3HPLC

Kcsa e71h-f103a mutant in the closed state
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVHTATTVGYGDLYPVTLWGRCVAVVVMVAGITSAGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab heavy chain
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 36
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3hplC00
3FB8C 5B3SC 2A0LA 3IFXA 2WLIA 3IGAC 3K04A 3OUFA 3R65A 3TCUA 3ABKC 3ZJZA 1M57C 1XL6A 3SPHA 3FB5C 3UKMA 4MW8A 4LCUC 4GX2A 4GX1A 3AG4C 1JVMA 2HVKC 5CBHA 2W0FC 3E86A 3E83A 4P9OA 3OGCC 4UUJC 3RVYA 3T1CA 2OCCC 5EBWC 4EKWA 2EINC 4MTFA 1ORQC 4PA7A 4X88A 3RVZA 4X89A 3OR7C 2EILC 1BL8A 2QTOA 4MVSA 4WFHA 5BZBA 4HZ3A 4GX5A 3OR6C 5KUMA 3ASNC 3LNMB 1QLEC 2A9HA 3ABLC 4MTGA 4XDJA 1ZWIC 4QNHB 2P7TC 4MVMA 5EC1C 2A79B 3LDDA 3K06A 2ZXWC 4MSWC 3WG7C 1R3JC 2X6CA 3K0GA 3ZRSA 1M56C 3ABMC 4BW5A 3K08A 3RBZA 4MVZA 2DWDC 2BOBC 3KG2A 3TETA 2Q69A 4XDKA 1G4YB 5B1AC 3HPLC 4P30A 4JTCB 4LP8A 3SPIA 1OCCC 3F5WC 3FB6C 2IH1C 4LBEC 3SYPA 2WLKA 3LUTB 3E8GA 5EK0A 2X6AA 5E1AC 2YEVA 4RUEA 2X6BA 1XL4A 2ZD9A 3BEHA 4QE9A 3PJSK 1V54C 2DYRC 4WFFA 4X8AA 1K4DC 4R50A 2IH3C 5EBMC 3E89A 3X2QC 4H33A 3RW0A 4DXWA 1R3KC 2DYSC 2EIJC 2Q67A 3E8BA 2HG5C 3E8HA 2WLMA 3OUSA 4MW3A 5B1BC 3UM7A 3AG2C 4G28B 3LDCA 4GX0A 3STZC 4RO2A 5EBLC 2HVJC 4JTDB 3SYQA 3E8FA 2HJFC 1R3IC 2QKSA 2Y69C 3K03A 4R8CA 3T4DA 2WLHA 5J9PC 2EIKC 4MVUA 4MVOA 4RAIA 4XDLA 2AHYA 4PDMA 2WLNA 4PA4A 2ITDC 4J9ZB 4PDVA 4I9WA 4WFEA 5IY5C 1OCZC 4R6ZA 4QE7A 3ASOC 1OCRC 4G27B 3K0DA 3F7VC 4KFMA 3SPGA 3AG1C 4WFGA 4MS2A 1KKDA 4PDLA 3JYCA 4J9YB 1P7BA 5EC2C 1S5HC 2EIMC 2ITCC 4RUFA 2NLJC 4PA9A 2AHZA 4P2ZA 4OXSA 3EFFK 2Q68A 4PA6A 3STLC 1R3LC 4PDRA 2Q6AA 3T4ZA 4H37A 4HYOA 4MVQA 4MVRA 1OCOC 3GB7C 2WLLB 4ZBMA 4TWKA 3SPJA 4MTOA 3SYAA 2H8PC 3SJQC 5CBFA 2K1EA 4F4LA 2HFEC 1K4CC 3FB7C 3LDEA 2BOCC 4P9PA 3F7YC 3VOUA 2WLIB 2WLJA 2DWEC 3SYOA 2KB1A 4JTAB 3AG3C 2ATKC 2JK5C 1J95A 3T2MA 1LNQA 2WLLA 3SYCA 2R9RB 3SPCA 1V55C 4PA3A 4R7CA 5CBGA 5KUKA 4CBCA
chains in the Genus database with same CATH superfamily
1F7YA 4I0XA 4E4EA 1IBLB 4DV2O 3JAMN 2F4VO 5AG2A 1JVMA 1NH2B 2XAFA 4DR1B 2ZR2A 5BXZA 1K8AW 3RVZA 1BE3H 3ZMZA 4JAUA 2QE7G 1WJZA 4MVSA 3LNMB 4LFAB 3K06A 1Z5VA 1JCHA 1R3JC 3K0GA 4JYCA 4LNUB 3BVOA 1TVKA 2CAZC 1ROPA 3VQVA 4DV3O 3CEIA 3CSXA 3P32A 4LF5O 3JD2A 2B9ZA 2YEVA 4X1KA 1NI8A 4H13B 2DYRC 4R50A 1Y74A 1TUBA 2N74A 2PTMA 2ZDIC 4TQFA 1EFRG 3OUSA 1GN6A 5LOVB 4DR4B 1PD3A 1SETA 1W2BU 3ZRWA 1YTFD 2VQEB 3JD4A 5LA6A 5F2VO 2JVDA 5KX5A 3CMEV 1IBKO 2Q8VA 1GM8A 4KFMA 1L1FA 3AG1C 3RT3C 2QJ1A 5JJJB 1TGOA 1AROP 2UXDO 1XNQB 2HJDA 1N34O 1R6NA 3N2GA 1JX9A 5CN0A 5L3BA 1YEWA 4LF8O 4FFBB 3STLC 4DW0A 3S3WA 1DF5A 3I56V 4HYOA 2PUSA 2OIGA 1GH6A 3ETEA 2HR3A 2R9IA 2CDYA 2UXBB 3UO3A 2DWEC 3B09A 3HKCB 3O9OA 4DRXB 5EZYA 1VQ5V 3CX5F 1IVSA 1JFFA 4FJCC 1IXMA 1BQ0A 5K1XA 3S3XA 5BR8B 2ZE5A 3WU2Z 3FB5C 4GYCB 1KP2A 3E2EA 1S5LZ 4LFCB 5FNVB 2X7RB 3OEHG 3RVYA 4PI2A 2KKWA 3AK3A 4DR2O 2FMLA 2EILC 4ZIBA 1Y4MA 2ZM6B 4EFBA 1FD9A 2Q0AA 4JPRA 3ZBHA 4DV1B 5IYDO 4MSWC 4YJ2A 4QPJA 3W7UA 2BSKA 4X64B 1JPXA 3T1HB 3NXSA 1ZUQA 1HNXB 2IH1C 1O9HA 3FD9A 4FLWA 2X6BA 2P5OA 3PJSK 5CA3A 1CPYA 1FPOA 5EBMC 4EB6A 1COWG 1YJ9V 3A0RA 4GX0A 4CS3A 3TGUH 3E8FA 2MW2B 2AHYA 2LGWA 2WLNA 1Y74B 4J9ZB 3RYIB 4CS2A 1YJWV 2OIEA 2ETNA 4MS2A 2ZKOA 1I0HA 2NR5A 1AR1B 3HKEB 3BY6A 2EX3A 1FXVA 1K34A 4LR3A 4IL6Z 3OEEG 2YIAA 3JD3A 5B1AB 1H2KA 3D36A 1ZAUA 2IJHA 2QDOA 2FKXA 2H8PC 4JI4O 3H1JH 1I08A 1SQBH 2BTOA 3D3QA 4WBNB 5B1BB 3JAKA 1XOUA 2QGNA 5KUKA 1L0LH 1M4UA 4DR6B 1YTFB 2WPDG 2QWOB 4J41A 1MG1A 1F23A 3DXRA 2R70A 3UKMA 4O2AA 4ZOLB 2W0FC 1SC5B 1WA8B 1GRJA 4P9OA 4BW9A 3G71V 5TISZ 2CH7B 1SQQH 1GMGA 1YCIA 4ZI7A 1KYOF 4FM2A 4WFHA 2Q7HA 3ASNC 3K5MA 3DC6A 2OYQA 3M7MX 3CB2A 3P30A 5EYPB 5CB4B 3K08A 3B8NA 1G4YB 1KQSU 3U10A 3ZHTA 3QO7A 1AJQA 1QLNA 1B04A 4WCEV 3KKYA 4LH7A 2WA4A 2BSKB 4JI1O 3TXSA 3GVMA 1KU9A 1MZFA 4DUYO 4N21A 1O9GA 5JJEB 1N33O 4ZHQB 1GM9A 4DV5O 5DEDA 4NXNB 4R8CA 2EIKC 4JI7O 5LXTB 3H01A 1FJGB 4X9QA 2GUZB 1LUWA 2ZE6A 1CEZA 2ZE8A 5HFLA 1MNGA 2EIMC 3EHBB 3OTOO 3CCQV 4N23A 5CA0B 3IC9A 3JAWA 2Y4TA 1OCRB 2P06A 1N36B 1H2SB 5LMUO 3JCUZ 5HFMA 2GBOA 1KD1W 3K3WA 3JCZA 3T2MA 2A7WA 3H9VA 1K97A 2YUAA 3IFXA 3EVKA 1RM1B 3G6EV 2VQFB 1OJHA 4O2BA 3TCUA 5H6RA 3OT7A 2IU3A 4J11A 2Q5ZA 1QCEA 1Q3EA 1Y76B 2HHHO 3CCUV 4BIZA 1PL0A 3PN1A 4EKWA 1OV9A 3Q4HA 5ITZB 4MTGA 4O2AB 1EM1A 2KQXA 2CGOA 1WPBA 3RBZA 1Q43A 4LP8A 1PKXA 3FB6C 2P4KA 2WLKA 3FAVA 2HKOA 3BEHA 5KHHA 2ZD9A 2UUBO 1ZSPA 3JARA 2WSSG 4BIOA 4TUYA 3RFRA 5J2TB 2DYSC 1QR9A 3LDCA 3BRCA 3L70H 5L3EA 3SYQA 1VQKV 2ZIMA 1XMOB 3OGIB 4WFEA 1HR0O 2OTLV 3NR7A 2EZPA 3F7VC 1PNLA 4WFGA 1TUEB 3CJHA 1HNWO 3ZHUA 4P2ZA 1N0NA 2Q68A 4JI3B 1US6A 3BA8A 4I50B 2E5LB 5IJ9B 2CE4A 1VQ7V 2YIBD 2PI4A 4FLYA 3SJQC 1K4CC 2LW1A 2DYRB 1XI1A 1K92A 5CMUA 2UXCB 4JI5O 1NS1A 2JIZG 4DV4O 1DLBA 2WLLA 1DTOA 5J9PC 5FLXN 1OCOB 4PI0A 3JD1A 1SA0A 2WLIA 4JV5O 2Y0IA 3IGAC 3K04A 2GSMB 3AG1B 1K33A 2HVKC 4QPKA 4FLTA 3HKBA 4DUZB 3SJAC 4PA7A 1JR9A 1VF7A 1UPGA 4PELA 2QWRB 2BTQB 1K7DA 4X1IB 4QNHB 4LF7O 1SQFA 3ZRXA 1HWYA 2WWWA 1G8MA 2IJKA 3KG2A 3JD0A 1Q8IA 3CCRV 1SQXH 4U3JB 3J7AU 1S72V 2YI8A 4IYIA 5IYCO 4B3TO 3CD6V 4LNUA 3OE7G 5CA1B 4YY3B 3CCSV 2Q9LA 5C8YB 1J5EB 4CZZA 4MW3A 1AR4A 5LL6Y 4K0KB 4QIWF 2QKSA 3DGEA 4PDMA 5H5NA 1NJIW 1ZL8B 2JS5A 3QG5A 2EILB 1OCRC 4G27B 4JI0B 4PDLA 3UT5B 4J9YB 4UCRA 4B7KA 4UVBA 1D2DA 1PM9A 5D5QA 2EJ7A 2E3CA 4PA6A 3H1LH 5JCOA 2XASA 3T4ZA 2V7QG 1L8DA 1RM1C 1EZVH 4O4JB 3WB1A 4FFBA 4D7SA 5L3CA 3AG3C 1VQ6V 2ATKC 5LHHA 2CGNA 3OM3B 2JJ2G 3KZIZ 4TV9B 4PA3A 4DV7B 2GTSA 1H38A 4FFKA 4JYAB 3HKCA 1XL6A 3HR0A 3ICXA 4MTFA 3CWBH 2BCCH 3K58A 1RSOB 5B3SB 1IBMO 2UXBO 4J7KA 4ASUG 4NXMO 5EC1C 3LDDA 1GO3F 2QM8A 1RPOA 