3HPLA

Kcsa e71h-f103a mutant in the closed state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hplA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hplA02
2ZOLB 5EOTA 4DKEH 2F53D 4N0FA 1E4XI 2W65A 2DQHL 4Y5YA 3O2VL 5L2JA 1FG2A 5BW7C 12E8H 1ACYL 4P9ML 3BE1H 3UTZB 3RKDD 5EORH 3GSNH 1YYLL 1G7MB 2HN7A 3ZE1F 1AGDA 3BGAA 3I50H 3U4EB 2JB5H 2Q7NA 1PY4A 5HDBF 1WLHA 1A64A 4HH9A 4ODWA 3D0VB 5KS9F 1AD0B 3EO1A 4F7MB 2AK4A 4JREC 1W72L 4AEFA 3TVMA 2Z31D 1P9MA 2GUOA 3NOIA 4AT6A 1PLGL 2W9EL 4RNRA 3BQUB 1SVZA 3VE0B 2ZG2A 1EHAA 4LCCB 2X70A 1RUAL 4FQHA 5D1QA 2W60A 1J8KA 2A6KB 3QCVH 4WWKA 2ICWA 4PJCB 5D7IF 2OL3A 2V5TA 1MY7A 1KFAH 5JO5A 6FABH 1NANH 1LK2A 3DWTA 2L7JA 1ZSDA 5JQ6H 3VFMB 2P8MB 3S34L 4P2OC 5F7HA 3P0VH 3MV8A 4GO6B 3X13A 2VYRE 2VXVL 1E6JL 1H5BA 4R7DA 3D69B 3QFJB 4TNVF 1CXIA 4XXDA 1GJIA 2NXYC 3ECBA 3HZYB 3VXMD 4U33A 3DMMD 2D03H 5BQ7B 1WEJL 3SCMC 5DHVA 1BFSA 3S96B 4D0CA 4ODVH 3X3GL 1N4XH 1H8SA 5E1AA 3FN0H 1RFDL 1CFQB 5EG6C 4Y16A 5BJTA 4CVZB 5AWNH 4OUUA 5I8KL 5DZNA 4B41A 4OLEA 3STBA 4N9GA 1I4FB 1WJ3A 2CKNA 1X44A 5ALCH 5HI3C 5EH1A 1BFOB 1XH3B 3KYOA 1I8LC 2EO1A 3MFFA 1A4KA 1XCQB 2YPLD 3DX7A 4G8IA 1MIEL 2ORBH 4NKDA 1PZ5B 2W38A 3MOQA 3CVHH 1UWEH 3FTGB 4L4JA 5T33L 2Z91B 4JANA 4U1JB 2ESVD 4I0CC 5J06A 2HTKC 4X4XB 3UPRB 3O3EA 4RGOH 1F4WL 3PWNA 3U9UB 4NRZA 1YN7A 2WM0A 2BJMH 1H15A 4NZTL 2APBA 1W2KT 1A21A 5HYJD 2BNUA 5HYIA 3SKJL 3FMGH 5D8JL 1DDHA 5IG7B 1VFUA 1HCVA 1FZMA 4Q0XL 1PJ9A 3SDAA 1TTUA 1CLYL 2BK8A 1BQUA 2DQCH 5MHSE 4DVBA 5HHOA 4AM0A 2QJDA 1NCUA 2FHFA 5HHME 1MCWW 5KW9L 1T5WB 2VQTA 4NM4L 2Q76A 2R1YB 4YE4L 5D7SH 4JRXE 5E8OA 2HKHL 1JP5A 3VFRA 4OZ4A 3DHMA 4LFHG 4ZS7H 5E8EB 3WUWA 3U36B 5CP3H 3T3PF 4MJ5B 4NRYB 1MCLA 5J6HA 1UKQA 4P5KB 3V7MA 4IM8A 2X09A 5C0JA 2HMID 2YEZB 4OAWA 1CT8A 1P6AB 3L3IB 1U6AH 4TVSa 3LY6A 1XZ0A 1IAIM 3QPQD 1F58L 1UM4H 2RIKA 1G9EA 2B4CL 4BH7A 3D5OF 1KCUL 2AS5M 1A5FH 3NCYP 4WHYH 4TNWK 5C09A 3TLRA 2AV1B 4HIJB 1P4IL 4KHTH 1PG7W 5E2WH 3SDYL 1ONQA 1WZKA 2IEPA 5F7YC 5FCUL 3S37X 1JWSB 3D25B 4MHHG 2BHUA 5EN2A 3MJ6A 4QNPF 2P45B 1UACL 5HGBA 1DVFB 4OTXH 1FVCA 4LPCA 4PY8J 2E27L 5F9WB 3MV9E 3BN9D 3SDXE 1T7YA 4U1SB 1YEIL 3H2WA 4TUKL 3W9EA 4X98B 2HAZA 3LKPA 3MRPB 4G8GA 4Y8AA 3B5TA 3TJHC 4GAGH 2VLLB 3DO7B 3RWEA 1KIQA 2OLDA 3D2UD 1KPUB 4JY6B 2NZ9C 4ZFFB 1FORL 2VLJB 1PKQE 4M93B 5GRXG 4LDOB 1R3KA 2YD4A 1ZOXA 4XBPA 2P5ED 1D3CA 4PGEB 5IB4A 4JPVH 1AFVH 3A6OA 5ILTL 5IB2B 5ANME 3FCTA 3RGVC 5HVWA 3D39A 3L3GB 3O4LE 2RHEA 3CUPB 4OV6F 4XAKE 3Q3GB 2CUIA 4ONHA 1CD9B 4ALAL 5TPWL 3X14B 3BDBA 3C60C 4LDLB 4DFHA 3L3JA 4LHUG 5J89A 4P3DB 4M4RA 4ELKA 5ESQA 1JGUH 1YEJL 1HSBB 4O58L 4PG2C 1Z3GH 1LVEA 5HSFA 1MFEH 4I77H 3LMJL 3U4BH 4YUEH 5F8RC 3JV4B 4HW6A 2LVCA 1PYWB 1RK1B 3OWEA 2CIKA 5GS0D 2AJYL 4PB0L 1L6ZA 1F8TH 4G9FE 3HE7D 4WJ5B 5DFTA 1U8HB 2D31B 4R97B 2NCMA 4Z78A 4XC1L 2C3VA 4K3EL 3T0ED 3QG6B 3SDDB 1CFTB 2HFGL 3WIHA 1KN4L 3PDOB 3RL1B 3HAEG 4M62H 1YJDC 4P46D 5GSVA 3MNVA 4RISH 4HWEL 1KJ3L 3UC0H 1LP9B 3IXAB 4ZYKA 4ONFH 4ZOCA 5I1IL 3GSRA 4KJYB 5DUBA 4Q6IC 4KQ4L 4G8EA 1RSFA 3T3ME 5I1JL 3CFEA 1DL7L 5EBLA 1C5BL 3RVXC 2H2PC 4P0DA 2VZ1A 3W2DL 3TN0C 2FJFB 4HSQA 2DTMH 3I2CL 4KVCL 1WAAF 4K3GA 3BEWA 3CFBA 2XTJD 4O2CB 3CLFH 5HGAB 4BSWB 4OF5A 1T83A 2X7LB 5F9DC 4U6YA 3MXVH 1UQSA 5D93B 2QTEA 3OAYK 3ARDA 4XX1G 5AAMA 1FNGA 1KTLA 4P3CL 4I13B 3TF7C 3LIZH 4FXGB 4TSCH 1FH5L 4KTEH 1KN2H 4PJ5B 2F15A 4YXLL 1Q94B 1CLCA 2Y06L 4HFWA 4PJXF 2FSEA 1S78D 1NC2D 4IHOA 5FGBC 5JHDB 4O2EB 4NHCL 4LBEA 3F58L 5F71A 4OLWL 3QNXB 3CAFA 2H8PA 4G6AC 3DVGA 4K94L 3K81A 1IM3B 1IFHH 5C7XL 2AJUH 1MFBH 5D71L 1QBMH 3QQ3A 2NPLX 3TT1H 2A0LD 2DJUA 3D48R 5IIEB 2XV6B 3JV6A 4NO2B 4HS3A 5GIRB 4K8RC 1T1WA 4K7FB 5IMMB 3DUUB 1I1AC 3N9GL 1MUJA 1YJDL 3P30H 1RURL 3HC0A 5JPNA 4U2YA 5IWLA 3ARVA 3QEHA 4JM2F 3OAYH 4PJHF 3QQ9D 3GGWB 5E2JA 3SPVB 3WS3A 1FLRL 2DM4A 3FO9A 5JDSA 1DLFH 1IGML 4GW1B 4F2MB 1HSAA 4TVPH 2FL5A 5IUSA 4LPXA 2IH3A 1FPTH 5DZLA 4GRMA 4KDWA 2FO4A 5SWSD 2ED9A 3CVIH 2Z4QB 2BXZA 5C0EA 2PO6A 5EZJA 4K3JH 2VL5B 3S5LG 3O8XA 1FCCA 3LQZB 4NBXB 4DVRH 1D5BB 4UIMB 5JQHC 2BOBB 2VIRB 4DGVL 2JB6A 4WV1B 1UZ6E 1B0GA 1GZPB 5LQBH 4QRUB 3RUGF 2OR7A 3BOVA 1BWMA 3BUYA 5J13C 3V0VA 4OCYL 1X4ZA 5AYUL 2IMMA 5ACZA 3QR2A 2V9TA 1FZJA 4QHLB 1U8MA 4R4FL 3BH9B 4XHJD 2PW2B 5F89A 2NY7L 1TZIB 1SYSA 1N6UA 4RFOH 1I9IH 1IAOA 4Z7VB 5C0AD 1RK0A 1HE7A 1HH6B 3KXFA 4OJFH 5KVGL 5L2KA 3M8OL 3QJFB 4PJBA 5IBUB 3SDCD 5TDOA 2HH0H 3WFHB 3IJSA 5B39A 4Y8DC 1MPAH 1QLRA 4X6BA 4GG6B 4YX2H 5JDJA 4PJ7E 3RVVD 1KCLA 2GFBB 4HC1L 1K4DA 4JFEB 3PABB 1I7UA 2NY1D 2IAND 5IVXE 2I07A 4JN2A 2DM3A 4HF5H 3PGDB 4L9LA 3FO0H 1T6VN 3NIDF 1FE8L 4JKMA 1S7VB 3IDXH 1NGZA 1ZVSB 5FKAB 2C1OA 3WO4B 4PRPA 4JAMA 3MRHA 4QYOB 4PB9L 3EOTH 5KZCD 5LXGH 4QY8B 4CADA 8CGTA 3U6RA 3TNNA 1CR9L 3MYZA 4N0UB 1P7QD 2OSLB 1D6EA 4UAOB 4G8FA 5GJSL 5DMIL 3RPIA 1FG9C 1RJCA 3HNTL 3PWJB 4OZGA 2J8UB 3LDBB 3E6HA 1EBPA 1DFBL 2Q1EA 2X40A 1QPXA 3VDCA 4UQ3B 4MNQA 4BQCA 2IGFL 4EQ3A 2XWBA 4X6CE 2ED7A 4J3OC 1MHEB 4YC2C 1KLUB 1FAIL 2BRRL 2ZSVB 4P5TB 5DJ2A 3RZCC 3MLSH 4OFPA 4WI3A 