3HPGA

Visna virus integrase (residues 1-219) in complex with ledgf ibd: examples of open integrase dimer-dimer interfaces
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCQENKMGIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 66
structure length 194
sequence length 209
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hpgA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hpgA02
4CHQA 1KRPA 4C8LA 3OJSA 4RW9A 1SL1A 3IRXA 4E19A 4FK4A 3AO1A 4H4MA 3HPHA 3VQEA 4CGFA 1VSMA 1NKBA 3PUFA 3OYBA 4KI4A 5CZ2A 2Z1HA 4FJGA 2F8TA 1ASUA 2YKNA 3AV9A 3ZSWA 3OYFA 4E7JA 4CECA 1RT5A 5FROA 1E0EA 3AVFA 5KRTA 1VSLA 3DLKA 2Z1JA 3LWLA 3K59A 1FKOA 3AA5X 4B9VA 4IKFA 2IC3A 3DLEA 4I9QA 1JLEA 2O4GA 5CY4A 4IFYA 3HVRA 1RT4A 2ZQBA 4DTUA 1FKPA 2RF2A 1S1VA 4KFBA 4Z4HA 4J2BA 3K5NA 1C1AA 4BE2A 4FZZA 4W5NA 3NF9A 4M3ZA 4DTMA 2BGGA 1S9GA 3KKSA 3TABA 4DSJA 4FLXA 4FJ5A 4M45A 2KFNA 1NK9A 4LH5A 4PQUA 1LWCA 3V4IA 4DFJA 5HRNA 4EP4A 5FRNA 1S1TA 1BL3A 2VG7A 1VRTA 2KQ2A 4N41A 3B6PA 1HQEA 4F3TA 3QLHA 4Y1CA 3OYKA 2YHBA 1D9FA 1RBTA 3AVGA 3KKRA 3SUOA 1B9FA 3LP1A 4CJKA 3WNFA 2OA8A 1REVA 3HYFA 2VWKA 2YNFA 1IH7A 2X6SA 3K2PA 3CFPA 4E1MA 3QEWA 1KCFA 1VSFA 4O0JA 4DSLA 4BACA 4OGCA 4DSFA 3V9UA 4KO0A 3AVBA 2QXFA 1DTTA 1VSDA 2XO7A 3QESA 1T8EA 2PY5A 3LPUA 3VQCA 4I2PA 2E6MA 3B6OA 3CYMA 2G8IA 4E89A 3K5LA 4ID1A 4EZ9A 3HL8A 3FFIA 1TKZA 1KONA 2YV0X 1A5WA 1VSEA 1A5XA 4CFBA 1WSGA 2OYQA 3NDKA 5HP1A 4DTNA 3RR7A 1RBSA 4LD0A 5T7BA 3KK2A 2D0BA 1LFPA 3VQPA 3C6UA 1QHTA 1HNVA 1VSKA 4Z4IA 5CYMA 5JS1A 3O3HA 4KTZA 4RG8A 2Z1GA 4ZHRA 2KZZA 1NJWA 3AA3A 2FBVA 1BQNA 1I39A 3OYHA 2A1RA 4FK0A 3HXMA 3L2UA 1J5OA 4OLBA 1TAUA 1VSIA 4J2EA 2FC0A 1KVBA 4M3TA 3AO5A 3C6TA 4KPYA 2G8UA 1UA0A 1IKVA 3ZSOA 4F8RA 2YNGA 2JGUA 2ZE2A 3DOLA 3NCIA 1JLBA 1L3UA 4E1NA 1JXEA 4CJVA 2E6LA 4FVMA 3O3GA 3SYZA 4CGJA 4E7HA 3OYNA 1U45A 1U47A 3HT3A 4HCBA 2O4IA 1CLQA 4UQGA 5HRSA 1EKEA 4FW1A 4W5RA 4O55A 4AHTA 4BDZA 4DTPA 4LH4A 4CHZA 3EZ5A 4O5BA 4PUOA 5HBMA 1GOAA 3SZ2A 1HMVA 2WOMA 3G10A 3WNHA 4FCYA 1Z26A 3TAFA 3K5OA 1WJCA 5HRPA 3NH1A 3DLGA 1RTHA 3E01A 4IG3A 3QNNA 3S3NA 2YNIA 1D9DA 4B9MA 4ELUA 1ZBIA 1U48A 3V81A 1EX4A 2B5JA 2I5JA 2ZD1A 4YFUA 5E41A 1N5YA 4ZTFA 1KVAA 3LANA 3NH2A 1JL1A 3MECA 1WJBA 3QETA 4B9NA 4KHUA 2HHQA 4HHTA 3VQ8A 1BI4B 4FM1A 3RR8A 3F73A 1W9HA 4DTOA 4CF2A 3AA2A 3MXJA 4NYFA 3OYAA 3KLGA 4DS5A 1BHLA 2HNDA 3SV3A 4AH9A 4CESA 1U49A 4CHOA 3SQ4A 3KIOA 1RILA 4B8AB 1BI4A 1QQCA 1WJEA 1HYSA 1HJRA 1RT2A 3PX4A 3M8SA 4DLGA 4FJIA 1QTMA 1BQMA 3OS0A 2IOCA 2LSNA 2HMIA 3ZSRA 3ZT0A 3IAYA 1HPZA 3KK1A 3L2WA 2AJQA 4DTJA 2HHXA 1SKWA 3NBPA 4CJ3A 2WONA 3DRRA 1JLGA 2D5RA 4B9LA 3HM9A 4BWJA 4DS4A 4CK3A 1QSYA 5D3GA 1LWEA 4KKOA 3F9KA 2BE2A 4NCGA 3KK3A 1TK8A 4DTXA 4Z4GA 1HNIA 2BANA 1RBUA 4DTSA 4FJ8A 3KJVA 3TWHA 2GUIA 1BIUA 4LY7A 3NF7A 4M42A 4I9LA 4CE9A 4EP5A 1X9SA 1JL2A 3EYZA 4CF9A 3NHGA 1Q9YA 3P83D 4B9TA 4CJPA 1CZ9A 1FXXA 1RDCA 1WSIA 3LZJA 3SQ1A 2Y1IA 1NJYA 3RRGA 5SZTA 4DQIA 3VQ4A 4PY5A 1CZBA 4CJQA 4OGEA 4Z4EA 4FJXA 3MXMA 5KGWA 4E7LA 4CFAA 3I8DA 1ZBHA 3L8BA 2OZMA 3AO4A 2HHUA 3OYGA 1WN7A 3ULDA 3TAEA 4CEEA 1LV5A 4F2RA 3V1QA 3VQBA 2VG6A 5J2NA 4DQPA 4FJJA 5SWMA 4DFMA 3QERA 4JRPA 4PWDA 3HPOA 3VQQA 1X9WA 1NJXA 1VSHA 3VQDA 4E0DA 3MAQA 4DU1A 2HNZA 3VQ6A 3OYJA 3VN5A 1C1BA 5FRMA 3HPGA 1TVRA 4CERA 2XY7A 1IKWA 2YNHA 4IFVA 3OYDA 4HUGA 4N76A 4FM2A 3CM6A 3OYMA 4DU3A 1RCHA 1GOBA 3K58A 1ASWA 4I7FA 4DSEA 4DFPA 5I3UA 4C8KA 3T1AA 3NF6A 2OPSA 1LAWA 3HP9A 1RDDA 4KTQA 1C1CA 4Z4FA 2B4JA 1WNSA 2RKIA 5CZ1A 4JRQA 1T7PA 2HW3A 4CEFA 4YNQA 4KHSA 4CJUA 2FBXA 1SL0A 1HRHA 2PZSA 4FYDA 1JLFA 1S9EA 1WSJA 3CFOA 1NK7A 4AHSA 1CXQA 3VQ5A 3V9WA 4M41A 3HP6A 3TI0A 1TKTA 1NK5A 1MW7A 3L2VA 4CCHA 1ZBFA 4KB0A 4KRFA 3LALA 4DF8A 2E4LA 2KTQA 1RT1A 3NGZA 4KHYA 1KVCA 4FM0A 1O1WA 1S1WA 3I0SA 3DRSA 1Y97A 3ZT3A 4FK2A 3DOKA 4HUEA 3HO1A 1NK4A 3AVHA 5KGXA 2IAJA 3ISNC 4DG1A 5J2QA 4FLTA 3SPZA 2XY8A 4CEBA 3T19A 1NK6A 3TR8A 3KTQA 2FBTA 4CJ5A 1GOCA 1ZBUA 4K8ZA 4CHPA 1XI1A 3QEVA 1YTAA 2XY6A 1NOYA 1RT7A 3ASMA 4N5SA 1EP4A 4M3RA 4GVMA 3UIQA 2X74A 4DF4A 1RDAA 2PYJA 2B6AA 4FLZA 3CQ8A 4Z0UA 4BE0A 4HUFA 3SV4A 4F3OA 4IDKA 2QKKA 3HSTB 4JS4A 2HHTA 3CG7A 4CJEA 4ELTA 1JLQA 2OPQA 2HB5A 3LAKA 2D0CA 2DFHA 1WSHA 2BDPA 1RBRA 3K5MA 3KD1E 4Z4CA 5C25A 4LSLA 4FJMA 1VK0A 4B08A 4CJRA 4PA1A 1D5AA 4ID5A 4RW7A 1IG9A 4OLAA 1BGXT 4KHNA 4KV8A 4N56A 1NOZA 4JS5A 3QEIA 1MU2A 3MEEA 4XIUA 3CM5A 3D0PA 4FLWA 4FLUA 3RMCA 1VSJA 4O4GA 1IKYA 4CFDA 1G15A 1KFDA 1JLAA 2P5GA 1LWFA 3NGYA 4M3WA 4DQQA 2ATQA 1B92A 4GMJB 4W5QA 4CGGA 2PYLA 3KLHA 4ELVA 1C0MA 4CEAA 1ZYQA 4OKJA 4JLHA 3L2RA 3DYAA 1TAQA 4IBNA 1T05A 4QCLA 3EY1A 5C42A 3DRPA 4AILC 3PO4A 4J2DA 4NYNA 1I3AA 4CK2A 3OYIA 3K57A 1U04A 3ALYA 3D45A 5CYQA 4CFCA 4OJRA 3SUNA 4KHQA 4QOZB 4FXDA 2ITGA 4DQSA 1YT3A 3G0ZA 2R7YA 1RDBA 4MFBA 4E3SA 4DU4A 1L3TA 3TARA 4E7KA 4CJSA 1HQUA 2F8SA 2DTUA 1L5UA 1X1PA 1TL3A 3QEXA 3DLBA 1D8YA 4CJ4A 3OYLA 3VA3A 3VQAA 5J2MA 5HROA 4RW8A 3OVNA 4M3XA 4C8OA 1C0UA 2IGIA 3SPYA 2KFZA 2VWJA 3QINA 3PO5A 4OPJA 2HVHA 2QKBA 2P1JA 4CEOA 2P51A 4CEQA 2G8FA 4OKKA 4BDPA 4FZXC 1RTJA 1BIZA 