1N32B 1DF4A 2L6LA 4PV1B 1E1RG 4DV0O 2QM4A 4EFEA 4Z2WA 5E1AC 4LFCO 3MDSA 4JI8O 1G1XB 1QHTA 2E76B 4PD4F 4DR3O 3E8HA 2ILMA 4JTDB 2F95B 3SJCC 1JQ0A 2W6JG 2ZM6O 1SZXA 2UXNA 4DV1O 3ZMVA 1MABG 4PDVA 2L35A 1MZEA 4NR1A 4QE7A 3T1HO 3ASNB 4GCZA 4CH4A 1HNXO 3W7SA 4X62B 1SKVA 4LF4B 1LR1A 4UV8A 3RYIA 5LMNB 4X65O 2YS8A 2YXHA 1VQ4V 2IM9A 3K9SA 4I55B 2PY5A 3HKEA 1FXKC 1OCOC 1FYJA 3G80A 5B1OA 4D6TH 4W4KA 2BOCC 5DM6V 1Q7YW 2RN9A 3R66A 4A5UB 1NVPD 3C3SA 4JZGA 1R1BA 2F1MA 1BHBA 3FB8C 2EIKB 1BGYH 1HW7A 2VS0A 3QO8A 2YIDA 1VQNV 4OX9O 1YF2A 3ABKC 4WBNA 2RQ6A 2XAJA 1VF6C 3SPHA 1Z5WA 4MW8A 4IYHA 1PL4A 2F43G 2IW5A 2YC0A 4K35A 5B5EZ 5KA5A 4KP4A 1BMFG 3SR2C 3E83A 4TV8B 4UUJC 1XMQB 1Z2GA 2EIMB 3CRMA 3KCYA 2ZINA 5KA6A 5KUMA 2CTWA 4GT1A 1XHXA 1YZBA 1M5IA 2UUAB 4ZOLA 1YITV 1WA8A 4O4LB 3T1YB 2VWKA 3D8CA 3C3TA 2CH7A 1AB3A 4P30A 4JTCB 4I4TB 4X66B 4DR6O 1Q6UA 3SYPA 4MTXA 5EYPA 2X6AA 5D5PA 2KG7B 5CB4A 2AGAA 1XL4A 3RYFB 3GWKC 4NTYA 4YJ3B 3DTUB 2HEPA 3L72H 4DV2B 1I94O 3A2FA 1XQ8A 2JEUA 3HKDB 5JJNB 5EBLC 2Q7EA 4B3MB 2Y69C 5B66Z 2CTQA 3JSLA 2ITDC 2EJRA 1YIJV 3ZN1A 4I9WA 3RN4A 1V54B 3WFVA 4IHJB 2RMKB 3QVNA 4ZHQA 3J80N 4JI2B 3ZN0A 2HP8A 3VQXA 5LXTA 2V1DA 4F6EA 3TXQA 2Q7GA 1WB8A 4UB6Z 3ETQA 5LP6C 4IGGA 1TA8A 2XNDG 2GUZA 4H37A 1U96A 4LH6A 4CH3A 4NXNO 4F6RB 3SGIA 2JS3A 4J42A 5CA0A 4CH6A 1T5EA 2DYSB 5JQGA 2JK5C 1J95A 1FJGO 4KHPB 4FLUA 3SPGA 4UCTA 1AI4A 5B3SC 1FKAO 1GN3A 5LYJB 3OUFA 1XILA 1CXZB 1ZTEA 2OCCC 5EBWC 1RFYA 3B2EE 1N36O 1BL8A 2QKAA 1QLEC 2XAQA 1H2NA 1MSWD 4H44B 1Y76A 2PGGA 1GN2A 4EEQA 1UJWB 1DK1A 2Y48A 5ITZA 3TETA 2XOKG 2LJ2A 2R72A 2VQFO 4LC1A 4FK5C 3VBBA 2Z3YA 2BE3A 4W4LA 1KMIZ 1NVPB 4B3SB 3E89A 5J2UB 5GW7A 1KECA 2O57A 3LNNA 5LHGA 5KAFZ 3L73H 5JVDB 3RWRD 4JASA 3M8AA 3UCSC 4Z1VA 1VP7A 3RYHB 1GN4A 1P7GA 1W0KG 1WN7A 1HNZO 3OW2U 4DR2B 5IWAO 5J2TA 3CE2A 2LW7A 4FVMA 3OMNB 3AG2B 2X0LA 4RUFA 1XNRB 5K1PA 2AW9A 4OPAA 2RDCA 4OXSA 3EFFK 5KMGB 2W6IG 1SRYA 4PDRA 5KHJA 3CRQA 1BCCH 5IDJA 4JZ2A 5BY1A 4FZ1A 1KC8W 3QF7A 3SYAA 1YDXA 3ZHQA 4LF9B 4KXRA 2XHBA 2YICA 4CC6A 1XMOO 2WA3A 4I50A 1AJNA 5IJ9A 2LFRA 3P3PA 3ML0A 2LFSA 3JSNA 1VQ8V 2A0LA 3O65A 2ZT9B 3R65A 2ZDIA 1M57C 4FLXA 3BABA 5JQGB 1RPRA 1OZ0A 4TOIA 4GX2A 2KSDA 1S76D 2LP7A 2E5LO 4B3RB 2N04A 1UFIA 3OD4A 1R73A 2EINC 5E79Z 1ORQC 3LSSA 5A9GA 3FKSG 5L3FA 1WP7A 1QVGU 4RQFA 1VF5B 1ZWIC 2UXCO 2UUCO 5KLVH 1NKDA 2QKCA 1Q6IA 1H2LA 2JGUA 1VQPV 1SQGA 2FB5A 2QTSA 3ZCCA 2BTQA 4X1IA 3AG3B 2NN4A 2GDSA 3JALB 3FX7A 4L8JA 1V54C 2AZ2A 4DYLA 2QWPB 1XREA 4DUZO 4U3JA 3CHXA 3THOA 3N27A 4BAYA 2GHYA 2OTJV 2HVJC 2K9PA 3P3NA 2DJVA 3CC4V 3FYEB 5KHKA 3RYCA 5CA1A 3IJ4A 1NU1H 5C8YA 1H8EG 3H1IH 1D5NA 4CS4A 2P67A 4FMTA 4NTXA 3QTCA 2ITCC 4FIPC 2ZR3A 4TSFG 1ZL8A 2H3OA 5GONB 2EULA 1AJPA 1J5EO 3UT5A 3GB7C 2A3QA 4DV6B 4K0KO 5BMVB 4F4LA 2DE0X 1QQCA 1S3JA 1MMMA 1E79G 5EIBD 3A8TA 4JTAB 2ADQB 5IYZB 1FFTB 5LHIA 4JI0O 4JI7B 4R7CA 4O4JA 1DGSA 1HP8A 3CP1A 4UXNA 4X20B 1N0JA 4LCUC 5LP6A 2ZNIA 4LFBB 2W0XA 4TV9A 1NT2B 1PPJH 3K5LA 2HLDG 1YVWA 1VQOV 4JGSA 3ZX6A 5LBQA 3OTOB 3ZEDA 1HDJA 1R6TA 2QTOA 5BZBA 2P90A 4O4HB 2Y0PA 4XDJA 2EBOA 2FL4A 2PI5A 4DW1A 1FXHA 1FXKB 1NTMH 3ABMC 5JWPA 2ZIOA 3H1KH 4DV7O 1RSOA 4I9QA 2Q69A 3LSQA 5IYBO 4JAAA 1SF9A 2OCHA 1NH2D 4JYAO 1JOYA 3I55V 5A2QN 3E8GA 2PF4E 4Z1MG 5LGNA 1BHAA 4QE9A 5FPRA 1XHZA 3AK2A 3CXHF 4WFFA 4JYBA 4GKJB 2YIBA 3AEIA 3X2QC 2EIJC 3ABKB 3UM7A 3IAYA 3AG2C 4IIJB 2MK3A 2YXYA 1PV0A 5L3DA 2CUGA 1NR7A 1WP8A 4DK1A 1WNSA 4JF3A 2QWNB 3UO2A 1SESA 1OCZC 3K0DA 1IBLO 2Q4PA 1NQTA 2M7WA 2XUMA 4CC5A 1SS3A 2F23A 1GM7A 3RYCB 4DR1O 5IJ0A 4LWSB 3JATA 1R3LC 4DR5B 1VEWA 3B8MA 3ZIAG 4LFAO 3DC5A 4TT3G 2YXLA 1QVFU 1VARA 4J80A 3LDEA 3N2KB 1YSCA 3F7YC 1P49A 5KAIZ 3SYOA 4I55A 1X59A 5LGTA 1IX9A 1LNQA 3OAAG 2XAGA 3ETGA 1AI5A 5CBGA 4J7ZA 3MD0A 3TJTA 2Y69B 3I5DA 4UVAA 4X62O 1AP6A 4LF4O 4AI8A 1WB7A 1K5SA 2DOSA 3AG4C 4DR4O 4DR7B 3K79A 1GAXA 2Z5UA 2E75B 3T1CA 2DW4A 2VQEO 2IJJA 4AHCA 2DQ3A 3LSUA 1AILA 1B6QA 3OR7C 2B1IA 1FFXB 2XTAA 1YJNV 3GWOA 5LP6B 2QM7A 4TV8A 2ZXWC 2ZNJA 4UCSA 1AI7A 2NNUA 1XNQO 2BOBC 4GZRB 1OCCC 3F5WC 1GTOA 4DV4B 3K5OA 1W0JG 2QR4A 4O4LA 2IU0A 2LO1A 4H0LB 4BR6A 1M9NA 1MSDA 2QEXV 2IH3C 3WG7B 1Y67A 4I4TA 3ABTA 3E8BA 1YHQV 4WFBV 1NR1A 4YHHB 2KG7A 2F66C 2HJFC 3K03A 3T4DA 1MOFA 2UUAO 3RYFA 5KHGA 5DECA 4GKKB 3T1YO 2OCCB 4YJ3A 3JASB 3HKDA 4HNAB 3CRAA 4LF7B 1EBOA 5BR8O 2G38A 1QLEB 1TAEA 4X66O 1PNMA 1VIBA 2ZCEA 2NLJC 4UB8Z 1FS0G 4IHJA 4FLZA 3BFRA 4Q20A 4MVQA 4B3TB 4TWKA 5IJ0B 4B3MO 2JGDB 3JATB 4O4IB 4X64O 1SERA 5GTHZ 1Q6HA 3ZMTA 1XBLA 2C2AA 2AXTZ 4U7OA 3SPCA 4JI2O 2E74B 1K3EA 4G2KA 4F6RA 1QR8A 3ZJZA 4UV9A 4DK0A 1H2GA 1THZA 3K59A 1N4CA 4GX1A 5CBHA 2D2CB 1EN4A 3KCXA 5LYJA 4X88A 1D5AA 4UCVA 2CK3G 1F4NA 5FPOA 4MVMA 3CYOA 1ZLZA 4FM0A 1H2MA 4GLXA 2ADPA 3K9AA 4JI6B 3ZRSA 4KHPO 1S77D 1VMGA 4LF6B 1ENVA 4HAMA 3SPIA 1I5XA 3AG7A 4AQYB 1IDSA 2JDIG 3MHHC 1KBHA 4RUEA 2RCVA 2N05A 2Z0AA 3E22B 4BWAA 4WFAV 1YXBA 2UU9B 1M57B 2P6JA 3STZC 4XBFA 3QO5A 3ZHSA 2WLHA 3ETDA 2M6YA 4PJ0Z 2EINB 3B77A 5J2UA 3K5NA 4X1YA 2YI9A 3CCLV 5IY5C 1IBMB 5JVDA 4NXMB 1KKDA 3RYHA 2WAMA 1M1KW 1S5HC 3CS5A 2JJ1G 3RGBA 4WF9V 4PA9A 1KUQA 5JH7B 3U11A 2F4VB 1IXBA 1BSMA 4DV0B 4B3SO 2QA4V 5H9CA 4ZBMA 3SPJA 4NB5A 4JI8B 2K1EA 3CRRA 4ICGA 3ZMUA 4DR3B 4P9PA 2GTAA 5KMGA 2KB1A 4I0XB 1QBZA 3G67A 2ARHA 4KUMA 3OFNG 4JYYA 1G6UA 1NZ6A 4DV3B 1XNRO 2ODMA 5DN6G 3IC7A 1Q81W 4LF5B 4OPHA 1GKFA 1AR5A 4UCOA 4ABMA 2DN9A 3FFQA 4X65B 2RJZA 2JRIA 4J7JA 5EIBC 3OR6C 3CCMV 1TVKB 4LF9O 2A9HA 3ABLC 2P7TC 2A79B 1V9PA 3WG7C 1URFA 1M56C 2A06H 2YEVB 4X1KB 3W7WA 1IBKB 1K5QA 2DWDC 3L74H 4U7NA 3B4SA 4XDKA 1TUBB 1JMKC 4FPPA 1AP5A 4LBEC 2UXDB 3HB3B 3G4SV 1N34B 3APOA 3ZRWB 1U97A 3ABUA 4LF8B 5LA6B 4Q6GA 4B3RO 1K4DC 4OX9B 4CH5A 3W7XA 