3HPLC

Kcsa e71h-f103a mutant in the closed state
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVHTATTVGYGDLYPVTLWGRCVAVVVMVAGITSAGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
molecule keywords Antibody Fab heavy chain
total genus 36
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hplC00
4LCUC 1V55C 5B1AC 3TCUA 3E86A 4QE9A 1K4CC 3FB7C 2EIJC 3F5WC 3LUTB 4J9ZB 2NLJC 4MW8A 3K06A 4MTGA 5EBLC 4GX5A 2WLLA 4PDLA 4RUFA 3LDDA 2Y69C 1M56C 4WFEA 1OCCC 2JK5C 3SYOA 3ZJZA 3T4ZA 3UM7A 1J95A 3ABKC 4H33A 5B1BC 3LDCA 3FB5C 4WFGA 1LNQA 3SPIA 3HPLC 4H37A 2Q6AA 3F7VC 3SYPA 3T1CA 5EC2C 1R3LC 4LBEC 4P30A 5EC1C 2EINC 1R3IC 3OR7C 2Q69A 3RW0A 4DXWA 3OUFA 3SJQC 2H8PC 2OCCC 4MVRA 4PDMA 2W0FC 3ASOC 4MVZA 4XDKA 2WLJA 1KKDA 2WLKA 2BOBC 3IGAC 3E8HA 2WLLB 3K04A 2A0LA 2WLHA 4ZBMA 2ZXWC 2ITDC 4I9WA 1P7BA 1ORQC 3K08A 3OUSA 3R65A 3OR6C 2BOCC 3AG1C 4MTOA 3E89A 4R7CA 1OCOC 1K4DC 4P2ZA 2ZD9A 3PJSK 2P7TC 4RO2A 3SPGA 4MTFA 4MVOA 3FB8C 1ZWIC 4UUJC 1R3JC 3RVZA 5EK0A 2AHZA 2HJFC 2EILC 2EIMC 2HVKC 4R6ZA 3E8GA 3T4DA 4MS2A 4P9PA 4F4LA 3WG7C 2X6CA 3E83A 1M57C 4MSWC 3KG2A 2K1EA 1R3KC 3OGCC 3TETA 3SYCA 5EBMC 4PA6A 2IH1C 4EKWA 4PA4A 4XDJA 2EIKC 2ITCC 2WLIA 4MVSA 3LNMB 5CBHA 2DWEC 4G27B 2IH3C 2Q67A 3EFFK 3LDEA 4P9OA 3STLC 3ZRSA 4G28B 2QTOA 3E8FA 2HG5C 4MVUA 4PDRA 3K0DA 5IY5C 3K0GA 4GX2A 2DYSC 2YEVA 3SPJA 2WLNA 4KFMA 1XL4A 2A9HA 2X6AA 1XL6A 3GB7C 4QE7A 5EBWC 1OCRC 3ABLC 1QLEC 4JTCB 5J9PC 4BW5A 5CBFA 3F7YC 2HVJC 4QNHB 1OCZC 4LP8A 1G4YB 2AHYA 2WLMA 3AG3C 4R8CA 4RAIA 3SYQA 5BZBA 2ATKC 3K03A 4J9YB 2Q68A 4JTDB 4X89A 4JTAB 4MW3A 2DYRC 4R50A 2A79B 3SYAA 3VOUA 4PA7A 4TWKA 3RBZA 4CBCA 5B3SC 3IFXA 5KUKA 2DWDC 4OXSA 4GX1A 3SPCA 3RVYA 5CBGA 2HFEC 4GX0A 4HYOA 3BEHA 5KUMA 3SPHA 3AG2C 4MVQA 4MVMA 4PDVA 4WFHA 4X8AA 1BL8A 5E1AC 3ABMC 3T2MA 2QKSA 4PA3A 4XDLA 2R9RB 4RUEA 3AG4C 3UKMA 4X88A 2KB1A 3ASNC 1S5HC 3E8BA 1V54C 3JYCA 4HZ3A 4PA9A 4WFFA 3STZC 2X6BA 3X2QC 1JVMA 3FB6C 2WLIB
chains in the Genus database with same CATH superfamily
1SA0B 4LCUC 3E86A 4JV5B 2W6JG 4GZRB 4OX9O 2WLLA 3OT7A 1YITV 4LF6B 1HNXO 3ABKC 2ZCEA 4WFGA 3P32A 3AG3B 3Q4HB 5JVDA 2CGNA 2FTKA 3W7WA 1HWYA 4DR5O 3JATA 5C93A 2EILB 1KU9A 3RYFB 1THZA 2DYRB 4RQFA 3ZEDA 3OGIB 1KP2A 1MSWD 3IAYA 1KB9F 5H2FZ 2BOBC 1VF6A 3A0HZ 2PTMA 4Z1MG 4JYCA 4DW0A 4B3SO 3K08A 3OUSA 5L3EA 4MTOA 1YXBA 5L3GA 2OCHA 2Z3YA 1DK1A 1HR0B 1XHZA 1SQBH 2VWJA 4X1YB 1KC8W 1B04A 1AI6A 3KG2A 4J10A 1V54B 2ITCC 2HEPA 4NXNB 4I55B 4MVUA 1M5IA 2F66C 2IBZH 5K1XA 2WLNA 2R9IA 1TAEA 4LF7B 4I0XB 3MD0A 1OCRC 1I08A 1JPXA 4JAAA 4DR1B 2E76B 4QGPA 4OPAA 4X89A 3T1HO 1LUWA 2QM4A 1H2NA 4FLWA 2RQ6A 4GKJO 2QTSA 3ZX6A 4I50A 1Y4MA 1CPYA 2RMKB 1FPOA 2GBOA 2VQEO 1WA8B 3ABTA 4CH6A 3NR7A 2NLJC 1Q86W 3K06A 2PI4A 1KD1W 3PN1A 2JK5C 1AI7A 5JCOC 1SQXH 5B1BC 3D8CA 2UU9B 3M8AA 1R3IC 4TV9B 1GTOA 1I5YA 5EYPA 2H8PC 1ROPA 4L87A 2FYUH 4EFEA 1EFRG 3DC6A 2Q0OC 5KA5A 2X7RB 1YJ9V 3RYFA 3OR6C 1H2SB 4JPRA 2UXDO 2XTAA 3X2QB 4R7CA 5EIBC 1ZX3A 3W7XA 4K35A 5D5QA 2ADQB 5JVDB 5J2TA 1FXHA 4JI6O 3UO2A 4H13B 1H2GA 3E8GA 4BWAA 4F4LA 5C8YB 3EVKA 1L0LH 2EIKB 3OFNG 3SJBC 4PA6A 1XMOB 4FLXA 2EIKC 4YY3B 4LNUA 3ZBHA 1ZTEA 5LMUB 3K0DA 4JYAO 2D2CB 4FM2A 1RM1B 3WB2A 3RYHA 4MT8A 4YXWG 5FLXN 5IY5B 2CTWA 2M6YA 4ABMA 1VQOV 3JD3A 4FVMA 3AG3C 4R8CA 2WWWA 4JI5B 4JTDB 5K1PA 2VWKA 2XNDG 1SQFA 2IJHA 3LSQA 5KUKA 2JIZG 3WG7B 4GX1A 5ITZA 3SDLA 5LHGA 2EX3A 1AR1B 5BR8O 1UJWB 1URFA 5FNVA 2OYQA 4O2BA 5KAFZ 3RYHB 2ZNJA 2EJRA 1OCCC 3RGBA 3ZJZA 3LDCA 2OTLV 4BIUA 2LO1A 3N27A 1SKVA 1OCOB 3JD2A 4MVRA 4LF7O 5LP6A 4KUMA 5C8YA 1Y76B 1ZUQA 4UCVA 4DUZO 3ASOC 2R9AA 1HDJA 2JGDB 1LUVA 2B5UA 5J2TB 2ZXWC 1VQ4V 3VQWA 3G4SV 1ORQC 1RPRA 1AJNA 1XEQA 2DW4A 1N36B 3R66A 5EIBD 3B8NA 3HB3B 3SPGA 3RN4A 1XHXA 3B09A 4X62B 1P7GA 2F4VO 4YJ2B 1Y66A 3WG7C 4YJ3A 2YIDA 2K1EA 3BY6A 4GYCB 1XREA 1MZFA 2ZE8A 4LFCO 4LF5O 3AK2A 2WA3A 1E1RG 2A7WA 4O4HA 1QQCA 2Q8VA 3DTUB 3HKCA 4B3RO 1FYJA 1FXKC 3UT5B 4KL1A 1JJOA 4QPJA 1QLEC 3N2GB 2E75B 1QLNA 4DR5B 2AHYA 4J80A 2P5OA 1UFIA 4B3MO 4I50B 4IIJB 4MW3A 3JD4A 4LF9B 3CE2A 1HNWO 2YXLA 2EZOA 3ZRXA 3S3XA 4LF8B 3TXQA 3RVYA 5CBGA 3P3PA 2VQFO 3AK1A 4K0KO 2QWQB 4LF4O 3A0BZ 1K33A 1JVMA 4BAYA 3LSSA 3VQYA 4RQEA 2CE4A 3ICXA 3BPZA 3LDDA 4FLUA 1K8AW 1D5AA 3P30A 3FB5C 1DGSA 1LNQA 2YUAA 3VBBA 1PM9A 2YICA 1R3LC 3ZHTA 4WCEV 2UUAB 3FYEB 1GN3A 2Q73A 1CXZB 5CA0B 3DXRB 4X1YA 5B1BB 2YIBA 3H1HH 2NR5A 3DGEA 3CRCA 3QO8A 4CH5A 2VS0A 2GTAA 4DV6B 4IHJB 3HKEB 4I9QA 1SZXA 1Q82W 1OCOC 5CA1B 4U7OA 2AZ0A 4DYLA 3O9OA 1ZLZA 4TV8A 4GKKB 3C3SA 1SQGA 2ZT9B 1AI4A 3ASOB 3OMAB 3GWKC 4AQYB 1H8HG 1B6QA 1I0HA 5IYDO 5L3DA 4UCUA 3JATB 4XDJA 2LGQA 1YVWA 2GTSA 3STLC 1WJZA 4X9QA 3CCUV 3JSNA 4DV7B 1S77D 3VQVA 2Q0AA 2QGNA 4E4EA 4AILC 1AROP 3CHXA 3AG4B 5EBWC 5JQGA 1Q8IA 1CEZA 4BW5A 2HVJC 3AG2B 4JASA 4QNHB 4LP8A 3CPWU 4GT1A 5IT9N 4CH3A 1PPJH 4W4KA 1S76D 3CD6V 1XMOO 1R73A 1IURA 1JMKC 1S5LZ 3VQXA 1P49A 3AEIA 4DUYO 2UXCB 4X65B 4FM0A 3RYIA 4PDVA 5KX5A 3QO5A 2DMXA 3ABMC 1NH2D 5F2VO 1N32O 2F95B 1V55C 3CRAA 4ICGA 2UXDB 4QIWF 3ETQA 4DR7O 2XHBA 1DTOA 4RUFA 2XAJA 4X1IB 4IT5A 3UM7A 4H33A 2DJVA 3CS5A 3RYCB 3A8TA 2E3CA 3F7VC 4DV5O 3JALA 5HFMA 3JALB 4DRXA 4TSFG 1FFXA 3RW0A 4DXWA 1MG1A 2F23A 1KP3A 2BTQB 4XDKA 1PD3A 1AP5A 3K04A 3K3WA 4BIZA 5IWAB 3OM3B 4TQDA 3FAVB 4B3TO 1YJWV 1NR7A 5GTIZ 1VIBA 1KUQA 4MTFA 2YIBD 2QDOA 2EILC 1N33O 3TJTA 4NTXA 4MSWC 1Q90D 4DR7B 3OGCC 3T1HB 2Q7GA 4U3JB 2XUMA 3E35A 4Z2WA 1S3JA 5JQGB 2QWRB 4CC5A 3H1KH 3P3NA 2QEXV 4EFBA 2CH7A 4X1KA 5BMVB 4QE7A 3GB7C 1I94B 4LH7A 4W4LA 4UV9A 4F6EA 3OAAG 5EZYB 4YHHO 4D6TH 3OE7G 1FD9A 3CMAV 2ATKC 4RWUA 3VOUA 4JF3A 1YTFD 2CAZC 4G2KA 3CCEV 4JAVA 2JS3A 1YEWA 4LFBO 4PV1B 4CH4A 4O4IB 1NVPD 3ZCCA 1FKAO 4DV7O 2LW1A 1XNQO 