3HPLC

Kcsa e71h-f103a mutant in the closed state
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVHTATTVGYGDLYPVTLWGRCVAVVVMVAGITSAGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
molecule keywords Antibody Fab heavy chain
total genus 36
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hplC00
4H33A 2BOCC 3OGCC 3FB6C 3RVZA 1V54C 2W0FC 4JTDB 3RBZA 2NLJC 2HG5C 4F4LA 2X6BA 2YEVA 3E8HA 4P2ZA 4H37A 3K08A 1OCCC 5IY5C 1J95A 3F7YC 5EBWC 3AG2C 2DWEC 4UUJC 4J9YB 3F5WC 5EC2C 3FB5C 4MVSA 3VOUA 1ORQC 1LNQA 4G28B 2WLLA 4PDLA 2R9RB 3TETA 2WLNA 2A79B 4WFFA 5E1AC 3LNMB 3SPIA 2HJFC 3ASOC 5B3SC 3ABKC 1R3IC 4MVMA 4PDMA 5KUMA 3T4ZA 5BZBA 2WLHA 4PA6A 3UM7A 2EIJC 2DWDC 1M57C 4MSWC 4X8AA 4QE9A 3ASNC 1QLEC 4GX0A 2DYSC 2A9HA 5KUKA 4MW3A 2WLLB 2IH3C 4PA4A 1KKDA 1R3JC 4WFHA 1JVMA 5B1AC 1P7BA 2AHYA 2EIMC 4QNHB 3BEHA 3X2QC 2EIKC 1ZWIC 1BL8A 4XDLA 2HVKC 5EBMC 3E8FA 2ITCC 3K03A 3LDDA 4G27B 5EK0A 4RAIA 3FB8C 4JTCB 2Q67A 4XDJA 2A0LA 3K0GA 2ZD9A 2OCCC 3IFXA 3AG3C 4PA9A 3OR6C 4R7CA 4CBCA 4R6ZA 1K4DC 2X6CA 4PDRA 2WLKA 4WFGA 4X88A 5EBLC 2AHZA 4RUFA 1S5HC 2Y69C 4P9PA 3AG4C 3AG1C 4MTGA 5EC1C 3ABLC 3E8GA 4EKWA 3ZRSA 4PDVA 3SYPA 4JTAB 3R65A 3SYOA 5CBHA 1R3LC 3UKMA 4MTFA 1G4YB 3SJQC 4P30A 3SPHA 4XDKA 3SPGA 3STZC 1XL4A 3JYCA 3E8BA 3OR7C 2WLMA 4KFMA 4MS2A 3E83A 2WLJA 3K0DA 4BW5A 3ABMC 2DYRC 2X6AA 4X89A 4MW8A 4R50A 3RVYA 3K04A 2WLIB 4HYOA 2WLIA 2IH1C 4MTOA 1XL6A 2ATKC 4TWKA 2Q69A 3LDEA 4ZBMA 4J9ZB 4GX2A 1M56C 3SYQA 4MVOA 4MVZA 3E86A 3SPJA 3HPLC 2HFEC 2P7TC 2QTOA 4RUEA 4WFEA 5B1BC 4PA7A 4HZ3A 5CBFA 1OCOC 3FB7C 2JK5C 4LCUC 5CBGA 3TCUA 3K06A 4MVUA 4MVRA 1V55C 3T1CA 3GB7C 3IGAC 4QE7A 4R8CA 3SPCA 3SYCA 3LDCA 2ITDC 3PJSK 3F7VC 2Q68A 4GX5A 4P9OA 3E89A 1K4CC 1OCZC 4MVQA 3ZJZA 2Q6AA 3T2MA 2ZXWC 3WG7C 2EILC 4LP8A 1OCRC 2BOBC 2EINC 2H8PC 3OUSA 4GX1A 3T4DA 3STLC 2QKSA 4OXSA 2K1EA 2KB1A 3LUTB 3RW0A 3KG2A 4LBEC 3SYAA 4DXWA 3OUFA 4RO2A 2HVJC 4I9WA 1R3KC 4PA3A 5J9PC 3EFFK
chains in the Genus database with same CATH superfamily
3OE7G 3ABLB 1RSOA 1IBKO 4IT5A 4XBFA 3UO3A 5CA1A 2X6BA 1N36B 4H37A 3CRCA 4BIOA 3ABKB 5KHKA 4ZKIA 1YJNV 1VQKV 2RDCA 1NBMG 1KBHA 4WFFA 5JQGA 3FYEB 4QPKA 2RNBA 2DQ0A 2HEPA 4ICGA 1H2SB 2LJ2A 1Y74A 2AHYA 5LHHA 2QWQB 3BVOA 3L9DA 2QR4A 2PYJA 4HNAA 1B6QA 1XREA 5KMGA 5CN0A 4TSFG 2OCHA 4WFBV 3CRAA 3JCZA 4O4HA 4JPRA 5B1BB 4RUFA 1JX9A 3EXAA 5FPOA 2BCCH 4JTAB 1WP7A 5FNVB 5CBHA 5FL7G 2Y4TA 1HNZB 2Z3YA 4OPHA 1IZ3A 2E76B 2Y48A 1IBMB 5LMUB 4K8ZA 3Q4HA 1K5QA 3B8NA 4X89A 3RVYA 4NTXA 3ZS8C 3OMIB 1AJQA 1H2KA 4X66B 3CX5F 4GYCB 3IJ4A 3CD6V 4UV9A 5B3SB 4GKJB 1K33A 4RUEA 1K97A 1RSOB 2JS5A 1G8MA 3ABUA 3TCUA 1NT2B 3K06A 2IJKA 3FD9A 1F7YA 3QO8A 3IGAC 4R8CA 1NR7A 3E2EA 3BA9A 2LGQA 1M9NA 5CMUA 4DYLA 5EZYA 2XNDG 5H6QA 2PTMA 3N2KB 4UCUA 4I7ZB 3OEEG 3NXSA 4AI8A 1Q3EA 5D5PA 4ZHQA 4O2AB 4LF5O 1L0LH 4UVBA 1IBLO 3UCSC 1B06A 4EEQA 5C8YB 3FAVB 4JI3B 3BAAA 5KHIA 3CWBH 5KHJA 2AZ2A 1OCCC 1S77D 5EBWC 4RQFA 5EC2C 4FLUA 5E1AC 5BXZA 3ASOC 1YHQV 2IU0A 3C3SA 1SA0A 3APQA 3N27A 4PA6A 1SZTA 5ITZA 1GO3F 2MK3A 1TAEA 1QLEC 1KU9A 1S0VA 1NKDA 3QNEA 2XOKG 2BTOA 4GCZA 1S72V 1NQTA 2F95B 4X20B 3JARB 4B3SB 4CBCA 1R6TA 2ZE6A 4EB6B 2VQEB 4JI6O 2WAMA 1PP9H 5LYJA 2ZNIA 1BGYH 4U7NA 1JPXA 1FYJA 3E83A 2QM8A 2JRIA 2Q0OC 2X6AA 2WA4A 4K0KO 1NU1H 2YSUB 1AR5A 1AROP 2JIZG 2YUAA 1SQGA 2CAZC 4GX2A 4OGQB 1M56C 1XILA 3E86A 5A2QN 2P7TC 1HR0B 2CUGA 4FPPA 3W7WA 5IYBO 4LF6B 4P9OA 4TT3G 2ZKOA 1H38A 4LH7A 1YSCA 4LFCO 2ZE8A 2UXXA 3ZMVA 3WB1A 1H2LA 3G6BA 4I9WA 3RN4A 4RO2A 4UXNA 1NVPD 2Z5UA 3EFFK 2EIMB 5JH7A 3CJHA 4JV5B 2R9AA 3C90A 4PI2A 4DR5O 5J2TB 2DOSA 4CH4A 1N34B 4TQDA 5D5QA 1OCZB 4IL6Z 1YJ9V 2RQ6A 4NKGB 4X66O 4GLXA 2VQEO 3RYIB 1GTOA 1HNWO 3LSQA 3OEHG 4DR6O 2YIDA 5L3DA 3CMEV 1FAFA 4IHJB 1XI1A 4K8XA 2EINB 2YI9A 1ZLZA 2ZIOA 1P84F 3K57A 4DR7O 4NXNB 4F6EA 4ZIBA 4JASA 1H2MA 4FLYA 2QGNA 3L74H 4DV5O 5B1AC 2EIMC 3D3IA 3M8AA 2LFSA 1VQ4V 2ZT9B 3FB8C 4JTCB 3ZN1A 3P30A 2QA4V 2ZD9A 4JI4B 2HR3A 3MD0A 4H13B 4R6ZA 1K4DC 4LF5B 4C7UA 1GM7A 2KG7A 3E8GA 4YJ2B 2F4VB 3OR7C 1T5EA 3K0DA 3N2GB 5F2VO 3VQWA 3B40A 3ZMUA 2Q7GA 4HYOA 4NTWA 4FIPC 1AP5A 4A5UB 1GN3A 4MVOA 3OTOO 1Z2GA 3I55V 3B4SA 1UFIA 2RN9A 5JCOA 1IBMO 1O9GA 4KP4A 2ZE7A 2ODMA 2QWOB 2WWWA 4JF3A 2OIEA 5B1NA 4QJFB 3CC4V 1YTFD 1PNMA 4OXSA 1KD1W 1JCHA 1WAZA 4DR7B 3JCUZ 3CCUV 1I5XA 1G1XB 1BCCH 3K5LA 3AK3A 3X2QB 4NVPA 3RYHB 3HKBB 1KQSU 3ETGA 5JJNB 2P4KA 3EVKA 3FKSG 2IW5A 2CTWA 2F23A 1KYOF 3UO2A 4X9QA 1I94O 2XHBA 4I0XB 3UM7A 2DWDC 3AG7A 1U97A 1IVSA 4GX0A 1RFYA 2B5UA 1NVPB 2EILB 4WBNB 3BFRA 4PI0A 4G27B 2HP8A 1DGSA 1V9PA 3JAWB 4R7CA 2Y4UA 1VIBA 4DV3B 1S5HC 3AK1A 1V54B 5IJ9A 2CGOA 2GHYA 3ZRSA 4LF9O 1BHAA 1R6NA 1AJPA 4WCEV 3MHHC 1HP8A 2PUSA 1M93A 3GWOA 1US6A 1YCIA 2LFRA 1Z5VA 4DR6B 2K9PA 1SQBH 4AHCA 4O4JA 1JFFA 2OTLV 2EX3A 1NTMH 4Q6GA 4EB6A 4YJ3B 5L3CA 1AILA 1Q6UA 4DV7B 1OCOC 5EIBD 4FMTA 1N32B 3HKDB 5LBQA 2L35A 4I50B 3VQXA 4MVRA 2YS8A 3T1CA 1QNMA 3VQYA 5DM6V 3ZRVA 3W7UA 4JI1O 4LF7B 3H1LH 1XDCA 1FXVA 5CA0B 1NTKH 2EINC 3AG2B 2HJDA 4DW1A 3OUSA 3CPWU 3STLC 1F23A 4W4KA 3CC7V 2E75B 4LBEC 3NR7A 4LNUA 2KSDA 3KZIZ 1AI4A 3OGCC 2XAQA 2BSKB 2N04A 2HG5C 1PPJH 3F5TA 1YIJV 3KCYA 1XQ8A 3JAWA 3F5WC 1VQLV 3RT3C 1N33O 1Q6IA 2WLLA 2WLNA 2IJHA 4D7SA 4DV1O 1I0HA 1GMGA 1M57C 4X8AA 4CH5A 2IBZH 1N34O 3U11A 1AI6A 1R3JC 1JR9A 1JVMA 3S3WA 4QNHB 4O4HB 3D36C 2YDEA 3LDDA 4B3SO 5H2FZ 4B7KA 3JD0A 1EN4A 4IIJA 4MTGA 5EC1C 4YJ2A 4JYAO 4FM0A 4DV5B 4QIWF 4JZ2A 1N0JA 5LOVA 3SPGA 1WN7A 1XL4A 5IT9N 1Z5WA 5EIBC 2G38A 2WPDG 2F66C 1Q82W 3K04A 1VF7A 2UUAB 1FKAO 2VS0A 1VF6A 4X1KB 2ATKC 3K58A 2X7RB 2CTQA 3TK1A 2CGNA 3D36A 4LF8O 4YJ3A 2OWOA 5CBGA 4X1IB 4GKKB 3LSSA 3RWRD 5L3EA 1BHBA 3HKDA 1Y76A 1VQ9V 3PJSK 2ITDC 2JJ2G 3P3PA 