3HPLC

Kcsa e71h-f103a mutant in the closed state
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
b'RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVHTATTVGYGDLYPVTLWGRCVAVVVMVAGITSAGLVTAALATWFVGREQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 36
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hplC00
4H37A 3FB5C 2DWDC 2DYSC 3K03A 3OUSA 1ZWIC 3RBZA 3SPJA 2Q69A 4X88A 4RO2A 4ZBMA 3UM7A 3ABKC 3K0GA 3AG2C 3STZC 2WLLA 5EC1C 2W0FC 2IH1C 4LP8A 2EIMC 4UUJC 3SYAA 3X2QC 3E83A 3SJQC 1G4YB 3T2MA 5IY5C 5EBLC 2ATKC 4PDRA 3LDCA 2X6BA 3BEHA 4PDLA 4CBCA 4MVSA 1OCRC 3K06A 4PA6A 3OGCC 2BOBC 4OXSA 3KG2A 4MS2A 3JYCA 1XL6A 2DYRC 1KKDA 4GX0A 5B3SC 3SYOA 4P9PA 3UKMA 4PA4A 1ORQC 2QTOA 1XL4A 4BW5A 2JK5C 3EFFK 4MTOA 2Q68A 4F4LA 4HYOA 2X6CA 5KUKA 2AHZA 2WLIA 4X8AA 4RUFA 3TETA 4GX1A 4PDMA 4MW3A 4RUEA 5EK0A 4J9YB 3RVYA 2NLJC 4WFHA 3T1CA 1V55C 2AHYA 3T4ZA 2EILC 3F7YC 3ASOC 2A0LA 2WLHA 3SYQA 1OCCC 2YEVA 2H8PC 3E8GA 1M57C 3OR6C 4PA3A 5E1AC 3WG7C 5BZBA 3K04A 4KFMA 1QLEC 3SYCA 4R50A 3FB8C 4RAIA 3LNMB 4MSWC 5EC2C 2KB1A 5CBHA 4MVUA 2ZD9A 4MVZA 4MW8A 1K4CC 4R8CA 4X89A 3TCUA 3SPCA 1P7BA 4P9OA 3GB7C 3K08A 3SYPA 2HVKC 2X6AA 1R3KC 2WLLB 2WLKA 4XDJA 1OCZC 1BL8A 2HJFC 3FB7C 3AG1C 3AG4C 2ZXWC 4PDVA 1M56C 1R3IC 2OCCC 4PA7A 4WFEA 4XDKA 5B1AC 3AG3C 4LCUC 4DXWA 3FB6C 4MVRA 4JTCB 5CBGA 3F7VC 2Y69C 2ITCC 2A79B 4WFFA 4P30A 3IGAC 4LBEC 2A9HA 4XDLA 2Q67A 1LNQA 2EIJC 3LUTB 4HZ3A 4WFGA 3LDEA 3OR7C 1V54C 4R6ZA 4MVMA 2WLMA 3E8HA 4TWKA 5CBFA 3ABLC 3ASNC 3LDDA 2ITDC 4GX2A 4JTAB 1R3JC 4H33A 4MVOA 3K0DA 3ZRSA 3VOUA 3R65A 2HG5C 3E86A 4MVQA 4J9ZB 4MTFA 1J95A 4EKWA 3SPGA 4QE7A 3F5WC 5KUMA 1JVMA 4I9WA 2WLIB 4MTGA 3T4DA 3E8BA 2K1EA 2R9RB 4QNHB 4PA9A 2P7TC 3SPHA 1K4DC 3OUFA 3RVZA 5J9PC 2Q6AA 3RW0A 3PJSK 2HVJC 5EBMC 4G27B 4QE9A 2EIKC 4G28B 1R3LC 5B1BC 1S5HC 4R7CA 2EINC 4P2ZA 3SPIA 3E8FA 1OCOC 3IFXA 4GX5A 2BOCC 3ZJZA 2WLJA 2HFEC 2DWEC 5EBWC 3HPLC 3E89A 3STLC 3ABMC 2QKSA 2WLNA 4JTDB 2IH3C
chains in the Genus database with same CATH superfamily
1NT2B 2Q7EA 2IJHA 4UFZA 2XHBA 3BA9A 2PF4E 1WJZA 1YZBA 5IJ0B 2DYRB 3OT7A 1R73A 4B7KA 2F43G 4K0KO 4IIJA 1OCRC 4FIPC 1SQFA 4UCVA 5H6RA 1YXBA 5KMGB 4DR4O 3EVKA 4FPPA 4JI3O 2F23A 3CRQA 3DTUB 4NXNO 1N32B 1XL4A 1K3EA 3D3IA 2E3CA 1H8HG 4JI1B 4FM1A 2CUGA 3D3QA 4UV8A 2OWOA 3L70H 3CCMV 1YTFB 3CXCU 4J41A 2QJ1A 3JD2A 4GZRB 5J2TA 3RWRD 3HKBA 5LGNA 3ZX6A 3BCCH 3WG7C 1FS0G 2Q8VA 4HNAA 1E79G 3FB8C 5LMUB 1I5XA 2DOSA 2EIKB 3CXHF 2GTAA 1Y67A 3TJTA 4CC5A 1FKAO 2X6AA 4FM2A 4X1KA 1BL8A 4RQEA 3T1YO 5B1AC 4WFBV 4CS4A 1K34A 2BSKB 3DC6A 4A5UB 1B3QA 1Q8IA 3W7TA 4FFBA 1O9GA 4YHHB 1XNQB 2Q9LA 4J11A 2JEUA 3VBBA 3ASNC 1JJ2U 1R3JC 1RSOA 5IY5B 1XREA 5JVDB 4MVQA 3M99B 5CB4B 1GO3F 3APQA 4MTXA 1X4TA 1I94O 2P7TC 2F95B 1K4DC 3RYFB 1AB3A 3PJSK 1N34O 1R3LC 1AILA 1S5HC 4H44B 3DXRA 1VQKV 3IFXA 4O2BB 4JI4B 5DEDA 3FAVA 4QPKA 1VQOV 5JQGA 2UU9B 1HNWB 2IJIA 1I08A 3K03A 1RPRA 3LSSA 1KMIZ 2WLLA 3CCUV 3SDLA 5IWAB 2BTQB 3K9AA 4LFCO 1G6UA 4DR3O 3ZBHA 2OCCB 3JYCA 2VS0A 4PA4A 2PTMA 4LNUA 3A0RA 1Q7YW 5L3FA 3TGUH 2QKCA 5HFLA 1X59A 1TUEB 3L73H 5GONA 4LF9O 4LF5B 2UUAO 1OJHA 2F93B 1V55C 2VQEB 2EILC 1ZAUA 4UCSA 4B3RB 5IYDO 1DK1A 3CD6V 4DUYO 1EN6A 1VQNV 1RSOB 3T1HB 1FFXA 2KB1A 5BR8O 4DR2B 1N33O 3ZHSA 3CSXA 1TVKA 1KYOF 4AILC 5H2FZ 3VQYA 2HJFC 4BIUA 1BS3A 1RPOA 1R3IC 4GCZA 4W4KA 2ZR3A 3UO2A 1QVGU 4NXMB 2QWQB 1HR0O 1D5NA 2DJVA 3A0BZ 4CS3A 3OR7C 4O4LB 3U0ZA 3QTCA 1S0VA 1AI7A 3FAVB 3CCEV 4B3MB 1BT8A 5C8YA 5L3GA 4WF9V 1OV9A 3H1LH 4EFEA 3I56V 1HNXO 4EKWA 3BY6A 1XMQO 2JRIA 3F5WC 5J2UA 1IBMB 4JYCA 1PNLA 3VQWA 4W4LA 2GTSA 3RYCB 3P30A 2HVJC 4QE9A 1SF9A 1Q5OA 5DM6V 2BTOA 2P4KA 3ZRVA 3ZMVA 2YEVB 4YY3O 2IM9A 4DUZO 1PL0A 3ABMC 1UFIA 2XAFA 3MHHC 1S76D 1I5YA 4PV1B 1ZWIC 1W59A 2ETNA 4UV9A 4FMTA 2WA3A 2JJ1G 2RQ6A 4YJ3A 3WU2Z 1QU7A 1BHBA 5KA5A 2AXTZ 3WB0A 4F6EA 5LMNB 3LDCA 2ZE6A 5GTHZ 1SQBH 4HAMA 1GM9A 1KKDA 1JFFA 3PN1A 4JI6O 2UUBB 4CZZA 1SQVH 1WB8A 1OCCB 1PD3A 4FZ0A 4CH3A 2CAZC 1N8RW 3ABLB 2NNUA 4RUEA 1TAEA 4LF7B 3I5DA 1YITV 3LSUA 1M90W 2WLHA 4I5SA 1XILA 2H8PC 2A7WA 5H9CA 4J7JA 1QVFU 2Q7HA 2YIBA 3JAKB 4DR7B 4DV5B 5LA6A 1FXKA 2YXHA 1TA8A 4DK0A 3CCSV 3SYPA 4ZOLB 1H38A 4XDKA 3FB6C 1NH2D 1U96A 4BW9A 3TK1A 4X65B 4J10A 4XDLA 2EBOA 3C3TA 1NS1A 3R66A 1ZSPA 3K57A 1A32A 2V7QG 3CCJV 3AEIA 3E8HA 4I0XB 4TV8B 3H1KH 4JAVA 5L3EA 1BQZA 3CRMA 2V1DA 3WFVA 2ARHA 4GKJB 2WLIB 4YJ3B 1GN6A 4C7UA 3VQVA 4X1YB 3L75H 1VIBA 3HB3B 2EIKC 1NBMG 3JSLA 3SPIA 3K5OA 2OTJV 1WP7A 3O65A 4E4EA 4GX5A 5LYJA 1H2SB 1COWG 3JALB 1WA8A 3N2KA 3I55V 4DV7O 4I50A 2IU3A 2LP7A 4UVAA 1VQ6V 4EB6A 4GT1A 4UUJC 2WAMA 1QLEB 2QM4A 4UVCA 2OYQA 5IY5C 4ABMA 2JVDA 2Q0AA 3KZIZ 1URFA 5KHJA 1IBLO 4RWUA 2Z0AA 2BOBC 2F1MA 2EZPA 2M7WA 3AG3B 4GX0A 2HHHB 2LW7A 4P9PA 4JI7B 2DN9A 4ZHQA 4YXWG 2EIJB 3CRRA 3UO3A 5GTIZ 4I4TA 4DV3O 1V54B 2KG7A 4LFAO 3JASB 4GX1A 2E5LB 1K5SA 4TQFA 2YS8A 3T4ZA 4JI0O 5F2VO 1LUVA 1SKVA 3IJ4A 3CC4V 3QO8A 4DW0A 5JJJB 1XI1A 4JI2B 4RQFA 2CDYA 5B1AB 4R50A 1XNRO 1K4CC 3CS5A 3G6BA 3RYIA 2EINB 3LSQA 2HVKC 2PI5A 2GDSA 2OCCC 1Q90D 4MVRA 3ZCCA 3B2EE 1TGOA 5C93A 1E1QG 2A79B 4E2LA 3EXAA 5LP6A 2RCVA 5DN6G 3CCVV 3QO7A 4KXRA 1IX9A 4CC6A 4MTFA 5D5PA 1AI4A 1J5EO 2YI8A 1R6KA 4JAAA 1XHXA 2JGDA 3JATB 3QNEA 4YJ2B 1MA1A 3ZMZA 3UQ8A 3JARA 4I55A 4WFEA 1SZXA 2JGUA 2Q69A 1EN5A 4ZBMA 5EC1C 2IH1C 2Q7GA 1NVPB 1ZX3A 5EBLC 2ZE7A 4PDRA 2P4VA 4PDLA 2VQFO 1KD1W 4OXSA 4PD4F 4MS2A 2EULA 1FJGB 1RFYA 1XEQA 4Z2WA 2Z3YA 2UXXA 5LHIA 2A3QA 3TETA 1F4MA 4UB6Z 5DECA 2KKWA 2JIZG 2OTLV 4AQYO 4IHJB 3SR2C 1N0NA 1WP8A 3MDSA 1L8DA 4KHPB 3WB1A 4Q6GA 3CMAV 3H1HH 1NTKH 3BRCA 2FTKA 2E75B 3L74H 1WPBA 1M9NA 1W0JG 2ZCEA 2WLKA 3FB7C 2HLDG 1KC8W 2ODMA 2UXNA 1PP9H 4B7EA 1DTOA 2DYSB 2QM8A 1M4UA 