4PI2A 1WB7A 4X88A 3STZC 4PA9A 3J7AU 4B08A 4MVSA 4LF8O 2NNUA 3FYIB 3H1IH 1MABG 2QJ1A 4MW8A 4J41A 4NB5A 2LFRA 4GX5A 4B3SB 1YHQV 5JCOA 3T4ZA 1B06A 3CCJV 2JRIA 3BRCA 3IC7A 2DN9A 3E22A 4LBEC 1IBMO 1AB3A 1KKCA 5JH7B 3OD4A 3OUFA 2P6JA 3ZMZA 1N0JA 3CP1A 1BCCH 3IGAC 4N21A 2KKWA 3THOA 2BTOA 2FB5A 1NTMH 1H2LA 1MMMA 1J5EO 1VQNV 4O4JA 3OTOO 4GCZA 2W6IG 1G1XB 3LSUA 4NXMO 3D3IA 1OHHG 2B1GA 3OEHG 2ZINA 1M56B 1F4MA 1KMIZ 3U0ZA 2HHHO 2ZR2A 2YS8A 4JI8O 1VARA 3H1LH 2QM7A 3ZRSA 1PP9H 1RPOA 1HW7A 1VQ6V 2VQFB 2MW2B 3J81N 5H6QA 4TT3G 1XL6A 5LBQA 1GAXA 1XQ8A 3WFVA 1FFTB 3MAQA 1B3QA 3CMEV 2HR3A 5B3SC 1NH2B 4JI6B 1GK9A 5IYBO 2IU3A 4TUYA 1WLEA 2FKXA 1I7FA 3UO3A 2JJ2G 4ASUG 3IJ4A 3T1YB 4WFHA 3APQA 4YIOA 3JAKA 3D36C 3UKMA 2PUSA 2KB1A 4FZ0A 3JARB 1XNRO 1QR9A 4IL6Z 4AHCA 3FB7C 5IYZB 4DR2O 2YC0A 2QSAA 2UUCB 2HKOA 2BE3A 1BSMA 1QU7A 3C3TA 4JI3B 1DF5A 5EC2C 4DV5B 2PF4E 3OW2U 3TK1A 1W0JG 1NKDA 2XOKG 2OCCC 4CS2A 4YY3O 1K9MW 3BHPA 1YI2V 1ZAUA 3E8HA 5KHHA 2XAGA 4I4TA 2ZM6O 4I9WA 3RT3C 4O2BB 5CA3A 4EB6A 1BHBA 1D5NA 3L71H 5FNVB 1Y74B 2ZE5A 2IJKA 3K79A 3ZMUA 2P7TC 4RO2A 4FFBA 4DV6O 4QJFB 2ZM6B 3BA8A 3CX5F 2OIGA 2N74A 3CB2A 5LMNO 2ZDIA 1SETA 5J2UB 1GH6A 4TQFA 1Q5OA 1Y67A 1Y74A 5B1AB 1OZ0A 1PNKA 2IH3C 4EB6B 4A5UB 3CCQV 3KCYA 2KG7B 1Q7YW 5KHGA 4G28B 4ZI7B 1JJ2U 1GMGA 4I4TB 1QNMA 5IJ0A 3W7SA 2UUCO 4NVPA 3ETEA 1QBZA 1YTFB 1SF9A 3BA9A 4LC1A 4LNUB 5CBFA 2PGGA 1VQPV 2UUBO 4JI4O 4PHZA 2EJ7A 2Q5ZA 4N23A 4X66O 1N8RW 1M93A 1TGOA 3AG2C 2NN4A 4FLTA 4JYAB 1HNWB 5KHJA 4I7ZB 2ZXWB 4HZ3A 3N2KB 3JARA 3TCUA 1BGYH 1BS3A 2JVDA 3B8MA 3TXSA 4HBNA 1N34B 5L3FA 3QF7A 3DSQA 3ML0A 4WFAV 3SJAC 2ZNIA 1JR9A 4X65O 1Z2GA 5EYPB 4F6RA 1IVSA 4TV9A 1SRYA 4LFCB 1AP6A 1OCRB 3OR7C 1VF6C 3SJQC 4J42A 4B3TB 2WSSG 4NKGB 4NXNO 1Z5VA 4JI4B 2XT9A 4OGQB 2WLJA 3K9AA 1NBMG 3CJHA 1WA8A 2M7WA 1WPXA 4Z1VA 5IE9A 2Y0PA 2CGOA 1AR5A 2JEUA 1A32A 2ZR3A 4PD4F 1RSOA 4DR2B 4UUJC 1N0NA 4Q20A 3RVZA 5B3SB 1BZKA 4R6ZA 5AG2A 1IBLO 4MS2A 1IX9A 4DUZB 5DM6V 1H38A 1AVMA 3HKBA 3SYCA 4PA4A 3G6EV 3BAAA 3FFQA 1WAZA 1S0VA 1RM1C 1XDCA 2Z0AA 2CTQA 1WP8A 3KKYA 4O4JB 5H9CA 2O57A 3K0GA 2R72A 1DF4A 1K34A 2G38A 1L8DA 5JJNB 4GKJB 1EN6A 1U97A 4LF5B 4I55A 1QVFU 3CRMA 1SQVH 4YIPA 1XOUA 4NR1A 5JH7A 1RFYA 1XNQB 2Q68A 2ZKOA 1M4UA 1VMGA 4LR3A 3JAMN 4IGGA 2RDCA 1QCEA 2FL4A 4MVMA 4ZIBA 5E79Z 4UVAA 2RCVA 2QM8A 4RUEA 1NT2B 4WFFA 1V54C 1K92A 2PI5A 4K3AA 2WLIB 4J7KA 4FLZA 3G71V 2OT5A 4QPKA 3QTCA 3GVMA 1J95A 4DO2A 4IYIA 4NXMB 3T1YO 2P4KA 1PNLA 1BMFG 4FK5C 3Q4HA 3CWBH 1K7DA 5BMVA 2WLLB 3LNNA 1FJGO 1NTZH 1SA0A 2Q9LA 4DK0A 3K58A 3ZS8C 4D7SA 1JX9A 1ZSPA 2DQ3A 1GN6A 1MA1A 5JWPA 2QWPB 3HKDA 4P9PA 1VF7A 1JFFB 3QO7A 4IYHA 4LH6A 2X6CA 1NU1H 1M57C 4OX9B 4X20B 1EZVH 4H44B 4JYYA 4FPPA 4LFAO 4P9OA 2UU9O 1SS3A 3ZHSA 3BFRA 1W0KG 1X59A 5B66Z 2YEVA 1XL4A 1NZ6A 2BTQA 3H1JH 3KCXA 4JAUA 3O65A 3BABA 2N05A 4DV4O 4DV1B 4B7EA 3JD0A 4H0LB 4J9YB 3L70H 1P84F 4CBCA 1O9HA 1GN4A 4ZOLB 3AG7A 5IYCO 4JYBA 4DV2O 2UXCO 2YEVB 4X8AA 5LGNA 5BXZA 2PYLA 4BR6A 3TETA 1YSCA 3X2QC 2E5LB 2MK3A 2Y4UA 3F5WC 4J9ZB 2QR4A 2IJJA 3J80N 1SQQH 2F4VB 3HKDB 4UVBA 1S72V 3SYPA 1SESA 4LWSB 1L0NH 2X0LA 3CYOA 4HNAA 2V4DA 1EM1A 1PNMA 4KHPO 4KHPB 1O9GA 2P67A 4EEQA 4PJ0Z 1W2BU 2W0FC 3I5DA 2ADPA 3B40A 2WLKA 2A3QA 1US6A 1R1BA 3QVNA 2ITDC 1P7BA 1OCZB 4UCTA 4O2AB 1M57B 3ZHQA 1AJPA 2BSKB 3G67A 3PJSK 1G6UA 1XUQA 2Y69B 2P90A 4HAMA 5JJEB 1R3JC 2HJFC 1WN7A 2N04A 2HVKC 3ABMB 3JASA 1BQ0A 3E83A 2AXTZ 5IJ9B 4AI8A 3L73H 2CK3G 3ZRWA 5EBMC 3ETGA 4EKWA 1YZBA 2Q7EA 2WLIA 3ZMSA 1MNGA 3HKEA 2YI8A 2PYJA 5LHIA 1M1KW 1QHTA 5IWAO 5HFLA 2LP7A 5DEDA 2YDEA 3FKSG 1OJHA 2B1IA 5J9PC 1U96A 3C90A 4DV3B 1OCZC 4DR3O 4GUNA 2UXBB 4R50A 4UV8A 4PA7A 4TWKA 4FIPC 1JA8A 5LXTB 5KUMA 2DOSA 2WA4A 5LMUO 3ZMTA 4XDLA 3CCRV 3JCUZ 5CB4A 2LGWA 1S5HC 5LMNB 2Z5UA 3K57A 2VQEB 3CSXA 4QE9A 3JCZA 3EHBB 3ZIAG 3ZRVA 1M56C 3L9DA 3HKBB 1QLEB 2RN9A 3BCCH 1VP7A 1AILA 3T1CA 1RSOB 2DE0X 4P30A 3ZRWB 1OV9A 5IJ9A 1VQMV 3N2GA 3JASB 4MVZA 3UT5A 2CTRA 3HKCB 1Q6IA 2WLHA 3S3WA 3DC5A 2RNBA 3CCMV 4JI2O 3RFRA 2BSKA 1N4CA 3G6BA 2F93B 2HHHB 1XBLA 1KQSU 4F6RB 1YF2A 4DK1A 4J7ZA 4YJ3B 5EK0A 2AHZA 2Y0IA 1YIJV 2EULA 4JI0B 4DR4O 1XNRB 2IU0A 4JI1B 1VQLV 1FAFA 2DYSB 3M7MX 5KLVH 4UCSA 4ZKIA 3ABKB 2IH1C 1TUBB 1W59A 5A2QN 4GKKO 2XAFA 5KHKA 1HP8A 3OTOB 3EFFK 2XAQA 3B77A 2Q4PA 3L75H 2QA4V 4B3MB 2JGDA 2K9PA 2R70A 4ZHQA 3RWRD 3WB1A 5LP6B 1FXVA 3K5OA 3K5NA 2W0XA 1HNZB 1AJQA 3SYAA 3CRQA 3U11A 4I5SA 1PL0A 4JI1O 4WBNA 1WP7A 4HYOA 5IJ0B 4NYKA 4ZOLA 1K97A 5LA6A 4PA3A 4LF6O 2KG7A 4Q6GA 1FS0G 1WPBA 3ZHUA 1WB8A 1R6NA 4MTGA 1OCCB 5LYJB 2UXBO 3NXSA 4DR3B 1VQ9V 4DR6B 3M99B 3SYOA 2LFSA 4LF4B 4JGSA 1GM8A 4FJCC 5L3BA 1HR0O 2QKAA 1JOYA 4E2LA 3HPLC 4H37A 2Q6AA 5EC1C 4X20A 4OPHA 1ENVA 1KECA 2FMLA 3W7TA 2ZIMA 4CC6A 4DV0B 4WF9V 2IJIA 3R65A 2QWOB 1NS1A 4UCOA 2ZE6A 1ZWIC 3ABUA 2EIMC 3H9VA 3T4DA 1HNXB 1WNSA 2YXHA 1YJNV 3JSLA 1AR4A 1VQ7V 3QG5A 3CXHF 1BE3H 2Q67A 3LDEA 3U10A 5B1NA 4UB6Z 2A06H 5B5EZ 4DV3O 5TISZ 3E8FA 4PDRA 3JAKB 5IY5C 4JI5O 3SPJA 4TUYB 5FPRA 1PKXA 4JTCB 2P06A 1F4NA 4B7KA 4YHHB 1IZ3A 2AGAA 2DYRC 2A79B 3IFXA 2ODMA 1N34O 1H2KA 4WFBV 1L1FA 2HFEC 3ETDA 4X64B 1E1QG 2Q7HA 1BL8A 3T2MA 1V9PA 2OIEA 4RAIA 4NTYA 2OCCB 2XASA 2JJ1G 3W7UA 2OWOA 4J7JA 5EBLC 2ZQMA 1F51A 5BR8B 4DV4B 2EZPA 1R6KA 4CS4A 2UUBB 1MOFA 3L74H 3JD1A 5A9GA 3F5TA 2XAHA 4FFKA 1K5SA 4PDMA 4I0XA 3D36A 4UVCA 2H94A 2CUGA 2V1DA 2L6LA 3BVOA 2EBOA 4UCRA 4FLYA 1DLBA 2E5LO 4TOIA 3AK3A 5L3CA 1K4DC 2HLDG 3E22B 3CJHB 2IW5A 4MVOA 2UXXA 3CCSV 1R3KC 4L8JA 3MHHC 2JEXA 2LQTA 1TA8A 4G27B 2QKCA 5DN6G 1VQKV 4PI0A 3CC7V 2HG5C 4JZ2A 4JZGA 4DV1O 3MDSA 1EN4A 3A0RA 1S5JA 2ARHA 1F23A 4NTWA 3CC2V 2UUAO 4UFZA 1I5XA 3N2KA 2V7QG 3SYQA 4JI3O 5BZBA 3K03A 3ZMVA 2JS5A 4JI8B 5EZYA 