3HPGA

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCQENKMGIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 66
structure length 194
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hpgA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpgA02
1MU2A 3PUFA 1RBVA 4ZTJA 1RT5A 3LWMA 1IO2A 1S1WA 3AVNA 1JL2A 3CFPA 4B9LA 2YV0X 2HW3A 4Z4FA 1UA1A 4HUGA 3RMCA 4CFAA 1YTUA 4HUEA 4CEQA 1LW0A 5HRSA 2KZMA 3DRSA 4UQGA 3CM5A 3ZSVA 4OKEA 1C1CA 1W9HA 2HB5A 3O4QA 4OKJA 1Q9YA 1FXXA 1DLOA 3AVCA 4WE1A 1HJRA 3RRGA 1JLBA 4CJRA 1WJDA 2F8SA 3SUPA 3WNFA 3SUNA 1U47A 1Z26A 2VWJA 2KZZA 2HVHA 1IKXA 1W0HA 1HYZA 4DFMA 4CIEA 3K59A 4XIUA 4DTNA 3RMDA 4FLXA 1HQUA 4KTQA 3AVAA 5J2NA 4OLAA 4DQIA 2YNFA 3S3OA 5D3GA 4DS4A 4FJ7A 3P1GA 1QS4A 2P1JA 3SQ1A 4CK1A 4B9TA 4KI6A 4TSXA 3TAFA 4CEAA 3ZSQA 4DU1A 4O44A 3KD1E 4W5NA 4NYNA 1LV5A 3C6TA 2XRIA 2YKNA 4PWDA 2Y1JA 1JL1A 1WSIA 4CHPA 1U04A 3SUOA 3LPTA 4CK2A 2IS3A 3M8PA 3WNEA 3NGIA 4DQSA 3I8DA 1RBSA 3QERA 4J2EA 4KRFA 1VSHA 3AO4A 2G8WA 3PO4A 4KB0A 1DTQA 1HNVA 2G8HA 2VG5A 4ID5A 4DFKA 4QAGA 5T7BA 4CERA 3LP0A 1BQNA 4KTZA 3K5MA 3V1OA 1NK5A 4M3WA 1ZBHA 1I3AA 4LH5A 1CXUA 2WOMA 3OVNA 3QINA 2E6MA 3OYNA 5I42A 4KHWA 3B6PA 4E89A 4N56A 3ZSOA 4FW1A 1NJYA 3DI6A 1FKPA 2XO7A 4Z4GA 3SV4A 1NK4A 4CGFA 4RW4A 2VWKA 3EY1A 4CJPA 2PYJA 1UAXA 1WSEA 3VQDA 1XI1A 2OZSA 4JS4A 4HHTA 4BDYA 1BCOA 5DK5A 4FJMA 4CGIA 4N76A 2FBTA 1T03A 4HCBA 4LSNA 1RBRA 3NCIA 3TR8A 2VG7A 4BWMA 3HP9A 3AA3A 3AVMA 1VSLA 3S3NA 4I2QA 3MXJA 2D0BA 4NYFA 4Y1CA 5HRRA 3VQ4A 2OPQA 1S6PA 3VQ7A 3NGZA 4CIFA 1L3UA 2BGGA 4EZ6A 1TAUA 3OYHA 1HQEA 2HNYA 3OYLA 3NE6A 3ULDA 2BE2A 5CZ1A 1TAQA 3KLFA 1WJBA 1BI4A 3V6DA 4FZZA 3DLGA 3DOLA 3KLHA 3HT3A 3THVA 3SZ2A 4B3OA 3ZT0A 4KI4A 1KTQA 1TKXA 4CESA 1D9DA 2KFNA 4G1QA 3HO1A 1VK0A 1T7PA 1IG9A 4PA1A 3L2VA 1A5WA 3MEDA 4B8AB 1BI4B 2KW4A 4I9LA 4H4OA 4R5PA 4FLZA 1S5JA 4B9NA 3CM6A 4BE0A 1HYSA 2HHSA 3K58A 2NUBA 4E7HA 4KHSA 3LAKA 1S1UA 1EX4A 3SV3A 1SKWA 2B5JA 1IKVA 1TL1A 3NF6A 5JS2A 4KHYA 1IKWA 1VRUA 3O3FA 5HRPA 3ZSYA 2YNGA 3V4IA 3AVLA 4ID1A 2XY8A 3O3HA 3ASMA 2XHBA 4DTUA 4HUFA 1NKCA 3VQPA 3U3YA 2G8FA 2QKBA 3PV8A 2IOCA 3P83D 1S6QA 3QEPA 3DLEA 3EYZA 3U3GA 4KHQA 3LP3A 4OGCA 4CGJA 1RTHA 5K14A 1EP4A 1WSGA 2X78A 2QXFA 3AO2A 4HTUA 3VQEA 3SYZA 3HPGA 5SWMA 2Z1IA 4CJ5A 4DQQA 4ELUA 2OPRA 4KREA 3PX4A 3HXMA 2XY7A 1KSPA 4W5RA 4FJHA 1RTDA 4FW2A 1RBUA 2RKIA 2YNIA 4DTXA 5HBMA 4FYDA 3V9UA 2FBXA 3L3UA 1S1TA 3VQ5A 3O4NA 2Z1HA 1RT1A 3NBPA 4KPYA 1WJEA 1KVBA 3AVJA 3WNHA 4CFBA 5KRSA 2E6LA 3ZSZA 2RPIA 3PO5A 1RDAA 2D5RA 5DMRA 3V9ZA 3TANA 4FJLA 5HLFA 4FJ5A 4KHNA 3CQ8A 4DLEA 3M8RA 3DLHA 1A5VA 4BDZA 3QEVA 4M41A 1GOBA 4DF8A 1JKHA 3SCXA 1JLQA 1KVAA 3T1AA 1B92A 3V9SA 1U49A 4FK2A 4Q5VA 3AVIA 2YHBA 4FZXC 1KRPA 4AHTA 1EKEA 3VQ9A 1TVRA 1TK8A 4CJFA 3HJFA 4M3TA 4RW9A 2OZMA 4AHSA 3CFRA 1RCHA 1NK6A 1O1WA 4CEOA 2GBZA 5J2PA 1KONA 4LY7A 3IAYA 1ITGA 3KD5E 2YNHA 4ZHRA 1QSLA 3DRRA 3OYKA 3HPHA 3QIOA 3DOKA 1A5XA 3MXMA 4FJJA 1JXEA 4DSEA 2PY5A 3AVFA 2ZE2A 4W5QA 4ELVA 1S9GA 1WJAA 3HVTA 3QEWA 2Y1IA 1TKDA 4F3TA 1RBTA 4FJ9A 3OY9A 4JS5A 2X6NA 3C94A 4M3XA 2KTQA 1CXQA 1VSMA 4CF8A 1HMVA 3EZ5A 4DQRA 1XHZA 1XC9A 4N47A 1HNIA 4FZYA 4M42A 4PY5A 2HNDA 4CHQA 3JSMA 1JLFA 3P5JA 3QNNA 5FRNA 1VRTA 4OPKA 4DTPA 4FVMA 3TAMA 1C1AA 2PZSA 3HVRA 4FM0A 3VA3A 4M45A 4DTRA 3OYDA 1RT7A 1VSEA 1Q8IA 3AA4A 3MECA 4IDKA 3NF7A 3PY8A 4RW7A 4CEDA 2O4GA 4CE9A 3D0PA 3I0RA 3V1RA 4CEZA 4IBNA 4Z4IA 4HVJA 4DQPA 3LZIA 2IC3A 1UWBA 2DFEA 2VG6A 5EU7A 4CJLA 4E7IA 1TKTA 3RMBA 4KB1A 4QOZB 3SPZA 3ITHA 3OYAA 1U4BA 4DFJA 2O4IA 4Z0UA 4KV8A 3NDKA 4E3SA 3S3MA 1UOCA 4YNQA 1L5UA 3OYCA 3ZSWA 4CGHA 3KJVA 2HHXA 1RT3A 1NJXA 3AO3A 2EHGA 3OYBA 2R7YA 3TABA 3DMJA 4FJIA 4CF1A 1Z25A 1WSFA 1X9WA 3ZSRA 3OS2A 3JYTA 1NK8A 1J9AA 3CYMA 5HROA 4AHVA 3KIOA 1BCMA 3IG1A 4K8XA 1CZBA 1WJCA 3ALYA 2BANA 4N5SA 1HYVA 4NCGA 1WNSA 4W5TA 1N5YA 3LWLA 2G8KA 4F8RA 3K5NA 2B4JA 3VQ6A 1GOAA 2HHQA 4DTMA 4JRQA 2ITGA 3C6UA 2P51A 4FJ8A 1QHTA 2YHAA 3KKSA 1EETA 4CF9A 1B9FA 1C0MA 4CHNA 3PX0A 3NFAA 1U45A 4FJXA 2X6SA 1VSIA 3HPOA 3TAQA 1RILA 4CJ3A 3LALA 4M3UA 1XHXA 1TK0A 4NCAA 1WLJA 1BIZA 3DYAA 1QE1A 3L2WA 4CJUA 2Z1GA 1D9FA 2P5GA 4CCHA 3AVBA 1TKZA 3L2UA 4CJWA 1WJFA 1RT2A 1JLGA 3QNOA 3AV9A 4QCLA 4B08A 3MAQA 2QKKA 4KHUA 2KFZA 2FC0A 2EX3A 4GVMA 3A2FA 3L2RA 3G0ZA 3NHGA 1NK9A 3SI6A 2GV9A 2HHVA 3AO5A 4CEEA 1C1BA 2P5OA 4CK3A 3SJJA 3RWUA 4OLBA 5J2QA 4E0DA 1SL1A 3K5OA 3F73A 5FRMA 3OJSA 2OA8A 1RDBA 4DSLA 4M3YA 4CF0A 4CFCA 3SNNA 3VQAA 4FJNA 1WAFA 5KGXA 4CFDA 4J2DA 1ZBLA 3HL8A 4F2SA 1F21A 2DY4A 4W5OA 4CHOA 3OYIA 2G8VA 4KAZA 3KK1A 3LDSA 1NKBA 3HSTB 3K2PA 3KKRA 4FXDA 4KO0A 4Q0BA 1G15A 3M8QA 3ZT2A 3VQCA 2FBYA 1C0TA 1JXBA 1X1PA 3MXIA 3LP1A 3MEEA 1L3VA 1KLNA 1SKSA 4IG3A 4AHUA 3OS1A 4DWIA 4FLVA 1J54A 5CY4A 3V1QA 1X9SA 1ZBIA 1I39A 2FBVA 1LWEA 3AA2A 3CG7A 4AH9A 4ICLA 3T19A 3OS0A 1CLQA 3QESA 3V9XA 1VSKA 5KI6A 4O0JA 4EP4A 4CJTA 4BE2A 3RMAA 4IG0A 5JS1A 1LW2A 2ZD1A 3AVGA 4E1NA 4Z4CA 4LSLA 5J2MA 3KTQA 4KFBA 3L8BA 1TGOA 1E0EA 3LAMA 3DRPA 1GOCA 4AILC 4ELTA 3DLRA 2JLEA 3HP6A 3L2QA 3VQ8A 3LANA 5KGWA 