1TGOA 2IDOA 1X9MA 1RT6A 3QNOA 5EU7A 3VQ7A 4B9SA 3AA4A 3AVAA 1DTQA 3TANA 4CEZA 1UWBA 4K8XA 4CHNA 1TKDA 4Q5VA 1J54A 2G8HA 1N6QA 4KI6A 2HVIA 4FJLA 2OPRA 2HHVA 5C24A 4GW6A 4HVJA 3OYEA 3T3FA 4KB1A 2ETJA 1J53A 3M8QA 5HRRA 3L3UA 3OY9A 1RNHA 1S1XA 2JLEA 2EX3A 3AVCA 1S5JA 2A1SA 4KHWA 4F2SA 5FDLA 1RBVA 4LSNA 5J2PA 3WNEA 3SQ0A 5JS2A 3IG1A 3HJFA 3AVKA 4KTWA 3AVLA 2XHBA 1TV6A 4FLVA 4FJKA 2P5OA 1DLOA 4W5TA 3BGRA 3M8PA 4CJTA 1NKEA 1TK0A 3KLFA 1L3VA 4ZTJA 2X78A 3ITHA 4C8NA 4OPKA 3U6FA 1S1UA 3SI6A 3QIPA 1NK8A 4HCCA 4AHVA 3PX6A 3AO3A 3AVIA 3RMAA 5DK5A 3VA0A 4KREA 3HVTA 3S9HA 1S6QA 3AVJA 1WAFA 2FBYA 1LW2A 1K6YA 3V9SA 1T03A 3NH0A 1BCOA 1SUQA 1VRUA 2XRIA 3P1GA 1KLNA 4N47A 1QS4A 3MXIA 3V6DA 4CF8A 1Z25A 1WAJA 4B8CA 4DSIA 3U3GA 3SJJA 3V1OA 1WSEA 3TAMA 3L3VA 4Y1DA 3ZSQA 1C0TA 4CGHA 3KD5E 3ZT2A 4OVLA 3ZT4A 4FLYA 3TAQA 2HNYA 4AHUA 3NAEA 2G8VA 4Q0BA 4ICLA 1UOCA 1R0AA 3C94A 4CF0A 1C6VA 2G8KA 2KZMA 1IKXA 5KI6A 1W0HA 3BDPA 4I2QA 4DFKA 2OZSA 4CEDA 1XHZA 1XC9A 3A2FA 3MEGA 4QAGA 4FJNA 3ZSVA 3VQ9A 4B3OA 1NJZA 1KLMA 1HYZA 3O4QA 4CHYA 1QE1A 4DTRA 3LAMA 3IS9A 3DMJA 4CIGA 3THVA 3M8RA 2G8WA 1NKCA 4OKEA 1TK5A 2W42A 3LZIA 1KSPA 1YTUA 1JXBA 3NF8A 4C8MA 1WJDA 3RMDA 2EHGA 3C95A 3RRHA 5HLFA 4NCAA 4M3YA 1HYVA 2DFFA 1WSFA 2NUBA 4R5PA 4WE1A 1UA1A 1SL2A 3ZSXA 5KRSA 1UAXA 2RPIA 3JSMA 4M3UA 4MQ3A 3SUPA 4L8RB 2IS3A 1ITGA 4FW2A 4RW4A 3V1RA 3LWMA 1SKSA 3SQ2A 3LDSA 4NCBA 3AVNA 1JLCA 1SV5A 3MEDA 4H8KA 3AVMA 1QSLA 3OS1A 3PY8A 4FJHA 1EXQA 1ASVA 4DSKA 3PX0A 1KTQA 1L3SA 3ZT1A 3LPTA 4AHRA 5J1EA 1U4BA 4E7IA 2DY4A 1S6PA 1WJFA 3L2QA 1RTDA 2GBZA 4O0IA 4BDYA 4EZ6A 3PV8A 1WJAA 2F96A 4FJ7A 1EETA 1YVUA 1RT3A 1WLJA 2Y1JA 3CFRA 2Z1IA 3TAGA 2D0AA 1A5VA 2RN2A 3LP2A 4RW6A 5DMRA 5KTQA 3O3FA 5I42A 4AHCA 1IO2A 1NK0A 2OPPA 2XY5A 3HK2A 4O44A 2YKMA 4CJWA 4HTUA 3LP3A 4IG0A 3QEPA 3SNNA 3NE6A 2KW4A 3S3OA 1FK9A 3U3YA 2X6NA 4H4OA 4CF1A 1BCMA 3KLEA 3H08A 2Q3SA 1JKHA 4BE1A 4CGIA 3TAPA 3QIOA 3SUQA 3S3MA 3WNGA 3V9XA 4KAZA 2QK9A 3DM2A 1RTIA 2VG5A 4J2AA 3JYTA 4DWIA 4F3QA 1XHXA 4TSXA 4F4KA 1XWLA 3DLRA 1CXUA 3V9ZA 3AO2A 4CJFA 1QSSA 2HHWA 1LW0A 3P5JA 3KLIA 3ZSYA 1ZBLA 4CGDA 1TKXA 2YHAA 4CIFA 1TL1A 2GV9A 1F21A 3RWUA 4G1QA 3ZCMA 4CK1A 3OYCA 1J9AA 3NGIA 5K14A 4FJ9A 3SCXA 3OS2A 4CJLA 1Q9XA 3DLHA 4DLEA 3QO9A 1Q8IA 4W5OA 3LP0A 1LAVA 3OJUA 2DFEA 4BWMA 3O4NA 3DI6A 4B9UA 1KFSA 3NFAA 3RMBA 2HHSA 4FZYA 4DQRA 1BISA 4CIEA 1SKRA 3ZSZA 3RTVA 4DMNA 3I0RA 1B9DA
chains in the Genus database with same CATH superfamily
2QF7A 2WB1A 4Y7NJ 4KI4A 2KQRA 3OYFA 2YKNA 2Y0SA 1FNNA 2ME0A 2F2EA 1O13A 5K5RA 5CY4A 2E20A 2RF2A 3LNQA 5CE3A 2YU9J 3GFMA 4F7ZA 2DT6A 2HTJA 1OH8A 2WV1A 4CA0A 2YHBA 4CJKA 3CFPA 3FZKA 4UV9A 4BGDA 3N4QA 3PO3J 3TO7A 3B6OA 3W3CA 2G8IA 3HL8A 3FFIA 3D1NI 3MQ0A 5T7BA 1W5CC 3K4KA 4N0BA 5HDKA 3SBGA 4IQJA 3VYUB 3ZQFA 4CCOA 1OCCH 3H5RA 3FM5A 2DT7B 4LH4A 2XSDC 4B3MK 4PUOA 3FZFA 1KQ9A 2E5NA 5CVUA 3TAFA 4GY2B 5M1KA 2V1NA 1FOXA 3LSGA 1BA0A 1B4AA 1JL1A 4RB2C 3WT0A 3IKVA 4HF0A 1GUUA 2PMZA 3THWB 4F93B 1NMDA 4E70A 3SAGA 3KIOA 1BI4A 1HYSA 1PDNC 4DLGA 4KUMA 2F7TA 1QSYA 3LDOA 3T0YA 3QYBA 1SVLA 3BTIA 2I10A 3EYZA 3GEZA 1FIAA 5J4VA 2QSFX 4JEPA 3SQ1A 1RDCA 1FXXA 3T1YK 5IYCJ 1GVDA 3OYGA 4IO9L 1D8KA 2LH9A 3FXOA 4FJJA 3UKRA 4ZZDA 1OQYA 3BTLA 4E0DA 4PCQA 5ADXA 1VQLI 1C0GA 1IKWA 3GZ6A 5I3UA 4AD9A 3ZQ7A 4DGWB 1K7AA 3SK3A 2DOFA 1KD1O 3CFOA 4OMYA 4P96A 3KYDB 1BOBA 2LFBA 5F0FA 4BY7J 2YPRA 3HOZJ 4LG0B 4PL7A 3CC4I 3U21A 2FBTA 3F9MA 4CBWA 1KC8O 1L0OC 5AQRA 4GCVA 4CDGA 4N9HA 1E4FT 4AF1A 3KD1E 5BN8A 3CUQC 2K9LA 1BIBA 2HXIA 1D5AA 3O9RA 1ZGWA 2NLXA 4JS5A 2JK3A 3GTOJ 2I7PA 3NGYA 4HNUA 4RAZA 4ELVA 4Y17A 4PUSA 3P9CA 4NB4A 4FWKA 5BPLA 1T56A 4RBOA 4MLOA 3ALYA 2N8GA 5K5QA 2R7YA 3LQRA 2P81A 3CCRI 4ILGB 2JSPA 2EWNA 1I27A 3HRSA 4HDVA 4MNUA 3R0JA 2CUJA 5EU7A 2LF8A 4FL9A 4FWNA 5H2FC 3S1NJ 3HGYA 3F5TA 2XHBA 3EQLF 1X3NA 1DLOA 2VQEK 3ABTA 3MKYB 5F1RA 2A3SA 1S6QA 1YX3A 4YHHK 1G6NA 1BWFO 4JKFA 2E1MC 1T39A 4DR2K 3SJJA 4HLXA 3C2GA 2HBJA 2Q36A 1HW1A 4OOIA 4AHUA 2Z2SB 2IS2A 4U7BA 2G8KA 4JHDB 4CIGA 3DMJA 5CHIA 4OKEA 3NF8A 4WYBA 1WJDA 4M3FA 2PJRB 4AIKA 1KZHA 3S2HJ 5KRSA 1D5YA 5EF6A 1YITI 4CHUA 1NG6A 1RR8C 4DSKA 3O9SA 5B5EC 1Q7YO 4CYDA 3BG7A 4BDYA 3BQZA 3K70C 2D0AA 1A5VA 3P7NA 5I42A 4AHCA 2OPPA 4BU2A 1QPMA 2UUAK 4RMNA 5K7FA 1U78A 1MBJA 1JKHA 4YOTA 4FO0A 2FSJA 3V9ZA 1RZ4A 4CGDA 1GV5A 5KVRA 2ZSHB 1I3QJ 3FWEA 4BBSJ 3I4MJ 5DM7F 3MKWB 5JVGL 3O8HA 1SL1A 4JAXA 1LVAA 1VSMA 5D8LB 4CECA 5KRTA 4OO1J 4PDKA 2CGJA 3MMYB 2YX7A 2IC3A 3H6EA 2O7OA 2P7CB 2XPUA 1S1VA 1I1SA 3HKZN 4B43A 1IRFA 1C1AA 1J6ZA 3L09A 3ZX3A 2Y31A 1W7AA 3V4IA 3SZTA 4I99C 1B1BA 2KQ2A 3S15J 3A2KA 1MWKA 3TSUA 4E1MA 1VSFA 2DA3A 4KO0A 5B66C 4PSXA 1DTTA 1KONA 4NQWA 4CYCB 4CFBA 3DU6A 3W2WA 4X62K 4LD0A 2MD0A 1BR4A 1SFOJ 2KZZA 1FWZA 4IZ9A 1JGSA 1JCEA 4BNCA 1K8KA 2E35A 1Y1WJ 5AIPA 2L7ZA 1L3UA 1HW5A 2E6LA 2CV0A 2RNGA 1OVYA 4AHTA 4U0WA 4O5BA 4DV4K 1USTA 3C6HA 1Z26A 1TKDA 4HPQA 3OBWA 3E01A 2PEXA 2Y69H 1RNLA 3DKXA 2QI2A 4D5CA 5M3FJ 5EEAA 3D2FA 3F73A 4DTOA 3H92A 1X3MA 4CVNE 4CZHA 1LDKB 3GCMA 1DDNA 1RILA 4F55A 3PX4A 1X3UA 2IOCA 2IPQX 4IZZA 