1AJQA 3ABLC 5KMGA 3FYIB 2AGAA 3AK3A 2ZM6B 3ZRSA 4X66O 2JDIG 1ZLZA 4B3SB 4L87A 4J42A 3HKDB 3E8BA 2K1EA 4JPRA 4D7TA 4TT3G 2P67A 5B1BC 2YC0A 3CB2A 3NR7A 2XAGA 2F4VB 4O4IB 1WN7A 1YSCA 3APOA 4YIPA 3FB5C 3RBZA 1MNGA 5J9PC 4RO2A 3STZC 3W7WA 4I9QA 3OFNG 1G4YB 2BSKA 3T2MA 3KCYA 4FLWA 3S3WA 5EYPB 1Q82W 4CBCA 4MVSA 1OZ0A 3FD9A 1Z2GA 1SC5B 4DR1O 5JJEB 3VQXA 5JVDA 2UXBO 2B1GA 1QCEA 5CB4A 5KUKA 3N2GB 3BVOA 5KX5B 4WFHA 3RYFA 4JI5O 2O57A 1FXHA 3K9SA 4XBFA 3HKCB 5FL7G 1VF6C 1VQ8V 3M8AA 4O2BA 1QLEC 4TV9B 5FNVB 4LF8O 4EFBA 2QGNA 4X89A 4K0KB 3J80N 4O4JA 3GB7C 1HNZO 1R3KC 1OCOB 3AG3C 4JTCB 5K1PA 3CE2A 5EZYB 1QR8A 2BTQA 4UVBA 1XHZA 2EIJC 1N32O 1V54C 2WLMA 5CBFA 4JTAB 4FM0A 4GX2A 1PNMA 2Q73A 4JI1O 3SJCC 2ZINA 2LJ2A 1J95A 1XDCA 4N21A 2UXDO 4Z1VA 2M6YA 4QNHB 2N74A 1S3JA 4U3JB 5LMUO 5CMUA 2QM7A 2QTSA 1HW7A 2EINC 1QQCA 2ZIOA 3K58A 2BOCC 3CC7V 2WLJA 3E89A 1B04A 4Z1MG 4LBEC 2IBZH 3G80A 5H5NA 1NR1A 1I0HA 1O9HA 1CPYA 3ASOB 1KUQA 1HWYA 4BIOA 3K0GA 1XNQO 2W0FC 4YIOA 1PPJH 1GN4A 3MHSC 4NKGB 1PNKA 3OD4A 4JV5B 4O4LA 3CP1A 1T5EA 1S5LZ 4GKKB 3UKMA 4WBNB 1NH2B 5FLXN 1ORQC 3CRAA 4O4JB 2QWPB 2Q68A 4ZKIA 4JI4O 2R9IA 1UJWB 2QEXV 4ZIBA 4J80A 2WPDG 2AHYA 2UU9O 3RYCA 5KHKA 4OPAA 1L1FA 4OX9B 2YXYA 5LOVB 4DW1A 2YEVA 2ZE8A 4PA3A 5BZBA 1M1KW 2JS5A 5IWAO 4LFCB 2R9AA 2GV9A 4DR3B 3OEHG 4KP4A 2P06A 4MT8A 5CA1B 1VF7A 2GUZB 3DC5A 3G6EV 3ABKB 2LFRA 4X64B 2BCCH 4DR5B 3FYEB 3C3SA 1KECA 3X2QB 1QLNA 4LF5O 2VWJA 1ZL8B 1JOYA 4LFBO 2VQEO 5JH7B 2XUMA 4GYCB 4J9ZB 4B3RO 1Y4MA 2PUSA 4LH7A 4UB8Z 2DMXA 3SPGA 1WNSA 4BAYA 4DUYB 5KUMA 1AP6A 1MG1A 5B3SB 4O4HB 1AROP 1K92A 2ILMA 3T1HO 2OT5A 1N33B 3OM3B 3LNNA 5BY1A 1SQXH 3B40A 1BMFG 2HFEC 3JAKA 1FD9A 2DYSC 2LGWA 3ETDA 3GVMA 3OMNB 4ICGA 2DQ0A 4ZOLA 4QJFB 3ABUA 4B3MO 3HKEB 1Y76B 1GKFA 2AZ2A 5IYCO 2H3OA 2QWNB 1RM1C 2H94A 3EHBB 4DV1O 1LUWA 4LF4O 3G4SV 1IBMO 4I0XA 4TV8A 1Q6UA 1EM1A 2IJJA 4BW5A 5LXTB 4YY3B 4HYOA 1SETA 1H2KA 2WLIA 4X8AA 4IL6Z 5EK0A 4J9YB 2YXLA 1XQ8A 4X1YA 1IXMA 2RN9A 3JD4A 5JCOC 4HBNA 2A0LA 4OGQB 3ZS8C 4D7SA 2HKOA 4PELA 3JALA 1WPXA 4RAIA 1YTFD 5CBHA 2XAHA 4DYLA 5LMNO 1Q6IA 3CYOA 1EN4A 1THZA 1VF6A 3GWOA 4LF6B 2G38A 2CGOA 2QSAA 1QHTA 2N05A 3IGAC 1NU1H 2UUBO 4DV6O 3E35A 4BIZA 3P3NA 2EIMB 2ITDC 3TXQA 4GLXA 4LF7O 4NB5A 5B1BB 2PYLA 1P84F 2LFSA 3T4DA 1R6TA 3JASA 2L35A 3OUFA 4FLXA 1JPXA 3M7MX 4DR7O 2BE3A 4ZI7B 2NR5A 2Y48A 4K8ZA 1OCOC 1H2MA 1KP2A 2YIDA 1W2BU 2OCHA 2QKSA 1ZTEA 3ZRWB 4X65O 2IH3C 3IC7A 3OUSA 1N0JA 2EX3A 4CH4A 3E83A 4U7OA 1VQ9V 2P6JA 3QF7A 1N36B 5CA0B 2AZ0A 4Q20A 3BEHA 4FFKA 1US6A 4CS2A 4JYAB 2DQ3A 4H13B 2W6IG 1KQSU 2XAJA 3W7UA 2ZNJA 3ZN1A 4DV0B 1GRJA 1MMMA 1ZUQA 2F66C 3AG7A 1VQPV 3JATA 4DV7B 4IGGA 5B1NA 3B4SA 3H1JH 1FPOA 3ASOC 1PKXA 4YJ2A 3B8NA 4NTYA 4X62B 3E8GA 1KP3A 3J81N 4X9QA 5EC2C 4MVUA 4R8CA 4B3TO 3TCUA 1K33A 3SPCA 1H2LA 2E76B 1TUBB 5KAFZ 2XNDG 4FLTA 5KHHA 1K7DA 3K79A 1D2DA 1G8MA 2HHHO 1MSWD 4JI7O 1IURA 4P30A 4DR6B 4WFGA 1NZ6A 1S77D 4LFAB 4QIWF 2E5LO 4JI0B 5H6QA 4JAUA 4IYHA 1R6NA 1VARA 4JI2O 1JVMA 1BSMA 3K3WA 1XMOO 3RVZA 2P22C 1MZFA 4TUYB 1Y6XA 1PM9A 2A06H 4IHJA 4G27B 3DSQA 2C2AA 1SS3A 3E8FA 4DK1A 2EJRA 2N04A 4X1IA 3HPLC 1F23A 2PI4A 5LGTA 5HFMA 3UM7A 3ABKC 3X2QC 2CTWA 2E74B 5KHIA 2ATKC 4DO2A 1OHHG 1D5AA 4PA6A 3BHPA 1ENVA 3E2EA 1XL6A 1AJPA 5B3SC 1G1XB 3SYOA 2EJ7A 2LW1A 2XAQA 3JD0A 4F4LA 1XOUA 3HKDA 3Q4HB 4G2KA 5KHGA 4NTXA 3KKYA 4AHCA 5AG2A 3CMEV 3RFRA 5B5EZ 1SRYA 5IE9A 4O4IA 3AK2A 3SYCA 4DV4B 3WB2A 1JA8A 4MW8A 5EIBD 2W6JG 2VQFB 5JCOA 4PJ0Z 2UXCO 5TISZ 3ML0A 2CGNA 2ZXWC 1Y74B 3G71V 3AK1A 5CBGA 2YDEA 1Z5WA 4LWSB 1FJGO 1YJNV 5JJNB 3B09A 1DF5A 5EYPA 3OW2U 4FLVA 1BE3H 4N23A 2VWKA 5LGUA 5BMVB 4X1IB 4DV2O 4FLYA 2ZIMA 3VOUA 3R65A 2RDCA 3ABTA 3E86A 3KCXA 2XTAA 3UCSC 2V4DA 5L3DA 4KHPO 1YI2V 2R9RB 3K5LA 3N2GA 2GHYA 3MD0A 5KX5A 1EZVH 1F51A 4L8JA 3CCQV 3ZMSA 1LR1A 4P2ZA 5LHHA 2QDOA 3HKCA 3JCUZ 4DRXB 5EBWC 2PYJA 2IJKA 4TV9A 3ZN0A 5FNVA 1P49A 3JAWB 1K8AW 2P5OA 2DWDC 2YICA 1PL4A 1RM1B 3CEIA 2EIMC 3O9OA 4K35A 3OE7G 3E22B 5EZYA 4J7KA 1VQMV 2CTRA 4TQDA 4KUMA 3OTOB 3K06A 4BR6A 5JWPA 1BQ0A 3ZMTA 4LR3A 4AI8A 3QVNA 2CH7B 2GSMB 4MTOA 2Z5UA 2YIBD 4PDMA 2F4VO 2QWOB 5IJ9A 4U3JA 2UUCB 3F7YC 3A2FA 4FVMA 4JI8B 4X20B 3RYHB 3H01A 1K73W 1M57C 3FFQA 2XT9A 2R72A 4KFMA 2YIAA 2ZKOA 1EFRG 3CRCA 5D5QA 1IBKB 1MSDA 4P9OA 3BABA 3BFRA 4XDJA 1AI6A 4NTWA 3ZHRA 1V9PA 2A9HA 2Q67A 1LNQA 1QBZA 4CH6A 2B1IA 2HEPA 3AG2B 2D3OW 2GBOA 4WBNA 3RT3C 5IYZB 1S72V 3P32A 4FZ1A 1SA0B 2Y4TA 3ZHUA 4UCUA 4O2AB 4DR4B 4ASUG 4LF8B 4JI3B 5FPRA 4NXNB 1U97A 1GMGA 2HJDA 3B77A 2Q4PA 4JGSA 1HNZB 5LOVA 1NQTA 1MOFA 4K3AA 2XOKG 4UCRA 2ZNIA 2Q5ZA 1NTZH 2DWEC 4I7ZB 1SESA 2LO1A 2X0LA 4EEQA 2WWWA 1Q3EA 1SQQH 3N27A 3CCLV 3SYAA 2PY5A 4NYKA 3OGIB 1IVSA 1JQ0A 5IJ9B 1FXKC 5CA1A 2GUZA 5BXZA 2UXDB 3AG1B 3T1YB 1NVPD 1MABG 5ITZB 3CPWU 4J7ZA 1ZL8A 4NVPA 2JS3A 5JH7A 4B08A 5LHGA 4IYIA 1IDSA 3A0HZ 1YDXA 4YHHO 1GH6A 2ZDIC 3RVYA 4O4HA 2Y0IA 2L6LA 5KAIZ 1VQLV 1I94B 4U3FH 4H0LB 1FAFA 1N34B 1Z5VA 1WAZA 4JV5O 4PDVA 4GKKO 5A2QN 4LCUC 2QA4V 3C90A 2IU0A 3HKEA 4WFFA 1XUQA 2LQTA 1Y76A 2FL4A 1HNWO 4IIJB 3LDEA 1DGSA 2QKAA 1AR1B 1YVWA 3ZHQA 5L3CA 3UT5A 4OX9O 5KA6A 5LXTA 2MK3A 4LH6A 4TSFG 2Q6AA 5EBMC 3DGEA 5J2TB 4LC1A 3BPZA 3HKBB 1NI8A 3MAQA 2P90A 4LF9B 4PHZA 4HNAB 2UUAB 1Q81W 1EBOA 1Q86W 4H37A 1L0LH 4X1KB 3ZMUA 1VEWA 4X64O 3OMAB 4LP8A 4DR5O 1VQ7V 1F7YA 3D36C 3SJQC 4LFBB 1KU9A 4PI2A 5BR8B 1WLEA 4DR2O 2X6BA 3QG5A 1IZ3A 4FFBB 1OCZB 4JZ2A 1YCIA 3KG2A 3P3PA 3GWKC 1HR0B 3ZEDA 4NXMO 4JYBA 3JD3A 4U7NA 3EFFK 5LP6C 3D8CA 4IT5A 1JCHA 4KL1A 3H9VA 4UXNA 4FLZA 5L3BA 2Y0PA 1HNXB 3FX7A 2KQXA 4F6RA 4ZI7A 2ADPA 2FMLA 2RMKB 2LGQA 1XMQB 3DXRB 2FYUH 1H2NA 2EZOA 2ZXWB 5JQGB 3U11A 3LNMB 3ZRWA 4MVZA 3UT5B 3L9DA 4DV1B 2WLLB 3ETEA 4LF4B 