3WNPA 1AJ7H 4RQQB 4XBEH 1RUMH 4Z7WA 4JO1L 5JPMA 5DQDH 3K7UA 2R15A 4H26A 2J7LA 2PCPB 1F90L 4HPOL 4F9PC 2FWOB 5C6TH 3BP5B 4XPGL 4N8CH 4U6VH 5A43C 1MAKA 1IILE 1WWCA 4NQEE 5DJ0B 5I2IA 3O11A 5E5MB 4NNXB 1QFHA 4K23H 3FQTA 1JZ8A 3ARWA 4U2ZA 2EECA 2KQNA 1KLFA 3Q5OA 1EIBA 4PJ9B 4OZHF 4YBLC 4MDJB 1DEEA 3R0NA 2AQ3A 1OAKH 1BVKA 3G5YA 4KJWD 4OD2A 5I1EL 3QDMB 3ZKXB 3MV7E 3BJ91 2FCBA 1CK0L 3I3DA 5F1SA 2K1MA 1T2QL 4QO1A 4NWTH 4GRLB 1XF3B 5D96B 1YEHH 2R2BA 4PRBB 1G6RB 4LLMB 2E6PA 3GHEL 1VENA 1RY7B 5F1KC 2P8LA 3GMPB 4M4PA 3S4SA 1HHJB 4M02A 3T2OA 5DD5L 3CDYA 4U49A 5DURD 5BZWB 3LSOB 3SE3C 2NY2B 4XCEA 3DRTB 2EYSB 1FIEA 3G5ZA 5A16A 3PXJA 5EUOE 1ZKAA 1V8HA 2AXFA 1U9KA 1M05B 2PYED 1OGTB 3BWUC 4X7SL 1MOEA 5BO1H 4CL7A 1F4YL 1U8LB 5HJ3A 2EIZA 4MAYB 4O2FB 3MCLH 5HHXL 5F7KC 5E08L 4Y5YC 3VRIB 4YIQB 2JCCB 5CD3B 4P2YA 2I5YL 2V17L 1NAMA 4ODHH 5IFJA 2GJ6E 3RWJA 2A6IB 4ZPTB 3VFGL 3PHOB 3B9KA 2F5AH 1RIHL 4H0GA 4J23A 2D7TL 4YHIA 3ULUF 3L7EA 5JW3L 3CPLA 3GB7A 1JGLL 4NUJA 5F1NA 3WLWC 1I3GH 3ILQC 2X1QA 4NKIL 3TVMC 3MRKA 4PRHB 5I19L 1P9MC 1KLGB 4WY7L 3O2DL 3OF6D 4MX7A 1FVEA 1RUKL 1A0QH 3IDYC 1MQKH 3UBXA 3TCLA 3RVWD 1CGWA 4N0YH 3RY5A 4M5YL 4XX1E 5D1QC 1AQDB 5GZND 1G84A 1N59B 3GRWA 3TYFB 4WWKC 3OKEA 3MJ9H 4PRNA 4WUUB 3CDFA 5C0BA 5L88L 4W6XB 3STLA 4EDWH 4JO2H 4LLWB 2BNRD 4FFYH 2R4RL 5IMOB 2B1HH 1OQXA 5KN5A 1UFUA 3VFOA 3OHXB 4MDIA 4NUGH 3UEZA 5KSAB 4L4VB 3VFPA 3EYSH 1H5BC 1KCVL 4K71C 5D2NE 1CDIA 5IHZB 5D6DA 2I25N 3S88H 5B8CB 2APFA 4JJ5B 1VFOA 2QSCL 5KSBB 3IS1X 2H2SC 4OGYH 1QSFD 1G7HA 1CG9B 1HILA 2OR8A 3ZTJG 1DN2A 5HHNA 3O3DA 4Y16C 3EW3B 1A1MB 2E9BA 4LPVA 3VFUA 4AIXA 1FC1A 2D7OA 1DBKH 2XTLA 3CDGA 5K9OA 4CAGA 3P4OA 4LSTL 2C3GA 1PSKL 4M43H 4PJEF 4A6YA 1HOCB 5EOQL 4BSJA 4F57L 1IQDB 4R4BB 3REWB 3W82A 4L8CB 4J6RL 3GJEB 4P23D 5BV7C 4WI6A 1HN1A 3HI5L 5FAAA 3MLZH 2AAVA 4RFNB 2EIDA 1BGXL 1U0QA 2WQRA 2FIKA 4W6WB 3RDTD 4FQCH 3INUH 4ORGB 2P5WD 3G9AB 4UMGA 1LEGA 4YDIH 5D70H 5DI8A 3WUWG 4UQ2A 1IZKA 3EJZC 3I3EA 4GXVL 2OL3L 4PV9B 4OCSH 2FBJL 4WTWA 3KDMA 1KNOB 3SDAC 1MAJA 1MFAH 4HZLA 4Y4FB 4N5EC 4DW2H 1Q0YH 2AJSH 2WBKA 2JELL 2VDRL 2YD6A 4UTBH 5E6ID 1IGJB 5J3HC 5ISZE 1ZGLM 2QADB 3QB7C 3UROR 3D3VB 4S1RL 4ZSOA 3CCHB 3KNBA 4PIRF 3BDYL 4PRDB 3A67L 2AP2A 4DKFL 1EGJH 1QBBA 2UVEA 3LV3A 3OKNB 1CVSC 4QHUB 4TQEL 1HEZA 3QUYD 4FTVB 2J88H 4MA7L 5IEHA 1M7DB 5JLZB 5I8OL 3I75B 2CK0L 4E41A 4QRQB 2XWTB 4ZDHB 4PJ8D 3V5HB 4FQ2H 2GJZB 1QSED 1SBSH 4GUPB 3VWJA 2ARJQ 4R4ND 4RRPA 4EI6A 2A73A 2WBWB 2BSED 3QUZD 4RMVA 3FB7B 1NCTA 3R1GL 3UMTA 4HKZB 1AGEB 4U7SA 2ADIB 4D3CH 3HI1A 1IEAB 5GGRB 2VR5A 1F13A 1QO3A 43C9A 4JFFA 4PJAF 3NFPB 3H9HA 3CGTA 4DK6A 4F33B 2Y5TB 3EOBB 1D5XB 2F19H 1U3ZA 4Z7UF 4M8VA 4ZNEE 1II4E 1QRNE 1MHCA 5E7BA 3BKCH 2HTLC 2XN9A 4HKXA 1FP5A 2CXKA 4XWOD 5IW6B 1LQSR 1K9TA 5TJWK 4Q2ZA 1TZHB 1K85A 3L1OH 5EU7C 1W0YT 1AI1H 3UYRH 1J0HA 4X7FC 2EC9U 5DLMH 3V4VH 1CIUA 2ATKA 4NHUB 4JN1L 2LU4A 3PWUB 1IGCH 4JLRA 2BSTB 1WGOA 1KBGH 1KELH 3PXHA 1MHHA 1EMTH 2YPLE 4M7ZB 4UB0H 2X42A 2C3HA 1JGVL 1GOGA 4F80A 2ZOKB 4G5ZH 2VXSL 1PG7H 1TZGH 3FOMB 4NYLB 1IC4L 4TULL 1KG0B 2Z93B 1CDGA 5IV2A 1VPOL 4XAWL 1S9YA 1WC7A 3VXSD 1VA9A 3L3OB 2XQBH 4KK6D 3VU2A 1RAMA 2HFTA 4G6FB 2NY0B 4Y2DA 2RFXA 3QUXB 4HQQL 4M6OH 1RVFL 1QEWB 4J3SA 3BDXA 2IQ9H 1MRCL 4S1SL 3NN8B 1HIML 2APXA 3RWGA 4FZ8L 4PREB 4W81A 1K2DA 5C0ND 1IQWL 1Q9LB 1JPSL 3IAQA 3QEQA 3KPSD 4LRNL 4PJDB 4OZFA 1CGVA 1ADQA 4RGNB 3QIBB 2YKLH 2EDJA 1J12A 1DLHA 3DUHA 3FOLA 3KJ6H 2AGJH 2XPGA 4FQIH 1BZ9A 2UVFA 2X6MA 4QF1B 4U1NA 4BQ9A 5BVJB 4R96B 1T83C 3B9VA 2O61B 1KOAA 2OMBA 4ENEC 2AK4E 2FH6A 4KZEH 4Z76A 3IDJA 5DYOB 4JRYB 3ARDC 5IW1B 2ZKHH 5CINL 4UIKL 5LBSL 1I7ZA 3BUTA 4LRIA 1FV1A 4TPRL 4YHLH 1QQDA 2FGWL 4YBQC 2DKSA 5E4EB 3S35X 3D1MC 3NAAL 4OKVB 4IDJH 1MI5A 1IAMA 1AGFB 4FN0A 4JZJA 1L0YA 1TDQA 3BKMH 4E42A 3AFLA 3UCRA 3K74B 3WHE1 5KVEL 5I30H 1X5KA 2GITB 4ZFOA 1C5DA 3ARED 3H8NA 3T0XA 3ULVC 1LWRA 5A1AA 4Y4KB 2IPUG 2VDNL 3WIHL 4M3JA 2NY3B 2R0WL 3MBXH 4EOWH 3LPGA 2P5EE 4EUPH 1GGIH 4Z9KB 2WAHA 5INDA 4HWNA 4YH6A 5IWLC 3ULUH 2QQLH 2VE6B 5T5FL 5GRJH 4PY7B 2NLJA 3VD3A 4OT1L 4XC3H 3B2UD 5F7NC 2X9YA 1OGAB 2ZG1A 1SM3H 5CEZL 3P11L 4Q9QL 3N85H 3W0WD 2NYYC 2Y36H 1KYOJ 2UY7A 2PO6C 4JFZH 3O8XC 4OGAC 4KRMB 2YA0A 4Y19A 4HXAH 1MCBA 5JNYA 1MWAH 4CUCA 3AU1A 1KPRB 2FHBA 5HDOA 1JGDB 2VDQH 4NN7B 5HHQA 1DN0A 3HPLA 1CTNA 3U0TB 1K5NB 1T4KA 1CE6B 1NCWL 2NY5H 4S0TD 1NC4B 1DJSA 5B39G 2P7TB 4XP6L 4L4TA 1ZA3B 2EKSA 1RZJC 1ACZA 5FECB 4TRPH 4K8RD 1I1YB 2XKSA 3MODL 5ICYB 1CICB 2WUCL 3CXDH 1TIUA 2ZUXA 5TH2A 4BZ2H 4QRRD 3LEXB 1K3ZA 4X6DA 4PS4L 1CFQA 2ITDB 3HMWL 4LIQL 5L8LB 4BQ8A 3FJTA 2Q7YA 4JFXB 5I1HH 5HHOE 5F3BA 1CI5A 5AUMB 5HI5D 3QZWB 4XHQA 3ULVL 3ZE2F 1XCQA 3WKML 4CJ0A 1PZ5A 2GW5A 1A3LL 4X6EB 4DGYL 2BHZA 3PF2A 2A1WH 3B2VH 1QSVA 4X4XA 2HJLB 4M7KL 3O9WB 4L9LC 1CFVL 4NKOA 4R2GD 1EZVX 1YQVL 3JZ7A 5KVFH 4FFVD 3ARRA 1FN4B 3HZKB 5C09E 3WBDA 4KDTA 5IG7A 4LAQL 3BYTA 4P2QA 5EA0L 5C8JB 4YBHA 1LO5B 5IEKB 1EFQA 1ZHNB 5EIIB 5F1OB 3B9EA 2V5SA 2R23B 5I74C 5CFHA 1IL1A 4M48L 3H42L 2R1YA 4OIIL 4G8GE 4YXKL 