3HPQA

Crystal structure of wild-type adenylate kinase from e. coli, in complex with ap5a
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational modulation of conformational fluctuations in adenylate kinase reveals a local unfolding mechanism for allostery and functional adaptation in proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 76
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hpqA00
3X2SA 3AKYA 4DRZA 3B1WA 2ZJ5A 4NMMA 3QJYA 4M21A 4UXJA 3DKPA 4Q02A 4X8OA 1RFLA 3H2YA 3ZGXA 5H8WA 1OHHA 3G5UA 2PBRA 1E9CA 1KI6B 1OXUA 2GJSA 2PMKA 2IYXA 1N6OA 3SJCA 5HKKA 4A36A 4NTZA 3MMPA 4XTCS 2Z43A 2VHCA 1II0A 1HTWA 4DDUA 1NBMA 1LS1A 4FINA 2GF9A 3A1TA 1J8MF 1P75A 1Z0AA 4ZDWA 4QJ3A 4D80A 1OH8A 4B71A 2V6IA 3NBFA 1JQLB 2J9RA 2XZLA 2A9KA 3PR1A 4EFLA 1X8JA 1IOZA 2QTHA 2Z4RA 4PFSA 3SN6A 4HZUA 2WWXA 1KK3A 3GQBA 4BFTA 3JZMA 5AUPB 1OFUX 2BEKA 3LWNA 1NBME 5JHGB 2NO1A 1VIAA 4EPTA 4BZPA 5JLJA 1VCIA 3JVVA 1CLUA 1W0JD 1ANKA 5C1BA 1ZNXA 4YMUA 3EZ9A 4ZDKA 3MWYW 1PLKA 5KTYA 3CX8A 3ZVNA 5EZ5A 4TL7A 5FI0B 1AQUA 4DXAA 3I8XA 1YZTA 1QHIA 4G0NA 5EJEA 2BJVA 3AVPA 1KTVA 1BS1A 2WKPA 2XTMA 3QBTA 1E4YA 3FHTA 2ZAMA 4CZ2A 2NTYC 5EP2A 2V1XA 2JJ1A 1XNJA 2A5GA 4Q5IA 2O8DA 1KI8A 1H8EA 2QE7A 4YMVA 4TZ6A 2NZJA 3GFPA 5G40A 4LYAA 1QHSA 5L8VA 1E2NA 5DYIA 2HCJB 3ZZUA 3GJ4A 3I32A 4W9MC 1T3LA 2IXGA 4CEJB 2O8EB 1SXJC 1N6KA 5J4YA 1R5BA 3AVYA 3FDIA 4Z1MA 2ZYWX 4LJ4A 4N3NA 1P2SA 1WXQA 5L3VA 3CUEF 1AZTA 1G5PA 2WWYA 2CL6X 3PCRB 3ZVMA 1KIMA 2JJ2A 4I1SA 4YONB 3B8HA 3C7KA 4LBYA 3SYNA 2BKUA 3IQWA 2GZHA 1NVXQ 4RD1A 4OL0A 3LVQE 2J5XA 1ZC4A 1S1CA 3LAWA 3RWMB 3X1ZA 2I1VB 3HPRA 3FYHA 1OFHA 1N6HA 2W58A 5IDVA 3ZD7A 5JHHB 3DDCA 4L8GA 1HQCA 2EFEB 2FJUA 4NKRA 1CXZA 1COWA 1HUQA 2QRNA 5JZVA 4HLDA 3KXIA 1GSIA 4V03A 2WOJA 4LZZA 3O8DA 4LJ9A 2DYKA 1TF5A 3M0EA 3OE7D 4JJKA 1OXXK 1YHNA 1VPLA 2AD1A 2XAUA 3LLMA 2XNDD 4HAZA 3SZRA 4C0SA 1K6MA 2FN4A 3AF2A 2PX3A 4OQLA 1U94A 1R0WA 3LLUA 3TSZA 5AUNB 2QPOA 1R6BX 4JKYA 5DYGA 2RCNA 3DHWC 2RGCA 4NCJA 2C77A 1YE8A 1VYUA 4X8HA 3TE6A 2Q3MA 1L4UA 2BBOA 2ZREA 2VL7A 2FEOA 3AF0A 2GXQA 1N0WA 1TQDA 3RRZA 5FI1B 5TY0A 1XBTA 2GJ8A 5TXGA 5AJYA 4DCTA 2QAGC 2XB4A 1W5TA 2JJ1D 3P1JA 2DFLA 1V43A 3THXB 1W48A 2YNMA 5AWFC 2CHVA 1W47A 4PAMA 4EDHA 2GAOA 2GEDA 4WXRA 2UZ3A 5EXXA 5JSZA 1QG2A 5KHOC 3IILA 1FW6A 5CK4A 5BW8A 3C16C 3VR6A 3QEOA 3MCAA 2X77A 3Q72A 3U6BA 2ZJBA 3QXJA 3W6PA 3MRSA 1CULC 2BM1A 2PLFA 2ZUDA 3NBYC 1XCPA 1E9DA 1UKVY 1Z6TA 2BBSA 4DBLC 3GJ5A 5FOTA 2NO9A 1LTQA 4RD4A 4A82A 1FTSA 3TUZC 3CM0A 3PUWA 3BGWA 4IOMA 2QGNA 3NTUA 4LGMA 2P6NA 1G16A 2F1JA 3X1YA 1A82A 4GNKA 3WNDA 3I61A 1EG7A 1SVKA 1XTJA 1NIJA 2HF8A 5EXTA 4EJSB 2AWNA 1M6NA 2QMHA 1A1VA 3R7WA 2KWIA 1NG1A 1SHZA 1P9RA 3QE0A 3HDTA 3REFA 1HE1C 2C2HA 2ZSBA 5C4MA 1E1RD 5C2JB 2XXAB 1QF9A 4Q4JB 3QVVA 5TV2A 3ZJYA 1F48A 2YOHA 1SVMA 3D31A 3K1JA 4IXNA 4GRAA 721PA 2ZRIA 4EQ6B 4JJZA 2J0UA 2WJVA 4MGIR 2QMOA 4KLNA 5FOXA 4AYWA 2H5EA 3NXSA 4AKGA 1CR1A 5DI3B 2JLWA 5CITA 3GFTA 5LD2C 1U0LA 2PEYA 1U90A 2VSXA 3SI7A 1Z06A 4PSKA 4BLQA 5FTNA 2CEAA 5IF9A 2G0NA 2RAPA 2E1RA 1N2CE 4PHFA 2QTVB 4Q00A 1NVWQ 4JLBA 4WIAA 3VNVA 1COWD 5J4HA 2O8BB 4Q4HA 2RH5A 2PMDA 2VH5R 3BH7A 3VKGA 4JLVA 3ONWA 2ZRKA 4BPBA 3NDPA 5CYPA 2BIFA 3F3YA 1Q57A 4C0LA 1T0HB 821PA 2XTNA 3BWDD 1IJEA 1P9NA 1N0UA 4UXHA 1S9HA 2GDJA 4ZIRB 2ZR9A 3A4NA 5FL7D 4MRNA 4Y0VA 2CHQA 3AF1A 2VIIA 2HV8A 1ONBA 1P2VA 3QF4A 4Q9HA 4DSNA 2VSOA 2GK7A 3OEEA 4C4PA 3ADKA 3BC1A 4R2HA 2BWJA 2A5JA 1YRAA 3CWZA 2C96A 5EUQB 2FH5B 2WJYA 3ZIAD 2PZEA 3RRYA 3KJIA 4QC2A 2IL1A 3DKVA 4A8JB 4BFWA 1XPUA 2A5DA 4US1R 3C5CA 1ZU5A 3UKDA 4UNSA 4XOIA 4NZYA 4CRWB 2CNWA 2R6FA 2F6RA 2ZU0C 4WZ6A 2ZTSA 4P32A 1G3RA 1U8YA 3K0CA 4EFMA 2FGKA 2V6JA 2G1JA 4G5SA 4YMTA 3PEVA 1M34E 1XEXA 2OCAA 5KPDA 2O8FB 3GMTA 2VF8A 3EWAA 3SBEA 3TUIC 2QMUA 3BJIC 2BMDA 1XMSA 1US8B 2WMOB 2IS4A 2XZOA 3KUCA 5D3QA 3B60A 1E94E 4QXAA 2PCLA 3TR0A 1OYYA 2ODWA 5JMTA 1TQ4A 1W0KA 1MO3A 3H4MA 3TH5A 1N5IA 1ZM9A 1GWNA 4KHZA 2IW3A 2BEJA 2ZSEA 3SQXA 3Q7PA 1XEFA 3RSLA 4Y0AA 5KSZA 1G3MA 3C8UA 1K5GA 5DH9A 1VIYA 4KFTA 5CJPA 1DEKA 1DAEA 4D82A 1R0ZA 4I81A 2IYUA 4Q1CA 4NYIQ 