3HPLC

Kcsa e71h-f103a mutant in the closed state
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
b'RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVHTATTVGYGDLYPVTLWGRCVAVVVMVAGITSAGLVTAALATWFVGREQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
molecule tags Immune system/metal transport
source organism Mus musculus
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
total genus 36
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hplC00
2DWEC 5EBMC 3JYCA 4H33A 3GB7C 2WLMA 4HZ3A 5EBWC 3SPIA 4PDLA 2W0FC 3LDCA 1K4DC 3ABMC 2AHYA 4P2ZA 4MTGA 2HG5C 3SPCA 3SJQC 4JTCB 2EILC 2X6BA 4J9YB 3FB5C 1R3JC 3OR6C 3OR7C 4G28B 3TETA 2R9RB 2DYSC 3IFXA 3F7VC 3E86A 4MW8A 5KUMA 5EK0A 4GX1A 3E83A 2WLLB 2WLNA 3KG2A 4PDVA 2IH3C 4RUFA 3SYQA 2HJFC 5CBGA 4X8AA 2DWDC 2Q69A 2Q67A 5EBLC 1OCRC 4GX5A 5EC2C 2K1EA 3K03A 4RO2A 1OCOC 4MS2A 4BW5A 3T4DA 4MW3A 4WFHA 3SYOA 4MTFA 4WFEA 3TCUA 5IY5C 3AG2C 3VOUA 3IGAC 2ITCC 5B1BC 2EINC 4LP8A 1ZWIC 5E1AC 4X89A 4LCUC 3FB7C 4P30A 4X88A 4MSWC 4QNHB 5CBFA 4HYOA 4I9WA 2HVJC 4WFFA 1G4YB 1K4CC 4MVMA 4P9PA 4PA6A 3K0GA 4QE7A 3SYPA 3ZJZA 4J9ZB 2AHZA 2WLHA 1V54C 3F7YC 3HPLC 2WLKA 4OXSA 3RVYA 5J9PC 4KFMA 2ATKC 2Y69C 3STZC 1OCZC 4WFGA 4MVQA 2QKSA 4PDMA 1P7BA 1R3KC 3SPHA 4RUEA 4PA3A 4XDLA 4GX2A 2EIKC 3T4ZA 2QTOA 4PA9A 2WLIB 1XL4A 5B1AC 2OCCC 4JTAB 4MVOA 2A0LA 4PA4A 2P7TC 3K0DA 1JVMA 5B3SC 1R3IC 3LDEA 3STLC 2Q68A 2ZXWC 4ZBMA 2YEVA 3UM7A 3RVZA 4XDJA 5KUKA 3AG3C 1M56C 3E8FA 3K06A 3UKMA 3OGCC 4TWKA 3SPGA 2HFEC 4JTDB 3LNMB 3RBZA 4G27B 2HVKC 5EC1C 1M57C 2KB1A 2EIJC 2NLJC 1BL8A 3PJSK 3E8BA 1V55C 3T2MA 1J95A 3SYAA 4MVUA 2ITDC 4R50A 4P9OA 3SYCA 4RAIA 2H8PC 4EKWA 4DXWA 3FB8C 4H37A 2EIMC 3K04A 2A79B 1XL6A 4CBCA 3RW0A 2JK5C 3X2QC 4R6ZA 3T1CA 1LNQA 3BEHA 3OUSA 1KKDA 3ZRSA 2DYRC 4R8CA 3OUFA 4R7CA 4UUJC 3WG7C 1QLEC 4GX0A 2WLIA 3K08A 3ABKC 3E8HA 3R65A 4LBEC 1S5HC 3E89A 1ORQC 3AG1C 4XDKA 3SPJA 2X6CA 4MVSA 3EFFK 5CBHA 3FB6C 1OCCC 2IH1C 4PDRA 3ASOC 4MVRA 3E8GA 2Q6AA 2WLJA 4MVZA 2WLLA 4F4LA 3LUTB 3F5WC 3LDDA 3ABLC 4QE9A 1R3LC 2BOCC 2A9HA 3AG4C 4PA7A 2ZD9A 2BOBC 5BZBA 3ASNC 2X6AA 4MTOA
chains in the Genus database with same CATH superfamily
2DWEC 1D2DA 5HFMA 3KCXA 3JYCA 3CMAV 4TV8A 2Q5ZA 3LDCA 2QM8A 2AHYA 1KC8W 4GKKB 5KHHA 1SERA 4L8JA 2OCCB 3IFXA 1VQ4V 1F23A 1GMGA 2QWQB 2DE0X 1DTOA 2WLNA 1ENVA 2QJ1A 2RQ6A 1HNZB 2IJIA 2UUAB 3JD1A 4FFBB 2AZ2A 3FB7C 5CBFA 1N36O 1AILA 4B08A 3UQ8A 2HR3A 1BT8A 1K73W 5JQGA 1V9PA 1NVPB 1M5IA 4JI5O 5IYZB 1N33B 1EBOA 2P7TC 5A9GA 1MABG 2F43G 3JSNA 2YEVA 1P7GA 3T1HO 3B4SA 4YHHB 1UJWB 4G2KA 3E8BA 4J7KA 1X4TA 2QM7A 3WB1A 1JMKC 3FB8C 1SETA 3OEEG 1KMIZ 2KKWA 1YF2A 1VQKV 2JRIA 2ZINA 3T1YO 3BEHA 2W6IG 3Q4HB 1MOFA 3CCQV 2PI5A 1Y6XA 1Q82W 1B6QA 1NTMH 1SZXA 3OMNB 3RYIA 2HKOA 4JI8B 4TQFA 2ZNJA 3ZMSA 2WLJA 4MVZA 1DF5A 4X9QA 5KX5A 2P4VA 1R6KA 1OHHG 3HKCA 2PTMA 4MTOA 2V7QG 3JATB 3BFRA 1PNKA 1R6NA 4J11A 2W0FC 1I94B 3ABMC 4JI5B 1FXKB 1ZUQA 2ZKOA 1YTFD 2WA4A 1QR8A 4G28B 5IE9A 2DW4A 1PKXA 2ZE8A 1N0JA 5B3SB 2JGDB 2IBZH 1S72V 4AQYB 2Q67A 5LP6C 3CXHF 3TCUA 4J10A 5JCOC 3G6EV 2B5UA 1YXBA 4JAAA 3LSQA 1Q7YW 1KU9A 1QVFU 4P9PA 1SA0B 3UT5B 5KA6A 4I55B 1YCIA 4B7KA 2JIZG 4DK1A 1PP9H 4OPAA 1I7FA 4ZI7A 1JVMA 1R3IC 3ZN1A 5KHIA 3CCVV 1H2LA 1KD1W 2O57A 4X1YB 3B40A 2HFEC 1OCOB 2EULA 3LNMB 4DR4B 3A0BZ 1JOYA 3ASNB 1TAEA 2Q0AA 4DV3O 4IHJA 2IU0A 3UT5A 5JJNB 5LBQA 4K0KB 5H6RA 3RW0A 4DV6B 3X2QC 4I5SA 2B1IA 1RSOA 5IYDO 2Z0AA 2BE3A 2OTJV 4W4KA 4E4EA 2W6JG 3M99B 5J2UB 4JV5O 1RPRA 5IDJA 3FB6C 2UXCO 2F93B 1GK9A 1XOUA 4WBNB 1SESA 3LUTB 4JGSA 2F4VB 4IT5A 2VQFO 2ZD9A 4JI1B 2X6AA 2HJDA 1N4CA 1NU1H 2OT5A 3HKDA 5D5PA 4JI0O 4DV5B 1VQ7V 1FFTB 3SPCA 3S3WA 5FPOA 1OJHA 2FTKA 4J9YB 4U3JA 4WFAV 3OR7C 5A2QN 4LF6B 2YS8A 1K3EA 2GUZA 1FXVA 4PDVA 2ZQMA 4X8AA 4PI2A 3RFRA 5IYZA 5EC2C 2FYUH 1O9GA 4AILC 1H8EG 3AG2C 4JV5B 2AZ0A 2F4VO 2FL4A 4ZOLA 3HKDB 3ZMTA 2E3CA 3P3PA 4JYAB 3ZJZA 3QO7A 2Y4UA 4J9ZB 1D5AA 3BY6A 2XAGA 3CCLV 2ATKC 3STZC 4K35A 3FYIB 3CSXA 1KECA 2WLIB 1Z5WA 2DQ3A 2HLDG 3K0DA 3CD6V 2Y0IA 2YI9A 1LR1A 3SPGA 3L74H 5L3DA 2VWKA 1XL6A 4JZGA 1KYOF 2PZSA 3JD4A 3CJHA 4R7CA 1MZFA 1Q5OA 1GN6A 3JALA 1FXKA 2YEVB 4LC1A 4IIJB 4EEQA 3UCSC 3E8GA 2R70A 2P4KA 3U0ZA 3CXCU 2IU3A 1JJ2U 4NTYA 3KCYA 3OM3B 1OCCB 3WFVA 2XTAA 1TUBB 4H33A 2WLMA 3RYHA 4PDLA 4X62O 1SC5B 4IYHA 4X62B 2ZE5A 2V1DA 2P22C 3CB2A 3FB5C 2XASA 4K8XA 4GKJB 3CX5F 1ZX3A 1QLEB 3E86A 4MW8A 5EK0A 2ADPA 2KG7A 5B5EZ 2JJ2G 4YIOA 4EFBA 4FLUA 2F95B 2CGOA 1THZA 3MHSC 5LGUA 3VOUA 5E1AC 3K79A 1FXKC 3RYHB 1I5XA 1AP6A 3BCCH 3FAVB 4DUZB 4FZ1A 1X59A 3SR2C 3K5OA 4X66O 3BA8A 2Q7EA 5C8YB 1YZBA 3CRCA 1P7BA 2L6LA 2QTOA 4JI0B 3HKEA 4DR2O 4JTAB 1HR0O 3JAKB 3STLC 4ZBMA 3T1HB 4K8ZA 1SQGA 3FYEB 1IBLB 3HKBA 1NJIW 3RBZA 1H2MA 1VQ6V 3TJTA 3ETEA 1N32O 2PI4A 2UXDB 2EIMC 2XAQA 4FK5C 3K3WA 2CE4A 2RJZA 1Y66A 2LP7A 3OEHG 3E89A 1VF7A 3RYFA 1GO3F 5IWAO 3EXAA 4LH6A 2CGNA 4PDRA 1SA0A 4LFCB 5LMUO 1NH2D 2ZDIC 3O65A 1Q6IA 3A0RA 1N34O 3OW2U 1DF4A 1BS3A 3H9VA 4RWUA 3CRAA 3ZN0A 1URFA 2V4DA 4DW1A 2LO1A 4A5UB 2R9AA 1ZSPA 1G6UA 5F2VO 3ABTA 4DR7O 1MSDA 2YIBA 2ZM6O 2UXXA 3TXSA 1UPGA 5K1XA 1SQXH 1S5LZ 1RM1B 3BABA 3JD0A 2CTRA 3SYQA 2IH3C 2UUCB 5H2FZ 4NXNO 2DWDC 3OGIB 3E35A 4KHPO 5LL6Y 3RGBA 4B3RB 4MTFA 4WFEA 1QR9A 4KL1A 4TV9A 5KHKA 4P30A 5JJJB 2UXBB 4AQYO 3SGIA 2JS3A 4GT1A 4U7OA 2AHZA 4LF8O 2M7WA 1XHZA 2LJ2A 4PI0A 1YTFB 1QQCA 3RYCB 4O4JA 3UO2A 5KLVH 1XL4A 3W7XA 2Q7GA 3APQA 4YHHO 2BTOA 2D3OW 5B3SC 1VQNV 2EINB 2QEXV 2ZXWC 1VQ8V 1FD9A 2QWNB 4ICGA 3CE2A 3M8AA 2EJRA 3ML0A 1TA8A 4IL6Z 4ZKIA 4O4LA 3OFNG 1V55C 5AG2A 1YHQV 3AG2B 3B8NA 4WF9V 1JFFA 3QNEA 3OD4A 2UXBO 2ODMA 1XBLA 5JQGB 1HNXO 2QE7G 4UVCA 2CDYA 2FB5A 2X0LA 4LR3A 2DYRC 4R8CA 2R72A 1TVKA 2WLIA 1B04A 3K08A 4B3RO 2ZNIA 