8A 3ZR8X 2DTRA 1K9MO 3TMOA 2V4JC 3E6BA 4KTZA 1RKTA 3ZSVA 4ETSA 2MLKA 4LIVA 3L2VA 2GWRA 3VEOA 3KETA 3GTGJ 5HROA 4M3UA 2UUZA 2WV0A 1X9SA 3CQXA 2HQAA 4GW6A 3DLRA 4FOEA 5C44J 1Y6IA 2L0KA 5K1YA 5DM7L 2KIUA 3CM6A 5C0YA 3MEDA 3SHFA 5J47A 3JCUC 1X4PA 2WTUA 2FEZA 3ZPLA 3HL8A 1NGDA 2MD0A 3C0BA 2Y69H 1P8ZA 3WNEA 4QSHA 1FSHA 3NGZA 2Z2SB 4BE0A 4IBNA 2ZXWH 4O8UA 2X6YA 1ZARA 2HGCA 4EZ6A 3D2EB 2XVCA 3C65A 4NUBA 3LWLA 1OYYA 2KRFA 3U4LA 3R8EA 4FZYA 3K7AJ 2R7DA 3ZT0A 4ZYAA 1ULYA 3PNYA 2GLOA 3NWSA 3E0JB 1S9HA 4N9IA 4QLCU 3BG6A 5D5UB 1FY7A 1ODDA 4BY9C 3JXUA 4F92B 3NF7A 3CQYA 1D4XA 1WJEA 5D4SA 5HRSA 4PL7A 2A3ZA 4XBFA 4C8NA 1KYWA 2DK5A 5ICEA 4BXFA 2LC2A 1WI9A 3WU0A 1EJ9A 3K4JA 3CUQA 4EJTA 3G2BA 1F5TA 5JS2A 3HKZA 3PL8A 2IGKA 3F9MA 4Q5SF 3T1BA 4BRKA 1BW6A 4JOMA 1VI0A 2P9KA 4F3OA 4JRPA 4KHQA 2H1KA 2OZUA 5JLHA 2ETJA 2IVOA 4YNQA 2V7ZA 3O1WA 4FZXC 5CVVA 1D0ZA 2A1RA 3VEXA 2C6YA 5HVQC 1TV6A 1WZ2A 1QHHD 2VLAA 5H2FC 1ZRDA 3E5UA 3I59B 4MO7A 3DEUA 3M1FA 3IH4A 2BANA 1MDUB 2VJ4A 1T56A 4LF5K 3SUOA 4JNEA 1KQ8A 3LQQA 3ZX3A 4OU0A 5B3SH 4Z0UA 4FWNA 1ZELA 4TSXA 3L2CA 2R7WA 2EX3A 1TW2A 3NF8A 2UZKA 4B4CA 5EG0A 3QAHA 4O6JA 2E2OA 4FJJA 3QBWA 2Z1HA 3HO1A 3GZ5A 1JJ8C 1QPIA 4LK0F 4MO4A 1KZHA 5HP1A 4BH9A 3OBYA 3CCJN 3DWLE 4BDZA 4W5RA 5BOXA 4Y1DA 5M5XJ 3AA5X 1TT5B 2G8FA 3Q0WA 4RWTA 1POGA 5FDLA 1TYQB 2YX7A 2RF2A 1SZ2A 2V1NA 2KLOA 4EJOA 4H4MA 1P4WA 1BI2A 3I3LA 4EM0B 2VGMA 2GOMA 4MO5A 5F2RA 2KP6A 5ILUA 3TAPA 3V4GA 4FWQA 3HOYJ 3DU5A 2DPUA 4AH9A 1L3LA 3BEXA 4M3ZA 1QE1A 2LRDA 2P7CB 1SFEA 4RW7A 3WEEA 1DTTA 3K4NA 2YNGA 4LFAK 3HJEA 3FZFA 2Y9ZA 1BL3A 4FL9A 1V3FA 1VSDA 3LALA 1SD6A 4B8AB 3EYIA 4QS7A 2FSNA 2DBBA 4ZHRA 4CD3A 1D8KA 4JK9A 4W1UA 2KFDA 3HSEA 1FTZA 5B5EC 1YJ9I 4GDFA 4EQQA 4WCGA 4KYWA 3LDPA 1WPKA 4DYRA 1S6PA 4HNUA 3ULDA 1RBVA 1OCPA 4F55A 4DR1K 3MN7A 4LG3A 1HNVA 2B4JA 3U9GA 3O6BB 3SMPA 1S1VA 4DF4A 5AQWA 3CO6C 4YOXA 2ME0A 2A6HF 4CJKA 4KDPA 4DJAA 3MN2A 3LSMA 3QFUA 4DGWB 4GCVA 4FQGA 2BHYA 5GAHJ 2BGCA 3G4SN 5AQPA 1HDPA 4N4OB 3DTIA 4CCHA 4UB8C 1FP1D 3I8BA 1WJDA 1U8RA 3O2PE 3CCUN 2HNYA 5M1PA 3BR0A 2L02A 4RAZA 4BC3A 3UKRB 4L3QA 1EWRA 3NCIA 1GDTA 2A42A 1WAFA 4L0ZB 2LKSA 1NOYA 1ATRA 1X2NA 3MZHA 2VOOA 4BUPA 2Z1DA 1NM1A 1YJWN 2G8UA 3O8GA 1DPRA 1Q1HA 4CJ4A 2JRTA 4M3FA 2GELA 1EA3A 1RT5A 3A01A 1IRZA 5DDGA 3WQTA 4CD1A 4M45A 2PMZN 2Q1NA 4MDAA 3VQ5A 4BROA 4DU3A 4B3XA 3PX4A 1YAGA 1YS6A 4Z4GA 1MW7A 3KIOA 1K7AA 4RW4A 3K10A 4W5OA 4G7ZF 3U3GA 2KZGA 3KZYA 3FFIA 4CZCA 1SEUA 4RS8A 3H36A 3HPGA 4JHDB 3QFPA 2W24A 2P4WA 3WTUC 3DLEA 5E84A 2F96A 3CHWA 4F2SA 1BC8C 5GTHC 2Q31A 4ANJA 1FSEA 3HL2A 3JAMK 4BKXA 2HHTA 1VFCA 4DV5K 4PGGA 1BGXT 3B02A 4A3KJ 3N97A 2XPVA 1S72N 4LGWA 4PDKA 1GLBG 4IL6C 2WBMA 4PJJA 4F91B 1BI1A 3HRGA 2NRVA 2P9LB 4YDUC 1W7PB 1VSEA 3EYZA 4AQYK 4E7IA 2QWNA 3ZSRA 4S04A 5HS8A 3L1PA 2MABA 4YG2F 1ZBSA 4Y7NJ 4FWSA 1CF7B 2X0LA 2HVHA 5BN8A 3O3HA 1ZRFA 2VQLA 1FOKA 1HW2A 2P5LC 1U47A 1IXRC 2NVXJ 4HRIA 4Y4RA 2BDPA 5CVRA 1Q9YA 1ERDA 4UV8A 3WGIA 4EATA 3MXIA 3KZBA 1ETVA 1JE8A 2W41A 1H8AC 1FIPA 3JYTA 1NKEA 5FKMA 1W1WE 3RQ4A 1R22A 5FKLA 4RB3C 1AA7A 3I64A 2XY7A 2I5JA 2G8WA 2W4SA 1RUOA 1NWKA 1MJ9A 4OJRA 3VODA 1K8KB 3DJCA 1WGXA 4IDKA 4OVLA 4FXDA 3IMXA 2DMTA 4F52A 1B59A 4QAGA 1U5TC 1S6LA 5LGNA 1FW6A 2F4IA 4IRHA 2Y9YA 3QPTA 5D4RA 1IV6A 3QMLA 3ZCMA 2V7FA 3CFRA 1UCRA 3UE5A 3MKWB 5ICFA 3HDDA 3P1GA 1LWCA 4BQZA 4C23A 3ENBA 1R59O 1YG2A 4B9QA 2X85A 5HLGA 5JVGF 3D5RC 4YOTA 2WA0A 4ISEA 4CHOA 4I2QA 1GXQA 2EV5A 1P90A 4IHVA 1A6QA 1MBEA 2IOCA 1NJZA 4B3SK 3KP7A 3CCQI 2KIFA 4F3TA 2GAUA 2JRMA 1X2MA 4OINF 3TSPA 3ZQHA 5I3UA 4A59A 2AQEA 1R7JA 2QWWA 3MKZA 1MNDA 3MWPA 3CMAI 4L18B 1BI3A 2FLOA 3KLGA 1VQKI 2DA3A 3L09A 1RFQA 3U1DA 4IHWA 2KQ2A 1BQMA 2EZLA 4A62A 2NRRA 3ZT2A 1HYZA 4XR6A 2ECCA 3BT9A 4CIGA 1GLAG 1V5FA 2E6MA 3ASOH 1LW2A 1XDSA 1TL8A 3K0SA 3OBWA 2EK5A 1LPQA 2EFPA 4FWRA 2DMQA 1YLFA 2A61A 2EFOA 