4XXCA 5F7EH 3U36A 1JIBA 2P42B 1B9ZA 3MLRH 3H0TB 1A6AB 1KC5L 3DXAD 1CU4H 4MJ5A 1RZJL 1FNSL 4JDVB 1FBIH 2WBJD 2YEZA 1T89A 1OWWA 1ZWIA 4Y5VB 1VFAB 5AYQA 4X80H 1S8DA 2D7NA 5E9DA 3TP4A 2EYRA 1TVHB 2DYPD 3QEGH 3EO9L 2AABL 1KV3A 1HCFX 2AV1A 1BX2B 4OIBA 2CKBL 4MJID 4P4KB 4ZAKD 5GGSB 5IMLB 1NFDF 4JQIH 2YMXL 4M1GL 5EU5B 3TIDA 5SWSE 3VXUA 1EERB 2GIYA 5DRNA 1T6WA 1GGYA 3SKOB 2WANA 1N6QL 1FFPA 1T2JA 4PGCA 4I4WA 5HHMB 3ZDYE 1LEKA 5C70A 2M1KA 2VLLA 3MLYL 5MEND 1KUMA 3S4SG 3LS5L 1HYSD 4JRXB 2AXJA 1KPUA 7CGTA 2ZCLH 5EFIB 3FONB 1N5YH 2DKMA 5GGTH 4PGEA 4PFEA 3U9PL 4XVJL 4NO0D 1BMGA 3MRNB 4I18B 5IB2A 1MCRA 1GGUA 3BT2L 5I1GL 2EO9A 4HLZG 1FJ1A 1ZAGA 3LQMA 3Q3GA 4GAJL 4P99A 4HCRA 5A3ID 3B9AA 1NGQL 3OR6B 5FYJD 4PUBH 4OGXH 5CEZE 1QKZL 4MA1C 4UU9B 2C1PB 3ALPA 3V5DB 3MRGB 5KSBF 3D18B 4FQLL 2L4OA 3HN3A 3MGOA 3VCLB 1YEFL 3MV9B 3WXVH 1TXKA 4HIHB 1AXSA 1PYWA 2Y6SC 3DV6A 4NNYB 3FHAA 1FZKB 3GO1H 2IAMA 1S3KH 3D6GA 4X7TA 3GHBH 5CBEB 3UP1A 2BZDA 2GT9A 3EFFB 1PKQB 4JPKL 3UBXG 2HJKB 1DE4A 1MREH 1DCLA 3LHPH 1L7IH 4LLYB 3PDOA 5GRVL 1EXUB 1U8NB 3B9KC 3F7PC 3KVQA 3HI6L 5ANMB 4M6NH 5DVKA 3UTQB 1W72B 3O4LB 3IXAA 1I3UA 5EULV 3TO4B 3AY4A 1KIPA 4JFDD 3BZFB 3O3UN 1U8JB 2UWEA 3RBSA 4HV8B 1UYWL 3QCUL 4PD4K 2GCYB 1J7VR 1FNEA 4FMFA 4LIQE 5FB8B 5HD8C 4XRCB 3RIFF 2R0LH 1F3JB 3SO3B 3K2UH 4BYHA 3J7HA 1P6FA 3EYUL 1JUFB 3H9YA 3GI8H 4NQUA 1D6VL 3ULVE 4O00A 1EAPA 5HGAA 2FYYA 3WNLA 4H5SB 3IFPB 1CL7I 2V7NB 4P2RB 2H6PB 1UM6H 1P84J 5FO7A 5IB3B 4L9DA 5TFSH 3VD7A 1SJEA 4JY4A 1K4CA 3RWIB 4QHKI 5I66B 5A2IH 1QTYT 1U3HB 3DUSB 5BMFL 1NLBH 3STZA 4V2CB 15C8H 1F6AB 1Q94A 4QRPB 1IC1A 4YNYB 2YWZA 2HT2D 3WIFA 5D6DC 4O2EA 4AMKH 3OKDA 5J9PA 3PJSA 3GJFA 3BD3A 2ADJB 1T04A 5FYJU 3AAZA 3MUY1 1XF2A 2MQ3A 1QFWL 4YAQB 2NY4D 3WFCL 4PD4J 5IIEA 1G9NC 1NAML 3P40A 3JV5A 5F96H 2R2HB 1IM9B 5GIRA 3E3QC 4XB7A 4I0PA 4FG6D 1WWWX 1W8OA 2UZIH 4CNIA 5DSCA 4RAVB 4JREB 4BFIB 3ZL4H 3L3DB 4IDLA 3C6LA 3SPVA 3CVHA 1RD6A 1T1YA 3VFNB 3MR9A 4GW1A 5F70A 4DAGL 4D9RE 4RA3A 3QI9B 1TETL 3CH1B 4U0QB 2G5BA 5L2KE 3MUJA 5TDNB 4NRXB 3F8UB 3I85A 3GBMH 1VKXB 3IYLW 4N90D 4LASL 3TBTB 4NJ9H 1JN6A 4G80A 1RZFH 2CLRB 3LQZA 3GRWL 4JO3L 4NQSB 5F6HI 4UIMA 1C7TA 2IFFH 3LKSB 4K7PX 2OM5A 1TJGH 2PYEE 1LO0H 1T20B 1J86A 1T1ZA 3HPJB 1RQ5A 2VDKL 4JDZB 4LSVH 1VGKA 2CJUH 2EH7L 5T1LD 3KPNB 3HCVB 1ZGLB 1JRHL 1MVFA 4AK1A 3GNML 1HHIB 4X7DC 4FHBD 1O0VA 5I6XB 4RRPG 1N3NB 2FBOJ 2NXYB 4HGWA 4NC0B 3DIFB 1WBXA 4UI2A 3HMXH 3SCMB 35C8L 3PV6B 3DTXA 5CILH 2AK1L 2AJVH 4PRPE 1Y6MR 5ICZA 1LD9B 2X44D 3RGHA 5FM5M 1IEBA 2H9GB 3B5HA 4YEEA 1RZ7H 5D2LA 4UOJA 5DF0A 5C6PB 2OTWA 4HPYH 1DQDH 3VWJC 4Q74A 4JY5L 4OZGE 4NN5C 4A6YL 4JRWA 3MNWA 1KCRH 3O6ML 3H3BC 4LLVB 1R0AH 5JZ7D 3HE6D 4Q9CA 4Z95L 1OSPH 5ID0A 3KPTA 4JFEA 4WEBH 3PABA 1N7MH 1UWGH 3DSNA 2CDFA 5DD6A 4MNQE 2ZCHL 3ARXA 3HR5B 1JTPA 4LCWA 4TTDC 5ITFB 1X5JA 2JE8A 5DD1L 3IKKA 4YHML 1BFVL 1T7ZA 3DBXA 2P49B 4JCMA 3WIIL 1ES0A 4P4RA 1T2XA 3NBNA 3QA3B 3DGGA 2BVPA 2VLRD 4Z7WE 1FGVL 4Z18A 3O41B 3GSXA 2EE9A 2F5BL 3B5GA 5C0FB 4QY8A 4NQVB 5I18H 4AEEA 1G6RH 2OYPA 2VDOL 1NCDL 2HWZH 2AXGB 4N0UA 5ADPH 5D5MF 3QHZH 3MO1B 4AIZB 4OFYD 1OLLA 4L8SA 1N8ZA 2ZCKH 1D5IH 4OD3L 3X17A 1T5XA 5GS1A 3GI9H 5FK9A 4Z7OF 3GIZH 4GXUN 5F1IB 2J8UA 4P9HH 4LCIH 4OM0H 2BP3A 1P7HL 2Z92B 3QDGD 2A9ML 4PJ7B 1CVRA 3OBAA 4UQ3A 1G7QB 4Z77B 3HUJF 4LU5H 1EHLH 1QBLL 2GY5A 5ALBH 4LEXH 3TA3A 1A6WL 1WITA 2YUXA 5FUZH 1KLUA 5IFAL 1AC6A 5IVXB 4JFHD 5FHBH 4IS6B 5FHAH 4RQQA 1A14L 1UH3A 2E6JA 4OCXH 4N9OB 4P59L 3L5XH 5C07A 4IOIB 1BVLB 2A77L 2ZUQC 2ICEB 4OZFG 1UA6L 1EO8L 3BYYA 5DFVC 5FO8A 2O93L 5L9DL 4C56D 3G08B 1WFNA 4P48A 4XCNA 3PE9A 3S98A 4ZUWB 3M1BA 3MOBH 4NNXA 5DD0L 3ZTNL 4TUJB 1IGYA 2E7HA 2Z8WC 1B88A 3JWDH 4Y2DC 3C5JB 2HG5A 4NKQB 4UNTA 1ITBB 3CMGA 4G6ML 4ZD3L 3UZEA 3GMQA 4WTXA 4APQB 4F7CB 1IEHA 1OQOA 4URTB 3IF1B 4QXUH 3ELAT 3M07A 1Q72L 4DK3A 5CD5D 3QDMA 3FFCD 4PTUA 1GXEA 4XP9L 4MQ7B 4HJ0D 4DZBB 3E8UH 2J3SA 2XZQH 2YC1A 4GRLA 4X6CB 3EDFA 1G0YR 4WDIB 1AKJB 1I1CA 1G7PB 5HDQH 3TEUA 2PW1A 3SGKA 3RGVB 4KAQH 3EOAA 1XR9B 5KSVB 5CJOH 1RIUL 4R8WH 5T5NG 4DUWA 4LRIC 3C60B 4K3DH 1QSEE 3MBEA 4YQXH 4NQEB 4S1QL 4LSQH 2V5YA 1FDLH 5LGJA 1EUUA 4CMHC 3NFNB 4WCYH 2EDLA 3RI5K 3NH7H 5JOFA 3SOBH 1S9KC 1EJOL 2DBLH 3QULA 1U8LA 2VL4A 4MA3A 2ZUVA 3BPNB 3I9GL 4X8JA 5C0BE 1HH9A 4JZJC 4YIQA 4PRIA 2D4DA 1YMHA 3M45A 1IGFL 4CMMA 4FFWD 1SYVB 3GSWB 2O5ZL 1MIMH 2G60L 3NZ8A 1NLDH 4RMRA 3P4NB 4NT6B 4K2UH 4HIXL 4LHUB 3CFJA 3C08H 1WWAX 1XGRB 4XVTH 3EDEA 1CFNA 1CGXA 3BAEH 4R3SB 3HC3H 3HNSH 5GHWL 2MJWA 3SGEI 1PD6A 3KHOA 4ZNCD 4QOKA 4KU1A 2HKFL 4Q6IB 4U1MB 2SEBB 4FQJH 1CIDA 2CH8A 3MA9L 5T3XD 3WDHA 1GPOH 1N59A 4YHPA 2A6JA 5IB5A 1ADQL 3HAEB 4FQXD 5EUOB 2IMNA 4QRTA 1MFNA 2AERT 3RNKA 3MA7A 4PLOB 5D7IA 3FRUB 3HNVH 4ZO8A 5HGGS 4BFEA 3TZVA 1RUPH 5EUKA 3C2AL 1I8KB 2GJ6B 2C7UB 1Z9LA 5IT2L 1CGTA 1B90A 5I1AB 1YUHB 4ZOEA 3S35L 2VZUA 4X5XB 1J0YA 2IH1B 4K9EH 5IHZA 1KCKA 1XGPB 1I85A 5HGHB 4X4ZA 3GSOB 5B8CA 3UJIL 3KS0J 1HDMB 3CU7A 5MEPB 3FQRB 3VXSE 1BLNB 4HEPG 1FNAA 1CG9A 2BVOB 4OQTA 5FUOL 2R4SH 2D7QA 