2ZR2A 4DUZB 2PZSA 2QR4A 4UCOA 5CA3A 2ITCC 3JCZA 3OTFA 5CA0A 3W7SA 4WFAV 1VP7A 1Q6HA 2KSDA 2HP8A 1KB9F 4LNUB 3K0DA 2DW4A 1FYJA 5GW7A 3CC2V 5GONB 3SPHA 4JI6B 3RW0A 3CJHA 5E79Z 4LF6O 1FXVA 3STLC 1FFXB 4CH5A 4OPHA 1H2GA 2WLNA 2DE0X 1M93A 4DV6B 1TVKB 3AG2C 1JJOA 2X7RB 1SQGA 1TUBA 3J7AU 5IDJA 1P4RA 2FB5A 3IC9A 4DV5O 1I7FA 1P7GA 4F6RB 3NXSA 3ZIAG 3ZHTA 1NR7A 1WB7A 3AG4B 1M56B 1B06A 1YF2A 2DYRC 2OIGA 5C8YB 2Y69B 4GUNA 3L71H 1VMGA 2QTOA 3CX5F 3JAMN 5J2UB 2X6CA 1M57B 3OEEG 3T1CA 4TUYA 1ROPA 3JD1A 2JEXA 4JF3A 1SZTA 4GKJO 1AI5A 2WA4A 2ZDIA 1XBLA 5E1AC 3SGIA 1CEZA 1KBHA 1JMKC 1QNMA 3B8MA 2AW9A 1N36O 2B5UA 3K08A 3ZRXA 1AR4A 3AG1C 3QO5A 4PA7A 1E1RG 2YSUB 2QE7G 4JYAO 4K8XA 3CJHB 2OIEA 4DV0O 3JSNA 1L0NH 4R6ZA 1NJIW 1JFFB 1EZJA 2RNBA 2CE4A 4H33A 3H1IH 2RJZA 2HG5C 3RN4A 5IT9N 2CTPA 1JX9A 1IBLB 1OCRB 3ZHVA 4X62O 1YJWV 4MTGA 3U10A 1GK9A 1BHAA 2XASA 3Q4HA 4B3TB 1GM7A 1AJNA 3BA8A 4R7CA 4DV3B 5FPOA 2B9ZA 1VQ5V 3OMIB 5LL6Y 5LA6B 1FXKB 4QPJA 3SPJA 4DR6O 3CHXA 1AR5A 2ZE5A 4FJCC 1MZEA 2FKXA 2MW2B 5B1OA 3WG7B 2PGGA 5KLVH 1AVMA 1Y74A 4LWSA 4BWAA 2Q0OC 1XNRB 2D2CB 5IYBO 2CTQA 1S5JA 3OGCC 5BMVA 1XMOB 3D36A 1CP9A 3K59A 1UPGA 1PV0A 1GN3A 3THOA 1VQ4V 1YHQV 1KKCA 2AHZA 1SQPH 3ASNB 2K9PA 4MW3A 5CN0A 1HP8A 2NLJC 1HDJA 1VF5B 5A9GA 3ICXA 3SYQA 1J5EB 5LYJB 3F5TA 1H8EG 1WA8B 3OR6C 4DRXA 3N2KB 3K04A 3A8TA 4MSWC 3JAWA 2ZD9A 1GN2A 1NTMH 4I50B 4EB6B 1OCZC 4FLUA 1QR9A 4DXWA 2WSSG 1Y66A 1R1BA 3SJBC 2R70A 3E22A 1BGYH 4MVMA 4TWKA 1GTOA 4QGPA 1DLBA 1BCCH 4JYYA 3K5MA 1W0KG 4MVOA 4ZHQB 1YIJV 4I4TB 2CH7A 2KG7B 3L72H 1GM8A 4QE7A 4I9WA 1SERA 4PA9A 5K1XA 4DV4O 2ZQMA 2YI9A 4G28B 4D6TH 1JR9A 1Q43A 2UXCB 1GAXA 4X20A 2CK3G 3RYHA 3ZJZA 3FKSG 4FK5C 1V55B 4AQYB 2IW5A 1AP5A 1F4NA 3RYIB 2EILB 2HR3A 3W7XA 4X88A 1K97A 4DV2B 1M5IA 1B6QA 5LBQA 3ETGA 3G67A 5LP6B 1RP3B 4JZGA 2JJ2G 1FFTB 4WCEV 3TXSA 5IYZA 2JK5C 5IJ0A 4NR1A 1SA0A 4RUFA 2JGDB 1K5QA 4O2AA 3RGBA 2YUAA 2Y4UA 2ZT9B 2ZM6O 3IAYA 4X66B 1OCCC 4B3SO 4PI0A 3CCRV 4TOIA 3JARB 4UCTA 1CXZB 4I55B 3HR0A 5EIBC 1P7BA 3SJAC 3OTOO 1N4CA 3AG4C 1M56C 3ABMB 3F7VC 2Y69C 1DF4A 3K5NA 2NN4A 3LUTB 4HZ3A 1YEWA 3ETQA 3LDDA 5ITZA 5B66Z 2UUCO 1YJ9V 2VRZA 1K9MW 4JI8O 3CWBH 2QWRB 3BAAA 4JASA 3S3XA 4DR1B 1IBKO 2ADQB 2UXBB 1BZKA 3OAAG 2W0XA 4JI5B 1IXBA 4JTDB 1NKDA
chains in the Genus database with same CATH topology
4H37A 3IC7A 2IJHA 3OUSA 2Q69A 4ZBMA 3ZMUA 5EC1C 3OMAB 4LP8A 2IH1C 1VQ7V 3E83A 4U7OA 3SJQC 1NVPB 2DYRB 1VQ9V 2P6JA 5EBLC 1WLEA 1R73A 4PDRA 2F43G 4Q20A 2X6BA 3BEHA 4PDLA 1OCZB 1OCRC 4FIPC 5H6RA 1KD1W 4OXSA 3KG2A 4MS2A 4FPPA 2DQ3A 3DTUB 2W6IG 1KQSU 2XAJA 3W7UA 4JYBA 3JD3A 1XL4A 2Z3YA 1K3EA 3D3IA 4U7NA 3EFFK 3ZN1A 2UXXA 1H8HG 5LHIA 3TETA 1F4MA 1JCHA 1VQPV 4UXNA 2JIZG 2OTLV 4UV8A 5L3BA 3CCMV 1YTFB 5B1NA 3CXCU 3JD2A 3ASOC 1PKXA 3B8NA 5LGNA 2EZOA 3E8GA 3WG7C 2ZXWB 1KP3A 3CMAV 1FS0G 1E79G 3FB8C 3LNMB 1I5XA 5EC2C 3ZRWA 4MVUA 2EIKB 4MVZA 4R8CA 2FTKA 3TCUA 1K33A 3SPCA 1M9NA 1W0JG 2X6AA 2WLLB 2WLKA 3ETEA 1BL8A 3FB7C 2XNDG 4RQEA 5B1AC 4WFBV 1K7DA 2ZR2A 4WFEA 1K34A 3K79A 1G8MA 1MSWD 2HLDG 1KC8W 5CA3A 2UXNA 2ITCC 4P30A 1DTOA 3JCZA 2DYSB 3W7TA 4WFGA 3W7SA 1S77D 2QM8A 4WFAV 2JEUA 1AJQA 3ABLC 3ASNC 4QIWF 3VBBA 1JJ2U 1R3JC 3FYIB 5IY5B 3K0DA 5H6QA 3ZRSA 4JAUA 2DW4A 4MVQA 3M99B 1R6NA 2JDIG 1GO3F 4L87A 5GW7A 3CC2V 4MTXA 1JVMA 3E8BA 2K1EA 3K3WA 2P7TC 3SPHA 1K4DC 4JPRA 3RVZA 4TT3G 3PJSK 3RW0A 2P67A 4G27B 1R3LC 5B1BC 2C2AA 1S5HC 3E8FA 1VQKV 2EJRA 3IFXA 2XAGA 1FXVA 3HPLC 4QPKA 3STLC 1VQOV 1F23A 1YSCA 1H2GA 2WLNA 2PI4A 5LGTA 2IJIA 3FB5C 3K03A 5HFMA 1RPRA 3RBZA 3LSSA 5J9PC 4RO2A 3UM7A 3ABKC 3STZC 3AG2C 2X7RB 2WLLA 3W7WA 3CCUV 3X2QC 3OFNG 1G4YB 3T2MA 3K9AA 2ATKC 1P4RA 5IDJA 4DO2A 1OHHG 1Q82W 3NXSA 3ZIAG 4CBCA 4MVSA 4PA6A 1NR7A 1OZ0A 3AG4B 1ENVA 1M56B 2OCCB 3E2EA 3JYCA 1XL6A 1AJPA 2DYRC 5B3SC 3SYOA 4PA4A 2Y69B 3A0RA 1Q7YW 5L3FA 2QTOA 2B1GA 5HFLA 1QCEA 2XAQA 1TUEB 3JD0A 4F4LA 5KUKA 2X6CA 1M57B 3OEEG 4G2KA 3T1CA 4WFHA 1V55C 1FXHA 3CMEV 1ROPA 2EILC 4XBFA 3JD1A 2JEXA 5IYDO 1SRYA 5FL7G 1VQ8V 3CD6V 4JF3A 1SZTA 1AI5A 5E1AC 2ZDIA 1VQNV 1QLEC 3SYCA 1CEZA 2KB1A 4X89A 3B8MA 4MW8A 2W6JG 2B5UA 3GB7C 3K08A 3ZRXA 1R3KC 1OCOB 2HJFC 3AG1C 3ML0A 2ZXWC 1RPOA 3QO5A 4BIUA 1R3IC 1E1RG 4PA7A 3G71V 4GCZA 5CBGA 3AG3C 2ZR3A 2YSUB 4JTCB 1YJNV 2QE7G 1QVGU 1QR8A 4UVBA 1DF5A 3OW2U 4N23A 2EIJC 5LGUA 3OR7C 1V54C 4R6ZA 2WLMA 5CBFA 1NJIW 4JTAB 4GX2A 1EZJA 1PNMA 1AI7A 1S0VA 4H33A 3CCEV 5L3GA 4WF9V 3VOUA 3I56V 3R65A 2HG5C 3ABTA 3E86A 1J95A 4EKWA 1JX9A 3BY6A 1OCRB 3F5WC 5L3DA 1YJWV 4MTGA 4N21A 1YI2V 2R9RB 4JYCA 1PNLA 4QNHB 1GK9A 2GHYA 1BHAA 2XASA 3MD0A 1S3JA 1GM7A 1AJNA 3P30A 2HVJC 1F51A 4QE9A 2QM7A 5CMUA 3CCQV 4R7CA 3ZMSA 2EINC 5DM6V 4P2ZA 3ZRVA 3ZMVA 5LHHA 2YEVB 2BOCC 3CC7V 2WLJA 5EBWC 2IJKA 3E89A 1PL0A 3ABMC 2XAFA 3ZN0A 3MHHC 4Z1MG 4LBEC 1VQ5V 1S76D 3OMIB 1K8AW 1FXKB 1NR1A 1I5YA 2DWDC 1CPYA 4QPJA 1ZWIC 3SPJA 3ASOB 4UV9A 4FMTA 4FJCC 1HWYA 1RM1B 2JJ1G 3K0GA 5B1OA 2W0FC 3WG7B 1BHBA 2EIMC 3OE7G 5KA5A 3MHSC 5IYBO 1VQMV 3LDCA 1PNKA 4KUMA 3K06A 3CP1A 3OGCC 4HAMA 3ZMTA 1GM9A 3D36A 1KKDA 1CP9A 3UKMA 1NH2B 1ORQC 1VQ4V 1YHQV 4CZZA 2GSMB 1OCCB 1PD3A 2Z5UA 2Q68A 4MTOA 1N8RW 2AHZA 3ABLB 3ASNB 2NNUA 4ZKIA 4PDMA 2R9IA 4MW3A 4RUEA 1UJWB 5CN0A 2QEXV 2NLJC 2WPDG 2AHYA 1YITV 1L1FA 3F7YC 1M90W 2WLHA 3SYQA 4I5SA 2YEVA 3H01A 1K73W 2H8PC 1M57C 1H8EG 3OR6C 4PA3A 5H9CA 5BZBA 1QVFU 3K04A 4KFMA 1M1KW 4MSWC 1EFRG 2ZD9A 1FXKA 4P9OA 3CCSV 3SYPA 4XDJA 1AI6A 1OCZC 3OEHG 1H38A 1QR9A 4XDKA 4DXWA 2WSSG 3FB6C 1NH2D 1Y66A 4KP4A 3TK1A 2A9HA 4XDLA 2Q67A 4MT8A 1LNQA 2EBOA 1QBZA 2B1IA 3G6EV 3ABKB 2LFRA 3AG2B 2V7QG 4MVMA 3CCJV 3AEIA 3FYEB 3E8HA 1GTOA 1KECA 4TWKA 3X2QB 1QLNA 1DLBA 2D3OW 1JOYA 1W0KG 4MVOA 4JAVA 5L3EA 2V1DA 1YIJV 