4B8CA 4E19A 4RW8A 3SPYA 1NJZA 3OJUA 3CFOA 2D0AA 4LH4A 2DFFA 3RRHA 4FLTA 4Z4EA 4DF4A 1UA0A 4C8MA 2ATQA 1U48A 4E7JA 4FLWA 1SL0A 1D5AA 4RW6A 2OPSA 1JLEA 1QQCA 2ZQBA 4CGGA 2HMIA 1L3SA 2DFHA 3U6FA 4GMJB 4ZTFA 1SKRA 3DM2A 3NGYA 1S1VA 3ZT4A 2D0CA 4CJSA 1KCFA 3LPUA 4IFYA 4AHRA 1IKYA 3OYEA 3BDPA 4FJGA 3OYGA 1L3TA 4RG8A 4J2AA 3ZT1A 4CHYA 4DS5A 1ASUA 3KLEA 4O4GA 4KTWA 3D45A 5HRNA 2QK9A 3NH0A 1RTIA 4FK0A 3KLGA 4B9MA 1KLMA 4I9QA 3QEXA 4Y1DA 4PQUA 2XY5A 2KQ2A 4JLHA 4F3OA 1K6YA 1C6VA 1J53A 1IH7A 3SQ2A 3LP2A 4EZ9A 4BACA 1T8EA 2DTUA 1RDDA 1LFPA 1X9MA 5I3UA 1ZBUA 5CYQA 5C25A 3TI0A 1T05A 1BHLA 3VQBA 3HM9A 4FLYA 4DTSA 2XY6A 3QO9A 2F96A 4DSJA 1RT4A 4MFBA 4FK4A 1FK9A 2IDOA 4JRPA 4E7LA 2RN2A 3UIQA 3NF9A 4O55A 1JLAA 3PX6A 4CJEA 1N6QA 1YT3A 3QIPA 3E01A 4CJKA 4O0IA 1TV6A 4DLGA 1R0AA 5HP1A 2W42A 3TAPA 1REVA 3HYFA 2JGUA 3QLHA 4IFVA 4LD0A 4CHZA 4HCCA 3RTVA 4B9SA 1TL3A 2A1SA 4BE1A 4DU3A 3H08A 1EXQA 1XWLA 2YKMA 3TAGA 5E41A 4FJKA 4CEBA 4N41A 4YFUA 4E7KA 5J1EA 1LAVA 2B6AA 1Q9XA 4MQ3A 2HHWA 3LZJA 4H8KA 2E4LA 3WNGA 3V81A 1SL2A 5KRTA 1RNHA 1KFSA 1CZ9A 4C8KA 2F8TA 3ISNC 3IRXA 4FLUA 3DLBA 3IS9A 4DTOA 4I7FA 2PYLA 4O5BA 1MW7A 3F9KA 1HPZA 4OJRA 3NAEA 3BGRA 2GUIA 2LSNA 2IAJA 2BDPA 3K5LA 4OKKA 2WONA 1C0UA 4BWJA 3TARA 3HK2A 2G8UA 1NJWA 1DTTA 1RDCA 4I2PA 4C8NA 1ZYQA 1J5OA 3FFIA 2X74A 3S9HA 3OYMA 5FROA 1QSSA 1KVCA 5CZ2A 4E1MA 3T3FA 1JLCA 4F4KA 4K8ZA 3ZT3A 1ZBFA 3NH1A 3KK3A 4F2RA 4CJVA 1NOYA 4C8LA 3QETA 1TK5A 5KTQA 4CECA 4DFPA 2OYQA 3B6OA 3RR8A 1RT6A 3MEGA 2Z1JA 3RR7A 3OYJA 2HHUA 4OGEA 1SV5A 4AHCA 1YTAA 4DU4A 1QSYA 5FDLA 1ASWA 4DTJA 1WSJA 1YVUA 3AO1A 4FCYA 4DSIA 4NCBA 4DMNA 1NKEA 1ASVA 1KFDA 4IKFA 2HNZA 2A1RA 1SUQA 3V9WA 2OPPA 2HVIA 4BDPA 3K57A 1WSHA 1BQMA 1WN7A 3SQ4A 3AVHA 4F3QA 1VSJA 3NH2A 4CF2A 3M8SA 1BGXT 1LWCA 4H4MA 5CYMA 3C95A 4J2BA 2G8IA 3O3GA 3L3VA 2Q3SA 1S9EA 3ZSXA 4OPJA 3OYFA 1RTJA 4OVLA 2AJQA 1QTMA 2HHTA 1NK0A 3AA5X 4M3RA 1BIUA 4CJQA 4CEFA 4FM1A 2RF2A 4C8OA 1S1XA 1LAWA 5SZTA 3I0SA 4KKOA 5C24A 4M3ZA 1D8YA 3VA0A 1B9DA 3AVKA 4DSFA 3SQ0A 1NK7A 4B9VA 3ZCMA 5C42A 1Y97A 3NF8A 4PUOA 1HRHA 3SUQA 4CIGA 3VQQA 4CGDA 3DLKA 2I5JA 3KLIA 4DG1A 4DSKA 1VSFA 3G10A 1WAJA 2IGIA 4L8RB 4Z4HA 3KK2A 3VN5A 4B9UA 2ETJA 1NOZA 4CJ4A 3TWHA 1FKOA 4FM2A 3QEIA 1VSDA 3TAEA 1BISA 1LWFA 4EP5A 4GW6A 1BL3A
chains in the Genus database with same CATH superfamily
2O9LA 1MJBA 3CUQA 1Z6RA 1JL2A 3M3YJ 1W9HA 2NRHA 2VJIA 4I6MA 2VWJA 3BP8A 1MBHA 1BDGA 3GUDA 3Q0WA 4FJ7A 4PL7A 1S3XA 4PJNA 5C3EJ 2XRIA 4LF5K 2QWOA 1X1BA 2GOXB 4H5VA 4UY8O 2HGCA 1DTQA 2G8HA 3HSFA 4JI1K 1CGPA 2ZJRL 2W00A 4HTLA 4A59A 3CJRB 4OINF 3OYNA 1FJGK 5BPIA 1NJYA 2Y0SN 2J5OA 2PYJA 3DCFA 1A04A 3VEXA 4J8FA 1TQMA 2NVTJ 3THWB 2W82A 4ON0A 5EX5A 2E20A 2CH5A 2HOAA 4FSVA 3M8EA 3MX5A 2HNYA 1QQIA 2BE2A 4M3EA 3RZDJ 2PMUA 3HO1A 1DU0A 4YIFA 4CZKA 4I9LA 3K58A 2NUBA 1XMAA 2OTLI 1Q82O 4J00A 3ASMA 1XD7A 3F6VA 4MFEA 2VQLA 5B1AH 4OIPF 1S6QA 1HF0A 2CGPA 3H6EA 4CGJA 5DDGA 3FZKA 4DTXA 1KVBA 5KRSA 5M5WJ 1KU7A 4QTRA 3ENHA 2EH3A 4KMFA 3K10A 4FJ5A 3QEVA 2CV1A 2KL4A 1B92A 1R36A 2LMDA 2OQGA 5IYDJ 2GBZA 5J2PA 4XMYA 4U0WA 4FJJA 5L3FA 1WJAA 4DYQA 4ETSA 3LA7A 4N47A 3QODA 2MA3A 2ZBKA 1ZELA 1R71A 1HKGA 3V1RA 3ZR8X 1SAUA 1WB9A 4DQPA 2PN6A 4AF1A 1P6RA 2EIKH 4ABZA 2ZO4A 3HSRA 1YO5C 1NJXA 4WQ4C 3IP4B 5FPMA 4C2MJ 3E6DA 4FISA 1NK8A 3QQAA 1Q81O 1W7PA 4ILJA 3VQ6A 4G9ZA 5ICEA 1RUNA 1U2VB 1U45A 2FF4A 4BR7A 2IGKA 4BR5A 3L2UA 4OWRB 2QKKA 4RM2A 1V4SA 2K9SA 5AQZA 3F73A 1NGBA 3GE1A 3HC7A 5DM7L 4HYEA 5KGXA 2K4JA 3J81K 4LF8K 2L3DA 4KAZA 5EF6A 1V4TA 1HDPA 4AHUA 2QTDA 1N32K 5DCFA 2AXTC 3CG7A 1EO1A 2LY1A 2HYJA 3LMMA 3RSEB 3ZRGA 4JEPA 4KFBA 4PJMA 3KLNA 3VQ8A 4X6AJ 3RRHA 1T95A 2NVYJ 2ATQA 1SFEA 2HKXA 4GMJB 2VKDA 4CZHA 1TTYA 4CHYA 4XLEA 1HNZK 2GX9A 4PCQA 3D6RA 4B9MA 2F2EA 4LB5A 3SJHA 3UE5A 1ATRA 1RC9A 3CC4N 1DUXC 4FK4A 3K0LA 1U5TC 3PX6A 2IGOA 4BKXA 2NVQJ 5IT9Z 3SFIA 1P90A 4AIHA 3TAGA 1BL0A 4CUGA 2O5RA 2VBWA 4RTFD 1TQPA 4I99C 3CHWA 1MW7A 1S72N 2CUEA 1GVJA 1KAZA 5AQFA 4AC0A 3OR2C 1RDCA 2A42A 2LRDA 4Y52J 1Z77A 1ZKGA 4A3CJ 4CJVA 3D5SC 2VKHA 4AHCA 3F9MA 1D1CA 1KFDA 1QNTA 3BR2A 1IV6A 4BU2A 4ZYHA 4C3HJ 1SFOJ 5AZIB 2V7YA 1ETYA 4P55A 5B8HA 2BH1A 5C42A 4IZZA 2DMTA 3TAEA 3G71N 3ZN0A 5J1YA 3BQYA 4BQQA 4BY1J 1HW5A 4B3XA 5TJJA 3JTGA 4JI5K 4LFAK 4KNYA 1JLBA 2JA5J 1WJDA 4EVIA 4BRCA 1U47A 1F9NA 3ZN1A 1ETKA 4OLAA 1T6CA 3WHCA 3KK7A 2QCOA 2VT3A 3M9AA 4IHXA 3BF1A 2KISA 2L9NA 1XG1A 2P9UA 3RKXA 3AO4A 5E18F 1FJLA 2Z33A 1OKJA 2L2OA 2H6CA 3J7YJ 2OD5A 2XSDC 3F23A 4HHTA 2ICWG 2LBFB 4U87A 3NCIA 2VG7A 4BWMA 4CZIA 2E35A 3MXJA 2QSGX 4IJNA 3FR0A 2UWMA 4HWIA 4FZZA 3KLHA 2E2JJ 1JKQC 1TKXA 1T2KA 3LSTA 1VK0A 3AL0B 5ILVA 4A3DJ 4R5PA 3JCUC 2NNWA 1ZG3A 3PFIA 1NGJA 2XY8A 5D8KB 5D5WB 2XUBA 3P83D 1KYWA 2FUG2 4CJ5A 3L4IA 1TBXA 3VGLA 1XDSA 3E6BA 1S1TA 3O9QA 3VQ5A 3O4NA 1BW6A 5IT3A 3DLHA 4M41A 1HQCA 3RYRA 2Z1DA 1JLQA 2Q1NA 3CCVN 1S7OA 2CGKA 3CFRA 2QWNA 2OUMA 3DWLE 1O4XA 4CEOA 3R0JA 1QSLA 1JCEA 4YOWA 2QWMA 4DSEA 2LF7A 3VEPA 4B8XA 4EGYA 4AYBN 1HMVA 1G99A 2WB1N 4FVMA 1NBWA 3OYDA 1VSEA 3PY8A 4G12A 1IBKK 4IBNA 2VOPA 