2HT4C 4NC1C 1QACA 1A1NB 4UTAH 5EBWA 1CBVH 4M6AA 1SEQH 3T65A 1UXSB 2EKJA 4JFQB 2HRPL 4NO3B 2EE2A 3KPSE 3P0YH 3ROOA 4OLXH 2B2XL 3RTQA 4POUB 3FO1A 4ZFOL 4R4BA 4ZXBB 3REWA 1I1AB 2G75A 2W0LA 1IJ9A 3GJEA 3VMNA 2PO6D 3U7YL 2FATH 1MJJB 3PP3H 4YLQT 1YMMA 5JA8B 1ZV5A 2H32B 4XP5L 4ERSH 4RIRB 1KXQE 3IJHB 4KRPD 4ODSH 4ORGA 5D2NB 1YNTB 3KYMB 4ZTOH 4KXZH 2Q3AA 5ABDE 3KYNA 1DQMH 5KAQG 1KJ2H 1VFBB 2WSKA 2P43B 1MJ7H 4KDTC 5E94A 3RHWF 1KNOA 1WF5A 1F42A 5TDPA 4NQCB 3BZEA 3LQAC 2ZUYA 3Q1SL 4POZD 4F58L 3PL6D 3TFKC 3CU1A 3PWPD 2YK1L 3P0GB 3IRZA 5J13B 5IMKB 3QIUA 4S0SD 3QUMH 4LF3B 4NQDB 4YHNB 1NKOA 3ESUF 4WW2A 4XXCC 3OKNA 5FO9B 2NX5A 5TE7H 5C08D 3S5LB 3IFOB 1M7DA 5JLZA 3V6FA 4KROC 1T89C 3P4MB 3LEYH 2LABA 1ZGLP 1Q0XH 1R5WB 4QTHB 5F9JB 3H3KA 5CHNA 2EE3A 2HLFC 5CLWA 3MACL 5CZKA 4PGDB 4GUPA 4TVPD 1NDGA 1U92B 2LTQC 1QUNA 3ZDXF 1C1EH 1U36A 4O4YL 3W0WE 1V7MH 4RMSA 1AGEA 4XT1C 5F9WC 1A7NL 1VDGA 5GGQH 5ERWB 5GS0H 3VXTA 4TYUA 5ISZB 3QO1B 5GGRA 5JMRA 1RJLA 5MERA 5KANG 1MFDH 4F33A 1AH1A 4RAUB 5FM4A 5I1DB 1Q38A 3MPCA 4M93C 4ZFZA 1OAXH 3DYPA 3CFKB 3UAJD 4IRJA 1VERA 2H1PH 4ONGH 1Q8MA 2LU7A 2FHCA 2HVKA 1EBAA 3UTOA 1JNHA 4HKJA 2VXQL 1DBJL 2XKUA 5DUMH 4L8DB 3MLWL 1X5XA 3LQAL 2QLVB 1TZHA 3MV11 3TPKA 4KJQC 5BS0D 1KB5H 4JQVA 4MCZA 4NHUA 1R3IL 3QEQE 1YDPA 4GKSA 4LNVA 2IC2A 1MNUH 5J6GA 2RBLA 3QH3B 1U95B 3NACL 2J8OA 3T3MF 3L5IA 2P48B 4AQ1B 2KKQA 4YC2B 2AJZA 4JR9L 2IAMC 3C9NA 3RZCB 4GMTL 3EYFA 4R97C 1ZTXL 5CEYB 3RJDA 3ULSA 5JTWA 1CGUA 2R56H 2XQYK 3GSQA 2YD8A 4X9FA 4M3KB 3QDJA 1OAZL 5JXAL 3DETD 1QRNB 3L3OA 1D9KD 1I7TB 3ARGD 3CK0L 3TYGH 2C26A 2Q8AL 5K59E 3LRGA 3T04D 1HHHB 3AY4C 2OX5A 4KKBD 1MJUL 5ECJE 4YDJA 4H8WC 3FB6B 1MI5E 5TF1L 4YBLB 4M7LL 4HS6A 1MRDH 3QIBA 4M61A 3AC0A 2XY1A 3HC4H 2XWJB 1S9WA 3G6DL 1HNFA 2DRUA 2WLZA 3VA6A 5DEZA 3MJ9A 3QUKA 1HQ4A 1CQKA 4U6HA 1M1SA 2ADGA 3ZSTA 4HUVB 4R96A 1YNKH 3U0PB 4GKZA 1OPGL 4YDKH 3Q6GH 2O61A 4LQ1A 3TIEB 4EVNB 3ZYOA 1PKOA 5DYOA 3Q2CA 4HCRL 5HBBA 5BXFB 2M26A 3VXOB 4M6ML 3VW3L 1MH5B 3U0WL 5LWYL 1KCSL 3RWFA 1S9XB 4LSPL 3WN5A 4MQSB 4N1HB 4XVSL 4MJIE 3GMNB 3UXFA 5EBMA 1J8HA 4J3WA 1KTDB 1QFWM 4PJXA 1P69B 1G0XA 2JK5A 1AGFA 4Z5RB 1I9RH 3H9SA 5EOTB 1T0NA 4Y19E 4DKEL 4N0FB 1R6VA 2W65B 4ZFGH 4XB8A 4Y5YB 4GQ9H 5L2JB 1FG2B 4PLKC 2X4RA 2YN3A 5T1KD 5H37H 5MENE 12E8L 2VDPL 5AZEL 5CSZB 4K55A 5EORL 2X1OA 3GSNL 4RX4A 1FSKC 4I0PC 1AGDB 2RCSL 3VD4A 1BQHB 2R69L 3I50L 5DMKA 2JB5L 5INCA 3SGEH 3GMMA 4ODWB 3OKLA 3VXRD 2AK4B 4PY7A 1INDH 3C6LC 3TVMB 1CD8A 2GUOB 4MQXC 3T8XB 1OGAA 2WIMA 3QG7H 2KUTA 1Z6JT 4X6DE 3FB8A 1YPZF 4AT6B 5FYJE 4NC1E 2VRAA 3QHFH 1YEGH 1LK3H 5M95B 1HZHH 1VFMA 1N0XH 5D1QB 4B53A 1TITA 3VI4F 3NIFE 4WWKB 2ICWB 1F3DH 2OL3B 4NPYA 5DEFB 4QLRA 5EC2A 3VI3E 1KFAL 4JPIA 6FABL 1LK2B 2DL9A 5FCSH 1JGDA 4KV5E 1MQ8A 5JQ6L 3U0TA 1K5NA 1OARH 1CE6A 1YZZA 1VADB 1S7TA 2DQDH 3X13B 3ZE0F 4K3HA 4WHYG 2CMRL 5DMGC 3MRIB 2ITCB 2VLME 3AMKA 5FECA 4R7DB 1J05A 4K71B 3LB6D 4XXDB 3LPWA 4HKBA 1YEKH 3SJVD 4X4YB 3ECBB 1CICA 2P8PA 4CVWA 1Z9SA 3LEXA 2D03L 5DHVB 4JM4H 4HX1A 2ITDA 1CF8H 4D0CB 4GBXD 4GRWE 4P2QE 4ODVL 4JFDE 5E1AB 2C3WA 3FN0L 1OP5H 4FFZH 5BJTB 4OUUB 4AYFA 2D4FA 5AWNL 5AUMA 2A9NH 4N9GB 2V9RA 4OZIF 4KFZC 4PJIA 5ALCL 4B50A 3KYOB 3UTSD 1JI1A 4G7YH 3LKQB 2CLVA 5B3JF 4NKDB 2ORBL 3BKJH 4MD0A 4OD1L 2HJLA 3CVHL 5SX5K 2ZNWA 2DOCA 2JIXD 3KPLA 3E1F1 3KPRD 3O3EB 5GRWA 5E9DE 3PWNB 4RGOL 3RAJH 5KJRH 4EXKA 4NRZB 4K7PL 1YN7B 3DX9A 5L7XL 1H15B 3U79A 2ERJC 4DQOH 4U1KB 5E6YA 2BNUB 2EH8H 2WUBH 1ND0A 5DVLA 1DDHB 2FEEL 3VXUE 2N4IA 5D7LE 1ZHNA 4DUVA 1FZMB 4MHHI 3SDAB 3CMOL 4DVBB 4L8SC 5HHOB 4AM0B 3RVUC 4EBQH 3QWOA 5GS1C 5LGKA 2R8SL 2D9QB 1A3QA 5CJBA 4BSVA 5E8OB 3LD8C 5D7SL 4OZ4B 2DICA 3WUWB 4ZS7L 4JDVA 4Z7NE 5HYEA 3OPZH 4L29B 3W39A 3TA3C 4XVUD 1J0JA 2DQHH 4Y5VA 3O2VH 1G0DA 1FFQA 1CT8B 2IBZX 3O6FD 4OAWB 4X99B 5EZLB 4AEIH 1UB6B 1GGCH 5DJCA 1U6AL 1SJXA 1XZ0B 4WGVB 3F65A 4JM2D 4Q97A 4EN3A 5DO2D 1UM4L 4JCLA 4BH7B 2BOCA 4OLUH 4V1DD 3QCTH 5EU5A 4Y0GA 2JJTA 5F7MC 4N8PA 1A5FL 2WWKT 5C09B 4GMSL 4XI5C 5LGHH 3SKOA 1R3LA 4KHTL 3GBNH 1ONQB 1XIWD 5EN2B 3U2SB 4YPGB 5HGBB 1PG7X 3ETBF 5E2UL 3KJ4B 1IKFH 1G7IB 3W9EB 2VH5H 4I8DA 5JW4M 3LKPB 4G8GB 5DGQA 5EFIA 4Z7QF 1CWVA 4GAGL 2PXYD 1KIQB 3ZKXC 1BQLL 2N7BA 1KB9J 1ERNA 3WKNA 4I18A 1R3KB 4FXKA 3EHBD 4XBPB 3OB0K 4GRLC 4H1LA 5IB4B 4U31A 4JPVL 4ELME 1AFVL 3SGKC 3OR6A 3S34H 4MJ6B 3MRQA 4ONHB 3EJYC 4LOUC 3KG5A 2UWEE 3OAZK 2X4OB 4PJGF 5SWSB 3MBEC 2E9JA 3MRGA 3L3JB 5I76B 5E8PA 1HI6A 1KULA 4NM8H 3VCLA 4NFDA 4ELKB 3SDXA 1T1XB 1JGUL 2IPTH 3PQYA 4X4MA 4NNYA 3QNZA 1Z3GL 1MFEL 4I77L 4YUEL 1UB5B 3C8KA 3BEVA 3I6LE 4JO4L 1ORQB 4FQPA 2BFVH 1BD2A 2VISB 4RWYH 5T1DL 4MCYA 3TBWA 2HJKA 3OR7A 1F8TL 3GKWL 4Z78B 1I8IA 2C3VB 1EXUA 1REIA 5DJ8A 1R3JB 3LZFL 4X9IA 5DK2A 3GMRA 4M62L 1XF5B 3PGFH 1NUFA 4EUPA 5CZXC 2DLGA 3ARBD 4OBRA 4RISL 1OY3B 2R9HD 2XOTA 3UC0L 3QRFM 4NC2B 4LSUL 4ZYKB 1EVTC 3K80A 4ONFL 3GSRB 4N5UA 3SDCB 5B21A 2AEWA 5FB8A 5DUBB 5EU6A 4J4PA 4G8EB 3RL2B 1OB1B 4NZTH 4Y1AD 4EI5D 3CFEB 3WHXA 2AJXL 1T03H 5EBLB 1OTSC 2HLAA 3REVA 2VABA 2RB8A 2DTML 