2RGNC 2Q3HA 1Z07A 3LVRE 2JDID 1OSNA 1D2EA 2H17A 5FH9A 1G4UR 3IHWA 4QBIA 4A0FA 2FFAA 1OHHD 5FPTA 3X1XA 1E69A 3B7GA 1C1YA 1UFQA 2V9PA 4M1YA 4RKFA 5J5CA 1KJWA 3SHWA 2OBNA 2OAQ1 1KAOA 2IWHA 4Q9IA 3E5HA 4FMDF 4Q1BA 5LD2B 3THWB 4KU4A 1Q0UA 1CJKC 2V55B 1XZQA 3QY0A 5DN6A 3TQCA 2CMKA 4MGYR 3N70A 3I73A 3IIJA 1RYFA 2ZJAA 4DWJA 2A7QA 4IEEA 1EX6A 4M0LA 3B1VA 4DHEA 3GCGA 5JEEA 3IEVA 3AP1A 1J90A 1E9EA 1GKIA 4DLZA 3EPLA 1E1QA 2ZE6A 3EC1A 4LV6A 4NCIA 3TK1A 3GLGE 1US8A 2AFHE 4TYPA 2O8DB 1QHHB 5HR5A 1E2LA 4AIIA 2N1BA 2ZRJA 3A1UA 2VP9A 2NZ8A 1N6LA 3QKRA 3FMIA 4TLEA 1E9AA 2NQ2C 4Q9KA 5L3QA 4CEIA 1JEEA 2WM9B 5IHPA 1XPRA 2ZS7A 4TMWA 3HYTA 1E0JA 3CH5A 3SJAA 4ACAA 1E0KA 2VEDA 4KODA 1ZVQA 3OZXA 4URWR 1Q21A 2QU8A 1Q1EA 1TL7C 3OIWA 4Z8XA 2HF9A 2IX3A 3B13B 4POAA 3OF5A 5FUYA 2YWGA 3GLIB 1YQTA 4B6FA 3RDPA 4I1OA 2OLJA 3U44A 3GLIE 1U0JA 1W46A 4JBXA 2OESA 1G6HA 2XEXA 4HAXA 3OEHD 3AKDA 1J2JA 3WYGA 2PLRA 2R8RA 3FB4A 2HJVA 3HU3A 2CHGA 1TADA 4PC2A 4EAQA 1DELA 2V7QA 1E9BA 3AM1A 2B8TA 1XDBA 1Z0JA 3WY9A 5KDLA 3ICEA 4G5OA 5J4VA 4U02A 1JPNA 3E2IA 1OLOA 4MUAA 2Z0MA 2D7DA 4GMDA 2ZSDA 5JWOA 3UWOA 5JRZA 3AV0B 4B3BA 1NY5A 2GCNA 3AH8A 4M1OA 4ZV4A 4O25A 2VRWA 4TLAA 4G5QA 4PXAA 2PJRA 1I2DA 3FVQA 1AS2A 3PG5A 4LV8B 4QBGB 2YYZA 3T61A 2J1LA 2OBMA 5DI3A 3A4LA 4S2EA 4E5UA 1E6CA 2V8OA 4GPTA 3EPHA 3WP1B 1QHHA 4BFXA 1G41A 3NIBA 4OK3A 3WMEA 4B43A 1WMSA 1T3SA 3CRRA 3GLFE 1CF4A 1II8A 3IIKA 1JR3E 5ANRB 1KDRA 3FGNA 3QQ5A 2CE7A 2ZRNA 2R62A 4EKDA 2HT1A 3LRPA 1DPFA 1BKDR 1ZD8A 1TF7A 1BOFA 1XRJA 4MKHA 2J45A 2G9NA 3U2QA 1U9IA 4Q1DA 1II8B 3F8TA 3I92A 4XJXA 1XD2B 1A7JA 1F2TA 2O5VA 1G8YA 4PC1A 4P0TA 4Z8YA 1JXOA 5FPSA 3THXA 1L4YA 1G8HA 1P73A 2ZSFA 3WNBA 5SZJA 2QAGA 4DLSA 4AKHA 2ZXUA 5BYKA 1GITA 1R8QA 1SZPA 2QBYA 2O8CA 2IHYA 4KVAA 4Q19A 4LPKA 4TLBA 2B21A 2GXSA 3EZ6A 3WP0A 4JVSB 2YWHA 4L9WA 4DLUA 1OIWA 4B3FX 2GAAA 3EPJA 5DLQC 1QRAA 5LBIA 1NLYA 4PANA 5KOYA 5CK5A 2IXFA 1I4LD 2B6HA 1G6OA 1RRFA 1XJCA 1Z47A 3CH4B 2RHDA 4Q18A 6Q21A 2DWOA 2X19A 4JZKA 4TQAA 2QNRA 5FTLA 3RS2A 4XTRA 1E3MA 4GMXA 4CW7A 4LBVA 1MRNA 1WRBA 5KSYA 2YJTD 5BN4A 3WMGA 3OIUA 3LBIA 4Q4HB 1ZIPA 4TL8A 1M1YE 2CBZA 5FUWA 1YZNA 5G3ZA 3F0TA 3LA6A 1X1RA 1I2MA 1NL3A 2JATA 3U5ZB 3B6EA 3Q5EA 4GDFA 2OSBA 3RVBA 1GRQA 3TJZA 2DFTA 1RZ3A 1U99A 2D4HA 2Q9AA 5KSPA 1W36B 4I99A 5DHAA 5JS8A 4FMCF 5BN3A 3HJNA 5E7IA 4G5GA 1VYTA 1ZM4A 4FWTA 2FZ4A 1ZRHA 4CF7A 4EPVA 1Q20A 1OH6A 4QM7A 3GJ7A 2AL7A 1DVRA 1GNQA 3TAUA 3PENA 5CDFE 1Q12A 3CRVA 3D7MA 3CONA 5EXSA 3U60B 1E0AA 1QG4A 2CVFA 1GKYA 2ZVQX 2WVJA 3RLFA 5AJZA 1D9ZA 2AFIE 4HB2A 2P65A 4H9GA 3SBDA 4EIWA 1OFIA 4BECA 5BQ5A 2FWRA 5FUVA 2J7PA 2XOKD 2IXEA 3EA0A 2ZI5A 4KBFA 2DCUA 3KXKA 2W2VA 1JJ7A 1KYIA 4BLRA 3QXHA 3LFUA 4YMWA 3X1DA 3H84A 4RVCA 1KI7A 2OZEA 3CPJB 1DO2A 2IK8A 3PUYA 5GJCA 3P32A 5JJIA 3MAAC 2NG1A 1KMHA 1XMVA 2CNWD 2O0KA 2ODEA 2XSZD 1AA9A 4UQOA 3CF0A 3TUJC 3GLFB 1O87A 3QXSA 3I62A 3CNLA 4OK5A 3QOFA 4EPWA 4HATA 4YC7A 2ZRDA 3B85A 2AD5A 3QPUA 3G82C 3BBPA 1GFIA 4KVGA 2QAJA 3T15A 3SJZA 1D5CA 2OV2A 1T5IA 3BORA 4JLDA 4NL4H 4W7SA 1E9RA 2P2LA 4EFNA 5FBQB 1W36C 4D25A 4Q03A 1N3BA 1E1QD 1R5NA 3FMFA 2CE2X 2AN9A 3PEWA 4WW0A 3K70D 4C9BA 1S0UA 4EPXA 1CIPA 4PPFA 2XTZA 2BDTA 2J0VA 5FL3A 4Q1AA 2GZDA 1GL6A 3AVQA 4US2R 4JVLA 1WB9A 1G7CA 2IYSA 3KUDA 3SHFA 2C9OA 5JJKA 2YOFA 3AKCA 2WTUA 4P31A 4MDFA 1ZC3A 1KO8A 2R9VA 3AVVA 1CR0A 2JA1A 2WWGA 1SXJE 2W83A 1NN5A 3BB1A 2D74A 2XZPA 1FL9A 3DMDA 2B92A 5FOVA 3Q3JB 2G1KA 3KL4A 3CPEA 3BFXA 3IO5A 2ZRCA 1NKSA 4TLCA 3O47A 3TRFA 3MJHA 1FP6A 4B32A 5BN5A 1ZM2A 2VP0A 3LW7A 4PO9A 5SZKB 3E70C 2B8WA 3NDBB 1YZQA 2BCGY 2GNOA 4B3GA 4PAOA 4A0HA 5AK0A 421PA 4B33A 3KQLA 1M8PA 2YC2C 4A6XA 3R8FA 2X2EA 1PJRA 4DLRA 2QORA 2RMKA 1T6NA 2QP3A 1AGPA 2OHFA 3AB3A 3IIMA 4D26A 2CK3A 3U7HB 1A2KC 1JQJC 1HEIA 4F4JA 4GI7A 4L15A 3QKRB 3IO3A 4BFUA 3IGFA 3AVUA 3PVSA 4AWXA 4XWKA 1KKMA 1FQJA 1YZUA 1JB1A 4QG7A 4TYNA 1UAAA 4IDNA 3PUZA 1FQKA 3HU1A 4IEIA 4P3YA 1IN8A 3ICQB 5HZKA 1XTSA 5H68A 4MRRA 3QENA 4FMDB 2IC5A 1G5TA 4HDQB 2WWWA 5JCZA 3UG7A 1IM2A 2JJ8A 3DPUA 5FBLB 4H1UA 3LD9A 3MLEA 1QHXA 1GL9B 2JGNA 2HUPA 4KITB 1OB2A 4IDQA 4D81A 4AKIA 