4Q5SF 3TW6A 3RMBA 1C0FA 3ITHA 2P5LC 3VSKA 1QQOA 3OYCA 3K70C 2Y69H 1FBUA 1J5YA 2RE2A 3C6AA 5JVTA 4GVEA 1S9HA 3KIOA 4MLEA 5IYCJ 3ZLJA 4A0YA 1EETA 2P9LA 4FJXA 5AQXA 5GTIC 2IGMA 3JREA 3Q7BA 3SZGA 2L4AA 5FLVA 1FLIA 1GV2A 4ANJA 1JUPA 3I59B 4CBUA 4QPOA 1MSFC 4E7SA 4LLLA 4BHPA 3UKRA 4WK8F 3CC4I 4GNIA 3OYIA 3U1DA 2DA7A 4X64K 2YUSA 4PZJA 1ONVA 2DQLA 1OYWA 4RGXA 3RSNA 4BEHA 4M6XA 1IRXA 3F22A 3T19A 4O0JA 1BWFO 2UXCK 4XKCA 1BOBA 1S72I 2IS4A 1VQ9N 2ZMEB 3CCQN 4L0ZB 4ELTA 5BOXA 2LLKA 5JI6A 4R79A 3VESA 2ID3A 1FNNA 4YOYA 4RW6A 1JLEA 2HMIA 4XRSG 3OYGA 4DS5A 3MN2A 1TWAJ 3Q9SA 4IRIA 4HOBA 4JLHA 2YU9J 2DT5A 4ESFA 1UG2A 3LP2A 3IC7A 3N4MA 4FLYA 2F5EA 3TO9A 5F1RA 3NF9A 2JTVA 4GXOA 1YXQA 4QS8A 5HP1A 5HDNA 2DYSH 2DPUA 1TL3A 4M7XA 1Y6IA 1EH6A 2JSPA 2C6YA 3J7AP 3G71I 3RYPA 2ZJPL 5KRTA 3L0QA 3BGRA 3OIQA 2BDPA 3GFMA 5GAHP 3EDPA 4E1MA 1JT0A 2VJJA 4RM3A 4CCJA 4C23A 4A57A 3ERED 5FLXZ 4BGBA 1SVMA 4O6JA 1IN4A 3V4GA 5K5OA 1WGXA 1M90O 1V5FA 1G2HA 1X2NA 1WSHA 1FTTA 4NLCA 1LWCA 3KP6A 2NRZA 1S9EA 4QS7A 5B5EC 5IT9O 2BY3A 3WXMB 1NK0A 1BIUA 3BR1A 2LY9A 3K4NA 3RDIA 2E19A 2E1NA 4PUOA 1HRHA 5CR4A 3SUQA 4M3GA 1B8IA 1LWFA 4ZTJA 4UVBA 5J4YA 3ATVA 4WFAL 3BZ6A 2M45A 3K4BA 3WEEA 1Q9YA 3HGYA 3RRGA 1IN6A 4CVNE 1Z26A 4D9JA 1W36D 4GV9A 2F4MB 4DQIA 4NBQA 1KC8O 2YNFA 1JXSA 2QW9A 5F08A 1YRNB 2MW8A 3LDLA 3CQZJ 2E36A 1VTNC 3I8DA 2VXDA 3MCZA 4JI3K 3O9UA 4KB0A 3ZETB 2OZUA 4LH5A 4PSWA 1CXUA 3LDPA 3SZTA 4BRMA 2CH0A 1JTYA 5FFXA 2M2EA 3ZMVA 2R92J 2QXLA 4KH5A 4G7HF 3ZX0A 3CCVI 3KZYA 4A5AA 4JHDA 2JZYA 3THVA 1B9NA 3QMLA 4JKAA 1VAZA 1DKGD 1D9DA 4BG8A 3BTJA 2KW4A 5BMZA 1MBJA 2V4JC 4PJJA 2PJPA 3CM6A 2RDPA 3PL8A 1VRUA 2KDZA 1TL8A 1PUFA 4BROA 4A2BA 3HOUJ 1IGNA 3CERA 2CFOA 4KREA 1K4SA 2F7TA 2VODA 2A6TA 2R7TA 1O13A 4EJUA 3ZSZA 2RPIA 3C1DA 3A02A 3C2HA 3VEZA 2VXZA 2E1YA 2ZKZA 4C30A 1RKTA 1YJWN 1ACIA 3CQYA 4FK2A 2DA2A 4MIMA 4AHTA 1EKEA 2MD0A 5DCMA 3KEYA 5GAGP 4XN3A 3DPTA 3IAYA 2X1DA 2DMPA 3HOZJ 1O57A 2XKPA 3CCSN 2R7UA 5D4RA 4HA8A 1HDDC 4KFCA 3GTKJ 2F5DA 3A5LC 2NRRA 2HNDA 3QNNA 5CKTA 2YHWA 4LK1F 1Q8IA 4MO7A 4I0AA 2M0MA 4LGWA 1VHXA 4E1JA 3GL1A 3R4KA 4RB0A 2NRTA 3D7EO 1VQ9I 3S41A 2VQEK 3CCQI 2R5YA 1XSVA 2KJCA 4N5SA 1Z91A 3IRQA 2X6SA 2Q1ZB 4M3UA 3J80K 1QE1A 5M1FA 2KZVA 1WJFA 4Z2YA 2FC0A 2E2IJ 2EX3A 2V9PA 4JX6A 1BI2A 4YHHK 3AO5A 1U3EM 3WGHA 3OJSA 1FOXA 4EHTA 1WAFA 2E2OA 4CFDA 4A6EA 3W6JB 1MWKA 1UJ8A 1AA7A 4I02A 5CPRB 2XC7A 3PM1A 3R8EA 4JK7A 4RLQA 1I39A 3TP0A 3AA2A 1CLQA 5JS1A 4CBXA 2K27A 2EWNA 3LANA 4B8CA 3SPYA 3CFOA 2DFFA 1YITI 1XQSC 1T8IA 3ZT4A 4Y4RA 3L00A 2VONA 2H94A 2F5CA 1T56A 2A61A 4L18B 4LD5A 3SQ2A 1DP7P 4BACA 2UUBK 3TI0A 1MMDA 3LFKA 2GIVA 2L7MP 3E01A 1MSEC 1I1SA 4IRHA 2H3GX 5EDNA 5F6FA 4FJKA 1LAVA 3A5NC 3WNGA 4RGRA 4PJLA 2PJRB 4D1QA 3CF2A 1X2MA 3CO7C 2GZWA 1I3QJ 3FFIA 4KITB 4IXCA 2KRHA 1VQNN 2FOWA 2ZM6K 4F2RA 5CQGA 2W6KA 4OGEA 1YTAA 1QSYA 2YX6A 4OOIA 1JT6A 3K4CA 2YJFA 4RA2A 4XLHA 5CJ9A 4CF2A 2OC6A 1D5YA 4RAZA 5IP6A 1YS7A 3T0YA 1H9TA 2UUZA 4DW6A 3LA3A 1KA8A 1XB4A 1TYQA 3PSIA 3TTDA 3PNVA 4B3RK 1FOWA 1FYMA 3KK2A 2W85A 4BXFA 2DO7A 3HG9A 1IO2A 2HXIA 2W24A 3OA9A 3CUQB 2DODA 1FXXA 3AVCA 3TTCA 1IRFA 5ED4A 1ZBSA 3W6VA 2KZZA 1HR0K 3M7GA 1AKHA 3IMXA 3HM5A 1LDKB 1Q86O 3VYSB 4PJ0C 4I6MB 3DTKA 2D0OA 3MMYB 1C0WA 2CUFA 4ILHA 3DFGA 1HX1A 5HS9A 1HNWK 4BNCA 3GTMJ 2EK5A 2HOEA 4JI0K 3KP3A 1G3TA 2B63J 3SQNA 4KHWA 4ZYAA 2HU9A 3DI6A 1VQMN 4EMSA 5AONA 3HOWJ 1MDMA 5DK5A 1YJWI 1OYYA 1ETXA 3B6AA 5BN9A 2FBTA 2EFQA 4LSNA 5C4XJ 1RBRA 3NVKA 4L9VA 4CCKA 5GADP 2PAVA 4NYFA 3VQ7A 2OPQA 4Z6YA 3AG4H 5AQQA 2BZTA 3CCSI 2VPRA 3BJAA 2KFNA 1IG9A 4BRQA 3H1VX 3KLOA 4IO9L 1S5JA 4AM6A 1VNDA 2M0CA 3SV3A 2FSKA 5JS2A 3AVLA 2XHBA 3VQPA 4U7DA 4ZDPA 4ZYGA 5HNHA 3EYZA 1K8AO 2K5CA 4XONA 4OGCA 3EYIA 1F4KA 2LFBA 1PVEA 2Y30A 4B3TK 3W3CA 1IBLK 3PO5A 3U21A 3UNGC 2ZJQL 2Y2ZA 4BDZA 1PYVA 4HAMA 4LMYA 3HJFA 2A3ZA 1OR7C 3VOVA 2KHOA 3I8BA 5EOYA 2EFOA 4LY7A 1B9MA 2K9MA 3HUGA 3HPHA 1DGRM 2VPLA 5BREA 2HBLA 2ETHA 4KICA 4F3TA 1TKDA 2STTA 1QVTA 5FRNA 4ENNA 2FSNA 1X19A 5FKKA 3FK6A 4CEDA 1AWCA 2JWKA 4BRHA 2P9PA 1J2XA 4AIKA 5EU7A 3OYAA 3U4LA 2O4IA 4Z0UA 4A3MJ 2V1NA 2YCHA 3A0HC 3GFJA 4A3BJ 4HDVA 2WUSA 3IG1A 4W5TA 1R22A 5K7ZA 2OZ6A 1QHTA 5LGUA 2DA1A 2LH9A 3HPOA 1QZYA 1W7PB 5EXWA 4YFKF 1WBBA 3KCCA 3ISPA 1BO5O 1W36C 3HM8A 4O5FA 1TWHJ 2IVOA 1XC5A 4IOCF 2MC3A 2HDDA 2XF7A 4FE4A 3FM5A 3SJJA 3WGIA 3MD2A 4RAFA 3VQAA 4MDAA 4WF2A 2VCPA 3RKYA 3T69A 1VQKN 1YHQN 2UXXA 4DWIA 1X9SA 3ENOA 2HWVA 2M7AA 2JVHA 3V7CA 3QESA 3H3UA 1Z9CA 3ABKH 3QYEA 1YJNN 1Z05A 1T98A 1SVLA 3OOPA 4UUVA 3DLRA 4G94A 4LH4A 2VQHA 2VOOA 2LD5A 2D1KA 1Y8RB 1ZRFA 4EM0B 2DOAA 1KCFA 4IFYA 1SC7A 1LJ9A 1YYVA 2KT0A 1YAGA 1UCRA 3FXLA 3I4NJ 3O9SA 1TWCJ 3WG9A 2E2PA 3DLAA 2XY5A 3EUAA 3WTTC 3I0TA 4U7BA 5AQOA 4RDUA 1LFPA 4BG9A 2HMPA 3CJCA 4MFBA 2E7XA 3JRBA 5FFZA 4CJEA 1N6QA 4A6DA 2F5VA 2PLYA 3QLHA 2M30A 2WC2A 2V6CA 4AVPA 4ENJA 1IC8A 2B6AA 3LZJA 4H8KA 2JJ7A 1OVQA 3DLBA 3QWLA 4NB4A 3GXOA 2IAJA 2G8UA 1YS6A 4G7ZF 1DTTA 2K86A 1SAXA 4JX5A 2X74A 2VIXA 5ADXH 4B43A 1JLCA 4K8ZA 5C0YA 1TK5A 3BCAA 4AQYK 5F0XA 1HUXA 