5DCMB 3OY9A 3CC4N 4IQJA 2QQBA 4OLAA 2ZMEB 1MWKA 4CJRA 4B08A 1MDMA 4U0VA 3A1YA 1VQPI 2WV1A 3JRIA 3JAMZ 5DUKA 1I3AA 1HLUA 2FBTA 2GXGA 3KKSA 4BQLA 3CCLN 1MNMC 1ZBLA 1A6IA 4AC0A 1H88C 3F8FA 2E71A 2G7HA 4KT6A 2O8KA 2V51B 1NKBA 3S1RJ 2E1MB 3I8DA 1IRGA 4X1EA 4LH5A 2H3GX 1R36A 4DU1A 3C6TA 4F3QA 2DT7B 2MC3A 2QK9A 4EV0A 2DXIA 3KFWX 4Z4CA 5TJJA 2PJRA 3TGNA 2K9LA 2VBYA 3I0SA 4IG3A 4ZZLA 1JLGA 1O7FA 2LLKA 2B9SA 3GDQA 3OYFA 1BC7C 3A2FA 4BC5A 4UUTA 2IGOA 1Y8RB 1DDNA 1TBXA 1X9JA 3A2KA 1T98A 2YUSA 1YRNA 4XLNF 3ZSOA 1ZGWA 3WTWC 4L5JA 3FKJA 2VC0A 4BY1J 1R1TA 3T0YA 2HEOA 2EPFA 2VONA 1SFXA 3ECHA 2HDCA 4G12A 2RN2A 3D0PA 3MEXA 4AU7A 2RNJA 3FXJA 2KJCA 3HRSA 1T3VA 2EV6A 2KDOA 4FWKA 1KYZA 4HPQA 5TISC 3J81Z 3IAYA 4A57A 2FBYA 5DM6L 3M8QA 1YVUA 1P2FA 3H45C 3OL4A 5LEKA 4ILHA 2R7VA 2O6GE 2F48A 2H6BA 1T6CA 5IWAK 3CFPA 2Y0SA 1RKWA 3CM5A 5FGMA 4A2AA 2CYYA 4FK4A 3NH1A 4JQFA 4YIIA 3LDOA 3V1QA 3BQYA 5A2QO 3ID8A 3FZVA 3J7YP 5HDGA 4H5VA 1NTCA 2NS0A 2M34A 5CYMA 3CC7N 4AHSA 2VE9A 5AFUA 4IFVA 5IT3A 1R00A 1FEXA 1RT4A 2RKHA 2DT5A 3H35A 1XDUA 4CF9A 4BVOA 5BPNA 3CJ9A 4PHTX 1NK4A 1L3VA 5LY3A 1EETA 3ZMVA 1BIAA 2Y0MA 3ZX2A 3ML6A 4GNIA 3PSIA 2HNDA 2YV0X 3ERED 4CGIA 2ELKA 2YI1A 4NB5A 1GV2A 3GW2A 2J5OA 5AQJA 5KVRA 1B9DA 2K3PA 2F4OB 3AVCA 3IS9A 1ZBIA 1MH4A 4EGZA 2GV9A 5CE3A 5DCFA 5AQKA 5FPMA 5FLXK 2NVQJ 1J9IA 3KE2A 1FBUA 1BIZA 2ASOA 1J0RA 4N4NB 4XH4A 2DA2A 1Z7LA 3OYAA 3CCJI 3RRGA 1HSJA 2IS6A 3IWZA 1JGSA 1IRFA 2HPIA 3AO1A 3S16J 4I0BA 3TL4X 2FSWA 3F8MA 4N76A 4LF6K 3HP9A 2OUMA 4K25A 4C3IJ 3V8JA 1DP3A 1VZ0A 2LKXA 1S3JA 2CQ7A 4JX4A 5CVIA 3WXJA 4O5BA 3Q3SA 3FLCO 2FSJA 2PYJA 4DCHA 3TW6A 4LB6B 4JI5K 5L3BA 2ZXJA 4RMNA 1I39A 1NJIO 3E66A 1IBKK 3L2QA 4CZFA 1IN7A 4BRFA 3ABLH 1C1AA 2ESHA 3L0QA 4CZKA 1WHUA 2VBZA 1FOXA 1UAXA 3D2FB 2O8CB 3PIPL 1SKWA 1EH8A 3GEZA 3DWLA 5HLHA 5HLIA 3RIRA 2LY1A 1IKVA 4B3AA 5EOYA 1X19A 1VQ4N 1BA5A 5IT9K 2BVMA 5AQQA 4X62K 1W2BM 1WSEA 4FTHA 3PQKA 4ESBA 1JTYA 4ZDPA 2DJNA 4CHQA 1IG9A 4JKFA 2YJFA 1WOQA 2QZ8A 3PLAA 5F64A 4JRQA 2DK8A 1SMTA 3TO7A 3G0ZA 3F23A 5BRDA 4OKEA 4EIAA 4KICA 1QTMA 3CDHA 1RPWA 2ZSIB 2DLLA 2NRWA 3QEPA 2HOSA 1LDDA 3QOPA 1VQ7I 1B9NA 2JPCA 3WHBA 3K2AA 4XICA 3BJAA 3PUFA 1HR0K 1KLMA 3LSHA 1QZZA 1CZBA 3SZTA 3T19A 3I0RA 3OW2M 2L5QA 3IRQA 2O03A 1ATSA 3HHHA 4M3DA 4DUZK 4DYQA 3LSKA 5BREA 3VQPA 2D1KA 1IDZA 4H5TA 4BR0A 3GMEA 3U2RA 3CCUI 3CLQA 2ZWHA 3BP8A 2EA2A 2ZQBA 5M1FA 3RMBA 3E1YA 4II2A 2XSJC 1W5TA 3H1CA 3F22A 1WJBA 2FBXA 4FE7A 3I53A 3CJ7A 3R9PA 5DM7F 2FOKA 1SKSA 3C7NA 4C1NK 4ESFA 5GADJ 3WODF 1YJWI 1I1SA 3KYCB 1UFMA 2H6CA 4UY8I 4O44A 4M6XA 3RPQA 3P4IA 1BR1A 2EH3A 2GOXB 1OH5A 3TP3A 1Z9CA 1MBKA 4M3XA 1Z6RA 2EHGA 3BCAA 1USTA 3AVFA 3VQBA 1SD4A 3RMDA 1QVGM 3CERA 5CYQA 4WXDA 5EU7A 2UUAK 5AQGA 4BWJA 2EJRA 3QB0A 1CLQA 4J2BA 2BHZA 5GAEP 5FLXZ 4E0DA 3BZCA 1IV8A 1FTTA 3MK6A 3TEDA 5C12A 2JA7J 4D1QA 4F9OA 5DUIA 4M9ZA 1TAUA 1RT2A 4CECA 1TVRA 1OJLA 5C24A 2L7KA 2ZFUA 2LH9A 2A6TA 3FXLA 2MH9A 2VE8A 1NGAA 3FZHA 2F5DA 4A0YA 4H0VB 4ZJZA 1G3SA 2LOOA 2A40A 3LWFA 3ONQA 1TC3C 4MHGA 2ZJRL 1S72I 4GXOA 1LFUP 4K41A 5AQIA 2IEKA 5HS7A 4CFCA 4XRMA 4LD0A 3SFZA 1B8IB 1TWAJ 1UHSA 5GPCA 1W97L 3IFRA 2W25A 2NAZA 2K4BA 3LSPA 3PUBA 2W1OA 4UUVA 1YFHA 4H5RA 5DYMA 3TAEA 3TU5A 2Y48A 3MWMA 4IKFA 1SL1A 3H5AA 4CZIA 3FMQA 3WNHA 5C4JJ 4E7LA 1O3QA 1ZLKA 2PMUA 3A4CA 4XKCA 1X9MA 5IT9Z 3SDBA 3CF5L 2VCPA 2E36A 4PQUA 3QNOA 2R7SA 1O1WA 3HB9A 1KC8O 3T7ZA 2HNZA 4D7NA 3LSJA 3RTRA 3V81A 2FBHA 1S1WA 2WUSA 4FYDA 4CEZA 1OCTC 3MEGA 1XHZA 2E60A 3VQCA 3S1NJ 1QGPA 3TANA 2O8DB 5K5QA 4MLOA 3P9KA 2DTZA 2K40A 3LMMA 3DXJF 2G8HA 2JGUA 5M1KA 4H0PA 3CJRB 1E4FT 4E70A 3SFIA 4I01A 2VODA 4B1WB 4PL8A 2E5NA 1EH7A 3VYTB 2F4VK 1T0FA 2VJ5A 4N0BA 1S3XA 4HF0A 2I5UA 4G6QA 1SD5A 4E3SA 5LGUA 3G1MA 3OMYA 4OKJA 3SI6A 4IRGA 1XUPO 2DU9A 2X6NA 3HT3A 1UG0A 3OIOA 1CF7A 4PCQA 3LL3A 1GUUA 4JS5A 2K27A 4B9TA 3GCMA 