3CRRA 2UUAO 4KHPB 2ARHA 1VARA 3ZRXA 2L35A 5JH7A 3ZS8C 2EZPA 4GLXA 2QM4A 2YC0A 3J80N 4NXMO 1GKFA 1AI5A 1I94O 4X66B 2RDCA 1P4RA 3LDDA 3CP1A 1H2SB 1WA8B 4I55A 3ZMUA 4LNUA 2QWRB 3U11A 2MK3A 5LHHA 4LFAO 1J5EO 1N0NA 1AVMA 1Z2GA 3ZHRA 1VQ9V 3WB0A 1R1BA 1Q6UA 4DUYO 5LHGA 1QCEA 4OX9O 3F7VC 4TQDA 3JD3A 5CBGA 4RQEA 5IYCO 1OCRB 2N04A 4IHJB 2RN9A 1GM8A 1MMMA 4ZIBA 1RSOB 1ZWIC 1SF9A 1DK1A 2W0XA 1YJNV 4LF5B 3JARA 1FJGO 4K3AA 1FKAO 2VQEO 3IC9A 4XDLA 1NR7A 4PA9A 1QBZA 3JSLA 1VIBA 2ZE7A 2Y48A 3SDLA 2ZR3A 4TUYA 3RVZA 4O2AB 2BSKB 4FLYA 1XQ8A 5EC1C 2HP8A 2NLJC 4WBNA 3T2MA 2ITDC 3SYCA 4DV7B 4RAIA 1IURA 5BMVA 5CA1B 3K04A 2E5LO 1RPOA 2LGWA 4CBCA 4LF5O 1SQFA 3ABLB 2JGUA 1IXMA 4UVBA 1HNZO 1HDJA 4AI8A 2CTPA 3T1YB 2Q0OC 3OMIB 1H8HG 1JJOA 1SQBH 3ZRVA 5LYJB 1WB7A 3JAKA 3MHHC 1N36B 2RMKB 3EFFK 4JYCA 1VEWA 1TUEB 4QPKA 1MNGA 3VQWA 2JJ1G 3THOA 1KB9F 5C8YA 3JAWB 1F7YA 5CB4A 2GV9A 5BMVB 5CA1A 3CMEV 2ZR2A 5BZBA 1AP5A 1Z5VA 1EN6A 3ZHQA 2VWJA 1J5EB 4F6EA 4H0LB 1N34B 1PL0A 3JCUZ 4B3TB 4UVAA 2EIJB 4JASA 2ADQB 5LMNO 4LF9B 2EILC 3ZRWA 1NTZH 3JASA 2QKCA 4DV1O 4YY3O 2P06A 3ZX6A 4X64O 4JPRA 3OTFA 2K1EA 1VQOV 5CB4B 2UU9B 3K5NA 4O2BA 4DR3B 5JVDA 2WSSG 1L8DA 2UXDO 3P32A 2YI8A 1FPOA 3JALB 5ITZA 4ASUG 2WAMA 4DR6O 3HR0A 1QLNA 3JAWA 3HPLC 2WLKA 1MA1A 2AW9A 3OMAB 4WFGA 3JASB 3JCZA 3SPHA 1BQ0A 4PA3A 1BHBA 4CS2A 3UO3A 3OAAG 5IWAB 3Q4HA 2FKXA 1Q43A 2OIGA 1Y74B 3UKMA 4HBNA 3ZMZA 3AK3A 2YDEA 4FMTA 4IYIA 5FL7G 4R50A 4H37A 4DV7O 1E1QG 4NXNB 3CC4V 1LNQA 3J81N 3OT7A 4UUJC 4DR3O 3QVNA 2OIEA 4X20B 3R65A 2E76B 1AI4A 1S5HC 3WB2A 2IM9A 4UB6Z 3A8TA 3DTUB 3RT3C 4O4IB 1N8RW 3CS5A 4NVPA 2DN9A 1P84F 3P3NA 3E22A 3RYCA 4JI3O 5FPRA 1S0VA 1FS0G 4DV5O 4GKKO 3ZCCA 3AG4C 3CPWU 2BOBC 3CCJV 2IJHA 2IJKA 5EBMC 4GZRB 3GB7C 4NTWA 4DV4B 5KAFZ 1EZVH 2DYRB 2QSAA 2Y4TA 1KQSU 3K5MA 2OYQA 4DK0A 5GONA 3J7AU 4GKJO 4GX1A 4ZHQB 5KMGB 1YIJV 2CUGA 5DEDA 3ZMVA 4CC5A 4B3SB 4U3FH 2EINC 2P6JA 1Y76B 1UFIA 5LYJA 1TUBA 4X88A 4JI2B 4I9WA 2HVJC 3DGEA 5LXTA 1EN5A 3M7MX 5KA5A 3E2EA 3ZHUA 4JI6O 2KSDA 1IBLO 1H2GA 2OCCC 2GSMB 4PA4A 4E2LA 1M90W 3EHBB 1HR0B 4FM0A 2E5LB 2A06H 1K34A 2HVKC 2LFRA 1GM9A 2ILMA 1PNLA 1J95A 2CTWA 2H94A 3GWKC 4MVUA 1NH2B 1GTOA 1K92A 2YIBD 3H1IH 2XNDG 2ZE6A 3AG7A 1BSMA 3OUFA 5B1NA 5CN0A 2A3QA 4LBEC 1VQPV 1GRJA 3L72H 2WWWA 4PD4F 5JWPA 1WP8A 4MVRA 1HP8A 3SJCC 1M9NA 2GUZB 4BIOA 4F4LA 3KZIZ 3F5WC 2N05A 1R3LC 5FNVB 2A9HA 4UCOA 4PA7A 1SRYA 5KHGA 1VQLV 1YITV 4JI1O 3SJAC 4U7NA 1Y74A 1AB3A 4LF4O 4JTCB 3BHPA 4B7EA 3SJBC 4X1IA 4LF6O 2WLLB 4RUFA 1HNWB 5IJ9B 5EBLC 5GTHZ 3CRQA 2OTLV 4FLTA 4N21A 2F23A 4TSFG 1OCZB 1JCHA 2ITCC 3FD9A 3MAQA 1JR9A 3OTOO 1WB8A 2DJVA 4DV0B 4FIPC 2X7RB 1AR5A 5H9CA 1R3KC 5FLXN 4YJ2B 5EZYB 2WA3A 2Q7HA 4JI2O 5B1AC 1BZKA 2VQFB 4FLXA 1R73A 4I9QA 4BWAA 3FFQA 3K9AA 4KP4A 5JH7B 1K5SA 1AROP 4I50B 1CPYA 2KB1A 4NB5A 4KXRA 3BAAA 1YJWV 2F1MA 1U96A 2UU9O 1FYJA 4FVMA 4DXWA 3ZBHA 1GN2A 4D7SA 4YY3B 1XNRO 1FAFA 5JCOA 4B3MB 1ZAUA 3AG4B 1JA8A 4FFBA 1QNMA 5EYPA 3L9DA 5L3CA 3AG1C 2Q4PA 1K9MW 3CRMA 3F5TA 4MVSA 1OCCC 2IH1C 2RCVA 1IXBA 3ASOC 1XDCA 3W7UA 2Y0PA 4JI3B 3U10A 2Q6AA 1H38A 4J41A 5L3GA 1FFXA 4DUZO 3ASNC 4LH7A 1M57B 2QWPB 1K97A 4KUMA 4HZ3A 1I5YA 4XBFA 1K4DC 2PUSA 4O2AA 1XMOO 4LF4B 2E75B 3CWBH 2XOKG 4OX9B 1IBKO 4NKGB 5KUMA 4GCZA 4DV4O 2YUAA 4K0KO 2G38A 2LGQA 1Q90D 5GW7A 4BW5A 4I7ZB 2UUBB 3GVMA 5CA0B 4DR5O 1SZTA 1NR1A 4UCSA 1S76D 1AJPA 1XEQA 4HYOA 4CH3A 4MVMA 4LFCO 1VQ5V 3ETGA 4MVQA 2B1GA 2XHBA 2JGDA 2EIKC 1BCCH 1XHXA 2EBOA 2A0LA 4DR2B 3ABMB 3ZHSA 4XDJA 2Q8VA 3E8FA 2CTQA 1M57C 2EIJC 3JARB 1SS3A 2QDOA 3SYAA 2KQXA 3BA9A 3P30A 5LP6A 4DV3B 3T1CA 1NVPD 1MG1A 1SKVA 2LW1A 1U97A 1VQMV 3WG7B 3OTOB 1EZJA 4PELA 3OE7G 5DECA 2CAZC 3SPJA 4CH5A 3N2GA 3I56V 4YJ3A 3CYOA 4W4LA 1KKCA 2OWOA 5H6QA 2BTQB 5D5QA 3A0HZ 2QKAA 2WLLA 2YIAA 3ABLC 2AXTZ 4QE9A 5LA6A 2ZT9B 4Q6GA 2EIMB 3H01A 1FXHA 4FZ0A 4X64B 4P2ZA 1EFRG 1RFYA 4YJ3B 1XMOB 1LUVA 1R6TA 5IJ0B 5EZYA 3E83A 1XUQA 3ZHVA 2H3OA 2Q69A 4I4TA 4WFBV 2YXYA 4MS2A 3SYOA 5IY5C 1WPBA 4I0XB 4PV1B 1Q3EA 4DV2B 2XT9A 4X20A 3RWRD 4MSWC 4UCTA 1OZ0A 4AHCA 1D5NA 2QR4A 2EIKB 4O4IA 4QE7A 3JAMN 2VQEB 2ZXWB 1KP3A 3RVYA 1VF5B 4OXSA 5CMUA 4CH4A 4LF7O 4DO2A 4JYYA 1HW7A 4NXMB 3RYIB 2Q68A 1DLBA 2C2AA 1QVGU 3H1KH 4JTDB 2EILB 1NQTA 2XAFA 3ZRWB 1BL8A 2EJ7A 3AEIA 1N32B 1Q6HA 4EKWA 2PY5A 3JD2A 3ZEDA 4UCUA 2Q73A 3CHXA 1FFXB 1XNQB 5BR8B 3C90A 4CS4A 4DV0O 5J2TA 2X6CA 2QTSA 3ETQA 2JEUA 1NTKH 4JYAO 3H1JH 2EZOA 3LNNA 5K1PA 1YDXA 3B8MA 4QIWF 1PPJH 1I0HA 2LFSA 5LMNB 5CA0A 4NYKA 3N2KB 4UCVA 5KHJA 4FM2A 1LUWA 2YXLA 1BQZA 1XNRB 1IBKB 4QGPA 3D8CA 3TXQA 4DUYB 2DYSC 1EM1A 2HJFC 5LP6B 5BR8O 3BPZA 4MW3A 4OPHA 1XNQO 4MTXA 3B09A 3HB3B 5C93A 2ZDIA 4FPPA 3AK2A 4EB6B 1K8AW 5J2UA 1G4YB 1K4CC 3G6BA 5H5NA 3W7TA 3K0GA 4Q20A 4JAUA 1IVSA 1QHTA 1W0JG 1T5EA 4EFEA 1YEWA 1NT2B 2Z3YA 5B1BB 3CEIA 3TGUH 1XMQB 3R66A 2PYJA 5LGNA 1SQPH 4X1KA 3ZHTA 1KP2A 1VP7A 4RQFA 4MVOA 4ABMA 5LMUB 2NNUA 4NR1A 1RM1C 1HNXB 4FFKA 4H44B 4CC6A 2UUCO 1HWYA 2HHHB 1YSCA 1L0NH 1F51A 3FAVA 1O9HA 4P9OA 2ZM6B 5LOVA 4U3JB 1CEZA 2P90A 3DXRB 4BW9A 1ZLZA 1NS1A 4DW0A 2LW7A 4UV8A 1S3JA 3ASOB 1IBMO 3ABUA 2P5OA 1NBMG 4UXNA 1G1XB 3CC2V 4FM1A 1MZEA 3CCEV 2BSKA 5IJ0A 3K57A 2QWOB 2OCHA 3O9OA 4TOIA 2P67A 1IZ3A 2ZIMA 5JVDB 4O4JB 3QO5A 1AR1B 3TK1A 5LHIA 3A2FA 5BXZA 5ITZB 1W0KG 3RYFB 1V55B 4C7UA 2ETNA 3FX7A 4NTXA 2R9RB 2JS5A 1VF6C 4DV2O 3DXRA 3AG3B 3ETDA 3IAYA 1OCOC 1WLEA 4TT3G 5B1OA 5IT9N 2K9PA 4MT8A 3IGAC 3I5DA 3QG5A 4X89A 4QNHB 4LWSA 4WFFA 5TISZ 1B06A 5B66Z 2JVDA 1V54C 2Y69C 5LA6B 4Z2WA 2R9IA 2GTSA 1SQQH 4GX2A 3T4ZA 1WA8A 1NI8A 1EN4A 4I4TB 2HHHO 2Y69B 4QJFB 1N33O 1DGSA 4LFAB 3N2KA 2DYSB 3IC7A 4GUNA 4X65O 4CS3A 1KUQA 3QTCA 1WJZA 4ZOLB 3W7WA 4JF3A 2H8PC 5IY5B 4L87A 5HFLA 4PHZA 1F4NA 2Z5UA 