5KX5B 2Q67A 2HG5C 1A32A 5C93A 4G28B 1XEQA 3H1HH 3JALA 4MVUA 4XDLA 3U0ZA 1CP9A 1SZTA 3N2GB 3MAQA 3ZRVA 3AK1A 2DQ0A 1P7BA 4C7UA 2AHZA 3QNEA 3ABMB 3FYIB 3L9DA 4X1YB 1JA8A 3E35A 2Q6AA 4FZ0A 5IE9A 2IJIA 3ASOB 4MVRA 5EZYB 3M99B 1IURA 4HBNA 3CCJV 3CCVV 3BAAA 1OHHG 2P22C 1I94B 1JFFB 3B40A 5GONA 3VOUA 3X2QB 5B1NA 2EIJB 3APQA 3SJBC 4PHZA 3EXAA 1M93A 4ZKIA 3UQ8A 3L75H 5BMVA 4CBCA 4J10A 1IZ3A 1BT8A 1RP3B 5IYZA 1OCZB 2PYLA 1B06A 1F4MA 4YJ2B 5H2FZ 4UVCA 4DV6O 4NYKA 3CPWU 3MHSC 4X89A 3VQWA 4X20A 3CXCU 5JCOC 4GX5A 3ZHVA 3F5TA 4QGPA 3CC7V 1WAZA 2VRZA 4BW5A 1MA1A 4GUNA 2F93B 4MVZA 1VQLV 1KP3A 4O4HA 4K3AA 4JI3O 4EB6B 1FXKA 4L87A 2Q73A 4LFBO 3BCCH 2V4DA 4DXWA 2R9AA 3ZS8C 1JJ2U 1EN5A 4RO2A 1H8HG 4JI4B 2ZQMA 2YSUB 3AG4B 1YI2V 4K8XA 1Y66A 3OMIB 4MVOA 4BIUA 2CTRA 4PA4A 4KL1A 4AILC 3WB2A 3TK1A 1ZX3A 1VF6A 1QNMA 4IIJA 3JYCA 1M90W 2B1GA 5EC2C 2XAHA 1QU7A 4E2LA 1S5JA 2ZXWB 1WPXA 2OT5A 4GKJO 1Q82W 1OCCB 3CCEV 1P84F 1K9MW 2QSAA 5CBFA 3JAKB 4FM1A 2OWOA 4LWSA 1NTZH 1B3QA 1PNKA 4B7EA 4RQEA 1NBMG 1NTKH 3DXRB 1HNZB 3CRCA 5IWAB 1JJOA 3N2KA 3BPZA 2P4VA 4ZI7B 4YY3O 3A0HZ 2AZ0A 4OGQB 3L71H 4DR5O 2IBZH 3SDLA 4JI1B 3OGCC 3D3IA 1V55B 4DUYB 1N33B 4HZ3A 2RNBA 4DV5B 5L3GA 4QJFB 1E1QG 4U3FH 2B5UA 2Y4UA 3OMAB 5H6QA 1BQZA 5B1AC 1FFXA 3HPLC 1PP9H 1SQPH 1F51A 5LGUA 4K8ZA 3WB0A 4DR7O 2FYUH 3G6BA 2XT9A 3RW0A 1R3KC 1X4TA 5B1BC 5LMUB 1VQ9V 1R3IC 3BHPA 2ZE7A 4RAIA 3W7TA 4MT8A 2EZOA 4R6ZA 1R6KA 3ASOC 2UUCB 2PYJA 3JAWB 5FL7G 3JASA 3ZMSA 1XDCA 1AVMA 4HNAA 4RWUA 2HHHB 1BZKA 3ZHRA 4YHHO 2HFEC 3FB7C 2LQTA 4NVPA 1S0VA 4I7ZB 1N32O 4GKKO 3DSQA 4O2BB 3K57A 4FLVA 4JAVA 4B08A 1VQMV 4IT5A 2JGDA 4O4IA 1EN6A 4YXWG 2VWJA 4NKGB 3Q4HB 1EZJA 2CTPA 4UFZA 5IY5B 1K73W 2H94A 5IT9N 2UUBB 1L0NH 3E86A 2YDEA 3A0BZ 5GTIZ 1P4RA 1KKCA 1XUQA 1N8RW 1WLEA 2X6CA 3FAVB 1AI6A 1HR0B 3J81N 3JARB 1KB9F 4YIOA 4D7TA 4TUYB 4I5SA 5LMNO 4TQDA 1HNWB 5LOVA 3LUTB 5EK0A 4X8AA 3CMAV 4H33A 1Q86W 3D36C 2FTKA 1Y6XA 4YIPA 2WLMA 1BS3A 1I5YA 3VQYA 1LUVA 3CJHB 4NTWA 1I7FA 4DO2A 2LGQA 4JI5B 3E22A 4UCUA 3CC2V 4JI6O 5KHIA 2QWQB 4LF6O 2D3OW 2UXXA 1Q90D 3ABLB 2GV9A 4JV5B 2DMXA 4AQYO 1FAFA 1M56B 1XMQO 3OTFA 2Q0OC 3BA9A 4DRXA 3C90A 2PZSA 2UU9O 2WLLB 4MTOA 5JH7A 2JEXA 1SA0B 1Q5OA 2WLIB 2WLJA 1GK9A 1SQVH 5FNVA 3SYCA 2R9RB 1V55C 3HKBB 1W59A
chains in the Genus database with same CATH topology
1VQ8V 1OCOB 3JD1A 2A0LA 2WLIA 3IGAC 3K04A 3R65A 2ZDIA 5DN6G 1M57C 3IC7A 1Q81W 1GKFA 1RPRA 1OZ0A 4GX2A 2GSMB 3AG1B 1K33A 1S76D 1JVMA 2HVKC 2XAFA 4QPKA 1NH2B 2LP7A 2ZR2A 1R73A 2EINC 1ORQC 3LSSA 4PA7A 1K8AW 3RVZA 3ZMZA 3FKSG 2QE7G 4JAUA 5L3FA 4PELA 4MVSA 3CCMV 3OR6C 3LNMB 1QVGU 2A9HA 3ABLC 4RQFA 1K7DA 1ZWIC 4QNHB 2P7TC 2A79B 3K06A 1JCHA 3WG7C 1NKDA 1R3JC 3ZRXA 1HWYA 3K0GA 1M56C 2WWWA 2YEVB 1G8MA 3W7WA 4JYCA 1VQPV 1K5QA 2DWDC 2IJKA 3KG2A 3JD0A 4U7NA 4XDKA 3CCRV 3ZCCA 1ROPA 4FPPA 3AG3B 4LBEC 3HB3B 3P32A 1S72V 3JD2A 3G4SV 3ZRWB 2YEVA 5IYCO 3ABUA 3CD6V 1V54C 3OE7G 2DYRC 3CCSV 1K4DC 4R50A 3W7XA 2ZDIC 2Q67A 1EFRG 3OUSA 4CZZA 2HG5C 4MW3A 5C93A 4G28B 4BAYA 1PD3A 1SETA 2GHYA 2OTJV 2HVJC 1W2BU 3ZRWA 1YTFD 4QIWF 2QKSA 3CC4V 3FYEB 3JD4A 3DGEA 4MVUA 4XDLA 4PDMA 1CP9A 1SZTA 1NJIW 1H8EG 3CMEV 2EILB 1OCRC 4G27B 1GM8A 4KFMA 1L1FA 2P67A 3AG1C 3ZRVA 4PDLA 4FMTA 2DQ0A 4J9YB 1P7BA 1AROP 2ITCC 4UVBA 4FIPC 2ZR3A 4TSFG 2AHZA 3QNEA 1R6NA 3ABMB 1JX9A 3FYIB 5CN0A 5L3BA 4PA6A 3E35A 3STLC 2XASA 2Q6AA 1AJPA 1DF5A 3T4ZA 2IJIA 3I56V 2V7QG 3ASOB 4HYOA 4MVRA 3GB7C 3M99B 1RM1C 3ETEA 2HR3A 2R9IA 3CCJV 3CCVV 4F4LA 1OHHG 1S3JA 1E79G 3VOUA 2DWEC 5L3CA 4JTAB 3X2QB 3AG3C 5B1NA 2EIJB 1VQ6V 2ATKC 5LHHA 3OM3B 1VQ5V 4ZKIA 2JJ2G 1FFTB 5LHIA 4PA3A 4R7CA 4CBCA 1H38A 3CP1A 4FJCC 1IXMA 1XL6A 4UXNA 1OCZB 3FB5C 1KP2A 3E2EA 4LCUC 2X7RB 1F4MA 3OEHG 3RVYA 2HLDG 1VQOV 4MTFA 4JGSA 5LBQA 4UVCA 3CPWU 3MHSC 4X89A 2EILC 2QTOA 5B3SB 3CXCU 5BZBA 2P90A 4GX5A 1Y4MA 4XDJA 2EBOA 4ASUG 5EC1C 2PI5A 4JPRA 3LDDA 5IYDO 1FXHA 3CC7V 4MSWC 1GO3F 1FXKB 4QPJA 4BW5A 3ABMC 2QM8A 3W7UA 1RPOA 4MVZA 1VQLV 1JPXA 1DF4A 2Q69A 3LSQA 1KP3A 5IYBO 3NXSA 1NH2D 2IH1C 1JOYA 1E1RG 3I55V 3E8GA 5LGNA 4Z1MG 1FXKA 4L87A 5E1AC 1BHAA 2X6BA 4QE9A 3PJSK 4WFFA 4JYBA 5CA3A 1CPYA 5EBMC 3AEIA 3X2QC 4DXWA 2EIJC 3E8HA 1COWG 3ABKB 3UM7A 1YJ9V 1JJ2U 3AG2C 3A0RA 4GX0A 2MK3A 4RO2A 1H8HG 4JTDB 5L3DA 1JQ0A 2W6JG 2YSUB 3AG4B 2ZQMA 2UXNA 1NR7A 3E8FA 1YI2V 1Y66A 3OMIB 4MVOA 3ZMVA 2AHYA 4BIUA 2WLNA 1MABG 4PA4A 4JF3A 4J9ZB 4PDVA 1YJWV 1SESA 1OCZC 3TK1A 4QE7A 3K0DA 1NQTA 3ASNB 4GCZA 2M7WA 4MS2A 1AR1B 3W7SA 3JYCA 1M90W 2B1GA 5EC2C 2XAHA 1GM7A 4E2LA 3BY6A 2ZXWB 1FXVA 4UV8A 1K34A 1WPXA 2OT5A 3OEEG 3JD3A 5B1AB 1VQ4V 1R3LC 3D36A 2IJHA 1OCCB 3B8MA 3ZIAG 1Q82W 3CCEV 4TT3G 1QVFU 1FXKC 1K9MW 1OCOC 5CBFA 2H8PC 5B1OA 3LDEA 2BOCC 5DM6V 1YSCA 3F7YC 3SYOA 1PNKA 1Q7YW 4RQEA 1NBMG 5LGTA 5B1BB 1LNQA 3OAAG 2XAGA 1NVPD 3ETGA 1BHBA 1AI5A 5CBGA 3MD0A 5KUKA 2Y69B 3FB8C 4UVAA 2EIKB 3QO8A 1YTFB 1VQNV 2WPDG 3ABKC 2XAJA 3SPHA 1MG1A 1F23A 4MW8A 3UKMA 1K5SA 5KA5A 2F43G 2IW5A 3AG4C 4KP4A 1BMFG 2W0FC 3K79A 2Z5UA 3E83A 4P9OA 3OGCC 4UUJC 3T1CA 3G71V 2DW4A 2EIMB 2IJJA 3D3IA 1GMGA 1V55B 2DQ3A 1B6QA 3OR7C 5KA6A 4WFHA 2B1IA 4HZ3A 5KUMA 3ASNC 1YJNV 4GT1A 3GWOA 5L3GA 2QM7A 1YITV 4QJFB 1E1QG 2ZXWC 3P30A 2B5UA 1AI7A 2NNUA 3K08A 3OMAB 5H6QA 3B8NA 2BOBC 5B1AC 1G4YB 3HPLC 4P30A 4JTCB 1KQSU 1OCCC 3F5WC 1GTOA 1F51A 3QO7A 3SYPA 1AJQA 1W0JG 1QLNA 2IU0A 4WCEV 5LGUA 4MTXA 2X6AA 1M9NA 1XL4A 2QEXV 2IH3C 3WG7B 3DTUB 3RW0A 1R3KC 3ABTA 3E8BA 5B1BC 2JEUA 4N21A 1YHQV 5EBLC 4WFBV 1NR1A 1GM9A 1VQ9V 2HJFC 1R3IC 3K03A 1MOFA 2Y69C 4R8CA 3T4DA 2EIKC 4RAIA 3W7TA 2OCCB 2ITDC 2EJRA 1YIJV 4MT8A 3ZN1A 2EZOA 4I9WA 4R6ZA 1V54B 3WFVA 3H01A 1R6KA 3ASOC 1EBOA 1QLEB 3ZN0A 1PNMA 1CEZA 5FL7G 5HFLA 2EIMC 2NLJC 2V1DA 3ZMSA 