1NKTA 2WKRA 3KQUA 1GAJA 2OXCA 5B30A 3PXGA 4DT1A 1FP7A 1G8PA 1G7SA 2WPDD 4UNPA 4CEHA 1KSHA 1BH2A 1T91A 2JLZA 4JBWA 3BOSA 4PC6A 2IYVA 3RS0A 1QHYA 3V9PA 4TL6A 4KYUA 3SU8A 3AVOA 2ZRMA 1EWQA 2R6AA 3IDQA 3TBKA 1ZM7A 2ONKA 1S3SA 2YVUA 3ADBA 2MMGA 5JJLA 1NMYA 2F43A 3U3RA 2V7QD 1T0JB 3Q5DA 4OHWA 2YV5A 1CJUC 3WYAA 4A0GA 2IS1A 1CU1A 3FKSA 3K53A 3K09A 4OJQA 2PCJA 3O8BA 4FCTA 1ZNWA 5EZ6B 1KI6A 1IXSB 3VKHA 2IUTA 1E2PA 1YR7A 1Z08A 2NIPA 4KFRA 3HU2A 4KFUA 3R20A 3SOPA 3EIQA 1XMJA 1LV7A 3Q7QA 2ZUBA 4N0DA 4L9SA 2NO6A 1JPJA 1L7VC 3AGPA 1G1MA 5EE9A 1AM4D 3WXMA 2D06A 2QENA 3SE0A 2ONJA 4DIDA 4M2LA 3BFVA 1NIPA 3FMOB 1NRJB 3BH6A 4ZCMA 4AURA 2GK6A 1I4TD 4BUJA 1RVDA 1HURA 4CYMA 1NMXA 2C98A 4NYMQ 1UADA 4M53A 3WBJA 1JR6A 5G3YA 2FPLA 3RS5A 4IFEA 5JECA 5FPHA 3PJRA 1SXJD 2BJWA 4LCBA 1G7TA 1S1MA 1R8SA 4LHVA 4Q7MB 3WBKA 4A2QA 3RANA 4IDPA 5FPYA 4BFZA 2QT0A 2G6BA 3NH6A 5F9FA 5GADl 4C2UA 5FBWB 2E9SA 3W34A 3FKSD 2MMCA 3ND9A 4URVR 2RGAA 4KI0A 4DDTA 2CCGA 3H1TA 1WBBA 2VHTA 1VCMA 2H57A 1TPZA 2VPPA 1XEWX 3BRWD 5J4LA 2P6UA 1E96A 3ZZ0A 1NLFA 2BMEA 3U7FB 3VR3A 2F3TA 2D2EA 3SFVA 1PLJA 1F6BA 4XSHA 4HB4A 4V0LA 3ADDA 3RS3A 2W6IA 4DLVA 2BM0A 2F43B 3CIOA 4A9AA 3V4RA 4ITRC 4MITA 2QEQA 1Q3TA 1IAQA 3BE4A 1G20E 5JI3E 5ELXA 2KSQA 1OW3B 1VTKA 3I72A 2J7PD 2XOKA 4IRUB 1ZD1A 5BWMA 3AQ4A 3I4LA 3CPHA 3V4FA 1CBUA 5IT5A 1P72A 1OIXA 1NSFA 1ZJ6A 2VHQA 4V0OA 2GVZC 3I3SR 4EQ6A 2DPXA 2Q21A 2ORVA 3VX3A 3K9GA 3QG5A 3IBYA 4Z54A 5TDHA 2ZVPX 1GM5A 3KFXA 3KX2A 4O3MA 2F3RA 4B74A 1KDOA 4DZZA 1LF0A 1UEJA 4MYTA 3NHAA 2AWOA 4HDCA 3B78A 2G0TA 5JSZB 1YZLA 1EGAA 1EFUA 2AHOA 5DN6D 1Z6XA 3A4MA 1JALA 1DS6A 2ATXA 4LJ7A 4P4UA 2Q0HA 1E2EA 2CLCX 3CB4A 4JLJA 4LBZA 2BV3A 3LX8A 4LPSA 3DOFA 1KO7A 1CJMA 4E22A 3RS4A 2O8CB 5EXPA 2EFCB 5HPYB 3P4XA 2C95A 5A5GA 3FHOA 1YU9A 2WBLC 2P5TB 4O0MA 5J40A 4TYQA 3TMKA 2R44A 5C4GB 3KB1A 1OXVA 4GOJA 5E4FA 1ESNA 1BYUA 1G3UA 2J3EA 1VG1A 2G3YA 5F2EA 5JI2E 4Q21A 3UMFA 1YRBA 3CNNA 1U8ZA 3FKQA 4MYCA 2WAXA 1PV4A 2JASA 1ELOA 1XD9A 3HWSA 4M8NE 3I5YA 4HLQB 2FFBA 1GRNA 5K8LA 3PIRA 2HYIC 3CRQA 4DJTA 2DBYA 1HT2E 3RYTC 2GZAA 3U6KA 3J81k 4M9QA 2TMKA 1YR8A 4FD2A 4OQFA 4IHQA 2OM2A 2GA8A 4G01B 3TIFA 1KOFA 3QKTA 4IVRA 4DDWA 2H1LA 3K9NA 4US0R 2FF7A 1CKEA 1U9IC 1DG1G 5SZHB 3QG1A 2A5YB 1R2QA 1GDDA 2KJQA 2W0MA 3BIFA 4B2LA 3W8RA 4JL8A 2ZROA 1MABA 4D4JA 5M04A 2NGRA 3EX7C 4M4SA 2XX3A 4B6EA 2MSCB 3CBQA 5LDDC 3HPQA 3BXZA 3EXAA 5TVKA 1NI3A 1GKUB 1TU3A 4B75A 1OF1A 1E79D 4URZR 4XSGA 3ASZA 4URXR 1VG9B 2J7KA 2OCBA 1DAIA 4HDOB 1UEIA 1SQ5A 4Q66C 1XXHB 3CF6R 2EYUA 2PL3A 3T1OA 2RGBA 4JSYA 2ZYTX 3ZD6A 4II7A 5KYKA 2FSFA 2OCYC 4BLPA 3ADCA 3LDAA 1F2UB 2OXRA 4M1TA 5E3HA 1IHUA 1G21E 4ZPXA 3ZS8A 4XVQA 1GZSA 3FFBA 4QHTA 5EE1A 2IYRA 2DWQA 5FUXA 3W6NA 2X8AA 4Q1EA 1DADA 2HEIA 3X1WA 2C9YA 3KKMA 4EJSA 1JI0A 1OYWA 3WNCA 5HZHA 3KB2A 3GEHA 5DNYB 1W5SA 3KKPA 4C30A 3CW2A 1KAGA 4NYMR 2QN6A 1W1WA 4TN1A 1GNRA 1ZNYA 3GLHA 4JBYA 3SEAA 5KUTA 1P61B 3TVDA 1SVOA 4P4SB 3MWKA 4F93B 4HLUC 2SHKA 1XPOA 4C7OA 4V0ME 2J0UB 4DUGA 3LBNA 1F3OA 2YZ2A 4LYFA 2AR7A 3SS8A 4D4KA 2H92A 4K46A 3DMNA 2BOVA 2ZETA 3BERA 2R6GA 1KSGA 4CT5A 1KO4A 1IXZA 3ZIAA 2FFQA 1XD8A 4QHSA 4E07A 5KU1A 3GLGA 1JR3D 2EW1A 4B34A 221PA 3AUYA 4V0KA 4AI6A 4RZ3A 5KNCA 1UDWA 4NONA 1G64A 1DBSA 3U44B 2IUSA 3T1VA 4B3XA 4GL2A 1MT0A 2A5FA 5DIFA 2ZJOA 2ZI4A 4PZZA 4DCNA 5AJXA 4AYXA 4TMXA 2J87A 3U3MA 1XXHA 4ABYA 5DI9A 4RD6A 4QKQA 3QF4B 1KK0A 3O8RA 2CK3D 4F7WA 1G4AE 3KTAA 5HCNA 2FFHA 3CR7A 2RGDA 2ASEA 4LOAA 4U5XA 5B57C 3VNUA 2Z4SA 2I3BA 1AKEA 2FMXA 2GEVA 1XB2A 4HEJA 1XTRA 1EWRA 2DHRA 2RGEA 4A8JA 2ZI7A 1Q1BA 5FTKA 1N5KA 4A2WA 4BFVA 4C2TA 1WCV1 1Z83A 4QBHA 1OH5A 1CJVC 1M7BA 5J4KA 1YR6A 3SQWA 1AS0A 4WXPA 2O52A 3LV8A 4M9XA 1FTNA 1NVVQ 3OAAA 4LSGA 1U2RA 1DO0A 4QJ5A 1KI4A 1GILA 4AC9A 1IY2A 1LFDB 2EFHB 2ZYUX 3C4JA 4IW3B 2WKQA 4KJZA 4HZUB 3Q9LA 5FOWA 1HA3A 2FGJA 1U8AA 4LV5B 3R9XA 1DG3A 2OE2A 3GP8A 3G0HA 4C7OB 4QNRA 2JCSA 3C14C 4Q7LA 4LRWA 2RGNA 4GFDA 3BB3A 2AK3A 4PQRA 1EX7A 1F2TB 3RRNA 3K0SA 4O2RA 1ZM3A 4LC0A 1AN0A 1XTIA 5GVSA 4QGAA 2QT1A 2IBMA 1P4SA 2W0SA 2GCOB 3DZDA 3T34A 1RRGA 4F91B 3VKWA 2QSYA 1E2GA 4N1AA 