3B8AX 3HOSA 2Q36A 4J8FA 2WOMA 1I3QJ 5E8IA 3ZMZA 4BGAA 2XAJA 4FW2A 3IV5A 2E7WA 1FWZA 4JYAK 2DN0A 1F9NA 1GLLO 1FXXA 3OSFA 4LG0B 4AWXB 3RKQA 5K7ZA 4Z2YA 5AR0A 1JXSA 4X64K 3NARA 1H0MA 2WY8Q 1ZBUA 1A5VA 4AM7A 4B1VA 1HMVA 5LJVA 4NYNA 3H5NA 2BBYA 1ETXA 4II3A 1BW5A 4CGDA 3FXOA 3HZJA 2ZJQL 4PSWA 3LP1A 2HHVA 4LSLA 3O9TA 3IHUA 4CEBA 1HKQA 2OF7A 3IUCA 2L9VA 3J81O 2V6EA 2FXAA 2R4GA 4BR5A 4N5SA 4M3YA 3FX3A 5AQNA 3CC4I 4F4KA 1QS4A 1I50J 3L4IA 2GTDA 1BA0A 5I42A 2ZF5O 1HKTA 2UUBK 1RT6A 3HSTB 4YOYA 1IN8A 3TSQA 3CCLI 3GBTA 4C3JJ 1S5JA 4V19S 2OPRA 3HOWJ 1GLCG 4LIUA 5H6RA 4UY8O 2VT2A 4LMYA 2RQQA 2O8FB 1TZLA 3CQ8A 4BRHA 2XY8A 4A5AA 4EHUA 3THXB 1X3MA 3LZIA 1HJRA 3ZSWA 4V19K 1L3UA 1YI2N 1VTNC 4BRDA 4HCCA 1S1TA 2YX6A 3TABA 3LP2A 2ZM6K 1PP8F 3MX2A 3ATVA 2Y2ZA 2HTJA 3OYNA 3AVIA 2M87A 3D1NI 2KZZA 3CMYA 2FF3B 4XORA 3M8PA 3HKZN 4ENNA 5E1ZB 4IOXA 4V2GA 2LREA 1D9DA 3VB2A 4ON0A 3FZLA 3O9RA 1LFPA 3FHNA 3ZT3A 2PAVA 3I56I 2XHBA 3DKXA 4U7BA 4FJNA 4MNUA 4CF0A 1MBJA 4CE9A 3HC7A 4YRVA 4JV5K 3KEYA 3S9HA 4FJGA 2Q3SA 3J8AA 1VHXA 2ZC2A 1VSKA 1ZR4A 3R60A 2KTQA 4M9XA 1XTAA 2BXZA 4U87A 4WQ5C 3LZJA 3U21A 2DA7A 3H3UA 1CZAN 1MJBA 1KD1O 4BGBA 3NE6A 1HKBA 4XLEA 2HF4A 4MQ3A 3HYFA 2P0WA 3MKLA 4XSXF 2E1NA 4L9VA 1BM9A 5D6EA 4JKBA 3L2RA 2K86A 3JRHA 1HW1A 1QA6A 5ICGA 2WY7Q 3OSGA 1ZLJA 2RREA 1M1EB 5C3EJ 3HTVA 3QLHA 1D5VA 1SVMA 2FJ1A 4RB0A 4KI6A 2BV6A 1HBXG 3KP6A 1RUNA 4BEHB 1A5XA 2VL8A 3CCMI 2BGGA 3GTOJ 1ETOA 2OANA 1XMKA 4HX4A 4G7OF 3CC7I 4ZTJA 1FBQA 4B1UB 3CDLA 3K4KA 2BW3A 1RR8C 3S2HJ 1GLEG 2RPIA 3S3OA 3W6JB 3JTGA 4XIDA 1UA0A 2M0MA 3DLBA 3TSUA 1U2VA 3B6CA 2CMPA 3C6HA 5KAIC 4CJEA 2CUFA 1VQ5N 2E2HJ 2PX9A 4H5WA 4PZJA 4R5PA 3NH0A 4FJLA 1XSDA 2GA2A 4KB0A 2OD5A 5J2QA 4Q4ZF 4M9SA 3EPZA 2YSRA 4JK7A 3CXCM 3H9GA 3K1MA 3BR6A 4K43A 4JKAA 1W36D 4EM1A 3OYHA 3ITHA 3U8XA 1R1VA 3M8FA 5AQOA 4U88A 3DBHB 5J1EA 1OCZH 4DQRA 1IBMK 2H1LA 1R4NB 4ID5A 1HNZK 1K4TA 2P9UB 3NDKA 2NRHA 1RBSA 2E2QA 4GV6A 2FUG2 2KKZA 3RMCA 3BTJA 5KGXA 4W5QA 3B73A 2CV0A 4M63C 3ZQFA 1UAAA 5LHIA 3OYKA 4MQ9F 4HF2A 4BACA 4Y3OA 1QVUA 1P92A 1F36A 1R5HA 3N05A 4IOCL 2A6AA 2NNWA 1Z05A 5CVUA 3EDPA 4DHYA 1IG8A 4CEOA 4CH7A 4BWMA 2HHWA 4KUMA 2QBYB 3E7LA 1N5YA 1KTQA 5EG0B 2E1ZA 4F93B 2DMPA 4DYCA 4RAYA 2KW4A 1JHHA 3THYA 4ICLA 3ISPA 2FNAA 2M7AA 2OPSA 4GO1A 4FM0A 2EIMH 4FCYA 1F21A 3ZXSA 4UHTA 4Y17A 2Q2EA 3ELKA 3VTHA 3S3NA 4NCGA 4QTRA 1Z77A 3O4WA 3J7YJ 4A3FJ 3GTKJ 4GKJK 4O0JA 4V2FA 4RW6A 3O9QA 1BU6O 3I71A 1TWHJ 2BE2A 3ZSXA 3NF9A 1V4SA 4CJ5A 3V9XA 5M1NA 2G7UA 4B1ZA 3CETA 4A3EJ 5J1YA 3DRSA 4NHJA 3LDLA 2A68F 4AM6A 4WF2A 1J5EK 3MDQA 5AQZA 2DI3A 2NVYJ 1WAJA 2KLAA 3VQ6A 2BEOA 3QYEA 2I7PA 4XRSG 1TL3A 4Z4EA 2R7XA 3OOUA 4X6AJ 1NGCA 1U8BA 3GXOA 1HX1A 1APLC 3CDIA 1DGKN 3WEEB 2FXUA 1EXQA 3PM1A 1HF0A 3IP4B 5LD2C 1HYSA 3IUOA 2HS5A 2UXBK 4ZYEA 4NCAA 1XGMA 3THWA 1J59A 1BL0A 2CH6A 4IFEA 5IOYA 3FHZA 2R5YA 3MMYB 1I6XA 4K8ZA 2HSTA 1TL1A 2QQAA 1TAQA 1ZGJA 2DPNA 4M71A 2GWJA 4OOIA 1FLIA 4DSKA 1TKDA 2NNYA 4W97A 5FO5A 2YR2A 4WXHA 4ZC3A 1BN5A 3KEOA 2CRGA 3U3YA 4I2PA 4W5TA 5E1WA 4E1JA 4KFBA 1HQCA 1KSPA 4CZMA 1ZR2A 1XCVA 1U6ZA 5B8HA 1DT9A 4IQ4A 2O8CA 4CBXA 4CFAA 4DQQA 1J09A 4KBOA 1GT0C 2ELHA 3KTQA 2PEXA 2UXXA 2LYCA 5EXWA 2OPTA 3ZX0A 4A3BJ 3H3ZA 1RI7A 1YW9A 3S14J 3ID6A 4DTMA 1Z0XA 4B9MA 1LOTB 3EQLF 3U9DA 2KDZA 2P9PB 1GLFO 3BY5A 4C2UA 3AVMA 4KHYA 1XGOA 4P1WA 3WQUA 3RR8A 2ITGA 3CUQC 1BISA 1M90O 5DM6F 2FD5A 4KIGA 2EFQA 4WCEL 1QQCA 1R5ID 3C2HA 3QBXA 5DMRA 1TQPA 4IZ9A 2G0EA 4FVMA 1HW5A 1YJ9N 4DV3K 1T95A 3FZKA 3DLHA 3L2UA 4BHCA 2HPMA 1NBWA 3AGRA 3WU1B 2DFEA 4NC6A 3OYLA 2F2EA 1YO5C 4WX9A 2KFZA 3ZQCA 1QRYA 5F1JA 2XY6A 2W6KA 3HIFA 3BTIA 1N77A 1FJGK 3AO4A 5EEHA 4DG1A 1QZ5A 3DM2A 2FBVA 1ZG3A 1HCRA 1R0AA 4M72A 1JUSA 4XNFA 3LSRA 1H89C 3TP0A 3HSRA 4O5FA 1OYWA 5JLXA 2P7VB 1ZN2A 1U6GA 4Q48A 3RKWA 4FZZA 2A5YB 2K9QA 3BTCA 4CJQA 5KRTA 1YHQI 4KT5C 1C0UA 