1FS0G 3EHBB 3CCQV 4N23A 4Q20A 2XNDG 4H37A 1OCRB 4MVQA 4TWKA 2HFEC 3FB7C 1S0VA 1SERA 2DYSB 5HFMA 1KD1W 3ZMTA 2JK5C 1J95A 3JCZA 3K3WA 2C2AA 3T2MA 4JAVA 4U7OA 1K97A 3SPCA 3SPGA 1AI4A 1K3EA 4G2KA 5B3SC 3IFXA 1RM1B 4YXWG 1QR8A 3OUFA 3G6EV 3TCUA 3ZJZA 4UV9A 1EZJA 5IY5B 1H2GA 5H6RA 2IU3A 1K73W 1THZA 2H94A 1QCEA 4GX1A 5CBHA 3CCUV 4BIZA 1PL0A 3E86A 2OCCC 5EBWC 4EKWA 4X88A 1P4RA 1BL8A 1QLEC 2XAQA 2CK3G 4MTGA 1N8RW 1F4NA 1MSWD 4MVMA 1WLEA 3CYOA 1UJWB 2X6CA 2Y48A 3K9AA 3ZRSA 1AI6A 3RBZA 1S77D 3TETA 4I5SA 1ENVA 4HAMA 2XOKG 4LP8A 3SPIA 1PKXA 3FB6C 1I5XA 4LC1A 2JDIG 2WLKA 4FK5C 3LUTB 5EK0A 2Z3YA 3VBBA 3MHHC 4RUEA 2HKOA 3BEHA 2ZD9A 2WSSG 4X8AA 1NVPB 3E89A 3CMAV 4H33A 1Q86W 5GW7A 2DYSC 1KECA 2FTKA 4WFAV 5LHGA 2WLMA 1M57B 1QR9A 1I5YA 2P6JA 3LDCA 4JASA 3STZC 4XBFA 3QO5A 5L3EA 3SYQA 1W0KG 1VQKV 2WLHA 3ETDA 3OW2U 4DO2A 2EINB 3B77A 3CC2V 3CCLV 4WFEA 5IY5C 2OTLV 2EZPA 3F7VC 2D3OW 1PNLA 2UXXA 4WFGA 1KKDA 1TUEB 3ABLB 3OMNB 2WAMA 1M1KW 3AG2B 1S5HC 2X0LA 2JJ1G 4RUFA 4WF9V 4PA9A 4P2ZA 1M56B 4OXSA 3EFFK 2Q68A 2W6IG 1SRYA 4PDRA 2QA4V 5H9CA 1VQ7V 5IDJA 4ZBMA 2WLLB 1KC8W 2PI4A 3SPJA 4MTOA 3SYAA 3SJQC 2K1EA 3ZMUA 1K4CC 2JEXA 4P9PA 2DYRB 1K92A 2WLIB 2WLJA 5CMUA 1GK9A 2KB1A 1AJNA 1QBZA 2JIZG 2LFRA 3ML0A 1DLBA 2LFSA 2WLLA 3SYCA 2R9RB 4KUMA 1V55C 1DTOA 5J9PC 3OFNG 1VQMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB8 C;  5B3S C;  2A0L A;  3IFX A;  2WLI A;  3IGA C;  3K04 A;  3OUF A;  3R65 A;  3TCU A;  3ABK C;  3ZJZ A;  1M57 C;  1XL6 A;  3SPH A;  3FB5 C;  3UKM A;  4MW8 A;  4LCU C;  4GX2 A;  4GX1 A;  3AG4 C;  1JVM A;  2HVK C;  5CBH A;  2W0F C;  3E86 A;  3E83 A;  4P9O A;  3OGC C;  4UUJ C;  3RVY A;  3T1C A;  2OCC C;  5EBW C;  4EKW A;  2EIN C;  4MTF A;  1ORQ C;  4PA7 A;  4X88 A;  3RVZ A;  4X89 A;  3OR7 C;  2EIL C;  1BL8 A;  2QTO A;  4MVS A;  4WFH A;  5BZB A;  4HZ3 A;  4GX5 A;  3OR6 C;  5KUM A;  3ASN C;  3LNM B;  1QLE C;  2A9H A;  3ABL C;  4MTG A;  4XDJ A;  1ZWI C;  4QNH B;  2P7T C;  4MVM A;  5EC1 C;  2A79 B;  3LDD A;  3K06 A;  2ZXW C;  4MSW C;  3WG7 C;  1R3J C;  2X6C A;  3K0G A;  3ZRS A;  1M56 C;  3ABM C;  4BW5 A;  3K08 A;  3RBZ A;  4MVZ A;  2DWD C;  2BOB C;  3KG2 A;  3TET A;  2Q69 A;  4XDK A;  1G4Y B;  5B1A C;  3HPL C;  4P30 A;  4JTC B;  4LP8 A;  3SPI A;  1OCC C;  3F5W C;  3FB6 C;  2IH1 C;  4LBE C;  3SYP A;  2WLK A;  3LUT B;  3E8G A;  5EK0 A;  2X6A A;  5E1A C;  2YEV A;  4RUE A;  2X6B A;  1XL4 A;  2ZD9 A;  3BEH A;  4QE9 A;  3PJS K;  1V54 C;  2DYR C;  4WFF A;  4X8A A;  1K4D C;  4R50 A;  2IH3 C;  5EBM C;  3E89 A;  3X2Q C;  4H33 A;  3RW0 A;  4DXW A;  1R3K C;  2DYS C;  2EIJ C;  2Q67 A;  3E8B A;  2HG5 C;  3E8H A;  2WLM A;  3OUS A;  4MW3 A;  5B1B C;  3UM7 A;  3AG2 C;  4G28 B;  3LDC A;  4GX0 A;  3STZ C;  4RO2 A;  5EBL C;  2HVJ C;  4JTD B;  3SYQ A;  3E8F A;  2HJF C;  1R3I C;  2QKS A;  2Y69 C;  3K03 A;  4R8C A;  3T4D A;  2WLH A;  5J9P C;  2EIK C;  4MVU A;  4MVO A;  4RAI A;  4XDL A;  2AHY A;  4PDM A;  2WLN A;  4PA4 A;  2ITD C;  4J9Z B;  4PDV A;  4I9W A;  4WFE A;  5IY5 C;  1OCZ C;  4R6Z A;  4QE7 A;  3ASO C;  1OCR C;  4G27 B;  3K0D A;  3F7V C;  4KFM A;  3SPG A;  3AG1 C;  4WFG A;  4MS2 A;  1KKD A;  4PDL A;  3JYC A;  4J9Y B;  1P7B A;  5EC2 C;  1S5H C;  2EIM C;  2ITC C;  4RUF A;  2NLJ C;  4PA9 A;  2AHZ A;  4P2Z A;  4OXS A;  3EFF K;  2Q68 A;  4PA6 A;  3STL C;  1R3L C;  4PDR A;  2Q6A A;  3T4Z A;  4H37 A;  4HYO A;  4MVQ A;  4MVR A;  1OCO C;  3GB7 C;  2WLL B;  4ZBM A;  4TWK A;  3SPJ A;  4MTO A;  3SYA A;  2H8P C;  3SJQ C;  5CBF A;  2K1E A;  4F4L A;  2HFE C;  1K4C C;  3FB7 C;  3LDE A;  2BOC C;  4P9P A;  3F7Y C;  3VOU A;  2WLI B;  2WLJ A;  2DWE C;  3SYO A;  2KB1 A;  4JTA B;  3AG3 C;  2ATK C;  2JK5 C;  1J95 A;  3T2M A;  1LNQ A;  2WLL A;  3SYC A;  2R9R B;  3SPC A;  1V55 C;  4PA3 A;  4R7C A;  5CBG A;  5KUK A;  4CBC A; 
#chains in the Genus database with same CATH topology
 1F7Y A;  4I0X A;  4E4E A;  1IBL B;  4DV2 O;  3JAM N;  2F4V O;  5AG2 A;  1JVM A;  1NH2 B;  2XAF A;  4DR1 B;  2ZR2 A;  5BXZ A;  1K8A W;  3RVZ A;  1BE3 H;  3ZMZ A;  4JAU A;  2QE7 G;  1WJZ A;  4MVS A;  3LNM B;  4LFA B;  3K06 A;  1Z5V A;  1JCH A;  1R3J C;  3K0G A;  4JYC A;  4LNU B;  3BVO A;  1TVK A;  2CAZ C;  1ROP A;  3VQV A;  4DV3 O;  3CEI A;  3CSX A;  3P32 A;  4LF5 O;  3JD2 A;  2B9Z A;  2YEV A;  4X1K A;  1NI8 A;  4H13 B;  2DYR C;  4R50 A;  1Y74 A;  1TUB A;  2N74 A;  2PTM A;  2ZDI C;  4TQF A;  1EFR G;  3OUS A;  1GN6 A;  5LOV B;  4DR4 B;  1PD3 A;  1SET A;  1W2B U;  3ZRW A;  1YTF D;  2VQE B;  3JD4 A;  5LA6 A;  5F2V O;  2JVD A;  5KX5 A;  3CME V;  1IBK O;  2Q8V A;  1GM8 A;  4KFM A;  1L1F A;  3AG1 C;  3RT3 C;  2QJ1 A;  5JJJ B;  1TGO A;  1ARO P;  2UXD O;  1XNQ B;  2HJD A;  1N34 O;  1R6N A;  3N2G A;  1JX9 A;  5CN0 A;  5L3B A;  1YEW A;  4LF8 O;  4FFB B;  3STL C;  4DW0 A;  3S3W A;  1DF5 A;  3I56 V;  4HYO A;  2PUS A;  2OIG A;  1GH6 A;  3ETE A;  2HR3 A;  2R9I A;  2CDY A;  2UXB B;  3UO3 A;  2DWE C;  3B09 A;  3HKC B;  3O9O A;  4DRX B;  5EZY A;  1VQ5 V;  3CX5 F;  1IVS A;  1JFF A;  4FJC C;  1IXM A;  1BQ0 A;  5K1X A;  3S3X A;  5BR8 B;  2ZE5 A;  3WU2 Z;  3FB5 C;  4GYC B;  1KP2 A;  3E2E A;  1S5L Z;  4LFC B;  5FNV B;  2X7R B;  3OEH G;  3RVY A;  4PI2 A;  2KKW A;  3AK3 A;  4DR2 O;  2FML A;  2EIL C;  4ZIB A;  1Y4M A;  2ZM6 B;  4EFB A;  1FD9 A;  2Q0A A;  4JPR A;  3ZBH A;  4DV1 B;  5IYD O;  4MSW C;  4YJ2 A;  4QPJ A;  3W7U A;  2BSK A;  4X64 B;  1JPX A;  3T1H B;  3NXS A;  1ZUQ A;  1HNX B;  2IH1 C;  1O9H A;  3FD9 A;  4FLW A;  2X6B A;  2P5O A;  3PJS K;  5CA3 A;  1CPY A;  1FPO A;  5EBM C;  4EB6 A;  1COW G;  1YJ9 V;  3A0R A;  4GX0 A;  4CS3 A;  3TGU H;  3E8F A;  2MW2 B;  2AHY A;  2LGW A;  2WLN A;  1Y74 B;  4J9Z B;  3RYI