3HRMA 1RFQA 3NMUA 1HW2A 2B0LA 1QTMA 2HHTA 4KIFA 3IRRA 4XK4A 1VQMI 2RF2A 5LY3A 1NMDA 3ZCMA 3IKTA 2EJRA 3VQQA 4CJ4A 1P4XA 1JI8A 2ZXHA 1P9QC 5ILSA 1N77A 2AQEA 5FD5A 2A41A 1CQTA 1HJRA 4MTEA 3SUNA 1W0HA 2ZMEC 2YI1A 5EGOA 3AARA 3SQ1A 4KI6A 3TGNA 4OPHA 1NG6A 1DP3A 1JL1A 2LVSA 4FT8A 4NO7A 4NHJA 2E1MB 3SBTA 3CF5L 2P9UB 3OVNA 3H3VK 3ZQCA 4FW1A 2ELJA 3IH3A 4BDYA 4MQ9F 3I9V2 3GTLJ 4DR5K 4N76A 1R23A 2X6XA 4CDGA 1KAYA 4I2QA 4J19A 3R0AA 3E9LA 2XROA 1YQAA 4BVOA 1GLLO 4JKHA 1Z21A 1FWZA 4AUXA 1G4DA 3WQUA 2MH2A 3I58A 1QU3A 5DTDA 3CC2N 4IEIA 5M1OA 1VQ6N 2M4GA 1PDNC 1SD4A 4ESJA 3S2WA 4AM7A 3DXJF 4JI2K 2JMWA 2EIJH 2DDAA 2QKBA 2IOCA 5ERIA 2FJ1A 3E7LA 3SYZA 4DQ2A 4CZJA 2XY7A 3PX4A 5J1UA 4BC4A 3HOTA 3WNHA 2D5RA 5JVGF 3V9ZA 4HLYA 3QPLA 1USTA 1EQYA 1TW3A 1JJ8C 4ISEA 1RCHA 2QWLA 3EUHC 1GXPA 3A01B 2YNHA 1BUPA 3QYBA 3QIOA 3DPLC 4A3IJ 3N4QA 5F1JA 2DQRA 3BCBA 5GAHJ 1WH5A 1VQKI 4IOXA 3AGRA 1YHQI 2QWWA 2H8WA 4E6KG 5AQHA 4GYGA 1OQYA 3WXKA 4BQNA 4C3IJ 3A03A 3FXRA 3VETA 2OQRA 3ELKA 3MWMA 2YPRA 4CGHA 1RT3A 2IPQX 4LLGF 3GLXA 2R7YA 2F5FA 3SMPA 3ABUA 1KD1O 3LQQA 2QSHX 1CZBA 4PHTX 1LDJA 4XIDA 4HPQA 5E84A 3OSGA 1EWQA 3O1BA 3EZWA 4JX4A 1WLJA 1BIZA 1NGDA 2LYCA 5AQYA 1O3RA 4QCLA 2P9LB 3BR3A 4XL9A 2VBXA 1XC3A 5HOOA 1NTCA 2ZNYA 4E0DA 3LSIA 4RAGA 3V7SA 4W97A 1RDBA 3E97A 5DM7F 5BN8A 1T0FC 1MNDA 3VSLA 1VQ8I 3UKRB 4XN0A 4ILGB 4PKHA 4FXDA 4KDPA 3ZT2A 3W2AA 2R7XA 3H3ZA 2EPFA 1Q7YO 2QBYA 1ZBIA 2FBVA 4P9UA 4ICLA 1HJOA 3VEWA 2CQKA 4EP4A 3WTSC 3RMAA 1JHHA 1LW2A 4LG3A 3ID8A 1U5TA 4BEHB 2EV0A 4AILC 2XAGA 4EJVA 2DPDA 4BUPA 4YOXA 1U48A 5AZJA 1ON2A 3TU5A 3BTLA 3U6FA 4ZYEA 4H5WA 3ZT1A 3BROA 3D45A 4CO8A 4FK0A 2WFBA 2DFIA 1NG9A 1YE9A 3MZYA 5ADXA 4FPAA 5C25A 4YIIA 1ZREA 1U8RA 1RKWA 1G59A 1J7KA 1SZ2A 3FZHA 4O0IA 4CYDA 1P7IA 1J6ZA 2XIGA 3BG6A 1XWLA 2YKMA 3WTUC 4RWTA 2PYLA 4O5BA 4AWXB 4FETA 2WONA 4CICA 2DPNA 4G8XA 2BBYA 2IXSA 3ID6A 3U2RA 3F8NA 4ENKA 2LDUA 2TRTA 3VFZA 2A07F 1VQ7N 3QETA 2P9NA 5FD6A 1R00A 5GIOA 1E3MA 1ASWA 1YLFA 4UUSA 5GAGJ 4L9NA 3SQ4A 3SK3A 4H4MA 2ITMA 3L3VA 3K9JA 4CCLA 1ITYA 3DU6A 5SZTA 1TC3C 1R6RA 2YU3A 3AVKA 3JAMZ 2FA5A 3DLKA 3KLIA 1NGAA 1WOQA 2HZTA 4A3EJ 1OPCA 3SEQA 5FKLA 2HVRA 2X6OA 4B9LA 1B8IB 2YV0X 3KX2A 3VF4A 3CC2I 4HF1A 3WHBA 1VQ6I 5AQPA 3KE2A 1IKXA 4CIEA 4XIUA 2W25A 3OWTA 5J2NA 4EQQA 2X4HA 1IN8A 2YX4A 4DU1A 2K9NA 3G4SN 1WSIA 4CHPA 3WNEA 1FBSA 2VWBA 1G3YA 2MYSA 2G8WA 4D0PA 4DZJA 4KT5C 4ID5A 1R5HA 2RVCA 1TT5B 5DEQA 4BRIA 4M3WA 2Y0MA 3S2HJ 1VI0A 4Z4GA 1QHGA 5EJCA 4CGFA 3EY1A 2DLLA 1HXDA 2OZSA 3G2BA 1ZHFA 2DMNA 4H0PA 1T03A 4FWNA 5H6QA 3LM9A 2MFZA 3HP9A 4M71A 3S3NA 2JVGA 2X1CA 3KZIC 1P4AA 4EGZA 2VKEA 3HT3A 2J4RA 4JHDB 4L5EA 1U78A 1A5WA 4PUSA 4XLFA 3BR5A 2HQRA 4OU0A 1SS6A 4H4OA 3CMEN 3CPWM 1HYSA 1NGEA 1R9TJ 4KHSA 2NS0A 4LIVA 2OCEA 3TEDA 2EB7A 2PBDA 4RLFA 2G8FA 4CZLA 2V1DA 1Y8QB 4FASD 4ELUA 1VQ5N 3HXMA 4D5CA 3SEZA 1PUFB 5L3BA 1JHFA 2Z1HA 1RT1A 1KZHA 1WJEA 3FZFA 1HOMA 3OTOK 1R49A 2CW8A 2W1OA 4XLCA 1H1VA 5HDKA 1L3LA 2Q2EA 2KHMA 4XBFA 3DU5A 1O1WA 1WQ2A 1KONA 2EV5A 1R4NB 4B1XB 2LSOA 5DCMB 4CJ7A 5F1XA 5LJWA 3QFPA 4BC3A 3MCPA 4M42A 5H2FC 1U6GA 1HKCA 1KQSM 1A6QA 4IHYA 1LE8A 3AAFA 4F7ZA 2W41A 3CCEN 4I6ZA 2IC3A 2DFEA 3W2VA 3CUQC 3N97A 2QWPA 1BN5A 3NDKA 3S3MA 3K9TA 1L5UA 3O6BB 2K02A 4F52A 3DMJA 1E4FT 3ESWB 3TPQA 2KJBA 3JYTA 2O8FA 2L54A 3HTSB 4F8RA 2L7FP 3M1EA 2R5YB 3WU2C 1ODDA 4A5BA 4HNVA 3DYAA 2FXUA 4JD2A 2Q8KA 4CJWA 1KGSA 3AV9A 1J9IA 3WQTA 4KHUA 2VKVA 5DV5A 5TKYA 4UVCA 2NOGA 3F6OA 3ML6A 2XF5A 5LGNA 4OLBA 1MA9B 2OBPA 5FRMA 3KP7A 5D8LB 1WI9A 5C2FA 2LKXA 3JS6A 2L9SA 3V8KA 4XRFA 2FQ4A 3IL2A 3EEQA 3V8JA 3O5BA 3J7ZO 3HB9A 2H09A 4OIQF 4LF4K 1VSKA 4RS8A 1TWFJ 1U0JA 5J8FA 3KYLA 4H03B 1MNMC 2AQFA 1E0EA 1RDWX 2HVQA 3A1YA 1QVFM 1VQ7I 2QWRA 5E3OA 2BE5F 2D0CA 3CJ7A 2O8CB 4J2AA 2PMZA 2NZTA 3H1CA 2R7WA 1K83J 2L0KA 2ISZA 3K4LA 2QZ8A 2HYGD 5AQWA 4FWPA 3LSGA 3KYCB 4OIRF 4P9FA 5GADJ 1IH7A 2XAQA 2DJIA 3FGUA 4DTSA 3CETA 2IDOA 2F48A 3K69A 4BBRJ 3ZQ7A 5M3FJ 1BU6O 3LDQA 2W42A 5BPDA 1V5GA 2HS5A 3GG4A 5BPLA 4HCCA 1IDZA 3PFYA 4MQ3A 1KU9A 2ZXWH 2YHXA 2FRHA 3IRXA 1NU0A 3NAEA 1V4RA 3S93A 2DA3A 5FJ8J 4IWVA 2L9VA 2VYPA 3VWBA 3OYMA 3LSPA 2M3AA 3HRSA 2QQ9A 2DTZA 2N8GA 3D2FA 3CDLA 3GO5A 2HHUA 3G4SI 1XDUA 1R5ID 3Q0UA 3GLLA 2P4WA 2HNZA 1SUQA 5FB2A 3CJQB 2A40A 5GIPA 3OMYA 3ZSXA 5HODA 3OSFA 4HRIA 2QGUA 5L3CA 1F5TA 4CJQA 4BR4A 4A3KJ 4M3ZA 3AG3H 4EAHD 3UB5A 4PFOA 5H20A 4GV6A 1EH7A 3DEUA 1TYQB 2FMYA 1ATSA 2XRNA 5EY4A 1SVOA 1YTUA 4HUEA 4AYBA 4XH5A 1A6IA 4XRSA 3SYTA 2UYTA 2GXAA 4DTNA 3FZMA 5C12A 2DK8A 2GELA 4TSXA 3DEEA 2ZGYA 4JAXA 1AKHB 5KQDA 5DUIA 1U04A 3ZQQA 2D1HA 5BRDA 4JI7K 4GV3A 2M87A 1VQ5I 1JE8A 1ZRDA 1AU7A 3LP0A 3QOPA 2Q0RA 5F2RA 4JKGA 1I3AA 1NK5A 4FQGA 4E89A 1A5JA 4FWLA 3JAMO 3VQDA 1UHWA 4NXNK 3T1HK 5TRDA 1Y0UA 4CCNA 3JSOA 3TR8A 3QFUA 1MDMB 4YG2F 1S6PA 1GLEG 4E7ZA 1HQEA 2DMUA 4BGDA 3SBGA 4KI4A 4C1NK 1KU3A 3KEOA 5AQMA 3ZXSA 2GXGA 3CCEI 2WY8Q 1TL1A 1LEBA 1NKCA 4V2GA 3FIWA 4NB5A 3QEPA 4ZDLA 1EP4A 4X66K 4NC6A 1MH4A 4DQQA 1JUMA 3W0LA 2ME6A 4FJHA 1ETOA 1RBUA 2F4IA 1XCVA 4IVNA 3H5NA 2WV0A 4DLEA 