4LWSA 3TJTA 1GN4A 1XHXA 3E89A 4DV1B 1OCRC 1ZTEA 3JALA 3T4DA 2XAJA 3K5MA 2OCCB 4DK1A 3W7SA 1AR1B 3K59A 2Y0IA 3VQVA 4MW8A 2Y69B 1ZUQA 5KLVH 4DR4B 2JJ1G 4CH6A 3LNNA 4FFKA 1Q43A 1I08A 3D8CA 1EM1A 3ZHVA 5J2TA 4DUYO 1JMKC 1TVKB 4F6RB 4NXNO 5BMVA 2YIBD 5CA3A 3ASNC 1KECA 4MW3A 4DUZB 4PA4A 4WFHA 5IDJA 3FYIB 1GM9A 3HKEB 3BEHA 1IXMA 5EBMC 2P06A 4XDLA 3BHPA 3BABA 3JASA 1S5LZ 2MW2B 4TQFA 1HWYA 2GSMB 1N4CA 1OHHG 5H5NA 3SGIA 2QJ1A 4AQYB 3AG4B 1WJZA 5LA6B 4EKWA 1K3EA 1Y76B 4JI2B 4BIUA 3ASNB 4LWSB 5LGUA 4FZ1A 3APOA 2HHHO 4YY3O 1VQ7V 3H9VA 4DV0O 1E1QG 2UUBO 4ZBMA 1DK1A 5JQGB 5JJEB 4JYBA 5LA6A 2IU3A 4DK0A 3ML0A 4X65O 5JH7B 3L73H 3ETEA 4JYAB 3KG2A 1MG1A 2EBOA 3CCQV 4O2AA 1VQNV 2JGDB 2BSKA 1W0JG 3OMNB 2F1MA 2OIGA 4JTDB 1TUBB 2NLJC 4F4LA 1M90W 2FL4A 2ADPA 4B3MO 3SJCC 2LP7A 4J9YB 1SQPH 2CTPA 2C2AA 1LNQA 2R9RB 3CYOA 4J7JA 3B09A 3J81N 2OTJV 1SF9A 5L3BA 2EIJC 3T1HB 5KX5A 4DV6O 4FM1A 5KUKA 2IH3C 3UT5B 2PI4A 1JFFB 3HR0A 3JD1A 1Q90D 3GVMA 3OW2U 3A0BZ 4ABMA 1HNZO 4PD4F 1WA8B 5EK0A 4TUYB 1MMMA 1EFRG 3G71V 5JJJB 1XMOO 3T1YB 2UXCO 1AVMA 3AG3B 3CP1A 4PDRA 1YDXA 1M4UA 3IC7A 2OYQA 3ABLC 2QEXV 1R3LC 2ZE5A 2F43G 3EHBB 3CC2V 3JAMN 1J5EO 5A9GA 1WB8A 1IBKB 4WF9V 2UXDO 2YXYA 3GWKC 3RYFB 2DE0X 4ZI7B 1I7FA 2QWNB 4WFEA 1FFTB 3ETQA 2XT9A 1PD3A 5J2UA 4G2KA 1SQXH 2PZSA 1K4CC 4D6TH 2ETNA 5K1PA 2P22C 1VQPV 2NR5A 2X0LA 1JJ2U 3JSLA 3K9AA 2IJIA 1DLBA 3SJBC 4Z1VA 2JDIG 4PA3A 1IXBA 1WLEA 1P7GA 1GRJA 2BTQB 1PM9A 2BOCC 4FFBA 4PELA 3ZHUA 1YI2V 1URFA 1OZ0A 3CE2A 1EZJA 2VWKA 3CRMA 1H8EG 2FKXA 2F93B 1Y4MA 3DSQA 2N74A 5B3SC 3ABKC 1VMGA 2WLHA 4ASUG 1H2GA 1AP6A 5H9CA 4FJCC 4LFAO 3K9SA 1SERA 2E5LO 4B3TO 1QHTA 3SJAC 1ZWIC 2BE3A 4J7KA 2R70A 4PV1B 4DUYB 4FFBB 5FNVA 5E79Z 3IFXA 1HNXB 2NNUA 4K0KB 5HFMA 1FXKA 3BY6A 4BIZA 4E4EA 4JI4O 1JA8A 2EULA 1VARA 2W0XA 5HFLA 4I55A 5B1AB 2QDOA 4J41A 3MDSA 4TV9A 1R6KA 1U96A 1NJIW 4KHPO 5AG2A 3ZRWA 4GT1A 5KA5A 4UVAA 4DV2B 1MSWD 5LYJB 3E22A 1AI7A 4AQYO 4DV6B 4UCOA 4TOIA 5LMNB 3JATB 4JI2O 3SPJA 5CA0A 2Y0PA 4LCUC 4MVUA 4YIPA 4B7EA 3T1YO 3AK2A 1E1RG 1N0NA 4MVQA 3ZJZA 2Q8VA 2NN4A 2ZDIC 1FFXA 2EIJB 2XASA 2CTRA 4GX1A 3IAYA 4N23A 3DXRB 3QVNA 1KP3A 4DR4O 1L8DA 2PGGA 3B2EE 1K73W 4DR1B 4GKJO 2ZQMA 2V4DA 5LP6C 4I5SA 1VQMV 2AW9A 1I5YA 2B1GA 1NI8A 2EJ7A 2V1DA 2HKOA 5GTHZ 2AXTZ 5IYDO 2P6JA 1FXKB 2ZCEA 3LNMB 3T4ZA 1KMIZ 4Z1MG 1D5AA 1WB7A 1FFXB 1WP8A 2IJJA 3HKBA 2QKAA 2F4VO 1PNLA 5KMGB 4B08A 2P4VA 2RJZA 1K9MW 1OCRB 5FPRA 1RPRA 2WSSG 3JATA 2WLKA 1ZL8B 2AHZA 4J80A 3M99B 4P9PA 3CCMV 5IJ0B 5GTIZ 4MTFA 4FLWA 4P30A 3SDLA 4XDKA 4BR6A 5BR8O 5IWAO 4CC5A 4MS2A 3A8TA 3K3WA 2VWJA 5KAIZ 3CS5A 5KAFZ 5LXTB 3MHSC 4R50A 4LFBO 1KC8W 3W7TA 3M7MX 3N2GA 2QKCA 4ZHQB 4NXMO 3CCEV 4MVZA 2JGUA 1HNWB 2V7QG 5CBFA 4U3FH 3ZHQA 4YHHO 1DF5A 1M5IA 2Q5ZA 4RQEA 3ICXA 3WG7C 1RM1C 3N2KA 2KB1A 3QG5A 3G67A 3ETDA 4DXWA 2QE7G 4X1YA 4I4TB 1D2DA 4TUYA 4NR1A 3MAQA 1VEWA 4J7ZA 1ZX3A 3A0RA 2LQTA 4F6RA 1BZKA 4IHJA 5IJ9B 4X62O 3AG2C 2UXBB 5C93A 2HLDG 3FB5C 5LMNO 4PDLA 3TETA 2HJFC 2JS3A 1SZXA 3OD4A 3WU2Z 2PF4E 3G6EV 4PJ0Z 4EFBA 1KKDA 2VQFB 4LFBB 1BL8A 1EZVH 3FAVA 4X1YB 3K03A 2ITCC 3CCLV 2JGDA 4FK5C 1JJOA 2Z0AA 4Z2WA 1S76D 1YZBA 1KUQA 5GONA 2LW1A 1CEZA 4X88A 4HNAB 1SA0B 1X4TA 5K1XA 4BW9A 4PHZA 4JI0O 5L3GA 3ZRXA 5TISZ 1XNQO 4NB5A 4DV7O 3CRQA 4DRXA 2Q7EA 4BW5A 4IYIA 3ASOB 3I5DA 4DV4O 1K7DA 2IH1C 4I4TA 1KP2A 1LUWA 3CCJV 3OM3B 1SETA 4PA7A 1MZFA 1OJHA 2AGAA 3H1KH 3J7AU 3RYFA 4LF8B 1COWG 3O65A 4TV9B 4JI8B 1MSDA 4UCVA 1MA1A 2QTSA 2GTSA 1XMQB 1SC5B 5CA1B 3FX7A 1TA8A 3ZHTA 3G4SV 4X1KA 1N33B 1TGOA 3DC5A 2VQFO 2OT5A 4CS3A 5LMUO 1XEQA 1FS0G 2QSAA 4UUJC 3AEIA 2LGWA 3OT7A 3TGUH 3L72H 2A79B 2P90A 1GK9A 4MVMA 2D2CB 2JEUA 2P67A 4YHHB 1BMFG 1WA8A 1YEWA 4QE9A 2FYUH 3ZHSA 1QU7A 2DYSC 3ZIAG 4B3RO 3WB2A 1RPOA 1L0NH 1P7BA 5LGTA 1F4NA 3CHXA 4J42A 1R1BA 4WFAV 1QCEA 1XUQA 1RM1B 3K5NA 4JI7B 2ZDIA 3AG1B 2ZM6O 3CEIA 3SYOA 1CXZB 4X20A 5KHGA 2PYLA 2EJRA 5IYZA 2M7WA 1F4MA 1Q6HA 5KA6A 5JVDA 4JI8O 3STZC 2UXBO 2Q73A 3H01A 3CCRV 2FTKA 3J80N 4CH3A 2DYRC 1Q8IA 2DJVA 3H1JH 1K34A 2UU9O 2WLIA 2D3OW 3BCCH 2E74B 4O4IB 1E79G 2HHHB 1W0KG 2ZIMA 4J9ZB 2ILMA 4NYKA 1Y66A 3HPLC 5EZYB 5B1BC 4DV0B 5IJ0A 1L1FA 3K5OA 4DV3O 4FLXA 2JK5C 3OTFA 4QE7A 1H8HG 2CH7B 3ZHRA 1XNRB 5LGNA 1CP9A 1KKCA 4UCTA 1FXHA 2Q6AA 1PNKA 1YJWV 1W2BU 2EILC 4I55B 2AZ0A 5JVDB 2H8PC 3RW0A 1LR1A 2A06H 4JI0B 4O2BA 1R3KC 5EYPA 3TXQA 4LC1A 1KB9F 5BY1A 5FLXN 1V54C 1BS3A 2W0FC 4H44B 3CXCU 2M6YA 3E8HA 4DV4B 4DUZO 3L75H 1YXBA 1A32A 1GH6A 4O4LB 3VOUA 4LF7O 1FJGO 1IBLB 1OV9A 1CPYA 4Q20A 4JI3O 5LHGA 3L71H 1GM8A 2DQ3A 4X62B 3CCSV 2EIKC 5H6RA 2ZXWB 3PN1A 4L8JA 1XBLA 2Q67A 5DEDA 1QVFU 2Q9LA 2DW4A 2OCCC 2RMKB 4UB8Z 1OCOB 2PI5A 1Y67A 5B1OA 1TUEB 4I0XA 4QGPA 4AILC 3ZMSA 1JOYA 3SYPA 4DR5B 1S3JA 1XNRO 4I50A 3SJQC 3K79A 4JAUA 5LHIA 4NTYA 1YVWA 3C3TA 4UCRA 2XAGA 2KG7B 4X64B 4WBNA 4IYHA 1Q86W 1MABG 2YC0A 3CCVV 3JAKB 4LR3A 2R9IA 3RFRA 2UXDB 2CE4A 1XL6A 4UFZA 1Q81W 4TWKA 4YXWG 2B9ZA 5CB4B 3HKCA 2CDYA 4KUMA 1XNQB 1BSMA 3DTUB 3JARA 3FB7C 1K5SA 3ZMZA 3SYCA 1ZSPA 3LDCA 3H1HH 3I56V 4FLTA 2CH7A 4DRXB 4I9QA 1M1KW 3B77A 4JI7O 1SKVA 4FLVA 4DR2O 3ZMTA 2K1EA 4HBNA 2DYSB 2XAHA 4TV8A 1XOUA 2UUAO 4CZZA 5LL6Y 4UB6Z 1VQ5V 1IURA 1BT8A 2A7WA 3T1HO 2P5OA 4U3JA 4ZOLA 4CS2A 2JVDA 4P2ZA 4DO2A 3LSUA 3O9OA 3E35A 3K08A 2LW7A 4UVCA 3P3NA 1ORQC 4O4LA 1PL4A 3RYCB 4JI5B 4MT8A 5BZBA 1NH2B 4UV8A 3KCXA 2H94A 5IE9A 2EZPA 2DYRB 4X64O 5B5EZ 4CC6A 4JYCA 4GZRB 2HVKC 4LFAB 1ZL8A 4JGSA 1BQ0A 3AG3C 4U7OA 1B04A 4FM2A 4JI6B 4J10A 2CK3G 4WFGA 3CRRA 3U10A 1N8RW 1HNXO 2QM4A 1G4YB 1YITV 4DR3B 3QF7A 3RYCA 3E8BA 2QM7A 1QR9A 1GKFA 2GV9A 3ABMC 1I94B 1PL0A 2WLIB 4CS4A 1AJNA 3WB0A 5DECA 3ZBHA 1HR0O 3WFVA 2RCVA 2Q69A 4L87A 2FB5A 4MTXA 3CMAV 3DC6A 4K35A 2ZR2A 