4ILJA 2W84A 2E7WA 1JLGA 2GOMA 4BWJA 1SVOA 2HVSA 2LP0A 1K61A 5GTHC 3NF7A 1B59A 2FXUA 5AFUA 3VWBA 2GM4A 4XH4A 5AQZA 3LA3A 4G6DA 1T95A 1Z91A 5C10A 3A5NC 1MA9B 1LJ9A 2BW3A 2HNZA 3VQ6A 3V7CA 4EHTA 4BBRJ 1OKJA 1E4GT 4DBRA 4DJAA 3ML6A 1LAWA 3F6OA 3U1DA 3W6KB 3RIRA 1R4MB 3FISA 2PZSA 3CCQI 1TYQA 1REPC 3V9WA 3MWMA 4RGXA 1MIJA 1U8BA 1W7PD 2HVQA 2ZMEB 4MHGA 1NK4A 3DP7A 4ON0A 3FXMA 3JS6A 1ETQA 4XKVA 1NBWA 4K8ZA 2XASA 3SJMA 4IO9F 2KIFA 4FLZA 1MSEC 4CJEA 4DUYK 2BDPA 3MKLA 1GLAG 4LK1F 1MBKA 1ZBSA 4CGGA 2Z5UA 3A0HC 4AYBA 4B48A 4QCLA 1TBXA 3HTUA 1T08B 4AM6A 2YR2A 4CJ4A 1X4OA 2IGIA 1GVJA 4PKHA 3E9PA 4A3EJ 2P0WA 2P51A 1X9MA 4B9SA 1MBHA 5EXWA 3AA4A 3HDDA 1Q82O 5AQQA 3L9FA 3U1KA 2O8EA 2HHHK 5HRRA 4HV5A 2MC4A 1FJLA 4I6MA 3ULQB 1FW6A 1OYWA 2DFIA 2R7TA 1L3VA 3VYSB 2GA2A 5LEJA 3FZMA 4M3BA 4HEA2 5ICCA 4DUZK 3KETA 1ATSA 1KLNA 4N47A 1QS4A 1WAJA 3TAMA 3R0AA 1SFXA 3PQKA 4KICA 3C94A 2KZMA 2YI1A 4CEDA 1QVTA 3A2FA 3MEGA 3VQ9A 4D0PA 3KZZA 1YTUA 3RRHA 1H88C 3TMOA 2V9VA 4I98B 1SKSA 2JA6J 3MEDA 3VFZA 5LD2C 1ASVA 2O9LA 2DPNA 3PX0A 3LSMA 5EZGA 1WJFA 2DAOA 4Q47A 3PV8A 3LDLA 1WLJA 1U5TA 3BPXA 2LY9A 1SANA 2LNBA 4O44A 4KHPK 3WHCA 2HOEA 3QQAA 4KN7X 3THXA 3PNTA 3D6RA 1QSSA 3L7WA 1XN7A 1Q9XA 3A8YA 2ELKA 2BVMA 3I53A 2VBWA 3OJUA 3RDIA 4B9UA 4A5AA 3RMBA 4PKIA 1B8IB 3REOA 1AKHB 3PO2J 1B9DA 2PJPA 5KQ8A 4CGFA 5D5WB 5FJ8J 3AVFA 4NC8A 2EFOA 3FMQA 4G7ZF 4DYCA 3ZMVA 4DTUA 5EZHA 4WK8F 1D0XA 3K5NA 3BG6A 2VGNA 2CO5A 1WVRA 4FZZA 3NF9A 2OCEA 3I56N 1YJWN 1LWCA 1XTAA 4XM3A 1Z7LA 4Y1CA 3WQUA 1B9FA 1YUWA 2M45A 1WWXA 4PJNA 1ZG3A 2FJ1A 1ORKA 3JAMO 4IEIA 2H8WA 4ISEA 5JVGF 1NK3P 1TLHB 1QZEA 2KP6A 1LEAA 3CJ9A 1VSEA 1LFPA 1MMSA 1J59A 3SFIA 1RETA 5JS1A 1LFUP 4LLGF 4BAYA 2YX4A 2E2JJ 4KITB 5J40A 3WTWC 4KPYA 4EJOA 3ZSOA 5J1YA 3FGUA 2EIKH 1V5EA 2M30A 4CI6A 5BQTA 3VEXA 1U45A 1U47A 4FW1A 1VQ9I 5ICGA 1DGRM 2AHQA 3GFJA 4A3FJ 2DI3A 3K5OA 2EFPA 4H0OA 4BRKA 1ZBIA 2BHZA 2NYXA 4JKEA 4L18B 3NH2A 4B1XB 1KGSA 1RIOH 1T0FA 2ZNYA 3DBRB 3SDBA 3ZETB 2K02A 3M8EA 3JAMK 1XCVA 3SQ4A 4B8AB 3DJCA 4A0XA 1QTMA 4X64K 1HKBA 3U8XA 4DTJA 4CJ3A 3N4MA 2JA5J 2ISYA 2UXBK 4HNVA 3TTCA 1HNIA 1VF9A 4FOIA 1G2HA 1WZ2A 1FIPA 3CPWM 3BZ6A 2GOXB 2KLOA 2VJ4A 1TP4A 5SZTA 4MFEA 4U7DA 1QZYA 4GNIA 2XPVA 1VZ0A 3CIPA 1P92A 3FMSA 5L3DA 3QRFF 3H3UA 4IFVA 5IYBJ 3OYMA 1GOBA 4I7FA 3ZRGA 4MO5A 3QDKA 1E3MA 4YNQA 4BHCA 2LDUA 4FYDA 3E5XA 2WAFA 2KTQA 4KRFA 4GV9A 5M1NA 5LMUK 5E1ZB 3AVHA 1YTYA 4DG1A 3FXKA 3TDUC 1YOVB 3TR8A 3DKYA 3QEVA 3ASMA 1VAZA 4LG0A 4CZGA 1VQ5I 5JMVA 2HOSA 1ZHFA 3LAKA 1O57A 1WSHA 4BHPA 3JRBA 4LSLA 5TKYA 2HF3A 2JA7J 3H9GA 1W0UA 4C2MJ 2Y2ZA 1BC8C 4XLAA 3KCCA 1LWFA 1SVMA 3O9TA 5DUKA 1XX5A 2P9PB 3F8CA 2KRHA 5BRFA 2AP1A 4C1NK 4CFCA 2WBNA 4FXDA 5E26A 3G73A 2CQ7A 2EFQA 3AG3H 3CCJN 2W6KA 4A3IJ 3QINA 3AKZA 3L0QA 5FLMJ 1XQSC 2LREA 1RTJA 2XAUA 2NRVA 4M73A 2KJBA 3KK7A 5E3OA 2VJ5A 3RKQA 3H9QA 1TQPA 2XB0X 3WTYC 3P31A 4BXUA 4M6XA 5CVJA 5JS2A 3F8FA 1EQYA 2GWJA 2DTZA 3RI4A 4M63C 3DWLA 3KFWX 2X78A 1BG3A 4C8NA 3C7NB 3ID6A 3IWZA 1U2VB 1QZ5A 3BQYA 1P8ZA 3C0BA 2YSRA 4PJMA 4CCNA 5EVZA 3U3GA 3V1OA 1WSEA 3A01B 3L3VA 1ULYA 5LHIA 3WXJA 4GVEA 3NAEA 2G8VA 4YOWA 2EINH 4NO7A 1P7JA 2O5RA 1HUXA 3CCVN 1HYZA 5JVHL 3M8RA 3S1MJ 4U88A 1ZELA 4C8MA 5HLFA 4JHDA 2DFFA 2V79A 4R5PA 2Z9OA 3ZSXA 2OF7A 2WAQN 1N75A 4HQMA 1M1KO 2K3FA 2DOAA 3LDSA 3TTDA 5IOYA 1YIJN 1SD7A 2PJRA 3SLCA 1LDJA 4HX4A 3PLAA 4O0IA 1UG0A 2GBYA 5AQNA 2E7XA 2FA5A 1YJNN 3SNNA 2M0MA 3W2AA 5EOYA 2Q3SA 4UY8I 2HFHA 3J7AP 3JYTA 4RA2A 2CYYA 1XWLA 1NMNA 3ZCMA 2GA1A 3LP0A 1CF7B 4AVZA 3F8BA 3J80O 3FKJA 4A3JJ 3ZSWA 2HQ5A 4IHYA 4M3GA 3UE5A 5E17F 4L9JA 4NXNK 2CV1A 1TQMA 2ZQBA 3LA7A 5KHDA 2EQRA 1YYVA 3M8FA 3NMUA 3IH3A 2CW0F 5FRNA 3G6EI 4EP4A 1APLC 5LHGA 2OD5A 3TDZC 3GYHX 5AQYA 4J2BA 3KP4A 3WNFA 1MNEA 1MSFC 2W1OA 3K2PA 4Y4RA 1DUXC 3IDHA 2IGOA 4ID1A 1MDUB 2IW5A 4BQLA 3CMEI 3H36A 2DA7A 1A5XA 3K4CA 2Z16A 1LFBA 2IVNA 3DF8A 4YIFA 2FRHA 3RSEB 4OINF 4CYCA 5TISC 3J80K 4OLBA 2KDZA 5TRDA 1VSIA 4AIJA 2R5YB 1H89C 3DXKB 4K2EA 3OYNA 4LF8K 1GOAA 2IA1A 2AQEA 4Y13A 3QNNA 1FZPB 3V81A 3CJCA 3ZQHA 4FPAA 1JUMA 2ZJ2A 4KHUA 4HHTA 5LGTA 3SEQA 1P9QC 1VQ9N 3MXJA 3OYAA 1W4MA 4P55A 3K1NA 3BPVA 5FB2A 5GP9A 2HMIA 2DODA 3F21A 4E4HA 1R00A 3FE1A 1AWCA 4DTSA 2PI0A 1XGMA 1VQ6I 2A5YB 1Y64A 3NHGA 1YG2A 3CJBA 4Z4EA 2ZCWA 4WFNL 2XGEA 5J2NA 1BW5A 1X9WA 4A5MA 5DDGA 3F8NA 3ZYYX 1EV7A 3VN5A 2EH3A 3K0SA 4FM2A 2CWEA 1KYWA 1NGCA 2P9SB 3JSOA 4GO1A 3ZXSA 2VQFK 4CEFA 4GKKK 4NLBA 1O3SA 1S9EA 1S7EA 3TI0A 4A3DJ 2OZ6A 2Q2RA 3I0SA 3HO1A 4IXCA 3H3VK 4BJTA 1RT7A 2OU2A 2ZMEA 2J5OA 3BUZB 2O6GE 3MK6A 2KMUA 1I50J 3IWFA 4LK0F 2DFHA 4RAYA 3WG7H 1O7LA 5HS8A 3K4JA 1IG9A 4KV8A 3IP4B 4HF1A 4XIUA 3FZHA 1CGPA 4FQGA 4V2GA 4CZKA 3IL2A 2ATQA 3E1YA 2PYLA 1RKTA 1K4TA 4XSXF 5ICEA 4Z94A 2I7NA 1SMTA 5L3BA 4BR2A 3SAFA 3G0ZA 4BG9A 5JICA 3A4CA 4XRSG 1X1PA 2XROA 1D8YA 5D8KB 5GAEJ 4XRFA 3VQ7A 1YE9A 1DTQA 4BGAA 4HSRA 1WKMA 5AQFA 3I4PA 3AL0C 5E3LA 2D0PA 3EYYA 3IG1A 4A2UA 4X0GA 4BYYA 1UFMA 2E1NA 5J6XA 1VQ7I 2GUPA 2ITMA 1FP1D 1K6YA 1POGA 1R5GA 2DQRA 2Q31A 3ELKA 2O03A 2BUPA 3CHWA 3VSLA 3AFHA 2YHYA 1W0HA 