2KG7B 4LFBO 3JATA 3BRCA 4TV9B 1S5JA 1VMGA 1ORQC 1F4MA 2QGNA 3QO8A 1H2NA 5CBHA 1WAZA 4I50A 1Y67A 4IGGA 4BAYA 4WCEV 2ZIOA 3H1LH 4YJ2A 4DRXA 2XUMA 4HAMA 3K59A 2BOCC 2WPDG 3CCMV 4F6RA 1W59A 2RNBA 4JYBA 2XAJA 2B9ZA 3AG1B 5KAIZ 4DV1B 1MSWD 1NKDA 2PGGA 1RP3B 4MTGA 4LF9O 2HG5C 1V54B 3L73H 4IIJA 5JJEB 1M93A 3OR6C 4DV6O 3D36A 3KG2A 2JEXA 1TVKB 1GN4A 3AK1A 4RO2A 3K03A 4YIPA 1L1FA 2D2CB 3NXSA 4JI4B 3L71H 3C3SA 3N27A 1QU7A 1JX9A 3B2EE 3G71V 2XAHA 3VQVA 5B1AB 3D3QA 4PA6A 5LOVB 4CZZA 2BTQA 5KX5B 3F7YC 3GWOA 5J9PC 5EIBC 5GONB 3KKYA 1M4UA 4RUEA 3HKCB 5KMGA 4O4HB 2GTAA 2BCCH 1A32A 1GM7A 4J42A 1NZ6A 4BIUA 2PYLA 5L3FA 3OGCC 4TWKA 2QA4V 1AI7A 3H1HH 4HNAA 1TGOA 4BR6A 3PJSK 4UV9A 4JI4O 5L3EA 3NR7A 5LXTB 2CH7B 3L75H 2VRZA 4R6ZA 4X65B 1KKDA 4B3MO 4DR4O 4DR6B 1QLEC 2DMXA 2N74A 1Y76A 1CP9A 3E8HA 1BHAA 1HNWO 4ZI7B 3DC5A 4XDKA 1GN3A 3IJ4A 1Y4MA 3W7SA 2HEPA 2A7WA 3I55V 1M56B 1FJGB 2PF4E 3BVOA 3DC6A 3HKBB 4X1IB 1Q86W 1WPXA 4LF7B 4UCRA 2DOSA 1OV9A 2VS0A 1S77D 3WU2Z 1CXZB 2NN4A 5EIBD 4O2BB 3X2QB 4X1YA 4DR7B 1XREA 1M1KW 1BMFG 1AI6A 3B77A 3ICXA 4J7JA 2X6BA 1R3JC 4J80A 1XILA 4LFBB 2CH7A 3APOA 3D36C 5CA3A 3L70H 2FMLA 1IDSA 1ZL8A 3CCRV 4FLZA 1COWG 2GHYA 4LP8A 1KBHA 1AJQA 4TV8B 3K5LA 4O4LB 2YXHA 3K58A 2UXNA 4J7ZA 4JI8O 4H13B 3SYPA 4D6TH 4YXWG 4KFMA 5FNVA 1GH6A 1K5QA 2QKSA 2JDIG 4QPJA 2ZCEA 4D7TA 5IJ9A 1GAXA 1P49A 5L3BA 5J2TB 1G8MA 4N23A 3DSQA 1ZL8B 5KUKA 3AG3C 1M56C 5BY1A 4G27B 3E22B 4PJ0Z 3FKSG 5IYBO 4JAVA 3EVKA 3LSSA 4Z1MG 1E79G 4UB8Z 5DM6V 2A79B 1Q81W 2IJJA 1XI1A 3OUSA 3ZRSA 4I0XA 1BE3H 3ABKC 1AR4A 4LF8B 2IW5A 3ABKB 5GTIZ 3K9SA 4ZHQA 1PL4A 1JFFB 1BGYH 1AJNA 3G80A 4JI6B 4UFZA 3G67A 3S3XA 3CJHB 1I08A 5EBWC 3SPIA 4EB6A 2CK3G 1WP7A 3C3TA 3SJQC 1K33A 1IBMB 4FLVA 3TETA 2EX3A 2M6YA 3VQXA 3D3IA 1ROPA 3CCSV 2MW2B 4DYLA 3VBBA 1E1RG 1VF6A 4FJCC 2UXCB 1OCRC 4DRXB 4GX5A 2GDSA 5EYPB 2DQ0A 4FLWA 3T4DA 1K7DA 4LNUB 4WFHA 5LGTA 3G4SV 4CH6A 3MDSA 5B1BC 1L0LH 1B3QA 1WN7A 4LCUC 1W2BU 3LSUA 3MD0A 4JZ2A 3N2GB 2YSUB 3ZIAG 4JI7O 1SQVH 4OGQB 2WLHA 1JPXA 3VQYA 4DR1O 1OCZC 4PDMA 3CCUV 1YJ9V 5E79Z 4F6RB 1Q8IA 4B3TO 2LQTA 1YI2V 5DN6G 3CC7V 3LDEA 1JQ0A 3RN4A 3UM7A 3K06A 1XMQO 2YICA 4GYCB 4Z1VA 2YIDA 3QF7A 1PD3A 1YVWA 1US6A 2E74B 1PM9A 2JK5C 4X1KB 1PV0A 1PNMA 1WNSA 3WG7C 4DR5B 1ZTEA 4GX0A 4B3SO 3HKEB 2UUBO 1H2KA 1IX9A 4TUYB 4JI7B 2F66C 4LWSB 3PN1A 4BIZA 2NR5A 2GBOA 4HNAB 2AGAA 4DR1B 4O4HA 2Q9LA
chains in the Genus database with same CATH topology
1YITV 2DWEC 5HFMA 3JYCA 3QO5A 3CMAV 1AR1B 3TK1A 5LHIA 3LDCA 2QM8A 3ABTA 2AHYA 1W0KG 1KC8W 4U7NA 1V55B 4JTCB 1SERA 2UXXA 2R9RB 2OCCB 3IFXA 1VQ4V 1F23A 1GMGA 3AG3B 1DTOA 1RM1B 3JD0A 2WLLB 2WLNA 3ETDA 3SYQA 2IH3C 4RUFA 1ENVA 2DWDC 3E35A 5EBLC 2OTLV 1OCOC 1WLEA 4N21A 4TT3G 4MTFA 4WFEA 2IJIA 4TSFG 1OCZB 5B1OA 1QR9A 3JD1A 4MT8A 1JCHA 3IGAC 2ITCC 4X89A 3FB7C 4P30A 4QNHB 5CBFA 4WFFA 4GT1A 4U7OA 2AHZA 1V54C 2HR3A 2M7WA 4FIPC 2X7RB 2Y69C 1K73W 1YTFB 5H9CA 1NVPB 1R3KC 2R9IA 4GX2A 3T4ZA 3W7XA 1XL4A 5B1AC 2Y69B 1EBOA 2P7TC 1R73A 4QJFB 2D3OW 5B3SC 1VQNV 2EINB 1MABG 2F43G 2QEXV 2ZXWC 3K9AA 2YEVA 1K5SA 1AROP 4KP4A 2DYSB 1VQ8V 3IC7A 1UJWB 2EJRA 4G2KA 3ML0A 1CPYA 2KB1A 4ZKIA 3E8BA 3OFNG 1V55C 1YHQV 1YJWV 3W7WA 2QM7A 3AG2B 3B8NA 4WF9V 4JF3A 2H8PC 5IY5B 4DXWA 3FB8C 1SETA 3OEEG 4L87A 3QNEA 5HFLA 1VQKV 2QE7G 1F4NA 2Z5UA 4UVCA 2X0LA 3BEHA 2DYRC 3AG4B 4R8CA 2W6IG 2WLIA 3K08A 1MOFA 3CCQV 2PI5A 5L3CA 1Q82W 1ORQC 1F4MA 3AG1C 3QO8A 1B6QA 3OMNB 1K9MW 3ZRXA 2HKOA 4MVSA 5CBHA 2EZPA 1OCCC 2IH1C 3ASOC 4BAYA 4WCEV 3W7UA 1GKFA 3ZMSA 1AI5A 2Q6AA 1DF5A 2WLJA 4MVZA 1H38A 5L3GA 1P4RA 3LDDA 4HAMA 3CP1A 2BOCC 3ZMUA 2WPDG 3CCMV 1R6KA 3ASNC 1OHHG 2MK3A 1M57B 4MTOA 2V7QG 5LHHA 4JYBA 2XAJA 3AG1B 1K97A 4KUMA 1PNKA 1R6NA 4HZ3A 2W0FC 1I5YA 1MSWD 4XBFA 1K4DC 3ABMC 1NKDA 4MTGA 1FXKB 1VQ9V 2HG5C 1V54B 1YTFD 5LHGA 1QR8A 2XOKG 3OR6C 4G28B 1QCEA 2DW4A 3F7VC 1PKXA 3JD3A 5KUMA 5B3SB 3D36A 3KG2A 2JEXA 4GCZA 5CBGA 5IYCO 4RQEA 1S72V 1OCRB 2Q67A 1GM8A 1L1FA 4RO2A 3K03A 5GW7A 4BW5A 3NXSA 3TCUA 1SZTA 3G6EV 1NR1A 2B5UA 1AJPA 1S76D 1ZWIC 1JX9A 3LSQA 3G71V 4HYOA 2XAHA 1YJNV 1Q7YW 5B1AB 4MVMA 1QVFU 4P9PA 4PA6A 4CZZA 1VQ5V 3F7YC 3GWOA 5J9PC 5KA6A 3ETGA 4MVQA 2B1GA 4RUEA 2JIZG 4XDLA 1NR7A 2EIKC 4PA9A 1QBZA 2EBOA 2A0LA 2Y48A 1JVMA 1R3IC 3ZN1A 2ZR3A 3ABMB 3CCVV 1KD1W 3RVZA 1GM7A 4XDJA 4BIUA 3E8FA 5L3FA 3OGCC 4TWKA 2QA4V 1AI7A 2HFEC 1OCOB 3LNMB 5EC1C 1M57C 2NLJC 2EIJC 3PJSK 4UV9A 1JOYA 3ASNB 3T2MA 3SYAA 2ITDC 3SYCA 4RAIA 3P30A 5L3EA 2IU0A 3K04A 5LBQA 1RPOA 5H6RA 4CBCA 3RW0A 3ABLB 3X2QC 4R6ZA 1IXMA 4UVBA 4I5SA 3T1CA 2B1IA 1NVPD 1KKDA 1MG1A 5IYDO 3OMIB 1H8HG 1QLEC 1VQMV 3WG7B 2OTJV 1EZJA 4PELA 1CP9A 3OE7G 3E8HA 3ZRVA 2W6JG 1BHAA 3M99B 4XDKA 3SPJA 3MHHC 3I56V 1Y4MA 1RPRA 3CYOA 5IDJA 3EFFK 3W7SA 4JYCA 3FB6C 1TUEB 4QPKA 3I55V 1M56B 5H6QA 1Q86W 1GK9A 2JJ1G 1WPXA 2WLLA 1SESA 3LUTB 1S77D 3ABLC 4QE9A 4JGSA 3CMEV 2ZR2A 2ZD9A 5BZBA 2X6AA 3X2QB 2EIMB 3H01A 1FXHA 1PL0A 2OT5A 4P2ZA 1EFRG 4UVAA 1VQ7V 1M1KW 2EIJB 1BMFG 1AI6A 3B77A 4JASA 1FFTB 3SPCA 2FTKA 2EILC 2X6BA 4J9YB 1R3JC 4WFAV 3OR7C 1K3EA 3ZRWA 1FXVA 3E83A 4PDVA 2ZQMA 4X8AA 2Q69A 4WFBV 5CA3A 4JPRA 5EC2C 2K1EA 1VQOV 4MS2A 3SYOA 5IY5C 3CCRV 1H8EG 2WSSG 3AG2C 1COWG 2GHYA 4LP8A 1AJQA 4MSWC 3P32A 1OZ0A 2WAMA 4ASUG 2UXNA 3ZMTA 2EIKB 1QLNA 4QE7A 3SYPA 3ZJZA 3QO7A 4J9ZB 2ZXWB 1KP3A 3BY6A 2XAGA 3HPLC 3RVYA 2WLKA 4OXSA 4YXWG 3CCLV 5CMUA 4KFMA 2ATKC 3STZC 1K5QA 3OMAB 3FYIB 4WFGA 2QKSA 2JDIG 4QPJA 3JCZA 3SPHA 4DO2A 4PA3A 1BHBA 3OAAG 1KECA 2WLIB 2DQ3A 2HLDG 3K0DA 5L3BA 1G8MA 2Q68A 4N23A 3CD6V 5KUKA 1DLBA 2C2AA 3AG3C 1M56C 3UKMA 3SPGA 1QVGU 3ZMZA 4JTDB 4G27B 2EILB 1NQTA 2XAFA 1BL8A 5L3DA 4FMTA 3ZRWB 5FL7G 3FKSG 5IYBO 3AEIA 4JAVA 3LSSA 4R50A 4EKWA 4Z1MG 3JD2A 1E79G 4H37A 1E1QG 5DM6V 