3MJ8B 2GEEA 4G9FA 3ALXA 2XA3A 4L3EA 3TZVC 3CLFL 5JIHA 2NY1B 5CWSA 2NY6C 4I9WE 4YZFF 4NM4H 4U6YB 1UQSB 2PTVA 3PDGA 3MXVL 3B4NA 3JTTB 3ARDB 2HKHH 1FNGB 1KTLB 3IDNA 4U7MA 2BVTA 1PAMA 4QTIH 5TQ0H 4XP4H 4TSCL 4KTEL 1I85C 1CXHA 3DURB 5B8CC 1KSRA 4C56E 1KTRL 4IBLT 2FSEB 1UCTA 3QIWD 1E4XL 4MA8H 1UM5H 4LBEB 2XA8H 3DV4A 2PTUA 4IIQB 2AI0H 2H8PB 2LAGB 2MNUA 2I9TA 3SE8L 4NOFA 2B1AH 1IFHL 2AJUL 1QBML 3QQ3B 2QV2A 1P4IH 1IM9A 3BQUD 3BSZH 4WFED 5SX4I 1GHFH 4LPTA 3RTQC 3CJJA 3TT1L 3UX9B 3FQUA 2OR9H 3JV6B 1DBMH 4HS3B 1MY5A 4RAVA 4PJEA 3C5ZA 1MUJB 2BNQD 5EO0A 3L3DA 3U4AA 3P30L 3HC0B 3KPOA 5H35A 3QEHB 4BQ6A 3QI9A 4QWWC 3WS3B 4P5MA 3FO9B 4Z0BL 2DQFA 5JDSB 5LCVH 3SGJA 1DLFL 1HSAB 1XMWA 2IH3B 5D2LE 1FPTL 5EZIH 2FO4B 3QFJD 3ORJA 1EDQA 3QRGH 5C0EB 1HXMA 4P57A 1X5GA 4K3JL 4MMZC 4U4BA 4LVNC 1CLZH 5B4MD 4DVRL 3ZLQC 2E7BA 3Q5TA 1G1CA 2JB6B 3OKOA 4HDIB 1B0GB 1U8KA 2APWA 4WWID 3THML 1UZ8A 1F00I 3SGDI 5LQBL 1ZGLA 4LCWE 3QIUC 4CGTA 3V0VB 5I73C 4WW2C 5JOPE 2EDHA 3C8HA 4JG1H 1FZJB 3LMJH 5DQJA 4Y89A 2W9DH 4XMPL 5IJKA 5E99H 1SYSB 2V7HA 1NMBL 4RFOL 1IAOB 5JXED 2QSVA 1LD9A 3EO0B 1SY6H 3HHRB 4F3FA 1MCSA 3KXFB 4WRLA 5CGTA 4PJFF 5L2KB 2MFNA 4OJFL 2V2TA 1BM3H 1OAUH 1B4RA 1HHGA 2CKBB 2G9HA 4U1LB 5JIIA 1DUZB 2HH0L 3ILPA 2Q8BH 3ME0A 4LGSB 5B39B 3SQOH 3RFZC 4UOW0 1MPAL 4HWEH 2WWKO 3MJ7A 4PP2A 1AP2A 1WSST 4X6BB 4E9LA 2Z8VC 1IRAY 4YX2L 5LJYH 1W0WA 2PYEB 2YD9A 2D0FA 3ZKND 5TGBA 1K4DB 3HR5A 4BA8A 3EBAA 2DLEA 4JKLA 1I7UB 4IOSD 1YY9C 4DEPC 2RQ8A 2I07B 4JN2B 1DL7H 3QA3A 4L9LB 4BZYA 1YYMH 3KLHD 1UENA 4Q9RH 2FX7H 3IDXL 5GGTA 1F11A 1KXVC 1MLCA 1NGZB 3MUGA 5C0FA 4LSRH 2C1OB 4IRJC 4NQVA 3AMLA 3GM0A 4PRPB 2GTZA 4JAMB 3MRHB 5E2TH 1F97A 2EDTA 3EOTL 5LXGL 4CADB 2OS7A 2CPCA 3TNNB 4P3CH 3G6JF 3WNOA 1JF1A 1I9EA 4G8FB 3IJYA 4JQVC 4PTTA 3ZKMC 4KK8D 1G7LA 4OZGB 4PJ7A 4ONOA 1G7QA 1C08A 3E6HB 4XMKH 4WFFD 3KYKL 3F58H 5I9QB 4PP1C 1DVFD 4ODUB 4MNQB 1JWMA 3FQWA 4IS6A 5H94B 2XWBB 5D71H 1RV6X 3MLSL 4IOIA 4MXQD 5BRZD 1AJ7L 2ICEA 1PW3A 2Y23A 4XBEL 4Z7WB 1T7WA 5JPMB 1KTKE 2DIBA 5DQDL 4H26B 5IF0A 1ROWA 1F45A 3N9GH 2VLJD 1YJDH 4KGJA 2WINB 4N8CL 3QXAB 1RJYA 5I2IB 1MCQA 1JHLH 1JVKA 4APQA 3DRQA 5E03A 3DX6A 3VXQA 5DJYA 1TENA 3K3QA 2E3VA 3RVTD 3BIAX 2WWMD 4PRIE 3QIBC 1DEEB 2J2ZA 5DJZA 2N1KA 4CDGC 1BVKB 1UKTA 3G5YB 5DK0A 4OD2B 1OAKL 4X6CA 1AKJA 1VSCA 5C08E 4P23B 1T66C 5IESH 2D7PA 3MCG1 5ENWB 5HDBE 2FX9L 3B83A 5KS9E 2P8LB 4G6JH 3S4SB 4QOKE 2D9CA 3SDDD 4D9QE 2B39A 4U1HB 3WN5C 1LO4H 1XEDA 4D0DB 3IETB 3ZYIA 4QXTB 2EZ0C 3G5ZB 5A16B 2AXFB 2XZCH 2C4FT 3MXWH 2GTWA 4OF7A 5D7IE 5BO1L 5HJ3B 5E6IB 1EFXA 2EIZB 3ZDZF 1XT5A 1NAMB 4NT6A 4V2BA 3MV7A 4ODHL 5JW4N 4YFLF 1U8OA 5IFJB 4H0IA 3VDAA 3RWJB 4K8RH 3B9KB 4OFKA 2F5AL 2PTTA 1ZEAH 2DMKA 2VLKD 5J57B 3KGRA 5GGVL 3CFDA 3BVNB 3L7EB 4R3SA 3CPLB 4NUJB 5F1NB 4MQTB 5C0CD 4YFLI 2YXFA 5ACMA 4F15B 2H32H 3QNYB 4QGTA 3ZT6A 4X5WB 1RJZA 2XQYG 4MX7B 1FVEB 1QSEB 1A0QL 1MQKL 4JDTH 2NXZD 3CH8A 3TCLB 5BS0E 4PJ5D 5EUOA 4N0YL 1ZT1A 3BXNA 5JHDD 1C8PA 3IDGA 4LCUB 4PRNB 5DMYA 3MJ9L 1EEYB 5C0BB 2F54A 4DTGH 4P3WA 4NN7C 4EDWL 1I8KA 2GJ6A 5KN5B 4CN4A 2C7UA 2CO7B 2B1HL 3VFOB 4NKMA 5D1ZA 1YEDA 2X89A 3ABZA 4NUGL 3QQ4A 3AS3A 1TQBC 1K8DB 1P1ZA 5DGRA 2EDOA 3VFPB 3GSOA 3DO3A 3BP4A 3HA0A 1WZMA 3CSGA 1CICC 4HT1L 1SJHA 5C9JB 3S88L 4GAYA 2BRRH 1E27A 4TUOA 5CEXA 4NCDA 2EC8A 3HMXA 3G5XA 4YEFA 4S10A 4J8RB 1V3LA 1V3KA 4OGYL 1G7HB 2K9UA 2X5PA 4CVXB 4JO1H 5SX4H 5KOMC 4LLQA 3KYAA 3O3DB 2ICCA 4NO3A 3VFUB 5K9OB 3CDGB 1DBKL 1A6UH 3TGXA 5C3LD 5IVZA 1VHPA 4DZ8A 4MXWH 4D2NA 4A6YB 4ZXBA 4M43L 1NJ9A 4IMKA 4J3TA 4KMQA 4JGJA 4MB4A 1BAFH 3J8F7 3K4DA 4PR5A 3GMOB 1X4XA 3T3PE 3DHJA 32C2A 3MREA 5C0IB 4MXVF 5JIKA 4OFVA 5D2NA 1A8JH 3MLZL 3LH2H 1WCBB 4UNUA 2FIKB 4RFEA 3OJVC 4FQCL 1JFQL 3INUL 4KTYA 5CLTA 5DI8B 5D70L 3VXSB 4WO4D 1T2QH 1Y18A 1JZ6A 5EO9B 2X4PA 2XXCB 1S7RA 4XH2A 4OCSL 3KDMB 4BKLB 2ZG3A 5DS8B 3IDMA 1IT9L 1MFAL 1H3PH 4DW2L 1Q0YL 2AJSL 4QNPE 2E9WA 5IMKA 3EOYG 4LF3A 1RZKC 4QHNA 1DR9A 3KNBB 5D1XD 4HMEA 3QT2A 1I3RA 4EDXA 1EGJL 4ETQA 5IM7A 2CRZA 3UPCA 1OD9A 4P49A 4HMCA 1HEZB 4NFBA 4I5BA 2Y72A 4QTHA 4Y5VC 4Y4HA 2EXWD 2V17H 1RU9H 2HP4A 4OCNC 4E41B 2A38A 1A7RH 2CSPA 4FQ2L 4EN3C 1U92A 2PF6A 3MLXH 3TJEL 1TNMA 1ZMYA 2JJTC 1AO7D 1SBSL 4F8QA 4JG0L 4EI6B 2A73B 2MQ0A 4PV8B 2EIBA 4H1LG 1UXWB 2F53A 2Q6WB 4WY7H 2PYFB 1A9BA 4PY8I 2X4TA 3FHQA 1B0RB 4RMWA 1ED3A 4KKCC 3HI1B 4NSKA 1CCZA 4JGMA 2L7UA 4M9OA 3K4AA 2RGSA 4RAUA 1QO3B 43C9B 1Q9KB 5B22A 3SKMA 3OX8A 1KPVA 3H9HB 3CFKA 4JEGB 4I18C 2F19L 3QDJE 3SJVE 1MHCB 4TNWF 2WV3A 2OTUA 1AR1D 2BX5A 4P5TD 5FV2A 3BKCL 4HKXB 3JWOH 4QHKJ 3SEPA 2FJHB 4NQXB 3LRSA 3WD5H 2Y9RT 4WNQB 3FN9A 3W0WB 1AI1L 3UYRL 5M7QA 1OAYH 2ATKB 2YHGA 1IGTB 3MZTA 3NCEB 4JLRB 1IGCL 2X1XR 2VITA 1KBGL 4EUPG 3FO2A 1KELL 3UTSE 3V4UH 3VGEA 1EMTL 4LEOB 4PJ9D 2FDBP 3BIKB 2EXYD 3ULVF 5D7KD 1U93B 4G5ZL 2QQKH 3L5WA 2ZUQB 1PG7L 1EV2E 3KPRE 3VXMA 2XXMB 1F4HA 4UT7H 3DMMA 3IDUA 1I7TA 4F57H 5IV2B 1S9YB 1WC7B 1V3MA 5DMJB 4LARH 2XQBL 3ULUC 5CIPA 1ZLUK 3NIGE 4PJXE 2IQ9L 3RWGB 3CLEH 4J4PC 3QEQB 3SO3C 1FVDA 3DVNA 4OZFB 