5IYZB 1P49A 1WPBA 3SPCA 4LFCB 3F7VC 1RP3B 4JZGA 1EN6A 1WNSA 1EN5A 2Q4PA 1IDSA 2BOBC 1DTOA 1P4RA 3HB3B 1MNGA 3THOA 1NS1A 1XMOB 4LF9B 3OUFA 4YY3B 1VQ6V 2HVJC 2WA3A 2EIKB 1MZEA 4H33A 3JD4A 3FB6C 2UUBB 3RVZA 2XTAA 2UUCB 3HKEA 3H1IH 4U3JB 4ZOLB 1HDJA 5L3FA 5IY5C 5LP6A 2E5LB 4B3TB 1VQ8V 2Q0AA 2YIBA 1V55B 3R66A 4MVSA 1ZAUA 4N21A 4UCSA 2EZOA 3G80A 4D7TA 3RGBA 2XUMA 4X65B 3RYIA 3DXRA 4B3RB 1R3IC 1N32O 3P32A 4QPJA 4O2BB 4LH6A 2Q7HA 1QLEB 2ZNJA 2A9HA 2WLLB 4LF4O 2KKWA 5B66Z 3X2QC 3JASB 3JD2A 3E8FA 2UXNA 3ZX6A 4DR2B 2O57A 4XDJA 2A0LA 3ABMB 1NZ6A 5IY5B 1BE3H 2ZM6B 1F51A 4DV2O 1R73A 2ZR3A 4GKKO 2Y69C 2YXLA 1SS3A 3SPHA 3JYCA 4IIJB 2WLMA 4FZ0A 4JI5O 1Y74B 3IC9A 5J2UB 5CB4A 1M56B 1K92A 1UJWB 1QQCA 5JCOC 4KL1A 3QO5A 1ENVA 1GN2A 2W6JG 1M57B 4NXMB 2YXHA 1SQQH 4JAAA 4GX5A 2B1IA 1J5EB 3T2MA 4LP8A 1N36O 2QKSA 4OPAA 5C8YA 1FPOA 1AI5A 3JSNA 5J9PC 4EFEA 1NH2D 2IM9A 1Y6XA 2QWRB 3KKYA 1QBZA 2DN9A 3UQ8A 4JI1B 2YEVB 4O4IA 1YTFB 1SRYA 2L6LA 1HW7A 1J95A 1MOFA 2DWEC 1FJGB 3CJHB 3BPZA 3SPIA 4PDMA 3FFQA 1LUVA 5KX5B 3A2FA 4MSWC 1BQZA 2XAFA 2DMXA 1NTZH 1TVKA 2PY5A 1OCCB 2ARHA 2E3CA 3ABTA 5IWAB 3K0GA 2H3OA 1NR1A 3W7XA 3QTCA 5LOVB 5EBLC 4ZI7A 3A0HZ 4E2LA 2UUCO 3AG1C 3ZRWB 4PDVA 3UKMA 1SESA 1S5JA 2N05A 3UT5A 3WG7B 1VQOV 3OGIB 1Q7YW 2WLJA 2GBOA 1D5NA 1SQVH 3Q4HB 1XHZA 1FXKC 3S3XA 1WPXA 3OFNG 4O4JB 4RWUA 2YIAA 3U0ZA 1PKXA 3LDEA 4DR3O 4LF4B 3SYQA 1O9HA 1W59A 5LXTA 1QLNA 3CXHF 1V55C 4B3MB 2GUZA 3SR2C 2ADQB 2Q68A 1OCZC 4OX9B 4IGGA 4JYYA 1DF4A 2ZXWC 3ZCCA 3BA8A 4KHPB 2QWPB 1IX9A 5KHHA 1X59A 4GUNA 3CB2A 1THZA 3OMAB 3SYAA 2W6IG 5ITZB 4LNUB 1AB3A 3JAKA 2BTQA 3TXSA 3DGEA 4FLZA 3RBZA 5GONB 3ZN0A 2YEVA 3CSXA 2UXCB 4JV5O 4BAYA 1GAXA 5GW7A 3F7YC 4K3AA 1AR4A 5BR8B 4G28B 2YICA 3B8MA 2KQXA 5KUMA 2GDSA 4FVMA 5JWPA 1B3QA 2LO1A 4TV8B 2R72A 4BWAA 1UPGA 5IYCO 1ROPA 4RAIA 4DR1O 3OAAG 3QO7A 5DN6G 3VBBA 4PA9A 3OR6C 2X6CA 2JEXA 4W4LA 4YIOA 3BRCA 3AG4C 3L70H 2YI8A 3R65A 1K8AW 4KXRA 2GUZB 4OX9O 1GN6A 1QR8A 2GTAA 4KFMA 4HAMA 3HKCB 4JAVA 3JALB 4LF6O 1FD9A 3RYHA 1VF6C 1VF5B 1Q5OA 3E22B 4MTOA 2ZINA 3JD3A 2UU9B 1XMQO 5LP6B 2HFEC 1SQFA 2QTOA 1EBOA 4HZ3A 4H0LB 1G6UA 1H2NA 3OTOB 4X1IA 2FMLA 3GB7C 1JQ0A 2VRZA 1YF2A 1VP7A 2A3QA 3D3QA 1QVGU 1PV0A 3LUTB 1TUBA 4DW0A 5BMVB 3ZEDA 5EYPB 4J11A
chains in the Genus database with same CATH topology
3OE7G 3OGCC 1VQ5V 2XAQA 3ABLB 4XBFA 1K73W 2HG5C 2ZQMA 2X6BA 4I5SA 4P2ZA 1VQMV 4DO2A 1YIJV 1I5YA 2B1GA 4H37A 3E35A 3K08A 4UVCA 2V1DA 2HKOA 3ABKB 3F5WC 1VQLV 4ZKIA 1YJNV 1VQKV 1ORQC 5IYDO 2WLLA 1NBMG 2P6JA 2WLNA 4WFFA 3FYEB 1FXKB 3LNMB 4QPKA 2IJHA 4MT8A 2DQ0A 5BZBA 3T4ZA 1NH2B 1GMGA 1M57C 4UV8A 4X8AA 4Z1MG 2H94A 2EZPA 2DYRB 1AI6A 1R3JC 1JVMA 2IJJA 2AHYA 4QNHB 5LHHA 4JYCA 2HVKC 3LDDA 4JGSA 1B6QA 1PNLA 5CN0A 4TSFG 4WFBV 3AG3C 3JCZA 4U7OA 1K9MW 1OCRB 3JD0A 1RPRA 2CK3G 2WSSG 2WLKA 4JPRA 4WFGA 5B1BB 2AHZA 4RUFA 3M99B 1JX9A 4P9PA 1N8RW 4MTGA 5EC1C 3CCMV 4JTAB 4QIWF 5CBHA 4MTFA 1YITV 1G4YB 5FL7G 4P30A 2Z3YA 4XDKA 3SPGA 1XL4A 3E8BA 2QM7A 4MS2A 1QR9A 2Y48A 3K3WA 1GKFA 3ABMC 1K5QA 2WPDG 3B8NA 4X89A 1PL0A 3MHSC 4R50A 3RVYA 1Q82W 3K04A 2WLIB 1AJNA 1KC8W 3OMIB 3W7TA 1AJQA 2ATKC 3WFVA 2Q69A 2X7RB 4L87A 3CCEV 3TK1A 4UV9A 4MVZA 3CD6V 3D36A 5B3SB 4MTXA 3CMAV 1K33A 4RUEA 1K97A 2V7QG 5CBFA 1G8MA 3ABUA 2ZR2A 3TCUA 3LSSA 5CBGA 3K06A 2IJKA 5L3EA 1BHBA 3QO8A 3IGAC 4R8CA 1DF5A 3SPCA 1VQ9V 1NR7A 3PJSK 2ITDC 2JJ2G 3F7VC 3E2EA 1M9NA 3E89A 4RQEA 5CMUA 2XNDG 3WG7C 5H6QA 1RM1C 1OCRC 2BOBC 1DTOA 1P4RA 3HB3B 3T4DA 3OEEG 2XAJA 2KB1A 2OCCB 3NXSA 3ETDA 3W7SA 1AR1B 4DXWA 3OUFA 1VQ6V 2QE7G 2HVJC 4MW8A 2EIKB 4H33A 3JD4A 3FB6C 4UVBA 3RVZA 2Y69B 3A0RA 2JJ1G 5L3FA 1S77D 1OCCC 5IY5C 5EBWC 1VQ8V 3AG2C 4RQFA 5C93A 5EC2C 1V55B 2HLDG 3FB5C 4MVSA 4N21A 2EZOA 4PDLA 3TETA 5E1AC 2HJFC 3ASOC 2IU0A 1YHQV 1R3IC 3P32A 4PA6A 1SZTA 4QPJA 1GO3F 1QLEB 3ASNC 2MK3A 5CA3A 3G6EV 1KECA 1QLEC 2A9HA 4MW3A 2WLLB 4PA4A 1S0VA 1KKDA 4WFHA 5IDJA 3FYIB 1NKDA 1GM9A 3BEHA 3X2QC 3QNEA 1IXMA 5EBMC 1BL8A 2XOKG 4XDLA 4GCZA 3JD2A 3E8FA 2ITCC 2UXNA 3K03A 3CCLV 4FK5C 1S72V 1HWYA 1NQTA 4XDJA 2A0LA 2GSMB 3ABMB 1OHHG 1S76D 5IY5B 4CBCA 1F51A 1CEZA 4X88A 1R73A 2ZR3A 3AG4B 2Y69C 4EKWA 1K3EA 2WAMA 5L3GA 3SPHA 3ZRXA 4BIUA 3JYCA 3ASNB 4U7NA 1JPXA 5LGUA 2WLMA 3E83A 2QM8A 4BW5A 2X6AA 3ASOB 2YSUB 1VQ7V 1AROP 2JIZG 1K7DA 2IH1C 1E1QG 1KP2A 4ZBMA 1M56B 3CCJV 4GX2A 1K92A 1UJWB 1M56C 3OM3B 3E86A 3QO5A 1ENVA 2P7TC 2W6JG 1SETA 4PA7A 1M57B 4FPPA 3W7WA 5IYBO 1COWG 4P9OA 4TT3G 4GX5A 4JYBA 2B1IA 2IU3A 1H38A 3T2MA 3ML0A 1YSCA 4LP8A 3ETEA 2QKSA 2UXXA 3KG2A 1AI5A 3ZMVA 3G4SV 1MG1A 4I9WA 2EBOA 5J9PC 4RO2A 4UXNA 3CCQV 1NVPD 2Z5UA 3EFFK 1NH2D 1VQNV 2EIMB 1W0JG 2OT5A 3OMNB 1QBZA 4JTDB 2NLJC 2YEVB 4F4LA 1YTFB 1FS0G 1SRYA 1M90W 1OCZB 1YJ9V 1J95A 4UUJC 1MOFA 2DWEC 3AEIA 2LP7A 4J9YB 2C2AA 1LNQA 2R9RB 3CYOA 2A79B 1GTOA 3SPIA 3LSQA 3OEHG 2OTJV 2P90A 5L3DA 1GK9A 4MVMA 4PDMA 2JEUA 3CMEV 2P67A 5L3BA 2EIJC 1BMFG 2EINB 4MSWC 4QE9A 2XAFA 2DYSC 3ZIAG 5KUKA 2IH3C 1RPOA 4JASA 2PI4A 5B1AC 1P7BA 3D3IA 2EIMC 3JD1A 3OW2U 2LFSA 1VQ4V 1OCCB 5EK0A 3FB8C 5LGTA 1EFRG 1F4NA 3ABTA 4JTCB 3ZN1A 3G71V 3P30A 3K0GA 2QA4V 2ZD9A 2HR3A 4WFAV 1NR1A 1QCEA 3AG3B 3MD0A 3W7XA 4R6ZA 3CP1A 1K4DC 4PDRA 5EBLC 1RM1B 2ZDIA 3AG1B 4E2LA 3IC7A 1GM7A 3AG1C 3ABLC 3E8GA 3ZRWB 4PDVA 3SYOA 2QEXV 1R3LC 3UKMA 2EJRA 2F43G 2M7WA 1F4MA 3EHBB 3CC2V 5KA6A 3STZC 1SESA 3H01A 3WG7B 3OR7C 1VQOV 3CCRV 1Q7YW 2FTKA 2WLJA 3K0DA 4WF9V 2DYRC 1FXKC 1K34A 3ZMUA 4HYOA 2WLIA 2D3OW 1WPXA 3OFNG 4FIPC 1PKXA 1E79G 1W0KG 3LDEA 4J9ZB 3SYQA 4MVOA 1QLNA 1Y66A 3HPLC 3I55V 4WFEA 5B1BC 1L1FA 2JK5C 1FFTB 4KP4A 1PD3A 1V55C 4G2KA 4QE7A 1H8HG 5LGNA 2WWWA 2Q68A 4JF3A 1CP9A 5B1NA 1K4CC 1OCZC 1FXHA 2Q6AA 4QJFB 1VQPV 1PNKA 1DF4A 2ZXWC 