1JCEA 4KJZA 2OV7A 2CGJA 2FF4A 5HODA 1Q9XA 3BY6A 2VG5A 1Y64A 2MG4A 1P7JA 1A5WA 3O9UA 4H0EA 1ZRCA 4DBQA 3ZCOA 3H46O 3S2DJ 4CCKA 2DA1A 1VSMA 2DDAA 3ZT1A 1IF1A 1RNLA 2JA5J 2LMDA 1OMIA 2EZIA 5GAEJ 4DZJA 1OISA 2NVTJ 2F9WA 4KIFA 3BR5A 4DSIA 1U5TA 5FKOA 1LUJB 1K78B 2OQRA 1WJ5A 2X6SA 1VQ6I 1HNIA 1B8IA 3CYMA 5DD8A 2CSOA 1D0XA 4IPAA 1Q1VA 2QKKA 1D5AA 4LJZF 4P9FA 1C0MA 4CGGA 3LAKA 4CW7B 3LDQA 3CPEA 3VQAA 1UMQA 2AQFA 4B9UA 1UB9A 1E4GT 3CFOA 3QYBA 4MGRA 5K5OA 5HDNA 3G10A 4DFPA 1IO2A 2R7YA 2R5ZA 3VEWA 3I55N 2E1CA 4BDPA 2QI2A 1YOVB 3BWGA 3HPOA 2HFHA 2WB1A 3GLLA 1RDDA 3PIPF 4DF8A 1QZEA 2PBDA 1TQMA 1X4OA 3M1EA 5FRNA 4XK4A 1BJAA 2F9TA 2P9NB 3WGHA 1H9GA 2YX4A 1W5SA 3TARA 1NKCA 3P9CA 3VENA 3TOBA 4PFOA 1PJRA 2EBIA 2ICWG 3PQJA 3WHCA 2HDDA 3L00A 3K4LA 3FXQA 4HV6A 2DODA 5M1QA 2P5GA 3F6VA 3QODA 1G3YA 3BQZA 2HOAA 2QF7A 3TBIA 2ZO4A 3ISNC 1FMWA 1W0TA 1SFOJ 3NBPA 4ILGB 4E1NA 3C95A 5AQSA 1KGSA 2EZHA 2EB7A 4DTJA 2PFBA 2NRAC 1AU7A 1Z3XA 3SQ1A 2OU2A 4LLLA 3L2WA 5AIQA 2M8EA 1N34K 4YIFA 3EETA 1USSA 1NGHA 4OAYA 3MXJA 4RLFA 4M7YA 2JQ7A 4LFBK 4O4GA 3VYRB 1QPMA 5BRFA 2JMWA 1REPC 1YI2I 3LAJA 2E4LA 2R7RA 5D5WB 2BH1A 3EEQA 5M5YJ 4FLZA 3H0GJ 4KB1A 4BJ5C 4CBWA 4WE1A 3VGMA 4IEEA 3WGGA 2KIQA 2VKEA 3H1QA 1MDMB 2Y0SN 3OOPA 4IZZA 2STTA 2QQ8A 1C1BA 3BF1A 3PY8A 1VQMI 2CW7A 2B63J 2NVUB 3CCRN 2LD5A 1XGNA 1LW0A 3GLXA 3QICA 3CCQN 3IKVA 2CUJA 1E3HA 1Y56A 1PYVA 3MAQA 4XLFA 3LA3A 3JS6A 3BTLA 4DIQA 2VPRA 4DZPA 2JLEA 4A3IJ 1KA8A 4JYKA 3M8SA 3SAGA 4OAZA 4BC4A 3QETA 1T8EA 1N32K 2HDWA 3BG3A 4B9NA 3G1OA 4LY7A 2HNHA 2ACJA 4J2EA 3C7JA 5KCMA 3M9AA 4KMFA 3EZWA 4FK2A 1SUQA 2O8FA 2IAIA 2Z9OA 5CLSA 1KAZA 3IAS2 4DR5K 3RVCA 2PQ8A 3THXA 3GZ6A 2IW5A 2XF7A 1MSEC 2KRCA 4BRIA 2R92J 4CICA 2ZJRF 3FM5A 5GP9A 4NYFA 4LC9B 2ID6A 1HJOA 5D8KB 1DU0A 1P9QC 1HDDC 4LD5A 5KQDA 2GUIA 1SFKA 4BY7J 5JHUA 2YU9J 4ELTA 4PWDA 2OCEA 2XASA 4KHSA 1FK9A 3ZSYA 3E97A 1D8YA 3O6WA 2RN7A 4CVNE 1NJXA 3NVMA 5F1RA 3F3XA 2XGCA 4FM1A 2V9VA 1IUFA 5KTQA 2QA4I 5CPRB 1HKSA 5CZ2A 3CF5F 3JRCA 1VQ5I 5AQHA 3A0HC 3EZ5A 4HUFA 4K8XA 4XKBA 1JUPA 4WFAL 3BZKA 3P38A 3OYIA 5IPAA 3V4IA 3CCEN 1VNDA 2DO7A 4A0XA 1ETYA 1HA8A 4GV9A 3ENHA 2LKPA 4L0YB 4A2UA 1TUUA 1XX5A 4CFBA 4N47A 1IKXA 3J7AY 1HKCA 1YF5L 1EQYA 4L9NA 5HS9A 3RZOJ 3K70C 2H09A 1IZ1A 2XO7A 3M4OJ 3Q0UA 2R7ZJ 2CFXA 5HDKA 5CVJA 4DSJA 3V7CA 4FLYA 2Z3YA 4BEHA 4CESA 1Y97A 2QWPA 2OYQA 4DWIA 4L5IA 3EE9A 3SAHA 1WUAA 4U67L 1RDUA 3PIOL 5F27A 2ZB9A 4EHTA 1BQNA 1A31A 3WTXC 4UXNA 3MQ0A 3GTMJ 3VQ8A 1G3TA 3K59A 1IRXA 3F72A 2ZD1A 2M30A 1WSIA 4NLBA 3BG9A 1IKYA 1EKEA 4CK3A 1UWBA 3IWFA 1I5ZA 4MTEA 4KHWA 2AO9A 3ZT4A 3ROUA 3QDKA 5JI6A 4A3GJ 3HXLA 1YUWA 3HOVJ 3K9KA 5EGOB 3QINA 4YIRX 4CO8A 2LBFB 2W6LA 2IS3A 1CZ9A 2ETHA 4B1XB 4A3JJ 2ZJQF 3NQOA 4S0HB 2P9IA 2B5JA 4RGXA 3HZ6A 1BUPA 1D0YA 4BJ6C 2P9UA 2OTLI 4CZLA 1N8RO 1L5UA 3AL0B 1ITGA 5GTIC 3BDPA 4Z6YA 2P5VA 3E9OA 4BR4A 2HHUA 3C3WA 5M1OA 5AONA 4Y52J 4FSVA 4DV2K 3SYTA 1W7AA 1N25A 3HSCA 2VG6A 4IX7A 3OHRA 5FFZA 4N41A 3OYJA 4EAHD 2QLZA 2D0CA 4H0TB 3ZEUA 2IGNA 3SBGA 4BQAA 1C0FA 1EO1A 1KCFA 1YQAA 3HVTA 5FD5A 5E18F 1CXUA 1Z25A 3VETA 4A93J 2QKBA 2QBYA 2QXLA 1C0GA 2GQQA 3HBTA 2RKIA 3VQEA 1QSSA 3VEZA 5LL6Z 1NG9A 4A5BA 2K9MA 1TT0A 4H5NA 4EVIA 1R23A 4BBSJ 2M8GX 2W57A 1VQLI 4DNCA 3LDSA 2M2EA 1Y1WJ 4A61A 1T7PA 4GYIA 4DFMA 1NK7A 3E5XA 4ENJA 5J6XA 1I1GA 4RB2C 3CZ6A 2A5XA 3KCCA 4B3RK 3QPSA 1D3YA 2EFWA 1NH3A 4JS4A 3QP5A 5TGTA 2ID3A 3T69A 2LY2A 1ZGAA 4CJLA 1XGSA 5J1RA 3WUHA 4E7ZA 3AVLA 4IJNA 4B3MK 1Y0NA 4ABZA 4BAYA 1O4XA 1MWMA 4ENMA 4KH5A 1ZQ3P 3BPVA 2MYSA 4FLTA 2W82A 4MQVA 5J1UA 4DTRA 2AHQA 3TO6A 1ZG5A 1L3SA 2YU3A 2D0PA 1KRPA 4HSTA 2NRXA 4O0IA 5D5XB 1NLVA 2K85A 3E5QA 4OWRB 2JUGA 1XN7A 1KVAA 2ZXHA 4JI2K 3OIPA 1RTHA 4BRGA 1RT7A 3C7NB 3F73A 1WQ2A 4PA1A 1BBYA 2K9NA 3ENOA 4NDLA 2DTUA 4OGEA 3HTSB 2E34A 3ZN1A 5LGTA 3W6KB 3NHGA 2AXTC 4RGUA 2R7TA 3IH2A 1Q18A 4H4OA 