3W8NA 1VHTA 4RKEA 2FV8A 1GOTA 3TLXA 1NG9A 4JLKA 4NCHA 4DC9A 5F98A 4DT1B 3A58B 1IQPA 3OEHA 3B82A 2WSSA 1CEEA 3GJ3A 1S3GA 1YZKA 2DFNA 3EAQA 3WHLA 4KXFB 2V54A 4DLTA 3WRYC 3NH9A 2EWWA 2VO1A 4UNRA 1PVOA 4MDEA 3IUYA 3KFVA 3VHXA 4BE7B 4ILEA 3M4YA 3AKEA 4JS0A 2PX0A 3NHBA 1N6RA 2K5UA 1RRCA 2ZSAA 1E1RA 3T12A 1KO1A 1FX0B 3VU9B 2IF0A 2OUKA 3PUXA 3FPAA 3NBZC 2ZUCA 4Q4JA 1B23P 2ZJ8A 4BLOA 3AF4A 3DVLA 4PO8A 4RZXA 4FMBB 5FL7A 2GJAA 2W2TA 4UXIA 3W5IA 4B3CA 4XVUA 1C9KA 1UBFA 4TT3D 4DIEA 1RYHA 4QL3A 4JLNA 2PT5A 4DEYA 1OFTA 4OI2A 1CR2A 3VTKA 4D0LB 1KI3A 1P6XA 2GKSA 1Q22A 2FU5C 2NOAA 3CF2A 2KBEA 1TQ6A 2QMEA 4H1VA 4WZBE 1HYQA 4DSUA 4RFSB 3GJ6A 1P3JA 3KDSE 1P62B 4HUQA 1W0KD 1XZPA 2QG6A 4MYUA 2O0JA 1J70A 1KDPA 4Z51A 621PA 4DCSA 1CJTC 3CZPA 2H8KA 3P4YA 3KQKA 3E1SA 3ETLA 1AIPA 4F92B 5B2ZA 2IS6A 4QHYA 4IOLA 1M74A 2ZS9A 4HYYA 1L2TA 1F60A 2L0XA 2ZR0A 4Q4AB 5EP1A 2GCOA 1G3IA 2WZQA 1ZYUA 4JKIA 3CZQA 1TEVA 1H8HD 2CCJA 4RZ2A 4DLWA 1PUJA 3OAAD 3HR7A 2JLSA 2IT1A 5DO9A 4L5BA 4LJ8A 2ZRGA 4NE2A 3RC8A 1VECA 2WJIA 1XJ0A 4MKIA 4OHZA 1XX6A 5LB4A 3UATA 4MRVA 1Z28A 2BKEA 1H8ED 2NO7A 2QE7D 3MD0A 1T8TA 2WSSD 1NJGA 2XNDA 2NMVA 5BXQC 4L16A 3TGPA 2ZJ2A 4NCNA 3BS4A 5F3WB 4JLAA 3NBXX 4I4LA 1Q44A 4C0BA 2GHIA 3KKQA 1Z3IX 2D3WA 4GOKA 3K0EA 4HB3A 5AJWA 3HYRA 1KO5A 1RKBA 2WWFA 3LY5A 4FW9A 4C0JA 5DGXA 4XD7D 3UMRA 2EQBA 2GWHA 4LX0A 3M1IA 2VSFA 2JLXA 1KI1A 3TNFA 1AKYA 3FWYA 4NP6A 1SULA 1ZIOA 3O8CA 5EE3A 1EESA 4FN5A 3EZ7A 2ECKA 3IEUA 4MUBA 3HP1A 3GJ8A 3GJ0A 3B9QA 1T8UA 4FI3C 5L3SA 1KGDA 4KSBA 5TMPA 1DTSA 3R8CA 1E2KA 2OBLA 1AK2A 1SKQA 2CXXA 4PQYA 2QM8A 1EFRD 3A1VA 4B2PA 1E32A 3EPKA 1YJ5A 2CJWB 4XH9B 1DAFA 3AGQA 2RKOA 1RRPA 1TMKA 4OI0A 3QVUA 2HYDA 4PHGA 1MO5A 5TARA 1D6JA 1W4CA 4C0HA 1W49A 4QM6A 2QA5A 1G17A 4P33A 5DSZA 3MSXA 3WYFA 4DCUA 2QQ0A 2VP4A 1XF9A 4A2PA 1NNEA 4PTLA 3QNUA 1P9WA 2G77B 4Q7JB 4DCVA 1FZQA 2YOGA 4A15A 1E0SA 3OE7A 4B3DA 1FMLA 2ATVA 2GEUA 3QKUA 4BWYA 2I1QA 3SNHA 3CNOA 4LK2A 3U61B 1JBKA 1W2GA 3BH0A 5D3MB 4GP6A 4JSTA 4TMTA 2AKAB 2XJ9A 2ZANA 3TSOA 2VQSA 3GD7A 2IYZA 2QP9X 1WBDA 1HE8B 3GEIA 1PUIA 3L0PA 1DAGA 3MJRA 1KDTA 2W6ID 3GFOA 2C04A 5AR1A 1FUUA 3DL0A 2R6DA 1DARA 5EE0A 1KMQA 1NMZA 4R71A 1JXMA 2OFXA 4NYIR 4QRHA 1UPTA 4D4MA 3CWQA 2IF2A 2J0SA 1BMFA 1D9XA 4KV9A 4DLYA 4P4SA 3B9PA 3FE2A 2Q3FA 1ZBDA 2ZRAA 3I5XA 4A8JC 4B2IA 3L2OB 3A8TA 1FFHA 3K70C 5HKKD 4LJAA 3UG6A 1ODFA 3VR4A 3L0SA 1G9XA 1Z2AA 4DUGD 1KJZA 5CB8A 3ZDQA 2O0HA 5GJVC 1KK2A 4K81B 1GIAA 5KNDA 1AZSC 1IONA 1RE0A 1I4DD 5CDFA 5AUQA 3T06B 4AD8A 4KLZA 2WMNB 4MKFA 1SVSA 2GILA 2WSMA 1SVWA 3A1SA 1XMIA 3EASA 4GOXA 2BMJA 2WV9A 4TTRA 1WP9A 5CIWA 5HCIA 4R98A 3EG5A 4ZO4A 2DWPA 1Q1QA 4YDSA 4U00A 1MO6A 1MRSA 3SC3A 4F38A 3OESA 1E4VA 4PC3A 5KDDA 1VCNA 2BBWA 1ZAKA 4IOKA 2GXUA 5E7JA 5IRCD 1Z0IA 5DE3A 1N6IA 4JVNA 2QZ4A 1L8QA 5H1YA 4MYHA 2J0QA 3AVXA 3RAPR 2GJ9A 5CLLA 3LBHA 2YWFA 2I4IA 3EARA 4GT1A 1ZD9A 4LYHA 3D3QA 1NBMD 1KKLA 1KY3A 1VDZA 1ZCBA 1R10A 1G7RA 1UJ2A 3S1AA 1D2MA 1Z22A 2FNAA 2PEZA 1G8GA 3QXCA 1T4GA 2REBA 1IN4A 2OFOA 2X1VA 2ZR7A 3KTAB 4BASA 3GEEA 3U7GA 3THWA 4LJ5A 1CP2A 4BFYA 4AG6A 4Z1MD 3MGCA 4ARZB 2UKDA 4PX9A 2EU8A 4JYBA 4LHWA 4NCKA 4EJSC 3U3KA 121PA 2OG2A 3ZH9B 2ANBA 3P20A 4JLMA 5TB5A 3ZLJA 1U81A 3OIYA 3VR2A 1KSFX 2BCJQ 4HUQB 3TR5A 1IBRA 4IKEA 4LJYA 4YXWA 3AF3A 3ZVRA 3U4QA 1S8FA 4IFBA 1Z8FA 1R7RA 4NYJR 4RJLA 4RSGA 1SVIA 1OB5A 1UBCA 4OQMA 4PSVA 1Z0FA 3W9YA 2OLKA 1OV4A 2LKDA 3PQCA 1W0JA 4HZIA 1Q3HA 3PFIA 1RJ9A 4IJMA 4S35A 2DY1A 1VCOA 3VR5A 1XTQA 4MH0R 3DM5A 4OBEA 2ZE8A 2JAQA 1UDXA 2JEOA 5HTKA 4RZUA 3I8SA 2ZPTX 2F9MA 1T5LA 2ERYA 3ND8A 2J46A 4E03A 3MWJA 1D8TA 1SVLA 2YC4C 4WVFA 2UZIR 4C0AC 4QNMA 1N0VC 2W2XA 1FMJA 4MA4A 2REOA 4PSAA 1ZMXA 1E2JA 1WA5A 4TMKA 5E7MA 1W36D 1KNXA 2IYYA 5A0FA 3TKLA 5EP4A 1B0UA 3QI2A 3VU9A 3ZQ6A 4HSEA 1MO4A 2FG5A 1WE2A 3W5JA 4ZDJA 2JIZD 5FBVB 3PEUA 5GVRA 2RHMA 2ZI6A 1VG8A 5EUMA 1FX0A 1QDEA 2ODNA 5H70A 2C5LA 2XNSA 3ASYA 2NPFA 2H7VA 3V00A 1OT3A 5CM8B 4ZI3A 5KPJA 1SKYE 1EFCA 4LHZA 2EFDB 4JL5A 2JIZA 2WJGA 4UKDA 2MSDB 1XU4A 2IHBA 1OJLA 3C5HA 4RD0A 3T35A 4DEXA 4PR0A 2O8BA 2GF0A 3L0OA 2ZU6A 4KYIB 1SXJA 3EIHA 