1YJWV 2X0LA 1W2BU 2EILC 3ZCCA 3CC4V 1JJ2U 2H8PC 1YTFD 1PNMA 4OXSA 1KD1W 1JCHA 3RW0A 1THZA 3K9AA 3OMAB 3SYAA 1I5XA 3CCUV 2IJIA 1DLBA 2W6IG 2JDIG 1R3KC 4PA3A 4LC1A 1WLEA 2BOCC 3X2QB 4PELA 1V54C 3DGEA 2W0FC 3CXCU 1KQSU 3RBZA 3ETGA 1YI2V 3ZN0A 1OZ0A 2YEVA 3E8HA 1EZJA 3FKSG 4BAYA 2IW5A 5GW7A 3F7YC 1H8EG 3VOUA 1Y4MA 4G28B 3B8MA 5B3SC 3ABKC 5KUMA 2WLHA 3UM7A 4ASUG 1H2GA 2DWDC 1CPYA 4Q20A 5H9CA 4GX0A 5LHGA 4FJCC 1GM8A 2B5UA 1SERA 2DQ3A 3CCSV 1NVPB 2EILB 2EIKC 5H6RA 1ZWIC 2ZXWB 5IYCO 4G27B 1ROPA 4RAIA 3OAAG 2Q67A 3QO7A 5DN6G 3VBBA 1QVFU 2DW4A 2OCCC 3IFXA 4PA9A 3OR6C 4R7CA 2NNUA 1OCOB 5HFMA 2PI5A 2X6CA 3BY6A 1FXKA 2JEXA 5B1OA 4BIZA 1TUEB 1S5HC 1V54B 3AG4C 2GHYA 3ZMSA 3ZRSA 1JOYA 3SYPA 3R65A 1S3JA 5HFLA 5B1AB 3SJQC 1BHAA 3K79A 1K8AW 4JAUA 5LHIA 1R6NA 1AJPA 4WCEV 3MHHC 1QR8A 4KFMA 1R6KA 3GWOA 2XAGA 1NJIW 3ZRWA 4HAMA 4GT1A 1Q86W 5KA5A 2LFRA 4UVAA 4JAVA 1MSWD 1MABG 1AI7A 3CCVV 2R9IA 2OTLV 4MTOA 1XL6A 1Q81W 3JD3A 4TWKA 4YXWG 4KUMA 3SPJA 5L3CA 2HFEC 2QTOA 1EBOA 3DTUB 4HZ3A 1OCOC 4FMTA 3FB7C 4LCUC 1K5SA 5LBQA 3ZMZA 4MVUA 4MVRA 3T1CA 3GB7C 3SYCA 5DM6V 1JQ0A 3LDCA 3ZRVA 3W7UA 3I56V 1E1RG 4MVQA 3ZJZA 1FXVA 2ZDIC 1M1KW 3B77A 2EINC 2EIJB 2XASA 3AG2B 3OUSA 4GX1A 3CPWU 4N23A 3STLC 1QVGU 3ZMTA 2K1EA 3LUTB 1F23A 2DYSB 2XAHA 3CC7V 4LBEC 1AI4A 4CZZA 1KP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H33 A;  2BOC C;  3OGC C;  3FB6 C;  3RVZ A;  1V54 C;  2W0F C;  4JTD B;  3RBZ A;  2NLJ C;  2HG5 C;  4F4L A;  2X6B A;  2YEV A;  3E8H A;  4P2Z A;  4H37 A;  3K08 A;  1OCC C;  5IY5 C;  1J95 A;  3F7Y C;  5EBW C;  3AG2 C;  2DWE C;  4UUJ C;  4J9Y B;  3F5W C;  5EC2 C;  3FB5 C;  4MVS A;  3VOU A;  1ORQ C;  1LNQ A;  4G28 B;  2WLL A;  4PDL A;  2R9R B;  3TET A;  2WLN A;  2A79 B;  4WFF A;  5E1A C;  3LNM B;  3SPI A;  2HJF C;  3ASO C;  5B3S C;  3ABK C;  1R3I C;  4MVM A;  4PDM A;  5KUM A;  3T4Z A;  5BZB A;  2WLH A;  4PA6 A;  3UM7 A;  2EIJ C;  2DWD C;  1M57 C;  4MSW C;  4X8A A;  4QE9 A;  3ASN C;  1QLE C;  4GX0 A;  2DYS C;  2A9H A;  5KUK A;  4MW3 A;  2WLL B;  2IH3 C;  4PA4 A;  1KKD A;  1R3J C;  4WFH A;  1JVM A;  5B1A C;  1P7B A;  2AHY A;  2EIM C;  4QNH B;  3BEH A;  3X2Q C;  2EIK C;  1ZWI C;  1BL8 A;  4XDL A;  2HVK C;  5EBM C;  3E8F A;  2ITC C;  3K03 A;  3LDD A;  4G27 B;  5EK0 A;  4RAI A;  3FB8 C;  4JTC B;  2Q67 A;  4XDJ A;  2A0L A;  3K0G A;  2ZD9 A;  2OCC C;  3IFX A;  3AG3 C;  4PA9 A;  3OR6 C;  4R7C A;  4CBC A;  4R6Z A;  1K4D C;  2X6C A;  4PDR A;  2WLK A;  4WFG A;  4X88 A;  5EBL C;  2AHZ A;  4RUF A;  1S5H C;  2Y69 C;  4P9P A;  3AG4 C;  3AG1 C;  4MTG A;  5EC1 C;  3ABL C;  3E8G A;  4EKW A;  3ZRS A;  4PDV A;  3SYP A;  4JTA B;  3R65 A;  3SYO A;  5CBH A;  1R3L C;  3UKM A;  4MTF A;  1G4Y B;  3SJQ C;  4P30 A;  3SPH A;  4XDK A;  3SPG A;  3STZ C;  1XL4 A;  3JYC A;  3E8B A;  3OR7 C;  2WLM A;  4KFM A;  4MS2 A;  3E83 A;  2WLJ A;  3K0D A;  4BW5 A;  3ABM C;  2DYR C;  2X6A A;  4X89 A;  4MW8 A;  4R50 A;  3RVY A;  3K04 A;  2WLI B;  4HYO A;  2WLI A;  2IH1 C;  4MTO A;  1XL6 A;  2ATK C;  4TWK A;  2Q69 A;  3LDE A;  4ZBM A;  4J9Z B;  4GX2 A;  1M56 C;  3SYQ A;  4MVO A;  4MVZ A;  3E86 A;  3SPJ A;  3HPL C;  2HFE C;  2P7T C;  2QTO A;  4RUE A;  4WFE A;  5B1B C;  4PA7 A;  4HZ3 A;  5CBF A;  1OCO C;  3FB7 C;  2JK5 C;  4LCU C;  5CBG A;  3TCU A;  3K06 A;  4MVU A;  4MVR A;  1V55 C;  3T1C A;  3GB7 C;  3IGA C;  4QE7 A;  4R8C A;  3SPC A;  3SYC A;  3LDC A;  2ITD C;  3PJS K;  3F7V C;  2Q68 A;  4GX5 A;  4P9O A;  3E89 A;  1K4C C;  1OCZ C;  4MVQ A;  3ZJZ A;  2Q6A A;  3T2M A;  2ZXW C;  3WG7 C;  2EIL C;  4LP8 A;  1OCR C;  2BOB C;  2EIN C;  2H8P C;  3OUS A;  4GX1 A;  3T4D A;  3STL C;  2QKS A;  4OXS A;  2K1E A;  2KB1 A;  3LUT B;  3RW0 A;  3KG2 A;  4LBE C;  3SYA A;  4DXW A;  3OUF A;  4RO2 A;  2HVJ C;  4I9W A;  1R3K C;  4PA3 A;  5J9P C;  3EFF K; 
#chains in the Genus database with same CATH topology
 3OE7 G;  3ABL B;  1RSO A;  1IBK O;  4IT5 A;  4XBF A;  3UO3 A;  5CA1 A;  2X6B A;  1N36 B;  4H37 A;  3CRC A;  4BIO A;  3ABK B;  5KHK A;  4ZKI A;  1YJN V;  1VQK V;  2RDC A;  1NBM G;  1KBH A;  4WFF A;  5JQG A;  3FYE B;  4QPK A;  2RNB A;  2DQ0 A;  2HEP A;  4ICG A;  1H2S B;  2LJ2 A;  1Y74 A;  2AHY A;  5LHH A;  2QWQ B;  3BVO A;  3L9D A;  2QR4 A;  2PYJ A;  4HNA A;  1B6Q A;  1XRE A;  5KMG A;  5CN0 A;  4TSF G;  2OCH A;  4WFB V;  3CRA A;  3JCZ A;  4O4H A;  4JPR A;  5B1B B;  4RUF A;  1JX9 A;  3EXA A;  5FPO A;  2BCC H;  4JTA B;  1WP7 A;  5FNV B;  5CBH A;  5FL7 G;  2Y4T A;  1HNZ B;  2Z3Y A;  4OPH A;  1IZ3 A;  2E76 B;  2Y48 A;  1IBM B;  5LMU B;  4K8Z A;  3Q4H A;  1K5Q A;  3B8N A;  4X89 A;  3RVY A;  4NTX A;  3ZS8 C;  3OMI B;  1AJQ A;  1H2K A;  4X66 B;  3CX5 F;  4GYC B;  3IJ4 A;  3CD6 V;  4UV9 A;  5B3S B;  4GKJ B;  1K33 A;  4RUE A;  1K97 A;  1RSO B;  2JS5 A;  1G8M A;  3ABU A;  3TCU A;  1NT2 B;  3K06 A;  2IJK A;  3FD9 A;  1F7Y A;  3QO8 A;  3IGA C;  4R8C A;  1NR7 A;  3E2E A;  3BA9 A;  2LGQ A;  1M9N A;  5CMU A;  4DYL A;  5EZY A;  2XND G;  5H6Q A;  2PTM A;  3N2K B;  4UCU A;  4I7Z B;  3OEE G;  3NXS A;  4AI8 A;  1Q3E A;  5D5P A;  4ZHQ A;  4O2A B;  4LF5 O;  1L0L H;  4UVB A;  1IBL O;  3UCS C;  1B06 A;  4EEQ A;  5C8Y B;  3FAV B;  4JI3 B;  3BAA A;  5KHI A;  3CWB H;  5KHJ A;  2AZ2 A;  1OCC C;  1S77 D;  5EBW C;  4RQF A;  5EC2 C;  4FLU A;  5E1A C;  5BXZ A;  3ASO C;  1YHQ V;  2IU0 A;  3C3S A;  1SA0 A;  3APQ A;  3N27 A;  4PA6 A;  1SZT A;  5ITZ A;  1GO3 F;  2MK3 A;  1TAE A;  1QLE C;  1KU9 A;  1S0V A;  1NKD A;  3QNE A;  2XOK G;  2BTO A;  4GCZ A;  1S72 V;  1NQT A;  2F95 B;  4X20 B;  3JAR B;  4B3S B;  4CBC A;  1R6T A;  2ZE6 A;  4EB6 B;  2VQE B;  4JI6 O;  2WAM A;  1PP9 H;  5LYJ A;  2ZNI A;  1BGY H;  4U7N A;  1JPX A;  1FYJ A;  3E83 