4DFKA 2XROA 3DLLL 2JSCA 5CQEA 1RCHA 3DOKA 4M3WA 1NG7A 3VYSB 3VQ9A 4JEPA 5L3FA 3P31A 2FA5A 1XHXA 2PI0A 1VQ7N 1X1PA 4E7HA 2JWTA 3SLCA 3NGYA 2Z16A 4O5VA 1BR4A 2XAHA 3D6RA 4HEA2 3A5LC 4DMNA 3QPHA 1WNSA 3PJRA 2CQKA 2GIZA 2Y1JA 1E2XA 1MMGA 1J53A 5J2PA 4C3HJ 3GVAA 1YTAA 5HRNA 2Y75A 3OS2A 1JCGA 1QQIA 4MFDA 4HQMA 1LEBA 4LF8K 5F6FA 2H94A 3WTSC 3AY9A 3WXIA 4FVUA 3TOAA 3JSOA 3AG1H 4HOBA 4GMJB 3V42A 2P9PA 3FFKB 3AA4A 3M8JA 4IO8A 1H1VA 2ZBKA 2HQ5A 4BG9A 1VQ9N 3WNFA 5GAHP 3LNQA 2WTEA 4HUEA 3I4NJ 3RR7A 4BG8A 4CEEA 5LMNK 4DV7K 1OH7A 1IGNA 3TWHA 2E8AA 1D1CA 1P4XA 4TV7A 4QCLA 4OIOF 3NVKA 1R4MB 4O55A 2I10A 3KHYA 1X58A 3CI5A 1PUEE 1JLQA 1E0EA 4JI8K 2F5VA 2BTFA 3TTDA 2RNGA 1KVBA 1OLTA 4CERA 5DV5A 1BIBA 4FLXA 3VDXA 3O4NA 3L9FA 4IOCF 4I7HA 3PX0A 4IDHA 2HF3A 1ASWA 2E2JJ 5CR4A 4WWCA 5KK1A 3G25A 3E3VA 4KN7X 1L3TA 1ZXOA 4FT8A 3NFAA 1I27A 4BR2A 1Z1DA 2R7OA 3DKWA 1JT6A 4IJAA 4NCBA 3V7RA 5L3CA 1ZTRA 4WFBL 1T8IA 4K42A 2MW8A 4CGZA 2IS4A 2K5CA 4IHXA 4KH6A 2K02A 1SC7A 3CCVI 4A3MJ 3LFKA 3DQVC 5EEAA 4EP5A 4KITB 4CUGA 2QWQA 5AQYA 2LF7A 3I55I 3VF4A 1QBJA 3G6EI 3CJTB 1NK0A 5H20A 4GVMA 4ENKA 3V7SA 1FKOA 2VIXA 3AVJA 3H0DA 2EQRA 1BOAA 1QSYA 2Z33A 3MZ8A 1XC5A 2HW3A 4MLHA 3ASMA 4CYCA 4CZHA 3HOTA 4DW6A 1NMNA 2QYOA 2XPUA 3E1SA 3NEUA 2RHKA 1JT0A 1JCFA 3BR2A 2JT1A 2O0YA 4DFJA 2XF6A 4CEDA 2CS3A 2IP2A 1C0WA 3OYEA 5JFRA 1NK6A 3LM9A 1ZYRF 3VPRA 3BZ6A 1K78A 4OPHA 3GL1A 2E7XA 3HOXJ 4CZEA 4E7JA 1XB4A 2VI6A 5JR3A 1LV5A 2WONA 2L9NA 2HR3A 2X51A 3F8NA 2L7FP 2Z5UA 5FJ8J 2JN6A 5JMVA 3H5RA 2YNIA 3R6SA 4GFBA 3KLIA 4CK1A 2XRIA 2M4KA 3A0IX 3MCPA 1BCMA 1TLHB 1HPMA 4FJ7A 3QQAA 1WCMJ 1NJWA 4AYBA 1LDJA 2ADUA 2OC6A 5K7FA 3HGYA 2P9SA 3P9IA 4AIDA 1I94K 3CESA 2XGXA 2HHXA 2L4AA 4JX5A 3T5XA 3QU6A 2P9NA 1W4MA 3D5SC 1RTDA 2FQ4A 4C30A 4AHUA 5DEQA 1SVOA 2XSDC 3CCRI 3KEQA 1S5LC 3CMMA 3VOEA 3BCBA 3HYIA 3CP8A 3WNGA 3BR3A 2D4WA 2RE2A 3AAFA 3K1PA 2P8TA 2JSPA 2HTSA 4W5NA 1LNWA 2WC2A 1OVQA 1IH7A 3CJNA 1J6ZA 2HOEA 3JRFA 2JWKA 5LJWA 2VWBA 1RGIA 3M3ZA 1TWGJ 1RNHA 3DOLA 4B47A 5HNHA 1ZYQA 2IS2A 3VMFB 1FP2A 2OAZA 4XN3A 5HNFA 1WB9A 2QQ9A 4WQ5A 3MN9A 5IP6A 2O61A 4G1QA 1LVAA 3AVNA 1T39A 4CEFA 5GAGJ 1Y0UA 1KU7A 3C18A 3W6VA 2GZWA 4F7ZA 1NG6A 3E6CC 3OVNA 1WJFA 4FM2A 4LITA 4JLHA 3QEVA 1X9WA 2IIRA 3HM8A 1HUXA 3EL2A 3CTAA 5IP9J 5D3GA 1J7KA 1ZC6A 5LBQA 2OA8A 3LFUA 3HVRA 4HUGA 4G6DA 4M3TA 4J01A 5J4YA 1J75A 1IUYA 3BR1A 4CEQA 3CP2A 4C9YA 4BL0B 1DGWY 4HSRA 2A41A 4XOPA 4WFNL 2X1DA 2MC4A 3LWMA 2ZNYA 5HBMA 3M5RA 4AVZA 2CH5A 4HWIA 2K4JA 1XC9A 1U78A 3MN6A 2QSGX 3MD2A 1DU6A 3CCEI 1DTQA 1DPUA 2RDPA 3HRMA 1XPXA 3I4MJ 3SK3A 1MMAA 1HSTA 2LP0A 3F9KA 4IHTA 2FX0A 2L54A 1G99A 2BW3B 1YTUA 4DSFA 3W2VA 3Q7BA 2DOEA 1IC8A 2HBLA 1EF4A 5AQMA 2MLGA 4EMSA 1U2VB 5L3GA 3HGGA 4EM2A 3I56N 1CGPA 3MCZA 1JLFA 1TQIA 2KT0A 3VEYA 1WJCA 1QQMA 4DR4K 5CQGA 4M74A 1YE9A 1FNNA 1OFCX 2WAFA 2RV8A 2NRZA 4PY5A 2XKOA 2ZNZA 2LF8A 3CIPA 4OIPF 2YHWA 1LE8B 3KK2A 4CIEA 4O8KA 4JKEA 1P6RA 2PBIA 1MMNA 3SXYA 2DFIA 5TKYA 2O4IA 2D1HA 4CXFA 2ZXIA 2IT0A 3TAMA 3RYPA 1B72A 1DGRM 2JPBA 5M3FJ 2ELJA 2WAQA 4P55A 2R0QC 2O9LA 3AO2A 4A5NA 1G59A 3TTCA 4FJ8A 3LM2A 3S2WA 4GYGA 2XB5A 5KPRA 3H3OB 3EY1A 2ISYA 1G15A 3B6OA 4RTFD 3R61A 4HHTA 1U45A 3DYAA 3LOCA 2BUPA 3O08A 1VRUA 1K83J 3KWGA 1VF9A 2D0AA 3CCMN 4DS4A 4D0PA 2CQQA 4DLEA 4RAFA 1JLAA 3U1KA 4PFPA 4C2TA 3OA9A 4KI4A 2BXYA 3K9TA 3F21A 4CHYA 4I6MB 4LFUA 1VQNN 3LAPA 5HOOA 3THYB 2DA5A 4B9VA 3AFHA 4BNCA 1BI0A 3RWUA 4IOAL 2JJ7A 4H03B 1OCRH 3S1MJ 3IG1A 2LFBA 4XLAA 4DKWA 1XS9A 2Q2EB 2YHBA 4BXUA 3CD6N 4FX4A 4WXCA 4HF1A 4CZJA 3DPUA 4A12A 2L7ZA 2DT6A 1LVKA 2A1SA 4YFXF 5EZGA 1B4AA 3N4QA 1EWQA 5B1BH 5DK5A 1R58A 2W48A 3VTIA 4GVEA 1R9TJ 3MN5A 1JKRC 3K2PA 2HVSA 4CGJA 2X74A 3FM3A 1QO0D 2XB0X 5AZIB 1HYVA 1NNEA 1TK0A 5C2FA 3DEEA 4HTUA 5T7BA 3AVGA 2E5ZA 1QZ6A 4P96A 1RDCA 1TW3A 4FJ9A 5BPDA 5EGOA 4UVBA 2JVHA 5A2QK 2LBFA 3HHGA 