3CC4V 2A79B 1XL6A 1Q81W 2IJJA 1LNQA 3OUSA 3JD4A 3ZRSA 4R7CA 4UUJC 3ABKC 3R65A 1AI4A 1S5HC 1FXKA 3DTUB 2IW5A 2X6CA 2YEVB 4LC1A 1N8RW 2JEUA 3ABKB 3E8GA 2EZOA 3CXCU 4QIWF 3B8MA 1S0VA 1FS0G 2IU3A 2LFSA 1JJ2U 3ZCCA 3AG4C 3CPWU 2BOBC 1AJNA 3CCJV 3OM3B 1OCCB 3WFVA 2IJHA 2IJKA 5EBMC 4H33A 3GB7C 2WLMA 5EBWC 3SPIA 4PDLA 2DYRB 2CK3G 2V1DA 3SJQC 1K33A 1KQSU 3TETA 3FB5C 2XASA 2DYSC 3D3IA 1ROPA 3CCSV 1QLEB 3E86A 4MW8A 5EK0A 4GX1A 3VBBA 1E1RG 2HJFC 4FJCC 1OCRC 2JJ2G 4GX5A 1YIJV 2DQ0A 1K7DA 4MW3A 3T4DA 4WFHA 5LGTA 3G4SV 4MTXA 3ZMVA 3HB3B 1THZA 5C93A 3MHSC 5LGUA 3VOUA 2ZDIA 2EINC 5E1AC 5B1BC 2P6JA 3K79A 4FPPA 4LCUC 1W2BU 1FXKC 4X88A 1K8AW 3MD0A 4I9WA 2HVJC 1G4YB 1K4CC 2YSUB 3DGEA 1I5XA 3W7TA 3K0GA 4Q20A 3ZIAG 4JAUA 2WLHA 1W0JG 1JPXA 5KA5A 1OCZC 2Z3YA 4PDMA 3CCUV 5B1BB 1P7BA 5LGNA 3E2EA 1KP2A 1YJ9V 2QTOA 1H2GA 4RQFA 2OCCC 4JTAB 4MVOA 1YI2V 5DN6G 2GSMB 4PA4A 2NNUA 4E2LA 3EHBB 3CC7V 1RM1C 1M90W 3STLC 3LDEA 1JQ0A 4ZBMA 3UM7A 3FYEB 3K06A 1NJIW 3RBZA 2LFRA 1K34A 1HWYA 2HVKC 1GM9A 1YSCA 1VQ6V 1PNLA 1F51A 1J95A 2H94A 3ETEA 4MVUA 1NH2B 4P9OA 2PI4A 2EIMC 1CEZA 2XAQA 1GTOA 2P90A 1PD3A 1K92A 3K3WA 4FK5C 2JK5C 2XNDG 3OUFA 1PNMA 4UV8A 5B1NA 1S3JA 3WG7C 3ASOB 1Y66A 4GX0A 3ABUA 5CN0A 1NBMG 4UXNA 2LP7A 3CC2V 3OEHG 4LBEC 3E89A 1VQPV 2WWWA 1GO3F 4PDRA 3CCEV 4MVRA 1M9NA 4BIZA 1NH2D 2ZDIC 4F4LA 3F5WC 3A0RA 1R3LC 2A9HA 3OW2U 1DF4A 4PA7A 1SRYA 1VQLV 2P67A 3ZN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWE C;  5EBM C;  3JYC A;  4H33 A;  3GB7 C;  2WLM A;  4HZ3 A;  5EBW C;  3SPI A;  4PDL A;  2W0F C;  3LDC A;  1K4D C;  3ABM C;  2AHY A;  4P2Z A;  4MTG A;  2HG5 C;  3SPC A;  3SJQ C;  4JTC B;  2EIL C;  2X6B A;  4J9Y B;  3FB5 C;  1R3J C;  3OR6 C;  3OR7 C;  4G28 B;  3TET A;  2R9R B;  2DYS C;  3IFX A;  3F7V C;  3E86 A;  4MW8 A;  5KUM A;  5EK0 A;  4GX1 A;  3E83 A;  2WLL B;  2WLN A;  3KG2 A;  4PDV A;  2IH3 C;  4RUF A;  3SYQ A;  2HJF C;  5CBG A;  4X8A A;  2DWD C;  2Q69 A;  2Q67 A;  5EBL C;  1OCR C;  4GX5 A;  5EC2 C;  2K1E A;  3K03 A;  4RO2 A;  1OCO C;  4MS2 A;  4BW5 A;  3T4D A;  4MW3 A;  4WFH A;  3SYO A;  4MTF A;  4WFE A;  3TCU A;  5IY5 C;  3AG2 C;  3VOU A;  3IGA C;  2ITC C;  5B1B C;  2EIN C;  4LP8 A;  1ZWI C;  5E1A C;  4X89 A;  4LCU C;  3FB7 C;  4P30 A;  4X88 A;  4MSW C;  4QNH B;  5CBF A;  4HYO A;  4I9W A;  2HVJ C;  4WFF A;  1G4Y B;  1K4C C;  4MVM A;  4P9P A;  4PA6 A;  3K0G A;  4QE7 A;  3SYP A;  3ZJZ A;  4J9Z B;  2AHZ A;  2WLH A;  1V54 C;  3F7Y C;  3HPL C;  2WLK A;  4OXS A;  3RVY A;  5J9P C;  4KFM A;  2ATK C;  2Y69 C;  3STZ C;  1OCZ C;  4WFG A;  4MVQ A;  2QKS A;  4PDM A;  1P7B A;  1R3K C;  3SPH A;  4RUE A;  4PA3 A;  4XDL A;  4GX2 A;  2EIK C;  3T4Z A;  2QTO A;  4PA9 A;  2WLI B;  1XL4 A;  5B1A C;  2OCC C;  4JTA B;  4MVO A;  2A0L A;  4PA4 A;  2P7T C;  3K0D A;  1JVM A;  5B3S C;  1R3I C;  3LDE A;  3STL C;  2Q68 A;  2ZXW C;  4ZBM A;  2YEV A;  3UM7 A;  3RVZ A;  4XDJ A;  5KUK A;  3AG3 C;  1M56 C;  3E8F A;  3K06 A;  3UKM A;  3OGC C;  4TWK A;  3SPG A;  2HFE C;  4JTD B;  3LNM B;  3RBZ A;  4G27 B;  2HVK C;  5EC1 C;  1M57 C;  2KB1 A;  2EIJ C;  2NLJ C;  1BL8 A;  3PJS K;  3E8B A;  1V55 C;  3T2M A;  1J95 A;  3SYA A;  4MVU A;  2ITD C;  4R50 A;  4P9O A;  3SYC A;  4RAI A;  2H8P C;  4EKW A;  4DXW A;  3FB8 C;  4H37 A;  2EIM C;  3K04 A;  2A79 B;  1XL6 A;  4CBC A;  3RW0 A;  2JK5 C;  3X2Q C;  4R6Z A;  3T1C A;  1LNQ A;  3BEH A;  3OUS A;  1KKD A;  3ZRS A;  2DYR C;  4R8C A;  3OUF A;  4R7C A;  4UUJ C;  3WG7 C;  1QLE C;  4GX0 A;  2WLI A;  3K08 A;  3ABK C;  3E8H A;  3R65 A;  4LBE C;  1S5H C;  3E89 A;  1ORQ C;  3AG1 C;  4XDK A;  3SPJ A;  2X6C A;  4MVS A;  3EFF K;  5CBH A;  3FB6 C;  1OCC C;  2IH1 C;  4PDR A;  3ASO C;  4MVR A;  3E8G A;  2Q6A A;  2WLJ A;  4MVZ A;  2WLL A;  4F4L A;  3LUT B;  3F5W C;  3LDD A;  3ABL C;  4QE9 A;  1R3L C;  2BOC C;  2A9H A;  3AG4 C;  4PA7 A;  2ZD9 A;  2BOB C;  5BZB A;  3ASN C;  2X6A A;  4MTO A; 
#chains in the Genus database with same CATH topology
 2DWE C;  1D2D A;  5HFM A;  3KCX A;  3JYC A;  3CMA V;  4TV8 A;  2Q5Z A;  3LDC A;  2QM8 A;  2AHY A;  1KC8 W;  4GKK B;  5KHH A;  1SER A;  4L8J A;  2OCC B;  3IFX A;  1VQ4 V;  1F23 A;  1GMG A;  2QWQ B;  2DE0 X;  1DTO A;  2WLN A;  1ENV A;  2QJ1 A;  2RQ6 A;  1HNZ B;  2IJI A;  2UUA B;  3JD1 A;  4FFB B;  2AZ2 A;  3FB7 C;  5CBF A;  1N36 O;  1AIL A;  4B08 A;  3UQ8 A;  2HR3 A;  1BT8 A;  1K73 W;  5JQG A;  1V9P A;  1NVP B;  1M5I A;  4JI5 O;  5IYZ B;  1N33 B;  1EBO A;  2P7T C;  5A9G A;  1MAB G;  2F43 G;  3JSN A;  2YEV A;  1P7G A;  3T1H O;  3B4S A;  4YHH B;  1UJW B;  4G2K A;  3E8B A;  4J7K A;  1X4T A;  2QM7 A;  3WB1 A;  1JMK C;  3FB8 C;  1SET A;  3OEE G;  1KMI Z;  2KKW A;  1YF2 A;  1VQK V;  2JRI A;  2ZIN A;  3T1Y O;  3BEH A;  2W6I G;  3Q4H B;  1MOF A;  3CCQ V;  2PI5 A;  1Y6X A;  1Q82 W;  1B6Q A;  1NTM H;  1SZX A;  3OMN B;  3RYI A;  2HKO A;  4JI8 B;  4TQF A;  2ZNJ A;  3ZMS A;  2WLJ A;  4MVZ A;  1DF5 A;  4X9Q A;  5KX5 A;  2P4V A;  1R6K A;  1OHH G;  3HKC A;  2PTM A;  4MTO A;  2V7Q G;  3JAT B;  3BFR A;  1PNK A;  1R6N A;  4J11 A;  2W0F C;  1I94 B;  3ABM C;  4JI5 B;  1FXK B;  1ZUQ A;  2ZKO A;  1YTF D;  2WA4 A;  1QR8 A;  4G28 B;  5IE9 A;  2DW4 A;  1PKX A;  2ZE8 A;  1N0J A;  5B3S B;  2JGD B;  2IBZ H;  1S72 V;  4AQY B;  2Q67 A;  5LP6 C;  3CXH F;  3TCU A;  4J10 A;  5JCO C;  3G6E V;  2B5U A;  1YXB A;  4JAA A;  3LSQ A;  1Q7Y W;  1KU9 A;  1QVF U;  4P9P A;  1SA0 B;  3UT5 B;  5KA6 A;  4I55 B;  1YCI A;  4B7K A;  2JIZ G;  4DK1 A;  1PP9 H;  4OPA A;  1I7F A;  4ZI7 A;  1JVM A;  1R3I C;  3ZN1 A;  5KHI A;  3CCV V;  1H2L A;  1KD1 W;  2O57 A;  4X1Y B;  3B40 A;  2HFE C;  1OCO B;  2EUL A;  3LNM B;  4DR4 B;  3A0B Z;  1JOY A;  3ASN B;  1TAE A;  2Q0A A;  4DV3 O;  