B;  4CS2 A;  1YJW V;  2OIE A;  2ETN A;  4MS2 A;  2ZKO A;  1I0H A;  2NR5 A;  1AR1 B;  3HKE B;  3BY6 A;  2EX3 A;  1FXV A;  1K34 A;  4LR3 A;  4IL6 Z;  3OEE G;  2YIA A;  3JD3 A;  5B1A B;  1H2K A;  3D36 A;  1ZAU A;  2IJH A;  2QDO A;  2FKX A;  2H8P C;  4JI4 O;  3H1J H;  1I08 A;  1SQB H;  2BTO A;  3D3Q A;  4WBN B;  5B1B B;  3JAK A;  1XOU A;  2QGN A;  5KUK A;  1L0L H;  1M4U A;  4DR6 B;  1YTF B;  2WPD G;  2QWO B;  4J41 A;  1MG1 A;  1F23 A;  3DXR A;  2R70 A;  3UKM A;  4O2A A;  4ZOL B;  2W0F C;  1SC5 B;  1WA8 B;  1GRJ A;  4P9O A;  4BW9 A;  3G71 V;  5TIS Z;  2CH7 B;  1SQQ H;  1GMG A;  1YCI A;  4ZI7 A;  1KYO F;  4FM2 A;  4WFH A;  2Q7H A;  3ASN C;  3K5M A;  3DC6 A;  2OYQ A;  3M7M X;  3CB2 A;  3P30 A;  5EYP B;  5CB4 B;  3K08 A;  3B8N A;  1G4Y B;  1KQS U;  3U10 A;  3ZHT A;  3QO7 A;  1AJQ A;  1QLN A;  1B04 A;  4WCE V;  3KKY A;  4LH7 A;  2WA4 A;  2BSK B;  4JI1 O;  3TXS A;  3GVM A;  1KU9 A;  1MZF A;  4DUY O;  4N21 A;  1O9G A;  5JJE B;  1N33 O;  4ZHQ B;  1GM9 A;  4DV5 O;  5DED A;  4NXN B;  4R8C A;  2EIK C;  4JI7 O;  5LXT B;  3H01 A;  1FJG B;  4X9Q A;  2GUZ B;  1LUW A;  2ZE6 A;  1CEZ A;  2ZE8 A;  5HFL A;  1MNG A;  2EIM C;  3EHB B;  3OTO O;  3CCQ V;  4N23 A;  5CA0 B;  3IC9 A;  3JAW A;  2Y4T A;  1OCR B;  2P06 A;  1N36 B;  1H2S B;  5LMU O;  3JCU Z;  5HFM A;  2GBO A;  1KD1 W;  3K3W A;  3JCZ A;  3T2M A;  2A7W A;  3H9V A;  1K97 A;  2YUA A;  3IFX A;  3EVK A;  1RM1 B;  3G6E V;  2VQF B;  1OJH A;  4O2B A;  3TCU A;  5H6R A;  3OT7 A;  2IU3 A;  4J11 A;  2Q5Z A;  1QCE A;  1Q3E A;  1Y76 B;  2HHH O;  3CCU V;  4BIZ A;  1PL0 A;  3PN1 A;  4EKW A;  1OV9 A;  3Q4H A;  5ITZ B;  4MTG A;  4O2A B;  1EM1 A;  2KQX A;  2CGO A;  1WPB A;  3RBZ A;  1Q43 A;  4LP8 A;  1PKX A;  3FB6 C;  2P4K A;  2WLK A;  3FAV A;  2HKO A;  3BEH A;  5KHH A;  2ZD9 A;  2UUB O;  1ZSP A;  3JAR A;  2WSS G;  4BIO A;  4TUY A;  3RFR A;  5J2T B;  2DYS C;  1QR9 A;  3LDC A;  3BRC A;  3L70 H;  5L3E A;  3SYQ A;  1VQK V;  2ZIM A;  1XMO B;  3OGI B;  4WFE A;  1HR0 O;  2OTL V;  3NR7 A;  2EZP A;  3F7V C;  1PNL A;  4WFG A;  1TUE B;  3CJH A;  1HNW O;  3ZHU A;  4P2Z A;  1N0N A;  2Q68 A;  4JI3 B;  1US6 A;  3BA8 A;  4I50 B;  2E5L B;  5IJ9 B;  2CE4 A;  1VQ7 V;  2YIB D;  2PI4 A;  4FLY A;  3SJQ C;  1K4C C;  2LW1 A;  2DYR B;  1XI1 A;  1K92 A;  5CMU A;  2UXC B;  4JI5 O;  1NS1 A;  2JIZ G;  4DV4 O;  1DLB A;  2WLL A;  1DTO A;  5J9P C;  5FLX N;  1OCO B;  4PI0 A;  3JD1 A;  1SA0 A;  2WLI A;  4JV5 O;  2Y0I A;  3IGA C;  3K04 A;  2GSM B;  3AG1 B;  1K33 A;  2HVK C;  4QPK A;  4FLT A;  3HKB A;  4DUZ B;  3SJA C;  4PA7 A;  1JR9 A;  1VF7 A;  1UPG A;  4PEL A;  2QWR B;  2BTQ B;  1K7D A;  4X1I B;  4QNH B;  4LF7 O;  1SQF A;  3ZRX A;  1HWY A;  2WWW A;  1G8M A;  2IJK A;  3KG2 A;  3JD0 A;  1Q8I A;  3CCR V;  1SQX H;  4U3J B;  3J7A U;  1S72 V;  2YI8 A;  4IYI A;  5IYC O;  4B3T O;  3CD6 V;  4LNU A;  3OE7 G;  5CA1 B;  4YY3 B;  3CCS V;  2Q9L A;  5C8Y B;  1J5E B;  4CZZ A;  4MW3 A;  1AR4 A;  5LL6 Y;  4K0K B;  4QIW F;  2QKS A;  3DGE A;  4PDM A;  5H5N A;  1NJI W;  1ZL8 B;  2JS5 A;  3QG5 A;  2EIL B;  1OCR C;  4G27 B;  4JI0 B;  4PDL A;  3UT5 B;  4J9Y B;  4UCR A;  4B7K A;  4UVB A;  1D2D A;  1PM9 A;  5D5Q A;  2EJ7 A;  2E3C A;  4PA6 A;  3H1L H;  5JCO A;  2XAS A;  3T4Z A;  2V7Q G;  1L8D A;  1RM1 C;  1EZV H;  4O4J B;  3WB1 A;  4FFB A;  4D7S A;  5L3C A;  3AG3 C;  1VQ6 V;  2ATK C;  5LHH A;  2CGN A;  3OM3 B;  2JJ2 G;  3KZI Z;  4TV9 B;  4PA3 A;  4DV7 B;  2GTS A;  1H38 A;  4FFK A;  4JYA B;  3HKC A;  1XL6 A;  3HR0 A;  3ICX A;  4MTF A;  3CWB H;  2BCC H;  3K58 A;  1RSO B;  5B3S B;  1IBM O;  2UXB O;  4J7K A;  4ASU G;  4NXM O;  5EC1 C;  3LDD A;  1GO3 F;  2QM8 A;  1RPO A;  1N32 B;  1DF4 A;  2L6L A;  4PV1 B;  1E1R G;  4DV0 O;  2QM4 A;  4EFE A;  4Z2W A;  5E1A C;  4LFC O;  3MDS A;  4JI8 O;  1G1X B;  1QHT A;  2E76 B;  4PD4 F;  4DR3 O;  3E8H A;  2ILM A;  4JTD B;  2F95 B;  3SJC C;  1JQ0 A;  2W6J G;  2ZM6 O;  1SZX A;  2UXN A;  4DV1 O;  3ZMV A;  1MAB G;  4PDV A;  2L35 A;  1MZE A;  4NR1 A;  4QE7 A;  3T1H O;  3ASN B;  4GCZ A;  4CH4 A;  1HNX O;  3W7S A;  4X62 B;  1SKV A;  4LF4 B;  1LR1 A;  4UV8 A;  3RYI A;  5LMN B;  4X65 O;  2YS8 A;  2YXH A;  1VQ4 V;  2IM9 A;  3K9S A;  4I55 B;  2PY5 A;  3HKE A;  1FXK C;  1OCO C;  1FYJ A;  3G80 A;  5B1O A;  4D6T H;  4W4K A;  2BOC C;  5DM6 V;  1Q7Y W;  2RN9 A;  3R66 A;  4A5U B;  1NVP D;  3C3S A;  4JZG A;  1R1B A;  2F1M A;  1BHB A;  3FB8 C;  2EIK B;  1BGY H;  1HW7 A;  2VS0 A;  3QO8 A;  2YID A;  1VQN V;  4OX9 O;  1YF2 A;  3ABK C;  4WBN A;  2RQ6 A;  2XAJ A;  1VF6 C;  3SPH A;  1Z5W A;  4MW8 A;  4IYH A;  1PL4 A;  2F43 G;  2IW5 A;  2YC0 A;  4K35 A;  5B5E Z;  5KA5 A;  4KP4 A;  1BMF G;  3SR2 C;  3E83 A;  4TV8 B;  4UUJ C;  1XMQ B;  1Z2G A;  2EIM B;  3CRM A;  3KCY A;  2ZIN A;  5KA6 A;  5KUM A;  2CTW A;  4GT1 A;  1XHX A;  1YZB A;  1M5I A;  2UUA B;  4ZOL A;  1YIT V;  1WA8 A;  4O4L B;  3T1Y B;  2VWK A;  3D8C A;  3C3T A;  2CH7 A;  1AB3 A;  4P30 A;  4JTC B;  4I4T B;  4X66 B;  4DR6 O;  1Q6U A;  3SYP A;  4MTX A;  5EYP A;  2X6A A;  5D5P A;  2KG7 B;  5CB4 A;  2AGA A;  1XL4 A;  3RYF B;  3GWK C;  4NTY A;  4YJ3 B;  3DTU B;  2HEP A;  3L72 H;  4DV2 B;  1I94 O;  3A2F A;  1XQ8 A;  2JEU A;  3HKD B;  5JJN B;  5EBL C;  2Q7E A;  4B3M B;  2Y69 C;  5B66 Z;  2CTQ A;  3JSL A;  2ITD C;  2EJR A;  1YIJ V;  3ZN1 A;  4I9W A;  3RN4 A;  1V54 B;  3WFV A;  4IHJ B;  2RMK B;  3QVN A;  4ZHQ A;  3J80 N;  4JI2 B;  3ZN0 A;  2HP8 A;  3VQX A;  5LXT A;  2V1D A;  4F6E A;  3TXQ A;  2Q7G A;  1WB8 A;  4UB6 Z;  3ETQ A;  5LP6 C;  4IGG A;  1TA8 A;  2XND G;  2GUZ A;  4H37 A;  1U96 A;  4LH6 A;  4CH3 A;  4NXN O;  4F6R B;  3SGI A;  2JS3 A;  4J42 A;  5CA0 A;  4CH6 A;  1T5E A;  2DYS B;  5JQG