3M8RA 1A5VA 5K1YA 4DF8A 3KEQA 4Q5VA 4Q4ZF 2RKHA 4F91B 4AHSA 2YS9A 3BPVA 1ITGA 1FEXA 2IVMA 3SDGA 1JXEA 2KLAA 3AKZA 2P9IA 3VEVA 4LF7K 3T7ZA 2X6NA 2KTQA 3EZ5A 4PY5A 3HUGB 1W5SA 4IQJA 4OO1J 3JTHA 4M45A 3PIOF 4IFEA 5KCMA 4IDKA 3N4PA 3VF2A 2RN7A 4CEZA 1H8AC 4QOZB 1SEUA 5D4SA 2F4OB 1DPRA 2P9PB 3O1WA 1HKQA 4FJIA 3AO3A 4HSTA 2XHKA 1Z25A 1ETWA 1T39A 1I50J 5IP9J 3BT9A 2V1UA 2PFBA 3IHUA 3ZP5A 3TSUA 4F92B 5DM6L 1GOAA 5HS7A 2NXNB 4CF9A 2E1MC 1X1CA 5CQEA 4NCAA 1OCOH 1D9FA 3FKJA 1SMYF 1RT2A 1WSUA 4RMNA 1HA8A 3S32A 3IFRA 4GVMA 3R6SA 2CWEA 2HHVA 1U9OA 4I98B 3K5OA 1VF9A 2FBHA 4DB3A 1W0UA 1SFKA 5C2DA 1G15A 4BHCA 4FLVA 1K61A 4AD9A 2KKZA 5J8CA 4JN4A 4BE2A 2VASA 2EV6A 3LSKA 4E1NA 5BPNA 2WBNA 2JRMA 2K40A 3K70D 3CLOA 4JK8A 3OJUA 2IS2A 3GBGA 3GWZA 1EWRA 1BI1A 5GAEP 2DFHA 4ZTFA 2FSJA 2PI0A 2F4VK 5E8IA 3DXKA 3P9KA 4DV5K 5K7HA 4ZH4F 5BRFA 3MKWB 2DDBA 4CSWA 2AA4A 3WXJA 3FXOA 5I3UA 3WU0A 2UXBK 3HM9A 1GXQA 1DQUA 2F96A 3HHHA 2DCEA 2EZHA 1FW6A 4HG2A 2RN2A 5CE3A 4NQWA 4GKKK 1YT3A 2JGUA 2YSRA 4IXAA 4B9SA 2A1SA 4BE1A 5E41A 5KK1A 1VQ4N 2ID6A 1U9NA 4BXUA 2VUMJ 4ZYDA 1U6ZA 1LUJB 3FE1A 3TARA 1R58A 5GPCA 4ISGA 3E66A 1QSSA 3HIFA 3ABMH 5B3SH 1ZBFA 4IRGA 4UXNA 4GDFA 4XRMA 1BI3A 1YIJN 5CLSA 1K8KA 4IEEA 1E4GT 2A6HF 5J47A 3CPEA 1SD6A 1KQ8A 1YVUA 4BRPA 4XLAA 3PQKA 1MBEA 2OPPA 4F3QA 1VSJA 2UXDK 4J2BA 4Z94A 2CMPA 3IV5A 1I27A 1OH7A 3MFKA 2EIMH 3S1RJ 5D6FA 1MGTA 3ZQFA 3KPHA 3FLCO 1FOKA 2X85A 3DP7A 3U9DA 4HF2A 2Y9ZA 3BOQA 3VN5A 2HBJA 3IWFA 4BR9A 1RT5A 2RQQA 2DI3A 1S1WA 2OAZA 4WXHA 5EG0B 1BR4A 2IA2A 1UA1A 2BVLA 4CEQA 1LW0A 2HB5A 2IT0A 1GLCG 1DLOA 2NS8A 4BHBA 3O6WA 3WNFA 3T8RA 3MN5A 3JW4A 4AM3A 4U88A 4BRKA 1K73O 3ZQIA 1ZK8A 3BY6A 1LVKA 3LDOA 3CCUN 1F1ZA 4F93B 2PBIA 3SUOA 3K4KA 3RPUD 4DYCA 5F04A 4LK0F 1HLUA 4CERA 3V1OA 3MEXA 4B1WB 2LOOA 4MGRA 2E6MA 1UAXA 5CVIA 5E3LA 5HL7L 5A2QZ 1NGFA 3FZVA 4FJMA 1TUYA 5JMVA 4S05A 3H9QA 5JFRA 2VB6A 1POGA 5LHHA 3GZ6A 4K0KK 3RTRA 1RR8C 1PP7U 2EA2A 2QVOA 1NWKA 1TAQA 5CZ1A 1BI4A 3DLGA 5F64A 2EQRA 2RNJA 2HKOA 1T6DA 1OR7A 4E7HA 3K7AJ 4KHYA 1FSEA 3OOUA 1D3YA 3V4IA 2D2WA 1V3FA 3SAFA 4CZEA 3DLEA 2JK3A 3U3GA 1QPIA 2X78A 4P96A 1P2FA 2OPRA 2GWRA 1IDYA 1FOYA 5GP9A 2DYRH 4FHTA 2P9SA 1O3TA 1ZQ3P 3RPQA 2XAJA 2JT1A 3MCAB 4QIWN 5FPNA 4KHNA 4UHTA 4A0ZA 2WADA 3FXJA 1U49A 4LJZF 3QRFF 2O6GE 2V52B 4RW9A 3HKZA 3CJAA 3R3LA 4DV0K 3I33A 1HCRA 4WF9L 3E5QA 4M73A 1MMGA 2VE9A 3CXCM 1CXQA 2PZSA 3VA3A 2OPTA 2HDWA 4HDUA 4L9JA 3MECA 2ZCWA 5AQIA 2MLKA 4B9QA 3OYBA 4WXCA 2LR8A 1LPQA 3TW7A 4K8XA 3LWLA 3RI4A 2ITGA 2YHAA 5BPMA 1LDDA 4V19S 5M1NA 5AFUA 2QENA 1K7AA 4CJ3A 2MH9A 4RB2C 1GLDG 1CF7A 1FPQA 3AVBA 4CCHA 3CCYA 3QNOA 4WCEL 4I7HA 3OIOA 4X62K 1S8NA 2H8RA 4LLNA 4JNEA 5AIQA 1NK9A 3SI6A 5CVJA 3OIPA 1SL1A 2OA8A 3H9JA 4CFCA 1I1GA 2HVSA 2LNBA 1ZBLA 4IEJA 2D0PA 3TP3A 3IUOA 2XVCA 1X1PA 3COAC 3MX2A 4E70A 1R5GA 3PQJA 1VQ4I 2V26A 1JJ6C 3LAPA 5KI6A 2QBYB 2ZD1A 3AVGA 4S04A 1K78B 1TGOA 3I4MJ 4RW8A 2MC4A 3I56N 2NVXJ 1U5TB 4I01A 3I55N 5FGMA 3WE3A 3LPUA 4PGGA 1YIJI 4RG8A 4PK4A 5AZJB 3IKMA 4FE7A 3Q9VA 3F8BA 1K6YA 4CBWA 5FLMJ 2X51A 3K4MA 1ZBUA 1MDUB 2PMZN 2FBKA 4JRPA 1MKMA 4YFNF 2LF8A 1NM1A 1TT0A 3U9GA 1REVA 3L1PA 2KP6A 2DW4A 2P5VA 5JICA 4AVZA 1EXQA 1FC3A 1WCMJ 1SL2A 3ISNC 4PDKA 4FLUA 3IS9A 4L3QA 2QM3A 2G7UA 3E9PA 2WV1A 3QP5A 4I2PA 1J5OA 4DZPA 1UHSA 2R4GA 3DLLF 1B1BA 1XMXA 3KK3A 1NOYA 1Z6TA 2GQQA 3CCUI 4BRLA 3VTIA 2ZFWA 3S2DJ 3K1PA 5EEAA 2RC4A 2PX9A 4DSIA 2FF6A 3L7WA 4OMYA 1BC8C 2QA4N 3M8SA 1MJAA 3O4WA 3C95A 4UUSB 2ZMEA 3WTWC 2MSYA 3FHNA 3OYFA 2KDOA 4ESBA 4OVLA 3AA5X 4N9IA 2CQQA 4FM1A 3CD6N 1S1XA 1BM9A 2ASOA 1XMOK 3SJMA 1IXSB 2ETJA 1NG7A 2CG4A 1MU2A 2A6EF 4NNJA 2BW3A 2NAZA 3CCJN 3P38A 5CYVA 1ETVA 4OKEA 3RCOA 3ZYYX 3VB2A 2DAOA 1SD7A 3VEOA 5DD8A 1N33K 4HLXA 1QBJA 4DQSA 2G7HA 1IG7A 1LFUP 2OJED 1ZBHA 2HZDA 3ZSOA 4AIJA 2Q2RA 2IJLA 1HBXG 1X3ZB 1ESVA 1UHMA 1TW2A 2FLOA 4CGIA 2FMLA 3TSQA 4JKEA 3UKGA 2DA4A 2WAQN 4Y1CA 3NGZA 3OYHA 1SAZA 4HZFA 4YEJA 3E5UA 4I09A 3DOLA 3SZ2A 3FWEA 5IP7J 3BG5A 3G6EN 4BJ6C 2EFWA 2XF6A 2VQCA 1BI0A 4O8KA 3DTIA 4M74A 3LAKA 2FNPA 3EUHA 1BA0A 1J5EK 1A36A 3ASOH 1R1UA 4RB1A 1C0GA 4LC9B 1WI3A 2JUCA 1V55H 3CC7N 2VGMA 5A2QO 4NXMK 1MJ9A 3M3ZA 3ULEA 5TISC 5AIPA 3FXKA 4X65K 2VE8A 1MH3A 3AVIA 2YHBA 4FZXC 2O61A 3LFUA 4GRIA 2AXLA 2Q0UA 2IGNA 2Q2EB 3MXMA 3LDNA 3C2GA 3NRVA 2Y1IA 4DR4K 4EJOA 1VSMA 1D0XA 4DQRA 2O0YA 1HNIA 3JSMA 1YIOA 3M6GA 3NAUA 4CE9A 1Z3YA 4HVJA 3LSRA 4B4CA 1LE8B 1NK3P 3S8PA 1IG8A 3CQXA 3KJVA 3J81Z 2XGXA 2WAEA 1IBMK 1W5TA 3BF3A 3CYMA 4AHVA 3I56I 1V54H 4MLOA 4N4NB 2G8KA 3GFIA 4WFNL 4IF4A 4XORA 3I55I 1JKRC 2HTJA 1MMAA 5KPTA 1KAXA 2O8FB 3CIPA 1TK0A 3F2KA 1T6SA 4GGGA 1TKZA 5ICCA 2K4BA 2RAEA 3A2FA 1YJ9N 4JD2B 2V7FA 2XV4S 5LRRA 4B48A 2VJ4A 2P5OA 1B4AA 1X4PA 3G1MA 5J2QA 4H0YB 4JV5K 5ICFA 3MDQA 2CUJA 3SNNA 4BC2A 4JP0A 1X9JA 4KMUX 2RNGA 2M7BA 4GO1A 2X1EA 4UV9A 3K2AA 4W1UA 3OS1A 5CY4A 4G9YA 1LWEA 4AH9A 1ERDA 1SANA 1K9MO 1N78A 1EV7A 4LSLA 4WQ5A 1R4MB 3HGGA 2QKLB 3DRPA 1B72A 2EINH 3F3XA 4E7JA 3NARA 3IH4A 4B44A 4I0BA 2PEXA 4HBLA 1QGPA 1RR7A 2DA5A 4XKVA 5HRNA 4Q47A 4ZZDA 