1KU9A 4RAGA 3THWB 4M7XA 2O8EA 1GLDG 4XN0A 1IDYA 2R5YB 2EWSA 3IRXA 3T1HK 4Z4IA 5IYBJ 3WTTC 3ULQB 3TAQA 5EDNA 1FOYA 2ZMEC 4Y13A 1GXPA 2EA4A 3AV9A 2R7FA 2VQCA 3K9JA 1S8NA 2GX9A 2GBYA 4E6KG 1X1DA 2A69F 5ILSA 1VAZA 4CCMA 4E89A 3VYUB 4HCBA 5F08A 4FK0A 2E1MC 4XQFA 3NMUA 4CJ7A 4KN4X 2EFNA 2K3FA 4NC8A 4DB3A 1FZPB 3WXKA 1TNSA 5J40A 4C8LA 1JUMA 1RDAA 3UKGA 1X3UA 4CDGA 3KP2A 5D5VB 3ULEA 1EH6A 3WE2A 4FX0A 3RI4A 1YX3A 2LY9A 5HRPA 2CO5A 3CCSN 4UNOA 5ADXH 1S1UA 4DR6K 3B6PA 3PNTA 3HM9A 3JSPA 4AHVA 4NXNK 2IBDA 2CV2A 4I7FA 3JRDA 1F4KA 2Z99A 4OMYA 1T6SA 1RDBA 1Q8IA 2E6LA 3VFZA 2V7YA 4HAMA 1JJ2M 1Z21A 4WF9L 3ESWB 4K0KK 2XRLA 4XEIA 1BHLA 4AHTA 4OGCA 3NGIA 1V4TA 2ZFWA 3E9PA 4P5OA 2QEXN 3DP7A 5D6FA 2G8KA 3ZQGA 2ISZA 2EV0A 3J7AP 3W2WA 3VQQA 4B09A 2R93J 1BOTO 1YW8A 3OL3A 4C2MJ 1AOYA 1MMDA 1WLJA 1T08B 2F7TA 1QQNA 1HXDA 4BGDA 4DOZA 4HA8A 2WADA 4RBOA 4BBRJ 4MFBA 3F2KA 3H9JA 3WTYC 1VQ9I 4M6YA 2DPDA 1G8XA 1XMQK 3M8RA 4HBLA 2WB1N 3FZMA 3WTVC 5J2NA 2FF6A 4B9SA 1W9HA 3TW7A 3AA3A 5CYVA 1BO5O 5L3EA 4DU4A 2G8IA 1Q7YO 3ABTA 3ZMSA 3EYYA 4CK2A 3ASNH 5ERIA 3QEIA 2HKXA 4DV1K 5GADP 2EZKA 5KPZA 1GOAA 3KYDB 4ISGA 1IAWA 1JXEA 3MFKA 4IRIA 4BYYA 4BQNA 2J5PA 1TUYA 5JVTA 3PIOF 5FPNA 1XMOK 2O7OA 3SJHA 3OYDA 1Q86O 1RDWX 5JLFA 2YCHA 1FX7A 2EWNA 3GE1A 3QPLA 4PUOA 1K61A 4XKWA 3SAFA 2YNHA 1N75A 5A2QZ 2IJLA 4KV8A 5D8LB 2L3DA 2COMA 5BRHA 1BG3A 4Y33A 1XMXA 1VQ8I 1MKMA 3MEEA 5F0HA 1U9OA 2Q0OA 4JI0K 3SQ2A 2BVLA 4OLBA 2IA1A 3EUHC 1OCOH 4KHUA 4KMUX 1U5TB 3FBIB 4QWQA 3DPTA 2E2NA 3W0LA 4BR9A 3EKUA 3ABKH 3W3CA 4IHSA 3GF2A 2JA8J 3V9UA 4PKIA 4M6VA 5SZTA 4OPJA 4L9JA 2F6CA 3KLHA 3AVHA 1UELB 4XIUA 4RB1A 4MTDA 1B9MA 5IY5H 4IO9L 1KQ0A 2FSKA 4NBQA 3RKXA 4XM3A 5HLTA 3SZ2A 2D5RA 3D7EO 2OTJI 1TK5A 2YHAA 2L2OA 4IWVA 1YT3A 2ESNA 1FPQA 1V4RA 3AG4H 1WJAA 2R5ZB 2QCOA 3X2QH 1PVEA 5C25A 2GEMA 5ILVA 2JA6J 1J5YA 1T03A 3FBNB 2KQRA 1Z3YA 1YHQN 1OH6A 4LLGF 2HBKA 3GZNB 3OYBA 3MZYA 4DBRA 1KLNA 1H9TA 3H3VK 4CCJA 5HRRA 4BE1A 3LSTA 3OR2C 2K9SA 3GYHX 3EKSA 2DJIA 1TNTA 3JAMO 4LB5A 3DI6A 2Y1IA 3PV8A 4HNVA 3DLGA 4JI1K 2P6TA 4RCHA 4DLGA 1LJ9A 2MGQA 5E3OA 3AVAA 3L3UA 1IV0A 3FXUA 1AKHB 3I0TA 3QYFA 1MBGA 1VQ6N 1DP7P 3VEPA 3HUGB 2IGIA 2PY5A 1MU2A 3PFYA 3EUAA 4IXCA 1WH7A 4G9YA 5FROA 4DQSA 3KP4A 5E1XA 2QTDA 3GTQJ 4CJSA 2XAFA 3DXMA 1MSFC 4RG8A 3O4QA 1HNXK 1JLCA 3L7WA 3H92A 2HXIA 4DR3K 1T44A 2FBIA 2ATQA 4X0GA 3GOIA 3HTUA 3A5OC 3F6OA 3T8TA 4EP4A 1VSIA 4JI3K 3CJBA 3FK7A 4CFDA 1DQUA 4KTQA 3KLFA 5F1XA 5HL7L 3BF3A 1Z7UA 2MH2A 1G6NA 4CBUA 3DRPA 1X3NA 4DSLA 2Q1ZB 3OR1C 3O9SA 3SPZA 2X4HA 1SS6A 3M07A 3DLLF 1Y1VJ 2DAOA 1ETWA 1XCBA 2QUFA 3QEXA 2TRTA 3G73A 4AHRA 2QGUA 2HVQA 3RPUD 4U0YA 4P9UA 3ABUA 2W7NA 4H8KA 2VKVA 4AHCA 4ZYDA 3MKYB 2DFFA 4FPBA 3O8HA 3QERA 1KU2A 1GVJA 4M42A 3CJQB 4UUSA 2GXBA 2P5KA 3UKUB 1MD0A 5IYDJ 2HHHK 2XHKA 4XH1A 1HKGA 1P4AA 4J19A 2DQLA 4NQWB 2KKOA 3IDHA 3P7NA 3ZETA 3KVGA 5FD6A 4QOZB 1SVLA 3MECA 3CPWM 2XAQA 2JTVA 4QS9A 2KPMA 3DXKA 1HQEA 2VWJA 2E2PA 2J4RA 2CW0F 3LA7A 4Y1CA 3K2ZA 5KAFC 1OR7C 2FBKA 1D8JA 3JW4A 1IKWA 3JREA 1SFUA 5E3MA 1ACIA 4CJFA 1FJLA 1VQMN 3S15J 4L9TA 3BLYA 3VEVA 3RYRA 4QIWN 2NZTA 3AO5A 4FLUA 5KHDA 4LLNA 4DTSA 3RZDJ 3TDZC 2AS5F 2DW4A 2LG4A 3J81K 3VQ7A 2IAJA 3Q5FA 1YITN 3T8RA 1C1CA 3K0LA 5F0FA 1JI8A 2ZJ2A 3WU2C 4BHPA 4Q5VA 3RSEB 3THVA 5KGWA 4ILJA 2FOWA 5FLMJ 1WI3A 1FMVA 1G3WA 5GPAA 5C42A 3SV3A 4M3GA 4R8HA 3U6FA 3LANA 4OPKA 4CF2A 4PJNA 3SCXA 1SL2A 3QNNA 1NMDA 4RM2A 4BRAA 4BRMA 3BG7A 4X65K 4KRFA 3Q7CA 3MMVA 3HOZJ 5J4VA 2VQEK 3SUQA 1ONVA 5E3LA 4ITVA 5SWMA 4CIFA 2D2WA 3E9LA 1OQYA 1K8AO 4C8OA 3HEFA 3UIQA 4Z4HA 4XH5A 3QIOA 3CC2I 5BPIA 3A5NC 2QWOA 1NK3P 1EV7A 2ASMA 5AJ3K 4FJKA 1TKZA 2WWYA 4C1NI 4NC7A 3J80K 2DYSH 2ASPA 2QA4N 1VQNI 1KFSA 3P83D 3CO7C 2Y30A 3GTPJ 2UUCK 1OCCH 2VWKA 3JRAA 2GWKA 3TTFA 1V55H 2JUCA 1IN5A 3D45A 4ELVA 3FWEA 3KX2A 3CD6I 1HNWK 3S32A 4PSXA 1VRTA 1ATNA 