5JBQA 1X1SA 1KK1A 1C4OA 2ZJZA 4FIDA 2VF7A 2ZYVX 3LQRA 3IQXA 1CTQA 3SDZA 4ASUD 2OILA 4BZQA 3RWOA 1HH4A 5B58C 3K70B 2GTPA 4BQSA 1SXJB 1JR3A 4W5JA 1S96A 3K8YA 1ESMA 2ZRFA 2QBYB 4G5RA 1ZCAA 4OQXA 4UJ3A 3IHLA 5G53C 1Q1ZA 5EE5B 5JCPA 1X3SA 2IUUA 1K8RA 5AUOB 4ZDIA 1BIFA 3BD9A 4V02A 2VYFA 1O3YA 2Z5FA 2FOLA 4LY6A 2C9CA 1W4BA 5AJVB 2CVHA 4C0QC 4A4DA 1OH7A 1HY3A 4EUNA 5G41A 1KZGB 2DB3A 1X86B 1P60A 2GETA 2B7BA 2WICA 2ZQ5A 4M1KA 3T5DA 1G19A 3ECCA 4AK9A 2ODBA 3WHKA 1CRPA 3U3OA 3K0AB 4OQNA 4PPGA 3A36A 5HE9A 3WMFA 3ZZTA 4F4CA 1EFRA 4PQFA 3QSYA 2QUZA 2QL6A 2A2ZA 1JJVA 3EWSA 3QIAA 3SJBA 2WIAA 2JLYA 1VYVA 5JRJA 4CEHB 2QY9A 1Z63A 1E2FA 4E09A 4HLCA 1G291 1YKSA 1Y63A 4HAWA 2AXNA 4IVPA 2ZS8A 3VHLB 3TVTA 1LS6A 2LWIA 2CJWA 1E2DA 3IPYA 1TTTA 4TMVA 4B48A 1VMAA 5FFMA 4AY2A 4IVQA 2V1UA 3SYLA 1T3HA 3EZFA 5FPKA 4QGFA 4M1SA 3MG9A 2J41A 3CRW1 1Z5ZA 4QFMA 3NVAA 2FSHA 2H18A 2ZRLA 1DOAA 5JFGA 4PPQA 2FEMA 2HLDD 2WWIA 3CLVA 5F9HA 5BYJA 4TYYA 3LO5A 2C78A 2JLUA 5GJBA 4UNNA 1ZP6A 2BBTA 3KJEA 2VLIA 5DHFA 3NEYA 4PZLA 5CB6A 1KI9A 3K0FB 2ZEJA 3NKVA 2IEZA 1ZUNB 4X8MA 3THYB 1GG2A 3LW8A 3DOEA 4LWZA 1HQYE 3TSWA 3EZ2A 1R5OA 4TSFA 2FX3A 1OXSC 1E2HA 2DFKB 1DAHA 1U98A 3BAFA 3ZVLA 1OKKD 4LBWA 5D3MA 1WDTA 4KFSA 1XEWY 2GCPA 3QKSA 1FNMA 1HV8A 2QPAA 3JVUA 4KBGA 4NBSA 1TU4A 1LF5A 1HT1E 2W6JA 4UNQA 4W5HA 3S1AB 4Q47A 1NVVR 1W44A 2QM7A 3C41J 2XB2A 2GESA 1QVAA 1E99A 4BZXA 2X2FA 4K8OA 1XP8A 3F5FA 1KHTA 4QJ4A 3UANA 2W6JD 2HXYA 4M1MA 3EA5A 3OHMA 1XXHE 4ZCIA 1E2QA 1UF9A 4IDOA 1F5NA 3UWKA 4FWIB 4JL6A 2JJ2D 1LVGA 5UKDA 4GZMA 5L3QB 3N5CA 2DR3A 2JDIA 4CEIB 1XEXB 4OJKA 3NC0C 5E95A 3W3ZB 2ZM5A 2XXAA 3AUXA 1MV5A 4WAUA 2RGXA 4B35A 2CDNA 2BC9A 5DISB 1YR9A 4HI0E 4NHOA 1EFTA 2ZIAA 1FOEB 1TEXA 1WF3A 4NU0A 3TW4A 1UM8A 2J59A 3BFKA 4G1UC 4YLGA 1G5RA 1BO6A 3KJGA 5GJWC 5EQTA 2HLDA 3A6PC 3D8BA 4WBSA 3DO6A 3FOZA 4Q9LA 1XWIA 3QXXA 5K8UA 2QROA 4CVNA 2P6RA 3THOA 3MWLA 3OFNA 1MABB 2JLVA 4RFVA 1M7HA 5FR1A 3KKOA 2VP2A 2QRZA 2VA8A 5JS7A 1E9FA 4FXPA 3QBVA 1IY1A 2P3SA 3GLHE 4DVGA 2Q9CA 4U7DA 2W00A 4Q1FA 3T5GA 2R65A 3Q8XB 4QGGA 3VFDA 2GJKA 3CX7A 5KSOA 2PJZA 2Z6VA 3QPWA 2B7CA 2OT3B 1A5TA 1S4QA 3THYA 1W4AA 1EK0A 3VMFA 2MSEB 4HLUA 2AXPA 2FA9A 2RB4A 3QUSA 2ZJYA 3QF7A 4DB4A 2GXAA 2F1RA 2RGGA 4ARZA 5FOSA 1TX4B 2YKGA 3TAHA 1OPXA 4L4UA 3A1WA 1E79A 1X6VA 1CRQA 2PT7A 3MUFA 2ZRBA 3N2EA 521PA 2F9LA 1G3QA 1GTVA 4MQBA 3AVWA 1QHNA 3LXRA 4D4LA 1TUIA 3W3AA 5P21A 2IS2A 4TTPA 1KI2A 2ZI9A 3RABA 1NP6A 4ACBA 1JEDA 1EFHA 3TQFA 1UBEA 2IWRA 3H86A 3U7EB 4TYWA 2G88A 3GLIA 1WQ1R 4CGZA 2EVWX 3GPLA 4TT3A 2BHRA 4MGKR 1ZW6A 2H16A 2V4ZA 3FFAA 4HAVA 4LI0A 4PPNA 1RW4A 1XD2A 2FSGA 4NH0A 2GVDC 4HAYA 4D0GA 1RJ9B 2O8EA 8OHMA 2R6CA 1J7KA 3K9LA 1XFAA 2XSZA 2PH1A 1E2MA 1YVDA 2ZITA 3IPXA 1RIFA 4PC7A 4KAXA 4PZYA 3K9HA 4NPHA 5FTMA 3I1FA 4PHTA 3SYKA 4J0QA 5J47A 5K8IA 2CLSA 1W7AA 4TTQA 1NN0A 3GJXC 4IOJA 3DEFA 3SR0A 1DAMA 5CM9C 3UIEA 2KI5A 2IYWA 2WPDA 4ERNA 1VG0B 4JLOA 3VX4A 1QBKC 2ORIA 4OI4A 4YMSA 4ZKDA 4XIGS 4RD2A 3KKNA 4ESHA 2WIBA 3CRMA 2GBLA 2QQEA 4X8LA 5FTJA 2HDNB 3VQTA 2QI9C 4LYJA 3L8YA 4ASUA 3FHCB 2P67A 1GUAA 2ZI3A 5CIQA 4OYHA 4CT4B 4CDGA 4ZCLA 4R7ZA 5SZIA 4LC1A 3KQHA 5CYOA 3RNLA 4PAQA 1QHGA 1Z0DA 2XGJA 5JWRA 1IXRC 3KXLA 1N5LA 4JT4A 5EP3A 2IYQA 4TZ0A 4IXMA 3M6AA 1YZGA 3UK6A 5C18A 1N5JA 1II9A 1X8KA 1Z6GA 1R4AA 4FCVA 1E2IA 4BGDA 1ZUIA 1FPMA 3OEED 2CLDX 2AX4A 1E9SA 3CX6A 1NVUQ 1XJQA 4YDHB 3CKLA 3PUVA 2E87A 4XVRA 1CS4C 4XWOA 4RFSA 1MH1A 2IYLD 5FOUA 3NC1C 1UKEA 1BYIA 3AP3A 4FCWA 2C99A 2ZE7A 3FTQA 4RCZA 2KB0A 3BK7A 1AS3A 4RY2A 4DDVA 1J99A 2A78A 1AJEA 5LB2A 1NJFA 3T1TA 1J8YF 1P2UA 3P27A 4A6PA 1JECA 4C3ZA 4OHVA 4BRWA 1N6NA 2QPTA 3NWJA 4M9ZA 3U4QB 3T1QA 4DSOA 4CEJA 2F7SA 2R2AA 2AK2A 4G3XA 4V0NA 3B2EA 2WJHA 4DB2A 1KZ7B 2QAGB 4KO8A 3UMSA 3AVTA 2C8VA 3R9WA 1A4RA 4JIMA 4TL9A 4AKEA 2FZLA 3C15C 1H65A 1KSJA 1S9DA 2BVNA 2G83A 2PZGA 2HJGA 1Z2CA 1PZNA 2OCPA 2FE4A 1XTKA 2FSIA 2LCFA 3LXXA 4M1WA 1NSTA 1H8HA 3EIEA 4PO1A 1P7CA 1N25A 4WOPA 2Q6TA 3VAAA 4LHXA 1NN1A 3A37A 3CR8A 2HCBA 1JAHA 1X8LA 1DE0A 3D6TB 2IA5A 4YXWD 1FNNA 5KNBA 1JAIA 4MRPA 3LH5A 5L3SB 1LY1A 2XITA 2ZE5A 1IN5A 3LQQA 