2RJZA 4OXSA 2DQ0A 1LR1A 5CMUA 2P22C 3OEEG 2CH7B 3E2EA 3ZN0A 3AG4C 3E8BA 2JDIG 2X6BA 3K59A 4U3JA 1Y6XA 1K4CC 2GV9A 1D2DA 3LUTB 1UPGA 5LL6Y 1T5EA 1BQZA 1NVPB 1HNZO 4ZI7A 3ASNB 5KHIA 4DW1A 4C7UA 2F1MA 1Q6HA 1COWG 1YDXA 2AZ2A 3FX7A 2EINC 2ZE7A 2Q69A 3WB0A 1SC5B 3FAVA 5J2UA 2H3OA 2WPDG 3GWOA 3ZN1A 4DR1O 2A0LA 1MSDA 2E74B 4FFBB 5LYJA 4O4LA 2P4VA 2YIAA 1GN2A 1IBLB 4JI0O 3CC4V 2BOCC 1FFXB 1M9NA 4DRXB 1GM7A 3E89A 1EZJA 4JI7O 2ZD9A 2KQXA 2AW9A 5LHHA 5LA6B 3K5LA 5B1OA 4J11A 4X62O 1XMQO 5LP6C 4WBNB 3HR0A 2GHYA 4LFBB 3D3QA 3I55V 2HJDA 3K5MA 1N36O 1XILA 4K0KB 3SGIA 3L72H 3WU2Z 1G8MA 1SQPH 1XMQB 3CRRA 1SERA 1K5QA 3ZHRA 1J5EB 1SZTA 1EN5A 1VQ5V 4JI7B 3OTFA 4ZHQB 3OMNB 2DYSC 3RYIB 1NI8A 4KFMA 2X6AA 2ILMA 5IYZA 2UXNA 3UQ8A 1K73W 3F7YC 1IBMB 1TUBA 4JTAB 4B3RB 1EBOA 3RBZA 1RP3B 1ZL8B 4MTXA 5LGUA 1F7YA 1GRJA 1IBKO 3FD9A 4MVQA 2QKSA 3SR2C 1NQTA 3JAWA 1TVKA 3FB6C 4X66B 3G80A 1XI1A 1QR8A 1NJIW 2Y4TA 1M90W 2EIJC 5CN0A 2CDYA 4PDLA 4PELA 1NR1A 3B2EE 2HP8A 3MHSC 4TV8B 2JGUA 5CA1A 1KYOF 1NTKH 2IM9A 2ZDIC 4UB8Z 1I94O 2F43G 4BW9A 5BY1A 5LOVA 1Q3EA 5KMGA 4IHJA 1FXKB 1JCHA 1KKDA 3IC9A 2GUZA 4K8ZA 1CP9A 2ZIOA 5GONA 1MZEA 3DXRA 3SJCC 5CA0A 4FM1A 3AG1C 4X64O 5CB4B 3OMIB 3AG1B 1VQ8V 3TGUH 3UCSC 5JJJB 5LXTA 1N33B 3CCVV 5IDJA 1KBHA 4KXRA 4DUYB 4K8XA 5DECA 4UXNA 2GSMB 2QTOA 5GONB 2YSUB 2LJ2A 1H2MA 2QWNB 2GUZB 1H8EG 4DR6O 2A9HA 1FXKA 5KMGB 2GDSA 3ZHVA 5LOVB 2ETNA 4IIJA 3ABLB 2WLMA 1PL4A 4FMTA 5LGTA 4FZ1A 4O4IA 1E79G 1IBKB 1GM9A 2B9ZA 1K3EA 4AQYO 3EXAA 1VEWA 4FLVA 4GX0A 3SPHA 3QNEA 5E1AC 2D3OW 4O4HB 3ASNC 1N32B 4DV0O 1FJGB 3H01A 4DV2B 1BT8A 2KSDA 2R9RB 4O2AA 1TVKB 5B1AC 1GKFA 3JAWB 3CEIA 2L35A 1Q6UA 2CTPA 3APOA 4X1KB 2Y69C 4WFEA 1P4RA 4YJ2A 4CS3A 1ZL8A 4XBFA 3SPIA 1BHAA 4HNAB 2EIMB 4LWSA 5FL7G 2QE7G 2OTJV 2LW7A 4KP4A 4DR4B 4U7NA 2EIJB 1X4TA 4ZBMA 1YCIA 2WAMA 1Y76A 5GW7A 1IXMA 2BCCH 2YI9A 5H6RA 5KAIZ 5GTHZ 4P2ZA 1V55B 4D7TA 3CXCU 3FB8C 3KZIZ 1QVGU 5D5PA 2YXYA 1R6TA 4BIOA 3I56V 5FPOA 4LF9O 2VRZA 5CBHA 3LNMB 2DWEC 3RYCA 2EINB 5H5NA 4O4LB 2Y48A 4X1IA 1Q43A 4GX2A 1Q81W 1AI5A 5ITZB 1VF5B 2C2AA 3K9SA 3ABLC 3CCLV 5KA6A 1G4YB 1IDSA 3A2FA 3B4SA 1IXBA 5KX5B 2DWDC 1JFFA 3SPCA 3BEHA 1JQ0A 4JV5O 4GLXA 2PY5A 1Z5WA 4U3FH 4CZZA 3JYCA 4JI2B 4LFAB 1PV0A 1GO3F 2PZSA 1TUEB
chains in the Genus database with same CATH topology
2XASA 1V55C 4LCUC 3E86A 4QIWF 2JJ1G 3G71V 2OT5A 4QPKA 2W6JG 3W7UA 1DTOA 5EBLC 4RUFA 2WLLA 2XAJA 2ZQMA 1F51A 1YITV 3UM7A 1J95A 2EZPA 3ABKC 4H33A 4DO2A 1R6KA 4WFGA 3P32A 3AG3B 3F7VC 2FTKA 3W7WA 1HWYA 1MOFA 1PNLA 1BMFG 5HFMA 5C93A 2EILB 4FK5C 4TSFG 3JD1A 3RW0A 4DXWA 2XAHA 1K5SA 1THZA 2DYRB 4RQFA 1MG1A 1K7DA 4PDMA 1KP2A 1MSWD 3D36A 1KP3A 4XDKA 4UVCA 1PD3A 2BOBC 2WLLB 2H94A 3K04A 3K3WA 2V1DA 4BIZA 4Z1MG 4JYCA 3OM3B 3K08A 2EBOA 3OUSA 1YJWV 5L3EA 1DLBA 4MTOA 1NR7A 5L3CA 1JX9A 1K4DC 5L3GA 2HLDG 2DQ3A 2Z3YA 2IW5A 4MTFA 4MVOA 2EILC 4P9PA 1KC8W 2UXXA 3CCSV 3QO7A 1AI6A 2X6CA 1M57C 4MSWC 3KG2A 1R3KC 1V54B 3OGCC 3MHHC 2JEXA 2ITCC 3E35A 4FPPA 4G27B 5DN6G 1S3JA 4P9OA 1VQKV 3CC7V 2HG5C 1W0KG 4MVUA 2QEXV 2YEVA 2WLNA 2R9IA 4QE7A 1XL4A 3GB7C 3A0RA 1F23A 4JAUA 3MD0A 3CC2V 4UV9A 1OCRC 3OAAG 1I5XA 1JPXA 3OE7G 3JD0A 2V7QG 3SYQA 3CMAV 5BZBA 2ATKC 3K03A 4J9YB 3ZMVA 4X89A 3VOUA 4CBCA 4JF3A 1YTFD 4G2KA 4OXSA 5IYCO 3CCEV 2DQ0A 4JAVA 4JYBA 5CMUA 3OEEG 2YEVB 3E2EA 4X8AA 1NVPD 3ZCCA 3ZN0A 5LGNA 1Y4MA 1CPYA 3AG4C 3TETA 4X88A 3E8BA 3STZC 4PA9A 1YSCA 2JDIG 2X6BA 3X2QC 4MVSA 2NNUA 3FYIB 1K4CC 2MK3A 3ABTA 3LUTB 3F5WC 1MABG 4J9ZB 2NLJC 4MW8A 3K06A 1Q86W 1NVPB 2LFRA 4GX5A 2PI4A 1KD1W 2IJJA 2JK5C 1YHQV 3T4ZA 3ASNB 1AI7A 5B1BC 3CCJV 4UVBA 1S72V 3IC7A 3SYPA 1SESA 1COWG 2X0LA 3CYOA 4LBEC 2EINC 1R3IC 1PNMA 1GTOA 2Q69A 1I5YA 3OUFA 2H8PC 1ROPA 2P67A 1W2BU 2WPDG 2W0FC 3GWOA 3ZN1A 2P6JA 3ZMZA 4L87A 2WLKA 3CP1A 3IGAC 4N21A 2A0LA 1EFRG 5KA5A 2X7RB 2ITDC 1VQNV 1P7BA 1YJ9V 4GCZA 1NH2B 1OCZB 2W6IG 3OR6C 3CC4V 2BOCC 4JPRA 1M57B 1M9NA 1GM7A 1AJPA 1EZJA 3E89A 4R7CA 3X2QB 2ZD9A 3PJSK 3D3IA 3W7XA 1OHHG 5LHHA 2Y69B 2B1GA 2P90A 4HAMA 5B1OA 1R3JC 1FXHA 2HJFC 3OEHG 2HVKC 3ABMB 1H2GA 3E8GA 1M56B 2GHYA 1F4MA 4F4LA 3E83A 3I55V 2EIKB 2CK3G 3OFNG 3ZRWA 2ZR2A 5EBMC 3ETGA 1G8MA 4PA6A 4EKWA 2EIKC 1SERA 2WLIA 3ZMSA 1K5QA 1SZTA 2QM7A 1VQ5V 3ZRSA 1RPOA 3OMNB 5LHIA 3K0DA 1VQ6V 1M1KW 2DYSC 1RM1B 4KFMA 5H6QA 2X6AA 1XL6A 4TT3G 5HFLA 5LBQA 2LP7A 4MT8A 3FKSG 4YXWG 2B1IA 3WFVA 5J9PC 2UXNA 5IY5B 1K73W 3F7YC 1FFTB 1VQOV 3JD3A 1OCZC 3AG3C 4R8CA 2WWWA 3CMEV 4JTDB 4JTAB 4R50A 4UV8A 1EBOA 2HR3A 2XNDG 4PA7A 4TWKA 3RBZA 1GK9A 2IJHA 3LSQA 5IYBO 5B3SC 2IU3A 5KUKA 2JIZG 4MTXA 4FIPC 1WLEA 3WG7B 4GX1A 5LGUA 2JJ2G 4ASUG 5KUMA 5LHGA 4MVQA 4WFHA 1AR1B 3ZMTA 3UKMA 2QKSA 4XDLA 3CCRV 2KB1A 1NQTA 1S5HC 1UJWB 3FB6C 1NJIW 1QR8A 1QR9A 2Z5UA 4QE9A 3FB7C 3JCZA 3EHBB 1M90W 2EIJC 5CN0A 3ZIAG 4PDLA 2EJRA 4PELA 3ZRVA 1M56C 1NR1A 1OCCC 2HKOA 1QLEB 3ZJZA 3LDCA 2OTLV 3MHSC 4BIUA 3T1CA 1DF5A 5EC2C 3OW2U 4P30A 1OCOB 3TK1A 1W0JG 1NKDA 2ZDIC 3ZRWB 3JD2A 2XOKG 2OCCC 1VQMV 4MVRA 4KUMA 2F43G 1K9MW 1YI2V 3ASOC 4MVZA 1FXKB 1JCHA 1KKDA 3E8HA 2B5UA 2XAGA 2WLHA 2ZXWC 1VQ4V 3CCMV 1CP9A 4I9WA 3G4SV 1ORQC 1RPRA 5CA3A 1AJNA 1BHBA 3AG1C 2DW4A 3K79A 2IJKA 3B8NA 3OMIB 3ZMUA 2P7TC 3HB3B 4RO2A 3SPGA 1KQSU 3AG1B 4QJFB 1VQ8V 5EK0A 2AHZA 1YIJV 3CCVV 5IDJA 2IU0A 2ZDIA 3WG7C 1Y66A 1SETA 1VQLV 2DYSB 2K1EA 3BY6A 4ZKIA 3ABKB 4UXNA 2IH1C 5B1AB 1OZ0A 2XAFA 1PNKA 2IH3C 3CCQV 3EFFK 1E1RG 1Q7YW 2GSMB 4G28B 2QTOA 2XAQA 2YSUB 1JJ2U 1GMGA 2PI5A 3DTUB 1H8EG 3W7SA 3B77A 2QA4V 3ETEA 1FXKC 1QBZA 2A9HA 1YTFB 1FXKA 4LC1A 4QPJA 1QLEC 5CBFA 1FXVA 1QLNA 1VQPV 3ABLB 2AHYA 2WLMA 4RAIA 1AJQA 4FMTA 4MW3A 5LGTA 3JD4A 3SYAA 4N23A 2EZOA 3ZRXA 1N8RW 1E79G 1GM9A 1K3EA 4I5SA 1PL0A 3RVYA 5CBGA 4GX0A 