4I2QA 3KP3A 1YW8A 1XDSA 3BCBA 3DEWA 1IJWC 2YCHA 3HTSB 4WE1A 1IV0A 3GWZA 4MQ3A 3EUHC 2V1UA 2IS3A 4ZYHA 4FW2A 3JRDA 3SQ2A 5B1BH 3AVNA 1JLCA 4A61A 1MMGA 2DA4A 4K43A 3KEQA 2STTA 1NM1A 1YHQN 3DBLB 3ZCOA 5GIPA 2PN6A 1BU6O 5BREA 3CCEI 2DK5A 1MMAA 2VJJA 1YW9A 4LOCA 4JK8A 2VT2A 3HRGA 3EE8A 5L3CA 4DWIA 4F3QA 4BROA 3A0IX 1CQTA 2YHAA 2XGCA 1LVKA 1WHUA 4FJ9A 3QO9A 4LLLA 3AG1H 4CSWA 5GPCA 1BISA 2K9QA 4CIEA 2P5LC 1B72B 1MH4A 1B8IA 4E7JA 2WB1N 1AKHA 2QWOA 3FBNB 4B9VA 2Y0SN 1O3QA 5FKMA 1QRYA 1IN6A 4Y15A 4FLXA 3SJHA 2O8CB 4JBAA 1HQEA 1WB9A 2E34A 1PYVA 3SEZA 4KH5A 2QXFA 1BL0A 4I2PA 3VQCA 4C23A 4JNEA 2L7MP 4HX7A 1RBSA 4M9ZA 2CGLA 2L4AA 3CI5A 4ZHRA 2FBVA 1ZLKA 4GYGA 1TQIA 2FC0A 4M3TA 3E6BA 4M74A 3U2RA 1XMKA 4RS8A 3Q0VA 3HM5A 2DOEA 3MN5A 2O4IA 2KT0A 1EKEA 3QYFA 1OH5A 2R92J 2PAVA 3ASNH 4B9MA 2OTLN 3LSRA 2NVXJ 4JYKA 1W97L 4ZTFA 2EIJH 1WJBA 2UZKA 4B9NA 1JUPA 3HL2A 2OZUA 3VQ8A 1R4NB 3KLGA 4HTLA 2PMZN 2VKDA 1AOYA 5FGMA 3ZMUA 3I9V2 3I55I 4CCLA 3ZETA 4H0YB 1G3TA 3JW4A 4KKOA 3QOPA 2QBYB 3CCLI 5EY4A 1BIUA 3OV8A 3LWFA 3LSIA 2GIZA 3KX2A 3LZJA 2E19A 1NJYA 4DQIA 1P2FA 5CVVA 1GDTA 4CEEA 1BOAA 3VQBA 1T44A 2CFXA 3C1DA 4A3GJ 2ACJA 3THYB 3CMMA 5LJWA 3HOWJ 4LG3A 5FRMA 5JLXA 4DU3A 3K58A 2R7UA 2IBDA 2JRMA 4Z4FA 1T7PA 1KYZA 2HQAA 3ZX0A 4L0ZB 2DMQA 3G25A 1HNXK 3LSTA 1UB9A 3QU6A 1J5YA 3CZ6A 1X3WB 2A68F 2XY8A 3KTQA 4I0AA 4BEHB 1XI1A 3J7AO 1NOYA 5IY5H 2X74A 2QA4I 5DV5A 2NRRA 5M3MJ 1JLQA 4YFXF 1RBRA 5C25A 3K9JA 1D1BA 3O08A 3QEIA 3MEEA 3CM5A 1VSJA 2QWPA 4HDUA 5C15A 3H0DA 2BXZA 3GBTA 2K5CA 3CJQB 1Y8QB 2K9NA 4JLHA 1LOTB 4KDPA 3EY1A 4J2DA 3K57A 4HX8A 4MDAA 2P9PA 3ZQCA 1MNDA 3VGKA 3HRUA 3EKUA 4E3SA 1VTNC 2Z1DA 1ATRA 4ZJZA 2FMLA 2VKVA 5J2MA 1VQ4I 4BJ6C 1ZC6A 4RW8A 4XOTA 2HVHA 4CEQA 5DD4A 4MO4A 1BIZA 4PZJA 2BTFA 1J54A 4F91B 2DYRH 3LFUA 4GW6A 2ETJA 3H46O 3C65A 1MZBA 2RE2A 1R59O 2W40A 4BR9A 2IGNA 2E1YA 3HJFA 3AVKA 4RM2A 4MTDA 1WPKA 4L9TA 3D5SC 3J7AY 1N25A 3RVCA 3GLXA 2DXIA 2ZJQL 1S1UA 2WTUA 4MLHA 2R4GA 1BCOA 2H6CA 3HOYJ 3C7NA 4BRFA 3TOAA 2L9SA 1U2VA 4DV7K 2H6BA 4LF5K 5DUIA 4GKJK 2MH2A 3CMAN 1LUJB 3VENA 3C95A 2UU9K 3GFIA 5BPIA 5TGTA 3UKUB 2ELJA 4I09A 4NC6A 1FC3A 3DXMA 3BJOA 2OA4A 1FOKA 3LPTA 1S6PA 4ILHA 5C12A 3MX2A 1JKOC 5HS7A 5DMRA 4AC0A 3LP2A 1IO2A 1TWHJ 2H3GX 4CJWA 1XNQK 3BTCA 4GV6A 3WNGA 4AIHA 4LFAK 1XHXA 1KQ0A 2GAUA 4H0VB 4MLEA 3EUAA 4CJFA 2IAIA 3O8GA 3E97A 3GTKJ 1K73O 1HQCA 3OOUA 1TW2A 4OIOF 3DLHA 3N4PA 3F2KA 2DFEA 2CRGA 1OCTC 4B1RA 4FWLA 4HA8A 1HBXG 1C0WA 4CEOA 1KRPA 3FHZA 3L00A 3AO1A 1CF7A 3PUFA 3VOEA 1KU2A 2A41A 2Z1JA 2ZFUA 1JI8A 5F08A 1MJBA 1FPQA 1N8RO 5CVIA 2XDVA 1JJ6C 1BI3A 4JKCA 1OFCX 2FBHA 3KWGA 2AQFA 1RBTA 3SUOA 3HYFA 1K79A 4BACA 4H5RA 1FX7A 1BI0A 2E6MA 3K5LA 3HZ6A 2LRDA 2Y48A 4V2FA 4RCHA 1JKRC 3RR7A 2X1EA 2RN7A 1UHMA 1J0RA 4OAZA 4UB6C 1QBJA 2Z1GA 3JSPA 1Z9CA 4DHYA 2V4JC 2WWYA 4PJJA 5HVQC 3RSEA 1DEJA 1YIOA 4FVMA 4BRGA 2NS7A 2R5YA 1Y8RB 4W5RA 4YOUA 5BPDA 4CHZA 4FCYA 3DXKA 5HRPA 3QPTA 3NH1A 1HNZK 1Z6TA 1HR0K 2M3AA 1WRJA 5M1PA 2GXGA 3ECOA 1W9HA 2WY7Q 4CF2A 3SYTA 1O4XA 5DYMA 4YOXA 2B9SA 1ON1A 5C3EJ 1YF5L 2EILH 2A6HF 1IRXA 2O8DB 3G4SI 3ZSRA 2AJQA 4MQ9F 4DW6A 1MD0A 3EEQA 2DLLA 3H0GJ 4ETSA 2ID3A 4MQVA 2Y30A 5KGWA 1ZAOA 1SD4A 3I8DA 4KT5C 3E9LA 4WQ5A 2L02A 2QEXI 5DCFA 1HJOA 5JI6A 4HF2A 3OL4A 4N9IA 3HPGA 1EWRA 5AQXA 1EH8A 2BY1A 4DR1K 2ZGZA 4J19A 1RDDA 1VQPN 2X6OA 2R3SA 1IXCA 1XNRK 2DQLA 4AHSA 2P9SA 4XRSA 1IXSB 1MMDA 2KIQA 2IS1A 3KPHA 2EB7A 4BKXA 1Y97A 4NLCA 3ISNC 5J2QA 1NK6A 4CJ5A 4CHPA 5DD8A 4K41A 3VTHA 4JS4A 1RESA 5GIOA 2OPQA 5KNLA 4DCHA 4YRVA 2IJLA 3S32A 2E2HJ 3CJRB 4CJRA 4PA1A 1LE8B 4MEYF 1NWKA 1R6RA 2HMPA 2W00A 2HDDA 2VB6A 4H0XB 2DMNA 2NOGA 4IBNA 3OWTA 4XK4A 4AYBN 4C3IJ 5AQGA 4CK2A 1U04A 3D45A 1JJ8C 4OJRA 2BH1A 4CZIA 3J7ZO 3ATVA 3D0SA 1W36D 2F8SA 2DTUA 1TL3A 2F5CA 3I64A 1NGHA 4IHVA 4AU7A 4M3XA 5LRRA 2GIVA 4C9YA 2I5UA 1KU3A 3FLCO 3HXLA 4ESJA 2BYVE 3LM9A 2CW8A 2HHVA 2NS0A 1J53A 4IDHA 3GZ5A 3MEXA 2M8GX 2M7AA 1BO5O 2KHOA 4FJKA 4DOZA 3PJRA 1SFEA 2CJJA 5HLGA 1TK0A 4ZYDA 1GLNA 3KLFA 2W4SA 1STZA 1QVUA 4XNFA 3V9SA 4ASNA 2HVRA 1X3ZB 4RM3A 3QFUA 3RQIA 1VQNN 4AVPA 3UKGA 1NGIA 5DEQA 2IRFG 3ZT4A 4NQWB 4LFCK 4DKWA 2FSNA 4NHJA 4Q0BA 4M3EA 9ANTA 4OPAA 1XC9A 3M1CA 3LSPA 4CZMA 2VCPA 2LC2A 3THVA 2V6EA 1NKCA 1T33A 3BCAA 2EHGA 4M3YA 1HYVA 1DP7P 2NUBA 1UAXA 1ZK8A 3HG9A 4WQ4C 4MFDA 1QPIA 2VXDA 4HYEA 2OPTA 2H8RA 1KTQA 1L3SA 2JWLA 3I3LA 3CPEA 2UYTA 2LSOA 5C4JJ 1N77A 2YKMA 4BC2A 4HTUA 3TP0A 4H4OA 4PJLA 4AM3A 2MC3A 1RTIA 4TSXA 2UUCK 1CXUA 3P5JA 3V8KA 4UUSB 4CIFA 3I5UA 4CK1A 3ZQLA 1D5VA 2ME6A 2E2NA 3HI0A 2NNWA 1T6SA 1D8JA 4CHQA 4G7OF 2VQHA 1GV2A 2DT5A 3CDLA 1QVGM 1RT5A 3H3OB 1B72A 2NVQJ 3AAPA 3CUQB 3RPUA 1Z3XA 3W2VA 4Y33A 2IT0A 2A40A 3DPUA 2R5ZB 1S1TA 2YJEA 4CW7B 3HBTA 1X9JA 4JKAA 2W85A 1YFHA 1IF1A 1VQ8N 1GLBG 3E1SA 2O8CA 3V9UA 4MDBA 4Y52J 2XO7A 2QWMA 2W57A 2K4JA 2HDCA 5FLXZ 2CW7A 2OYQA 1S3JA 5AJ3K 1HNVA 2GEMA 3O3HA 4RG8A 1IRZA 1RI7A 2DJNA 4B47A 3GUDA 3P9IA 3HRTA 1IKVA 1UA0A 2Y9ZA 1JHHA 4XH5A 1WGXA 3KLNA 3D5RC 4E7HA 1MGTA 1BIAA 3RKYA 3QAHA 2FF3B 4EM1A 1B6AA 4ANJA 2FX0A 3WNHA 5MLCQ 3S3NA 