1ZU4A 4YQFA 2EWVA 2KE5A 4C0KA 4QBFA 3B5JA 4TSFD 2HT6A 3B1ZA 2VHUA 4TMZA 4BEBA 1A2BA 2VP5A 2BMFA 4ESVA 3DM9B 3B1XA 3NEJA 3RS7A 2AKYA 3WRXC 5C46F 1W2HA 4O2LA 4TQ9A 1VHLA 4TQUS 4XWAA 2VP6A 1LB1B 1MOZA 3BB4A 4KSCA 1BMFD 1EXMA 4JMPA 3PV0A 4Q4LA 4PHHA 2Z83A 1SGWA 1GP2A 1IN7A 2ANCA 2D7CA 4BLSA 4BRUA 2F1HA 4V0MA 2CL7X 2P5SA 4ZKEA 2QTFA 1LNZA 3QPVA 1IN6A 3K0FA 2D2FA 4IDHA 5CLQA 4BLTA 3U3JA 1RC8A 1TF2A 3HR8A 3KZ1E 3QKSB 4B76A 2Y8EA 4QOSA 4LUCA 1GNPA 5LPNA 2ZAOA 3Q85A 1UBGA 2EFGA 3ZS9A 4QGHA 4GP7A 4GZLA 5FR2A 3VR1A 1OXTA 2EYQA 4JYCA 3W90A 3IKJA 4N0EA 5B64A 1M2OB 4WA7A 1ZNZA 2V3CC 1ZUHA 3R7WB 3H0KA 4LHYA 5A4JA 4EPRA 4R2IA 5HE8A 3SFZA 3AP2A 4W5WA 1QVRA 1M7GA 1W4RA 4KCGA 3L0IB 2ZRHA 1KY2A 4AG5A 1CR4A 1TNDA 2N46A 2WAYA 1XCMA 2QSZA 4GSYA 2IYTA 2YINC 1SHKA 3PITA 1T9HA 2KBFA 1R0YA 2O8FA 2YHSA 3RSOA 2GBLC 3K0AA 1P2TA 5FBRB 2LKCA 2FDCA 1G18A 4EPYA 4B44A 1RPZA 1R0XA 4D0NA 1XCGB 2WOOA 3LX5A 4LDJA 5IK2A 2QP4A 4NYJQ 2C03A 4A1FA 2ERXA 2VBCA 1MKYA 1NN3A 4FMCB 3REGA 4URYR 1KJYA 1UKZA 3AEZA 1Z29A 4MKGA 3RC3A 4HUTA 5K8TA 3OFND 2D62A 4LJ6A 4CIDA 1FUKA 3ZQJA 1MR3F 2VHJA 1K5DA 4RCYA 4I1VA 4JT2A 4D6PA 5IK2D 2UVQA 3GLGB 4HB0A 1GRRA 1V5WA 2FPKA 3RHFA 2XJ4A 5CJ2A 4DSTA 4B47A 1AQYA 3JZAA 2NPIA 1G8FA 1TQ2A 2F1IA 2YWEA 1D2NA 4I1UA 2P0EA 5JWHA 1Y3AA 4JLPA 1P5ZB 3EW9A 1IY0A 1IJFA 4XD7A 2F55A 3W6OA 4M22A 4A92A 5L3RA 3EC2A 4D2IA 2JLRA 4AYTA 2CL0X 1F2UA 4Q4AA 3L8ZA 1KNQA 4M9SA 3OIVA 4OHXA 4DKXA 1OIVA 1GVNB 4WZAE 4ZIRA 2QGZA 2JLQA 3R9IA 5KDOA 1VKJA 2IEYA 3CO5A 3RRMA 1N6PA 2OO7A 3IBGA 4JVMA 4ON9A 1JNYA 3MFYA 1NF3A 2WJJA 4OK6A 2FPMA 1OE0A 2VTKA 3UXMA 3L43A 1NY6A 2ORWA 1E98A 2OEPA 1TUEA 4URUR 4A0RA 4RD3A 2ZRPA 4OI1A 3N2IA 2WHXA 3GLHB 3P26A 4TLDA 4MRSA 4HAUA 2Q9BA 1KMHB 4TWZA 1SKYB 3UPUA 2REXB 4R9UC 3B1YA 4F4IA 1Z0KA 3GLFA 1TAGA 2PZFA 1DAKA 4Q9JA 2GRJA 1UKYA 2N42A 3K09C 4Q01A 4OKSA 3TW8B 1Z6YA 1NLZA 4NDZA 3ZYCA 3QEJA 4BFSA 1QZXA 4GBMA 2CCKA 3KJHA 3L82B 1Z6AA 3K0CC 4UJ5A 5JEDA 5KO2A 3LNCA 3KQNA 1S2MA 4BEJA 1U0HC 3NG1A 4B73A 3DZ8A 4MGZR 3FMPB 4P4TA 1AGRA 4Q48A 2HXSA 1ETUA 2A30A 2OFWA 4Q7KA 3PEYA 2WWHA 1GL7A 4OHYA 4ZI2A 2NO0A 1OKKA 2OAP1 4DLXA 1PLLA 1LW7A 1ZINA 2A3RA
chains in the Genus database with same CATH superfamily
2HCTA 3HDQA 3U7QA 3X2SA 4C78A 3FBWA 2ZJ5A 4G56A 1P4AA 4YMIA 1WX1A 1QE3A 4ZP1A 3EEYA 4P08A 2JGEA 3NV9A 1YOVB 4AWBA 1PGOA 2ODPA 4IWYA 4Q02A 4X8OA 5IEBA 1SBHA 3H2YA 5H8WA 1Y8QB 3LGSA 1PZFA 5H3HA 4BVLA 2WUVA 4A36A 4TS1A 3Q7EA 5AI5A 1AX9A 3WZLA 2I1WA 3ZGZA 3HRKA 3NNNA 3P2IA 2Z43A 3JAKB 5HK8A 3NO4A 4FS8A 3SG0A 3MCUA 1CUZA 5EUBA 4ZDWA 5IABA 3CZMA 2O7NA 4D80A 3O75A 2X6RA 4B71A 3GRKA 1ULSA 3NBFA 1SKUA 2XZLA 2FLWA 2A9KA 3PR1A 4EFLA 3I37X 4GUDA 1IOZA 2QTHA 1QFZA 3AQIA 1IIRA 3SN6A 5E4TA 1PJSA 1BHO1 5FPQA 4RIHA 2Z8YM 1NBME 3V1UA 3L7IA 5ADUS 5JLJA 1WMEA 1RQ7A 2OBYA 1P6UA 2PWPA 3B6IA 2DBVO 4MVXA 4P34A 2P9EA 5EMLA 4YMUA 3B51X 3NOOA 2KPOA 4WXMA 4QDTA 2Q8QA 3ZVNA 2VUHB 3VZSA 4MICA 3NHLA 4TL7A 1PFYA 3R09A 1DEOA 4Q39A 3WDMA 5ITZB 1AQUA 3MHTA 4WFIA 2QG4A 4I6GA 4DXAA 1WUTA 2DUNA 1Y4ZA 2PANA 3Q3HA 3AVPA 1I1QB 2SECE 1E4YA 4KPFC 3U4DA 4MDYA 2SNIE 3FHTA 4IJVA 5EP2A 2Q5QA 4A03A 1ULHA 5BVGA 9LDBA 1O57A 2O8DA 3W2HA 2BKAA 1QG0A 5DTMA 1H8EA 2VLBA 2NZJA 4RANA 1R4NA 4DCPA 2M98A 3GFPA 3KV1A 2V7EA 4MMZB 1AE1A 4QQKA 1E2NA 1XDWA 2VNJA 3ZZUA 5CX4A 3B5EA 3G9XA 1HLFA 5KCZA 2HMAA 4IEFB 5D5PA 1SXJC 1N6KA 1R5BA 4RENA 4Z1MA 1UJNA 3I2JA 4XOUA 1RHJA 4GX0A 1WXQA 4LY3A 5L3VA 4H16A 4O08A 4IS2A 3EYWA 4ADSG 3TR6A 3WGUA 2WWYA 1NUTA 3V97A 1VLVA 5HKBA 1M2OA 3CEHA 2G63A 1RCUA 2CL6X 2XR1A 3H75A 4N7JA 1P1JA 3G2PA 4S12A 5HKLA 3ZVMA 2VOJA 4I1SA 1EFLA 2G1UA 3C7KA 4KOAA 4YONB 3RFTA 1VCHA 1NVXQ 4RD1A 2RJOA 2D1YA 2AW5A 5DJ5A 3QFHA 3P0JA 4KYVA 3C48A 1ZC4A 1S1CA 4FWBA 1K7YA 3LY9A 1ZH6A 1XN1A 4RL6A 2CJPA 1SXIA 2BI4A 2HQSA 4XM0A 1N6HA 2J3DA 3TLKA 2DH5A 5EZYB 1CVRA 2D00A 2X58A 3AESA 1V3QE 2EF0A 2EFEB 4PSUA 3CUUA 1COWA 2QRNA 3KPVA 3KPWA 4OLJA 3KXIA 4B7UA 3FCCA 1GSIA 3ILYA 3IVMA 5EIOA 4DMCA 2DYKA 3M0EA 3ER9A 3AESB 3FF4A 3OE7D 4FFDA 4ZJPA 4JJKA 2OCGA 2AD1A 4OBWA 1ISFA 4LISA 4OYYA 4EGFA 1K6MA 2SBTA 1KFEB 1RC0A 1U94A 3EFBA 1PJCA 