4J9ZB 1S72V 3WFVA 1Y4MA 3SPGA 1GM8A 3P32A 4QE7A 4BAYA 5KUMA 4I9WA 2WLIB 1SERA 1MG1A 4PA9A 5B3SB 4ASUG 1AROP 1K92A 2ZQMA 2OT5A 3OM3B 3HB3B 2EIKC 4G28B 1GMGA 1NBMG 3B77A 4JGSA 3SPIA 2OTJV 1NQTA 1MOFA 2XOKG 2CK3G 1BMFG 4GX5A 3ZJZA 1COWG 2DWEC 2HFEC 3FKSG 4FK5C 1SESA 1V55B 3I55V 2IW5A 1F4NA 2EILB 2X0LA 2HR3A 2DYSC 3W7XA 2WWWA 2IU3A 2LP7A 4X88A 3ETDA 4UVAA 3OMNB 1VQ6V 1K97A 4GT1A 3CCLV 4UUJC 3SYAA 2DQ0A 2WAMA 1QLEB 4UVCA 4QJFB 3ABUA 1B6QA 5IY5C 1JQ0A 1FXKC 5LBQA 1GKFA 3ETGA 5IYCO 1RM1C 2H94A 3EHBB 3AG1B 2BOBC 1NVPD 3G4SV 1MABG 2EZPA 2JJ2G 2M7WA 3AG3B 4GX0A 3CPWU 4P9PA 1FFTB 4WCEV 4YXWG 2EIJB 5LHGA 1V54B 2IJJA 4BW5A 2JK5C 4HYOA 1SETA 2WLIA 4X8AA 1Q86W 4RUFA 4GX1A 2ZDIC 1K5QA 1K5SA 4J9YB 5EK0A 3RVYA 3T4ZA 1IXMA 3CC4V 3QO8A 3JD4A 1VQLV 2A0LA 1OCCC 4RQFA 3CCRV 2HKOA 4PELA 5B1AB 1WPXA 4R50A 4RAIA 1YTFD 5CBHA 2XAHA 1K4CC 2EINB 3LSQA 3CYOA 1P7BA 1THZA 2HVKC 3GWOA 2PI5A 3AG4C 4PDVA 1M56C 2OCCC 3ABMB 4LCUC 4MVRA 2QA4V 3ZCCA 2IU0A 5C93A 3F7VC 1E1QG 1DF4A 2A79B 2Y69C 4WFFA 3IGAC 4E2LA 3LUTB 4HZ3A 3E35A 3LDEA 4BIZA 2EIMB 3LDDA 2ITDC 1AR1B 5DN6G 3CCVV 3QO7A 5L3CA 4MTFA 5B1BB 1YJ9V 1AI4A 1K9MW 5KA6A 2LFSA 3T4DA 1R6KA 2MK3A 3OUFA 4TSFG 1JPXA 2Q6AA 4JASA 5EBMC 3DGEA 3QNEA 4LC1A 2Y48A 2P90A 1OCOC 1KP2A 3ZMZA 1W2BU 3OAAG 1Q81W 3ZRWB 2QKSA 1EBOA 4JTDB 2IH3C 1NKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H37 A;  3FB5 C;  2DWD C;  2DYS C;  3K03 A;  3OUS A;  1ZWI C;  3RBZ A;  3SPJ A;  2Q69 A;  4X88 A;  4RO2 A;  4ZBM A;  3UM7 A;  3ABK C;  3K0G A;  3AG2 C;  3STZ C;  2WLL A;  5EC1 C;  2W0F C;  2IH1 C;  4LP8 A;  2EIM C;  4UUJ C;  3SYA A;  3X2Q C;  3E83 A;  3SJQ C;  1G4Y B;  3T2M A;  5IY5 C;  5EBL C;  2ATK C;  4PDR A;  3LDC A;  2X6B A;  3BEH A;  4PDL A;  4CBC A;  4MVS A;  1OCR C;  3K06 A;  4PA6 A;  3OGC C;  2BOB C;  4OXS A;  3KG2 A;  4MS2 A;  3JYC A;  1XL6 A;  2DYR C;  1KKD A;  4GX0 A;  5B3S C;  3SYO A;  4P9P A;  3UKM A;  4PA4 A;  1ORQ C;  2QTO A;  1XL4 A;  4BW5 A;  2JK5 C;  3EFF K;  4MTO A;  2Q68 A;  4F4L A;  4HYO A;  2X6C A;  5KUK A;  2AHZ A;  2WLI A;  4X8A A;  4RUF A;  3TET A;  4GX1 A;  4PDM A;  4MW3 A;  4RUE A;  5EK0 A;  4J9Y B;  3RVY A;  2NLJ C;  4WFH A;  3T1C A;  1V55 C;  2AHY A;  3T4Z A;  2EIL C;  3F7Y C;  3ASO C;  2A0L A;  2WLH A;  3SYQ A;  1OCC C;  2YEV A;  2H8P C;  3E8G A;  1M57 C;  3OR6 C;  4PA3 A;  5E1A C;  3WG7 C;  5BZB A;  3K04 A;  4KFM A;  1QLE C;  3SYC A;  4R50 A;  3FB8 C;  4RAI A;  3LNM B;  4MSW C;  5EC2 C;  2KB1 A;  5CBH A;  4MVU A;  2ZD9 A;  4MVZ A;  4MW8 A;  1K4C C;  4R8C A;  4X89 A;  3TCU A;  3SPC A;  1P7B A;  4P9O A;  3GB7 C;  3K08 A;  3SYP A;  2HVK C;  2X6A A;  1R3K C;  2WLL B;  2WLK A;  4XDJ A;  1OCZ C;  1BL8 A;  2HJF C;  3FB7 C;  3AG1 C;  3AG4 C;  2ZXW C;  4PDV A;  1M56 C;  1R3I C;  2OCC C;  4PA7 A;  4WFE A;  4XDK A;  5B1A C;  3AG3 C;  4LCU C;  4DXW A;  3FB6 C;  4MVR A;  4JTC B;  5CBG A;  3F7V C;  2Y69 C;  2ITC C;  2A79 B;  4WFF A;  4P30 A;  3IGA C;  4LBE C;  2A9H A;  4XDL A;  2Q67 A;  1LNQ A;  2EIJ C;  3LUT B;  4HZ3 A;  4WFG A;  3LDE A;  3OR7 C;  1V54 C;  4R6Z A;  4MVM A;  2WLM A;  3E8H A;  4TWK A;  5CBF A;  3ABL C;  3ASN C;  3LDD A;  2ITD C;  4GX2 A;  4JTA B;  1R3J C;  4H33 A;  4MVO A;  3K0D A;  3ZRS A;  3VOU A;  3R65 A;  2HG5 C;  3E86 A;  4MVQ A;  4J9Z B;  4MTF A;  1J95 A;  4EKW A;  3SPG A;  4QE7 A;  3F5W C;  5KUM A;  1JVM A;  4I9W A;  2WLI B;  4MTG A;  3T4D A;  3E8B A;  2K1E A;  2R9R B;  4QNH B;  4PA9 A;  2P7T C;  3SPH A;  1K4D C;  3OUF A;  3RVZ A;  5J9P C;  2Q6A A;  3RW0 A;  3PJS K;  2HVJ C;  5EBM C;  4G27 B;  4QE9 A;  2EIK C;  4G28 B;  1R3L C;  5B1B C;  1S5H C;  4R7C A;  2EIN C;  4P2Z A;  3SPI A;  3E8F A;  1OCO C;  3IFX A;  4GX5 A;  2BOC C;  3ZJZ A;  2WLJ A;  2HFE C;  2DWE C;  5EBW C;  3HPL C;  3E89 A;  3STL C;  3ABM C;  2QKS A;  2WLN A;  4JTD B;  2IH3 C; 
#chains in the Genus database with same CATH topology
 1NT2 B;  2Q7E A;  2IJH A;  4UFZ A;  2XHB A;  3BA9 A;  2PF4 E;  1WJZ A;  1YZB A;  5IJ0 B;  2DYR B;  3OT7 A;  1R73 A;  4B7K A;  2F43 G;  4K0K O;  4IIJ A;  1OCR C;  4FIP C;  1SQF A;  4UCV A;  5H6R A;  1YXB A;  5KMG B;  4DR4 O;  3EVK A;  4FPP A;  4JI3 O;  2F23 A;  3CRQ A;  3DTU B;  4NXN O;  1N32 B;  1XL4 A;  1K3E A;  3D3I A;  2E3C A;  1H8H G;  4JI1 B;  4FM1 A;  2CUG A;  3D3Q A;  4UV8 A;  2OWO A;  3L70 H;  3CCM V;  1YTF B;  3CXC U;  4J41 A;  2QJ1 A;  3JD2 A;  4GZR B;  5J2T A;  3RWR D;  3HKB A;  5LGN A;  3ZX6 A;  3BCC H;  3WG7 C;  1FS0 G;  2Q8V A;  4HNA A;  1E79 G;  3FB8 C;  5LMU B;  1I5X A;  2DOS A;  2EIK B;  3CXH F;  2GTA A;  1Y67 A;  3TJT A;  4CC5 A;  1FKA O;  2X6A A;  4FM2 A;  4X1K A;  1BL8 A;  4RQE A;  3T1Y O;  5B1A C;  4WFB V;  4CS4 A;  1K34 A;  2BSK B;  3DC6 A;  4A5U B;  1B3Q A;  1Q8I A;  3W7T A;  4FFB A;  1O9G A;  4YHH B;  1XNQ B;  2Q9L A;  4J11 A;  2JEU A;  3VBB A;  3ASN C;  1JJ2 U;  1R3J C;  1RSO A;  5IY5 B;  1XRE A;  5JVD B;  4MVQ A;  3M99 B;  5CB4 B;  1GO3 F;  3APQ A;  4MTX A;  1X4T A;  1I94 O;  2P7T C;  2F95 B;  1K4D C;  3RYF B;  1AB3 A;  3PJS K;  1N34 O;  1R3L C;  1AIL A;  1S5H C;  4H44 B;  3DXR A;  1VQK V;  3IFX A;  4O2B B;  4JI4 B;  5DED A;  3FAV A;  4QPK A;  1VQO V;  5JQG A;  2UU9 B;  1HNW B;  2IJI A;  1I08 A;  3K03 A;  1RPR A;  3LSS A;  1KMI Z;  2WLL A;  3CCU V;  3SDL A;  5IWA B;  2BTQ B;  3K9A A;  4LFC O;  1G6U A;  4DR3 O;  3ZBH A;  2OCC B;  3JYC A;  2VS0 A;  4PA4 A;  2PTM A;  4LNU A;  3A0R A;  1Q7Y W;  5L3F A;  3TGU H;  2QKC A;  5HFL A;  1X59 A;  1TUE B;  3L73 H;  5GON A;  4LF9 O;  4LF5 B;  2UUA O;  1OJH A;  2F93 B;  1V55 C;  2VQE B;  2EIL C;  1ZAU A;  4UCS A;  4B3R B;  5IYD O;  1DK1 A;  3CD6 V;  4DUY O;  1EN6 A;  1VQN V;  1RSO B;  3T1H B;  1FFX A;  2KB1 A;  5BR8 O;  4DR2 