A;  2QM8 A;  2JRI A;  2Q0O C;  2X6A A;  2WA4 A;  4K0K O;  1NU1 H;  2YSU B;  1AR5 A;  1ARO P;  2JIZ G;  2YUA A;  1SQG A;  2CAZ C;  4GX2 A;  4OGQ B;  1M56 C;  1XIL A;  3E86 A;  5A2Q N;  2P7T C;  1HR0 B;  2CUG A;  4FPP A;  3W7W A;  5IYB O;  4LF6 B;  4P9O A;  4TT3 G;  2ZKO A;  1H38 A;  4LH7 A;  1YSC A;  4LFC O;  2ZE8 A;  2UXX A;  3ZMV A;  3WB1 A;  1H2L A;  3G6B A;  4I9W A;  3RN4 A;  4RO2 A;  4UXN A;  1NVP D;  2Z5U A;  3EFF K;  2EIM B;  5JH7 A;  3CJH A;  4JV5 B;  2R9A A;  3C90 A;  4PI2 A;  4DR5 O;  5J2T B;  2DOS A;  4CH4 A;  1N34 B;  4TQD A;  5D5Q A;  1OCZ B;  4IL6 Z;  1YJ9 V;  2RQ6 A;  4NKG B;  4X66 O;  4GLX A;  2VQE O;  3RYI B;  1GTO A;  1HNW O;  3LSQ A;  3OEH G;  4DR6 O;  2YID A;  5L3D A;  3CME V;  1FAF A;  4IHJ B;  1XI1 A;  4K8X A;  2EIN B;  2YI9 A;  1ZLZ A;  2ZIO A;  1P84 F;  3K57 A;  4DR7 O;  4NXN B;  4F6E A;  4ZIB A;  4JAS A;  1H2M A;  4FLY A;  2QGN A;  3L74 H;  4DV5 O;  5B1A C;  2EIM C;  3D3I A;  3M8A A;  2LFS A;  1VQ4 V;  2ZT9 B;  3FB8 C;  4JTC B;  3ZN1 A;  3P30 A;  2QA4 V;  2ZD9 A;  4JI4 B;  2HR3 A;  3MD0 A;  4H13 B;  4R6Z A;  1K4D C;  4LF5 B;  4C7U A;  1GM7 A;  2KG7 A;  3E8G A;  4YJ2 B;  2F4V B;  3OR7 C;  1T5E A;  3K0D A;  3N2G B;  5F2V O;  3VQW A;  3B40 A;  3ZMU A;  2Q7G A;  4HYO A;  4NTW A;  4FIP C;  1AP5 A;  4A5U B;  1GN3 A;  4MVO A;  3OTO O;  1Z2G A;  3I55 V;  3B4S A;  1UFI A;  2RN9 A;  5JCO A;  1IBM O;  1O9G A;  4KP4 A;  2ZE7 A;  2ODM A;  2QWO B;  2WWW A;  4JF3 A;  2OIE A;  5B1N A;  4QJF B;  3CC4 V;  1YTF D;  1PNM A;  4OXS A;  1KD1 W;  1JCH A;  1WAZ A;  4DR7 B;  3JCU Z;  3CCU V;  1I5X A;  1G1X B;  1BCC H;  3K5L A;  3AK3 A;  3X2Q B;  4NVP A;  3RYH B;  3HKB B;  1KQS U;  3ETG A;  5JJN B;  2P4K A;  3EVK A;  3FKS G;  2IW5 A;  2CTW A;  2F23 A;  1KYO F;  3UO2 A;  4X9Q A;  1I94 O;  2XHB A;  4I0X B;  3UM7 A;  2DWD C;  3AG7 A;  1U97 A;  1IVS A;  4GX0 A;  1RFY A;  2B5U A;  1NVP B;  2EIL B;  4WBN B;  3BFR A;  4PI0 A;  4G27 B;  2HP8 A;  1DGS A;  1V9P A;  3JAW B;  4R7C A;  2Y4U A;  1VIB A;  4DV3 B;  1S5H C;  3AK1 A;  1V54 B;  5IJ9 A;  2CGO A;  2GHY A;  3ZRS A;  4LF9 O;  1BHA A;  1R6N A;  1AJP A;  4WCE V;  3MHH C;  1HP8 A;  2PUS A;  1M93 A;  3GWO A;  1US6 A;  1YCI A;  2LFR A;  1Z5V A;  4DR6 B;  2K9P A;  1SQB H;  4AHC A;  4O4J A;  1JFF A;  2OTL V;  2EX3 A;  1NTM H;  4Q6G A;  4EB6 A;  4YJ3 B;  5L3C A;  1AIL A;  1Q6U A;  4DV7 B;  1OCO C;  5EIB D;  4FMT A;  1N32 B;  3HKD B;  5LBQ A;  2L35 A;  4I50 B;  3VQX A;  4MVR A;  2YS8 A;  3T1C A;  1QNM A;  3VQY A;  5DM6 V;  3ZRV A;  3W7U A;  4JI1 O;  4LF7 B;  3H1L H;  1XDC A;  1FXV A;  5CA0 B;  1NTK H;  2EIN C;  3AG2 B;  2HJD A;  4DW1 A;  3OUS A;  3CPW U;  3STL C;  1F23 A;  4W4K A;  3CC7 V;  2E75 B;  4LBE C;  3NR7 A;  4LNU A;  2KSD A;  3KZI Z;  1AI4 A;  3OGC C;  2XAQ A;  2BSK B;  2N04 A;  2HG5 C;  1PPJ H;  3F5T A;  1YIJ V;  3KCY A;  1XQ8 A;  3JAW A;  3F5W C;  1VQL V;  3RT3 C;  1N33 O;  1Q6I A;  2WLL A;  2WLN A;  2IJH A;  4D7S A;  4DV1 O;  1I0H A;  1GMG A;  1M57 C;  4X8A A;  4CH5 A;  2IBZ H;  1N34 O;  3U11 A;  1AI6 A;  1R3J C;  1JR9 A;  1JVM A;  3S3W A;  4QNH B;  4O4H B;  3D36 C;  2YDE A;  3LDD A;  4B3S O;  5H2F Z;  4B7K A;  3JD0 A;  1EN4 A;  4IIJ A;  4MTG A;  5EC1 C;  4YJ2 A;  4JYA O;  4FM0 A;  4DV5 B;  4QIW F;  4JZ2 A;  1N0J A;  5LOV A;  3SPG A;  1WN7 A;  1XL4 A;  5IT9 N;  1Z5W A;  5EIB C;  2G38 A;  2WPD G;  2F66 C;  1Q82 W;  3K04 A;  1VF7 A;  2UUA B;  1FKA O;  2VS0 A;  1VF6 A;  4X1K B;  2ATK C;  3K58 A;  2X7R B;  2CTQ A;  3TK1 A;  2CGN A;  3D36 A;  4LF8 O;  4YJ3 A;  2OWO A;  5CBG A;  4X1I B;  4GKK B;  3LSS A;  3RWR D;  5L3E A;  1BHB A;  3HKD A;  1Y76 A;  1VQ9 V;  3PJS K;  2ITD C;  2JJ2 G;  3P3P A;  4LWS A;  3TJT A;  1GN4 A;  1XHX A;  3E89 A;  4DV1 B;  1OCR C;  1ZTE A;  3JAL A;  3T4D A;  2XAJ A;  3K5M A;  2OCC B;  4DK1 A;  3W7S A;  1AR1 B;  3K59 A;  2Y0I A;  3VQV A;  4MW8 A;  2Y69 B;  1ZUQ A;  5KLV H;  4DR4 B;  2JJ1 G;  4CH6 A;  3LNN A;  4FFK A;  1Q43 A;  1I08 A;  3D8C A;  1EM1 A;  3ZHV A;  5J2T A;  4DUY O;  1JMK C;  1TVK B;  4F6R B;  4NXN O;  5BMV A;  2YIB D;  5CA3 A;  3ASN C;  1KEC A;  4MW3 A;  4DUZ B;  4PA4 A;  4WFH A;  5IDJ A;  3FYI B;  1GM9 A;  3HKE B;  3BEH A;  1IXM A;  5EBM C;  2P06 A;  4XDL A;  3BHP A;  3BAB A;  3JAS A;  1S5L Z;  2MW2 B;  4TQF A;  1HWY A;  2GSM B;  1N4C A;  1OHH G;  5H5N A;  3SGI A;  2QJ1 A;  4AQY B;  3AG4 B;  1WJZ A;  5LA6 B;  4EKW A;  1K3E A;  1Y76 B;  4JI2 B;  4BIU A;  3ASN B;  4LWS B;  5LGU A;  4FZ1 A;  3APO A;  2HHH O;  4YY3 O;  1VQ7 V;  3H9V A;  4DV0 O;  1E1Q G;  2UUB O;  4ZBM A;  1DK1 A;  5JQG B;  5JJE B;  4JYB A;  5LA6 A;  2IU3 A;  4DK0 A;  3ML0 A;  4X65 O;  5JH7 B;  3L73 H;  3ETE A;  4JYA B;  3KG2 A;  1MG1 A;  2EBO A;  3CCQ V;  4O2A A;  1VQN V;  2JGD B;  2BSK A;  1W0J G;  3OMN B;  2F1M A;  2OIG A;  4JTD B;  1TUB B;  2NLJ C;  4F4L A;  1M90 W;  2FL4 A;  2ADP A;  4B3M O;  3SJC C;  2LP7 A;  4J9Y B;  1SQP H;  2CTP A;  2C2A A;  1LNQ A;  2R9R B;  3CYO A;  4J7J A;  3B09 A;  3J81 N;  2OTJ V;  1SF9 A;  5L3B A;  2EIJ C;  3T1H B;  5KX5 A;  4DV6 O;  4FM1 A;  5KUK A;  2IH3 C;  3UT5 B;  2PI4 A;  1JFF B;  3HR0 A;  3JD1 A;  1Q90 D;  3GVM A;  3OW2 U;  3A0B Z;  4ABM A;  1HNZ O;  4PD4 F;  1WA8 B;  5EK0 A;  4TUY B;  1MMM A;  1EFR G;  3G71 V;  5JJJ B;  1XMO O;  3T1Y B;  2UXC O;  1AVM A;  3AG3 B;  3CP1 A;  4PDR A;  1YDX A;  1M4U A;  3IC7 A;  2OYQ A;  3ABL C;  2QEX V;  1R3L C;  2ZE5 A;  2F43 G;  3EHB B;  3CC2 V;  3JAM N;  1J5E O;  5A9G A;  1WB8 A;  1IBK B;  4WF9 V;  2UXD O;  2YXY A;  3GWK C;  3RYF B;  2DE0 X;  4ZI7 B;  1I7F A;  2QWN B;  4WFE A;  1FFT B;  3ETQ A;  2XT9 A;  1PD3 A;  5J2U A;  4G2K A;  1SQX H;  2PZS A;  1K4C C;  4D6T H;  2ETN A;  5K1P A;  