1U41A 1I8MA 2YKLL 2YPLA 3FOLB 1DLHB 2DLFH 2NY2D 4GXVH 4N0CD 3KJ6L 2FBJH 4HUVA 2AGJL 5F6HJ 1VGEH 1BZ9B 4FQIL 2R2EA 4U1NB 4M1CC 3TIEA 5D4QA 2IADA 4LGPB 1R5IB 2ESVA 4MAYD 3VG0H 3BH8B 3BJLA 3MLUH 5EO1B 1MELA 4S1RH 4TSBH 1URLA 4Z76B 1U3HC 1NDMA 4DKFH 2ZKHL 1I7ZB 5HYJA 1FV1B 4PJHE 5DRZB 1U3YA 4NN6B 2DF3A 1FFNA 1QQDB 3EYOA 1KTDA 1B3JA 1ZANL 3X3FH 5I8OH 1FIGH 4Z5RA 1ZT7A 4B0MM 1DBAL 1WFUA 4GLRI 4PJBF 1MI5B 4IDJL 4PRHD 4S1DD 4RWHA 1QRKA 1N26A 1P4LA 4DN4H 4JZJB 4O02H 2R0KH 5IOPA 4E42B 3BKML 1S7WB 5C9KA 2I9LB 5CSZA 4B7IA 4ZO6A 5I30L 1AY1L 1LE9B 3QEUB 5CGYD 3VA2C 4ZFOB 1C5DB 3PGCA 1BQHA 5E8DH 2O5YL 5E4IA 5IBLC 3U7AA 3C5ZC 4JVWA 4WUUD 3RX5A 2BSSA 3D0LA 1V7NH 3MBXL 3MJGX 4EOWL 5BV7H 1I9JH 3IFNH 5INDB 1GGIL 2GK2A 3ULUL 3MUHL 2IG2H 3T8XA 2QQLL 1TJHH 3SQBA 3QI9C 2NLJB 4XC3L 3SGJC 3T4AB 2IFGA 5GGUB 4G3YH 1SM3L 5KSAD 4L4VD 4HK0A 5E0QA 2O5XH 2VDLH 1KJ2A 1GC1H 2LVEA 2Q3ZA 2Y36L 5DEFA 4JFZL 2NR6D 4PLJC 1ZLVK 2VXTH 2MWCA 3DSFL 4Y19B 3LOWA 4PJIE 5JNYB 2Y5EA 4HXAL 1MWAL 4RBPK 1L4IA 1NBVH 3AU1B 3QP3A 5E2VH 1V05A 3QXVA 4HEME 3DOSA 5E8NA 5MENB 1WFOA 4OZGF 1VADA 5HHQB 3D2UA 2VDQL 2EDBA 1DN0B 1YY8A 3HPLB 3RX8A 2CDGA 1T4KB 4ETYA 3MRIA 5DA0B 2ITCA 2P5EA 3DECA 5I6XC 3P9LB 4X4YA 1T7XA 2IBBA 4L4TB 4Q9BA 5CBAA 2EKSB 2BSRA 1OHQA 3NIDE 4E5XB 4TRPL 2PNDA 4FS0A 3WFEH 5IJKC 5FGSA 1J1PH 5TH2B 3BISA 5D72L 1BZ7B 4BZ2L 4WVRA 1NSNH 4BK5A 4Z7WF 2EYTA 2X4QB 3MMEB 4X6DB 3S37H 4WFGE 2B4CC 2H3NB 2QL1A 2VXSH 1DEDA 1EEZA 4TULH 3MLTA 5J7CC 5F7FA 2Q7YB 3NTCH 5GZOC 5MI0C 2HYMA 2BVUA 5CUSH 5F3BB 5I1HL 4Y1AE 4QGYA 5I8CA 1FGNH 4XAWH 1TJIH 3MQIA 1ZLVH 3BZ4A 4HLJA 3V52H 3LKQA 2LAAA 2UYLA 1SEBB 1EA9C 1MRCH 4FZ8H 2XFXA 3HE7A 4Y4FD 1JPSH 2ARJA 3FFDA 1HWHB 1NBZA 1P7KA 3T0EA 4KI5D 2A1WL 1BZQK 1L0QA 2QADD 1XGUA 2ZPKL 1MFCH 3D3VD 1J0ZA 4NKOB 5E56A 5I1KH 5KVFL 4U1KA 2VAAA 4KZDH 5I8EB 4FTVD 4OM1H 3AM8A 4GRWB 4P2QB 3MRMB 4JFDB 3NVQA 1TTFA 4UBDC 5CINH 1WZLA 5D5MA 2VKWA 1SMAA 5E6ZA 1IL1B 1JHKH 4IEFB 3HKFA 2W0PA 2AEQH 1OTUD 2FGWH 2MHAB 4WFEE 4OZHE 5B3NA 5F7EL 4BK4A 3MLRL 4L29A 3NAAH 1CU4L 3F7VA 3HUJA 3F6IA 4N8VA 2BNQE 1YN6B 4KROB 1FBIL 2HT3D 5EZLA 4X99A 2FEDD 3N1FC 1UB6A 1ZWIB 1JPTH 5KVEH 2IF7A 1S8DB 4X80L 5DUPH 5E9DB 2EYRB 1NUDA 4XPFL 3QEGL 5DD3H 3TT3H 5IHUL 2YD7A 1NC2A 2LTQB 2R0WH 3UPAA 4JQIL 3TIDB 3QFJE 1JWUB 3VXUB 3U2SA 4YPGA 5IK3A 5DRNB 5D7LB 5IQ7H 4OLYH 5F93C 5DFWH 4F7PA 1FFPB 1AXTH 4APQC 4PGCB 1G7IA 4I4WB 3HB3C 3PQYE 1LEKB 5CEZH 4X4ME 2AV7A 4J3UA 2ARWA 3O6KL 1JYWA 1NFKA 1BD2E 1CLOL 3IDIA 5DK3A 1N5YL 2AJ3B 5DEGA 3ROLA 3UBXI 5GGTL 2DQUH 4P2CG 5F21B 4MJ6A 1FJ1B 4L5FH 1CXKA 3ULUE 4LSSH 2CGRH 5T3XH 5C0RL 3WDJA 4HBCH 2VKXA 2X4OA 1X4YA 4HUUB 1L7TH 5SWSA 4MS8D 3CXHK 4PUBL 4YFDB 5I76A 4OGXL 3RJQB 3OXRB 1V5JA 5EU6E 5I75C 5GPRA 1BIHA 1T1XA 2IPUK 3MGOB 4G6FD 3QO0A 1EPFA 2NY0D 4K94C 3WXVL 3QUXD 3BPNC 1UB5A 4XTRD 1AXSB 5KG9A 3DV6B 1ORQA 3D87B 2VISA 2IAMB 3GO1L 4L3EE 4X7TB 3O2WH 3T0AA 1X6NA 4DGIH 2GT9B 3GHBL 1JJUA 4RGND 1DE4B 1R3JA 1NGWA 3GSNB 5L8JB 3ULVH 1MREL 4XMLH 2FNBA 3LHPL 4NFCA 1L9NA 4CU7A 1XF5A 5C0AA 2XACC 4I3RH 4ELMB 1J10A 1TPXC 3DPBA 3V95A 1N6VA 4M6NL 3OJDB 1NCAH 5ESVA 1KIPB 3SDCA 3JV0A 4CN1A 4M7KH 2UY6A 4F9LA 2UWEB 1CFVH 4JRYD 3RL2A 1OB1A 3QDHA 4YR6A 1FNEB 1JZ5A 3CXHJ 1P5VA 3OKKA 5E5RB 1H3VA 2R0LL 5TE4H 4KUZH 3K2UL 2BCKA 3GI8L 3MJ8A 1EAPB 2FYYB 4PJEE 2IANA 3L7FB 4KKAC 4LKXA 4XNXH 2UZYB 1UM6L 1EK3A 3MRFA 5FO7B 3JTTA 1F3RB 5D1ZC 1SJEB 4JY4B 1K4CB 5BRZE 1MCDA 3NPSC 3IT8D 3STZB 1NLBL 1ZHLA 4Y4KD 3DURA 3WMSA 1RZJH 4GLRH 5LVEA 1CFSB 3NCYS 4MVBD 3WIFB 3PNWB 2ID5A 2NY3D 3OKDB 3N1PC 3PP4H 5J1AB 5K93A 4ZS6D 5J9PB 4XNYH 3PJSB 3T08A 3GJFB 4MMXC 4IIQA 1P7QA 1T04B 4WU7B 3AAZB 3ARFD 3ARTA 1XF2B 5HTSA 1MCFA 3KPPA 1HKLH 4KK9C 2R29H 1JZ7A 3SO5A 4HIEA 4IOFC 4IRSD 1ZXQA 1FSKB 4I0PB 5DXWA 4ZXBC 3EYQD 4MYWB 4OSUH 1BIIA 4IMKC 5D7JD 4CNIB 2UZIL 5DSCB 2J1KA 1P53A 2YBRB 4XP1H 3L5HA 1DBBH 3VWKD 3C6LB 3P9WB 3ZL4L 3CVHB 3LS5H 1T1YB 1QNZH 3WDIA 3MR9B 1ZK9A 5L6YL 3E2HB 1CGSH 5D2NC 4W68A 1A7PL 2G5BB 1OT1A 4GKOA 2WW8A 1NC4D 3S36X 2CR6A 5GRVK 4WU5B 1OTTC 3OAUH 3GBML 1JN6B 1JNNH 2FB4H 4G80B 5EIVA 4NJ9L 1RZFL 2BMKA 3BWAB 4NWUL 4GAJH 4OFIA 2Z8SA 4C83B 3NFSL 4TSAH 3BPLC 2IFFL 3JBG7 4HDIA 4UINL 1TJGL 4JFOB 1LO0L 1T1ZB 1QKZH 2OTPA 3P3YA 3PHSA 1VGKB 4LSVL 3MX0A 1CDCA 2I27N 5HY9B 4FQLH 3UTTD 3KR3H 4LVHC 4PJAE 3BP7B 4GFTB 4HGWB 5ITBH 4JVUA 5IJVA 1OL0A 2VLKE 3EO0A 4HJJH 4KKLD 4UDTA 1WBXB 4YDVA 5C0CE 3HMXL 3DTXB 4Y4HC 5ICZB 4Z7UE 2AJVL 5GSRA 4JPKH 3S3SA 1IEBB 2DQGL 2VTFA 3FB5B 2CKBA 3O9WD 4U1LA 5D2LB 1DUZA 1JV5A 1RZ7L 2V9QA 1T0MA 4ZTPL 2VR4A 3C87A 2DM2A 2OTWB 4HUWB 4HPYL 2FLRT 1HHKB 2DI9A 4UV4L 2PYEA 3MNWB 3ZO0A 1KCRL 3JWDC 1R0AL 3PWVA 5ID0B 2ENSA 4BJLA 4WEBL 3ZYJA 1N7ML 1UWGL 3FKUS 2CDFB 5DD6B 4JKPH 4WIQA 4XNQB 4LCWB 3RKDC 3O45A 2OMNA 5EU4B 4GSDH 4XCCL 3DBXB 1QLEH 1ES0B 4P4RB 2GYSA 5FA3A 5K9QI 3DGGB 2BVPB 2DB8A 1T22A 3UJTH 1WZ1H 2ERJB 3W11D 25C8L 4PG9B 3GSXB 3QSKB 1MCWM 3HRZA 4AJ0A 1MCKA 3OF6A 5I17A 3RWHA 5I18L 1G6RL 1O7SA 1X7QA 2HWZL 3D9AL 5ADPL 3PHQA 4U1IA 4L8SB 1N8ZB 5C2BH 1D5IL 5HPMB 