4HYOA 3SPHA 3AG2C 3QNEA 1K97A 5E1AC 2D3OW 4PA3A 3ASNC 2ZXWB 4HZ3A 1K33A 3H01A 1FS0G 1JVMA 4BAYA 2R9RB 5B1AC 3LSSA 3TCUA 1GKFA 4RQEA 1R6NA 1OCCB 4MTGA 3NXSA 1VQ9V 3B8MA 3LDDA 3M99B 2Y69C 4WFEA 1P4RA 2LFSA 3SYOA 1K8AW 5L3FA 4JGSA 1GM8A 3P30A 4FJCC 5L3BA 3ML0A 3FB5C 4XBFA 1LNQA 3SPIA 4E2LA 3HPLC 4WFAV 1JOYA 4H37A 2Q6AA 3VBBA 1R3LC 1SRYA 5EC1C 1BHAA 1OCRB 3OR7C 2EIMB 4WCEV 5FL7G 3SJQC 3FYEB 1ENVA 2WSSG 1KECA 2QE7G 2OTJV 5B1BB 4KP4A 4U7NA 2EIJB 2WLJA 3DGEA 3W7TA 3K9AA 3QO8A 1NBMG 4ZBMA 2M7WA 2WAMA 5GW7A 1WPXA 1IXMA 2IJIA 3R65A 4WF9V 1Q82W 5H6RA 2JEUA 1OCOC 4P2ZA 1V55B 4U7OA 2ZR3A 3CXCU 3FB8C 1ZWIC 4UUJC 4Q20A 3RVZA 3ABUA 2EIMC 1QVGU 5B3SB 1TUEB 4R6ZA 3T4DA 4MS2A 1AI4A 3ASOB 5DM6V 1H38A 3OMAB 1H8HG 1YJNV 1B6QA 5IYDO 5L3DA 3I56V 3SYCA 1VQ7V 4PA4A 4XDJA 3G6EV 5CBHA 1S0VA 3LNMB 1RM1C 2DWEC 2Q67A 3LDEA 3STLC 5B1NA 2EINB 3E8FA 5H9CA 2Y48A 4PDRA 3CCUV 5IY5C 1S77D 3K0GA 4GX2A 1DF4A 1K34A 3SPJA 1Q81W 1AROP 1AI5A 3AG4B 2C2AA 5EBWC 3ABLC 1PKXA 4JTCB 1QVFU 1F4NA 4BW5A 3CCLV 1CEZA 5KA6A 2HVJC 3AG2B 4JASA 4QNHB 4LP8A 3CPWU 4GT1A 1G4YB 2Q68A 1S76D 3CD6V 2DYRC 1R73A 2A79B 3IFXA 2DWDC 3AEIA 4WFBV 1L1FA 3SPCA 2HFEC 1QCEA 3BEHA 1JQ0A 1E1QG 3ETDA 4MVMA 4PDVA 1BL8A 4UVAA 3QO5A 2QM8A 3ABMC 3T2MA 4RUEA 4CZZA 3JYCA 4WFFA 1V54C 1NH2D 1K92A 1GO3F 2OCCB 2WLIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCU C;  1V55 C;  5B1A C;  3TCU A;  3E86 A;  4QE9 A;  1K4C C;  3FB7 C;  2EIJ C;  3F5W C;  3LUT B;  4J9Z B;  2NLJ C;  4MW8 A;  3K06 A;  4MTG A;  5EBL C;  4GX5 A;  2WLL A;  4PDL A;  4RUF A;  3LDD A;  2Y69 C;  1M56 C;  4WFE A;  1OCC C;  2JK5 C;  3SYO A;  3ZJZ A;  3T4Z A;  3UM7 A;  1J95 A;  3ABK C;  4H33 A;  5B1B C;  3LDC A;  3FB5 C;  4WFG A;  1LNQ A;  3SPI A;  3HPL C;  4H37 A;  2Q6A A;  3F7V C;  3SYP A;  3T1C A;  5EC2 C;  1R3L C;  4LBE C;  4P30 A;  5EC1 C;  2EIN C;  1R3I C;  3OR7 C;  2Q69 A;  3RW0 A;  4DXW A;  3OUF A;  3SJQ C;  2H8P C;  2OCC C;  4MVR A;  4PDM A;  2W0F C;  3ASO C;  4MVZ A;  4XDK A;  2WLJ A;  1KKD A;  2WLK A;  2BOB C;  3IGA C;  3E8H A;  2WLL B;  3K04 A;  2A0L A;  2WLH A;  4ZBM A;  2ZXW C;  2ITD C;  4I9W A;  1P7B A;  1ORQ C;  3K08 A;  3OUS A;  3R65 A;  3OR6 C;  2BOC C;  3AG1 C;  4MTO A;  3E89 A;  4R7C A;  1OCO C;  1K4D C;  4P2Z A;  2ZD9 A;  3PJS K;  2P7T C;  4RO2 A;  3SPG A;  4MTF A;  4MVO A;  3FB8 C;  1ZWI C;  4UUJ C;  1R3J C;  3RVZ A;  5EK0 A;  2AHZ A;  2HJF C;  2EIL C;  2EIM C;  2HVK C;  4R6Z A;  3E8G A;  3T4D A;  4MS2 A;  4P9P A;  4F4L A;  3WG7 C;  2X6C A;  3E83 A;  1M57 C;  4MSW C;  3KG2 A;  2K1E A;  1R3K C;  3OGC C;  3TET A;  3SYC A;  5EBM C;  4PA6 A;  2IH1 C;  4EKW A;  4PA4 A;  4XDJ A;  2EIK C;  2ITC C;  2WLI A;  4MVS A;  3LNM B;  5CBH A;  2DWE C;  4G27 B;  2IH3 C;  2Q67 A;  3EFF K;  3LDE A;  4P9O A;  3STL C;  3ZRS A;  4G28 B;  2QTO A;  3E8F A;  2HG5 C;  4MVU A;  4PDR A;  3K0D A;  5IY5 C;  3K0G A;  4GX2 A;  2DYS C;  2YEV A;  3SPJ A;  2WLN A;  4KFM A;  1XL4 A;  2A9H A;  2X6A A;  1XL6 A;  3GB7 C;  4QE7 A;  5EBW C;  1OCR C;  3ABL C;  1QLE C;  4JTC B;  5J9P C;  4BW5 A;  5CBF A;  3F7Y C;  2HVJ C;  4QNH B;  1OCZ C;  4LP8 A;  1G4Y B;  2AHY A;  2WLM A;  3AG3 C;  4R8C A;  4RAI A;  3SYQ A;  5BZB A;  2ATK C;  3K03 A;  4J9Y B;  2Q68 A;  4JTD B;  4X89 A;  4JTA B;  4MW3 A;  2DYR C;  4R50 A;  2A79 B;  3SYA A;  3VOU A;  4PA7 A;  4TWK A;  3RBZ A;  4CBC A;  5B3S C;  3IFX A;  5KUK A;  2DWD C;  4OXS A;  4GX1 A;  3SPC A;  3RVY A;  5CBG A;  2HFE C;  4GX0 A;  4HYO A;  3BEH A;  5KUM A;  3SPH A;  3AG2 C;  4MVQ A;  4MVM A;  4PDV A;  4WFH A;  4X8A A;  1BL8 A;  5E1A C;  3ABM C;  3T2M A;  2QKS A;  4PA3 A;  4XDL A;  2R9R B;  4RUE A;  3AG4 C;  3UKM A;  4X88 A;  2KB1 A;  3ASN C;  1S5H C;  3E8B A;  1V54 C;  3JYC A;  4HZ3 A;  4PA9 A;  4WFF A;  3STZ C;  2X6B A;  3X2Q C;  1JVM A;  3FB6 C;  2WLI B; 
#chains in the Genus database with same CATH topology
 1SA0 B;  4LCU C;  3E86 A;  4JV5 B;  2W6J G;  4GZR B;  4OX9 O;  2WLL A;  3OT7 A;  1YIT V;  4LF6 B;  1HNX O;  3ABK C;  2ZCE A;  4WFG A;  3P32 A;  3AG3 B;  3Q4H B;  5JVD A;  2CGN A;  2FTK A;  3W7W A;  1HWY A;  4DR5 O;  3JAT A;  5C93 A;  2EIL B;  1KU9 A;  3RYF B;  1THZ A;  2DYR B;  4RQF A;  3ZED A;  3OGI B;  1KP2 A;  1MSW D;  3IAY A;  1KB9 F;  5H2F Z;  2BOB C;  1VF6 A;  3A0H Z;  2PTM A;  4Z1M G;  4JYC A;  4DW0 A;  4B3S O;  3K08 A;  3OUS A;  5L3E A;  4MTO A;  1YXB A;  5L3G A;  2OCH A;  2Z3Y A;  1DK1 A;  1HR0 B;  1XHZ A;  1SQB H;  2VWJ A;  4X1Y B;  1KC8 W;  1B04 A;  1AI6 A;  3KG2 A;  4J10 A;  1V54 B;  2ITC C;  2HEP A;  4NXN B;  4I55 B;  4MVU A;  1M5I A;  2F66 C;  2IBZ H;  5K1X A;  2WLN A;  2R9I A;  1TAE A;  4LF7 B;  4I0X B;  3MD0 A;  1OCR C;  1I08 A;  1JPX A;  4JAA A;  4DR1 B;  2E76 B;  4QGP A;  4OPA A;  4X89 A;  3T1H O;  1LUW A;  2QM4 A;  1H2N A;  4FLW A;  2RQ6 A;  4GKJ O;  2QTS A;  3ZX6 A;  4I50 A;  1Y4M A;  1CPY A;  2RMK B;  1FPO A;  2GBO A;  2VQE O;  1WA8 B;  3ABT A;  4CH6 A;  3NR7 A;  2NLJ C;  1Q86 W;  3K06 A;  2PI4 A;  1KD1 W;  3PN1 A;  2JK5 C;  1AI7 A;  5JCO C;  1SQX H;  5B1B C;  3D8C A;  2UU9 B;  3M8A A;  1R3I C;  4TV9 B;  1GTO A;  1I5Y A;  5EYP A;  2H8P C;  1ROP A;  4L87 A;  2FYU H;  4EFE A;  1EFR G;  3DC6 A;  2Q0O C;  5KA5 A;  2X7R B;  1YJ9 V;  3RYF A;  3OR6 C;  1H2S B;  4JPR A;  2UXD O;  2XTA A;  3X2Q B;  4R7C A;  5EIB C;  1ZX3 A;  3W7X A;  4K35 A;  5D5Q A;  2ADQ B;  5JVD B;  5J2T A;  1FXH A;  4JI6 O;  3UO2 A;  4H13 B;  1H2G A;  3E8G A;  4BWA A;  4F4L A;  5C8Y B;  3EVK A;  1L0L H;  2EIK B;  3OFN G;  3SJB C;  4PA6 A;  1XMO B;  4FLX A;  2EIK C;  4YY3 B;  4LNU A;  3ZBH A;  1ZTE A;  5LMU B;  3K0D A;  4JYA O;  2D2C B;  4FM2 A;  1RM1 B;  3WB2 A;  3RYH A;  4MT8 A;  4YXW G;  5FLX N;  5IY5 B;  2CTW