2P6SA 3RMAA 5E8GA 1B9FA 1NK2P 1LE8A 4FWMA 2P9IB 1O3RA 1N6QA 3M8EA 2OBPA 2VASA 5E17F 1D1BA 3A02A 1DKGD 1WFXA 3SDGA 1HQUA 2FC0A 1ORKA 2HHSA 1YVNA 3VN5A 4ZZDA 3U9ZA 4DTXA 1VSJA 2KRHA 3T3FA 1NGBA 2WBNA 4XLCA 1E17A 4J2DA 1RESA 3ZEUB 1XG1A 2L9RA 1QHGA 2O5RA 3SZPA 1A5JA 3JR9A 3VGLA 2IA2A 3PO3J 1S29A 1HPZA 5IYCJ 4BC2A 1Z6TA 1W5CC 1REVA 3OJSA 4CJUA 3V9WA 3GFJA 3M3YJ 3H1VX 3COAC 5K7HA 4I6MA 2TDXA 2X1EA 1BOBA 2E1YA 2CFOA 4H0OA 1XWLA 2KL4A 2CJJA 4Q47A 3MXMA 1FC3A 3WE3A 2ZJPL 1MJAA 2VQGA 1JXBA 3TDUC 4IVNA 4YEJA 4RGRA 5LHGA 5H6QA 5FLVA 2Q8KA 1RBUA 2NOGA 2KFNA 3KD1E 4MDBA 1RT1A 5FLXO 3DPLC 2OJED 3BJOA 2O8BB 1MBHA 3OV8A 4LF7K 4YOUA 3NAUA 4MIMA 1WSHA 4CI6A 4GRIA 5EEGA 4FJHA 2OTLN 4JKGB 1WKMA 4HTLA 2COBA 2FE3A 3CCSI 1QHTA 3CUOA 3DEWA 3VF6A 1MZBA 3E6DA 4WQ4C 4FWOA 4BR7A 1P7IA 5AZIA 3MVPA 1GLNA 2PZSA 3N4MA 3AARA 5K14A 1WSJA 2HBMA 4IXAA 4B44A 2PMHA 4A69C 3VPZA 1BI4B 4H0YB 3KP3A 2Z1IA 2QEXI 3SYZA 4HQEA 2E20A 1NK9A 3D2EA 4PGHA 3TKYA 4QPOA 2XY5A 3K69A 2FMYA 1CXQA 3FXKA 4OIQF 3HRTA 5E79C 1MMSA 5TKWA 4YELA 2H8WA 1VQLN 1QSLA 4OMZA 2CUZA 3SQ0A 1VSLA 3J80Z 4S05A 1U0JA 3IL2A 5IT9O 4CHZA 2X6WA 3JTHA 1WVRA 1XNRK 3QRFF 2QWLA 1UZCA 3FXMA 4B9LA 1ZK8A 4FWLA 2HWVA 2ME6A 4OPAA 9ANTA 1N78A 3SZGA 2QVOA 1HLVA 3VOVA 2X9DA 1J9AA 2A05A 5E20A 4MEXF 3AG2H 2UYTA 3V1OA 3QO9A 1OPCA 3TQNA 3L8BA 2FU4A 4E19A 2HI3A 4B1RA 3CF2A 3B6AA 3MCAB 2H27A 2F5FA 3R1XA 3ZSQA 1HC8A 2YNFA 4HLXA 2VKDA 3CG7A 3OWTA 1YIJN 4BVPA 3K4CA 1WRJA 2KMUA 3KK7A 2M5WA 3CJAA 1O3TA 1FYKA 4FOIA 1NGJA 3QOEA 2XDVA 1K79A 1ILYA 3ZN0A 1FYLA 3I59A 2OQGA 3RJPA 5B1AH 2OPQA 2ZSHB 4PKGA 5B66C 4O3MA 5F0CA 1Y8QB 3G71N 5FKKA 4HV5A 1O57A 4JP0A 4JI4K 4FW1A 2HBJA 3ZLJA 1JKQC 3V6DA 3QU3A 2NLXA 4A3DJ 5GINA 1BIUA 4LSNA 3SV4A 1X1BA 1LDKB 2KZMA 2DFHA 4WYBA 3TO9A 3V8KA 1SV5A 4XONA 1S6QA 4DTOA 4AYBN 4YDUA 5LLQA 4AM3A 3GBGA 2ITMA 4ISFA 4XMYA 1W0HA 4B8CA 2BY0A 4IOAF 4LF4K 3AG3H 3QEWA 2ZCWA 2KJBA 1VQON 5CJ9A 2H8RA 4DS5A 4LK1F 3TR8A 3RTVA 5IOZA 3N4PA 1NGFA 4ZYHA 1TYQA 2ECBA 2MFZA 4Z94A 3KLOA 3G4SI 2HZDA 3CMEN 4A6EA 3CJCA 2JVGA 4K2EA 2RGVA 3VSKA 4XKVA 3JRBA 4BRLA 1DUXC 3KPHA 4BREA 4BDYA 2QM1A 2XKPA 4CYCB 1TKXA 2HYFA 4KISA 2DOAA 1R71A 4M3RA 1G4DA 2LDUA 2UWMA 2LSNA 2NS7A 1LAVA 1LKXA 3ZSZA 2E1OA 2V9KA 4C8KA 3H9QA 3G3ZA 2VJIA 1JGGA 1JL1A 4I9QA 4FETA 3GO5A 2V6CA 3FMSA 1SD7A 5LEJA 1RIOH 1KQ9A 4KPYA 4KNYA 4DUYK 2IPQX 4KAZA 3S93A 4JD2B 2QWRA 5C4XJ 3W3DA 4KHNA 4Q0BA 3KKRA 3CCVN 2VGNA 1GLJO 2AXLA 3PSFA 2IA0A 4BRCA 1LFBA 2V26A 1NHAA 3V8LA 3PO4A 1UA1A 1WSFA 2CQXA 3C2GA 3G6EN 2LTPA 1O13A 2P9SB 2D45A 3P5JA 1WBBA 1VSFA 3KK1A 2VT3A 3NRVA 1T6DA 4Y0WA 3PO2J 1TWCJ 3F8CA 4BQOA 2L9SA 2XF5A 3BDDA 2YJEA 2BY1A 2IXSA 3UKRA 3KK3A 4OKKA 4JKDA 4KREA 3KD5E 1MBFA 2VYPA 4I6ZA 3HG9A 3J7AO 4BQQA 3K5NA 4PKHA 3ZMUA 1RRJA 4HG2A 2W42A 1J5OA 4I0AA 5CY4A 1JKHA 3D0SA 3HPHA 4HVJA 1SL0A 4EJVA 1GHCA 1WSGA 1MNEA 1AKHA 5LMUK 4FISA 3ZRGA 4CF1A 4RGSA 3HUGA 2JWLA 3RDIA 2GUPA 3A0BC 5LRSA 1RTJA 3AO3A 4KO0A 1SANA 2OZ6A 1NGGA 1WSUA 3WG7H 1SMYF 3BG5A 1X3ZB 3SQNA 4XSZF 3F5TA 4DQ2A 4IF4A 2IVNA 4A3LJ 4KIBA 2XUBA 5JS1A 3Q9VA 4I99C 1KAXA 2M45A 3LSIA 5AQFA 3OJUA 3H6EA 3ERMA 5BQTA 3S17J 2MBFA 3VA0A 2VBXA 2GXAA 4NXMK 1NK8A 5AZJB 4KKOA 2V1XA 2WAQN 5FPDA 2R3SA 4JHDA 2HQRA 5DTDA 1YXQA 4PUSA 4AD9A 2X6XA 4A5MA 2IVPA 2M0CA 2WC9A 1K4SA 2DMNA 4JX6A 5KPTA 1RR7A 4IHYA 5BR9A 2AP1A 1ON1A 4D5CA 1RZ4A 3DRRA 1KFDA 4XRSA 2W84A 3DKYA 1LEAA 1O7LA 2D5VA 5AQVA 2VXDA 3H3NO 5BPMA 2TCTA 4IG0A 3SEZA 3O8MA 4QPQA 2UU9K 1SKRA 1YITI 3OYCA 2P9LA 5AFUH 1W7PA 2VB6A 4KHPK 1LB2A 3K6GA 5BN9A 4FO0A 1I6HJ 2M4GA 3IC7A 4CHUA 3UKUA 4R79A 3IRRA 1K6OA 4H4KC 2X1CA 1RTIA 4BRNA 2VQFK 5C15A 1U49A 4E4HA 2OA4A 4N9HA 4NQWA 4PJLA 2AA4A 1ZBFA 2A3SA 4LH4A 2FRHA 1GV5A 4G7HF 2RAEA 1JJ6C 4YORA 1J2XA 3DBRB 1UHMA 4A0ZA 4JAXA 4BE2A 3R0JA 2HZTA 3DU6A 1YW7A 2PMZA 2M7BA 1X3WB 1YS7A 3HBLA 3I4PA 2NYXA 5C10A 3KYLA 