1EINA 5BN4B 3DBRA 5AUNB 1R6BX 5DYGA 2FVXA 2XNHA 5JZSA 1BQ4A 2FG6C 4TV8A 3SZ3A 4M46A 5C8VA 3BQMB 1FE8A 1S2GA 2XYRA 4DCCA 1UBKS 5FO1A 1VYUA 1NJ1A 3C98A 3TE6A 1L4UA 4LVUA 1VMIA 1NWCA 2ZREA 2DJ5A 4LDRA 3VV3A 1JLRA 1BVYF 2FEOA 1YMQA 2VL7A 3AF0A 4ZEOA 3DWFA 1N0WA 2AHRA 2W8BB 4Z3DA 4DABA 1A9XB 1YDHA 2HA4A 1RQRA 2PTHA 2QN7A 3P9RA 2GJ8A 4MDHA 5AK6A 2QAGC 2XQFA 3AHDA 3RT1A 2DFLA 3IEXA 1W48A 3GVPA 2CHVA 3W5SA 3H5OA 1IPFA 1I5EA 1H2HA 1ZOLA 2HHJA 2P9HA 2FPIA 2CJXA 2UZ3A 4HH1A 5DPMA 4WTOA 5A4KA 4AO7A 1DO8A 4C7BA 5BW8A 4PIMA 2NYAA 3A4VA 3QEOA 2V9CA 4OX9Y 2ZJBA 2AE2A 5B58T 4C1BA 4G8CA 1WCIA 3MRSA 3M2PA 2WUWE 2BM1A 2ZUDA 2O2ZA 2VDRB 3LWBA 2XUHA 3MT8A 2BBSA 1P0FA 3FDJA 4L7QA 2M6LA 3ZXSA 2V98A 4KOEC 4EW1A 1IPHA 1GPMA 2Y3IA 4LDQA 5EXEA 2C1EA 4MB2A 5H5JA 4ZFNA 1FTSA 3TUZC 4H7DA 3CYFA 3RAJA 2INGX 2P6OA 3BGWA 3NTUA 3O95A 2F1JA 5DX1A 3X1YA 1A82A 3WNDA 5C5CA 2MYNA 4CQMB 5CB4B 4U2EA 2BFEB 5JCOA 1ZSYA 1TB4A 2QMHA 2QOEA 4K7JA 1DX6A 1HRKA 3SZOA 1A1VA 2KWIA 3H42B 1P9RA 1PEDA 4PW0A 1BEZA 2OXTA 2G06A 1HE1C 2D8MA 5I7SA 1E1RD 4NE7A 4JY7A 2ZPAA 2R7KA 3EIOA 4ZJUA 2V7WA 3NAMA 5JANA 1QF9A 4Q4JB 1KZHA 1O8CA 1ODTC 4UUNA 3RU2A 3ZJYA 2WF5A 2VZEA 2HMVA 4QTYA 1LC0A 3T7JA 5J2TB 2C5HA 2ZRIA 3N2LA 4BNDA 2H5EA 3FCUB 4AKGA 5LBTA 1H22A 4YRBA 3ELUA 3VYRB 3ZU6A 5LD2C 4IHKA 1MGOA 4X3CA 2PEYA 2AQHA 3FFXA 1Z06A 2FEKA 4KPYA 4P35A 4L8YA 4AY3A 4CG0A 3TG2A 2G0NA 4FC6A 5LU8A 2J3IA 3MJ4A 1BN6A 1N2CE 1WXDA 3OM0A 2O0LA 4Q00A 4JLBA 3IP9A 1COWD 1Z73A 3ZLUA 3DL7A 2O8BB 3RBAA 2UXCB 4Q4HA 2V4UA 4GQBA 3LQKA 5ECYA 4TUYA 1KQPA 1E1KA 4KACA 1OLXB 4X64B 9ABPA 4RJ2A 1FBTA 5DT9A 4D96A 2A3NA 1S2LA 4OVKA 4YS6A 5F2OA 3T4EA 3NDPA 2BIFA 1Y6RA 4FHZA 4DBVO 4O6VA 1NZFA 2FX2A 3DULA 1BGXT 3E3AA 3NEAA 3VNSA 2GDJA 5ALFA 5EJ2A 3A4NA 4GR4A 2AMVA 3OLXA 3LL4A 2C0CA 1FNCA 1R66A 3A6FA 3VR6D 3I09A 5AKIA 1ZWKA 3QBDA 4XR9A 1T5TA 3ECAA 1ULAA 3B38A 5H02A 5NULA 2QW0X 3ABZA 1CUXA 3QVGB 7REQA 2Z3WA 2B69A 2BWJA 2A5JA 3KT8A 3DWEX 1DQRA 1YRAA 4YRJA 1ZH2A 2C96A 3BTUA 5EUQB 4WBNB 3OOWA 1WV1A 3ZIAD 2PZEA 2AGVA 1XQVA 4P8RA 3JARA 3R4CA 4OHMA 3M7IA 4JUAA 1JB9A 3RRYA 3V6MA 4QC2A 1JYSA 2NU6B 4ZALA 3FOFC 1D09A 1N8TA 1ZU5A 2PUFA 5AJTA 4B0PA 2CFIA 2ZU0C 3PXUA 3QH4A 4OF4A 1T36A 5BNZA 1YRLA 3G89A 4P7FA 1U8YA 4JLSA 4UM5A 3C3JA 3KLNA 4HQLA 2G1JA 4GPAA 3K1YA 3PL1A 3PEVA 4YMTA 1PR5A 3NRBA 5KQPA 4E3ZA 1TZJA 4GI1A 3DT6A 1I7PA 2VF8A 3EWAA 2R47A 3SBEA 2O8FB 1Q0HA 2QMUA 4LXTA 1VKHA 1T2UA 5K3FA 4TV9B 1RQLA 1IHOA 1KDVA 3LHKA 2UYHA 2B20A 5ALXA 1XYVA 2H2IA 4UUPA 1EVJA 3IV6A 2VUTA 1E94E 2PCLA 2YJGA 1X13A 5E3JA 1W0KA 2E82A 2PGAA 5G0UA 3TH5A 5TIIA 2CUZA 1N5IA 2ZUSA 4DOMA 3QEBZ 1CYDA 5U4QA 2IW3A 2BEJA 2R1TA 3T4XA 3A70A 2WF6A 4I4TF 4PYJA 4JLWA 3K92A 1A5BB 3ITKA 4PCUA 5H7XA 3TQSA 4QE3A 3AJAA 3A6KA 4MWDA 3HA5A 1G3MA 1SWWA 3ADPA 4WOBA 3OQMA 4FIZA 1ISIA 3AX6A 3CG4A 1DEKA 2RHCA 1P5RA 2B4AA 2JNWA 4I81A 4KLRA 3G5AA 1Y8CA 2O8NA 4WFJA 3TN7A 4D9BA 1HE2A 4NYIQ 5EKSA 5K9ZA 5C5EA 5KVAA 4W5RA 4UMEA 4MZDA 1J25A 1YSCA 3IHWA 3LSYA 4CIYA 2VDWB 4A0FA 1TCVA 4LI3X 4MVJI 1G5FA 3UWDA 5E6UB 3LTNC 2FVYA 1UFQA 4NI5A 4RKFA 3SQOA 3KVVA 3SHWA 3N2GB 2HRDA 2OAQ1 1AXGA 2XBMA 2FZKA 1JLLA 2IWHA 4Q9IA 4Q1BA 1K08A 3B6MA 3PHLA 4C5CA 1U1DA 5JZ9A 1GQ2A 1B73A 4MMXB 1G38A 2O2SA 1TJ5A 3PQ3A 3TQOA 4GE0A 1R6VA 1V25A 4M76B 3N70A 1QB7A 3I73A 5AIBA 1GFWA 1RYFA 2RK4A 3IIJA 3JAWA 3D8SA 4L3OA 4QUKA 4JEIA 3TTTA 5HF6A 2F3PA 5GOZA 4YV2A 1JIUA 1NBWB 3I39X 3SDSA 4X90A 5IT0A 2C83A 3R9XB 4WN9B 1Y82A 3IEVA 5BSVA 3AP1A 4IWXA 4D99A 4DQVA 1E9EA 3WBBA 1C7IA 4OLFA 1MFZA 3UAOA 4LV6A 4K1LA 1UBSB 1US8A 4FOPA 1PZXA 3A6EA 4IUCS 4TYPA 5DLDA 1E2LA 3UTDA 4AIIA 5HR5A 2VP9A 5GAJA 3FMIA 4ZCSA 1BKYA 4B73A 3PEEA 4QT4A 4IXWA 5LQSA 3LGAA 1J24A 4DV1B 3GRRA 1TPYA 2VYNA 2PXHA 2XMZA 2CLKB 3DB2A 3GAZA 1UBRS 1D7AA 1YRHA 3HYTA 4PYMA 3SJAA 3X1MA 4D9JA 5ALIA 1JHAA 1LK0A 1Z4NA 2IQ5A 5K1ZA 2VEDA 4JOBA 1E5XA 3JR7A 2FDRA 3OZXA 1Q21A 4O2BF 5KYGA 1TL7C 5IAAA 4KI7A 2IX3A 2CVZA 2YQZA 1UJ4A 4POAA 4DLNA 5FWNA 3Q8LA 2YWGA 2EXXA 3MZ0A 3GLIB 3UJ7A 2YX1A 4B6QA 5KWVA 4JXXA 1M8FA 3WGVA 4UE3S 2BUBA 5CFLA 3H2IA 4JBXA 4GVLA 2XUZA 3EQ7A 3JVDA 4UHJA 2OESA 