A;  2M6Y A;  4ABM A;  1VQO V;  3JD3 A;  4FVM A;  3AG3 C;  4R8C A;  2WWW A;  4JI5 B;  4JTD B;  5K1P A;  2VWK A;  2XND G;  1SQF A;  2IJH A;  3LSQ A;  5KUK A;  2JIZ G;  3WG7 B;  4GX1 A;  5ITZ A;  3SDL A;  5LHG A;  2EX3 A;  1AR1 B;  5BR8 O;  1UJW B;  1URF A;  5FNV A;  2OYQ A;  4O2B A;  5KAF Z;  3RYH B;  2ZNJ A;  2EJR A;  1OCC C;  3RGB A;  3ZJZ A;  3LDC A;  2OTL V;  4BIU A;  2LO1 A;  3N27 A;  1SKV A;  1OCO B;  3JD2 A;  4MVR A;  4LF7 O;  5LP6 A;  4KUM A;  5C8Y A;  1Y76 B;  1ZUQ A;  4UCV A;  4DUZ O;  3ASO C;  2R9A A;  1HDJ A;  2JGD B;  1LUV A;  2B5U A;  5J2T B;  2ZXW C;  1VQ4 V;  3VQW A;  3G4S V;  1ORQ C;  1RPR A;  1AJN A;  1XEQ A;  2DW4 A;  1N36 B;  3R66 A;  5EIB D;  3B8N A;  3HB3 B;  3SPG A;  3RN4 A;  1XHX A;  3B09 A;  4X62 B;  1P7G A;  2F4V O;  4YJ2 B;  1Y66 A;  3WG7 C;  4YJ3 A;  2YID A;  2K1E A;  3BY6 A;  4GYC B;  1XRE A;  1MZF A;  2ZE8 A;  4LFC O;  4LF5 O;  3AK2 A;  2WA3 A;  1E1R G;  2A7W A;  4O4H A;  1QQC A;  2Q8V A;  3DTU B;  3HKC A;  4B3R O;  1FYJ A;  1FXK C;  3UT5 B;  4KL1 A;  1JJO A;  4QPJ A;  1QLE C;  3N2G B;  2E75 B;  1QLN A;  4DR5 B;  2AHY A;  4J80 A;  2P5O A;  1UFI A;  4B3M O;  4I50 B;  4IIJ B;  4MW3 A;  3JD4 A;  4LF9 B;  3CE2 A;  1HNW O;  2YXL A;  2EZO A;  3ZRX A;  3S3X A;  4LF8 B;  3TXQ A;  3RVY A;  5CBG A;  3P3P A;  2VQF O;  3AK1 A;  4K0K O;  2QWQ B;  4LF4 O;  3A0B Z;  1K33 A;  1JVM A;  4BAY A;  3LSS A;  3VQY A;  4RQE A;  2CE4 A;  3ICX A;  3BPZ A;  3LDD A;  4FLU A;  1K8A W;  1D5A A;  3P30 A;  3FB5 C;  1DGS A;  1LNQ A;  2YUA A;  3VBB A;  1PM9 A;  2YIC A;  1R3L C;  3ZHT A;  4WCE V;  2UUA B;  3FYE B;  1GN3 A;  2Q73 A;  1CXZ B;  5CA0 B;  3DXR B;  4X1Y A;  5B1B B;  2YIB A;  3H1H H;  2NR5 A;  3DGE A;  3CRC A;  3QO8 A;  4CH5 A;  2VS0 A;  2GTA A;  4DV6 B;  4IHJ B;  3HKE B;  4I9Q A;  1SZX A;  1Q82 W;  1OCO C;  5CA1 B;  4U7O A;  2AZ0 A;  4DYL A;  3O9O A;  1ZLZ A;  4TV8 A;  4GKK B;  3C3S A;  1SQG A;  2ZT9 B;  1AI4 A;  3ASO B;  3OMA B;  3GWK C;  4AQY B;  1H8H G;  1B6Q A;  1I0H A;  5IYD O;  5L3D A;  4UCU A;  3JAT B;  4XDJ A;  2LGQ A;  1YVW A;  2GTS A;  3STL C;  1WJZ A;  4X9Q A;  3CCU V;  3JSN A;  4DV7 B;  1S77 D;  3VQV A;  2Q0A A;  2QGN A;  4E4E A;  4AIL C;  1ARO P;  3CHX A;  3AG4 B;  5EBW C;  5JQG A;  1Q8I A;  1CEZ A;  4BW5 A;  2HVJ C;  3AG2 B;  4JAS A;  4QNH B;  4LP8 A;  3CPW U;  4GT1 A;  5IT9 N;  4CH3 A;  1PPJ H;  4W4K A;  1S76 D;  3CD6 V;  1XMO O;  1R73 A;  1IUR A;  1JMK C;  1S5L Z;  3VQX A;  1P49 A;  3AEI A;  4DUY O;  2UXC B;  4X65 B;  4FM0 A;  3RYI A;  4PDV A;  5KX5 A;  3QO5 A;  2DMX A;  3ABM C;  1NH2 D;  5F2V O;  1N32 O;  2F95 B;  1V55 C;  3CRA A;  4ICG A;  2UXD B;  4QIW F;  3ETQ A;  4DR7 O;  2XHB A;  1DTO A;  4RUF A;  2XAJ A;  4X1I B;  4IT5 A;  3UM7 A;  4H33 A;  2DJV A;  3CS5 A;  3RYC B;  3A8T A;  2E3C A;  3F7V C;  4DV5 O;  3JAL A;  5HFM A;  3JAL B;  4DRX A;  4TSF G;  1FFX A;  3RW0 A;  4DXW A;  1MG1 A;  2F23 A;  1KP3 A;  2BTQ B;  4XDK A;  1PD3 A;  1AP5 A;  3K04 A;  3K3W A;  4BIZ A;  5IWA B;  3OM3 B;  4TQD A;  3FAV B;  4B3T O;  1YJW V;  1NR7 A;  5GTI Z;  1VIB A;  1KUQ A;  4MTF A;  2YIB D;  2QDO A;  2EIL C;  1N33 O;  3TJT A;  4NTX A;  4MSW C;  1Q90 D;  4DR7 B;  3OGC C;  3T1H B;  2Q7G A;  4U3J B;  2XUM A;  3E35 A;  4Z2W A;  1S3J A;  5JQG B;  2QWR B;  4CC5 A;  3H1K H;  3P3N A;  2QEX V;  4EFB A;  2CH7 A;  4X1K A;  5BMV B;  4QE7 A;  3GB7 C;  1I94 B;  4LH7 A;  4W4L A;  4UV9 A;  4F6E A;  3OAA G;  5EZY B;  4YHH O;  4D6T H;  3OE7 G;  1FD9 A;  3CMA V;  2ATK C;  4RWU A;  3VOU A;  4JF3 A;  1YTF D;  2CAZ C;  4G2K A;  3CCE V;  4JAV A;  2JS3 A;  1YEW A;  4LFB O;  4PV1 B;  4CH4 A;  4O4I B;  1NVP D;  3ZCC A;  1FKA O;  4DV7 O;  2LW1 A;  1XNQ O;  4PI2 A;  1WB7 A;  4X88 A;  3STZ C;  4PA9 A;  3J7A U;  4B08 A;  4MVS A;  4LF8 O;  2NNU A;  3FYI B;  3H1I H;  1MAB G;  2QJ1 A;  4MW8 A;  4J41 A;  4NB5 A;  2LFR A;  4GX5 A;  4B3S B;  1YHQ V;  5JCO A;  3T4Z A;  1B06 A;  3CCJ V;  2JRI A;  3BRC A;  3IC7 A;  2DN9 A;  3E22 A;  4LBE C;  1IBM O;  1AB3 A;  1KKC A;  5JH7 B;  3OD4 A;  3OUF A;  2P6J A;  3ZMZ A;  1N0J A;  3CP1 A;  1BCC H;  3IGA C;  4N21 A;  2KKW A;  3THO A;  2BTO A;  2FB5 A;  1NTM H;  1H2L A;  1MMM A;  1J5E O;  1VQN V;  4O4J A;  3OTO O;  4GCZ A;  2W6I G;  1G1X B;  3LSU A;  4NXM O;  3D3I A;  1OHH G;  2B1G A;  3OEH G;  2ZIN A;  1M56 B;  1F4M A;  1KMI Z;  3U0Z A;  2HHH O;  2ZR2 A;  2YS8 A;  4JI8 O;  1VAR A;  3H1L H;  2QM7 A;  3ZRS A;  1PP9 H;  1RPO A;  1HW7 A;  1VQ6 V;  2VQF B;  2MW2 B;  3J81 N;  5H6Q A;  4TT3 G;  1XL6 A;  5LBQ A;  1GAX A;  1XQ8 A;  3WFV A;  1FFT B;  3MAQ A;  1B3Q A;  3CME V;  2HR3 A;  5B3S C;  1NH2 B;  4JI6 B;  1GK9 A;  5IYB O;  2IU3 A;  4TUY A;  1WLE A;  2FKX A;  1I7F A;  3UO3 A;  2JJ2 G;  4ASU G;  3IJ4 A;  3T1Y B;  4WFH A;  3APQ A;  4YIO A;  3JAK A;  3D36 C;  3UKM A;  2PUS A;  2KB1 A;  4FZ0 A;  3JAR B;  1XNR O;  1QR9 A;  4IL6 Z;  4AHC A;  3FB7 C;  5IYZ B;  4DR2 O;  2YC0 A;  2QSA A;  2UUC B;  2HKO A;  2BE3 A;  1BSM A;  1QU7 A;  3C3T A;  4JI3 B;  1DF5 A;  5EC2 C;  4DV5 B;  2PF4 E;  3OW2 U;  3TK1 A;  1W0J G;  1NKD A;  2XOK G;  2OCC C;  4CS2 A;  4YY3 O;  1K9M W;  3BHP A;  1YI2 V;  1ZAU A;  3E8H A;  5KHH A;  2XAG A;  4I4T A;  2ZM6 O;  4I9W A;  3RT3 C;  4O2B B;  5CA3 A;  4EB6 A;  1BHB A;  1D5N A;  3L71 H;  5FNV B;  1Y74 B;  2ZE5 A;  2IJK A;  3K79 A;  3ZMU A;  2P7T C;  4RO2 A;  4FFB A;  4DV6 O;  4QJF B;  2ZM6 B;  3BA8 A;  3CX5 F;  2OIG A;  2N74 A;  3CB2 A;  5LMN O;  2ZDI A;  1SET A;  5J2U B;  1GH6 A;  4TQF A;  1Q5O A;  1Y67 A;  1Y74 A;  5B1A B;  1OZ0 A;  1PNK A;  2IH3 C;  4EB6 B;  4A5U B;  3CCQ V;  3KCY A;  2KG7 B;  1Q7Y W;  5KHG A;  4G28 B;  4ZI7 B;  1JJ2 U;  1GMG A;  4I4T B;  1QNM A;  5IJ0 A;  3W7S A;  