4IHJ A;  2IU0 A;  3UT5 A;  5JJN B;  5LBQ A;  4K0K B;  5H6R A;  3RW0 A;  4DV6 B;  3X2Q C;  4I5S A;  2B1I A;  1RSO A;  5IYD O;  2Z0A A;  2BE3 A;  2OTJ V;  4W4K A;  4E4E A;  2W6J G;  3M99 B;  5J2U B;  4JV5 O;  1RPR A;  5IDJ A;  3FB6 C;  2UXC O;  2F93 B;  1GK9 A;  1XOU A;  4WBN B;  1SES A;  3LUT B;  4JGS A;  2F4V B;  4IT5 A;  2VQF O;  2ZD9 A;  4JI1 B;  2X6A A;  2HJD A;  1N4C A;  1NU1 H;  2OT5 A;  3HKD A;  5D5P A;  4JI0 O;  4DV5 B;  1VQ7 V;  1FFT B;  3SPC A;  3S3W A;  5FPO A;  1OJH A;  2FTK A;  4J9Y B;  4U3J A;  4WFA V;  3OR7 C;  5A2Q N;  4LF6 B;  2YS8 A;  1K3E A;  2GUZ A;  1FXV A;  4PDV A;  2ZQM A;  4X8A A;  4PI2 A;  3RFR A;  5IYZ A;  5EC2 C;  2FYU H;  1O9G A;  4AIL C;  1H8E G;  3AG2 C;  4JV5 B;  2AZ0 A;  2F4V O;  2FL4 A;  4ZOL A;  3HKD B;  3ZMT A;  2E3C A;  3P3P A;  4JYA B;  3ZJZ A;  3QO7 A;  2Y4U A;  4J9Z B;  1D5A A;  3BY6 A;  2XAG A;  3CCL V;  2ATK C;  3STZ C;  4K35 A;  3FYI B;  3CSX A;  1KEC A;  2WLI B;  1Z5W A;  2DQ3 A;  2HLD G;  3K0D A;  3CD6 V;  2Y0I A;  2YI9 A;  1LR1 A;  3SPG A;  3L74 H;  5L3D A;  2VWK A;  1XL6 A;  4JZG A;  1KYO F;  2PZS A;  3JD4 A;  3CJH A;  4R7C A;  1MZF A;  1Q5O A;  1GN6 A;  3JAL A;  1FXK A;  2YEV B;  4LC1 A;  4IIJ B;  4EEQ A;  3UCS C;  3E8G A;  2R70 A;  2P4K A;  3U0Z A;  3CXC U;  2IU3 A;  1JJ2 U;  4NTY A;  3KCY A;  3OM3 B;  1OCC B;  3WFV A;  2XTA A;  1TUB B;  4H33 A;  2WLM A;  3RYH A;  4PDL A;  4X62 O;  1SC5 B;  4IYH A;  4X62 B;  2ZE5 A;  2V1D A;  2P22 C;  3CB2 A;  3FB5 C;  2XAS A;  4K8X A;  4GKJ B;  3CX5 F;  1ZX3 A;  1QLE B;  3E86 A;  4MW8 A;  5EK0 A;  2ADP A;  2KG7 A;  5B5E Z;  2JJ2 G;  4YIO A;  4EFB A;  4FLU A;  2F95 B;  2CGO A;  1THZ A;  3MHS C;  5LGU A;  3VOU A;  5E1A C;  3K79 A;  1FXK C;  3RYH B;  1I5X A;  1AP6 A;  3BCC H;  3FAV B;  4DUZ B;  4FZ1 A;  1X59 A;  3SR2 C;  3K5O A;  4X66 O;  3BA8 A;  2Q7E A;  5C8Y B;  1YZB A;  3CRC A;  1P7B A;  2L6L A;  2QTO A;  4JI0 B;  3HKE A;  4DR2 O;  4JTA B;  1HR0 O;  3JAK B;  3STL C;  4ZBM A;  3T1H B;  4K8Z A;  1SQG A;  3FYE B;  1IBL B;  3HKB A;  1NJI W;  3RBZ A;  1H2M A;  1VQ6 V;  3TJT A;  3ETE A;  1N32 O;  2PI4 A;  2UXD B;  2EIM C;  2XAQ A;  4FK5 C;  3K3W A;  2CE4 A;  2RJZ A;  1Y66 A;  2LP7 A;  3OEH G;  3E89 A;  1VF7 A;  3RYF A;  1GO3 F;  5IWA O;  3EXA A;  4LH6 A;  2CGN A;  4PDR A;  1SA0 A;  4LFC B;  5LMU O;  1NH2 D;  2ZDI C;  3O65 A;  1Q6I A;  3A0R A;  1N34 O;  3OW2 U;  1DF4 A;  1BS3 A;  3H9V A;  4RWU A;  3CRA A;  3ZN0 A;  1URF A;  2V4D A;  4DW1 A;  2LO1 A;  4A5U B;  2R9A A;  1ZSP A;  1G6U A;  5F2V O;  3ABT A;  4DR7 O;  1MSD A;  2YIB A;  2ZM6 O;  2UXX A;  3TXS A;  1UPG A;  5K1X A;  1SQX H;  1S5L Z;  1RM1 B;  3BAB A;  3JD0 A;  2CTR A;  3SYQ A;  2IH3 C;  2UUC B;  5H2F Z;  4NXN O;  2DWD C;  3OGI B;  3E35 A;  4KHP O;  5LL6 Y;  3RGB A;  4B3R B;  4MTF A;  4WFE A;  1QR9 A;  4KL1 A;  4TV9 A;  5KHK A;  4P30 A;  5JJJ B;  2UXB B;  4AQY O;  3SGI A;  2JS3 A;  4GT1 A;  4U7O A;  2AHZ A;  4LF8 O;  2M7W A;  1XHZ A;  2LJ2 A;  4PI0 A;  1YTF B;  1QQC A;  3RYC B;  4O4J A;  3UO2 A;  5KLV H;  1XL4 A;  3W7X A;  2Q7G A;  3APQ A;  4YHH O;  2BTO A;  2D3O W;  5B3S C;  1VQN V;  2EIN B;  2QEX V;  2ZXW C;  1VQ8 V;  1FD9 A;  2QWN B;  4ICG A;  3CE2 A;  3M8A A;  2EJR A;  3ML0 A;  1TA8 A;  4IL6 Z;  4ZKI A;  4O4L A;  3OFN G;  1V55 C;  5AG2 A;  1YHQ V;  3AG2 B;  3B8N A;  4WF9 V;  1JFF A;  3QNE A;  3OD4 A;  2UXB O;  2ODM A;  1XBL A;  5JQG B;  1HNX O;  2QE7 G;  4UVC A;  2CDY A;  2FB5 A;  2X0L A;  4LR3 A;  2DYR C;  4R8C A;  2R72 A;  1TVK A;  2WLI A;  1B04 A;  3K08 A;  4B3R O;  2ZNI A;  3CRR A;  2UUA O;  4KHP B;  2ARH A;  1VAR A;  3ZRX A;  2L35 A;  5JH7 A;  3ZS8 C;  2EZP A;  4GLX A;  2QM4 A;  2YC0 A;  3J80 N;  4NXM O;  1GKF A;  1AI5 A;  1I94 O;  4X66 B;  2RDC A;  1P4R A;  3LDD A;  3CP1 A;  1H2S B;  1WA8 B;  4I55 A;  3ZMU A;  4LNU A;  2QWR B;  3U11 A;  2MK3 A;  5LHH A;  4LFA O;  1J5E O;  1N0N A;  1AVM A;  1Z2G A;  3ZHR A;  1VQ9 V;  3WB0 A;  1R1B A;  1Q6U A;  4DUY O;  5LHG A;  1QCE A;  4OX9 O;  3F7V C;  4TQD A;  3JD3 A;  5CBG A;  4RQE A;  5IYC O;  1OCR B;  2N04 A;  4IHJ B;  2RN9 A;  1GM8 A;  1MMM A;  4ZIB A;  1RSO B;  1ZWI C;  1SF9 A;  1DK1 A;  2W0X A;  1YJN V;  4LF5 B;  3JAR A;  1FJG O;  4K3A A;  1FKA O;  2VQE O;  3IC9 A;  4XDL A;  1NR7 A;  4PA9 A;  1QBZ A;  3JSL A;  1VIB A;  2ZE7 A;  2Y48 A;  3SDL A;  2ZR3 A;  4TUY A;  3RVZ A;  4O2A B;  2BSK B;  4FLY A;  1XQ8 A;  5EC1 C;  2HP8 A;  2NLJ C;  4WBN A;  3T2M A;  2ITD C;  3SYC A;  4DV7 B;  4RAI A;  1IUR A;  5BMV A;  5CA1 B;  3K04 A;  2E5L O;  1RPO A;  2LGW A;  4CBC A;  4LF5 O;  1SQF A;  3ABL B;  2JGU A;  1IXM A;  4UVB A;  1HNZ O;  1HDJ A;  4AI8 A;  2CTP A;  3T1Y B;  2Q0O C;  3OMI B;  1H8H G;  1JJO A;  1SQB H;  3ZRV A;  5LYJ B;  1WB7 A;  3JAK A;  3MHH C;  1N36 B;  2RMK B;  3EFF K;  4JYC A;  1VEW A;  1TUE B;  4QPK A;  1MNG A;  3VQW A;  2JJ1 G;  3THO A;  1KB9 F;  5C8Y A;  3JAW B;  1F7Y A;  5CB4 A;  2GV9 A;  5BMV B;  5CA1 A;  3CME V;  2ZR2 A;  5BZB A;  1AP5 A;  1Z5V A;  1EN6 A;  3ZHQ A;  2VWJ A;  1J5E B;  4F6E A;  4H0L B;  1N34 B;  1PL0 A;  3JCU Z;  4B3T B;  4UVA A;  2EIJ B;  4JAS A;  2ADQ B;  5LMN O;  4LF9 B;  2EIL C;  3ZRW A;  1NTZ H;  3JAS A;  2QKC A;  4DV1 O;  4YY3 O;  2P06 A;  3ZX6 A;  4X64 O;  4JPR A;  3OTF A;  2K1E A;  1VQO V;  5CB4 B;  2UU9 B;  3K5N A;  4O2B A;  4DR3 B;  5JVD A;  2WSS G;  1L8D A;  2UXD O;  3P32 A;  2YI8 A;  1FPO A;  3JAL B;  5ITZ A;  4ASU G;  2WAM A;  4DR6 O;  3HR0 A;  1QLN A;  3JAW A;  3HPL C;  2WLK A;  1MA1 A;  2AW9 A;  3OMA B;  4WFG A;  3JAS B;  3JCZ A;  3SPH A;  1BQ0 A;  4PA3 A;  1BHB A;  4CS2 A;  3UO3 A;  3OAA G;  5IWA B;  3Q4H A;  2FKX A;  1Q43 A;  2OIG A;  1Y74 B;  3UKM A;  4HBN A;  3ZMZ A;  3AK3 A;  2YDE A;  4FMT