2E2NA 1E3OC 3K6GA 5E3MA 3GTOJ 2QA4I 1Y1WJ 2QEXN 4EZ9A 1X9MA 4M6VA 3ENBA 2XY6A 4DKWA 4PL8A 2OTLN 4DSJA 5BQTA 1ILYA 1OH5A 1BIAA 2IW5A 3CD6I 3SFZA 1W0TA 4NUBA 4DLGA 3TAPA 3SAGA 3P39A 3R6MA 1HSTA 2AP1A 2DOFA 4CEBA 5EZGA 4H5NA 4BRFA 2MBFA 3CCJI 1HPZA 2O8EA 2FBIA 2O3FA 3WE2A 4S0HB 3ZMZA 2P0WA 4IOCL 4YIRX 3FXUA 2ELHA 4HNTA 1UELB 2XGDA 3MEGA 2CV2A 2HPMA 5IT9K 4HF0A 4A62A 3D2FB 3AO1A 1WHUA 1BJAA 5KPRA 3K57A 5L3GA 3TOBA 1AOYA 4P5OA 2Q3SA 2COMA 5AJ3K 2HF4A 5JVHL 1BOTO 2LK2A 4CEFA 2W48A 4FO0A 4XSZF 3LAJA 2IGIA 9ANTA 4Z4HA 4EM2A 3MZHA 4K25A 1ENHA 1HNXK 2JA2A 4H0EA 2JA8J 5E1XA 2GA2A 1T3VA 3DRSA 5LEKA 3G6EI 2JA6J 5HNFA 3ATUA 2R7SA 1HQUA 4KTQA 3AVAA 4FWMA 4CW7B 1Y1VJ 3ZSQA 4O44A 4NYNA 3EPZA 2YKNA 2RV8A 3LNQA 4CK2A 3NGIA 4J2EA 1VSHA 1FP1D 1ON1A 4DFKA 1STZA 2PJRA 5T7BA 4KTZA 3CC7I 3OBYA 4MLHA 2XB0X 4JKGB 1Y56A 3AVMA 4BS9A 5HRRA 3EKSA 3VQ4A 1L3UA 2A5WA 3G25A 3BG7A 3TDUC 2BGGA 4EZ6A 1TAUA 3F0CA 2NOJB 3KLFA 2X6YA 2O8KA 3THYA 4CESA 4KN7X 3H3NO 3MEDA 4B8AB 4FWQA 5GAEJ 5AQGA 3GW2A 4FLZA 1ZAOA 1MZBA 3O8GA 4BE0A 1D0YA 5IPAA 2HHSA 4I76A 4RGSA 1SKWA 3DWLA 2BYVE 5HRPA 3K2ZA 3JSPA 2P81A 1NGGA 4GKJK 3ROUA 4DNCA 3LP3A 3AO2A 3VQEA 2Z1IA 3DTEA 4UB8C 2NNYA 1XGOA 2HQ5A 1XSXA 4CFBA 1B6AA 1MD0A 1RDAA 2M8GX 3CQ8A 5AQSA 1R1VA 5LFAA 3HJEA 3T1AA 3EL2A 3HTUA 3KP2A 1TVRA 1YJ9I 2WC9A 3UR3C 1NK6A 1BIBA 2LKPA 1Z0XA 2VC0A 4IPAA 3AVFA 1PUEE 2GM4A 4M3XA 1XC9A 4YELA 2P9IB 4OPKA 4JBAA 3AY9A 2NRXA 3HKZN 2O4GA 4V19K 5D6EA 5FPEA 1Z3XA 4IQ4A 2HHXA 2P9KA 1WSFA 3R1XA 5HLHA 2V9KA 2IRFG 1N5YA 4BQOA 4Z4IA 1B9FA 2GOMA 4DUYK 3OHRA 3TAQA 1XHXA 5HLGA 4CJUA 1JJ2M 2P5GA 5BR8K 4DV6K 1ZN2A 4FX0A 1VQON 2XDVA 5CVVA 1R59O 2QEXI 2BXZA 2ZGZA 4CK3A 1FMWA 1EF4A 3F21A 2LTPA 2GA1A 3D5RC 4M3YA 4M6YA 4J2DA 4M7YA 2Y31A 2YJEA 4CHUA 3KK1A 3M4OJ 4B3AA 1OCCH 3MN9A 2H27A 2KRCA 3I53A 1V5EA 1SFUA 2M8EA 1F36A 3GTQJ 3QDKA 4CJTA 3J81O 5JVGL 5M1QA 2J5PA 3ZMUA 1PP8F 3AAPA 3WTVC 2A69F 4QLCU 1GOCA 2CSOA 2JLEA 3F5TA 3E9OA 1P7JA 4E19A 1JUSA 4XOPA 2OPSA 1QQCA 3RQIA 1WRJA 2EZKA 4JKBA 3A5MC 3BWGA 1S1VA 4CJSA 4AHRA 1IKYA 4UV8A 4FJGA 1EJ9A 2BXYA 4MO5A 3KZZA 2NLXA 3DXKB 4MTDA 1C6VA 1J53A 4Y7NJ 1BHLA 4B09A 4E4HA 3H36A 1W4MA 4EIAA 3PIPF 2ZXIA 1DT9A 1QPMA 1R0AA 1XMKA 4NQWB 3H0GJ 4E7KA 1Q9XA 1TQIA 2A5YB 2E4LA 2F8TA 3ZMSA 4D5FA 4XICA 4I7FA 1KQ9A 5LHGA 2A5XA 1ZG5A 2IIRA 5EZHA 4X0GA 3BZKA 3CLQA 3BJ6A 2GWKA 3NH1A 3KHYA 4C8LA 4JKCA 1ZGJA 2OYQA 3RR7A 1GT0C 4H0TB 1R7JA 1K8KB 2A1RA 5KPZA 2Y9YA 1BQMA 4EHUA 2VN2A 1BGXT 5CYMA 5HLTA 3EO3A 1BBYA 1WH7A 2BEOA 3OL3A 2BGCA 3SQ0A 3SDBA 3U8XA 2HBKA 1Y97A 3NF8A 1WVRA 4KJZA 3C7JA 2R7FA 3OL4A 4B9UA 5L3DA 1BL3A 5FLXK 1H88C 2ZWHA 3CFPA 2HW3A 3RMCA 3HDDA 4UQGA 1M1EB 1S7EA 3WTZA 3TO6A 1TP4A 3SUPA 4IOAF 2FEZA 2HVHA 1HSJA 3GBTA 3CO6C 4DFMA 4AU7A 2NRAC 3K59A 3RMDA 1OVYA 3THXA 3RKWA 1HKTA 1QS4A 4XH1A 3B8AX 3TAFA 4CGZA 4C2UA 3C6TA 5AQVA 2GLOA 2A6AA 2IS3A 3MK6A 4WXDA 5AQRA 3VPRA 4KN4X 3FMRA 4BQZA 2VG5A 4QAGA 5ELZA 3K5MA 1BQNA 3BG3A 5C10A 5H1SQ 3L9FA 2QSFX 3U1KA 2BHYA 2HF3A 4IO8A 1XNQK 2KIUA 2ACJA 3FHZA 4HX7A 2RQPA 2XASA 2TDXA 1I94K 2Q97A 1BOAA 2XAHA 4DJAA 1USSA 4A2UA 3ULDA 2H6BA 2ESNA 2AO9A 4G1QA 3L2VA 1BI4B 4U0YA 4LF9K 2AS5F 1S1UA 1IRZA 1IKWA 4R8HA 1NGIA 3CESA 5LD2C 5K14A 5E1ZB 1WSGA 4HTUA 4UUTA 1RTDA 2RKIA 3L3UA 1PJRA 3I54A 2E6LA 3AL0C 1G8XA 3BG9A 1IV0A 1O7FA 1GOBA 2P9SB 1IN7A 4R1HA 3SCXA 3P4IA 2P8TA 4II3A 1KRPA 1VQOI 4G6QA 3TDZC 5JLXA 3VQ9A 3ZX2A 4CJFA 3HSCA 4XKWA 4KISA 2I5UA 1JCFA 2MABA 1VQNI 3DV8A 4OAZA 3KD5E 4F9OA 5LEJA 4YORA 3RIRA 2ZB9A 1N8RO 3QEWA 3OV8A 3I71A 3OY9A 1ULYA 4Y33A 3C94A 3J80Z 4FZYA 2GTDA 4DR3K 1RT7A 2CU7A 3MKLA 4CJLA 3TL4X 2Y75A 2VGNA 4E3SA 3TABA 3SAHA 4DQ8A 1X9WA 3OS2A 1Z1DA 1XSDA 1J9AA 3ALYA 4II2A 5DM6F 3C6UA 3QAHA 4HQMA 1GDTA 4C3JJ 3CJTB 1SD5A 3RKQA 1JLGA 5FPDA 1CF7B 3KP5A 2GV9A 4CEEA 4B1ZA 2Q36A 3H35A 2GWJA 3R9PA 3K4JA 3WXIA 4M72A 3HSEA 3ULQB 3K2PA 1JGGA 2LP0A 2XPWA 5KHDA 1WUAA 4CI6A 3AFHA 3J7AO 4IG0A 5DYMA 2HI3A 4Z4CA 4GYIA 1H9GA 3NWSA 2CQXA 2R7QA 3A01A 2V6EA 4FLTA 1UA0A 1N34K 1SL0A 2ZQBA 1D8KA 4IL6C 2CYYA 1J59A 3HL2A 2GUPA 1L3TA 3W3DA 4O4GA 3CJBA 3BR0A 2R7VA 3S17J 4Y1DA 4Y15A 5D5VB 2YX7A 1AHDP 1FP2A 4HV6A 2VT2A 4A93J 2QUFA 1RDDA 2G0EA 4U0VA 3QO9A 5J3LA 3QP6A 2QWQA 1FK9A 4M63C 3UIQA 2O7OA 2BTFA 1TUUA 2D4WA 1J75A 4ISFA 1GLAG 2ZJRF 2L02A 1N36K 3E5XA 3P9CA 1RNHA 4JK1X 4MQVA 1YVNA 4DTOA 2M34A 4CZZA 4FVUA 3E0JB 4LFUA 2QKMB 5LL6Z 5IWAK 5FROA 1N75A 2OANA 3GEZA 4F55A 3ZT3A 2L9RA 4CD3A 5ILUA 5KTQA 3MQ0A 4DFPA 3QPTA 4TV7A 4DU4A 5FDLA 4P1WA 3V9WA 1IZ1A 3O3GA 5GPAA 1Y0NA 1IN5A 4YDUC 3GZNB 2AJQA 1W1WE 3H1QA 4DV3K 3QB0A 4BJTA 1S7AA 4CCOA 2VQGA 3O80A 1B9DA 2QQAA 5IOZA 1GLBG 2CW7A 4CIGA 2XPUA 4A3LJ 4CGDA 2Q31A 4DSKA 4LFBK 3OR1C 3TWHA 3QEIA 1E3PA 4GW6A 3K9KA 3F8MA 1RPWA 3HOYJ 4BL0B 4CZGA 4JI4K 4G6DA 5EVZA 4WQ4A 2B7EA 3O4QA 1ZC6A 1M1KO 2BW3B 4M3DA 3VMFB 4XOTA 2DT7B 5KVRA 3ZEUA 5D3GA 1B59A 3P1GA 2P1JA 3OBWA 3TO7A 3U9ZA 4BVPA 4CEAA 4H5TA 4N0BA 1E3HA 3QERA 1VZ0A 1W7PD 3IUCA 4O8UA 3B6PA 3BUZB 1X58A 3QPSA 3SV4A 2M1BA 3E1YA 2VWKA 1WSEA 1YJNI 4JS4A 5DD4A 1BCOA 3HBTA 5CHIA 1YITN 