3BJAA 5F0HA 2HEOA 4GRIA 3RR8A 3WTSC 1USSA 5LLQA 2E1MB 3MCAB 3S17J 1SAZA 3T7ZA 4JK1X 2QQ9A 3K0LA 3M8SA 3L2WA 3KK1A 3ABLH 1ZGJA 4CK3A 2IXSA 4B3SK 3T5XA 3OMYA 4BRAA 2GXAA 1NGJA 4CE9A 1IBKK 4CF9A 1Q9YA 2QBYA 5CQGA 3QICA 3G4SN 1CZBA 3M3ZA 2DBBA 1E17A 3ULDA 3K10A 3AGKA 4DV3K 4PWDA 4DV2K 2CQKA 1QQMA 3OYJA 4DU1A 1VQON 3DTIA 4BREA 2HS5A 4DFPA 3THYA 2IA0A 1C1CA 2DPUA 4CZEA 3NARA 1JTXA 5CZ1A 3LSKA 3HSFA 1CXQA 3IKMA 1MW7A 3B8AX 3WU1B 2K7LA 1K78B 3RKWA 3MVPA 2W48A 2DYSH 4CZLA 1YAGA 4G12A 1S29A 1XSDA 3VOVA 4BEHA 5CKTA 1NH3A 4YY3K 5BPMA 2L01A 4OLAA 4N56A 4AIDA 1BOTO 1EH7A 2PMUA 5AZJB 5M1FA 3OR2C 4DQQA 4X1EA 5C2DA 3P38A 1W5SA 4KIGA 3BR6A 1A04A 5GAEP 4AILC 3VYTB 4CUGA 4KHQA 2ITGA 2Q97A 3KP6A 1ZN2A 4HQEA 1RDBA 1ONVA 3TARA 4IHWA 5FPDA 4LC9B 1WH5A 3DLBA 2YS9A 1KU9A 3QB0A 4C8OA 1ETOA 1TWCJ 4BL0B 1D0ZA 3CMYA 2XF7A 4W1UA 4OWRB 3VB2A 3QNOA 1ZQ3P 1A5JA 2P9IB 3ECHA 4ZDLA 3T3FA 1TTYA 1JE8A 4XN0A 2JLEA 5FDLA 3SQ0A 1TV6A 1Z6RA 2BV6A 3DPLC 4C1NI 5M1OA 4ZTJA 3ITHA 4EM0B 4BH9A 2EA2A 4A6DA 5IT3A 1U9NA 2RHKA 3TGNA 2FBYA 5JR3A 4DV6K 3V6DA 4IHSA 4B8CA 4YOYA 2OANA 4MEXF 1C6VA 2A61A 3ZSVA 3O4QA 3H1VX 1P4XA 3JRCA 1RUOA 3RMDA 4WCGA 2WFBA 4E6KG 1G3SA 2OJED 2Q1ZB 4S0HB 2W25A 2ID6A 3GZNB 2JPBA 2V7ZA 2E5LK 3UKUA 3AVMA 3OS1A 1VQMN 3ERMA 3MD2A 2HNHA 1ETVA 3I59B 5LFAA 2VPRA 1FK9A 1LQ1A 3SUQA 3V9XA 3PUBA 3EO3A 3M3YJ 3KLIA 2ZBKA 2QZ8A 3COAC 4C2TA 5IP9J 5IOZA 4CJLA 1Y39A 1EF4A 4BC3A 1LCUA 4BWMA 2AA4A 3HZJA 1ON2A 3I0RA 3C7JA 4C8LA 3LAPA 4RW9A 4H5NA 4Q5SF 5CZ2A 2Z1HA 3Q9VA 3GVAA 1LNWA 3DLKA 3AY9A 4BRPA 2E8AA 2A07F 4Z4HA 2VLAA 3KKSA 4DSJA 4M45A 3CC7I 2VG7A 4Z2YA 1Z7UA 4N41A 3SBTA 3Q7BA 1QNTA 1D9FA 2BBYA 4KFCA 3GLLA 4XR6A 3RZOJ 3E6CC 1T8EA 2WAEA 1G4DA 3AG4H 3FX3A 3WTVC 3S14J 4A5BA 4DR5K 5H6QA 2A6EF 2LVSA 1O7FA 2NRAC 4DR4K 2WBMA 1D1AA 3CCSN 4C3HJ 4ISFA 5FLVA 4PGHA 1XGNA 2KL4A 1HKQA 2JSCA 3HSEA 4HZFA 2ZGYA 4A5NA 5LJVA 2PFBA 1LEBA 2FLOA 4E7ZA 2OC6A 1GLCG 3Q0UA 1TNSA 3K70D 1EX4A 5D4RA 3I33A 3VODA 4KBOA 3KEYA 5GADJ 1R1UA 3QBXA 2A42A 1N33K 5IYDJ 2J4RA 4DS5A 2LY2A 3T1HK 2R7FA 1GLJO 3WUHA 1FOWA 5FKKA 1BQMA 3SAHA 1IN4A 3CO7C 1U8RA 3KEOA 2MSYA 3MDQA 2F5VA 1W7PB 2WADA 1TK8A 4DTXA 2O8DA 2OBPA 1P7IA 1R9TJ 4YDUC 3KJVA 4YELA 5AQJA 3HOUJ 3TWHA 3FFKB 3R4KA 3T69A 1OH6A 2HSTA 1K8AO 3TAEA 3LSJA 2G7UA 1JKPC 5SWMA 3G71N 2LD5A 3ULEB 2H1LA 2BGCA 2RQQA 3QOEA 4A93J 4CBUA 1ITYA 1QO0D 2L9VA 3T1AA 3K4NA 2ASPA 4W97A 1WNSA 1SL0A 1FLIA 2XIGA 4KB0A 3HP6A 4A3KJ 5AQIA 5J8CA 2LLKA 2DMTA 3FXJA 2BEOA 3DOKA 2NZTA 4IWVA 1YTAA 4KJZA 2E60A 3BZKA 4BE0A 4HUFA 2QKKA 2GELA 2D0CA 4IQ4A 4JV5K 4B08A 2VT3A 2D0OA 3RMCA 4A3BJ 3GTPJ 2P5GA 3CXCM 3DTEA 1LE8A 1P6RA 4FSVA 3WQTA 4KH6A 3V8LA 4MIMA 4QS7A 2VGMA 5AQSA 1IG7A 2O8KA 1HC8A 3TTFA 2ZO4A 1N34K 2BHYA 5FKOA 3OYLA 3KP2A 3WEEB 4OPJA 4NB5A 3A1YA 4BDPA 4OKKA 3H35A 1YLFA 1RDWX 5E1WA 3AVAA 4PL8A 4QSHA 3RZDJ 3F0CA 2VL8A 1WQ2A 3SQNA 3OYEA 3I56I 1YJWI 2ZJPL 1RNHA 4DNCA 4KTWA 4XMYA 2EA4A 2M87A 1WI9A 3HOSA 1T2KA 3QIPA 4L5IA 1N78A 3HVTA 2P4WA 3M8JA 2XRIA 1I1GA 2QSGX 1H1VA 1UJ8A 5J1UA 3GTGJ 2QVOA 4N4OB 3UB5A 2MABA 2NVTJ 2VI6A 3DPTA 3OBYA 2HU9A 1ZH5A 3MN7A 3BDPA 2G8WA 3H1CA 1JXBA 2Z33A 2FSWA 1BA5A 4XLNF 4IO8A 2HGCA 3ABMH 2OTJI 2VQCA 3LWMA 2RV8A 2V9PA 4Q4ZF 3DBHB 3U9ZA 4L9VA 3PY8A 2Q0OA 4E7IA 3H9JA 5AQOA 3UR3C 3IC7A 1RTDA 4KN4X 4FT8A 3HOXJ 4G9YA 1TWFJ 3HK2A 2HWVA 3QEPA 3JREA 4RGSA 2NNYA 1JUSA 2XKPA 1CZAN 3DLRA 1ZBLA 1TKXA 2OQRA 1OPCA 2P9LB 1IZ1A 2WC9A 3HIFA 4JI2K 4YFKF 4UUSA 1H9TA 2HHSA 4DMNA 1PVEA 4I6ZA 3MZYA 3JRGA 2PX9A 1D0YA 1JT6A 3VQEA 4FJGA 2GTDA 3M1EA 3A0BC 1E0EA 3LL3A 2Y0MA 1RT4A 5BR9A 4EIAA 5BMZA 4JD2B 4G94A 4W5NA 4M3ZA 1S9GA 5J1RA 3CUQA 4FJ5A 2PQ8A 4DFJA 3DCFA 2R5ZA 2YNFA 1IH7A 3V4GA 1BR2A 5AQMA 3AVBA 3DLLL 1HDPA 3LPUA 1QGPA 5EG0B 3CYMA 1MJ9A 3G3ZA 1T3VA 3CC7N 4IOXA 2F9WA 3R60A 2COBA 1RKWA 2X9DA 2WAQA 1EH6A 3OIQA 3CCMN 4KTZA 2EWSA 4B3AA 1FT9A 3OIOA 5D5UB 1TAUA 2P9UB 3L2UA 4KMFA 3C6TA 3BDDA 2FBKA 4IPAA 2JGUA 4FHTA 1R1TA 1YI2N 3SYZA 2EV0A 5HRSA 4C3JJ 3HUGB 4PJ0C 4IOCL 3G10A 4UB8C 2YU3A 3LDPA 1VI0A 4PSWA 5GAGP 3CCJI 1T6DA 2E1CA 2DN0A 2HHQA 2EZHA 3ISPA 2HQNA 4BR5A 3QYEA 1MH3A 4AH9A 5HLTA 2P9KB 2L9RA 1RT2A 1QHHD 3K4MA 2HBLA 2ECCA 3NBPA 1R1VA 1Z3YA 4NCGA 1ESVA 1V4TA 1RBUA 3HEFA 4CJQA 3FBIB 3AG2H 5E8IA 3IKTA 1LV5A 3BR3A 4F52A 3WGIA 1DKGD 1SC7A 5K7HA 1NJXA 3J7YJ 3ZMDA 4H0TB 2ESHA 4CCJA 3FXRA 1K6OA 4JI0K 3IAM2 3DAWA 3CCVI 4NNJA 2JMWA 2UXNA 1T38A 1YJ9N 4QTRA 2YHWA 4ISGA 3VEWA 3CJNA 5BNGA 1RT1A 3CP8A 4LIVA 4I2OA 5BS6A 4OX9K 1FJGK 2OV7A 4AUXA 4HUEA 2VUMJ 1YIJI 1NGAA 2JUGA 4CEBA 3T19A 4JP0A 1SAUA 3QMLA 1K78A 4N5SA 3CC2N 4M3RA 4DF4A 5ICFA 4RLQA 4Z0UA 4RTFD 4OPHA 4FWOA 1OKRA 1YJNI 1X1AA 2BY0A 1VK0A 4XRMA 3G2BA 3A03A 3EN9A 2FNAA 4KH4A 1ZXOA 1BR1A 3LA2A 3WU2C 5BN9A 4ENNA 4CEAA 1MBEA 1X19A 3DYAA 1TAQA 1R5HA 1ZR2A 5AZJA 3DRPA 2Z3YA 1NNEA 1Y56A 3OTOK 1L3TA 3S1RJ 5E79C 2FU4A 3VA3A 4NUBA 3VYRB 4B9QA 4B3XA 4P9FA 1GXQA 3SFZA 3IRRA 2VXZA 1MWMA 2WUSA 2V7YA 1TGOA 2XF5A 2QW9A 3TANA 1NG9A 2A6TA 1F5TA 2PLYA 3LAJA 1NGEA 2P9IA 2LMDA 1FY7A 3AVCA 1WBDA 4YG2F 3GDQA 4LSNA 1S7OA 4JX6A 1RR7A 2HZDA 2RGVA 3KP5A 