B;  1N33 O;  3ZHS A;  3CSX A;  1TVK A;  1KYO F;  4AIL C;  5H2F Z;  3VQY A;  2HJF C;  4BIU A;  1BS3 A;  1RPO A;  1R3I C;  4GCZ A;  4W4K A;  2ZR3 A;  3UO2 A;  1QVG U;  4NXM B;  2QWQ B;  1HR0 O;  1D5N A;  2DJV A;  3A0B Z;  4CS3 A;  3OR7 C;  4O4L B;  3U0Z A;  3QTC A;  1S0V A;  1AI7 A;  3FAV B;  3CCE V;  4B3M B;  1BT8 A;  5C8Y A;  5L3G A;  4WF9 V;  1OV9 A;  3H1L H;  4EFE A;  3I56 V;  1HNX O;  4EKW A;  3BY6 A;  1XMQ O;  2JRI A;  3F5W C;  5J2U A;  1IBM B;  4JYC A;  1PNL A;  3VQW A;  4W4L A;  2GTS A;  3RYC B;  3P30 A;  2HVJ C;  4QE9 A;  1SF9 A;  1Q5O A;  5DM6 V;  2BTO A;  2P4K A;  3ZRV A;  3ZMV A;  2YEV B;  4YY3 O;  2IM9 A;  4DUZ O;  1PL0 A;  3ABM C;  1UFI A;  2XAF A;  3MHH C;  1S76 D;  1I5Y A;  4PV1 B;  1ZWI C;  1W59 A;  2ETN A;  4UV9 A;  4FMT A;  2WA3 A;  2JJ1 G;  2RQ6 A;  4YJ3 A;  3WU2 Z;  1QU7 A;  1BHB A;  5KA5 A;  2AXT Z;  3WB0 A;  4F6E A;  5LMN B;  3LDC A;  2ZE6 A;  5GTH Z;  1SQB H;  4HAM A;  1GM9 A;  1KKD A;  1JFF A;  3PN1 A;  4JI6 O;  2UUB B;  4CZZ A;  1SQV H;  1WB8 A;  1OCC B;  1PD3 A;  4FZ0 A;  4CH3 A;  2CAZ C;  1N8R W;  3ABL B;  2NNU A;  4RUE A;  1TAE A;  4LF7 B;  3I5D A;  1YIT V;  3LSU A;  1M90 W;  2WLH A;  4I5S A;  1XIL A;  2H8P C;  2A7W A;  5H9C A;  4J7J A;  1QVF U;  2Q7H A;  2YIB A;  3JAK B;  4DR7 B;  4DV5 B;  5LA6 A;  1FXK A;  2YXH A;  1TA8 A;  4DK0 A;  3CCS V;  3SYP A;  4ZOL B;  1H38 A;  4XDK A;  3FB6 C;  1NH2 D;  1U96 A;  4BW9 A;  3TK1 A;  4X65 B;  4J10 A;  4XDL A;  2EBO A;  3C3T A;  1NS1 A;  3R66 A;  1ZSP A;  3K57 A;  1A32 A;  2V7Q G;  3CCJ V;  3AEI A;  3E8H A;  4I0X B;  4TV8 B;  3H1K H;  4JAV A;  5L3E A;  1BQZ A;  3CRM A;  2V1D A;  3WFV A;  2ARH A;  4GKJ B;  2WLI B;  4YJ3 B;  1GN6 A;  4C7U A;  3VQV A;  4X1Y B;  3L75 H;  1VIB A;  3HB3 B;  2EIK C;  1NBM G;  3JSL A;  3SPI A;  3K5O A;  2OTJ V;  1WP7 A;  3O65 A;  4E4E A;  4GX5 A;  5LYJ A;  1H2S B;  1COW G;  3JAL B;  1WA8 A;  3N2K A;  3I55 V;  4DV7 O;  4I50 A;  2IU3 A;  2LP7 A;  4UVA A;  1VQ6 V;  4EB6 A;  4GT1 A;  4UUJ C;  2WAM A;  1QLE B;  2QM4 A;  4UVC A;  2OYQ A;  5IY5 C;  4ABM A;  2JVD A;  2Q0A A;  3KZI Z;  1URF A;  5KHJ A;  1IBL O;  4RWU A;  2Z0A A;  2BOB C;  2F1M A;  2EZP A;  2M7W A;  3AG3 B;  4GX0 A;  2HHH B;  2LW7 A;  4P9P A;  4JI7 B;  2DN9 A;  4ZHQ A;  4YXW G;  2EIJ B;  3CRR A;  3UO3 A;  5GTI Z;  4I4T A;  4DV3 O;  1V54 B;  2KG7 A;  4LFA O;  3JAS B;  4GX1 A;  2E5L B;  1K5S A;  4TQF A;  2YS8 A;  3T4Z A;  4JI0 O;  5F2V O;  1LUV A;  1SKV A;  3IJ4 A;  3CC4 V;  3QO8 A;  4DW0 A;  5JJJ B;  1XI1 A;  4JI2 B;  4RQF A;  2CDY A;  5B1A B;  4R50 A;  1XNR O;  1K4C C;  3CS5 A;  3G6B A;  3RYI A;  2EIN B;  3LSQ A;  2HVK C;  2PI5 A;  2GDS A;  2OCC C;  1Q90 D;  4MVR A;  3ZCC A;  3B2E E;  1TGO A;  5C93 A;  1E1Q G;  2A79 B;  4E2L A;  3EXA A;  5LP6 A;  2RCV A;  5DN6 G;  3CCV V;  3QO7 A;  4KXR A;  1IX9 A;  4CC6 A;  4MTF A;  5D5P A;  1AI4 A;  1J5E O;  2YI8 A;  1R6K A;  4JAA A;  1XHX A;  2JGD A;  3JAT B;  3QNE A;  4YJ2 B;  1MA1 A;  3ZMZ A;  3UQ8 A;  3JAR A;  4I55 A;  4WFE A;  1SZX A;  2JGU A;  2Q69 A;  1EN5 A;  4ZBM A;  5EC1 C;  2IH1 C;  2Q7G A;  1NVP B;  1ZX3 A;  5EBL C;  2ZE7 A;  4PDR A;  2P4V A;  4PDL A;  2VQF O;  1KD1 W;  4OXS A;  4PD4 F;  4MS2 A;  2EUL A;  1FJG B;  1RFY A;  1XEQ A;  4Z2W A;  2Z3Y A;  2UXX A;  5LHI A;  2A3Q A;  3TET A;  1F4M A;  4UB6 Z;  5DEC A;  2KKW A;  2JIZ G;  2OTL V;  4AQY O;  4IHJ B;  3SR2 C;  1N0N A;  1WP8 A;  3MDS A;  1L8D A;  4KHP B;  3WB1 A;  4Q6G A;  3CMA V;  3H1H H;  1NTK H;  3BRC A;  2FTK A;  2E75 B;  3L74 H;  1WPB A;  1M9N A;  1W0J G;  2ZCE A;  2WLK A;  3FB7 C;  2HLD G;  1KC8 W;  2ODM A;  2UXN A;  1PP9 H;  4B7E A;  1DTO A;  2DYS B;  2QM8 A;  1M4U A;  1AJQ A;  3ABL C;  5KMG A;  3FYI B;  2AGA A;  3AK3 A;  2ZM6 B;  3ZRS A;  4X66 O;  2JDI G;  1ZLZ A;  4B3S B;  4L87 A;  4J42 A;  3HKD B;  3E8B A;  2K1E A;  4JPR A;  4D7T A;  4TT3 G;  2P67 A;  5B1B C;  2YC0 A;  3CB2 A;  3NR7 A;  2XAG A;  2F4V B;  4O4I B;  1WN7 A;  1YSC A;  3APO A;  4YIP A;  3FB5 C;  3RBZ A;  1MNG A;  5J9P C;  4RO2 A;  3STZ C;  3W7W A;  4I9Q A;  3OFN G;  1G4Y B;  2BSK A;  3T2M A;  3KCY A;  4FLW A;  3S3W A;  5EYP B;  1Q82 W;  4CBC A;  4MVS A;  1OZ0 A;  3FD9 A;  1Z2G A;  1SC5 B;  4DR1 O;  5JJE B;  3VQX A;  5JVD A;  2UXB O;  2B1G A;  1QCE A;  5CB4 A;  5KUK A;  3N2G B;  3BVO A;  5KX5 B;  4WFH A;  3RYF A;  4JI5 O;  2O57 A;  1FXH A;  3K9S A;  4XBF A;  3HKC B;  5FL7 G;  1VF6 C;  1VQ8 V;  3M8A A;  4O2B A;  1QLE C;  4TV9 B;  5FNV B;  4LF8 O;  4EFB A;  2QGN A;  4X89 A;  4K0K B;  3J80 N;  4O4J A;  3GB7 C;  1HNZ O;  1R3K C;  1OCO B;  3AG3 C;  4JTC B;  5K1P A;  3CE2 A;  5EZY B;  1QR8 A;  2BTQ A;  4UVB A;  1XHZ A;  2EIJ C;  1N32 O;  1V54 C;  2WLM A;  5CBF A;  4JTA B;  4FM0 A;  4GX2 A;  1PNM A;  2Q73 A;  4JI1 O;  3SJC C;  2ZIN A;  2LJ2 A;  1J95 A;  1XDC A;  4N21 A;  2UXD O;  4Z1V A;  2M6Y A;  4QNH B;  2N74 A;  1S3J A;  4U3J B;  5LMU O;  5CMU A;  2QM7 A;  2QTS A;  1HW7 A;  2EIN C;  1QQC A;  2ZIO A;  3K58 A;  2BOC C;  3CC7 V;  2WLJ A;  3E89 A;  1B04 A;  4Z1M G;  4LBE C;  2IBZ H;  3G80 A;  5H5N A;  1NR1 A;  1I0H A;  1O9H A;  1CPY A;  3ASO B;  1KUQ A;  1HWY A;  4BIO A;  3K0G A;  1XNQ O;  2W0F C;  4YIO A;  1PPJ H;  1GN4 A;  3MHS C;  4NKG B;  1PNK A;  3OD4 A;  4JV5 B;  4O4L A;  3CP1 A;  1T5E A;  1S5L Z;  4GKK B;  3UKM A;  4WBN B;  1NH2 B;  5FLX N;  1ORQ C;  3CRA A;  4O4J B;  2QWP B;  2Q68 A;  4ZKI A;  4JI4 O;  2R9I A;  1UJW B;  2QEX V;  4ZIB A;  4J80 A;  2WPD G;  2AHY A;  2UU9 O;  3RYC A;  5KHK A;  4OPA A;  1L1F A;  4OX9 B;  2YXY A;  5LOV B;  4DW1 A;  2YEV A;  2ZE8 A;  4PA3 A;  5BZB A;  1M1K W;  2JS5 A;  5IWA O;  4LFC B;  2R9A A;  2GV9 A;  4DR3 B;  3OEH G;  4KP4 A;  2P06 A;  4MT8 A;  5CA1 