2D0BA 4BQLA 4CIFA 2W4SA 1WJ5A 3NE6A 1OCZH 3PSFA 1DPUA 3MMVA 1YF5L 1T33A 1X3WB 2BUPA 5D5XB 4IZ9A 1KTQA 2L5QA 1YW7A 5BRHA 3JRHA 4B9NA 3L09A 2FQ3A 2KRFA 1NJIO 1HKSA 3F8CA 3REOA 5K5QA 4BRAA 3CJ9A 1OFCX 1ZH5A 1TNTA 1D4XA 4CXFA 2M9HA 3HRGA 4B1RA 5BNGA 4M3FA 1YX5A 4XSXF 3MKZA 4YOUA 1XNRK 4IHWA 3V9SA 3BQZA 4HSRA 5EEGA 3ULEB 1RNLA 4HEA2 4DGWB 3DOKA 2IS1A 1NNEA 3HVTA 4K43A 5IOYA 3DXMA 4FJ9A 2P6SA 4LG0A 2YR2A 2CW0F 4CHQA 3Q0VA 1VRTA 3TAMA 2PG4A 3JXUA 4ZZLA 5M5XJ 2I8DA 4DR1K 3A0BC 4KIBA 3CMYA 4DFJA 4O3MA 3J7ZI 3RQ4A 3TKYA 2M4KA 2UUAK 2MD5A 3VOEA 3ZOBA 3VPZA 2DK5A 3ZSRA 3S1QJ 1DGKN 2EZLA 2O03A 2BANA 1HYVA 3QBWA 4OIOF 5LJVA 3LALA 3L2WA 3TBIA 2ESHA 2GEMA 3C65A 4BH9A 3KZBA 5E1WA 5F27A 1W5CC 2ADUA 3J80O 4DSLA 3C2BA 4FJNA 1IF1A 2DY4A 3H5RA 1NKBA 3HSTB 3AAQA 4Q0BA 1L0OC 3VODA 1XPXA 3FF5A 3FMQA 1JXBA 3LP1A 1MBKA 1ZLJA 1JCGA 2OU2A 2HSTA 3IH2A 2BVMA 3EUKL 2DA6A 3P31A 3L8BA 1NGCA 1Y64A 5KGWA 4Z4EA 5M1PA 3CDIA 3H5AA 1HLVA 3LWFA 1P8ZA 4CGGA 3C7NA 2P5KA 1B72B 2ELKA 1NK2P 3MZ8A 3NGYA 2BY2A 1WWXA 1RTIA 1KLMA 4LF6K 4PQUA 4H0VB 2F9WA 2KQ2A 3VENA 3VTHA 2G9WA 3HOXJ 1T38A 1LFBA 3TSPA 4LIUA 3WEEB 3PIOL 4CZMA 3I64A 4FPBA 1OCTC 3H92A 5CYQA 1RRJA 2KLOA 4RCHA 1MMSA 2R5ZA 4FL9A 3H9GA 4O55A 1JLAA 2HDCA 3GX4X 2ASPA 3QIPA 4FWRA 1TV6A 3S1NJ 5GTHC 3VYRB 3E6MA 3EYYA 1J09A 5E20A 3V81A 2JQ7A 4RAYA 2ZF5O 2HR3A 4FX4A 2ZSHB 4A3JJ 2LSNA 2KKOA 3BC8A 1UZCA 4A12A 3QU6A 3R60A 2O8DA 2R0QC 2O8EB 2NRVA 2E5NA 1XN7A 2E7WA 2BY0A 3B6OA 1RT6A 1G3SA 2Z1JA 4CZFA 2QLZA 1O3SA 1T08B 3G3ZA 4BDPA 2HXOA 3PNYA 3KFWX 1FSHA 1X3MA 3SHFA 4OPJA 1RTJA 3HOSA 2CS3A 4CYCA 1X4OA 4Q48A 1D8YA 1YG2A 2OA4A 2DXIA 3E3VA 3D5LA 3G10A 2O8CA 3S1MJ 1NOZA 1VSDA 1KVCA 2L7KA 1RBVA 3AVNA 4CD1A 2V79A 4HX4A 3WT0A 4EFHA 3VGKA 4A2AA 5M3MJ 2KMUA 4LB6B 4DV4K 2F8SA 1QVUA 2AHQA 2LKSA 4FLXA 4K41A 4CK1A 4PWDA 2WBMA 3M8PA 1U8BA 3GTPJ 4K2EA 4IDHA 4BGAA 4A3GJ 4BRGA 5ICGA 4XLPF 3I3LA 2IAIA 2XO7A 4RGUA 1VFCA 1SMTA 2FOKA 2HOTA 3BZCA 2R7RA 1OCPA 2IP2A 2OCCH 4QPQA 2I10A 5HLIA 1G6NA 2YHYA 3OYLA 1QHAA 1WJBA 5CVRA 3MWPA 4BREA 2W6LA 3A8YA 3UKUA 3GYHX 1SQKA 3THYB 1QHHD 2YNGA 1XGNA 3O3HA 4DTUA 4WYBA 3U3YA 2K7LA 1RZ4A 3CP8A 3JR9A 3HPGA 5SWMA 4QSHA 2R93J 1KSPA 4W5RA 4FYDA 3PNTA 1FTZA 3W6KB 1O7LA 4KPYA 3NBPA 3AVJA 4M9XA 2DOEA 5DMRA 1S3JA 5HLFA 4DYRA 1DU6A 2E1OA 3ERMA 3CTAA 5EYRA 4A69C 2E34A 2OZMA 3NVMA 3IWZA 3M5RA 2HYFA 5FLXO 3OYKA 2PY5A 3X2QH 2ZE2A 1S9GA 2VLAA 1RUOA 5BR9A 4BXXJ 3HVRA 4ITVA 1HKBA 4L9TA 3HZJA 4RW7A 3D0PA 3SZPA 3D2EA 2W40A 3LZIA 1K6OA 2R7DA 3DPUA 4KV8A 1UOCA 3OW2M 3RPUA 4N9HA 2JWLA 3H3OB 4ZJZA 1K4TA 4JKFA 3K5NA 2B4JA 2P9KB 2P51A 2ZJPF 3KKSA 1VSIA 3EN9A 4RBOA 2KIFA 4H0XB 3BR6A 3CCLN 4BRDA 2UV1A 4KIGA 1LNWA 3I4PA 4A61A 1LKXA 3G73A 3DKXA 2O8BA 1C1BA 1XCBA 4YFXF 5M5YJ 1VQPN 3T1YK 3V7RA 2GBYA 4HV5A 3VGMA 4W5OA 3O2PE 3M8JA 5JLHA 4DV1K 4KO0A 1VQLN 3M8QA 3VQCA 3IAM2 4EV0A 1KLNA 1SKSA 5LMNK 1J54A 3TOAA 3OS0A 4B3SK 2VBYA 3V9XA 1FX7A 1UG0A 4X1EA 4DV7K 1GUUA 1NGHA 3KTQA 2XRLA 3KP4A 1IXCA 2KQRA 2JRTA 3HP6A 3L2QA 3FBIB 1L3SA 1SKRA 4EM1A 2VC1A 1FIAA 1XMQK 2W57A 2QYOA 3NH0A 2Z99A 1P4WA 3QBXA 4JK9A 1LOTB 3HHGA 2IVPA 4XQFA 3IKVA 2WWYA 3CMEI 1GHCA 2DTUA 3J7AY 3C6HA 2E71A 1RT4A 4JYAK 2F9TA 1S22A 1FY7A 2EILH 4PSXA 4DU3A 4IX7A 4BYYA 1ORKA 1IUYA 2VQFK 3DBRB 2WAQA 1E17A 1S6LA 2WTUA 4IHVA 4JQFA 2JPBA 1FYLA 1KFSA 4A5MA 4CH7A 4C8KA 5E17F 1LCUA 1LEAA 3HK2A 1NJWA 4IHSA 2IA0A 2FSWA 1MBGA 4DV2K 1XS9A 4CECA 3S16J 1TZLA 5KAIC 1SV5A 1IUFA 4DTJA 4DMNA 4B1VA 3FFKB 1WZ2A 2HVIA 3G1LA 1WN7A 3AVHA 3Q7CA 5B66C 1XUPO 1TLHB 4M3RA 1OISA 2XGEA 1LAWA 3I0SA 4FOIA 3QYFA 5C4JJ 3DBHB 2QQBA 5JLWA 2XB5A 3MKYB 1IRGA 1WAJA 4L8RB 3EETA 1BISA 4EP5A 2E60A 2A68F 3WGGA 1FMVA 4BQAA 4Z4FA 1BR1A 1RI7A 1YFHA 3GCMA 4CJRA 1DGWY 4G6TB 1FT9A 2CQ7A 5KAFC 2UZKA 6PAXA 3KETA 3KVGA 2XPVA 5K5RA 1VQ8N 3THXB 3LPTA 3DJCA 5AQUA 3JAMK 4KRFA 5K7FA 1HNVA 3KYDB 3LSJA 1ZARA 2WOMA 2BOLA 4H4KC 2K3PA 1Z7LA 4RW4A 3BY5A 3THWA 1HC8A 2D45A 4HCBA 1KXPA 4YOTA 2R3SA 4DBQA 1DEJA 1VSLA 3DLLL 1QQMA 3LM2A 5CVUA 4L5JA 4M3BA 4B3OA 2K9QA 3FK7A 4BR2A 1T7PA 1QZ6A 2FE3A 3D1NI 5AR0A 4HQEA 2K85A 4CA0A 2B5JA 3PO3J 3O3FA 2GXBA 4HUFA 1YI2N 4IJAA 1Z7UA 1DDNA 1ZYRF 4UB6C 3ZQHA 1IAWA 4FW2A 2FBXA 3D0SA 5EG0A 2LC2A 2XAFA 3M1CA 2ZJ2A 3SLCA 4OPAA 2W84A 5E3NA 3DKYA 3JRIA 1MNEA 3CCLI 4DIQA 5D5UB 1TK8A 2K3FA 2WY7Q 2V51B 1QVGM 3SXYA 4ZHRA 1VQPI 3AG2H 4A3FJ 5JHUA 4FWKA 3GOIA 1RBTA 3P5JA 2IBDA 1VQLI 3CCRN 1JKPC 2STWA 1C1AA 4BAYA 4DTRA 2ZSIB 3AA4A 3NF7A 1IXRC 4C2TA 2DJNA 4KB1A 1U4BA 3EE8A 2QQ8A 1Q1HA 4YNQA 4KUMA 4U67L 2K9LA 2EHGA 2L01A 4CF1A 1U2VA 5HROA 1BCMA 1GLJO 4Y0WA 1D8JA 1WJCA 4NCGA 1JGSA 2HHQA 4L0YB 5TKWA 1QZZA 3N05A 4MEYF 4NC8A 3FXQA 4DHYA 4OX9K 3L2RA 3G0ZA 2VJ5A 3LOCA 1OH6A 2CQNA 3FDYA 2NRWA 2EFNA 4IHTA 3MN6A 3EKUA 3MXIA 1FZPB 1S29A 3DQVC 2E88A 2P6TA 3RSEA 2RHKA 3GVAA 2CH6A 2TCTA 2X9DA 5LHIA 2FX0A 4BJ5C 4JKDA 1X3NA 1BC7C 1NJZA 3VYTB 4FLWA 3SMSA 4MEXF 1GLNA 2H1LA 4GCVA 4QS9A 1QO0D 1ASUA 3BJOA 2QK9A 3GFLA 4HW0A 1WFXA 2IA1A 3QEXA 4MDBA 4XLNF 3BDDA 1REPC 4F3OA 3QPHA 1IW7F 5LLQA 4ZC3A 1T8EA 3VQBA 2HPIA 3C3WA 2CFXA 5E8GA 