2P22 C;  1VQP V;  2NR5 A;  2X0L A;  1JJ2 U;  3JSL A;  3K9A A;  2IJI A;  1DLB A;  3SJB C;  4Z1V A;  2JDI G;  4PA3 A;  1IXB A;  1WLE A;  1P7G A;  1GRJ A;  2BTQ B;  1PM9 A;  2BOC C;  4FFB A;  4PEL A;  3ZHU A;  1YI2 V;  1URF A;  1OZ0 A;  3CE2 A;  1EZJ A;  2VWK A;  3CRM A;  1H8E G;  2FKX A;  2F93 B;  1Y4M A;  3DSQ A;  2N74 A;  5B3S C;  3ABK C;  1VMG A;  2WLH A;  4ASU G;  1H2G A;  1AP6 A;  5H9C A;  4FJC C;  4LFA O;  3K9S A;  1SER A;  2E5L O;  4B3T O;  1QHT A;  3SJA C;  1ZWI C;  2BE3 A;  4J7K A;  2R70 A;  4PV1 B;  4DUY B;  4FFB B;  5FNV A;  5E79 Z;  3IFX A;  1HNX B;  2NNU A;  4K0K B;  5HFM A;  1FXK A;  3BY6 A;  4BIZ A;  4E4E A;  4JI4 O;  1JA8 A;  2EUL A;  1VAR A;  2W0X A;  5HFL A;  4I55 A;  5B1A B;  2QDO A;  4J41 A;  3MDS A;  4TV9 A;  1R6K A;  1U96 A;  1NJI W;  4KHP O;  5AG2 A;  3ZRW A;  4GT1 A;  5KA5 A;  4UVA A;  4DV2 B;  1MSW D;  5LYJ B;  3E22 A;  1AI7 A;  4AQY O;  4DV6 B;  4UCO A;  4TOI A;  5LMN B;  3JAT B;  4JI2 O;  3SPJ A;  5CA0 A;  2Y0P A;  4LCU C;  4MVU A;  4YIP A;  4B7E A;  3T1Y O;  3AK2 A;  1E1R G;  1N0N A;  4MVQ A;  3ZJZ A;  2Q8V A;  2NN4 A;  2ZDI C;  1FFX A;  2EIJ B;  2XAS A;  2CTR A;  4GX1 A;  3IAY A;  4N23 A;  3DXR B;  3QVN A;  1KP3 A;  4DR4 O;  1L8D A;  2PGG A;  3B2E E;  1K73 W;  4DR1 B;  4GKJ O;  2ZQM A;  2V4D A;  5LP6 C;  4I5S A;  1VQM V;  2AW9 A;  1I5Y A;  2B1G A;  1NI8 A;  2EJ7 A;  2V1D A;  2HKO A;  5GTH Z;  2AXT Z;  5IYD O;  2P6J A;  1FXK B;  2ZCE A;  3LNM B;  3T4Z A;  1KMI Z;  4Z1M G;  1D5A A;  1WB7 A;  1FFX B;  1WP8 A;  2IJJ A;  3HKB A;  2QKA A;  2F4V O;  1PNL A;  5KMG B;  4B08 A;  2P4V A;  2RJZ A;  1K9M W;  1OCR B;  5FPR A;  1RPR A;  2WSS G;  3JAT A;  2WLK A;  1ZL8 B;  2AHZ A;  4J80 A;  3M99 B;  4P9P A;  3CCM V;  5IJ0 B;  5GTI Z;  4MTF A;  4FLW A;  4P30 A;  3SDL A;  4XDK A;  4BR6 A;  5BR8 O;  5IWA O;  4CC5 A;  4MS2 A;  3A8T A;  3K3W A;  2VWJ A;  5KAI Z;  3CS5 A;  5KAF Z;  5LXT B;  3MHS C;  4R50 A;  4LFB O;  1KC8 W;  3W7T A;  3M7M X;  3N2G A;  2QKC A;  4ZHQ B;  4NXM O;  3CCE V;  4MVZ A;  2JGU A;  1HNW B;  2V7Q G;  5CBF A;  4U3F H;  3ZHQ A;  4YHH O;  1DF5 A;  1M5I A;  2Q5Z A;  4RQE A;  3ICX A;  3WG7 C;  1RM1 C;  3N2K A;  2KB1 A;  3QG5 A;  3G67 A;  3ETD A;  4DXW A;  2QE7 G;  4X1Y A;  4I4T B;  1D2D A;  4TUY A;  4NR1 A;  3MAQ A;  1VEW A;  4J7Z A;  1ZX3 A;  3A0R A;  2LQT A;  4F6R A;  1BZK A;  4IHJ A;  5IJ9 B;  4X62 O;  3AG2 C;  2UXB B;  5C93 A;  2HLD G;  3FB5 C;  5LMN O;  4PDL A;  3TET A;  2HJF C;  2JS3 A;  1SZX A;  3OD4 A;  3WU2 Z;  2PF4 E;  3G6E V;  4PJ0 Z;  4EFB A;  1KKD A;  2VQF B;  4LFB B;  1BL8 A;  1EZV H;  3FAV A;  4X1Y B;  3K03 A;  2ITC C;  3CCL V;  2JGD A;  4FK5 C;  1JJO A;  2Z0A A;  4Z2W A;  1S76 D;  1YZB A;  1KUQ A;  5GON A;  2LW1 A;  1CEZ A;  4X88 A;  4HNA B;  1SA0 B;  1X4T A;  5K1X A;  4BW9 A;  4PHZ A;  4JI0 O;  5L3G A;  3ZRX A;  5TIS Z;  1XNQ O;  4NB5 A;  4DV7 O;  3CRQ A;  4DRX A;  2Q7E A;  4BW5 A;  4IYI A;  3ASO B;  3I5D A;  4DV4 O;  1K7D A;  2IH1 C;  4I4T A;  1KP2 A;  1LUW A;  3CCJ V;  3OM3 B;  1SET A;  4PA7 A;  1MZF A;  1OJH A;  2AGA A;  3H1K H;  3J7A U;  3RYF A;  4LF8 B;  1COW G;  3O65 A;  4TV9 B;  4JI8 B;  1MSD A;  4UCV A;  1MA1 A;  2QTS A;  2GTS A;  1XMQ B;  1SC5 B;  5CA1 B;  3FX7 A;  1TA8 A;  3ZHT A;  3G4S V;  4X1K A;  1N33 B;  1TGO A;  3DC5 A;  2VQF O;  2OT5 A;  4CS3 A;  5LMU O;  1XEQ A;  1FS0 G;  2QSA A;  4UUJ C;  3AEI A;  2LGW A;  3OT7 A;  3TGU H;  3L72 H;  2A79 B;  2P90 A;  1GK9 A;  4MVM A;  2D2C B;  2JEU A;  2P67 A;  4YHH B;  1BMF G;  1WA8 A;  1YEW A;  4QE9 A;  2FYU H;  3ZHS A;  1QU7 A;  2DYS C;  3ZIA G;  4B3R O;  3WB2 A;  1RPO A;  1L0N H;  1P7B A;  5LGT A;  1F4N A;  3CHX A;  4J42 A;  1R1B A;  4WFA V;  1QCE A;  1XUQ A;  1RM1 B;  3K5N A;  4JI7 B;  2ZDI A;  3AG1 B;  2ZM6 O;  3CEI A;  3SYO A;  1CXZ B;  4X20 A;  5KHG A;  2PYL A;  2EJR A;  5IYZ A;  2M7W A;  1F4M A;  1Q6H A;  5KA6 A;  5JVD A;  4JI8 O;  3STZ C;  2UXB O;  2Q73 A;  3H01 A;  3CCR V;  2FTK A;  3J80 N;  4CH3 A;  2DYR C;  1Q8I A;  2DJV A;  3H1J H;  1K34 A;  2UU9 O;  2WLI A;  2D3O W;  3BCC H;  2E74 B;  4O4I B;  1E79 G;  2HHH B;  1W0K G;  2ZIM A;  4J9Z B;  2ILM A;  4NYK A;  1Y66 A;  3HPL C;  5EZY B;  5B1B C;  4DV0 B;  5IJ0 A;  1L1F A;  3K5O A;  4DV3 O;  4FLX A;  2JK5 C;  3OTF A;  4QE7 A;  1H8H G;  2CH7 B;  3ZHR A;  1XNR B;  5LGN A;  1CP9 A;  1KKC A;  4UCT A;  1FXH A;  2Q6A A;  1PNK A;  1YJW V;  1W2B U;  2EIL C;  4I55 B;  2AZ0 A;  5JVD B;  2H8P C;  3RW0 A;  1LR1 A;  2A06 H;  4JI0 B;  4O2B A;  1R3K C;  5EYP A;  3TXQ A;  4LC1 A;  1KB9 F;  5BY1 A;  5FLX N;  1V54 C;  1BS3 A;  2W0F C;  4H44 B;  3CXC U;  2M6Y A;  3E8H A;  4DV4 B;  4DUZ O;  3L75 H;  1YXB A;  1A32 A;  1GH6 A;  4O4L B;  3VOU A;  4LF7 O;  1FJG O;  1IBL B;  1OV9 A;  1CPY A;  4Q20 A;  4JI3 O;  5LHG A;  3L71 H;  1GM8 A;  2DQ3 A;  4X62 B;  3CCS V;  2EIK C;  5H6R A;  2ZXW B;  3PN1 A;  4L8J A;  1XBL A;  2Q67 A;  5DED A;  1QVF U;  2Q9L A;  2DW4 A;  2OCC C;  2RMK B;  4UB8 Z;  1OCO B;  2PI5 A;  1Y67 A;  5B1O A;  1TUE B;  4I0X A;  4QGP A;  4AIL C;  3ZMS A;  1JOY A;  3SYP A;  4DR5 B;  1S3J A;  1XNR O;  4I50 A;  3SJQ C;  3K79 A;  4JAU A;  5LHI A;  4NTY A;  1YVW A;  3C3T A;  4UCR A;  2XAG A;  2KG7 B;  4X64 B;  4WBN A;  4IYH A;  1Q86 W;  1MAB G;  2YC0 A;  3CCV V;  3JAK B;  4LR3 A;  2R9I A;  3RFR A;  2UXD B;  2CE4 A;  1XL6 A;  4UFZ A;  1Q81 W;  4TWK A;  4YXW G;  2B9Z A;  5CB4 B;  3HKC A;  2CDY A;  4KUM A;  1XNQ B;  1BSM A;  3DTU B;  3JAR A;  3FB7 C;  1K5S A;  3ZMZ A;  3SYC A;  1ZSP A;  3LDC A;  3H1H H;  3I56 V;  4FLT A;  2CH7 A;  4DRX B;  4I9Q A;  1M1K W;  3B77 A;  4JI7 O;  1SKV A;  4FLV A;  4DR2 O;  3ZMT A;  2K1E A;  4HBN A;  2DYS B;  2XAH A;  4TV8 A;  1XOU A;  2UUA