B;  1VF7 A;  2GUZ B;  3DC5 A;  3G6E V;  3ABK B;  2LFR A;  4X64 B;  2BCC H;  4DR5 B;  3FYE B;  3C3S A;  1KEC A;  3X2Q B;  1QLN A;  4LF5 O;  2VWJ A;  1ZL8 B;  1JOY A;  4LFB O;  2VQE O;  5JH7 B;  2XUM A;  4GYC B;  4J9Z B;  4B3R O;  1Y4M A;  2PUS A;  4LH7 A;  4UB8 Z;  2DMX A;  3SPG A;  1WNS A;  4BAY A;  4DUY B;  5KUM A;  1AP6 A;  1MG1 A;  5B3S B;  4O4H B;  1ARO P;  1K92 A;  2ILM A;  3T1H O;  2OT5 A;  1N33 B;  3OM3 B;  3LNN A;  5BY1 A;  1SQX H;  3B40 A;  1BMF G;  2HFE C;  3JAK A;  1FD9 A;  2DYS C;  2LGW A;  3ETD A;  3GVM A;  3OMN B;  4ICG A;  2DQ0 A;  4ZOL A;  4QJF B;  3ABU A;  4B3M O;  3HKE B;  1Y76 B;  1GKF A;  2AZ2 A;  5IYC O;  2H3O A;  2QWN B;  1RM1 C;  2H94 A;  3EHB B;  4DV1 O;  1LUW A;  4LF4 O;  3G4S V;  1IBM O;  4I0X A;  4TV8 A;  1Q6U A;  1EM1 A;  2IJJ A;  4BW5 A;  5LXT B;  4YY3 B;  4HYO A;  1SET A;  1H2K A;  2WLI A;  4X8A A;  4IL6 Z;  5EK0 A;  4J9Y B;  2YXL A;  1XQ8 A;  4X1Y A;  1IXM A;  2RN9 A;  3JD4 A;  5JCO C;  4HBN A;  2A0L A;  4OGQ B;  3ZS8 C;  4D7S A;  2HKO A;  4PEL A;  3JAL A;  1WPX A;  4RAI A;  1YTF D;  5CBH A;  2XAH A;  4DYL A;  5LMN O;  1Q6I A;  3CYO A;  1EN4 A;  1THZ A;  1VF6 A;  3GWO A;  4LF6 B;  2G38 A;  2CGO A;  2QSA A;  1QHT A;  2N05 A;  3IGA C;  1NU1 H;  2UUB O;  4DV6 O;  3E35 A;  4BIZ A;  3P3N A;  2EIM B;  2ITD C;  3TXQ A;  4GLX A;  4LF7 O;  4NB5 A;  5B1B B;  2PYL A;  1P84 F;  2LFS A;  3T4D A;  1R6T A;  3JAS A;  2L35 A;  3OUF A;  4FLX A;  1JPX A;  3M7M X;  4DR7 O;  2BE3 A;  4ZI7 B;  2NR5 A;  2Y48 A;  4K8Z A;  1OCO C;  1H2M A;  1KP2 A;  2YID A;  1W2B U;  2OCH A;  2QKS A;  1ZTE A;  3ZRW B;  4X65 O;  2IH3 C;  3IC7 A;  3OUS A;  1N0J A;  2EX3 A;  4CH4 A;  3E83 A;  4U7O A;  1VQ9 V;  2P6J A;  3QF7 A;  1N36 B;  5CA0 B;  2AZ0 A;  4Q20 A;  3BEH A;  4FFK A;  1US6 A;  4CS2 A;  4JYA B;  2DQ3 A;  4H13 B;  2W6I G;  1KQS U;  2XAJ A;  3W7U A;  2ZNJ A;  3ZN1 A;  4DV0 B;  1GRJ A;  1MMM A;  1ZUQ A;  2F66 C;  3AG7 A;  1VQP V;  3JAT A;  4DV7 B;  4IGG A;  5B1N A;  3B4S A;  3H1J H;  1FPO A;  3ASO C;  1PKX A;  4YJ2 A;  3B8N A;  4NTY A;  4X62 B;  3E8G A;  1KP3 A;  3J81 N;  4X9Q A;  5EC2 C;  4MVU A;  4R8C A;  4B3T O;  3TCU A;  1K33 A;  3SPC A;  1H2L A;  2E76 B;  1TUB B;  5KAF Z;  2XND G;  4FLT A;  5KHH A;  1K7D A;  3K79 A;  1D2D A;  1G8M A;  2HHH O;  1MSW D;  4JI7 O;  1IUR A;  4P30 A;  4DR6 B;  4WFG A;  1NZ6 A;  1S77 D;  4LFA B;  4QIW F;  2E5L O;  4JI0 B;  5H6Q A;  4JAU A;  4IYH A;  1R6N A;  1VAR A;  4JI2 O;  1JVM A;  1BSM A;  3K3W A;  1XMO O;  3RVZ A;  2P22 C;  1MZF A;  4TUY B;  1Y6X A;  1PM9 A;  2A06 H;  4IHJ A;  4G27 B;  3DSQ A;  2C2A A;  1SS3 A;  3E8F A;  4DK1 A;  2EJR A;  2N04 A;  4X1I A;  3HPL C;  1F23 A;  2PI4 A;  5LGT A;  5HFM A;  3UM7 A;  3ABK C;  3X2Q C;  2CTW A;  2E74 B;  5KHI A;  2ATK C;  4DO2 A;  1OHH G;  1D5A A;  4PA6 A;  3BHP A;  1ENV A;  3E2E A;  1XL6 A;  1AJP A;  5B3S C;  1G1X B;  3SYO A;  2EJ7 A;  2LW1 A;  2XAQ A;  3JD0 A;  4F4L A;  1XOU A;  3HKD A;  3Q4H B;  4G2K A;  5KHG A;  4NTX A;  3KKY A;  4AHC A;  5AG2 A;  3CME V;  3RFR A;  5B5E Z;  1SRY A;  5IE9 A;  4O4I A;  3AK2 A;  3SYC A;  4DV4 B;  3WB2 A;  1JA8 A;  4MW8 A;  5EIB D;  2W6J G;  2VQF B;  5JCO A;  4PJ0 Z;  2UXC O;  5TIS Z;  3ML0 A;  2CGN A;  2ZXW C;  1Y74 B;  3G71 V;  3AK1 A;  5CBG A;  2YDE A;  1Z5W A;  4LWS B;  1FJG O;  1YJN V;  5JJN B;  3B09 A;  1DF5 A;  5EYP A;  3OW2 U;  4FLV A;  1BE3 H;  4N23 A;  2VWK A;  5LGU A;  5BMV B;  4X1I B;  4DV2 O;  4FLY A;  2ZIM A;  3VOU A;  3R65 A;  2RDC A;  3ABT A;  3E86 A;  3KCX A;  2XTA A;  3UCS C;  2V4D A;  5L3D A;  4KHP O;  1YI2 V;  2R9R B;  3K5L A;  3N2G A;  2GHY A;  3MD0 A;  5KX5 A;  1EZV H;  1F51 A;  4L8J A;  3CCQ V;  3ZMS A;  1LR1 A;  4P2Z A;  5LHH A;  2QDO A;  3HKC A;  3JCU Z;  4DRX B;  5EBW C;  2PYJ A;  2IJK A;  4TV9 A;  3ZN0 A;  5FNV A;  1P49 A;  3JAW B;  1K8A W;  2P5O A;  2DWD C;  2YIC A;  1PL4 A;  1RM1 B;  3CEI A;  2EIM C;  3O9O A;  4K35 A;  3OE7 G;  3E22 B;  5EZY A;  4J7K A;  1VQM V;  2CTR A;  4TQD A;  4KUM A;  3OTO B;  3K06 A;  4BR6 A;  5JWP A;  1BQ0 A;  3ZMT A;  4LR3 A;  4AI8 A;  3QVN A;  2CH7 B;  2GSM B;  4MTO A;  2Z5U A;  2YIB D;  4PDM A;  2F4V O;  2QWO B;  5IJ9 A;  4U3J A;  2UUC B;  3F7Y C;  3A2F A;  4FVM A;  4JI8 B;  4X20 B;  3RYH B;  3H01 A;  1K73 W;  1M57 C;  3FFQ A;  2XT9 A;  2R72 A;  4KFM A;  2YIA A;  2ZKO A;  1EFR G;  3CRC A;  5D5Q A;  1IBK B;  1MSD A;  4P9O A;  3BAB A;  3BFR A;  4XDJ A;  1AI6 A;  4NTW A;  3ZHR A;  1V9P A;  2A9H A;  2Q67 A;  1LNQ A;  1QBZ A;  4CH6 A;  2B1I A;  2HEP A;  3AG2 B;  2D3O W;  2GBO A;  4WBN A;  3RT3 C;  5IYZ B;  1S72 V;  3P32 A;  4FZ1 A;  1SA0 B;  2Y4T A;  3ZHU A;  4UCU A;  4O2A B;  4DR4 B;  4ASU G;  4LF8 B;  4JI3 B;  5FPR A;  4NXN B;  1U97 A;  1GMG A;  2HJD A;  3B77 A;  2Q4P A;  4JGS A;  1HNZ B;  5LOV A;  1NQT A;  1MOF A;  4K3A A;  2XOK G;  4UCR A;  2ZNI A;  2Q5Z A;  1NTZ H;  2DWE C;  4I7Z B;  1SES A;  2LO1 A;  2X0L A;  4EEQ A;  2WWW A;  1Q3E A;  1SQQ H;  3N27 A;  3CCL V;  3SYA A;  2PY5 A;  4NYK A;  3OGI B;  1IVS A;  1JQ0 A;  5IJ9 B;  1FXK C;  5CA1 A;  2GUZ A;  5BXZ A;  2UXD B;  3AG1 B;  3T1Y B;  1NVP D;  1MAB G;  5ITZ B;  3CPW U;  4J7Z A;  1ZL8 A;  4NVP A;  2JS3 A;  5JH7 A;  4B08 A;  5LHG A;  4IYI A;  1IDS A;  3A0H Z;  1YDX A;  4YHH O;  1GH6 A;  2ZDI C;  3RVY A;  4O4H A;  2Y0I A;  2L6L A;  5KAI Z;  1VQL V;  1I94 B;  4U3F H;  4H0L B;  1FAF A;  1N34 B;  1Z5V A;  1WAZ A;  4JV5 O;  4PDV A;  4GKK O;  5A2Q N;  4LCU C;  2QA4 V;  3C90 A;  2IU0 A;  3HKE A;  4WFF A;  1XUQ A;  2LQT A;  1Y76 A;  2FL4 A;  1HNW O;  4IIJ B;  3LDE A;  1DGS A;  2QKA A;  1AR1 B;  1YVW A;  3ZHQ A;  5L3C A;  3UT5 A;  4OX9 O;  5KA6 A;  5LXT A;  2MK3 A;  4LH6 A;  4TSF G;  2Q6A A;  