A;  2JK5 C;  1J95 A;  1FJG O;  4KHP B;  4FLU A;  3SPG A;  4UCT A;  1AI4 A;  5B3S C;  1FKA O;  1GN3 A;  5LYJ B;  3OUF A;  1XIL A;  1CXZ B;  1ZTE A;  2OCC C;  5EBW C;  1RFY A;  3B2E E;  1N36 O;  1BL8 A;  2QKA A;  1QLE C;  2XAQ A;  1H2N A;  1MSW D;  4H44 B;  1Y76 A;  2PGG A;  1GN2 A;  4EEQ A;  1UJW B;  1DK1 A;  2Y48 A;  5ITZ A;  3TET A;  2XOK G;  2LJ2 A;  2R72 A;  2VQF O;  4LC1 A;  4FK5 C;  3VBB A;  2Z3Y A;  2BE3 A;  4W4L A;  1KMI Z;  1NVP B;  4B3S B;  3E89 A;  5J2U B;  5GW7 A;  1KEC A;  2O57 A;  3LNN A;  5LHG A;  5KAF Z;  3L73 H;  5JVD B;  3RWR D;  4JAS A;  3M8A A;  3UCS C;  4Z1V A;  1VP7 A;  3RYH B;  1GN4 A;  1P7G A;  1W0K G;  1WN7 A;  1HNZ O;  3OW2 U;  4DR2 B;  5IWA O;  5J2T A;  3CE2 A;  2LW7 A;  4FVM A;  3OMN B;  3AG2 B;  2X0L A;  4RUF A;  1XNR B;  5K1P A;  2AW9 A;  4OPA A;  2RDC A;  4OXS A;  3EFF K;  5KMG B;  2W6I G;  1SRY A;  4PDR A;  5KHJ A;  3CRQ A;  1BCC H;  5IDJ A;  4JZ2 A;  5BY1 A;  4FZ1 A;  1KC8 W;  3QF7 A;  3SYA A;  1YDX A;  3ZHQ A;  4LF9 B;  4KXR A;  2XHB A;  2YIC A;  4CC6 A;  1XMO O;  2WA3 A;  4I50 A;  1AJN A;  5IJ9 A;  2LFR A;  3P3P A;  3ML0 A;  2LFS A;  3JSN A;  1VQ8 V;  2A0L A;  3O65 A;  2ZT9 B;  3R65 A;  2ZDI A;  1M57 C;  4FLX A;  3BAB A;  5JQG B;  1RPR A;  1OZ0 A;  4TOI A;  4GX2 A;  2KSD A;  1S76 D;  2LP7 A;  2E5L O;  4B3R B;  2N04 A;  1UFI A;  3OD4 A;  1R73 A;  2EIN C;  5E79 Z;  1ORQ C;  3LSS A;  5A9G A;  3FKS G;  5L3F A;  1WP7 A;  1QVG U;  4RQF A;  1VF5 B;  1ZWI C;  2UXC O;  2UUC O;  5KLV H;  1NKD A;  2QKC A;  1Q6I A;  1H2L A;  2JGU A;  1VQP V;  1SQG A;  2FB5 A;  2QTS A;  3ZCC A;  2BTQ A;  4X1I A;  3AG3 B;  2NN4 A;  2GDS A;  3JAL B;  3FX7 A;  4L8J A;  1V54 C;  2AZ2 A;  4DYL A;  2QWP B;  1XRE A;  4DUZ O;  4U3J A;  3CHX A;  3THO A;  3N27 A;  4BAY A;  2GHY A;  2OTJ V;  2HVJ C;  2K9P A;  3P3N A;  2DJV A;  3CC4 V;  3FYE B;  5KHK A;  3RYC A;  5CA1 A;  3IJ4 A;  1NU1 H;  5C8Y A;  1H8E G;  3H1I H;  1D5N A;  4CS4 A;  2P67 A;  4FMT A;  4NTX A;  3QTC A;  2ITC C;  4FIP C;  2ZR3 A;  4TSF G;  1ZL8 A;  2H3O A;  5GON B;  2EUL A;  1AJP A;  1J5E O;  3UT5 A;  3GB7 C;  2A3Q A;  4DV6 B;  4K0K O;  5BMV B;  4F4L A;  2DE0 X;  1QQC A;  1S3J A;  1MMM A;  1E79 G;  5EIB D;  3A8T A;  4JTA B;  2ADQ B;  5IYZ B;  1FFT B;  5LHI A;  4JI0 O;  4JI7 B;  4R7C A;  4O4J A;  1DGS A;  1HP8 A;  3CP1 A;  4UXN A;  4X20 B;  1N0J A;  4LCU C;  5LP6 A;  2ZNI A;  4LFB B;  2W0X A;  4TV9 A;  1NT2 B;  1PPJ H;  3K5L A;  2HLD G;  1YVW A;  1VQO V;  4JGS A;  3ZX6 A;  5LBQ A;  3OTO B;  3ZED A;  1HDJ A;  1R6T A;  2QTO A;  5BZB A;  2P90 A;  4O4H B;  2Y0P A;  4XDJ A;  2EBO A;  2FL4 A;  2PI5 A;  4DW1 A;  1FXH A;  1FXK B;  1NTM H;  3ABM C;  5JWP A;  2ZIO A;  3H1K H;  4DV7 O;  1RSO A;  4I9Q A;  2Q69 A;  3LSQ A;  5IYB O;  4JAA A;  1SF9 A;  2OCH A;  1NH2 D;  4JYA O;  1JOY A;  3I55 V;  5A2Q N;  3E8G A;  2PF4 E;  4Z1M G;  5LGN A;  1BHA A;  4QE9 A;  5FPR A;  1XHZ A;  3AK2 A;  3CXH F;  4WFF A;  4JYB A;  4GKJ B;  2YIB A;  3AEI A;  3X2Q C;  2EIJ C;  3ABK B;  3UM7 A;  3IAY A;  3AG2 C;  4IIJ B;  2MK3 A;  2YXY A;  1PV0 A;  5L3D A;  2CUG A;  1NR7 A;  1WP8 A;  4DK1 A;  1WNS A;  4JF3 A;  2QWN B;  3UO2 A;  1SES A;  1OCZ C;  3K0D A;  1IBL O;  2Q4P A;  1NQT A;  2M7W A;  2XUM A;  4CC5 A;  1SS3 A;  2F23 A;  1GM7 A;  3RYC B;  4DR1 O;  5IJ0 A;  4LWS B;  3JAT A;  1R3L C;  4DR5 B;  1VEW A;  3B8M A;  3ZIA G;  4LFA O;  3DC5 A;  4TT3 G;  2YXL A;  1QVF U;  1VAR A;  4J80 A;  3LDE A;  3N2K B;  1YSC A;  3F7Y C;  1P49 A;  5KAI Z;  3SYO A;  4I55 A;  1X59 A;  5LGT A;  1IX9 A;  1LNQ A;  3OAA G;  2XAG A;  3ETG A;  1AI5 A;  5CBG A;  4J7Z A;  3MD0 A;  3TJT A;  2Y69 B;  3I5D A;  4UVA A;  4X62 O;  1AP6 A;  4LF4 O;  4AI8 A;  1WB7 A;  1K5S A;  2DOS A;  3AG4 C;  4DR4 O;  4DR7 B;  3K79 A;  1GAX A;  2Z5U A;  2E75 B;  3T1C A;  2DW4 A;  2VQE O;  2IJJ A;  4AHC A;  2DQ3 A;  3LSU A;  1AIL A;  1B6Q A;  3OR7 C;  2B1I A;  1FFX B;  2XTA A;  1YJN V;  3GWO A;  5LP6 B;  2QM7 A;  4TV8 A;  2ZXW C;  2ZNJ A;  4UCS A;  1AI7 A;  2NNU A;  1XNQ O;  2BOB C;  4GZR B;  1OCC C;  3F5W C;  1GTO A;  4DV4 B;  3K5O A;  1W0J G;  2QR4 A;  4O4L A;  2IU0 A;  2LO1 A;  4H0L B;  4BR6 A;  1M9N A;  1MSD A;  2QEX V;  2IH3 C;  3WG7 B;  1Y67 A;  4I4T A;  3ABT A;  3E8B A;  1YHQ V;  4WFB V;  1NR1 A;  4YHH B;  2KG7 A;  2F66 C;  2HJF C;  3K03 A;  3T4D A;  1MOF A;  2UUA O;  3RYF A;  5KHG A;  5DEC A;  4GKK B;  3T1Y O;  2OCC B;  4YJ3 A;  3JAS B;  3HKD A;  4HNA B;  3CRA A;  4LF7 B;  1EBO A;  5BR8 O;  2G38 A;  1QLE B;  1TAE A;  4X66 O;  1PNM A;  1VIB A;  2ZCE A;  2NLJ C;  4UB8 Z;  1FS0 G;  4IHJ A;  4FLZ A;  3BFR A;  4Q20 A;  4MVQ A;  4B3T B;  4TWK A;  5IJ0 B;  4B3M O;  2JGD B;  3JAT B;  4O4I B;  4X64 O;  1SER A;  5GTH Z;  1Q6H A;  3ZMT A;  1XBL A;  2C2A A;  2AXT Z;  4U7O A;  3SPC A;  4JI2 O;  2E74 B;  1K3E A;  4G2K A;  4F6R A;  1QR8 A;  3ZJZ A;  4UV9 A;  4DK0 A;  1H2G A;  1THZ A;  3K59 A;  1N4C A;  4GX1 A;  5CBH A;  2D2C B;  1EN4 A;  3KCX A;  5LYJ A;  4X88 A;  1D5A A;  4UCV A;  2CK3 G;  1F4N A;  5FPO A;  4MVM A;  3CYO A;  1ZLZ A;  4FM0 A;  1H2M A;  4GLX A;  2ADP A;  3K9A A;  4JI6 B;  3ZRS A;  4KHP O;  1S77 D;  1VMG A;  4LF6 B;  1ENV A;  4HAM A;  3SPI A;  1I5X A;  3AG7 A;  4AQY B;  1IDS A;  2JDI G;  3MHH C;  1KBH A;  4RUE A;  2RCV A;  2N05 A;  2Z0A A;  3E22 B;  4BWA A;  4WFA V;  1YXB A;  2UU9 B;  1M57 B;  2P6J A;  3STZ C;  4XBF A;  3QO5 A;  3ZHS A;  2WLH A;  3ETD A;  2M6Y A;  4PJ0 Z;  2EIN B;  3B77 A;  5J2U A;  3K5N A;  4X1Y A;  2YI9 A;  3CCL V;  5IY5 C;  1IBM B;  5JVD A;  4NXM B;  1KKD A;  3RYH A;  2WAM A;  1M1K W;  1S5H C;  3CS5 A;  2JJ1 G;  3RGB A;  4WF9 V;  4PA9 A;  1KUQ A;  5JH7 B;  3U11 A;  2F4V B;  1IXB A;  1BSM A;  4DV0 B;  