O;  4CZZ A;  5LL6 Y;  4UB6 Z;  1VQ5 V;  1IUR A;  1BT8 A;  2A7W A;  3T1H O;  2P5O A;  4U3J A;  4ZOL A;  4CS2 A;  2JVD A;  4P2Z A;  4DO2 A;  3LSU A;  3O9O A;  3E35 A;  3K08 A;  2LW7 A;  4UVC A;  3P3N A;  1ORQ C;  4O4L A;  1PL4 A;  3RYC B;  4JI5 B;  4MT8 A;  5BZB A;  1NH2 B;  4UV8 A;  3KCX A;  2H94 A;  5IE9 A;  2EZP A;  2DYR B;  4X64 O;  5B5E Z;  4CC6 A;  4JYC A;  4GZR B;  2HVK C;  4LFA B;  1ZL8 A;  4JGS A;  1BQ0 A;  3AG3 C;  4U7O A;  1B04 A;  4FM2 A;  4JI6 B;  4J10 A;  2CK3 G;  4WFG A;  3CRR A;  3U10 A;  1N8R W;  1HNX O;  2QM4 A;  1G4Y B;  1YIT V;  4DR3 B;  3QF7 A;  3RYC A;  3E8B A;  2QM7 A;  1QR9 A;  1GKF A;  2GV9 A;  3ABM C;  1I94 B;  1PL0 A;  2WLI B;  4CS4 A;  1AJN A;  3WB0 A;  5DEC A;  3ZBH A;  1HR0 O;  3WFV A;  2RCV A;  2Q69 A;  4L87 A;  2FB5 A;  4MTX A;  3CMA V;  3DC6 A;  4K35 A;  2ZR2 A;  5IYZ B;  1P49 A;  1WPB A;  3SPC A;  4LFC B;  3F7V C;  1RP3 B;  4JZG A;  1EN6 A;  1WNS A;  1EN5 A;  2Q4P A;  1IDS A;  2BOB C;  1DTO A;  1P4R A;  3HB3 B;  1MNG A;  3THO A;  1NS1 A;  1XMO B;  4LF9 B;  3OUF A;  4YY3 B;  1VQ6 V;  2HVJ C;  2WA3 A;  2EIK B;  1MZE A;  4H33 A;  3JD4 A;  3FB6 C;  2UUB B;  3RVZ A;  2XTA A;  2UUC B;  3HKE A;  3H1I H;  4U3J B;  4ZOL B;  1HDJ A;  5L3F A;  5IY5 C;  5LP6 A;  2E5L B;  4B3T B;  1VQ8 V;  2Q0A A;  2YIB A;  1V55 B;  3R66 A;  4MVS A;  1ZAU A;  4N21 A;  4UCS A;  2EZO A;  3G80 A;  4D7T A;  3RGB A;  2XUM A;  4X65 B;  3RYI A;  3DXR A;  4B3R B;  1R3I C;  1N32 O;  3P32 A;  4QPJ A;  4O2B B;  4LH6 A;  2Q7H A;  1QLE B;  2ZNJ A;  2A9H A;  2WLL B;  4LF4 O;  2KKW A;  5B66 Z;  3X2Q C;  3JAS B;  3JD2 A;  3E8F A;  2UXN A;  3ZX6 A;  4DR2 B;  2O57 A;  4XDJ A;  2A0L A;  3ABM B;  1NZ6 A;  5IY5 B;  1BE3 H;  2ZM6 B;  1F51 A;  4DV2 O;  1R73 A;  2ZR3 A;  4GKK O;  2Y69 C;  2YXL A;  1SS3 A;  3SPH A;  3JYC A;  4IIJ B;  2WLM A;  4FZ0 A;  4JI5 O;  1Y74 B;  3IC9 A;  5J2U B;  5CB4 A;  1M56 B;  1K92 A;  1UJW B;  1QQC A;  5JCO C;  4KL1 A;  3QO5 A;  1ENV A;  1GN2 A;  2W6J G;  1M57 B;  4NXM B;  2YXH A;  1SQQ H;  4JAA A;  4GX5 A;  2B1I A;  1J5E B;  3T2M A;  4LP8 A;  1N36 O;  2QKS A;  4OPA A;  5C8Y A;  1FPO A;  1AI5 A;  3JSN A;  5J9P C;  4EFE A;  1NH2 D;  2IM9 A;  1Y6X A;  2QWR B;  3KKY A;  1QBZ A;  2DN9 A;  3UQ8 A;  4JI1 B;  2YEV B;  4O4I A;  1YTF B;  1SRY A;  2L6L A;  1HW7 A;  1J95 A;  1MOF A;  2DWE C;  1FJG B;  3CJH B;  3BPZ A;  3SPI A;  4PDM A;  3FFQ A;  1LUV A;  5KX5 B;  3A2F A;  4MSW C;  1BQZ A;  2XAF A;  2DMX A;  1NTZ H;  1TVK A;  2PY5 A;  1OCC B;  2ARH A;  2E3C A;  3ABT A;  5IWA B;  3K0G A;  2H3O A;  1NR1 A;  3W7X A;  3QTC A;  5LOV B;  5EBL C;  4ZI7 A;  3A0H Z;  4E2L A;  2UUC O;  3AG1 C;  3ZRW B;  4PDV A;  3UKM A;  1SES A;  1S5J A;  2N05 A;  3UT5 A;  3WG7 B;  1VQO V;  3OGI B;  1Q7Y W;  2WLJ A;  2GBO A;  1D5N A;  1SQV H;  3Q4H B;  1XHZ A;  1FXK C;  3S3X A;  1WPX A;  3OFN G;  4O4J B;  4RWU A;  2YIA A;  3U0Z A;  1PKX A;  3LDE A;  4DR3 O;  4LF4 B;  3SYQ A;  1O9H A;  1W59 A;  5LXT A;  1QLN A;  3CXH F;  1V55 C;  4B3M B;  2GUZ A;  3SR2 C;  2ADQ B;  2Q68 A;  1OCZ C;  4OX9 B;  4IGG A;  4JYY A;  1DF4 A;  2ZXW C;  3ZCC A;  3BA8 A;  4KHP B;  2QWP B;  1IX9 A;  5KHH A;  1X59 A;  4GUN A;  3CB2 A;  1THZ A;  3OMA B;  3SYA A;  2W6I G;  5ITZ B;  4LNU B;  1AB3 A;  3JAK A;  2BTQ A;  3TXS A;  3DGE A;  4FLZ A;  3RBZ A;  5GON B;  3ZN0 A;  2YEV A;  3CSX A;  2UXC B;  4JV5 O;  4BAY A;  1GAX A;  5GW7 A;  3F7Y C;  4K3A A;  1AR4 A;  5BR8 B;  4G28 B;  2YIC A;  3B8M A;  2KQX A;  5KUM A;  2GDS A;  4FVM A;  5JWP A;  1B3Q A;  2LO1 A;  4TV8 B;  2R72 A;  4BWA A;  1UPG A;  5IYC O;  1ROP A;  4RAI A;  4DR1 O;  3OAA G;  3QO7 A;  5DN6 G;  3VBB A;  4PA9 A;  3OR6 C;  2X6C A;  2JEX A;  4W4L A;  4YIO A;  3BRC A;  3AG4 C;  3L70 H;  2YI8 A;  3R65 A;  1K8A W;  4KXR A;  2GUZ B;  4OX9 O;  1GN6 A;  1QR8 A;  2GTA A;  4KFM A;  4HAM A;  3HKC B;  4JAV A;  3JAL B;  4LF6 O;  1FD9 A;  3RYH A;  1VF6 C;  1VF5 B;  1Q5O A;  3E22 B;  4MTO A;  2ZIN A;  3JD3 A;  2UU9 B;  1XMQ O;  5LP6 B;  2HFE C;  1SQF A;  2QTO A;  1EBO A;  4HZ3 A;  4H0L B;  1G6U A;  1H2N A;  3OTO B;  4X1I A;  2FML A;  3GB7 C;  1JQ0 A;  2VRZ A;  1YF2 A;  1VP7 A;  2A3Q A;  3D3Q A;  1QVG U;  1PV0 A;  3LUT B;  1TUB A;  4DW0 A;  5BMV B;  3ZED A;  5EYP B;  4J11 A; 
#chains in the Genus database with same CATH homology
 3OE7 G;  3OGC C;  1VQ5 V;  2XAQ A;  3ABL B;  4XBF A;  1K73 W;  2HG5 C;  2ZQM A;  2X6B A;  4I5S A;  4P2Z A;  1VQM V;  4DO2 A;  1YIJ V;  1I5Y A;  2B1G A;  4H37 A;  3E35 A;  3K08 A;  4UVC A;  2V1D A;  2HKO A;  3ABK B;  3F5W C;  1VQL V;  4ZKI A;  1YJN V;  1VQK V;  1ORQ C;  5IYD O;  2WLL A;  1NBM G;  2P6J A;  2WLN A;  4WFF A;  3FYE B;  1FXK B;  3LNM B;  4QPK A;  2IJH A;  4MT8 A;  2DQ0 A;  5BZB A;  3T4Z A;  1NH2 B;  1GMG A;  1M57 C;  4UV8 A;  4X8A A;  4Z1M G;  2H94 A;  2EZP A;  2DYR B;  1AI6 A;  1R3J C;  1JVM A;  2IJJ A;  2AHY A;  4QNH B;  5LHH A;  4JYC A;  2HVK C;  3LDD A;  4JGS A;  1B6Q A;  1PNL A;  5CN0 A;  4TSF G;  4WFB V;  3AG3 C;  3JCZ A;  4U7O A;  1K9M W;  1OCR B;  3JD0 A;  1RPR A;  2CK3 G;  2WSS G;  2WLK A;  4JPR A;  4WFG A;  5B1B B;  2AHZ A;  4RUF A;  3M99 B;  1JX9 A;  4P9P A;  1N8R W;  4MTG A;  5EC1 C;  3CCM V;  4JTA B;  4QIW F;  5CBH A;  4MTF A;  1YIT V;  1G4Y B;  5FL7 G;  4P30 A;  2Z3Y A;  4XDK A;  3SPG A;  1XL4 A;  3E8B A;  2QM7 A;  4MS2 A;  1QR9 A;  2Y48 A;  3K3W A;  1GKF A;  3ABM C;  1K5Q A;  2WPD G;  3B8N A;  4X89 A;  1PL0 A;  3MHS C;  4R50 A;  3RVY A;  1Q82 W;  3K04 A;  2WLI B;  1AJN A;  1KC8 W;  3OMI B;  3W7T A;  1AJQ A;  2ATK C;  3WFV A;  2Q69 A;  2X7R B;  4L87 A;  3CCE V;  3TK1 A;  4UV9 A;  4MVZ A;  3CD6 V;  3D36 A;  5B3S B;  4MTX A;  3CMA V;  1K33 A;  4RUE A;  1K97 A;  2V7Q G;  