4A6EA 4AHVA 3CO6C 4H03B 1T03A 4DYRA 1ZGAA 2KIMA 2RREA 1Z25A 2EZLA 4KISA 3WXKA 3P9KA 3BG5A 3KP7A 3NVMA 5E3NA 1KA8A 3RYPA 4ICLA 1UOCA 4IRGA 4EFHA 5EYRA 2ZJPF 2DMUA 4DTRA 4XBFA 1XMXA 1Z1DA 2L5QA 2RPIA 1OMIA 5LGUA 4IHXA 3ABKH 4NCBA 1YVNA 4BRHA 5AQUA 2EZKA 5J1EA 2DY4A 4YOVA 1U4BA 1FSHA 1YS7A 3GMEA 3IHUA 1DU0A 2OTJN 4KA4A 5LY3A 3LP3A 5KCMA 3KLEA 3BG3A 3QIOA 3S93A 3I59A 5E3MA 3R6MA 5BPNA 5DS9A 3AO2A 2HHWA 1ZRCA 1LW0A 3OS2A 2XGDA 1Z05A 2MYSA 1Q8IA 2GXBA 3PSIA 3O4NA 1Q86O 4O5FA 1QVFM 1HOMA 3HOTA 1ZARA 2V7FA 3ZR8X 4H4MA 2F8TA 1ASUA 3K59A 3GO5A 3AA5X 4B4CA 2J5PA 5B1AH 2STWA 3TKYA 1EJ9A 1NK9A 3BWGA 4FETA 1XMOK 1XMQK 5H20A 4FE4A 4H0PA 4B8XA 4F3TA 3AVGA 1DGKN 3SMSA 2ZM6K 2PY5A 2M8EA 5LBQA 2YV0X 1W0TA 1G99A 1AU7A 3D5LA 2FQ3A 2D5VA 5IT9Z 4IOAL 4BRMA 1XC3A 3L6QA 4QLCU 1I39A 1W2BM 2XAHA 3JTHA 2Q8KA 4G9ZA 2G8UA 4F8RA 3DOLA 3NCIA 4BRDA 4D7NA 4HCBA 4BDZA 3DLLF 2WOMA 5FPNA 4KYWA 1S72N 1WJCA 3W6JB 4A2BA 4AQYK 5E41A 1EWQA 3F6VA 1Y0NA 3AA2A 4NYFA 2NVUB 3VETA 2HNDA 4PHTX 3SV3A 4JI8K 4CHOA 4K42A 2CGPA 1OCZH 1QQCA 1DU6A 4HWIA 1W5TA 2V1DA 2NRWA 2HHXA 5D3GA 3HSCA 2HQRA 4IOCF 2QUFA 2YX6A 2D2WA 4KIFA 4DIQA 1W7PA 3P83D 1WSIA 1IDYA 1HCRA 1J5EK 2P9NB 3LMMA 1ZBHA 3L8BA 4BR7A 3PM1A 1C1BA 3WXLA 2CQXA 4CERA 2R7WA 2Y9YA 2O8BB 2WC2A 3ULEA 2D45A 4CCKA 2KFDA 1WCMJ 2B4JA 3B02A 1GLLO 3EPZA 3GTQJ 3KLOA 4XSZF 2CQNA 3LFKA 5F0CA 5JLFA 1ZG1A 3OW2M 1O1WA 3ZT3A 2HXOA 2YJFA 2LR8A 5H1SQ 2XY6A 3HHHA 1YHQI 2PYJA 2B6AA 3DXMB 3M5RA 1X2MA 3CG7A 5BR8K 1MKMA 5AQLA 3K5MA 4Z4CA 2DW4A 1E3HA 2XRNA 4GXOA 3NAUA 3VF4A 1IKYA 2R7RA 1V4SA 1BC7C 3CDHA 4EEFG 2RNJA 1UAAA 4FWPA 2FF6A 4OIPF 2W82A 4DBQA 5CYQA 2KPMA 2Q0RA 3LM2A 2VODA 2H27A 3TU5A 4O3MA 1R36A 1PUEE 3MZ8A 3WTTC 2G8FA 3VEOA 4O8UA 3WEEA 4R8HA 4Q5VA 3LQQA 3VGLA 2G8HA 4C30A 4KI6A 4BVPA 4FJLA 6PAXA 3MMVA 2B0LA 2FOKA 2IVMA 3L3UA 1ETWA 2DU9A 2ZXIA 5JHUA 3SZPA 1G8XA 2NNNA 2JJ7A 4DV1K 2F5EA 5J4YA 2V26A 3ATUA 3GTJJ 3AVIA 2LG4A 1ETKA 4BC5A 1R5ID 1LW2A 4RGUA 1HF0A 3MN2A 3W3DA 5TKWA 3UNGC 3FXLA 3GTLJ 4DFKA 3T8TA 4ENMA 4A62A 2KKOA 2VC0A 1WSFA 3JRAA 1SL2A 3PSFA 2E36A 1OISA 2QXLA 4OU0A 4L8RB 3V1RA 2OTLI 2ZXWH 1VQKN 3R3LA 4AHRA 3BF1A 3S41A 1WJAA 1X1DA 2AS5F 1WH7A 3CFRA 2XKOA 3F8MA 2X4HA 2XY5A 4KT6A 1P4WA 1V5FA 4B1YB 3CCUN 2LOOA 1YRNB 2KW4A 3S8PA 5HLHA 2BZTA 3ZLJA 3IV5A 5GPAA 4XICA 3J7ZI 3DM2A 1UCRA 5F0XA 5DTDA 3EL2A 2QYOA 1HSTA 3FZVA 1E3OC 3OYCA 1Z21A 2X6WA 1XS9A 4IF4A 5CJ9A 1DT9A 3C18A 1JKQC 3IUCA 3PFIA 1J2XA 1KFSA 3NFAA 3LL7A 2P9LA 3KHYA 2ZB9A 3SDGA 3IRXA 4LGWA 4A59A 1VSLA 4K25A 2W7NA 4FWSA 1ZYRF 2VE8A 3DEUA 2QWLA 1JLEA 1DPUA 3HVRA 4KFBA 1HX1A 4BE2A 4FWRA 2BGGA 2KFNA 4FTHA 2DDAA 1G3YA 1S9HA 4JD2A 3ERED 2IEKA 2A69F 3KKRA 3ZQQA 4S04A 4DSFA 2Q1NA 4EJWA 2F4VK 4LJZF 3CD6I 3WG9A 3HBLA 5FKLA 4QS8A 1HLVA 4I02A 1XDUA 2QLZA 5EG0A 2D0BA 3C6UA 1FBSA 2UUBK 2UXXA 5K5OA 1RFQA 5IP7J 3WGGA 2FMYA 2HI3A 3G1MA 4L9NA 3MKZA 3AO5A 1OCPA 3K4LA 2YNGA 3KZYA 3TO9A 2L7FP 2P9UA 3O3GA 2L0KA 2X0LA 4HBLA 5GADP 1OLTA 1R58A 5HBMA 4ZYGA 1NGBA 1RRJA 1RTHA 2ZWHA 2IS6A 4ELUA 2LYCA 3ROUA 3HUGA 3WGHA 5JLWA 4YFUA 4GDFA 4IOAF 3LOCA 4FM1A 3FXQA 1YX5A 2IVPA 4EAHD 4ITVA 1BJAA 5F1XA 5KQDA 1SKWA 2P9KA 3QODA 2LY1A 3HM9A 3VPRA 3VDXA 2GUIA 1JCGA 4RLFA 3TSQA 3IH2A 2MGQA 5B8HA 1U5TC 3BT9A 4ENJA 1Y6IA 1UMQA 2VOPA 3FXUA 2OZMA 2HHUA 3ZPLA 1H0MA 2VG6A 1WOQA 2E2IJ 1A6IA 2K4BA 4JRPA 2NS8A 2F4OB 1NGFA 4PKGA 3GW2A 2XY7A 4J00A 3J81Z 3RSNA 3I0TA 4J8FA 4DSEA 2ZF5O 3GL1A 4CZZA 3EZWA 2VC1A 2LBFB 5HODA 2KZGA 4JKGB 3CMAI 2VQLA 5HOOA 2C6YA 3H5NA 4I7HA 1BA1A 1NK5A 2XAFA 1XUPO 2HYJA 5M5YJ 4LLNA 3RPQA 4JK7A 1HDDC 3SMPA 4B1WB 1GOCA 4WCEL 5CPRB 3JRFA 2FNPA 3LSHA 2IIRA 4GVMA 2DDBA 3CQ8A 4F3OA 4YFNF 4HW0A 2HB5A 1IV6A 1D1CA 4EQQA 3NVKA 3KE2A 4RW7A 1DQUA 2P5VA 1BGXT 1AHDP 1X2NA 2VQGA 3D2EB 2PG4A 1S6LA 4Y3OA 3DFGA 1JLAA 5KPTA 5E84A 3J8AA 3I4NJ 5GTIC 3D7EO 1C0MA 4OKJA 5FPEA 1YO5C 1T05A 1FMWA 4EHUA 1I3AA 2HKXA 4MFBA 1TWGJ 2QQBA 1HQUA 4UVCA 5EDNA 1TT5B 1QHGA 3K1MA 1TNTA 4LF9K 4JK9A 2M5WA 2D1HA 4PGGA 5JVTA 4TV7A 4CEZA 1UWBA 3MZHA 4M71A 1FTTA 2FOWA 4IEEA 3K9TA 3O6BB 2H94A 1S1XA 2EX3A 2A1SA 2FD5A 4F2SA 5J2PA 2QM1A 2M9HA 2M1BA 2RVCA 3BGRA 1T0FC 2QM3A 2DA1A 5FLXO 5AQWA 3F22A 4ESFA 2OAZA 3P1GA 3MXIA 4BQOA 1F9NA 2V9KA 4CGHA 1VQLN 4FLYA 4RAFA 3TAQA 4IHTA 4XLHA 1R0AA 4J01A 2QENA 5KI6A 4OMZA 1J7KA 4CHYA 3DTKA 3LAMA 1TK5A 3KYLA 5FD6A 5BRHA 4XORA 5AIQA 3O2PE 1XC5A 4ZH4F 4BR0A 3CC4N 2FUG2 4FJHA 3VEYA 1IRGA 2VKEA 4QPQA 3QU3A 2F96A 2WA0A 5HLIA 4RW6A 5KTQA 4YIRX 2CFOA 1G59A 3CQXA 3NE6A 3DU5A 5FLXK 5HS9A 4CD1A 2UXDK 3E6DA 5CLSA 1S3XA 2CUFA 3TW6A 4JKHA 1MDMB 2K40A 1J9AA 4M9SA 4F92B 2G0EA 2GWKA 3DI6A 4BRQA 5CVRA 4FZYA 4DQRA 1DP3A 3BR2A 3CCRN 2BOLA 2LTPA 3HPHA 2EK5A 3G1OA 3OYBA 4B1ZA 4A3MJ 4LMYA 4V19K 5F1JA 4I9QA 2O4GA 3AAFA 3U9DA 5C0YA 1VQPI 4RWTA 2FSKA 5L3FA 4DV5K 4LH5A 3CERA 1HKCA 5HRNA 1BL3A 1VRTA 4Q48A 3QLHA 5C4XJ 3LP1A 2OA8A 1REVA 2F48A 4EVIA 4EMSA 5A2QZ 4UXNA 5EGOB 3RCOA 3IAS2 4H4KC 4P1WA 3WTXC 1I94K 4M6YA 1WSGA 1U6ZA 3VQPA 4H5WA 2OUMA 5J3LA 3CJTB 2VE9A 2ESNA 4FK0A 3IRQA 4A0ZA 4J2EA 3VERA 2RC4A 3CD6N 4CJVA 2EFNA 2XAGA 1CLQA 4O55A 