5GS1B 1T5XB 5K59F 5FK9B 3GI9L 4RMQA 2E7LA 2DLIA 1EHNA 3GIZL 4P4KD 3SKNA 2Z35A 2BY0A 4OM0L 4YO0A 3LD8B 1M4KA 2ZUTA 4HWBA 4H20H 1E4WH 2MKLC 3AVEA 4ODUA 5FOJA 3BD5A 5MHSD 1EHLL 2BNRA 4HLZH 5H94A 4JHWH 5ALBL 2VXUH 3TA3B 5HHMD 5FUZL 1T21A 5T5NF 3VXPA 1A7BA 4ODTH 3DJ9A 4JZOA 4LMQI 5JHLH 5FHBL 5FHAL 2P46B 3G6AA 4JRXD 4OCXL 4MNGE 5C07B 3L5XL 2EIEA 4LLUA 2LFGA 4XNZB 2YPVH 5DDHA 3N1QC 1S7UA 2WINA 3DMMC 5FO8B 3QXAA 4XCNB 3SE4A 4U3CA 3MRLA 1QSFA 3M1BB 3MOBL 1IGYB 4KK5D 1J1XH 3T4YA 2HG5B 3JWDL 3HLAB 3GMQB 1F4AA 2BVQA 2CLZA 5CSGA 3GEWB 4PJCF 1IAKA 1OSZA 3OB8A 3MSPA 4QXUL 3P4LA 4PTUB 3BPCA 4P23A 3E8UL 1JBJA 2XZQL 2YC1B 3MV9D 3MYJB 3WO3B 2NTFA 3O6LH 4OF0A 4KHXH 5ENWA 3MLVL 2PW1B 1EO5A 5HDQL 2EH7H 3EOAB 4KAQL 1IKNA 4ZUVA 1ZHKA 3FQNA 3RDTA 1KENL 4G7VL 5CJOL 2P5WA 4OLZH 4R8WL 4U1HA 2CK2A 4XCFH 4K9EC 4LAJH 4D0DA 3MBEB 3IETA 4K3DL 5E5UB 4YQXL 2YOCA 1FL3A 5FF6A 1BQHG 2K7PA 3BW9A 4QXTA 1AO7E 2H26A 4LSQL 3WV0A 5LGJB 1FDLL 5IQ9B 2A74A 3KAAA 2AK1H 3O4LD 4XAKD 1MRFH 4WCYL 5H8DA 1UVQA 4AL8H 1X5ZA 5JOFB 2VZSA 3SOBL 3TO4D 3QULB 2DBLL 1QLFA 5E6IA 1PVHA 3PL6B 4MA3B 4FZEH 4X8JB 1DQQA 1HH9B 2KH2B 2FR4A 4PRIB 1YMHB 2F54E 3NIFF 5J0BA 4CMMB 1Q9WA 3SBWA 1JK8A 1G9NH 4HZAA 2X4SA 3MROB 1MIML 3NZ8B 3VD5A 3EUUA 5DHXB 4A6YH 1EO7A 1NLDL 1PFCA 4KV5F 3CSPA 4K2UL 1EEQA 3CFJB 5C08B 3VFWA 1UH2A 3QUYA 1FYTD 3C08L 2QKIB 4XVTL 3BVNA 3FAXA 4NGHL 1CFNB 2DKUA 3UJJH 2HMIC 1CTOA 4DKDC 5DQ9B 3QNYA 4P2RD 1UJ3A 4PJ8A 2R0ZH 3LS4H 3QPQC 4PPTA 3BAEL 5DD1H 5KS9B 4X5WA 1JHTA 3HC3L 1BFVH 3HNSL 1QSEA 1GYAA 1U3JA 3I3BA 5JMOC 4QOKB 1PQZB 1QPPA 1U3HD 4JHAH 3AS1A 4FQJL 3WLBA 5EC1A 1YPZA 5CJ8A 1DQJA 3BGMA 5F7DA 4QRPD 3FZUD 3QUZA 1RZ8A 3F7YA 4YHPB 1GPOL 2A6JB 5IB5B 2AKRB 4LCUA 1CL7L 3P2TA 1EEYA 3P73A 1J0KA 1N2RA 1U8PB 2YUVA 4QRTB 3RNKB 3MA7B 2V2WA 5D7IB 2YD1A 4QEGA 1F6LL 3TZVB 2VO5A 5EUKB 4UOW1 4KTDH 2NY6B 4KH2A 1BEYH 3ZZ1A 5IBTH 1K6QH 1M7XA 2MMXA 5D7KE 1K8DA 1MCPL 5KAQF 3C6SB 5DWUL 4K9EL 4KQ3L 3BKYL 5C9JA 5HVFB 2OJEB 4XPHH 5CJXA 2VSCA 3CZJA 4J8RA 4CVXA 5F97E 2WMPA 1NMCB 2R4SL 2DD8H 4AG4L 4HGKC 5EBWB 4UTAL 4YGAB 1J1OH 1CBVL 1SEQL 3T65B 1DQLL 4EZMA 3ROOB 5JIPA 3P0YL 3RTQB 4OLXL 3FO1B 2G2RA 5DD0H 3ZTNH 5C0DB 4WHDA 5EOCJ 1WV7T 2DQTH 2G75B 1CZ8H 4D94A 2IBGA 2E7CA 5DA4A 3GMOA 1OW0A 2FATL 5DC0A 5GS0C 4JPWH 3DYOA 3HE7C 4LQFH 1WWBX 5C0IA 1YMMB 5CCKH 5HVGB 3U1SH 1WCBA 2YUWA 3CNKA 3T0EC 4P2OD 3SKUD 5F7LB 3ZSSA 1NAKH 4ERSL 1QVOA 4ODSL 5F3HA 2R1XB 4L8BB 3VXSA 4XPBH 2PN5A 4ZTOL 4JFPA 1D9KB 2EICA 4NCC2 5FKPA 5EO9A 2NXYD 3CIQA 3KYNB 2BDNH 1KJ2L 2FZ3A 2A6DB 5E94B 3AM8C 4BKLA 1PGRB 6CGTA 4N8VG 1NFDE 3SCMD 4LVNB 5DS8A 5TDPB 3BZEB 3HG1D 1JGEB 2QSQA 2F53E 3KPSA 2KL6A 1NGPH 1ETZA 5E7FA 3QIUB 5F72S 5I73B 1W0VA 1QFUL 1C5CH 3QUML 2FD6H 4WW2B 3SE9H 1FL5B 5CP7A 2XI9A 1HXYB 2NX5B 2VC2H 2YZ8A 2XTJC 5HI3D 1S7XB 4M7JH 5ICXA 3V6FB 2VN4A 1IGFH 3VD9A 3LEYL 5J4MA 3K8MA 1Q0XL 8FABA 1H3GA 5CHNB 4TOYH 1B4JH 2HTKD 5ID1A 1CXEA 3VGBA 5GGSY 1P5UA 1NDGB 5DVMA 1S78C 4L4VE 2W0FA 1NBYA 5MP6H 2JLLA 1LP9F 4H88L 1C1EL 3BP6B 4PV8A 3QJHA 3IVKA 1GL4B 1UXWA 2Q6WA 2PYFA 5HGDA 2UWEF 2YPKA 3HTLX 1B0RA 1SHMA 3KJ4C 3NCMA 5HHVH 1G9MH 5KSBE 4OUOA 5GGQL 2I60H 3VXTB 5GS0L 4QCIB 1I1FA 4YXHH 4DEPB 1Q9KA 1RJLB 2A0LC 3AREA 3Q6FA 1YEEH 5MERB 4PGBA 2DQEH 2GQHA 1MFDL 4WHTA 5GJTL 4ZFZB 3VH8B 4MSWA 2ZWLT 4MD4B 3WFDH 2LQRA 1OAXL 4X0KB 5CZVH 1XF4A 4IRJB 1GIGH 1TMCB 3VXME 2H1PL 2HVKB 3QQ9C 2ZNXA 2VZ3A 2YXMA 5A40E 3H7BA 3M17A 1JNHB 4HKJB 3S7GA 4NP4L 5IT2H 1NEZA 1U58A 2FJHA 2IALA 4NQXA 1ZLWK 2A2QT 5T3ZH 2YWYA 4WNQA 5H37G 3W0WA 2OK0H 4FMKA 1KB5L 5J1TC 4MCZB 3VXNA 1IGTA 4BZ1L 3UJIH 5FYKH 1YDPB 4GKSB 3D85D 4LFHD 5J6GB 3UZQA 5SWZD 3V4PH 2P47B 5FUOH 1S5HA 1GZQA 4KKNA 1ZT4A 1JF5A 2J8HA 2NW3B 1JF6A 4LEOA 2YR3A 3KPQA 2VB5A 5I1LA 5FEBA 3BIKA 3CZFA 1JPFA 4OCWH 2AJZB 3TH2T 3C9NB 4Z6AT 4YHZL 1U93A 4JFYB 3EYFB 2ESVE 3ULSB 3F12B 1VACA 3TJHD 2O26U 4DCQA 2R56L 3GSQB 1F5WA 2NZ9D 4XHJC 3QDJB 1MSPA 3SJVB 2OP4H 5FIEA 5HYJE 4QRRA 3ZKQD 3LN4A 1FO0A 3TYGL 1PEZA 1YA5A 4AZ8A 5ADOH 3GMLB 1TCRB 3RGVD 2GHWB 1QR4A 3SDCC 4F9LC 2E8ZA 4YDJB 3SY0A 3LCYA 1F2QA 5ESAB 4HS6B 3C60D 4M61B 1MRDL 3BX7C 4NQED 3HC4L 1KEMH 5FUCC 1IGIH 1S9WB 3RVVC 3HZMA 4HAGA 2XZZA 2HRLA 3UTSB 3QUKB 1HQ4B 4U6HB 2ADGB 3Q0HA 1R5IA 2NY1C 4GKZB 1YNKL 2XKNA 3BH8A 4YDKL 3Q6GL 5EO1A 1LE5B 1J5OH 3RIAF 3BHBA 5FOBB 3KPRB 2J12B 5TE6L 5EZOH 5DRZA 3VFSA 1X5YA 4LHUD 3WEXB 3RWFB 4Z7VF 3X11A 4I0KA 3WN5B 3RWCA 2F74A 1KYOK 2X1WL 1MCEA 5EBMB 1J8HB 4W4OA 4GAFB 4PJXB 4IIQC 2JK5B 3MACH 4GH7B 5IB1A 1I9RL 3H9SB 1S7WA 1T0NB 2I9LA 4RMTA 4EKXA 4ZFGL 4GG6F 4GQ9L 1LE9A 1IBGH 2X4RB 3QEUA 3DXAA 4Y5XA 1INQA 3RRQA 2H2PD 3RVXD 4B5EA 2WBJA 3L5JA 3TN0D 5DMKB 2D2OA 5INCB 3GMMB 5J11B 3OKLB 2DWDA 2W59A 4O51B 2DYPA 1INDL 3FT2B 3QWRD 3GK8H 4JM2B 5I1CH 2DDQL 3T4AA 4PJHB 5GGUA 4ZAKA 3QG7L 4MJIA 2F8VA 3FB8B 5L8KB 1I1RA 1KEGL 2CDEA 2B0SL 3MNZB 4XPTH 1MEXL 3QHFL 5I15H 4O9HH 1HZHL 1LEIA 1INEL 1N0XL 2PR4H 4MB5A 3B43A 3K46A 3OV6A 4NPYB 1DBJH 3WXWH 1BBJA 5EC2B 2ENYA 4JPIB 3LQAH 2EDYA 2W07A 4G6AD 5MENA 3VMOA 5JR1L 3MGTA 4A2LA 2J8UF 1D5MA 