4B3S O;  2QA4 V;  5H9C A;  4ZBM A;  3SPJ A;  4NB5 A;  4JI8 B;  2K1E A;  3CRR A;  4ICG A;  3ZMU A;  4DR3 B;  4P9P A;  2GTA A;  5KMG A;  2KB1 A;  4I0X B;  1QBZ A;  3G67 A;  2ARH A;  4KUM A;  3OFN G;  4JYY A;  1G6U A;  1NZ6 A;  4DV3 B;  1XNR O;  2ODM A;  5DN6 G;  3IC7 A;  1Q81 W;  4LF5 B;  4OPH A;  1GKF A;  1AR5 A;  4UCO A;  4ABM A;  2DN9 A;  3FFQ A;  4X65 B;  2RJZ A;  2JRI A;  4J7J A;  5EIB C;  3OR6 C;  3CCM V;  1TVK B;  4LF9 O;  2A9H A;  3ABL C;  2P7T C;  2A79 B;  1V9P A;  3WG7 C;  1URF A;  1M56 C;  2A06 H;  2YEV B;  4X1K B;  3W7W A;  1IBK B;  1K5Q A;  2DWD C;  3L74 H;  4U7N A;  3B4S A;  4XDK A;  1TUB B;  1JMK C;  4FPP A;  1AP5 A;  4LBE C;  2UXD B;  3HB3 B;  3G4S V;  1N34 B;  3APO A;  3ZRW B;  1U97 A;  3ABU A;  4LF8 B;  5LA6 B;  4Q6G A;  4B3R O;  1K4D C;  4OX9 B;  4CH5 A;  3W7X A;  5KX5 B;  2Q67 A;  2HG5 C;  1A32 A;  5C93 A;  4G28 B;  1XEQ A;  3H1H H;  3JAL A;  4MVU A;  4XDL A;  3U0Z A;  1CP9 A;  1SZT A;  3N2G B;  3MAQ A;  3ZRV A;  3AK1 A;  2DQ0 A;  1P7B A;  4C7U A;  2AHZ A;  3QNE A;  3ABM B;  3FYI B;  3L9D A;  4X1Y B;  1JA8 A;  3E35 A;  2Q6A A;  4FZ0 A;  5IE9 A;  2IJI A;  3ASO B;  4MVR A;  5EZY B;  3M99 B;  1IUR A;  4HBN A;  3CCJ V;  3CCV V;  3BAA A;  1OHH G;  2P22 C;  1I94 B;  1JFF B;  3B40 A;  5GON A;  3VOU A;  3X2Q B;  5B1N A;  2EIJ B;  3APQ A;  3SJB C;  4PHZ A;  3EXA A;  1M93 A;  4ZKI A;  3UQ8 A;  3L75 H;  5BMV A;  4CBC A;  4J10 A;  1IZ3 A;  1BT8 A;  1RP3 B;  5IYZ A;  1OCZ B;  2PYL A;  1B06 A;  1F4M A;  4YJ2 B;  5H2F Z;  4UVC A;  4DV6 O;  4NYK A;  3CPW U;  3MHS C;  4X89 A;  3VQW A;  4X20 A;  3CXC U;  5JCO C;  4GX5 A;  3ZHV A;  3F5T A;  4QGP A;  3CC7 V;  1WAZ A;  2VRZ A;  4BW5 A;  1MA1 A;  4GUN A;  2F93 B;  4MVZ A;  1VQL V;  1KP3 A;  4O4H A;  4K3A A;  4JI3 O;  4EB6 B;  1FXK A;  4L87 A;  2Q73 A;  4LFB O;  3BCC H;  2V4D A;  4DXW A;  2R9A A;  3ZS8 C;  1JJ2 U;  1EN5 A;  4RO2 A;  1H8H G;  4JI4 B;  2ZQM A;  2YSU B;  3AG4 B;  1YI2 V;  4K8X A;  1Y66 A;  3OMI B;  4MVO A;  4BIU A;  2CTR A;  4PA4 A;  4KL1 A;  4AIL C;  3WB2 A;  3TK1 A;  1ZX3 A;  1VF6 A;  1QNM A;  4IIJ A;  3JYC A;  1M90 W;  2B1G A;  5EC2 C;  2XAH A;  1QU7 A;  4E2L A;  1S5J A;  2ZXW B;  1WPX A;  2OT5 A;  4GKJ O;  1Q82 W;  1OCC B;  3CCE V;  1P84 F;  1K9M W;  2QSA A;  5CBF A;  3JAK B;  4FM1 A;  2OWO A;  4LWS A;  1NTZ H;  1B3Q A;  1PNK A;  4B7E A;  4RQE A;  1NBM G;  1NTK H;  3DXR B;  1HNZ B;  3CRC A;  5IWA B;  1JJO A;  3N2K A;  3BPZ A;  2P4V A;  4ZI7 B;  4YY3 O;  3A0H Z;  2AZ0 A;  4OGQ B;  3L71 H;  4DR5 O;  2IBZ H;  3SDL A;  4JI1 B;  3OGC C;  3D3I A;  1V55 B;  4DUY B;  1N33 B;  4HZ3 A;  2RNB A;  4DV5 B;  5L3G A;  4QJF B;  1E1Q G;  4U3F H;  2B5U A;  2Y4U A;  3OMA B;  5H6Q A;  1BQZ A;  5B1A C;  1FFX A;  3HPL C;  1PP9 H;  1SQP H;  1F51 A;  5LGU A;  4K8Z A;  3WB0 A;  4DR7 O;  2FYU H;  3G6B A;  2XT9 A;  3RW0 A;  1R3K C;  1X4T A;  5B1B C;  5LMU B;  1VQ9 V;  1R3I C;  3BHP A;  2ZE7 A;  4RAI A;  3W7T A;  4MT8 A;  2EZO A;  4R6Z A;  1R6K A;  3ASO C;  2UUC B;  2PYJ A;  3JAW B;  5FL7 G;  3JAS A;  3ZMS A;  1XDC A;  1AVM A;  4HNA A;  4RWU A;  2HHH B;  1BZK A;  3ZHR A;  4YHH O;  2HFE C;  3FB7 C;  2LQT A;  4NVP A;  1S0V A;  4I7Z B;  1N32 O;  4GKK O;  3DSQ A;  4O2B B;  3K57 A;  4FLV A;  4JAV A;  4B08 A;  1VQM V;  4IT5 A;  2JGD A;  4O4I A;  1EN6 A;  4YXW G;  2VWJ A;  4NKG B;  3Q4H B;  1EZJ A;  2CTP A;  4UFZ A;  5IY5 B;  1K73 W;  2H94 A;  5IT9 N;  2UUB B;  1L0N H;  3E86 A;  2YDE A;  3A0B Z;  5GTI Z;  1P4R A;  1KKC A;  1XUQ A;  1N8R W;  1WLE A;  2X6C A;  3FAV B;  1AI6 A;  1HR0 B;  3J81 N;  3JAR B;  1KB9 F;  4YIO A;  4D7T A;  4TUY B;  4I5S A;  5LMN O;  4TQD A;  1HNW B;  5LOV A;  3LUT B;  5EK0 A;  4X8A A;  3CMA V;  4H33 A;  1Q86 W;  3D36 C;  2FTK A;  1Y6X A;  4YIP A;  2WLM A;  1BS3 A;  1I5Y A;  3VQY A;  1LUV A;  3CJH B;  4NTW A;  1I7F A;  4DO2 A;  2LGQ A;  4JI5 B;  3E22 A;  4UCU A;  3CC2 V;  4JI6 O;  5KHI A;  2QWQ B;  4LF6 O;  2D3O W;  2UXX A;  1Q90 D;  3ABL B;  2GV9 A;  4JV5 B;  2DMX A;  4AQY O;  1FAF A;  1M56 B;  1XMQ O;  3OTF A;  2Q0O C;  3BA9 A;  4DRX A;  3C90 A;  2PZS A;  2UU9 O;  2WLL B;  4MTO A;  5JH7 A;  2JEX A;  1SA0 B;  1Q5O A;  2WLI B;  2WLJ A;  1GK9 A;  1SQV H;  5FNV A;  3SYC A;  2R9R B;  1V55 C;  3HKB B;  1W59 A; 
#chains in the Genus database with same CATH homology
 1VQ8 V;  1OCO B;  3JD1 A;  2A0L A;  2WLI A;  3IGA C;  3K04 A;  3R65 A;  2ZDI A;  5DN6 G;  1M57 C;  3IC7 A;  1Q81 W;  1GKF A;  1RPR A;  1OZ0 A;  4GX2 A;  2GSM B;  3AG1 B;  1K33 A;  1S76 D;  1JVM A;  2HVK C;  2XAF A;  4QPK A;  1NH2 B;  2LP7 A;  2ZR2 A;  1R73 A;  2EIN C;  1ORQ C;  3LSS A;  4PA7 A;  1K8A W;  3RVZ A;  3ZMZ A;  3FKS G;  2QE7 G;  4JAU A;  5L3F A;  4PEL A;  4MVS A;  3CCM V;  3OR6 C;  3LNM B;  1QVG U;  2A9H A;  3ABL C;  4RQF A;  1K7D A;  1ZWI C;  4QNH B;  2P7T C;  2A79 B;  3K06 A;  1JCH A;  3WG7 C;  1NKD A;  1R3J C;  3ZRX A;  1HWY A;  3K0G A;  1M56 C;  2WWW A;  2YEV B;  1G8M A;  3W7W A;  4JYC A;  1VQP V;  1K5Q A;  2DWD C;  2IJK A;  3KG2 A;  3JD0 A;  4U7N A;  4XDK A;  3CCR V;  3ZCC A;  1ROP A;  4FPP A;  3AG3 B;  4LBE C;  3HB3 B;  3P32 A;  1S72 V;  3JD2 A;  3G4S V;  3ZRW B;  2YEV A;  5IYC O;  3ABU A;  3CD6 V;  1V54 C;  3OE7 G;  2DYR C;  3CCS V;  1K4D C;  4R50 A;  3W7X A;  2ZDI C;  2Q67 A;  1EFR G;  3OUS A;  4CZZ A;  2HG5 C;  4MW3 A;  5C93 A;  4G28 B;  4BAY A;  1PD3 A;  1SET A;  2GHY A;  2OTJ V;  2HVJ C;  1W2B U;  3ZRW A;  1YTF D;  4QIW F;  2QKS A;  3CC4 V;  3FYE B;  3JD4 A;  3DGE A;  4MVU A;  4XDL A;  4PDM A;  1CP9 A;  1SZT A;  1NJI W;  1H8E G;  3CME V;  2EIL B;  1OCR C;  4G27 B;  1GM8 A;  4KFM A;  1L1F A;  2P67 A;  3AG1 C;  3ZRV A;  4PDL A;  4FMT A;  2DQ0 A;  4J9Y B;  1P7B A;  1ARO P;  