1OYIA 3HYIA 1YITN 2VBYA 4IG3A 4LFBK 4FVUA 1ETYA 1YXQA 1N5YA 2VPLA 3OSFA 3QETA 2DPDA 3ABUA 3FK7A 4M72A 3HM8A 2JT1A 4HAMA 1KAXA 2DA5A 2OCCH 4NC7A 3RTRA 1ZRFA 1HJRA 2GX9A 5EEGA 3ENOA 2VONA 3IAYA 2LKSA 1XPXA 3K7AJ 3A02A 5HL7L 4DS4A 3KK3A 3IH4A 1NGDA 2L9NA 4I9LA 3J7YP 1JL2A 1WBBA 2W24A 5F64A 3WXIA 2R7VA 5E8GA 4E7LA 4CFAA 3EUHA 3QPLA 2JPCA 3CESA 1GT0C 1GHCA 1VQNI 2P9NA 1O3TA 4EM2A 1NHAA 2JA8J 1TVRA 3C2HA 1P90A 4CBXA 4C8KA 3K1PA 3GG4A 2OPSA 3H3NO 5M5WJ 3BR0A 2ICWG 2HW3A 4KHSA 2FBXA 2O8BA 1M1EB 4JX5A 1WSJA 1TKTA 2NVYJ 2R7OA 2KDOA 1ZBFA 4JI6K 4DF8A 1IGNA 3CP2A 1S7AA 2XHKA 2CH0A 4FK2A 3HB9A 4ZZLA 4LITA 4CD3A 4IJAA 2PBDA 4DV0K 2EZIA 4IDKA 3S1QJ 4ELTA 1PUFB 4BRIA 3F72A 2PMHA 5FKNA 3L1PA 1NOZA 3D0PA 4FLWA 2LK2A 4CFDA 3HRMA 1AA7A 2CSOA 5LGNA 3O4WA 1I6HJ 4L0YB 1X58A 2HPIA 3GBGA 3C2BA 4DQSA 2KRCA 4G8XA 1LPQA 4GYIA 4CJSA 2K9MA 3THWA 1Y0UA 1C0UA 1R23A 1Q1VA 1D3YA 1RDUA 1OR7A 2ZJRL 3ZMSA 4CHNA 5ED4A 5KPRA 2OPRA 5EJCA 3VEZA 3F23A 2ADUA 2E88A 1K9MO 1VQ8I 3O8MA 1XG1A 3AVLA 2R7SA 3FF5A 1IBLK 4CZFA 2F4MB 2EJRA 2NRZA 2O61A 2P6TA 3PX6A 1P4AA 4R1HA 5FFXA 2KJCA 1WAFA 5K7ZA 1BM9A 1Z77A 2R93J 3DEEA 1VRUA 3R1XA 4BC4A 3L4QA 3ZSQA 4XL9A 4XKCA 4LF4K 1OCOH 5M5XJ 4XEIA 1T6CA 2OZSA 5AZIB 4QAGA 4RB0A 4HSTA 1Q1HA 2DTRA 1QZ6A 2NAZA 4NCAA 3CCQN 3Q3SA 2F4IA 2ISZA 3U4LA 5DM6L 4JKBA 4JI1K 3BZCA 3IMXA 4UHTA 4RDUA 5KAIC 2AXLA 1QSLA 1J09A 3TQNA 4OAYA 3PIPL 4WXCA 4XONA 1RUNA 4BQNA 4FJ7A 3TAGA 4X6AJ 3HTVA 3EUKL 2HKOA 1RC9A 3HGGA 3H08A 2QK9A 3S3MA 2E2PA 2VG5A 4BQQA 2HDWA 5GAHP 2AXTC 1YRNA 2JN6A 3TW7A 3E5QA 1SQKA 3AGRA 3RWUA 2X85A 2GZWA 1E3PA 1PJRA 4XKWA 2ZMEC 2JRTA 2CUZA 4YIIA 2KKZA 4U87A 1KAYA 3JCUC 2O8FB 5GAGJ 1SKRA 3I54A 3JRIA 1E2XA 3SZGA 3R9PA 4FE7A 1NKBA 4WXHA 3CJAA 2XGXA 1VQOI 4XOPA 4EATA 4IFYA 1FKPA 2IGKA 3TABA 5M1QA 2BVLA 1ACIA 4DZPA 1MBGA 1KCFA 3ZQIA 5EX5A 5JHFA 3KZBA 4GV3A 1ZKGA 3AAQA 2X6XA 1TKZA 2YUSA 2VOOA 4XLPF 4IRHA 2FE3A 1K83J 2UWMA 5IP6A 3DQVC 5CYMA 2X51A 4WXDA 4FPBA 4DR7K 2RDPA 2CS3A 1FYLA 3CQZJ 4E1NA 2EPFA 3TSPA 5F27A 3HT3A 1FBQA 4HRIA 3KVGA 4DTPA 1XSXA 3EZ5A 4YORA 2UXCK 2MLGA 2DJIA 2PFUA 3MCZA 4WF2A 2I5JA 1ZR4A 1TUYA 1SS6A 2K85A 1BHLA 4CESA 1KQSM 2WTEA 2FF4A 1F4KA 4FJIA 2VYPA 3OS0A 3ZT0A 1HPZA 1I6XA 2D1KA 1QQNA 1NK2P 3DRRA 1OYYA 1C0FA 2D5RA 4BQAA 2R0QC 2LF7A 4OIRF 1Z67A 5GINA 1GXPA 3OOPA 3MWPA 3FM3A 2Y1IA 1U2WA 3MX5A 3ZEUB 1Y1VJ 3AO4A 2XB5A 3NWTA 4F2RA 1QA6A 3QERA 1ZTRA 3VQQA 3HJEA 3VQDA 1NTCA 1YQAA 2A6AA 3OYDA 5F6FA 1IN8A 3TEDA 4Y0WA 1WFXA 3L4IA 4ZYAA 2F9TA 4KTQA 5KAFC 4JRQA 4BRNA 2O8XA 4CCMA 4QIWN 1JT0A 2FBIA 2LBFA 2F6CA 4IRIA 4JKGA 3NGZA 3K69A 4I76A 4LF7K 5BRDA 1SEUA 4IXAA 3SPZA 1VQMI 1ZBUA 4FX4A 3KWIA 4BXFA 4AWXB 4D7MA 1RDAA 2TDXA 3SV4A 3X2QH 2MD5A 2HOAA 4ID5A 3W6VA 1MU2A 2HTSA 1M90O 3RKXA 3E0JB 4O4GA 2EBIA 2GWRA 2XPWA 4M3WA 1N32K 3KLHA 3TL4X 3D2EA 3M1FA 1ZYQA 3QWLA 1TUUA 3L2RA 1IC8A 3R6SA 3CLQA 1OH7A 4BHBA 5C42A 3MAJA 3PO4A 3OHRA 5KPZA 1X4PA 2ASOA 3Q0WA 3S2WA 2CGKA 3QEXA 3VSKA 3BLYA 3OSGA 1GLFO 1I5ZA 5HROA 3OVNA 2GLOA 4HNTA 1LDDA 1UG2A 4EJUA 2QKBA 4FASD 1RT6A 5JLHA 1N6QA 1HNWK 5C24A 4KB1A 3I58A 3G1LA 4RB3C 2VN2A 4KHWA 2P5KA 3BY5A 3NWSA 1QU3A 4FLVA 2P5OA 3CF5L 1WUAA 3EYIA 4OPKA 5L3GA 2Y75A 1SAXA 3AO3A 3T8RA 5DK5A 4NBQA 3S9HA 1JCFA 3MN9A 1SUQA 4CF8A 2QKMB 2ZJRF 3KD5E 3E5UA 3QP5A 1V54H 4CF0A 3MWTA 4HG2A 3CCSI 3HSRA 1IAWA 3GF2A 3ESWB 3LZIA 1KSPA 2MH9A 3OL3A 3ENHA 3QBWA 2DO7A 1ZREA 1ODDA 3NEUA 2E2QA 3CLOA 1S22A 4M7XA 4U0YA 4DYQA 3SUPA 1IN7A 5CQEA 4H8KA 3E6MA 2A5WA 2E1OA 2BY3A 2GBZA 3WTZA 1VQ5N 1QZZA 1QQIA 1YVUA 2RN2A 4E7SA 4WWCA 1NG7A 2OQGA 4D1QA 2L2OA 2X6NA 1JJ2M 4CF1A 2CMPA 4CGIA 1BDGA 4F9OA 3A5OC 2R7XA 1HXDA 2DA6A 4LFUA 3M6GA 4F4KA 5DM6F 2QQ8A 2NRXA 4CJ7A 1TL1A 3V7SA 3NGIA 3SCXA 1MBFA 1MDMA 1XB4A 2X6YA 3ZSZA 3PIPF 1X1CA 4FK4A 2XSJC 5ELZA 3G71I 4L5EA 3OA9A 1IV8A 5FROA 4IKFA 5AR0A 3HKZA 3CJ1A 3IFRA 1Q18A 1BN5A 1HW2A 3BC8A 4XLFA 4PQUA 1L3LA 1F1ZA 1A31A 1U9OA 2ZXJA 1HKSA 1LB2A 4O0JA 4OGCA 4JOMA 3QESA 3DXJF 3ZQGA 2QCOA 3ID8A 1FYKA 4JQFA 4E89A 4EZ9A 2K3PA 4RB1A 4B3RK 4DTNA 5EGOA 1FSEA 3GX4X 3ENBA 5B3SH 4BGBA 3AA3A 3GXOA 2P6SA 5ILUA 5E20A 2F5DA 1JLBA 2XRLA 1A35A 3SXYA 1V5GA 2YHXA 1U3EM 3HC7A 2VBXA 4IVNA 3LANA 4KIBA 3GE1A 2AO9A 3ONQA 4ZC3A 2DMPA 3WE3A 3RQ4A 4QS9A 3RYRA 4BS9A 3FZLA 4H5TA 2LSNA 5ERIA 2XC7A 2XAQA 4Z4GA 4XH1A 4FJ8A 4LY7A 4JKDA 1R22A 1CZ9A 2UV1A 3RRGA 4JI4K 3VQ4A 4LIUA 1SFKA 4HLYA 1WN7A 4WQ4A 3V1QA 3CETA 1MNMC 4WX9A 4Z6YA 1R7JA 4KMUX 1VSHA 3B6CA 2A05A 3FHNA 2YNHA 3LDNA 4BR4A 4HUGA 3CM6A 4DQ2A 1RCHA 2R7QA 1H9GA 1OR7C 3KZIC 5ADXH 4FOEA 4I01A 4CJUA 4UNOA 1HRHA 1X1BA 5FO5A 1YW7A 3G6EN 1B9MA 4G7HF 3K4BA 3LALA 2E4LA 4ABZA 3CJ7A 1BJZA 2BXYA 2HR3A 3DRSA 4R79A 5KGXA 4II2A 2JVGA 3JAMZ 5K1YA 4BY1J 3CMEN 3UIQA 1HSJA 2X48A 2CG4A 5DCMB 2XF6A 2V51B 3H3ZA 5FFZA 4A69C 3ZN0A 5D5XB 4KHNA 2O0YA 4FLUA 5FPMA 1G15A 2Q0UA 1PUFA 2L7KA 3N97A 2IVOA 1XGSA 2JWTA 4GMJB 4MO7A 4W5QA 3RJPA 4M7YA 2QWNA 3PL8A 1JHFA 1DGWY 4LD5A 2QSHX 4M3DA 5EEHA 3ZN1A 1EO1A 5D5VB 1ATNA 1S5LC 4DU4A 2EFWA 3K9KA 2ZFWA 2KFZA 3SPYA 4EGYA 4PFOA 2DK8A 2P1JA 4FZXC 1HKGA 3VESA 2RQPA 3WTUC 2W6LA 