5EBM C;  3DGE A;  5J2T B;  4LC1 A;  3BPZ A;  3HKB B;  1NI8 A;  3MAQ A;  2P90 A;  4LF9 B;  4PHZ A;  4HNA B;  2UUA B;  1Q81 W;  1EBO A;  1Q86 W;  4H37 A;  1L0L H;  4X1K B;  3ZMU A;  1VEW A;  4X64 O;  3OMA B;  4LP8 A;  4DR5 O;  1VQ7 V;  1F7Y A;  3D36 C;  3SJQ C;  4LFB B;  1KU9 A;  4PI2 A;  5BR8 B;  1WLE A;  4DR2 O;  2X6B A;  3QG5 A;  1IZ3 A;  4FFB B;  1OCZ B;  4JZ2 A;  1YCI A;  3KG2 A;  3P3P A;  3GWK C;  1HR0 B;  3ZED A;  4NXM O;  4JYB A;  3JD3 A;  4U7N A;  3EFF K;  5LP6 C;  3D8C A;  4IT5 A;  1JCH A;  4KL1 A;  3H9V A;  4UXN A;  4FLZ A;  5L3B A;  2Y0P A;  1HNX B;  3FX7 A;  2KQX A;  4F6R A;  4ZI7 A;  2ADP A;  2FML A;  2RMK B;  2LGQ A;  1XMQ B;  3DXR B;  2FYU H;  1H2N A;  2EZO A;  2ZXW B;  5JQG B;  3U11 A;  3LNM B;  3ZRW A;  4MVZ A;  3UT5 B;  3L9D A;  4DV1 B;  2WLL B;  3ETE A;  4LF4 B;  2ZR2 A;  4DUZ B;  2PZS A;  2QR4 A;  4UCO A;  5CA3 A;  2ITC C;  3JCZ A;  3OTF A;  5CA0 A;  3W7S A;  4WFA V;  1VP7 A;  1Q6H A;  2KSD A;  2HP8 A;  1KB9 F;  4LNU B;  3K0D A;  2DW4 A;  1FYJ A;  5GW7 A;  3CC2 V;  5GON B;  3SPH A;  4JI6 B;  3RW0 A;  3CJH A;  5E79 Z;  4LF6 O;  1FXV A;  3STL C;  1FFX B;  4CH5 A;  4OPH A;  1H2G A;  2WLN A;  2DE0 X;  1M93 A;  4DV6 B;  1TVK B;  3AG2 C;  1JJO A;  2X7R B;  1SQG A;  1TUB A;  3J7A U;  5IDJ A;  1P4R A;  2FB5 A;  3IC9 A;  4DV5 O;  1I7F A;  1P7G A;  4F6R B;  3NXS A;  3ZIA G;  3ZHT A;  1NR7 A;  1WB7 A;  3AG4 B;  1M56 B;  1B06 A;  1YF2 A;  2DYR C;  2OIG A;  5C8Y B;  2Y69 B;  4GUN A;  3L71 H;  1VMG A;  2QTO A;  3CX5 F;  3JAM N;  5J2U B;  2X6C A;  1M57 B;  3OEE G;  3T1C A;  4TUY A;  1ROP A;  3JD1 A;  2JEX A;  4JF3 A;  1SZT A;  4GKJ O;  1AI5 A;  2WA4 A;  2ZDI A;  1XBL A;  5E1A C;  3SGI A;  1CEZ A;  1KBH A;  1JMK C;  1QNM A;  3B8M A;  2AW9 A;  1N36 O;  2B5U A;  3K08 A;  3ZRX A;  1AR4 A;  3AG1 C;  3QO5 A;  4PA7 A;  1E1R G;  2YSU B;  2QE7 G;  4JYA O;  4K8X A;  3CJH B;  2OIE A;  4DV0 O;  3JSN A;  1L0N H;  4R6Z A;  1NJI W;  1JFF B;  1EZJ A;  2RNB A;  2CE4 A;  4H33 A;  3H1I H;  2RJZ A;  2HG5 C;  3RN4 A;  5IT9 N;  2CTP A;  1JX9 A;  1IBL B;  1OCR B;  3ZHV A;  4X62 O;  1YJW V;  4MTG A;  3U10 A;  1GK9 A;  1BHA A;  2XAS A;  3Q4H A;  4B3T B;  1GM7 A;  1AJN A;  3BA8 A;  4R7C A;  4DV3 B;  5FPO A;  2B9Z A;  1VQ5 V;  3OMI B;  5LL6 Y;  5LA6 B;  1FXK B;  4QPJ A;  3SPJ A;  4DR6 O;  3CHX A;  1AR5 A;  2ZE5 A;  4FJC C;  1MZE A;  2FKX A;  2MW2 B;  5B1O A;  3WG7 B;  2PGG A;  5KLV H;  1AVM A;  1Y74 A;  4LWS A;  4BWA A;  2Q0O C;  1XNR B;  2D2C B;  5IYB O;  2CTQ A;  1S5J A;  3OGC C;  5BMV A;  1XMO B;  3D36 A;  1CP9 A;  3K59 A;  1UPG A;  1PV0 A;  1GN3 A;  3THO A;  1VQ4 V;  1YHQ V;  1KKC A;  2AHZ A;  1SQP H;  3ASN B;  2K9P A;  4MW3 A;  5CN0 A;  1HP8 A;  2NLJ C;  1HDJ A;  1VF5 B;  5A9G A;  3ICX A;  3SYQ A;  1J5E B;  5LYJ B;  3F5T A;  1H8E G;  1WA8 B;  3OR6 C;  4DRX A;  3N2K B;  3K04 A;  3A8T A;  4MSW C;  3JAW A;  2ZD9 A;  1GN2 A;  1NTM H;  4I50 B;  4EB6 B;  1OCZ C;  4FLU A;  1QR9 A;  4DXW A;  2WSS G;  1Y66 A;  1R1B A;  3SJB C;  2R70 A;  3E22 A;  1BGY H;  4MVM A;  4TWK A;  1GTO A;  4QGP A;  1DLB A;  1BCC H;  4JYY A;  3K5M A;  1W0K G;  4MVO A;  4ZHQ B;  1YIJ V;  4I4T B;  2CH7 A;  2KG7 B;  3L72 H;  1GM8 A;  4QE7 A;  4I9W A;  1SER A;  4PA9 A;  5K1X A;  4DV4 O;  2ZQM A;  2YI9 A;  4G28 B;  4D6T H;  1JR9 A;  1Q43 A;  2UXC B;  1GAX A;  4X20 A;  2CK3 G;  3RYH A;  3ZJZ A;  3FKS G;  4FK5 C;  1V55 B;  4AQY B;  2IW5 A;  1AP5 A;  1F4N A;  3RYI B;  2EIL B;  2HR3 A;  3W7X A;  4X88 A;  1K97 A;  4DV2 B;  1M5I A;  1B6Q A;  5LBQ A;  3ETG A;  3G67 A;  5LP6 B;  1RP3 B;  4JZG A;  2JJ2 G;  1FFT B;  4WCE V;  3TXS A;  5IYZ A;  2JK5 C;  5IJ0 A;  4NR1 A;  1SA0 A;  4RUF A;  2JGD B;  1K5Q A;  4O2A A;  3RGB A;  2YUA A;  2Y4U A;  2ZT9 B;  2ZM6 O;  3IAY A;  4X66 B;  1OCC C;  4B3S O;  4PI0 A;  3CCR V;  4TOI A;  3JAR B;  4UCT A;  1CXZ B;  4I55 B;  3HR0 A;  5EIB C;  1P7B A;  3SJA C;  3OTO O;  1N4C A;  3AG4 C;  1M56 C;  3ABM B;  3F7V C;  2Y69 C;  1DF4 A;  3K5N A;  2NN4 A;  3LUT B;  4HZ3 A;  1YEW A;  3ETQ A;  3LDD A;  5ITZ A;  5B66 Z;  2UUC O;  1YJ9 V;  2VRZ A;  1K9M W;  4JI8 O;  3CWB H;  2QWR B;  3BAA A;  4JAS A;  3S3X A;  4DR1 B;  1IBK O;  2ADQ B;  2UXB B;  1BZK A;  3OAA G;  2W0X A;  4JI5 B;  1IXB A;  4JTD B;  1NKD A; 
#chains in the Genus database with same CATH homology
 4H37 A;  3IC7 A;  2IJH A;  3OUS A;  2Q69 A;  4ZBM A;  3ZMU A;  5EC1 C;  3OMA B;  4LP8 A;  2IH1 C;  1VQ7 V;  3E83 A;  4U7O A;  3SJQ C;  1NVP B;  2DYR B;  1VQ9 V;  2P6J A;  5EBL C;  1WLE A;  1R73 A;  4PDR A;  2F43 G;  4Q20 A;  2X6B A;  3BEH A;  4PDL A;  1OCZ B;  1OCR C;  4FIP C;  5H6R A;  1KD1 W;  4OXS A;  3KG2 A;  4MS2 A;  4FPP A;  2DQ3 A;  3DTU B;  2W6I G;  1KQS U;  2XAJ A;  3W7U A;  4JYB A;  3JD3 A;  1XL4 A;  2Z3Y A;  1K3E A;  3D3I A;  4U7N A;  3EFF K;  3ZN1 A;  2UXX A;  1H8H G;  5LHI A;  3TET A;  1F4M A;  1JCH A;  1VQP V;  4UXN A;  2JIZ G;  2OTL V;  4UV8 A;  5L3B A;  3CCM V;  1YTF B;  5B1N A;  3CXC U;  3JD2 A;  3ASO C;  1PKX A;  3B8N A;  5LGN A;  2EZO A;  3E8G A;  3WG7 C;  2ZXW B;  1KP3 A;  3CMA V;  1FS0 G;  1E79 G;  3FB8 C;  3LNM B;  1I5X A;  5EC2 C;  3ZRW A;  4MVU A;  2EIK B;  4MVZ A;  4R8C A;  2FTK A;  3TCU A;  1K33 A;  3SPC A;  1M9N A;  1W0J G;  2X6A A;  2WLL B;  2WLK A;  3ETE A;  1BL8 A;  3FB7 C;  2XND G;  4RQE A;  5B1A C;  4WFB V;  1K7D A;  2ZR2 A;  4WFE A;  1K34 A;  3K79 A;  1G8M A;  1MSW D;  2HLD G;  1KC8 W;  5CA3 A;  2UXN A;  2ITC C;  4P30 A;  1DTO A;  3JCZ A;  2DYS B;  3W7T A;  4WFG A;  3W7S A;  1S77 D;  2QM8 A;  4WFA V;  2JEU A;  1AJQ A;  3ABL C;  3ASN C;  4QIW F;  3VBB A;  1JJ2 U;  1R3J C;  3FYI B;  5IY5 B;  3K0D A;  5H6Q A;  3ZRS A;  4JAU A;  2DW4 A;  4MVQ A;  3M99 B;  1R6N