2ITC C;  4UVB A;  4FIP C;  2ZR3 A;  4TSF G;  2AHZ A;  3QNE A;  1R6N A;  3ABM B;  1JX9 A;  3FYI B;  5CN0 A;  5L3B A;  4PA6 A;  3E35 A;  3STL C;  2XAS A;  2Q6A A;  1AJP A;  1DF5 A;  3T4Z A;  2IJI A;  3I56 V;  2V7Q G;  3ASO B;  4HYO A;  4MVR A;  3GB7 C;  3M99 B;  1RM1 C;  3ETE A;  2HR3 A;  2R9I A;  3CCJ V;  3CCV V;  4F4L A;  1OHH G;  1S3J A;  1E79 G;  3VOU A;  2DWE C;  5L3C A;  4JTA B;  3X2Q B;  3AG3 C;  5B1N A;  2EIJ B;  1VQ6 V;  2ATK C;  5LHH A;  3OM3 B;  1VQ5 V;  4ZKI A;  2JJ2 G;  1FFT B;  5LHI A;  4PA3 A;  4R7C A;  4CBC A;  1H38 A;  3CP1 A;  4FJC C;  1IXM A;  1XL6 A;  4UXN A;  1OCZ B;  3FB5 C;  1KP2 A;  3E2E A;  4LCU C;  2X7R B;  1F4M A;  3OEH G;  3RVY A;  2HLD G;  1VQO V;  4MTF A;  4JGS A;  5LBQ A;  4UVC A;  3CPW U;  3MHS C;  4X89 A;  2EIL C;  2QTO A;  5B3S B;  3CXC U;  5BZB A;  2P90 A;  4GX5 A;  1Y4M A;  4XDJ A;  2EBO A;  4ASU G;  5EC1 C;  2PI5 A;  4JPR A;  3LDD A;  5IYD O;  1FXH A;  3CC7 V;  4MSW C;  1GO3 F;  1FXK B;  4QPJ A;  4BW5 A;  3ABM C;  2QM8 A;  3W7U A;  1RPO A;  4MVZ A;  1VQL V;  1JPX A;  1DF4 A;  2Q69 A;  3LSQ A;  1KP3 A;  5IYB O;  3NXS A;  1NH2 D;  2IH1 C;  1JOY A;  1E1R G;  3I55 V;  3E8G A;  5LGN A;  4Z1M G;  1FXK A;  4L87 A;  5E1A C;  1BHA A;  2X6B A;  4QE9 A;  3PJS K;  4WFF A;  4JYB A;  5CA3 A;  1CPY A;  5EBM C;  3AEI A;  3X2Q C;  4DXW A;  2EIJ C;  3E8H A;  1COW G;  3ABK B;  3UM7 A;  1YJ9 V;  1JJ2 U;  3AG2 C;  3A0R A;  4GX0 A;  2MK3 A;  4RO2 A;  1H8H G;  4JTD B;  5L3D A;  1JQ0 A;  2W6J G;  2YSU B;  3AG4 B;  2ZQM A;  2UXN A;  1NR7 A;  3E8F A;  1YI2 V;  1Y66 A;  3OMI B;  4MVO A;  3ZMV A;  2AHY A;  4BIU A;  2WLN A;  1MAB G;  4PA4 A;  4JF3 A;  4J9Z B;  4PDV A;  1YJW V;  1SES A;  1OCZ C;  3TK1 A;  4QE7 A;  3K0D A;  1NQT A;  3ASN B;  4GCZ A;  2M7W A;  4MS2 A;  1AR1 B;  3W7S A;  3JYC A;  1M90 W;  2B1G A;  5EC2 C;  2XAH A;  1GM7 A;  4E2L A;  3BY6 A;  2ZXW B;  1FXV A;  4UV8 A;  1K34 A;  1WPX A;  2OT5 A;  3OEE G;  3JD3 A;  5B1A B;  1VQ4 V;  1R3L C;  3D36 A;  2IJH A;  1OCC B;  3B8M A;  3ZIA G;  1Q82 W;  3CCE V;  4TT3 G;  1QVF U;  1FXK C;  1K9M W;  1OCO C;  5CBF A;  2H8P C;  5B1O A;  3LDE A;  2BOC C;  5DM6 V;  1YSC A;  3F7Y C;  3SYO A;  1PNK A;  1Q7Y W;  4RQE A;  1NBM G;  5LGT A;  5B1B B;  1LNQ A;  3OAA G;  2XAG A;  1NVP D;  3ETG A;  1BHB A;  1AI5 A;  5CBG A;  3MD0 A;  5KUK A;  2Y69 B;  3FB8 C;  4UVA A;  2EIK B;  3QO8 A;  1YTF B;  1VQN V;  2WPD G;  3ABK C;  2XAJ A;  3SPH A;  1MG1 A;  1F23 A;  4MW8 A;  3UKM A;  1K5S A;  5KA5 A;  2F43 G;  2IW5 A;  3AG4 C;  4KP4 A;  1BMF G;  2W0F C;  3K79 A;  2Z5U A;  3E83 A;  4P9O A;  3OGC C;  4UUJ C;  3T1C A;  3G71 V;  2DW4 A;  2EIM B;  2IJJ A;  3D3I A;  1GMG A;  1V55 B;  2DQ3 A;  1B6Q A;  3OR7 C;  5KA6 A;  4WFH A;  2B1I A;  4HZ3 A;  5KUM A;  3ASN C;  1YJN V;  4GT1 A;  3GWO A;  5L3G A;  2QM7 A;  1YIT V;  4QJF B;  1E1Q G;  2ZXW C;  3P30 A;  2B5U A;  1AI7 A;  2NNU A;  3K08 A;  3OMA B;  5H6Q A;  3B8N A;  2BOB C;  5B1A C;  1G4Y B;  3HPL C;  4P30 A;  4JTC B;  1KQS U;  1OCC C;  3F5W C;  1GTO A;  1F51 A;  3QO7 A;  3SYP A;  1AJQ A;  1W0J G;  1QLN A;  2IU0 A;  4WCE V;  5LGU A;  4MTX A;  2X6A A;  1M9N A;  1XL4 A;  2QEX V;  2IH3 C;  3WG7 B;  3DTU B;  3RW0 A;  1R3K C;  3ABT A;  3E8B A;  5B1B C;  2JEU A;  4N21 A;  1YHQ V;  5EBL C;  4WFB V;  1NR1 A;  1GM9 A;  1VQ9 V;  2HJF C;  1R3I C;  3K03 A;  1MOF A;  2Y69 C;  4R8C A;  3T4D A;  2EIK C;  4RAI A;  3W7T A;  2OCC B;  2ITD C;  2EJR A;  1YIJ V;  4MT8 A;  3ZN1 A;  2EZO A;  4I9W A;  4R6Z A;  1V54 B;  3WFV A;  3H01 A;  1R6K A;  3ASO C;  1EBO A;  1QLE B;  3ZN0 A;  1PNM A;  1CEZ A;  5FL7 G;  5HFL A;  2EIM C;  2NLJ C;  2V1D A;  3ZMS A;  1FS0 G;  3EHB B;  3CCQ V;  4N23 A;  4Q20 A;  2XND G;  4H37 A;  1OCR B;  4MVQ A;  4TWK A;  2HFE C;  3FB7 C;  1S0V A;  1SER A;  2DYS B;  5HFM A;  1KD1 W;  3ZMT A;  2JK5 C;  1J95 A;  3JCZ A;  3K3W A;  2C2A A;  3T2M A;  4JAV A;  4U7O A;  1K97 A;  3SPC A;  3SPG A;  1AI4 A;  1K3E A;  4G2K A;  5B3S C;  3IFX A;  1RM1 B;  4YXW G;  1QR8 A;  3OUF A;  3G6E V;  3TCU A;  3ZJZ A;  4UV9 A;  1EZJ A;  5IY5 B;  1H2G A;  5H6R A;  2IU3 A;  1K73 W;  1THZ A;  2H94 A;  1QCE A;  4GX1 A;  5CBH A;  3CCU V;  4BIZ A;  1PL0 A;  3E86 A;  2OCC C;  5EBW C;  4EKW A;  4X88 A;  1P4R A;  1BL8 A;  1QLE C;  2XAQ A;  2CK3 G;  4MTG A;  1N8R W;  1F4N A;  1MSW D;  4MVM A;  1WLE A;  3CYO A;  1UJW B;  2X6C A;  2Y48 A;  3K9A A;  3ZRS A;  1AI6 A;  3RBZ A;  1S77 D;  3TET A;  4I5S A;  1ENV A;  4HAM A;  2XOK G;  4LP8 A;  3SPI A;  1PKX A;  3FB6 C;  1I5X A;  4LC1 A;  2JDI G;  2WLK A;  4FK5 C;  3LUT B;  5EK0 A;  2Z3Y A;  3VBB A;  3MHH C;  4RUE A;  2HKO A;  3BEH A;  2ZD9 A;  2WSS G;  4X8A A;  1NVP B;  3E89 A;  3CMA V;  4H33 A;  1Q86 W;  5GW7 A;  2DYS C;  1KEC A;  2FTK A;  4WFA V;  5LHG A;  2WLM A;  1M57 B;  1QR9 A;  1I5Y A;  2P6J A;  3LDC A;  4JAS A;  3STZ C;  4XBF A;  3QO5 A;  5L3E A;  3SYQ A;  1W0K G;  1VQK V;  2WLH A;  3ETD A;  3OW2 U;  4DO2 A;  2EIN B;  3B77 A;  3CC2 V;  3CCL V;  4WFE A;  5IY5 C;  2OTL V;  2EZP A;  3F7V C;  2D3O W;  1PNL A;  2UXX A;  4WFG A;  1KKD A;  1TUE B;  3ABL B;  3OMN B;  2WAM A;  1M1K W;  3AG2 B;  1S5H C;  2X0L A;  2JJ1 G;  4RUF A;  4WF9 V;  4PA9 A;  4P2Z A;  1M56 B;  4OXS A;  3EFF K;  2Q68 A;  2W6I G;  1SRY A;  4PDR A;  2QA4 V;  5H9C A;  1VQ7 V;  5IDJ A;  4ZBM A;  2WLL B;  1KC8 W;  2PI4 A;  3SPJ A;  4MTO A;  3SYA A;  3SJQ C;  2K1E A;  3ZMU A;  1K4C C;  2JEX A;  4P9P A;  2DYR B;  1K92 A;  2WLI B;  2WLJ A;  5CMU A;  1GK9 A;  2KB1 A;  1AJN A;  1QBZ A;  2JIZ G;  2LFR A;  3ML0 A;  1DLB A;  2LFS A;  2WLL A;  3SYC A;  2R9R B;  4KUM A;  1V55 C;  1DTO A;  5J9P C;  3OFN G;  1VQM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...