5CBF A;  1G8M A;  3ABU A;  2ZR2 A;  3TCU A;  3LSS A;  5CBG A;  3K06 A;  2IJK A;  5L3E A;  1BHB A;  3QO8 A;  3IGA C;  4R8C A;  1DF5 A;  3SPC A;  1VQ9 V;  1NR7 A;  3PJS K;  2ITD C;  2JJ2 G;  3F7V C;  3E2E A;  1M9N A;  3E89 A;  4RQE A;  5CMU A;  2XND G;  3WG7 C;  5H6Q A;  1RM1 C;  1OCR C;  2BOB C;  1DTO A;  1P4R A;  3HB3 B;  3T4D A;  3OEE G;  2XAJ A;  2KB1 A;  2OCC B;  3NXS A;  3ETD A;  3W7S A;  1AR1 B;  4DXW A;  3OUF A;  1VQ6 V;  2QE7 G;  2HVJ C;  4MW8 A;  2EIK B;  4H33 A;  3JD4 A;  3FB6 C;  4UVB A;  3RVZ A;  2Y69 B;  3A0R A;  2JJ1 G;  5L3F A;  1S77 D;  1OCC C;  5IY5 C;  5EBW C;  1VQ8 V;  3AG2 C;  4RQF A;  5C93 A;  5EC2 C;  1V55 B;  2HLD G;  3FB5 C;  4MVS A;  4N21 A;  2EZO A;  4PDL A;  3TET A;  5E1A C;  2HJF C;  3ASO C;  2IU0 A;  1YHQ V;  1R3I C;  3P32 A;  4PA6 A;  1SZT A;  4QPJ A;  1GO3 F;  1QLE B;  3ASN C;  2MK3 A;  5CA3 A;  3G6E V;  1KEC A;  1QLE C;  2A9H A;  4MW3 A;  2WLL B;  4PA4 A;  1S0V A;  1KKD A;  4WFH A;  5IDJ A;  3FYI B;  1NKD A;  1GM9 A;  3BEH A;  3X2Q C;  3QNE A;  1IXM A;  5EBM C;  1BL8 A;  2XOK G;  4XDL A;  4GCZ A;  3JD2 A;  3E8F A;  2ITC C;  2UXN A;  3K03 A;  3CCL V;  4FK5 C;  1S72 V;  1HWY A;  1NQT A;  4XDJ A;  2A0L A;  2GSM B;  3ABM B;  1OHH G;  1S76 D;  5IY5 B;  4CBC A;  1F51 A;  1CEZ A;  4X88 A;  1R73 A;  2ZR3 A;  3AG4 B;  2Y69 C;  4EKW A;  1K3E A;  2WAM A;  5L3G A;  3SPH A;  3ZRX A;  4BIU A;  3JYC A;  3ASN B;  4U7N A;  1JPX A;  5LGU A;  2WLM A;  3E83 A;  2QM8 A;  4BW5 A;  2X6A A;  3ASO B;  2YSU B;  1VQ7 V;  1ARO P;  2JIZ G;  1K7D A;  2IH1 C;  1E1Q G;  1KP2 A;  4ZBM A;  1M56 B;  3CCJ V;  4GX2 A;  1K92 A;  1UJW B;  1M56 C;  3OM3 B;  3E86 A;  3QO5 A;  1ENV A;  2P7T C;  2W6J G;  1SET A;  4PA7 A;  1M57 B;  4FPP A;  3W7W A;  5IYB O;  1COW G;  4P9O A;  4TT3 G;  4GX5 A;  4JYB A;  2B1I A;  2IU3 A;  1H38 A;  3T2M A;  3ML0 A;  1YSC A;  4LP8 A;  3ETE A;  2QKS A;  2UXX A;  3KG2 A;  1AI5 A;  3ZMV A;  3G4S V;  1MG1 A;  4I9W A;  2EBO A;  5J9P C;  4RO2 A;  4UXN A;  3CCQ V;  1NVP D;  2Z5U A;  3EFF K;  1NH2 D;  1VQN V;  2EIM B;  1W0J G;  2OT5 A;  3OMN B;  1QBZ A;  4JTD B;  2NLJ C;  2YEV B;  4F4L A;  1YTF B;  1FS0 G;  1SRY A;  1M90 W;  1OCZ B;  1YJ9 V;  1J95 A;  4UUJ C;  1MOF A;  2DWE C;  3AEI A;  2LP7 A;  4J9Y B;  2C2A A;  1LNQ A;  2R9R B;  3CYO A;  2A79 B;  1GTO A;  3SPI A;  3LSQ A;  3OEH G;  2OTJ V;  2P90 A;  5L3D A;  1GK9 A;  4MVM A;  4PDM A;  2JEU A;  3CME V;  2P67 A;  5L3B A;  2EIJ C;  1BMF G;  2EIN B;  4MSW C;  4QE9 A;  2XAF A;  2DYS C;  3ZIA G;  5KUK A;  2IH3 C;  1RPO A;  4JAS A;  2PI4 A;  5B1A C;  1P7B A;  3D3I A;  2EIM C;  3JD1 A;  3OW2 U;  2LFS A;  1VQ4 V;  1OCC B;  5EK0 A;  3FB8 C;  5LGT A;  1EFR G;  1F4N A;  3ABT A;  4JTC B;  3ZN1 A;  3G71 V;  3P30 A;  3K0G A;  2QA4 V;  2ZD9 A;  2HR3 A;  4WFA V;  1NR1 A;  1QCE A;  3AG3 B;  3MD0 A;  3W7X A;  4R6Z A;  3CP1 A;  1K4D C;  4PDR A;  5EBL C;  1RM1 B;  2ZDI A;  3AG1 B;  4E2L A;  3IC7 A;  1GM7 A;  3AG1 C;  3ABL C;  3E8G A;  3ZRW B;  4PDV A;  3SYO A;  2QEX V;  1R3L C;  3UKM A;  2EJR A;  2F43 G;  2M7W A;  1F4M A;  3EHB B;  3CC2 V;  5KA6 A;  3STZ C;  1SES A;  3H01 A;  3WG7 B;  3OR7 C;  1VQO V;  3CCR V;  1Q7Y W;  2FTK A;  2WLJ A;  3K0D A;  4WF9 V;  2DYR C;  1FXK C;  1K34 A;  3ZMU A;  4HYO A;  2WLI A;  2D3O W;  1WPX A;  3OFN G;  4FIP C;  1PKX A;  1E79 G;  1W0K G;  3LDE A;  4J9Z B;  3SYQ A;  4MVO A;  1QLN A;  1Y66 A;  3HPL C;  3I55 V;  4WFE A;  5B1B C;  1L1F A;  2JK5 C;  1FFT B;  4KP4 A;  1PD3 A;  1V55 C;  4G2K A;  4QE7 A;  1H8H G;  5LGN A;  2WWW A;  2Q68 A;  4JF3 A;  1CP9 A;  5B1N A;  1K4C C;  1OCZ C;  1FXH A;  2Q6A A;  4QJF B;  1VQP V;  1PNK A;  1DF4 A;  2ZXW C;  1YJW V;  2X0L A;  1W2B U;  2EIL C;  3ZCC A;  3CC4 V;  1JJ2 U;  2H8P C;  1YTF D;  1PNM A;  4OXS A;  1KD1 W;  1JCH A;  3RW0 A;  1THZ A;  3K9A A;  3OMA B;  3SYA A;  1I5X A;  3CCU V;  2IJI A;  1DLB A;  2W6I G;  2JDI G;  1R3K C;  4PA3 A;  4LC1 A;  1WLE A;  2BOC C;  3X2Q B;  4PEL A;  1V54 C;  3DGE A;  2W0F C;  3CXC U;  1KQS U;  3RBZ A;  3ETG A;  1YI2 V;  3ZN0 A;  1OZ0 A;  2YEV A;  3E8H A;  1EZJ A;  3FKS G;  4BAY A;  2IW5 A;  5GW7 A;  3F7Y C;  1H8E G;  3VOU A;  1Y4M A;  4G28 B;  3B8M A;  5B3S C;  3ABK C;  5KUM A;  2WLH A;  3UM7 A;  4ASU G;  1H2G A;  2DWD C;  1CPY A;  4Q20 A;  5H9C A;  4GX0 A;  5LHG A;  4FJC C;  1GM8 A;  2B5U A;  1SER A;  2DQ3 A;  3CCS V;  1NVP B;  2EIL B;  2EIK C;  5H6R A;  1ZWI C;  2ZXW B;  5IYC O;  4G27 B;  1ROP A;  4RAI A;  3OAA G;  2Q67 A;  3QO7 A;  5DN6 G;  3VBB A;  1QVF U;  2DW4 A;  2OCC C;  3IFX A;  4PA9 A;  3OR6 C;  4R7C A;  2NNU A;  1OCO B;  5HFM A;  2PI5 A;  2X6C A;  3BY6 A;  1FXK A;  2JEX A;  5B1O A;  4BIZ A;  1TUE B;  1S5H C;  1V54 B;  3AG4 C;  2GHY A;  3ZMS A;  3ZRS A;  1JOY A;  3SYP A;  3R65 A;  1S3J A;  5HFL A;  5B1A B;  3SJQ C;  1BHA A;  3K79 A;  1K8A W;  4JAU A;  5LHI A;  1R6N A;  1AJP A;  4WCE V;  3MHH C;  1QR8 A;  4KFM A;  1R6K A;  3GWO A;  2XAG A;  1NJI W;  3ZRW A;  4HAM A;  4GT1 A;  1Q86 W;  5KA5 A;  2LFR A;  4UVA A;  4JAV A;  1MSW D;  1MAB G;  1AI7 A;  3CCV V;  2R9I A;  2OTL V;  4MTO A;  1XL6 A;  1Q81 W;  3JD3 A;  4TWK A;  4YXW G;  4KUM A;  3SPJ A;  5L3C A;  2HFE C;  2QTO A;  1EBO A;  3DTU B;  4HZ3 A;  1OCO C;  4FMT A;  3FB7 C;  4LCU C;  1K5S A;  5LBQ A;  3ZMZ A;  4MVU A;  4MVR A;  3T1C A;  3GB7 C;  3SYC A;  5DM6 V;  1JQ0 A;  3LDC A;  3ZRV A;  3W7U A;  3I56 V;  1E1R G;  4MVQ A;  3ZJZ A;  1FXV A;  2ZDI C;  1M1K W;  3B77 A;  2EIN C;  2EIJ B;  2XAS A;  3AG2 B;  3OUS A;  4GX1 A;  3CPW U;  4N23 A;  3STL C;  1QVG U;  3ZMT A;  2K1E A;  3LUT B;  1F23 A;  2DYS B;  2XAH A;  3CC7 V;  4LBE C;  1AI4 A;  4CZZ A;  1KP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...