2UUC O;  4NVP A;  3ETE A;  1QBZ A;  1YTF B;  1SF9 A;  3BA9 A;  4LC1 A;  4LNU B;  5CBF A;  2PGG A;  1VQP V;  2UUB O;  4JI4 O;  4PHZ A;  2EJ7 A;  2Q5Z A;  4N23 A;  4X66 O;  1N8R W;  1M93 A;  1TGO A;  3AG2 C;  2NN4 A;  4FLT A;  4JYA B;  1HNW B;  5KHJ A;  4I7Z B;  2ZXW B;  4HZ3 A;  3N2K B;  3JAR A;  3TCU A;  1BGY H;  1BS3 A;  2JVD A;  3B8M A;  3TXS A;  4HBN A;  1N34 B;  5L3F A;  3QF7 A;  3DSQ A;  3ML0 A;  4WFA V;  3SJA C;  2ZNI A;  1JR9 A;  4X65 O;  1Z2G A;  5EYP B;  4F6R A;  1IVS A;  4TV9 A;  1SRY A;  4LFC B;  1AP6 A;  1OCR B;  3OR7 C;  1VF6 C;  3SJQ C;  4J42 A;  4B3T B;  2WSS G;  4NKG B;  4NXN O;  1Z5V A;  4JI4 B;  2XT9 A;  4OGQ B;  2WLJ A;  3K9A A;  1NBM G;  3CJH A;  1WA8 A;  2M7W A;  1WPX A;  4Z1V A;  5IE9 A;  2Y0P A;  2CGO A;  1AR5 A;  2JEU A;  1A32 A;  2ZR3 A;  4PD4 F;  1RSO A;  4DR2 B;  4UUJ C;  1N0N A;  4Q20 A;  3RVZ A;  5B3S B;  1BZK A;  4R6Z A;  5AG2 A;  1IBL O;  4MS2 A;  1IX9 A;  4DUZ B;  5DM6 V;  1H38 A;  1AVM A;  3HKB A;  3SYC A;  4PA4 A;  3G6E V;  3BAA A;  3FFQ A;  1WAZ A;  1S0V A;  1RM1 C;  1XDC A;  2Z0A A;  2CTQ A;  1WP8 A;  3KKY A;  4O4J B;  5H9C A;  2O57 A;  3K0G A;  2R72 A;  1DF4 A;  1K34 A;  2G38 A;  1L8D A;  5JJN B;  4GKJ B;  1EN6 A;  1U97 A;  4LF5 B;  4I55 A;  1QVF U;  3CRM A;  1SQV H;  4YIP A;  1XOU A;  4NR1 A;  5JH7 A;  1RFY A;  1XNQ B;  2Q68 A;  2ZKO A;  1M4U A;  1VMG A;  4LR3 A;  3JAM N;  4IGG A;  2RDC A;  1QCE A;  2FL4 A;  4MVM A;  4ZIB A;  5E79 Z;  4UVA A;  2RCV A;  2QM8 A;  4RUE A;  1NT2 B;  4WFF A;  1V54 C;  1K92 A;  2PI5 A;  4K3A A;  2WLI B;  4J7K A;  4FLZ A;  3G71 V;  2OT5 A;  4QPK A;  3QTC A;  3GVM A;  1J95 A;  4DO2 A;  4IYI A;  4NXM B;  3T1Y O;  2P4K A;  1PNL A;  1BMF G;  4FK5 C;  3Q4H A;  3CWB H;  1K7D A;  5BMV A;  2WLL B;  3LNN A;  1FJG O;  1NTZ H;  1SA0 A;  2Q9L A;  4DK0 A;  3K58 A;  3ZS8 C;  4D7S A;  1JX9 A;  1ZSP A;  2DQ3 A;  1GN6 A;  1MA1 A;  5JWP A;  2QWP B;  3HKD A;  4P9P A;  1VF7 A;  1JFF B;  3QO7 A;  4IYH A;  4LH6 A;  2X6C A;  1NU1 H;  1M57 C;  4OX9 B;  4X20 B;  1EZV H;  4H44 B;  4JYY A;  4FPP A;  4LFA O;  4P9O A;  2UU9 O;  1SS3 A;  3ZHS A;  3BFR A;  1W0K G;  1X59 A;  5B66 Z;  2YEV A;  1XL4 A;  1NZ6 A;  2BTQ A;  3H1J H;  3KCX A;  4JAU A;  3O65 A;  3BAB A;  2N05 A;  4DV4 O;  4DV1 B;  4B7E A;  3JD0 A;  4H0L B;  4J9Y B;  3L70 H;  1P84 F;  4CBC A;  1O9H A;  1GN4 A;  4ZOL B;  3AG7 A;  5IYC O;  4JYB A;  4DV2 O;  2UXC O;  2YEV B;  4X8A A;  5LGN A;  5BXZ A;  2PYL A;  4BR6 A;  3TET A;  1YSC A;  3X2Q C;  2E5L B;  2MK3 A;  2Y4U A;  3F5W C;  4J9Z B;  2QR4 A;  2IJJ A;  3J80 N;  1SQQ H;  2F4V B;  3HKD B;  4UVB A;  1S72 V;  3SYP A;  1SES A;  4LWS B;  1L0N H;  2X0L A;  3CYO A;  4HNA A;  2V4D A;  1EM1 A;  1PNM A;  4KHP O;  4KHP B;  1O9G A;  2P67 A;  4EEQ A;  4PJ0 Z;  1W2B U;  2W0F C;  3I5D A;  2ADP A;  3B40 A;  2WLK A;  2A3Q A;  1US6 A;  1R1B A;  3QVN A;  2ITD C;  1P7B A;  1OCZ B;  4UCT A;  4O2A B;  1M57 B;  3ZHQ A;  1AJP A;  2BSK B;  3G67 A;  3PJS K;  1G6U A;  1XUQ A;  2Y69 B;  2P90 A;  4HAM A;  5JJE B;  1R3J C;  2HJF C;  1WN7 A;  2N04 A;  2HVK C;  3ABM B;  3JAS A;  1BQ0 A;  3E83 A;  2AXT Z;  5IJ9 B;  4AI8 A;  3L73 H;  2CK3 G;  3ZRW A;  5EBM C;  3ETG A;  4EKW A;  1YZB A;  2Q7E A;  2WLI A;  3ZMS A;  1MNG A;  3HKE A;  2YI8 A;  2PYJ A;  5LHI A;  1M1K W;  1QHT A;  5IWA O;  5HFL A;  2LP7 A;  5DED A;  2YDE A;  3FKS G;  1OJH A;  2B1I A;  5J9P C;  1U96 A;  3C90 A;  4DV3 B;  1OCZ C;  4DR3 O;  4GUN A;  2UXB B;  4R50 A;  4UV8 A;  4PA7 A;  4TWK A;  4FIP C;  1JA8 A;  5LXT B;  5KUM A;  2DOS A;  2WA4 A;  5LMU O;  3ZMT A;  4XDL A;  3CCR V;  3JCU Z;  5CB4 A;  2LGW A;  1S5H C;  5LMN B;  2Z5U A;  3K57 A;  2VQE B;  3CSX A;  4QE9 A;  3JCZ A;  3EHB B;  3ZIA G;  3ZRV A;  1M56 C;  3L9D A;  3HKB B;  1QLE B;  2RN9 A;  3BCC H;  1VP7 A;  1AIL A;  3T1C A;  1RSO B;  2DE0 X;  4P30 A;  3ZRW B;  1OV9 A;  5IJ9 A;  1VQM V;  3N2G A;  3JAS B;  4MVZ A;  3UT5 A;  2CTR A;  3HKC B;  1Q6I A;  2WLH A;  3S3W A;  3DC5 A;  2RNB A;  3CCM V;  4JI2 O;  3RFR A;  2BSK A;  1N4C A;  3G6B A;  2F93 B;  2HHH B;  1XBL A;  1KQS U;  4F6R B;  1YF2 A;  4DK1 A;  4J7Z A;  4YJ3 B;  5EK0 A;  2AHZ A;  2Y0I A;  1YIJ V;  2EUL A;  4JI0 B;  4DR4 O;  1XNR B;  2IU0 A;  4JI1 B;  1VQL V;  1FAF A;  2DYS B;  3M7M X;  5KLV H;  4UCS A;  4ZKI A;  3ABK B;  2IH1 C;  1TUB B;  1W59 A;  5A2Q N;  4GKK O;  2XAF A;  5KHK A;  1HP8 A;  3OTO B;  3EFF K;  2XAQ A;  3B77 A;  2Q4P A;  3L75 H;  2QA4 V;  4B3M B;  2JGD A;  2K9P A;  2R70 A;  4ZHQ A;  3RWR D;  3WB1 A;  5LP6 B;  1FXV A;  3K5O A;  3K5N A;  2W0X A;  1HNZ B;  1AJQ A;  3SYA A;  3CRQ A;  3U11 A;  4I5S A;  1PL0 A;  4JI1 O;  4WBN A;  1WP7 A;  4HYO A;  5IJ0 B;  4NYK A;  4ZOL A;  1K97 A;  5LA6 A;  4PA3 A;  4LF6 O;  2KG7 A;  4Q6G A;  1FS0 G;  1WPB A;  3ZHU A;  1WB8 A;  1R6N A;  4MTG A;  1OCC B;  5LYJ B;  2UXB O;  3NXS A;  4DR3 B;  1VQ9 V;  4DR6 B;  3M99 B;  3SYO A;  2LFS A;  4LF4 B;  4JGS A;  1GM8 A;  4FJC C;  5L3B A;  1HR0 O;  2QKA A;  1JOY A;  4E2L A;  3HPL C;  4H37 A;  2Q6A A;  5EC1 C;  4X20 A;  4OPH A;  1ENV A;  1KEC A;  2FML A;  3W7T A;  2ZIM A;  4CC6 A;  4DV0 B;  4WF9 V;  2IJI A;  3R65 A;  2QWO B;  1NS1 A;  4UCO A;  2ZE6 A;  1ZWI C;  3ABU A;  2EIM C;  3H9V A;  3T4D A;  1HNX B;  1WNS A;  2YXH A;  1YJN V;  3JSL A;  1AR4 A;  1VQ7 V;  3QG5 A;  3CXH F;  1BE3 H;  2Q67 A;  3LDE A;  3U10 A;  5B1N A;  4UB6 Z;  2A06 H;  5B5E Z;  4DV3 O;  5TIS Z;  3E8F A;  4PDR A;  3JAK B;  5IY5 C;  4JI5 O;  3SPJ A;  4TUY B;  5FPR A;  1PKX A;  4JTC B;  2P06 A;  1F4N A;  4B7K A;  4YHH B;  1IZ3 A;  2AGA A;  2DYR C;  2A79 B;  3IFX A;  2ODM A;  1N34 O;  1H2K A;  4WFB V;  1L1F A;  2HFE C;  3ETD A;  4X64 B;  1E1Q G;  2Q7H A;  1BL8 A;  3T2M