A;  2JDI G;  1GO3 F;  4L87 A;  5GW7 A;  3CC2 V;  4MTX A;  1JVM A;  3E8B A;  2K1E A;  3K3W A;  2P7T C;  3SPH A;  1K4D C;  4JPR A;  3RVZ A;  4TT3 G;  3PJS K;  3RW0 A;  2P67 A;  4G27 B;  1R3L C;  5B1B C;  2C2A A;  1S5H C;  3E8F A;  1VQK V;  2EJR A;  3IFX A;  2XAG A;  1FXV A;  3HPL C;  4QPK A;  3STL C;  1VQO V;  1F23 A;  1YSC A;  1H2G A;  2WLN A;  2PI4 A;  5LGT A;  2IJI A;  3FB5 C;  3K03 A;  5HFM A;  1RPR A;  3RBZ A;  3LSS A;  5J9P C;  4RO2 A;  3UM7 A;  3ABK C;  3STZ C;  3AG2 C;  2X7R B;  2WLL A;  3W7W A;  3CCU V;  3X2Q C;  3OFN G;  1G4Y B;  3T2M A;  3K9A A;  2ATK C;  1P4R A;  5IDJ A;  4DO2 A;  1OHH G;  1Q82 W;  3NXS A;  3ZIA G;  4CBC A;  4MVS A;  4PA6 A;  1NR7 A;  1OZ0 A;  3AG4 B;  1ENV A;  1M56 B;  2OCC B;  3E2E A;  3JYC A;  1XL6 A;  1AJP A;  2DYR C;  5B3S C;  3SYO A;  4PA4 A;  2Y69 B;  3A0R A;  1Q7Y W;  5L3F A;  2QTO A;  2B1G A;  5HFL A;  1QCE A;  2XAQ A;  1TUE B;  3JD0 A;  4F4L A;  5KUK A;  2X6C A;  1M57 B;  3OEE G;  4G2K A;  3T1C A;  4WFH A;  1V55 C;  1FXH A;  3CME V;  1ROP A;  2EIL C;  4XBF A;  3JD1 A;  2JEX A;  5IYD O;  1SRY A;  5FL7 G;  1VQ8 V;  3CD6 V;  4JF3 A;  1SZT A;  1AI5 A;  5E1A C;  2ZDI A;  1VQN V;  1QLE C;  3SYC A;  1CEZ A;  2KB1 A;  4X89 A;  3B8M A;  4MW8 A;  2W6J G;  2B5U A;  3GB7 C;  3K08 A;  3ZRX A;  1R3K C;  1OCO B;  2HJF C;  3AG1 C;  3ML0 A;  2ZXW C;  1RPO A;  3QO5 A;  4BIU A;  1R3I C;  1E1R G;  4PA7 A;  3G71 V;  4GCZ A;  5CBG A;  3AG3 C;  2ZR3 A;  2YSU B;  4JTC B;  1YJN V;  2QE7 G;  1QVG U;  1QR8 A;  4UVB A;  1DF5 A;  3OW2 U;  4N23 A;  2EIJ C;  5LGU A;  3OR7 C;  1V54 C;  4R6Z A;  2WLM A;  5CBF A;  1NJI W;  4JTA B;  4GX2 A;  1EZJ A;  1PNM A;  1AI7 A;  1S0V A;  4H33 A;  3CCE V;  5L3G A;  4WF9 V;  3VOU A;  3I56 V;  3R65 A;  2HG5 C;  3ABT A;  3E86 A;  1J95 A;  4EKW A;  1JX9 A;  3BY6 A;  1OCR B;  3F5W C;  5L3D A;  1YJW V;  4MTG A;  4N21 A;  1YI2 V;  2R9R B;  4JYC A;  1PNL A;  4QNH B;  1GK9 A;  2GHY A;  1BHA A;  2XAS A;  3MD0 A;  1S3J A;  1GM7 A;  1AJN A;  3P30 A;  2HVJ C;  1F51 A;  4QE9 A;  2QM7 A;  5CMU A;  3CCQ V;  4R7C A;  3ZMS A;  2EIN C;  5DM6 V;  4P2Z A;  3ZRV A;  3ZMV A;  5LHH A;  2YEV B;  2BOC C;  3CC7 V;  2WLJ A;  5EBW C;  2IJK A;  3E89 A;  1PL0 A;  3ABM C;  2XAF A;  3ZN0 A;  3MHH C;  4Z1M G;  4LBE C;  1VQ5 V;  1S76 D;  3OMI B;  1K8A W;  1FXK B;  1NR1 A;  1I5Y A;  2DWD C;  1CPY A;  4QPJ A;  1ZWI C;  3SPJ A;  3ASO B;  4UV9 A;  4FMT A;  4FJC C;  1HWY A;  1RM1 B;  2JJ1 G;  3K0G A;  5B1O A;  2W0F C;  3WG7 B;  1BHB A;  2EIM C;  3OE7 G;  5KA5 A;  3MHS C;  5IYB O;  1VQM V;  3LDC A;  1PNK A;  4KUM A;  3K06 A;  3CP1 A;  3OGC C;  4HAM A;  3ZMT A;  1GM9 A;  3D36 A;  1KKD A;  1CP9 A;  3UKM A;  1NH2 B;  1ORQ C;  1VQ4 V;  1YHQ V;  4CZZ A;  2GSM B;  1OCC B;  1PD3 A;  2Z5U A;  2Q68 A;  4MTO A;  1N8R W;  2AHZ A;  3ABL B;  3ASN B;  2NNU A;  4ZKI A;  4PDM A;  2R9I A;  4MW3 A;  4RUE A;  1UJW B;  5CN0 A;  2QEX V;  2NLJ C;  2WPD G;  2AHY A;  1YIT V;  1L1F A;  3F7Y C;  1M90 W;  2WLH A;  3SYQ A;  4I5S A;  2YEV A;  3H01 A;  1K73 W;  2H8P C;  1M57 C;  1H8E G;  3OR6 C;  4PA3 A;  5H9C A;  5BZB A;  1QVF U;  3K04 A;  4KFM A;  1M1K W;  4MSW C;  1EFR G;  2ZD9 A;  1FXK A;  4P9O A;  3CCS V;  3SYP A;  4XDJ A;  1AI6 A;  1OCZ C;  3OEH G;  1H38 A;  1QR9 A;  4XDK A;  4DXW A;  2WSS G;  3FB6 C;  1NH2 D;  1Y66 A;  4KP4 A;  3TK1 A;  2A9H A;  4XDL A;  2Q67 A;  4MT8 A;  1LNQ A;  2EBO A;  1QBZ A;  2B1I A;  3G6E V;  3ABK B;  2LFR A;  3AG2 B;  2V7Q G;  4MVM A;  3CCJ V;  3AEI A;  3FYE B;  3E8H A;  1GTO A;  1KEC A;  4TWK A;  3X2Q B;  1QLN A;  1DLB A;  2D3O W;  1JOY A;  1W0K G;  4MVO A;  4JAV A;  5L3E A;  2V1D A;  1YIJ V;  4J9Z B;  1S72 V;  3WFV A;  1Y4M A;  3SPG A;  1GM8 A;  3P32 A;  4QE7 A;  4BAY A;  5KUM A;  4I9W A;  2WLI B;  1SER A;  1MG1 A;  4PA9 A;  5B3S B;  4ASU G;  1ARO P;  1K92 A;  2ZQM A;  2OT5 A;  3OM3 B;  3HB3 B;  2EIK C;  4G28 B;  1GMG A;  1NBM G;  3B77 A;  4JGS A;  3SPI A;  2OTJ V;  1NQT A;  1MOF A;  2XOK G;  2CK3 G;  1BMF G;  4GX5 A;  3ZJZ A;  1COW G;  2DWE C;  2HFE C;  3FKS G;  4FK5 C;  1SES A;  1V55 B;  3I55 V;  2IW5 A;  1F4N A;  2EIL B;  2X0L A;  2HR3 A;  2DYS C;  3W7X A;  2WWW A;  2IU3 A;  2LP7 A;  4X88 A;  3ETD A;  4UVA A;  3OMN B;  1VQ6 V;  1K97 A;  4GT1 A;  3CCL V;  4UUJ C;  3SYA A;  2DQ0 A;  2WAM A;  1QLE B;  4UVC A;  4QJF B;  3ABU A;  1B6Q A;  5IY5 C;  1JQ0 A;  1FXK C;  5LBQ A;  1GKF A;  3ETG A;  5IYC O;  1RM1 C;  2H94 A;  3EHB B;  3AG1 B;  2BOB C;  1NVP D;  3G4S V;  1MAB G;  2EZP A;  2JJ2 G;  2M7W A;  3AG3 B;  4GX0 A;  3CPW U;  4P9P A;  1FFT B;  4WCE V;  4YXW G;  2EIJ B;  5LHG A;  1V54 B;  2IJJ A;  4BW5 A;  2JK5 C;  4HYO A;  1SET A;  2WLI A;  4X8A A;  1Q86 W;  4RUF A;  4GX1 A;  2ZDI C;  1K5Q A;  1K5S A;  4J9Y B;  5EK0 A;  3RVY A;  3T4Z A;  1IXM A;  3CC4 V;  3QO8 A;  3JD4 A;  1VQL V;  2A0L A;  1OCC C;  4RQF A;  3CCR V;  2HKO A;  4PEL A;  5B1A B;  1WPX A;  4R50 A;  4RAI A;  1YTF D;  5CBH A;  2XAH A;  1K4C C;  2EIN B;  3LSQ A;  3CYO A;  1P7B A;  1THZ A;  2HVK C;  3GWO A;  2PI5 A;  3AG4 C;  4PDV A;  1M56 C;  2OCC C;  3ABM B;  4LCU C;  4MVR A;  2QA4 V;  3ZCC A;  2IU0 A;  5C93 A;  3F7V C;  1E1Q G;  1DF4 A;  2A79 B;  2Y69 C;  4WFF A;  3IGA C;  4E2L A;  3LUT B;  4HZ3 A;  3E35 A;  3LDE A;  4BIZ A;  2EIM B;  3LDD A;  2ITD C;  1AR1 B;  5DN6 G;  3CCV V;  3QO7 A;  5L3C A;  4MTF A;  5B1B B;  1YJ9 V;  1AI4 A;  1K9M W;  5KA6 A;  2LFS A;  3T4D A;  1R6K A;  2MK3 A;  3OUF A;  4TSF G;  1JPX A;  2Q6A A;  4JAS A;  5EBM C;  3DGE A;  3QNE A;  4LC1 A;  2Y48 A;  2P90 A;  1OCO C;  1KP2 A;  3ZMZ A;  1W2B U;  3OAA G;  1Q81 W;  3ZRW B;  2QKS A;  1EBO A;  4JTD B;  2IH3 C;  1NKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...