4KJWC 3DROA 1DANT 2GK0A 4U6XB 3VGAB 1S7TB 1DTUA 3T0EE 3P9LA 2VZVA 1TQBB 4NO0A 4BM7A 1UEMA 3NACH 2OQJA 1J05B 3DNKA 5FFLA 4E5XA 1A9EA 4HKBB 43CAA 1I1AD 5DJ6A 2P8PB 2VZTA 5JORA 1BZ7A 5DJDA 2X4QA 3MMEA 4GMTH 2H3NA 1FNLA 4HX1B 4JM4L 1JL8A 1CF8L 3R8BB 3IXTA 3LEVL 4UV7H 4FFZL 1OAZH 5JXAH 3R4DA 2J6EH 5EWIH 5D5ME 2A9NL 4MGXA 4WHCA 1E6OH 1K8IA 3MRRA 5DRXB 3U7WH 4Z7OE 4GKNA 4PJIB 1SEBA 3PWLB 4FNLL 2XTJE 4G7YL 2IQAA 3OKMB 2CLVB 4HMDA 3L9RA 4NQCD 1IC5L 5DRWB 3S36L 4F7EA 4ORZC 3HUJE 2R1WB 1AQKH 4PBWD 2VZOA 1OT2A 3BKJL 1HNGA 1GAFH 1NCCH 4MD0B 3TV3H 2WQ8A 1HQRA 1F4XH 3KPLB 4NQDD 2Y7QA 4YFEA 2KDGA 3RAJL 5KJRL 3DX9B 5I8EA 2CIIA 1BOGA 1BHGA 1JYNA 4LKCB 4DQOL 1I3VA 2QBWA 1ND0B 3MRMA 4JFDA 2EH8L 2WUBL 2AEPH 1Z5LA 5EB9A 4M8QA 1H0DA 3RVWC 3T0VA 4Y1AB 3QWOB 3G6JA 4QT5B 4EBQL 2MHAA 5GZNC 4OLVL 2E7LC 4ZO9A 1F6FB 4BSVB 5I9QC 3N50A 1YN6A 2JCCF 3OPZL 3W39B 3CD4A 1N5AB 1CE1H 4GW5A 1ZLSL 5ISZD 5K9JH 5BVPL 4NO5A 3KWWA 4AEIL 5DJCB 2VDPH 5AZEH 1GGCL 1LO2H 4EN3B 4ZMAT 2BOCB 2RCSH 2R69H 3SHSA 4OLUL 5HI4C 4IRZH 1JWUA 3QCTL 5D7LA 3QPXH 3QIWB 2RAMA 3SE4C 1R3LB 5LGHL 1R3HB 4PGZA 3GBNL 2OZ4H 1PEWA 3EDJA 3GJFK 4H8WH 1IKFL 1RULH 4HFUH 2OJZH 2VH5L 3BFOA 1L9MA 4OZHB 2AJ3A 5HDLA 2B5IC 3UTTE 2BNQB 3HR6A 2ZZUT 4P23C 4FXKB 5DVNA 1A7QH 4H1LB 3ET9F 3T77A 5C0AE 3O81A 3V7AE 5IFHH 4Y88A 1GSMA 1IKNC 3RZCD 4HUUA 3RDTC 1Z9MA 3MRQB 5SWQA 2CMRH 1AGBB 2KBGA 3R8QA 3OXRA 3CFIC 1C12B 2EEAA 5E8PB 1QRND 1HI6B 3F7QA 2WZPD 2APTA 1OM3L 4NM8L 4Z8FH 4I3SL 3GJFH 4HWBL 5FUCE 3SDXB 3PQYB 2IPTL 3HS0B 1CGYA 1BECA 3DX8A 1P84K 3QNZB 5KVDH 5E6IC 5T1LA 3S3JA 3C8KB 3VRLF 1LDSA 3BEVB 2IANE 4XNUL 1BD2B 2Q86A 2BFVL 3TBWB 4MCYB 3SBWC 4L1DA 4RWYL 3GSNA 3OR7B 2L0DA 4XCYB 1I8IB 5D9SA 5DJ8B 3WNMA 4UUJA 4ELMA 3KLDA 3QUYC 4PLNC 2MKWA 1KGCD 2WP3T 2Y25A 5DK2B 1OOAA 3GMRB 3TM6A 3OJDA 3RIAK 1A4JA 3PGFL 1PX4A 4EUPB 4F15C 2Q20A 3O0RL 3KLSA 4OD1H 3T0BA 1UJ3C 1XR8A 4PJ8C 3T2NH 4F37K 1UCBH 3RI5F 5EU6B 2LV4A 4K7PH 5L7XH 4R4NC 4ZUUB 3QUZC 3WHXB 3VRJB 2IPKA 3MOAL 4I48B 2HLAB 3REVB 1T03L 2VABB 3EYVB 3HE6A 3U46A 4F7TA 2X4NA 3V2AR 3RWDA 4X6FA 3L7FA 3H6JA 5AG9A 4KI5F 3CMOH 1MWAB 3IGAB 4G9FB 5HVHC 4L3EB 4W4NA 4WI7A 4HBQA 5CWSB 2X05A 2R8SH 4WW2F 3JTSA 2NMSA 2VLRA 2W0KA 1IC7H 3WL9A 3IDNB 1CFSA 5TQ0L 4QTIL 3PNWA 4D9LH 2HJFA 4XP4L 5J1AA 3QDAA 4X7CC 5CJXC 1ORSA 3WLWD 4CW1A 4XWOC 4XNMB 4WU7A 2AK4D 4OFYA 4MA8L 3ILQD 1RIVH 3CC5B 1UM5L 3DV4B 3TVMD 2XA8L 2HFFA 5C86A 2DWEB 2I9TB 2AI0L 2P24B 3TWCH 2B1AL 5LAXA 3FT4A 3QDGA 4GMSH 3W9DA 3BSZL 1IAII 1XFPA 4ZQKA 5D1QD 1A6ZA 1GHFL 1LNUA 3B8YA 3FQUB 4WWKD 2YBRA 2OR9L 1DBML 4PJEB 1JTTA 3C5ZB 2EEBA 1XGYH 5E2UH 4RMUA 5E1HB 5EO0B 3WSQH 4DOHE 3KPOB 1U8IA 2VUOA 1OW0C 3IS0X 1MF2H 4IMLA 5H35B 1A02N 4NIKB 3V0WH 1LDPH 2XNAA 3B3IB 5BRZB 2E6QA 2K7QA 3B6SA 4P5MB 2DQFB 3MV8D 1BQLH 2NW2A 4C56A 4EEEA 3O3AA 5LCVL 3NMEA 4C55A 4WU5A 4KK6C 5EZIL 5KTEH 3W5NA 3OXSA 1DUYA 3BWAA 5JOEA 4LVOC 2GAZA 4H25A 4KXZI 3EZJB 3QRGL 5IP4A 1HXMB 4P57B 4C83A 2EDKA 2YSSB 3ZDXE 2BY2A 2H2SD 5C0NC 4JFOA 1CLZL 3R06A 2FJGA 3V0AC 1S5IH 3OKOB 4Y16D 1U8KB 5HY9A 1UZ8B 3FFCA 5JUEH 1NKRA 4AH2B 3MV01 4LCYB 2V2XA 1QR1B 5CP3A 2DJ4A 5CKGA 1FL6A 3BP7A 3G5VA 4JG1L 1FYTE 3U82B 5DQJB 2V7HB 2W9DL 5E99L 4JO4H 4BELD 1DP0A 2AVGA 3PIQA 2QQQA 4P2RE 5T1DH 1SY6L 3FB5A 4ISVA 4F3FB 3GKWH 1MLBA 3U48A 2V2TB 1BM3L 1OAUL 4NZRH 3RA7H 3LZFH 5MI0B 3BPOC 4HUWA 1HHGB 2G9HB 3ILPB 1HHKA 2Q8BL 1QYGH 4QRPE 5H2BA 3WCYA 3SQOL 3TCXA 1N64H 3GDBA 3MJ7B 4PP2B 1AP2B 4R90H 3EJZD 4KUCF 4LSUH 1W0WB 2QEJA 1YECH 2C3XA 4PJDF 3SDAD 1JPGA 5TGBB 3VG9B 2E8YA 4XNQA 2BNRE 4S2SB 4N5ED 5EU4A 1NEZG 5C0GA 5HHOD 4LHQB 3AREC 5J3HD 3IU4H 4YWGH 2AJXH 5KBNC 1NCBH 4UT9H 1GGBL 1YYML 3DVIA 4PJAB 3KPMB 1NGYA 4Q9RL 3JWNC 4PG9A 1AGCB 1F11B 1MLCB 2FX7L 2VLKB 3MUGB 4LSRL 4LVEA 3NABH 1A1OA 5C0CB 4KRLB 5IVOA 2GTZB 2OXGA 4Z7UB 5E2TL 1WIUA 5J8OA 1FFOB 4WI9A 1QSFE 3B2UC 4EQ2A 1WQVT 5HPMA 5MEQB 2NXZB 3WNKA 1JF1B 1XGTA 1OF2B 2J5LC 3IJYB 4LDEB 7FABH 4PTTB 4FQXA 1X5HA 5IROA 5C09D 1G7LB 2NNAA 2BVEA 3NIGF 1C08B 1E4XH 1JNLH 4XMKL 1K3IA 3LVEA 1E4KA 1JWMB 3KLAA 4L1HA 3SE8H 2PETA 3FQWB 2X4UB 3I6KB 3K8LA 1ODAA 4LNRB 3NCJH 5TQ2L 5HHPB 4G8GD 1UGNA 4XPAH 1A3RH 5IKCA 1FLTX 2P44B 4OB5H 3C5SA 5IF0B 1CDHA 3GSUA 2P5WE 5EOCL 5HYSA 3BGFC 1MCJA 3RQ3A 4OCLC 2WP3O 5EDXA 4YHOH 1RJYB 4R26H 3HLAA 4TNVK 5FYLH 1RHFA 1JHLL 3DRQB 2HTLD 3D39D 4Z0BH 3DX6B 1MCOH 3VXQB 2VR9A 3HG1E 1TFHA 1R5VB 4KPHH 3TBSA 4NDMA 5DJYB 1G6VK 1QFOA 5HI5C 3E6FA 3H3PH 1TCMA 3ES6A 4R7NA 5DJZB 3CFCH 5DK0B 2F58H 4Z0XA 5FV1L 2ZP0T 3MYJA 1KJMA 2AQ1A 1A6VH 3BESR 5IESL 5F88B 1A2YA 4YHYC 3THMH 5DJAA 4MNGB 5CMAA 4WFHD 4ZOBA 4M1DH 4R2GC 4G6JL 4FFVC 1HWGB 4ZUSB 4NN6C 1CDJA 5I75B 3HZVA 3PDDA 2WIIA 4WO4B 1B6UA 1LO4L 4XMPH 5IQ9A 3EGSA 1NMBH 1YPZE 1CDUA 4MD5A 3MTRA 3V9FA 4W4OC 3DVFA 5M94B 1OCWH 1WBZA 4JVPA 4OQTH 4AIOA 5GISL 3PL6A 3PWPA 3VGDA 5FDWA 2GTWB 2XZCL 3OZ9H 3MXWL 4U6TA 3VI4E 4FABH 3VMPA 1EFXB 5CEZD 1IE5A 4N68A 1QHPA 1WTLA 1P4BH 3MROA 2XZAH 4DUXA 3MV7B 5D1XB 5C08A 1U8OB 4PJIF 3FT3A 4Y5XC 2QKIA 2WBJC 4K8RL 4UT6H 4IJ3B 2OI9C 2PTTB 5DQ9A 3ZE0E