A;  1V9P A;  2OIE A;  4RAI A;  4NTY A;  2OCC B;  2XAS A;  2JJ1 G;  3W7U A;  2OWO A;  4J7J A;  5EBL C;  2ZQM A;  1F51 A;  5BR8 B;  4DV4 B;  2EZP A;  1R6K A;  4CS4 A;  2UUB B;  1MOF A;  3L74 H;  3JD1 A;  5A9G A;  3F5T A;  2XAH A;  4FFK A;  1K5S A;  4PDM A;  4I0X A;  3D36 A;  4UVC A;  2H94 A;  2CUG A;  2V1D A;  2L6L A;  3BVO A;  2EBO A;  4UCR A;  4FLY A;  1DLB A;  2E5L O;  4TOI A;  3AK3 A;  5L3C A;  1K4D C;  2HLD G;  3E22 B;  3CJH B;  2IW5 A;  4MVO A;  2UXX A;  3CCS V;  1R3K C;  4L8J A;  3MHH C;  2JEX A;  2LQT A;  1TA8 A;  4G27 B;  2QKC A;  5DN6 G;  1VQK V;  4PI0 A;  3CC7 V;  2HG5 C;  4JZ2 A;  4JZG A;  4DV1 O;  3MDS A;  1EN4 A;  3A0R A;  1S5J A;  2ARH A;  1F23 A;  4NTW A;  3CC2 V;  2UUA O;  4UFZ A;  1I5X A;  3N2K A;  2V7Q G;  3SYQ A;  4JI3 O;  5BZB A;  3K03 A;  3ZMV A;  2JS5 A;  4JI8 B;  5EZY A;  2RJZ A;  4OXS A;  2DQ0 A;  1LR1 A;  5CMU A;  2P22 C;  3OEE G;  2CH7 B;  3E2E A;  3ZN0 A;  3AG4 C;  3E8B A;  2JDI G;  2X6B A;  3K59 A;  4U3J A;  1Y6X A;  1K4C C;  2GV9 A;  1D2D A;  3LUT B;  1UPG A;  5LL6 Y;  1T5E A;  1BQZ A;  1NVP B;  1HNZ O;  4ZI7 A;  3ASN B;  5KHI A;  4DW1 A;  4C7U A;  2F1M A;  1Q6H A;  1COW G;  1YDX A;  2AZ2 A;  3FX7 A;  2EIN C;  2ZE7 A;  2Q69 A;  3WB0 A;  1SC5 B;  3FAV A;  5J2U A;  2H3O A;  2WPD G;  3GWO A;  3ZN1 A;  4DR1 O;  2A0L A;  1MSD A;  2E74 B;  4FFB B;  5LYJ A;  4O4L A;  2P4V A;  2YIA A;  1GN2 A;  1IBL B;  4JI0 O;  3CC4 V;  2BOC C;  1FFX B;  1M9N A;  4DRX B;  1GM7 A;  3E89 A;  1EZJ A;  4JI7 O;  2ZD9 A;  2KQX A;  2AW9 A;  5LHH A;  5LA6 B;  3K5L A;  5B1O A;  4J11 A;  4X62 O;  1XMQ O;  5LP6 C;  4WBN B;  3HR0 A;  2GHY A;  4LFB B;  3D3Q A;  3I55 V;  2HJD A;  3K5M A;  1N36 O;  1XIL A;  4K0K B;  3SGI A;  3L72 H;  3WU2 Z;  1G8M A;  1SQP H;  1XMQ B;  3CRR A;  1SER A;  1K5Q A;  3ZHR A;  1J5E B;  1SZT A;  1EN5 A;  1VQ5 V;  4JI7 B;  3OTF A;  4ZHQ B;  3OMN B;  2DYS C;  3RYI B;  1NI8 A;  4KFM A;  2X6A A;  2ILM A;  5IYZ A;  2UXN A;  3UQ8 A;  1K73 W;  3F7Y C;  1IBM B;  1TUB A;  4JTA B;  4B3R B;  1EBO A;  3RBZ A;  1RP3 B;  1ZL8 B;  4MTX A;  5LGU A;  1F7Y A;  1GRJ A;  1IBK O;  3FD9 A;  4MVQ A;  2QKS A;  3SR2 C;  1NQT A;  3JAW A;  1TVK A;  3FB6 C;  4X66 B;  3G80 A;  1XI1 A;  1QR8 A;  1NJI W;  2Y4T A;  1M90 W;  2EIJ C;  5CN0 A;  2CDY A;  4PDL A;  4PEL A;  1NR1 A;  3B2E E;  2HP8 A;  3MHS C;  4TV8 B;  2JGU A;  5CA1 A;  1KYO F;  1NTK H;  2IM9 A;  2ZDI C;  4UB8 Z;  1I94 O;  2F43 G;  4BW9 A;  5BY1 A;  5LOV A;  1Q3E A;  5KMG A;  4IHJ A;  1FXK B;  1JCH A;  1KKD A;  3IC9 A;  2GUZ A;  4K8Z A;  1CP9 A;  2ZIO A;  5GON A;  1MZE A;  3DXR A;  3SJC C;  5CA0 A;  4FM1 A;  3AG1 C;  4X64 O;  5CB4 B;  3OMI B;  3AG1 B;  1VQ8 V;  3TGU H;  3UCS C;  5JJJ B;  5LXT A;  1N33 B;  3CCV V;  5IDJ A;  1KBH A;  4KXR A;  4DUY B;  4K8X A;  5DEC A;  4UXN A;  2GSM B;  2QTO A;  5GON B;  2YSU B;  2LJ2 A;  1H2M A;  2QWN B;  2GUZ B;  1H8E G;  4DR6 O;  2A9H A;  1FXK A;  5KMG B;  2GDS A;  3ZHV A;  5LOV B;  2ETN A;  4IIJ A;  3ABL B;  2WLM A;  1PL4 A;  4FMT A;  5LGT A;  4FZ1 A;  4O4I A;  1E79 G;  1IBK B;  1GM9 A;  2B9Z A;  1K3E A;  4AQY O;  3EXA A;  1VEW A;  4FLV A;  4GX0 A;  3SPH A;  3QNE A;  5E1A C;  2D3O W;  4O4H B;  3ASN C;  1N32 B;  4DV0 O;  1FJG B;  3H01 A;  4DV2 B;  1BT8 A;  2KSD A;  2R9R B;  4O2A A;  1TVK B;  5B1A C;  1GKF A;  3JAW B;  3CEI A;  2L35 A;  1Q6U A;  2CTP A;  3APO A;  4X1K B;  2Y69 C;  4WFE A;  1P4R A;  4YJ2 A;  4CS3 A;  1ZL8 A;  4XBF A;  3SPI A;  1BHA A;  4HNA B;  2EIM B;  4LWS A;  5FL7 G;  2QE7 G;  2OTJ V;  2LW7 A;  4KP4 A;  4DR4 B;  4U7N A;  2EIJ B;  1X4T A;  4ZBM A;  1YCI A;  2WAM A;  1Y76 A;  5GW7 A;  1IXM A;  2BCC H;  2YI9 A;  5H6R A;  5KAI Z;  5GTH Z;  4P2Z A;  1V55 B;  4D7T A;  3CXC U;  3FB8 C;  3KZI Z;  1QVG U;  5D5P A;  2YXY A;  1R6T A;  4BIO A;  3I56 V;  5FPO A;  4LF9 O;  2VRZ A;  5CBH A;  3LNM B;  2DWE C;  3RYC A;  2EIN B;  5H5N A;  4O4L B;  2Y48 A;  4X1I A;  1Q43 A;  4GX2 A;  1Q81 W;  1AI5 A;  5ITZ B;  1VF5 B;  2C2A A;  3K9S A;  3ABL C;  3CCL V;  5KA6 A;  1G4Y B;  1IDS A;  3A2F A;  3B4S A;  1IXB A;  5KX5 B;  2DWD C;  1JFF A;  3SPC A;  3BEH A;  1JQ0 A;  4JV5 O;  4GLX A;  2PY5 A;  1Z5W A;  4U3F H;  4CZZ A;  3JYC A;  4JI2 B;  4LFA B;  1PV0 A;  1GO3 F;  2PZS A;  1TUE B; 
#chains in the Genus database with same CATH homology
 2XAS A;  1V55 C;  4LCU C;  3E86 A;  4QIW F;  2JJ1 G;  3G71 V;  2OT5 A;  4QPK A;  2W6J G;  3W7U A;  1DTO A;  5EBL C;  4RUF A;  2WLL A;  2XAJ A;  2ZQM A;  1F51 A;  1YIT V;  3UM7 A;  1J95 A;  2EZP A;  3ABK C;  4H33 A;  4DO2 A;  1R6K A;  4WFG A;  3P32 A;  3AG3 B;  3F7V C;  2FTK A;  3W7W A;  1HWY A;  1MOF A;  1PNL A;  1BMF G;  5HFM A;  5C93 A;  2EIL B;  4FK5 C;  4TSF G;  3JD1 A;  3RW0 A;  4DXW A;  2XAH A;  1K5S A;  1THZ A;  2DYR B;  4RQF A;  1MG1 A;  1K7D A;  4PDM A;  1KP2 A;  1MSW D;  3D36 A;  1KP3 A;  4XDK A;  4UVC A;  1PD3 A;  2BOB C;  2WLL B;  2H94 A;  3K04 A;  3K3W A;  2V1D A;  4BIZ A;  4Z1M G;  4JYC A;  3OM3 B;  3K08 A;  2EBO A;  3OUS A;  1YJW V;  5L3E A;  1DLB A;  4MTO A;  1NR7 A;  5L3C A;  1JX9 A;  1K4D C;  5L3G A;  2HLD G;  2DQ3 A;  2Z3Y A;  2IW5 A;  4MTF A;  4MVO A;  2EIL C;  4P9P A;  1KC8 W;  2UXX A;  3CCS V;  3QO7 A;  1AI6 A;  2X6C A;  1M57 C;  4MSW C;  3KG2 A;  1R3K C;  1V54 B;  3OGC C;  3MHH C;  2JEX A;  2ITC C;  3E35 A;  4FPP A;  4G27 B;  5DN6 G;  1S3J A;  4P9O A;  1VQK V;  3CC7 V;  2HG5 C;  1W0K G;  4MVU A;  2QEX V;  2YEV A;  2WLN A;  2R9I A;  4QE7 A;  1XL4 A;  3GB7 C;  3A0R A;  1F23 A;  4JAU A;  3MD0 A;  3CC2 V;  4UV9 A;  1OCR C;  3OAA G;  1I5X A;  1JPX A;  3OE7 G;  3JD0 A;  2V7Q G;  3SYQ A;  3CMA V;  5BZB A;  2ATK C;  3K03 A;  4J9Y B;  3ZMV A;  4X89 A;  3VOU A;  4CBC A;  4JF3 A;  