A;  4IYI A;  5FL7 G;  4R50 A;  4H37 A;  4DV7 O;  1E1Q G;  4NXN B;  3CC4 V;  1LNQ A;  3J81 N;  3OT7 A;  4UUJ C;  4DR3 O;  3QVN A;  2OIE A;  4X20 B;  3R65 A;  2E76 B;  1AI4 A;  1S5H C;  3WB2 A;  2IM9 A;  4UB6 Z;  3A8T A;  3DTU B;  3RT3 C;  4O4I B;  1N8R W;  3CS5 A;  4NVP A;  2DN9 A;  1P84 F;  3P3N A;  3E22 A;  3RYC A;  4JI3 O;  5FPR A;  1S0V A;  1FS0 G;  4DV5 O;  4GKK O;  3ZCC A;  3AG4 C;  3CPW U;  2BOB C;  3CCJ V;  2IJH A;  2IJK A;  5EBM C;  4GZR B;  3GB7 C;  4NTW A;  4DV4 B;  5KAF Z;  1EZV H;  2DYR B;  2QSA A;  2Y4T A;  1KQS U;  3K5M A;  2OYQ A;  4DK0 A;  5GON A;  3J7A U;  4GKJ O;  4GX1 A;  4ZHQ B;  5KMG B;  1YIJ V;  2CUG A;  5DED A;  3ZMV A;  4CC5 A;  4B3S B;  4U3F H;  2EIN C;  2P6J A;  1Y76 B;  1UFI A;  5LYJ A;  1TUB A;  4X88 A;  4JI2 B;  4I9W A;  2HVJ C;  3DGE A;  5LXT A;  1EN5 A;  3M7M X;  5KA5 A;  3E2E A;  3ZHU A;  4JI6 O;  2KSD A;  1IBL O;  1H2G A;  2OCC C;  2GSM B;  4PA4 A;  4E2L A;  1M90 W;  3EHB B;  1HR0 B;  4FM0 A;  2E5L B;  2A06 H;  1K34 A;  2HVK C;  2LFR A;  1GM9 A;  2ILM A;  1PNL A;  1J95 A;  2CTW A;  2H94 A;  3GWK C;  4MVU A;  1NH2 B;  1GTO A;  1K92 A;  2YIB D;  3H1I H;  2XND G;  2ZE6 A;  3AG7 A;  1BSM A;  3OUF A;  5B1N A;  5CN0 A;  2A3Q A;  4LBE C;  1VQP V;  1GRJ A;  3L72 H;  2WWW A;  4PD4 F;  5JWP A;  1WP8 A;  4MVR A;  1HP8 A;  3SJC C;  1M9N A;  2GUZ B;  4BIO A;  4F4L A;  3KZI Z;  3F5W C;  2N05 A;  1R3L C;  5FNV B;  2A9H A;  4UCO A;  4PA7 A;  1SRY A;  5KHG A;  1VQL V;  1YIT V;  4JI1 O;  3SJA C;  4U7N A;  1Y74 A;  1AB3 A;  4LF4 O;  4JTC B;  3BHP A;  4B7E A;  3SJB C;  4X1I A;  4LF6 O;  2WLL B;  4RUF A;  1HNW B;  5IJ9 B;  5EBL C;  5GTH Z;  3CRQ A;  2OTL V;  4FLT A;  4N21 A;  2F23 A;  4TSF G;  1OCZ B;  1JCH A;  2ITC C;  3FD9 A;  3MAQ A;  1JR9 A;  3OTO O;  1WB8 A;  2DJV A;  4DV0 B;  4FIP C;  2X7R B;  1AR5 A;  5H9C A;  1R3K C;  5FLX N;  4YJ2 B;  5EZY B;  2WA3 A;  2Q7H A;  4JI2 O;  5B1A C;  1BZK A;  2VQF B;  4FLX A;  1R73 A;  4I9Q A;  4BWA A;  3FFQ A;  3K9A A;  4KP4 A;  5JH7 B;  1K5S A;  1ARO P;  4I50 B;  1CPY A;  2KB1 A;  4NB5 A;  4KXR A;  3BAA A;  1YJW V;  2F1M A;  1U96 A;  2UU9 O;  1FYJ A;  4FVM A;  4DXW A;  3ZBH A;  1GN2 A;  4D7S A;  4YY3 B;  1XNR O;  1FAF A;  5JCO A;  4B3M B;  1ZAU A;  3AG4 B;  1JA8 A;  4FFB A;  1QNM A;  5EYP A;  3L9D A;  5L3C A;  3AG1 C;  2Q4P A;  1K9M W;  3CRM A;  3F5T A;  4MVS A;  1OCC C;  2IH1 C;  2RCV A;  1IXB A;  3ASO C;  1XDC A;  3W7U A;  2Y0P A;  4JI3 B;  3U10 A;  2Q6A A;  1H38 A;  4J41 A;  5L3G A;  1FFX A;  4DUZ O;  3ASN C;  4LH7 A;  1M57 B;  2QWP B;  1K97 A;  4KUM A;  4HZ3 A;  1I5Y A;  4XBF A;  1K4D C;  2PUS A;  4O2A A;  1XMO O;  4LF4 B;  2E75 B;  3CWB H;  2XOK G;  4OX9 B;  1IBK O;  4NKG B;  5KUM A;  4GCZ A;  4DV4 O;  2YUA A;  4K0K O;  2G38 A;  2LGQ A;  1Q90 D;  5GW7 A;  4BW5 A;  4I7Z B;  2UUB B;  3GVM A;  5CA0 B;  4DR5 O;  1SZT A;  1NR1 A;  4UCS A;  1S76 D;  1AJP A;  1XEQ A;  4HYO A;  4CH3 A;  4MVM A;  4LFC O;  1VQ5 V;  3ETG A;  4MVQ A;  2B1G A;  2XHB A;  2JGD A;  2EIK C;  1BCC H;  1XHX A;  2EBO A;  2A0L A;  4DR2 B;  3ABM B;  3ZHS A;  4XDJ A;  2Q8V A;  3E8F A;  2CTQ A;  1M57 C;  2EIJ C;  3JAR B;  1SS3 A;  2QDO A;  3SYA A;  2KQX A;  3BA9 A;  3P30 A;  5LP6 A;  4DV3 B;  3T1C A;  1NVP D;  1MG1 A;  1SKV A;  2LW1 A;  1U97 A;  1VQM V;  3WG7 B;  3OTO B;  1EZJ A;  4PEL A;  3OE7 G;  5DEC A;  2CAZ C;  3SPJ A;  4CH5 A;  3N2G A;  3I56 V;  4YJ3 A;  3CYO A;  4W4L A;  1KKC A;  2OWO A;  5H6Q A;  2BTQ B;  5D5Q A;  3A0H Z;  2QKA A;  2WLL A;  2YIA A;  3ABL C;  2AXT Z;  4QE9 A;  5LA6 A;  2ZT9 B;  4Q6G A;  2EIM B;  3H01 A;  1FXH A;  4FZ0 A;  4X64 B;  4P2Z A;  1EFR G;  1RFY A;  4YJ3 B;  1XMO B;  1LUV A;  1R6T A;  5IJ0 B;  5EZY A;  3E83 A;  1XUQ A;  3ZHV A;  2H3O A;  2Q69 A;  4I4T A;  4WFB V;  2YXY A;  4MS2 A;  3SYO A;  5IY5 C;  1WPB A;  4I0X B;  4PV1 B;  1Q3E A;  4DV2 B;  2XT9 A;  4X20 A;  3RWR D;  4MSW C;  4UCT A;  1OZ0 A;  4AHC A;  1D5N A;  2QR4 A;  2EIK B;  4O4I A;  4QE7 A;  3JAM N;  2VQE B;  2ZXW B;  1KP3 A;  3RVY A;  1VF5 B;  4OXS A;  5CMU A;  4CH4 A;  4LF7 O;  4DO2 A;  4JYY A;  1HW7 A;  4NXM B;  3RYI B;  2Q68 A;  1DLB A;  2C2A A;  1QVG U;  3H1K H;  4JTD B;  2EIL B;  1NQT A;  2XAF A;  3ZRW B;  1BL8 A;  2EJ7 A;  3AEI A;  1N32 B;  1Q6H A;  4EKW A;  2PY5 A;  3JD2 A;  3ZED A;  4UCU A;  2Q73 A;  3CHX A;  1FFX B;  1XNQ B;  5BR8 B;  3C90 A;  4CS4 A;  4DV0 O;  5J2T A;  2X6C A;  2QTS A;  3ETQ A;  2JEU A;  1NTK H;  4JYA O;  3H1J H;  2EZO A;  3LNN A;  5K1P A;  1YDX A;  3B8M A;  4QIW F;  1PPJ H;  1I0H A;  2LFS A;  5LMN B;  5CA0 A;  4NYK A;  3N2K B;  4UCV A;  5KHJ A;  4FM2 A;  1LUW A;  2YXL A;  1BQZ A;  1XNR B;  1IBK B;  4QGP A;  3D8C A;  3TXQ A;  4DUY B;  2DYS C;  1EM1 A;  2HJF C;  5LP6 B;  5BR8 O;  3BPZ A;  4MW3 A;  4OPH A;  1XNQ O;  4MTX A;  3B09 A;  3HB3 B;  5C93 A;  2ZDI A;  4FPP A;  3AK2 A;  4EB6 B;  1K8A W;  5J2U A;  1G4Y B;  1K4C C;  3G6B A;  5H5N A;  3W7T A;  3K0G A;  4Q20 A;  4JAU A;  1IVS A;  1QHT A;  1W0J G;  1T5E A;  4EFE A;  1YEW A;  1NT2 B;  2Z3Y A;  5B1B B;  3CEI A;  3TGU H;  1XMQ B;  3R66 A;  2PYJ A;  5LGN A;  1SQP H;  4X1K A;  3ZHT A;  1KP2 A;  1VP7 A;  4RQF A;  4MVO A;  4ABM A;  5LMU B;  2NNU A;  4NR1 A;  1RM1 C;  1HNX B;  4FFK A;  4H44 B;  4CC6 A;  2UUC O;  1HWY A;  2HHH B;  1YSC A;  1L0N H;  1F51 A;  3FAV A;  1O9H A;  4P9O A;  2ZM6 B;  5LOV A;  4U3J B;  1CEZ A;  2P90 A;  3DXR B;  4BW9 A;  1ZLZ A;  1NS1 A;  4DW0 A;  2LW7 A;  4UV8 A;  1S3J A;  3ASO B;  1IBM O;  3ABU A;  2P5O A;  1NBM G;  4UXN A;  1G1X B;  3CC2 V;  4FM1 A;  1MZE A;  3CCE V;  2BSK A;  5IJ0 A;  3K57 A;  2QWO B;  2OCH A;  3O9O A;  4TOI A;  2P67 A;  1IZ3 A;  2ZIM A;  5JVD B;  4O4J B;  3QO5 A;  1AR1 B;  3TK1 A;  5LHI A;  