5AQKA 5EGOB 1ZR2A 4LFCK 3NEUA 3KWGA 5IY5H 4UNOA 1ZG1A 5J1EA 5LRSA 3F9KA 3PJRA 2GUIA 1I6XA 3K5LA 3S9HA 4KH4A 1IV8A 2DT6A 3GDQA 3T3FA 2E2QA 1TWGJ 4F4KA 2B9SA 2DU9A 4WX9A 5DS9A 3R61A 1BA5A 5FKNA 2Y48A 3OYJA 3NQOA 1SFXA 3TQNA 4YY3K 4PKGA 2E1CA 1BR2A 4LOCA 4FCYA 2Z16A 5HDGA 3FM3A 4IKFA 1WPKA 4Y17A 4IO9F 4A0XA 4D7MA 2PQ8A 5AZIA 3NH2A 3LL7A 1K78A 2HEOA 4XH4A 1N25A 3E1SA 2QM1A 1QRYA 1ZXOA 3CP2A 3GTJJ 4C8OA 1YW9A 3VA0A 1NK7A 4DSFA 3CI5A 3CDHA 4DR2K 2I5JA 5C44J 1ZTRA 1JKOC 1QA6A 3LL3A 3WTYC 3PUFA 1A35A 3O3KA 3LWMA 4V2FA 2H1KA 2ZJQF 3WTXC 4HUGA 3O08A 5FO5A 4CFAA 5HRSA 2KZMA 3CM5A 1C1CA 3A5OC 4WE1A 3HRTA 2XGCA 1HYZA 4RB3C 2L4MA 3VF6A 3ZX3A 3O9TA 2HQAA 1YW8A 4B9TA 3G1OA 3V8LA 4W5NA 1YI2I 4M9SA 4WQ5C 1RESA 2Y1JA 1Y39A 2Y0SA 3ZEUB 5EEHA 5GINA 4B1UB 2FD5A 5H6RA 2O8XA 3QU3A 1NMNA 2Z5UA 1W7AA 5I42A 1BW5A 2DMQA 4KT6A 2LBFA 4N56A 3Q5FA 5F0HA 1FKPA 1NK4A 4M9ZA 4NC7A 1ETQA 2F6CA 3K1NA 2BV6A 3V42A 1FBQA 2HNHA 4UVAA 2HTSA 4B47A 2ZFUA 3ZT0A 1QQNA 1RGIA 2P7VB 2OF7A 3GTGJ 3CCRI 1RIOH 2DBBA 4HNUA 3QICA 1D0ZA 1IKVA 2ZXJA 3ZSYA 2JPCA 1W97L 3HBLA 2CUZA 1GLFO 3GMEA 4B1YB 4MFDA 4KHQA 4L5IA 1BG3A 3F72A 1LVAA 4OMZA 1JTXA 5HBMA 4DR7K 1T44A 3ABLH 4XM3A 4EEFG 2Z2SB 3ONQA 2UUCK 5JR3A 4K42A 2FNAA 2NVUB 1JKHA 4J01A 1EA3A 2CJJA 1A31A 4M3TA 3A0IX 1X3UA 3CMAN 5JHFA 2X48A 4N4OB 3H46O 2UXNA 2XSJC 2Z3YA 4ELVA 4JS5A 3JRDA 4JI6K 1JLFA 3FXMA 4ZDOA 1GV5A 2D5VA 4C1NI 4YOVA 3DXMB 3O9RA 3I0RA 4LG0B 3DAWA 2ZNZA 4E7IA 1QZ5A 3SPZA 1KU2A 1UFMA 4JI8K 3ZMTA 4H5RA 3ZQLA 2HBMA 1WNSA 3EE9A 4JRQA 1YUWA 3L4QA 4FJ8A 3PX0A 1C0MA 3NFAA 2OTJN 1UB9A 2BHZA 4DUZK 3I59A 1R1TA 3QOEA 4B3MK 4B08A 3BPXA 3PUBA 1NHAA 3HEFA 5AQTA 3M07A 1D5VA 2HOSA 2NYXA 3ASNH 2VI6A 3AGKA 2L7ZA 2NNNA 4CF0A 1W2BM 3T8TA 3HL8A 4F2SA 1F21A 3J7YP 2E1ZA 3FBNB 2G8VA 4FWOA 2P9NB 3LSMA 3KKRA 2RGVA 2FBYA 3J8AA 3MEEA 1L3VA 4PKIA 3HYIA 1OMIA 3VEYA 2D1VA 3LAMA 3FX3A 2E2HJ 4C8MA 1D5AA 2ISYA 5F0FA 1G3WA 3C7NB 4KBOA 3ECOA 4LITA 4A5NA 2Z9OA 4PFPA 1D1AA 1H89C 2ZC2A 3AG1H 1U2WA 3CZ6A 5AQNA 1T05A 5L3EA 2VL8A 2WTEA 4OAYA 2EBIA 2EZIA 2R5ZB 5MLCQ 1EH8A 2KZGA 3HYFA 3BTCA 3VYUB 3CF5F 4DOZA 1YTYA 4N41A 2EWSA 4YDUA 3RJPA 1CZ9A 5J40A 2KFDA 1KQ0A 1BJZA 4BR0A 2X6WA 1C0UA 1HPMA 4MO4A 4BWJA 5E79C 3DBLB 1XTAA 2P7CB 2R7OA 5J6XA 4FWSA 4BC5A 3RR8A 2O8DB 5E26A 3BTIA 2QF7A 1MWMA 3GZ5A 1WSJA 4NCBA 4DCHA 1NKEA 1ASVA 1OH8A 1KYZA 1IJJA 2MGQA 4XR6A 4Y13A 1ZLKA 2I7PA 1HW1A 5LMUK 1ZGWA 3WU1B 1ATNA 2ECBA 3CCMN 2CGJA 2DTRA 4KKOA 5C24A 1D1BA 4B9VA 2ME0A 1F43A 4CYCB 3DKWA 4O5VA 1O3QA 1ZGAA 3LSHA 3H0DA 1FKOA 1FIPA 3S15J 3W2WA 3JRCA 4CZCA 1WBDA 5JLFA 1K79A 4G7OF 1RETA 4D7NA 2LY2A 1APLC 2E8AA 3ZSVA 5IYBJ 2HHHK 3DF8A 4OKJA 4GFBA 2XAUA 1YRNA 3S3OA 4DS4A 2CV0A 3KD1E 4WWCA 2V7ZA 5FKMA 3ZETA 1LV5A 3T1BA 1YOVB 3BEXA 2COBA 3CUOA 3PIPL 4EJWA 1RBSA 2QI2A 3PO4A 3C18A 4GY2B 1CZAN 2KPMA 5AQLA 3HOVJ 5FKOA 3ZCOA 1YX3A 3QINA 4DBRA 1X1DA 3CMMA 2FF3B 3P9IA 1T0FA 3LQRA 2JA7J 4CJPA 2RREA 1XI1A 2NS7A 1OKRA 3IDHA 2WAFA 3VERA 2E5LK 4BRNA 2JWTA 5BS6A 3CMAI 3AA3A 1OCRH 2A3SA 2XKOA 3HZ6A 2JUGA 3V6DA 2CGLA 5AQJA 1ZR4A 5HVQC 5TGTA 2ASMA 2FU4A 4PA1A 2MLGA 3A4CA 2FXAA 3DEWA 4CCMA 4UY8I 3A2KA 1EX4A 3T5XA 3NF6A 2Q0OA 3HXLA 5J1RA 4ID1A 3UKUB 4KH6A 5A2QK 3PV8A 3TTFA 1RTHA 3B73A 4KA4A 2QXFA 3ZPLA 3BLYA 4JYKA 3RZOJ 3C0BA 3CJNA 1ZRCA 4HX8A 2YNIA 3RVCA 2OV7A 5LGTA 3V9UA 3S14J 2IVNA 3PLAA 4ASNA 3TANA 4FJLA 2OTJI 4I2OA 1WKMA 4EATA 1UAAA 3FKIJ 1Q1VA 1UMQA 1KVAA 3ZGKA 5LBQA 3O8HA 2WB1A 4QWQA 4IOAL 3B6CA 2PFUA 5F0CA 3DRRA 3K0SA 1A5XA 4EJTA 4W5QA 4BBSJ 1H0MA 4CF8A 1XHZA 1BA1A 3MN7A 4DTPA 4FM0A 3MWTA 3JRFA 4WFBL 3Q3SA 2R7ZJ 1FYKA 1UWBA 2VG6A 1TKTA 2KIQA 2IEKA 4NLBA 3ZSWA 3D2EB 1NH3A 4XNFA 4Y3OA 3L2CA 4NDLA 2KIMA 5HS8A 4DTMA 4CHNA 2JSCA 2I7NA 1RILA 3FISA 2Z1GA 1I6HJ 4BY9C 5KNLA 4BY7J 2CO5A 3MAQA 2KFZA 2MG4A 3K1MA 1MBFA 3L6QA 1GVDA 5J4VA 5C15A 3NHGA 2A05A 3GF2A 4WCGA 1LB2A 3RWUA 1OJLA 2HQNA 1MIJA 1X1AA 3O8MA 4XKBA 3MAJA 1Z67A 2O8BB 3NWTA 1Q18A 3M8FA 4ENMA 4CHOA 2HFHA 4AIDA 2JN6A 4H0OA 4MHGA 2X0LA 2GIZA 2EFPA 3LDSA 3E6CC 1C0TA 2W7NA 4IG3A 3V1QA 2PMHA 4XEIA 3WXLA 3VDXA 1TNSA 5J2MA 4FOEA 2LREA 4C9YA 2CRGA 3TMOA 1XX5A 2D0AA 2ECCA 4DF4A 3WUHA 2UU9K 5M1KA 3WG7H 4FTHA 2M5WA 3DM2A 3B02A 4MNUA 4YRVA 3OYEA 3BDPA 3KLEA 4KTWA 3KLGA 4I9QA 3FMSA 5DUKA 3KWIA 3P7NA 4JOMA 5B1BH 1E2XA 1OYIA 3PO2J 1XGSA 4DR6K 4KYWA 1QZEA 3M1FA 2V1XA 3EQLF 3HTVA 3CCMI 4E7LA 4CJKA 4CHZA 4IFVA 4LD0A 3RTVA 5I9EB 3H08A 1MMNA 2E5ZA 4YFUA 1NLVA 2HHWA 1P92A 2WA0A 4OJRA 3IAS2 4OKKA 1S5LC 4C8NA 2BY1A 1ZYQA 3ABTA 5CZ2A 4KHPK 3ECHA 1J0RA 3CJ1A 1I5ZA 1XGMA 1LQ1A 1OLTA 2GAUA 3ZMDA 2LG4A 2EA4A 2V9VA 2IS6A 2G8IA 3JRGA 3FZLA 5AFUH 3H45C 3WODF 4PGHA 2DN0A 3LA2A 3JRAA 3MVPA 3F8FA 1RDUA 3HI0A 1IJWC 2VBZA 4DG1A 1VSFA 3ZQGA 3HRUA 4FM2A 5KQ8A 3I5UA
chains in the Genus database with same CATH topology
1MU2A 2L7KA 1RBVA 4NNJA 1P9QC 1N77A 2BW3A 3AVNA 1JL2A 2AQEA 4OKEA 1W9HA 2KMUA 2VJIA 3RCOA 1HJRA 2F8SA 3SUNA 2VWJA 1W0HA 4FLXA 4FJ7A 3SQ1A 4CK1A 4KI6A 4PJNA 1NG6A 1DP3A 4PWDA 2XRIA 2WBMA 1X1BA 1JL1A 2GOXB 3M8PA 4DQSA 2E1MB 1DTQA 2G8HA 2W00A 1ZBHA