1YTF D;  4G2K A;  4OXS A;  5IYC O;  3CCE V;  2DQ0 A;  4JAV A;  4JYB A;  5CMU A;  3OEE G;  2YEV B;  3E2E A;  4X8A A;  1NVP D;  3ZCC A;  3ZN0 A;  5LGN A;  1Y4M A;  1CPY A;  3AG4 C;  3TET A;  4X88 A;  3E8B A;  3STZ C;  4PA9 A;  1YSC A;  2JDI G;  2X6B A;  3X2Q C;  4MVS A;  2NNU A;  3FYI B;  1K4C C;  2MK3 A;  3ABT A;  3LUT B;  3F5W C;  1MAB G;  4J9Z B;  2NLJ C;  4MW8 A;  3K06 A;  1Q86 W;  1NVP B;  2LFR A;  4GX5 A;  2PI4 A;  1KD1 W;  2IJJ A;  2JK5 C;  1YHQ V;  3T4Z A;  3ASN B;  1AI7 A;  5B1B C;  3CCJ V;  4UVB A;  1S72 V;  3IC7 A;  3SYP A;  1SES A;  1COW G;  2X0L A;  3CYO A;  4LBE C;  2EIN C;  1R3I C;  1PNM A;  1GTO A;  2Q69 A;  1I5Y A;  3OUF A;  2H8P C;  1ROP A;  2P67 A;  1W2B U;  2WPD G;  2W0F C;  3GWO A;  3ZN1 A;  2P6J A;  3ZMZ A;  4L87 A;  2WLK A;  3CP1 A;  3IGA C;  4N21 A;  2A0L A;  1EFR G;  5KA5 A;  2X7R B;  2ITD C;  1VQN V;  1P7B A;  1YJ9 V;  4GCZ A;  1NH2 B;  1OCZ B;  2W6I G;  3OR6 C;  3CC4 V;  2BOC C;  4JPR A;  1M57 B;  1M9N A;  1GM7 A;  1AJP A;  1EZJ A;  3E89 A;  4R7C A;  3X2Q B;  2ZD9 A;  3PJS K;  3D3I A;  3W7X A;  1OHH G;  5LHH A;  2Y69 B;  2B1G A;  2P90 A;  4HAM A;  5B1O A;  1R3J C;  1FXH A;  2HJF C;  3OEH G;  2HVK C;  3ABM B;  1H2G A;  3E8G A;  1M56 B;  2GHY A;  1F4M A;  4F4L A;  3E83 A;  3I55 V;  2EIK B;  2CK3 G;  3OFN G;  3ZRW A;  2ZR2 A;  5EBM C;  3ETG A;  1G8M A;  4PA6 A;  4EKW A;  2EIK C;  1SER A;  2WLI A;  3ZMS A;  1K5Q A;  1SZT A;  2QM7 A;  1VQ5 V;  3ZRS A;  1RPO A;  3OMN B;  5LHI A;  3K0D A;  1VQ6 V;  1M1K W;  2DYS C;  1RM1 B;  4KFM A;  5H6Q A;  2X6A A;  1XL6 A;  4TT3 G;  5HFL A;  5LBQ A;  2LP7 A;  4MT8 A;  3FKS G;  4YXW G;  2B1I A;  3WFV A;  5J9P C;  2UXN A;  5IY5 B;  1K73 W;  3F7Y C;  1FFT B;  1VQO V;  3JD3 A;  1OCZ C;  3AG3 C;  4R8C A;  2WWW A;  3CME V;  4JTD B;  4JTA B;  4R50 A;  4UV8 A;  1EBO A;  2HR3 A;  2XND G;  4PA7 A;  4TWK A;  3RBZ A;  1GK9 A;  2IJH A;  3LSQ A;  5IYB O;  5B3S C;  2IU3 A;  5KUK A;  2JIZ G;  4MTX A;  4FIP C;  1WLE A;  3WG7 B;  4GX1 A;  5LGU A;  2JJ2 G;  4ASU G;  5KUM A;  5LHG A;  4MVQ A;  4WFH A;  1AR1 B;  3ZMT A;  3UKM A;  2QKS A;  4XDL A;  3CCR V;  2KB1 A;  1NQT A;  1S5H C;  1UJW B;  3FB6 C;  1NJI W;  1QR8 A;  1QR9 A;  2Z5U A;  4QE9 A;  3FB7 C;  3JCZ A;  3EHB B;  1M90 W;  2EIJ C;  5CN0 A;  3ZIA G;  4PDL A;  2EJR A;  4PEL A;  3ZRV A;  1M56 C;  1NR1 A;  1OCC C;  2HKO A;  1QLE B;  3ZJZ A;  3LDC A;  2OTL V;  3MHS C;  4BIU A;  3T1C A;  1DF5 A;  5EC2 C;  3OW2 U;  4P30 A;  1OCO B;  3TK1 A;  1W0J G;  1NKD A;  2ZDI C;  3ZRW B;  3JD2 A;  2XOK G;  2OCC C;  1VQM V;  4MVR A;  4KUM A;  2F43 G;  1K9M W;  1YI2 V;  3ASO C;  4MVZ A;  1FXK B;  1JCH A;  1KKD A;  3E8H A;  2B5U A;  2XAG A;  2WLH A;  2ZXW C;  1VQ4 V;  3CCM V;  1CP9 A;  4I9W A;  3G4S V;  1ORQ C;  1RPR A;  5CA3 A;  1AJN A;  1BHB A;  3AG1 C;  2DW4 A;  3K79 A;  2IJK A;  3B8N A;  3OMI B;  3ZMU A;  2P7T C;  3HB3 B;  4RO2 A;  3SPG A;  1KQS U;  3AG1 B;  4QJF B;  1VQ8 V;  5EK0 A;  2AHZ A;  1YIJ V;  3CCV V;  5IDJ A;  2IU0 A;  2ZDI A;  3WG7 C;  1Y66 A;  1SET A;  1VQL V;  2DYS B;  2K1E A;  3BY6 A;  4ZKI A;  3ABK B;  4UXN A;  2IH1 C;  5B1A B;  1OZ0 A;  2XAF A;  1PNK A;  2IH3 C;  3CCQ V;  3EFF K;  1E1R G;  1Q7Y W;  2GSM B;  4G28 B;  2QTO A;  2XAQ A;  2YSU B;  1JJ2 U;  1GMG A;  2PI5 A;  3DTU B;  1H8E G;  3W7S A;  3B77 A;  2QA4 V;  3ETE A;  1FXK C;  1QBZ A;  2A9H A;  1YTF B;  1FXK A;  4LC1 A;  4QPJ A;  1QLE C;  5CBF A;  1FXV A;  1QLN A;  1VQP V;  3ABL B;  2AHY A;  2WLM A;  4RAI A;  1AJQ A;  4FMT A;  4MW3 A;  5LGT A;  3JD4 A;  3SYA A;  4N23 A;  2EZO A;  3ZRX A;  1N8R W;  1E79 G;  1GM9 A;  1K3E A;  4I5S A;  1PL0 A;  3RVY A;  5CBG A;  4GX0 A;  4HYO A;  3SPH A;  3AG2 C;  3QNE A;  1K97 A;  5E1A C;  2D3O W;  4PA3 A;  3ASN C;  2ZXW B;  4HZ3 A;  1K33 A;  3H01 A;  1FS0 G;  1JVM A;  4BAY A;  2R9R B;  5B1A C;  3LSS A;  3TCU A;  1GKF A;  4RQE A;  1R6N A;  1OCC B;  4MTG A;  3NXS A;  1VQ9 V;  3B8M A;  3LDD A;  3M99 B;  2Y69 C;  4WFE A;  1P4R A;  2LFS A;  3SYO A;  1K8A W;  5L3F A;  4JGS A;  1GM8 A;  3P30 A;  4FJC C;  5L3B A;  3ML0 A;  3FB5 C;  4XBF A;  1LNQ A;  3SPI A;  4E2L A;  3HPL C;  4WFA V;  1JOY A;  4H37 A;  2Q6A A;  3VBB A;  1R3L C;  1SRY A;  5EC1 C;  1BHA A;  1OCR B;  3OR7 C;  2EIM B;  4WCE V;  5FL7 G;  3SJQ C;  3FYE B;  1ENV A;  2WSS G;  1KEC A;  2QE7 G;  2OTJ V;  5B1B B;  4KP4 A;  4U7N A;  2EIJ B;  2WLJ A;  3DGE A;  3W7T A;  3K9A A;  3QO8 A;  1NBM G;  4ZBM A;  2M7W A;  2WAM A;  5GW7 A;  1WPX A;  1IXM A;  2IJI A;  3R65 A;  4WF9 V;  1Q82 W;  5H6R A;  2JEU A;  1OCO C;  4P2Z A;  1V55 B;  4U7O A;  2ZR3 A;  3CXC U;  3FB8 C;  1ZWI C;  4UUJ C;  4Q20 A;  3RVZ A;  3ABU A;  2EIM C;  1QVG U;  5B3S B;  1TUE B;  4R6Z A;  3T4D A;  4MS2 A;  1AI4 A;  3ASO B;  5DM6 V;  1H38 A;  3OMA B;  1H8H G;  1YJN V;  1B6Q A;  5IYD O;  5L3D A;  3I56 V;  3SYC A;  1VQ7 V;  4PA4 A;  4XDJ A;  3G6E V;  5CBH A;  1S0V A;  3LNM B;  1RM1 C;  2DWE C;  2Q67 A;  3LDE A;  3STL C;  5B1N A;  2EIN B;  3E8F A;  5H9C A;  2Y48 A;  4PDR A;  3CCU V;  5IY5 C;  1S77 D;  3K0G A;  4GX2 A;  1DF4 A;  1K34 A;  3SPJ A;  1Q81 W;  1ARO P;  1AI5 A;  3AG4 B;  2C2A A;  5EBW C;  3ABL C;  1PKX A;  4JTC B;  1QVF U;  1F4N A;  4BW5 A;  3CCL V;  1CEZ A;  5KA6 A;  2HVJ C;  3AG2 B;  4JAS A;  4QNH B;  4LP8 A;  3CPW U;  4GT1 A;  1G4Y B;  2Q68 A;  1S76 D;  3CD6 V;  2DYR C;  1R73 A;  2A79 B;  3IFX A;  2DWD C;  3AEI A;  4WFB V;  1L1F A;  3SPC A;  2HFE C;  1QCE A;  3BEH A;  1JQ0 A;  1E1Q G;  3ETD A;  4MVM A;  4PDV A;  1BL8 A;  4UVA A;  3QO5 A;  2QM8 A;  3ABM C;  3T2M A;  4RUE A;  4CZZ A;  3JYC A;  4WFF A;  1V54 C;  1NH2 D;  1K92 A;  1GO3 F;  2OCC B;  2WLI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...