3A2F A;  5BXZ A;  5ITZ B;  1W0K G;  3RYF B;  1V55 B;  4C7U A;  2ETN A;  3FX7 A;  4NTX A;  2R9R B;  2JS5 A;  1VF6 C;  4DV2 O;  3DXR A;  3AG3 B;  3ETD A;  3IAY A;  1OCO C;  1WLE A;  4TT3 G;  5B1O A;  5IT9 N;  2K9P A;  4MT8 A;  3IGA C;  3I5D A;  3QG5 A;  4X89 A;  4QNH B;  4LWS A;  4WFF A;  5TIS Z;  1B06 A;  5B66 Z;  2JVD A;  1V54 C;  2Y69 C;  5LA6 B;  4Z2W A;  2R9I A;  2GTS A;  1SQQ H;  4GX2 A;  3T4Z A;  1WA8 A;  1NI8 A;  1EN4 A;  4I4T B;  2HHH O;  2Y69 B;  4QJF B;  1N33 O;  1DGS A;  4LFA B;  3N2K A;  2DYS B;  3IC7 A;  4GUN A;  4X65 O;  4CS3 A;  1KUQ A;  3QTC A;  1WJZ A;  4ZOL B;  3W7W A;  4JF3 A;  2H8P C;  5IY5 B;  4L87 A;  5HFL A;  4PHZ A;  1F4N A;  2Z5U A;  2KG7 B;  4LFB O;  3JAT A;  3BRC A;  4TV9 B;  1S5J A;  1VMG A;  1ORQ C;  1F4M A;  2QGN A;  3QO8 A;  1H2N A;  5CBH A;  1WAZ A;  4I50 A;  1Y67 A;  4IGG A;  4BAY A;  4WCE V;  2ZIO A;  3H1L H;  4YJ2 A;  4DRX A;  2XUM A;  4HAM A;  3K59 A;  2BOC C;  2WPD G;  3CCM V;  4F6R A;  1W59 A;  2RNB A;  4JYB A;  2XAJ A;  2B9Z A;  3AG1 B;  5KAI Z;  4DV1 B;  1MSW D;  1NKD A;  2PGG A;  1RP3 B;  4MTG A;  4LF9 O;  2HG5 C;  1V54 B;  3L73 H;  4IIJ A;  5JJE B;  1M93 A;  3OR6 C;  4DV6 O;  3D36 A;  3KG2 A;  2JEX A;  1TVK B;  1GN4 A;  3AK1 A;  4RO2 A;  3K03 A;  4YIP A;  1L1F A;  2D2C B;  3NXS A;  4JI4 B;  3L71 H;  3C3S A;  3N27 A;  1QU7 A;  1JX9 A;  3B2E E;  3G71 V;  2XAH A;  3VQV A;  5B1A B;  3D3Q A;  4PA6 A;  5LOV B;  4CZZ A;  2BTQ A;  5KX5 B;  3F7Y C;  3GWO A;  5J9P C;  5EIB C;  5GON B;  3KKY A;  1M4U A;  4RUE A;  3HKC B;  5KMG A;  4O4H B;  2GTA A;  2BCC H;  1A32 A;  1GM7 A;  4J42 A;  1NZ6 A;  4BIU A;  2PYL A;  5L3F A;  3OGC C;  4TWK A;  2QA4 V;  1AI7 A;  3H1H H;  4HNA A;  1TGO A;  4BR6 A;  3PJS K;  4UV9 A;  4JI4 O;  5L3E A;  3NR7 A;  5LXT B;  2CH7 B;  3L75 H;  2VRZ A;  4R6Z A;  4X65 B;  1KKD A;  4B3M O;  4DR4 O;  4DR6 B;  1QLE C;  2DMX A;  2N74 A;  1Y76 A;  1CP9 A;  3E8H A;  1BHA A;  1HNW O;  4ZI7 B;  3DC5 A;  4XDK A;  1GN3 A;  3IJ4 A;  1Y4M A;  3W7S A;  2HEP A;  2A7W A;  3I55 V;  1M56 B;  1FJG B;  2PF4 E;  3BVO A;  3DC6 A;  3HKB B;  4X1I B;  1Q86 W;  1WPX A;  4LF7 B;  4UCR A;  2DOS A;  1OV9 A;  2VS0 A;  1S77 D;  3WU2 Z;  1CXZ B;  2NN4 A;  5EIB D;  4O2B B;  3X2Q B;  4X1Y A;  4DR7 B;  1XRE A;  1M1K W;  1BMF G;  1AI6 A;  3B77 A;  3ICX A;  4J7J A;  2X6B A;  1R3J C;  4J80 A;  1XIL A;  4LFB B;  2CH7 A;  3APO A;  3D36 C;  5CA3 A;  3L70 H;  2FML A;  1IDS A;  1ZL8 A;  3CCR V;  4FLZ A;  1COW G;  2GHY A;  4LP8 A;  1KBH A;  1AJQ A;  4TV8 B;  3K5L A;  4O4L B;  2YXH A;  3K58 A;  2UXN A;  4J7Z A;  4JI8 O;  4H13 B;  3SYP A;  4D6T H;  4YXW G;  4KFM A;  5FNV A;  1GH6 A;  1K5Q A;  2QKS A;  2JDI G;  4QPJ A;  2ZCE A;  4D7T A;  5IJ9 A;  1GAX A;  1P49 A;  5L3B A;  5J2T B;  1G8M A;  4N23 A;  3DSQ A;  1ZL8 B;  5KUK A;  3AG3 C;  1M56 C;  5BY1 A;  4G27 B;  3E22 B;  4PJ0 Z;  3FKS G;  5IYB O;  4JAV A;  3EVK A;  3LSS A;  4Z1M G;  1E79 G;  4UB8 Z;  5DM6 V;  2A79 B;  1Q81 W;  2IJJ A;  1XI1 A;  3OUS A;  3ZRS A;  4I0X A;  1BE3 H;  3ABK C;  1AR4 A;  4LF8 B;  2IW5 A;  3ABK B;  5GTI Z;  3K9S A;  4ZHQ A;  1PL4 A;  1JFF B;  1BGY H;  1AJN A;  3G80 A;  4JI6 B;  4UFZ A;  3G67 A;  3S3X A;  3CJH B;  1I08 A;  5EBW C;  3SPI A;  4EB6 A;  2CK3 G;  1WP7 A;  3C3T A;  3SJQ C;  1K33 A;  1IBM B;  4FLV A;  3TET A;  2EX3 A;  2M6Y A;  3VQX A;  3D3I A;  1ROP A;  3CCS V;  2MW2 B;  4DYL A;  3VBB A;  1E1R G;  1VF6 A;  4FJC C;  2UXC B;  1OCR C;  4DRX B;  4GX5 A;  2GDS A;  5EYP B;  2DQ0 A;  4FLW A;  3T4D A;  1K7D A;  4LNU B;  4WFH A;  5LGT A;  3G4S V;  4CH6 A;  3MDS A;  5B1B C;  1L0L H;  1B3Q A;  1WN7 A;  4LCU C;  1W2B U;  3LSU A;  3MD0 A;  4JZ2 A;  3N2G B;  2YSU B;  3ZIA G;  4JI7 O;  1SQV H;  4OGQ B;  2WLH A;  1JPX A;  3VQY A;  4DR1 O;  1OCZ C;  4PDM A;  3CCU V;  1YJ9 V;  5E79 Z;  4F6R B;  1Q8I A;  4B3T O;  2LQT A;  1YI2 V;  5DN6 G;  3CC7 V;  3LDE A;  1JQ0 A;  3RN4 A;  3UM7 A;  3K06 A;  1XMQ O;  2YIC A;  4GYC B;  4Z1V A;  2YID A;  3QF7 A;  1PD3 A;  1YVW A;  1US6 A;  2E74 B;  1PM9 A;  2JK5 C;  4X1K B;  1PV0 A;  1PNM A;  1WNS A;  3WG7 C;  4DR5 B;  1ZTE A;  4GX0 A;  4B3S O;  3HKE B;  2UUB O;  1H2K A;  1IX9 A;  4TUY B;  4JI7 B;  2F66 C;  4LWS B;  3PN1 A;  4BIZ A;  2NR5 A;  2GBO A;  4HNA B;  2AGA A;  4DR1 B;  4O4H A;  2Q9L A; 
#chains in the Genus database with same CATH homology
 1YIT V;  2DWE C;  5HFM A;  3JYC A;  3QO5 A;  3CMA V;  1AR1 B;  3TK1 A;  5LHI A;  3LDC A;  2QM8 A;  3ABT A;  2AHY A;  1W0K G;  1KC8 W;  4U7N A;  1V55 B;  4JTC B;  1SER A;  2UXX A;  2R9R B;  2OCC B;  3IFX A;  1VQ4 V;  1F23 A;  1GMG A;  3AG3 B;  1DTO A;  1RM1 B;  3JD0 A;  2WLL B;  2WLN A;  3ETD A;  3SYQ A;  2IH3 C;  4RUF A;  1ENV A;  2DWD C;  3E35 A;  5EBL C;  2OTL V;  1OCO C;  1WLE A;  4N21 A;  4TT3 G;  4MTF A;  4WFE A;  2IJI A;  4TSF G;  1OCZ B;  5B1O A;  1QR9 A;  3JD1 A;  4MT8 A;  1JCH A;  3IGA C;  2ITC C;  4X89 A;  3FB7 C;  4P30 A;  4QNH B;  5CBF A;  4WFF A;  4GT1 A;  4U7O A;  2AHZ A;  1V54 C;  2HR3 A;  2M7W A;  4FIP C;  2X7R B;  2Y69 C;  1K73 W;  1YTF B;  5H9C A;  1NVP B;  1R3K C;  2R9I A;  4GX2 A;  3T4Z A;  3W7X A;  1XL4 A;  5B1A C;  2Y69 B;  1EBO A;  2P7T C;  1R73 A;  4QJF B;  2D3O W;  5B3S C;  1VQN V;  2EIN B;  1MAB G;  2F43 G;  2QEX V;  2ZXW C;  3K9A A;  2YEV A;  1K5S A;  1ARO P;  4KP4 A;  2DYS B;  1VQ8 V;  3IC7 A;  1UJW B;  2EJR A;  4G2K A;  3ML0 A;  1CPY A;  2KB1 A;  4ZKI A;  3E8B A;  3OFN G;  1V55 C;  1YHQ V;  1YJW V;  3W7W A;  2QM7 A;  3AG2 B;  3B8N A;  4WF9 V;  4JF3 A;  2H8P C;  5IY5 B;  4DXW A;  3FB8 C;  1SET A;  3OEE G;  4L87 A;  3QNE A;  5HFL A;  1VQK V;  2QE7 G;  1F4N A;  2Z5U A;  4UVC A;  2X0L A;  3BEH A;  2DYR C;  3AG4 B;  4R8C A;  2W6I G;  2WLI A;  3K08 A;  