2HVIA 3HHGA 3M8QA 3VTIA 3OY9A 3CTAA 1JTYA 2H1KA 1S5JA 3JRHA 3O1BA 1IUFA 3WNEA 3C3WA 1VQ6N 2LKPA 4BVOA 4CJTA 1NKEA 3BF3A 2M7BA 1MMNA 3LDQA 1NK8A 3RMAA 2K86A 3AVJA 1ZLJA 2MA3A 1WSUA 5IT9O 3E66A 1C0TA 3CCMI 1OJLA 1HPMA 3ZT2A 4OVLA 2Q2EB 2HNYA 4II3A 2H09A 4BY9C 2NXNB 3TP3A 4FJNA 5AQHA 4K0KK 4JN4A 3IS9A 2V6CA 1YI2I 1ZRDA 5AZIA 1QHAA 2BY2A 3O9UA 3CF5F 2HYFA 4WQ5C 3DKWA 1KU7A 3BTJA 4A57A 1IW7F 3ZT1A 4EZ6A 1EETA 1RT3A 1XCBA 4A3LJ 2X1DA 2Z99A 1NK0A 1A36A 4IG0A 2QWRA 3S3OA 4BE1A 1ENHA 4HOBA 3WODF 3ZGKA 3FDYA 1O3RA 5IT9K 1K4SA 3ZSYA 2RAEA 5HDGA 1FEXA 1PP7U 3L2CA 5E1XA 5LHHA 5ILVA 3WU0A 4DLEA 2VIXA 1U6GA 4KAZA 1GLDG 3FMRA 3V42A 4E19A 2WV0A 2O8FA 4EJVA 3AV9A 4JI3K 3O6WA 3VF6A 2NRHA 2XV4S 4UVAA 3M7GA 1KXPA 1YJ9I 5LMNK 4WFBL 3EE9A 3H1QA 2CU7A 1IUYA 3SHFA 3WE2A 3ZMZA 3OYKA 4WFAL 1IDZA 3FKIJ 3P39A 2VWKA 3QEWA 4DSLA 3O9QA 1VQ7N 2A5XA 3A01A 4CICA 3H45C 4PK4A 4CZCA 3CC2I 2F5FA 3C6AA 3M4OJ 2CH6A 1VSKA 4Z4IA 1FOYA 2XUBA 1LKXA 2E1ZA 5AQTA 3HXMA 3I8BA 4A3CJ 2JUCA 2DCEA 3RPUD 4XN3A 4XIDA 5AQKA 1JXEA 3JR9A 1FTZA 3W0LA 1BW6A 4P9UA 2UUZA 2XAJA 3WHBA 3M07A 3SZ2A 1HMVA 1D9DA 2YNIA 1SMYF 4BUPA 4U67L 1U48A 2ZD1A 3MECA 1IBMK 3Q9SA 1BI4B 2L54A 2R7DA 3QFPA 2IGMA 3CCEN 3QPSA 3S2DJ 2ZKZA 1J9IA 2KIUA 4JX4A 1WJEA 2COMA 4BRLA 3V7RA 1FBUA 2G9WA 3VMFB 2VWBA 1J75A 4IFEA 1LWEA 4DZJA 4JYAK 5AONA 2BANA 3PIOL 2GQQA 1ETXA 4M42A 1D4XA 4EP5A 1F43A 5CR4A 2CQQA 3UKRB 4GGGA 3QP6A 4PY5A 4FJXA 3J80Z 3GFLA 3ASOH 4BXXJ 4ENKA 3GTMJ 4M9XA 3I71A 4I0BA 1N36K 5AFUH 2G7HA 3ZEUA 1RGIA 3MAQA 2MFZA 1ILYA 1ASWA 2V52B 1RPWA 3NF6A 3HP9A 2RKIA 3ZP5A 3TO6A 1FP2A 1JLFA 3VQ5A 4M41A 1H8AC 3L2VA 1NJIO 4FM0A 3BROA 1S1WA 2IAJA 2HOTA 4FISA 4KNYA 3BR5A 1EP4A 1IG8A 3HSTB 2ECBA 1IJJA 3KYCB 4CGZA 5LRSA 2D1VA 4FJMA 1TWAJ 1NLVA 1KFDA 2LKXA 4UUVA 2EV5A 2QQAA 4OIQF 1B92A 4MTEA 1Z0XA 2VKHA 2B63J 4RAGA 4U0VA 2VBZA 3OYIA 1TC3C 1V55H 3K2ZA 5J47A 4UY8O 1SD5A 1YT3A 2HYGD 3ZMTA 4RGRA 4E7KA 2DA2A 1SFUA 2A3ZA 3VQAA 3EETA 4XLEA 3H5AA 3CCYA 3PO5A 1UHWA 3E7LA 1DPRA 2TCTA 1VHXA 2X1CA 4MGRA 3I55N 5C44J 5AQPA 2CV2A 4HVJA 3CQYA 2ZSIB 3JXUA 5KK1A 3CCLN 2I8DA 4IX7A 3HOVJ 3A5LC 2HBKA 3PFYA 3E3VA 3M8PA 1GLEG 3K6GA 4H0EA 2FQ4A 3SI6A 1IXRC 4HCCA 3VA0A 2K27A 1B9NA 2JZYA 4CH7A 4BG8A 3M9AA 1R49A 2HF4A 4EJTA 4FWQA 4WF9L 3U9GA 3O5BA 5IPAA 2XVCA 1V3FA 1KLMA 4ESBA 3JTGA 2NRTA 2W42A 4UUTA 5HNFA 3F3XA 2FXAA 1F36A 1UA1A 3QPHA 1A6QA 1YS6A 3JSMA 4B1UB 1BUPA 1ITGA 1S72I 3DWLE 5LL6Z 2MG4A 1JXSA 5E18F 4ZDOA 2P8TA 4YDUA 3TOBA 5AQVA 3NRVA 2M4KA 4XLCA 2Y1JA 2QA4N 2Z1IA 3O3FA 2P7VB 4ZDPA 3BR1A 3P4IA 4CO8A 1BCMA 3PNYA 3CDIA 1MJAA 1PP8F 1XD7A 1G3WA 2KZVA 1UELB 4G1QA 2ASMA 1T98A 1BI2A 4L5JA 4N4NB 3RTVA 3OJSA 4XQFA 1VQ4N 5D6FA 3LWLA 3NQOA 1FKOA 3FR0A 4EGZA 3J81O 2HBMA 2QWQA 3PNVA 3DLEA 3BY6A 4A12A 3PQJA 3E9OA 3T1BA 2D4WA 2E5ZA 3MN6A 3S16J 4DTMA 3VGMA 1UHSA 3DLAA 1BI1A 3A5MC 4FWMA 3B6PA 1JGGA 1FYMA 2X6SA 2E2OA 1TW3A 2JTVA 5TJJA 1VSDA 1ERDA 3ZX2A 4IL6C 4CXFA 4BQZA 5F2RA 1ZG5A 1A5WA 4B44A 4M6VA 4DB3A 1HKTA 5HP1A 3NDKA 2JQ7A 3KK2A 1U0JA 5J8FA 1QHTA 4D5FA 1K8KB 5CYVA 3B73A 1FMVA 1NJWA 3OYHA 1BQNA 2BE5F 2A1RA 2ZJQF 1J5OA 2MLKA 1KVBA 4NDLA 2MW8A 2CUEA 2ZE2A 4A0YA 4D9JA 2IP2A 1WJ5A 1IN5A 4CGJA 5L3EA 4UQGA 3J81K 4V19S 3VEPA 3DLGA 3GOIA 3D2FB 1VNDA 2B5JA 1QQOA 4H5VA 1KVAA 2EV6A 1W36C 1XMAA 4XKBA 2O3FA 2QWWA 1U49A 2ZXHA 2ELHA 3FIWA 4X66K 2JWKA 2WONA 4B9LA 3MCPA 2HZTA 3O80A 3VF2A 3F9KA 2BE2A 1XSVA 4A2AA 4QPOA 2QTDA 1EA3A 5ILSA 2TRTA 1X9SA 1Q81O 4B9TA 4CJPA 1KAZA 4E1JA 2IS4A 4JI5K 4OGEA 4DQ8A 3MXMA 2BW3B 2M4GA 2KLAA 2M34A 2ZNZA 2M0CA 4DQPA 4DFMA 4X65K 2R7ZJ 4L3QA 3HPOA 1OCRH 4DR6K 4O8KA 3BG9A 1NGGA 3K2AA 4N76A 4IEJA 2L3DA 3OR1C 4FX0A 1TYQB 2W41A 2KHMA 2JVHA 4B09A 3PIOF 1NK7A 3CUOA 3EKSA 4CCHA 4KHYA 1KVCA 1R71A 2QKLB 4HV6A 5I9EB 2JA2A 4FLTA 1VQKI 2V1XA 3FK6A 4P5OA 5C2FA 3DV8A 4LF6K 3O3KA 1OVQA 2ETHA 4EV0A 1BBYA 3WXMB 2M2EA 2HHTA 4UVBA 5H6RA 4O5VA 2L4MA 5LEKA 2IA2A 4G6TB 3CCUI 2KRFA 4LB5A 5DCMA 3Q7CA 5FD5A 5BOXA 1XGOA 3VEVA 2ZC2A 3MFKA 4BRCA 4BJ5C 4NYNA 4QOZB 3SUNA 3BP8A 3V8JA 2EIMH 2NOJB 1L5UA 3BEXA 4GFBA 1WI3A 3BOQA 4ZYEA 1S8NA 4S05A 2VWJA 4NXMK 1KQ8A 2IDOA 3R8EA 2VJIA 2HPMA 1W1WE 1TZLA 2O8EB 4K8XA 3IUOA 3O1WA 4B3TK 4I6MB 5GAHJ 1T8IA 4UV8A 4AM7A 4QWQA 3R61A 1RBVA 3VPZA 3AARA 4W5TA 4JI7K 5HNHA 5A2QO 4IJNA 4B1VA 4YEJA 3U6FA 4KREA 3NH0A 2QEXN 1SZ2A 3B6AA 4DSIA 2PBIA 4Y1DA 4CZJA 5F04A 1IKXA 1XHZA 2WY8Q 5D6EA 4B3OA 1NJZA 2Q2EA 1QE1A 2CH5A 5D4SA 4DR3K 4G6QA 4PFPA 5JFRA 4M3UA 5IWAK 2VASA 4RW4A 2KISA 1HLUA 1SV5A 2K9SA 1EXQA 1U5TB 3AL0B 3OIPA 3ZOBA 2FEZA 3L2QA 2RKHA 1NU0A 5DM7L 1HA8A 4C2UA 3CF2A 3THXB 5A2QK 3EDPA 3N05A 4O6JA 1V4RA 2B7EA 3U3YA 1UZCA 3TAPA 1VFCA 1SD6A 2E71A 4J2AA 3BJ6A 3TPQA 5HDNA 2GV9A 1F21A 5K14A 4LB6B 1TL8A 2MBFA 4W5OA 1LAVA 2QGUA 3Q5FA 3TBIA 1TT0A
chains in the Genus database with same CATH topology
3SZGA 1D0YA 2WB1A 3VQEA 1NKBA 4KI4A 4FJGA 2KQRA 3OYFA 2YKNA 4E7JA 1E0EA 2Y0SA 3FBNB 4XOPA 4B9VA 4EATA 5CY4A 4IFYA 1RT4A 1FKPA 2RF2A 2IGKA 4W5NA 4M3ZA 1S9GA 3TABA 4FLXA 4FJ5A 4DFJA 2DT6A 2BVLA 1HQEA 4CA0A 2YHBA 1PYVA 4CJKA 3CFPA 2YNFA 1IH7A 3SEZA