4HZFA 5BMZA 2JK3A 3BOQA 3I5UA 4UB6C 3AGKA 2VKHA 1KXPA 4E7KA 1K8KA 2LVSA 2VPLA 1T05A 1YIOA 4I02A 1QHAA 2BZTA 4IO9F 5EF6A 3OTOK 5E26A 1ZG1A 4CCNA 3M7GA 3CCYA 3RQIA 3RCOA 3OIQA 3RKYA 1B72B 1BCOA 4A6DA 3GWZA 1J54A 4CHPA 5C2DA 4CYDA 5AIPA 4A3CJ 4FASD 3I54A 3VQ4A 4LOCA 3RSEA 1PUFB 1S7EA 4M41A 3IKMA 1RBRA 2LR8A 4JKHA 2IVMA 4M3EA 3BGRA 4B48A 3UR3C 4U7DA 4RLQA 1UOCA 3O1BA 5J8FA 3W2AA 3VQDA 5FPEA 1OYIA 1S22A 3GFLA 1R49A 2LNBA 3HOUJ 2HXOA 1TWFJ 3L4QA 6PAXA 5J8CA 1QNTA 3K5LA 3BJ6A 3SMSA 4NNJA 4DV4K 2CV1A 4G94A 2GA1A 2QKLB 2PLYA 4L8RB 3AVKA 2CWEA 3A03A 3K58A 5LHHA 2FMLA 1U2WA 3T1YK 1FYMA 3OS1A 4KTWA 1Z26A 4ZDLA 2B7EA 2P1JA 3UNGC 1IG7A 3J80O 2DYRH 5AQRA 2QXFA 1JKOC 1YJNN 4HYEA 1O3SA 4D9JA 1WH5A 4JK1X 4DR7K 2P51A 5CZ1A 1FOWA 5KRSA 3S1QJ 1XNQK 3SEQA 2KISA 3DLKA 5DCMA 1E3OC 5JHFA 2ZMEA 4BHBA 3K70D 3SQ4A 3M6GA 2XGEA 2VOPA 2D0OA 3HRUA 3IH3A 2DA6A 4CJTA 3NH2A 4PJ0C 2EILH 4XOTA 4CJWA 3GTLJ 1JLBA 1BJZA 1NGIA 2OCCH 1QU3A 3QIPA 2O8EB 3WXLA 3WT0A 2FNPA 3DCFA 3S41A 4ELUA 1QZYA 2HU9A 3AKZA 2CW8A 4F2RA 1ENHA 2FQ3A 2HB5A 2NXNB 4DQPA 3FDYA 2DY4A 2VXZA 4L5EA 3O3FA 3C94A 1W36C 4DSEA 1UHWA 4DTNA 4CA0A 4FHTA 2GBZA 5J3LA 3O80A 3WG9A 1U48A 3DBLB 2L4MA 1NU0A 3IAM2 2M1BA 2HVIA 3J7ZI 4BU2A 1TTYA 1N36K 2M9HA 5E3NA 4HNTA 3FF5A 4ZYGA 2P5OA 4CJ3A 4M3BA 2XGDA 1Y39A 4B1YB 3HXMA 4YFKF 3ULEB 2P81A 3AA2A 2F8SA 3CUQB 1NOZA 3S3MA 2Q2RA 3FIWA 1A35A 1GOBA 1RT3A 4EJWA 4D7MA 3O5BA 4AUXA 3Q0VA 2F4MB 2P9KB 4FWPA 1MGTA 2QSFX 3VF2A 2WAEA 4YFUA 3V1RA 1ETQA 4I2OA 1HOMA 3S8PA 2PJPA 1Q81O 2RC4A 4IFYA 1JHFA 3GFIA 1U9NA 2D1VA 1PDNC 2AJQA 4DQIA 2MD5A 2O8BA 3HK2A 2QM3A 4XRFA 1V5EA 1IXSB 4UVAA 1RC9A 3DV8A 4CGFA 4JKGA 5AQTA 4DTPA 1T38A 1IN6A 3CJ1A 1L0OC 1OKRA 1ZKGA 4B43A 1RBTA 1HRHA 4CEAA 2LK2A 3A5MC 4HLYA 1LAWA 5TRDA 2A6EF 5BNGA 1OKJA 2YKMA 1EP4A 2R7QA 1YIJI 3KLEA 5EJCA 1ETKA 1W0UA 3FE1A 3ZQIA 3BUZB 2Z1JA 1NGEA 4RW9A 1V5GA 3MAJA 3KZIC 2UXNA 1FIAA 2B0LA 1WBDA 1BI4A 2O4GA 4FJMA 2OPPA 4ZDOA 1S1XA 1TK8A 1UJ8A 2UXCK 5F04A 2F5CA 1XD7A 5LFAA 4H0XB 5CKTA 3I33A 3D5LA 1MA9B 3G71I 5BR8K 3BROA 1X1AA 4YOVA 3GUDA 3SPYA 4IEJA 3C1DA 2W85A 4DR2K 4G6TB 1T2KA 1ASUA 1KU3A 1VQ4I 3HM5A 1XI1A 4CJVA 3EUHA 2IRFG 2DA4A 4Z4FA 2CGPA 1Z91A 4N56A 3LPTA 4AIKA 2XC7A 2LSOA 3ZQ7A 3TAFA 3M1CA 3ZMTA 4OIRF 3K57A 1R6RA 1F1ZA 1AHDP 3GTJJ 1XQSC 3T1AA 3DMJA 3VGKA 1LWEA 2Z1GA 3G1LA 4UV9A 4EFHA 2HYJA 5ELZA 5F0XA 4FJ5A 1TP4A 3ZQLA 5JLWA 3I9V2 3JRGA 4RM3A 2EIKH 1VQOI 1VK0A 3EN9A 3R4KA 4B3TK 4NLCA 2IC3A 2KHOA 3ZGKA 4OX9K 3FKIJ 2IDOA 3TI0A 1BDGA 3CMEI 5EVZA 2BYVE 1A36A 2KHMA 5DD4A 1XMAA 2YPRA 4CZZA 1JL2A 1DLOA 2OZMA 1B1BA 4B3OA 1N33K 4XLHA 2O3FA 4UVCA 4IEIA 4M73A 3RRHA 3MWTA 3LA2A 3L3VA 3LAMA 3K4BA 3LP3A 3D2FA 3EE8A 2EIJH 1ESVA 3P39A 2VUMJ 1D1AA 3DTKA 3PNVA 2XAUA 4RW8A 4QS8A 4A2BA 4MFEA 5BPLA 4GY2B 3K5MA 3E01A 3K5OA 4E7SA 3AL0C 1MIJA 2RVCA 2M3AA 2UV1A 4LF9K 2R7UA 5M5WJ 3SBTA 5JVGL 3SJMA 2NUBA 3GG4A 4XL9A 1QVTA 2X78A 4Y15A 1IJWC 2BY3A 4WK8F 4UQGA 2IGMA 4PK4A 1YX5A 1ITYA 3VWBA 4RA2A 2W40A 3CLOA 2DDBA 1IN4A 2ZJPF 2VG7A 1VQ8N 1K6YA 3SUNA 2V1UA 2CGLA 2YKNA 4CGHA 2A5WA 3RPUA 2G9WA 4CJPA 1D5YA 1ASVA 2VC1A 1ZH5A 3FK6A 3SUPA 1LWFA 4HX7A 4NO7A 3SNNA 4JK8A 1UG2A 2EINH 1SAUA 1B92A 4I9LA 4I76A 5MLCQ 5M3MJ 3A01B 1Q82O 4BXXJ 1ZAOA 3C6UA 2Y31A 3ABMH 1DEJA 3DXMB 4JKCA 3J7ZO 3OYGA 2HMIA 1STZA 1XSVA 2V79A 3L6QA 3ATUA 3ZMDA 2OTJN 3OS0A 2MA3A 1B6AA 4YHHK 2I7NA 2E19A 4MLEA 1R5GA 2PYLA 5I9EB 5FFXA 4YOWA 4NB4A 4FLWA 4EEFG 3ALYA 2PFUA 4JBAA 4AIHA 3E6MA 5AQLA 2DQRA 4CCOA 5K5RA 2VBWA 1FBSA 3FISA 3K4MA 1YTYA 4ZTFA 2Q0RA 3PX6A 4I09A
chains in the Genus database with same CATH topology
3VQ8A 2OZSA 1KONA 3G0ZA 3AO5A 4FLUA 4OKEA 5KHDA 4DTSA 3K59A 1IRXA 3PO5A 2ZD1A 4BJTA 1QTMA 2ZSIB 1WSIA 2LG4A 1IKYA 3QEPA 3VQ7A 1EKEA 2IAJA 1UWBA 4CK3A 4KHWA 1C1CA 1S9EA 3ZT4A 1JI8A 3PUFA 4Q5VA 3HXLA 1KLMA 1FKPA 3LSHA 1CZBA 3T19A 3THVA 5KGWA 3I0RA