1MOF A;  3CCQ V;  2PI5 A;  5L3C A;  1Q82 W;  1ORQ C;  1F4M A;  3AG1 C;  3QO8 A;  1B6Q A;  3OMN B;  1K9M W;  3ZRX A;  2HKO A;  4MVS A;  5CBH A;  2EZP A;  1OCC C;  2IH1 C;  3ASO C;  4BAY A;  4WCE V;  3W7U A;  1GKF A;  3ZMS A;  1AI5 A;  2Q6A A;  1DF5 A;  2WLJ A;  4MVZ A;  1H38 A;  5L3G A;  1P4R A;  3LDD A;  4HAM A;  3CP1 A;  2BOC C;  3ZMU A;  2WPD G;  3CCM V;  1R6K A;  3ASN C;  1OHH G;  2MK3 A;  1M57 B;  4MTO A;  2V7Q G;  5LHH A;  4JYB A;  2XAJ A;  3AG1 B;  1K97 A;  4KUM A;  1PNK A;  1R6N A;  4HZ3 A;  2W0F C;  1I5Y A;  1MSW D;  4XBF A;  1K4D C;  3ABM C;  1NKD A;  4MTG A;  1FXK B;  1VQ9 V;  2HG5 C;  1V54 B;  1YTF D;  5LHG A;  1QR8 A;  2XOK G;  3OR6 C;  4G28 B;  1QCE A;  2DW4 A;  3F7V C;  1PKX A;  3JD3 A;  5KUM A;  5B3S B;  3D36 A;  3KG2 A;  2JEX A;  4GCZ A;  5CBG A;  5IYC O;  4RQE A;  1S72 V;  1OCR B;  2Q67 A;  1GM8 A;  1L1F A;  4RO2 A;  3K03 A;  5GW7 A;  4BW5 A;  3NXS A;  3TCU A;  1SZT A;  3G6E V;  1NR1 A;  2B5U A;  1AJP A;  1S76 D;  1ZWI C;  1JX9 A;  3LSQ A;  3G71 V;  4HYO A;  2XAH A;  1YJN V;  1Q7Y W;  5B1A B;  4MVM A;  1QVF U;  4P9P A;  4PA6 A;  4CZZ A;  1VQ5 V;  3F7Y C;  3GWO A;  5J9P C;  5KA6 A;  3ETG A;  4MVQ A;  2B1G A;  4RUE A;  2JIZ G;  4XDL A;  1NR7 A;  2EIK C;  4PA9 A;  1QBZ A;  2EBO A;  2A0L A;  2Y48 A;  1JVM A;  1R3I C;  3ZN1 A;  2ZR3 A;  3ABM B;  3CCV V;  1KD1 W;  3RVZ A;  1GM7 A;  4XDJ A;  4BIU A;  3E8F A;  5L3F A;  3OGC C;  4TWK A;  2QA4 V;  1AI7 A;  2HFE C;  1OCO B;  3LNM B;  5EC1 C;  1M57 C;  2NLJ C;  2EIJ C;  3PJS K;  4UV9 A;  1JOY A;  3ASN B;  3T2M A;  3SYA A;  2ITD C;  3SYC A;  4RAI A;  3P30 A;  5L3E A;  2IU0 A;  3K04 A;  5LBQ A;  1RPO A;  5H6R A;  4CBC A;  3RW0 A;  3ABL B;  3X2Q C;  4R6Z A;  1IXM A;  4UVB A;  4I5S A;  3T1C A;  2B1I A;  1NVP D;  1KKD A;  1MG1 A;  5IYD O;  3OMI B;  1H8H G;  1QLE C;  1VQM V;  3WG7 B;  2OTJ V;  1EZJ A;  4PEL A;  1CP9 A;  3OE7 G;  3E8H A;  3ZRV A;  2W6J G;  1BHA A;  3M99 B;  4XDK A;  3SPJ A;  3MHH C;  3I56 V;  1Y4M A;  1RPR A;  3CYO A;  5IDJ A;  3EFF K;  3W7S A;  4JYC A;  3FB6 C;  1TUE B;  4QPK A;  3I55 V;  1M56 B;  5H6Q A;  1Q86 W;  1GK9 A;  2JJ1 G;  1WPX A;  2WLL A;  1SES A;  3LUT B;  1S77 D;  3ABL C;  4QE9 A;  4JGS A;  3CME V;  2ZR2 A;  2ZD9 A;  5BZB A;  2X6A A;  3X2Q B;  2EIM B;  3H01 A;  1FXH A;  1PL0 A;  2OT5 A;  4P2Z A;  1EFR G;  4UVA A;  1VQ7 V;  1M1K W;  2EIJ B;  1BMF G;  1AI6 A;  3B77 A;  4JAS A;  1FFT B;  3SPC A;  2FTK A;  2EIL C;  2X6B A;  4J9Y B;  1R3J C;  4WFA V;  3OR7 C;  1K3E A;  3ZRW A;  1FXV A;  3E83 A;  4PDV A;  2ZQM A;  4X8A A;  2Q69 A;  4WFB V;  5CA3 A;  4JPR A;  5EC2 C;  2K1E A;  1VQO V;  4MS2 A;  3SYO A;  5IY5 C;  3CCR V;  1H8E G;  2WSS G;  3AG2 C;  1COW G;  2GHY A;  4LP8 A;  1AJQ A;  4MSW C;  3P32 A;  1OZ0 A;  2WAM A;  4ASU G;  2UXN A;  3ZMT A;  2EIK B;  1QLN A;  4QE7 A;  3SYP A;  3ZJZ A;  3QO7 A;  4J9Z B;  2ZXW B;  1KP3 A;  3BY6 A;  2XAG A;  3HPL C;  3RVY A;  2WLK A;  4OXS A;  4YXW G;  3CCL V;  5CMU A;  4KFM A;  2ATK C;  3STZ C;  1K5Q A;  3OMA B;  3FYI B;  4WFG A;  2QKS A;  2JDI G;  4QPJ A;  3JCZ A;  3SPH A;  4DO2 A;  4PA3 A;  1BHB A;  3OAA G;  1KEC A;  2WLI B;  2DQ3 A;  2HLD G;  3K0D A;  5L3B A;  1G8M A;  2Q68 A;  4N23 A;  3CD6 V;  5KUK A;  1DLB A;  2C2A A;  3AG3 C;  1M56 C;  3UKM A;  3SPG A;  1QVG U;  3ZMZ A;  4JTD B;  4G27 B;  2EIL B;  1NQT A;  2XAF A;  1BL8 A;  5L3D A;  4FMT A;  3ZRW B;  5FL7 G;  3FKS G;  5IYB O;  3AEI A;  4JAV A;  3LSS A;  4R50 A;  4EKW A;  4Z1M G;  3JD2 A;  1E79 G;  4H37 A;  1E1Q G;  5DM6 V;  3CC4 V;  2A79 B;  1XL6 A;  1Q81 W;  2IJJ A;  1LNQ A;  3OUS A;  3JD4 A;  3ZRS A;  4R7C A;  4UUJ C;  3ABK C;  3R65 A;  1AI4 A;  1S5H C;  1FXK A;  3DTU B;  2IW5 A;  2X6C A;  2YEV B;  4LC1 A;  1N8R W;  2JEU A;  3ABK B;  3E8G A;  2EZO A;  3CXC U;  4QIW F;  3B8M A;  1S0V A;  1FS0 G;  2IU3 A;  2LFS A;  1JJ2 U;  3ZCC A;  3AG4 C;  3CPW U;  2BOB C;  1AJN A;  3CCJ V;  3OM3 B;  1OCC B;  3WFV A;  2IJH A;  2IJK A;  5EBM C;  4H33 A;  3GB7 C;  2WLM A;  5EBW C;  3SPI A;  4PDL A;  2DYR B;  2CK3 G;  2V1D A;  3SJQ C;  1K33 A;  1KQS U;  3TET A;  3FB5 C;  2XAS A;  2DYS C;  3D3I A;  1ROP A;  3CCS V;  1QLE B;  3E86 A;  4MW8 A;  5EK0 A;  4GX1 A;  3VBB A;  1E1R G;  2HJF C;  4FJC C;  1OCR C;  2JJ2 G;  4GX5 A;  1YIJ V;  2DQ0 A;  1K7D A;  4MW3 A;  3T4D A;  4WFH A;  5LGT A;  3G4S V;  4MTX A;  3ZMV A;  3HB3 B;  1THZ A;  5C93 A;  3MHS C;  5LGU A;  3VOU A;  2ZDI A;  2EIN C;  5E1A C;  5B1B C;  2P6J A;  3K79 A;  4FPP A;  4LCU C;  1W2B U;  1FXK C;  4X88 A;  1K8A W;  3MD0 A;  4I9W A;  2HVJ C;  1G4Y B;  1K4C C;  2YSU B;  3DGE A;  1I5X A;  3W7T A;  3K0G A;  4Q20 A;  3ZIA G;  4JAU A;  2WLH A;  1W0J G;  1JPX A;  5KA5 A;  1OCZ C;  2Z3Y A;  4PDM A;  3CCU V;  5B1B B;  1P7B A;  5LGN A;  3E2E A;  1KP2 A;  1YJ9 V;  2QTO A;  1H2G A;  4RQF A;  2OCC C;  4JTA B;  4MVO A;  1YI2 V;  5DN6 G;  2GSM B;  4PA4 A;  2NNU A;  4E2L A;  3EHB B;  3CC7 V;  1RM1 C;  1M90 W;  3STL C;  3LDE A;  1JQ0 A;  4ZBM A;  3UM7 A;  3FYE B;  3K06 A;  1NJI W;  3RBZ A;  2LFR A;  1K34 A;  1HWY A;  2HVK C;  1GM9 A;  1YSC A;  1VQ6 V;  1PNL A;  1F51 A;  1J95 A;  2H94 A;  3ETE A;  4MVU A;  1NH2 B;  4P9O A;  2PI4 A;  2EIM C;  1CEZ A;  2XAQ A;  1GTO A;  2P90 A;  1PD3 A;  1K92 A;  3K3W A;  4FK5 C;  2JK5 C;  2XND G;  3OUF A;  1PNM A;  4UV8 A;  5B1N A;  1S3J A;  3WG7 C;  3ASO B;  1Y66 A;  4GX0 A;  3ABU A;  5CN0 A;  1NBM G;  4UXN A;  2LP7 A;  3CC2 V;  3OEH G;  4LBE C;  3E89 A;  1VQP V;  2WWW A;  1GO3 F;  4PDR A;  3CCE V;  4MVR A;  1M9N A;  4BIZ A;  1NH2 D;  2ZDI C;  4F4L A;  3F5W C;  3A0R A;  1R3L C;  2A9H A;  3OW2 U;  1DF4 A;  4PA7 A;  1SRY A;  1VQL V;  2P67 A;  3ZN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...