5BV2P 1G6HA 3AEXA 4WUTA 1FFEA 4LOKA 5DTRA 2BR5A 4ZMSA 1MHTA 1N5OX 1NF9A 2R8RA 3GLUA 2HJVA 3RVKA 2B78A 2CHGA 3D6MA 3HU3A 2CNKA 3IP6A 2Q5OA 2OYRA 1O4VA 1Y8QA 1E9BA 2G7MC 2B8TA 3AM1A 5CNJA 3WY9A 5KDLA 1P5FA 3LO8A 1CY1A 4RV4A 5ICFA 3KYBA 4LXQA 1JV2B 1W2WB 4MUAA 5CURA 1KE2A 2V7GA 2Z0MA 4KUEA 4YUAA 1IQUA 2ZSDA 4H31A 1ZGZA 1XLVA 4UHBA 3TXXA 1FNBA 3HDGA 5JRZA 3LZ6A 3AV0B 3ZJUA 2GCNA 2JD1A 3AH8A 4F11A 1V8FA 3E3LA 2VRWA 2OHVA 2YJ5A 1ZGBA 3EVAA 4JELA 1U5CA 1FLVA 3LHSA 4XQEA 2EEZA 3HS3A 3MEQA 5KHAA 4BO3A 5CBPA 2AMFA 1WQ4A 2BGUA 2PBLA 3Q5GA 1DSSG 4IQFA 4N8EA 4YAGA 4LV8B 5BUSA 1G5IA 2J1LA 3K1TA 3L8FA 2OBMA 3ZHCA 1W85A 5T4FA 1Z4QA 3HCWA 4S2EA 4CMKA 2O1SA 3GFSA 3JQ6A 2CWWA 5EZSA 2SCUB 3QE2A 1PGJA 2R7MA 3HEMA 4D8UA 1G41A 3SPXA 3TE7A 2P27A 5G0TA 3OT1B 3ZXYA 2NT4A 2CT8A 2FRDC 5A9RA 3SAJA 1CY0A 1II8A 3DA8A 4LZOA 1J2UA 1KDRA 2X9GA 2XE6A 3FGNA 4M60A 4ZVQA 3VH4A 3IR5A 1D6MA 3LRPA 2ON6A 1TF7A 1DT5A 3W5UA 4PYLA 2DGDA 3U2QA 2CNBA 1U9IA 4XJXA 1EB9A 1F2TA 3U7JA 1UT5A 1F4PA 3O03A 4UOEA 1Q15A 5D5HA 4PR3A 3MM4A 2W2KA 4ZWNA 4FX2A 4Q9NA 4FGUA 3V55A 2R11A 1P73A 1UKAA 1ENYA 2FPXA 4OB6A 1CUJA 1U2QA 2W9XA 4LEIA 4DLSA 1D2AA 4BNZA 4LRXA 5JC1A 3RVNA 3GZTB 4QYIA 3E9ZA 1N3YA 5REQB 4IL5A 2GF2A 3BZUA 2OD7A 2B21A 4TLBA 1SC1A 5C7YA 4FNMA 4RABA 3VZRA 1P45A 2J30A 1ZISA 1I6LA 1FRQA 1P8AA 3CVWA 4YAIA 3QVXA 2XGMA 4KVZA 1KJIA 4MWGA 4PANA 4B3SB 1VE6A 2B6HA 3B20A 5SY9A 8ADHA 2XYQA 2PR2A 3RIMA 2WJPA 3PX7A 2O5RA 3IQZA 3QNWA 4G4GA 4OQ4A 4DGQA 2HRRA 4L5JA 4RIGA 2IV7A 3M34A 5AQEA 1CLEA 4TQAA 4HX9A 4A5OA 4F9GA 2QNRA 4PTZA 1EQUA 2PO5A 1IAVA 1FYVA 1KC3A 2H1RA 1MBZA 2P9BA 4XTRA 1E3MA 5FA8A 3PFGA 2PFGA 1WHSA 1WCYA 2H2AA 3I64A 1MB4A 4HRXA 3DJYA 4TKUB 3GK3A 1EUCB 2N47A 1L7DA 5B1IA 4CW7A 2DHQA 3A14A 3OX3A 5KSYA 3OLZA 4EB6B 1GYRA 2GEBA 4KQKA 2YJTD 4CKXA 4BEWA 5BN4A 3LBIA 4FI3F 3JTMA 2AOVA 3QA3E 2AG1A 3I4CA 3LA6A 5C1DA 4EG4A 4ZGWA 1C9YA 5HRCA 3RSFA 3R4VA 4G97A 3U5ZB 1K3TA 3RO7A 1I7NA 5K2OA 1GGJA 5LL6P 3A3YA 3OICA 1KBQA 5C52B 1IZ9A 3PDIB 5DHAA 3GI1A 1EWTA 3P0RA 1RKUA 5BN3A 1T9KA 3FDXA 5K51A 4LWQA 1WXEA 5J5AA 5E7IA 3EF3A 4G5GA 5EPOA 4AX8A 2GEKA 4QM7A 4LECA 1L7PA 1M34A 1UPFA 3ZGOA 1UXHA 4FLMA 5HUHA 3PENA 4F8JA 5F76A 1IZZA 3CRVA 3N2GA 4TVOA 2WVJA 2C7OA 5BN5B 1D9ZA 2AFIE 2PJDA 4HB2A 4IRMA 3KYDA 4H9GA 4ZXPA 4B3TB 3G02A 1OFIA 1PR3A 3MQ2A 4OUDA 2FWRA 5FUVA 4XQGA 3ZU4A 4D9IA 3EA0A 3KQPA 1F8XA 2AC7A 3V7NA 2GBFA 2XDAA 1X1AA 5I8WA 3LFUA 2PUVA 5B1SA 4MQLA 2P9ZA 1LLFA 1IM5A 3PUYA 5GJCA 4DR6B 5DVZA 4EAAA 4O4JF 2FZVA 3N58A 4M7RA 4OJTA 2CNWD 1PJTA 1PW7A 4TKMA 4ZOEA 3WHPA 5ITVA 3GLFB 2DFPA 1O87A 1D1PA 2ZM6B 4B8ZA 1AMUA 4Q4CA 1IEQA 4HGRA 4NFSA 3VHRA 1EVIA 4Y2PA 3ENQA 4HS9A 1T1RA 3C8HA 4M38A 5LJLA 3R5TA 3G82C 3BBPA 2FPUA 1GFIA 1NYLA 2W98A 2OAGA 1XO1A 4TPKA 1REQA 2X8JB 3PNQA 4MIEA 5KU7A 3CZ9A 5FBQB 2XUPA 3P0HA 3EQ9A 3F4KA 1N3BA 4P93A 3UMMA 1MHPA 1D4FA 3DE2X 3LC0A 2EF1A 3DMFA 4JEMA 3K70D 3H19A 4ZK6A 2IITA 5I9BA 3ZY3A 3A6HA 3LE8A 3CEJA 4O4IA 2O1EA 2BDTA 1TMOA 4XUCA 5FL3A 4Q1AA 1OZAA 2GZDA 5C3MA 1UPAA 2D5BA 4AO6A 2IEGA 1G7CA 1S2NA 4HDAA 4EW2A 4UDXX 2Q7DA 3UOWA 1E6LA 2C9OA 3ZZMA 1BVUA 2BTOA 4CDMA 3CXUA 1NUSA 2JA1A 4XB1A 1AKRA 2WWGA 3O8LA 4JBNA 1SXJE 3L84A 2QY6A 3RGWS 3WI7A 1L7XA 1OROA 1X7WB 2UAGA 2ZBFA 4K0KB 3EGOA 4O2BB 1WB6A 2C2ZA 1P33A 2W5UA 2PVCA 4FQ5A 3A1EA 3KVNA 3N8HA 5FOVA 4HTFB 4LF8B 1FMFA 1Q0SA 5IJ0B 3KL4A 4JQOA 3QU2A 2ZRCA 4YRKA 2BEWB 1OI3A 4OBXA 2Y0PA 2QXUA 5CVUA 2AKEA 2ZIEA 3O47A 4TSRA 3RAGA 3TRFA 4D57A 2I22A 4O2BA 3IAS6 4B32A 2WQZA 1I2AA 3PX2A 1TOAA 1R0RE 4LQ4A 4QD3A 3ZZNA 2HHHB 1EM8A 1HG1A 1XI2A 1YZQA 2CUTA 2GNOA 3UM9A 4U2FA 4AF6A 4RTQA 3DO8A 4IHJA 2V3VA 3E9QA 2QORA 4M54A 1T6NA 2QP3A 1AGPA 1O97D 3BGDA 1KEUA 4MS4B 2CK3A 1XN4A 4RMHA 5CFZA 4G4SP 1A2KC 1JQJC 5IAGA 2ZAIA 3AR7A 2WLSA 4LXXA 2B8JA 3PVSA 2CDRA 4C4AA 1GQSA 1KKMA 1P0QA 1U5BB 2NU7B 1YL5A 2YR0A 3D8NA 5EVJA 3EMDA 2JLYA 3ICPA 3TDMA 4QFBA 3P52A 2VUIB 2UVPA 3C3DA 3GDWA 4G85A 3ICQB 3H8JA 1XXLA 1H6CA 1X7GA 2VWPA 3F1LA 1JVNA 3R3XA 2PS3A 3HWX1 4EZEA 2DT5A 4ZHQB 5AI9A 5JAOA 4UFPA 1OLUA 1I3KA 2W6ZA 4MGEA 3OT1A 1G5TA 1FDOA 2VP3A 5TQ2B 2WWWA 3VKVA 2O2JA 1PD1A 2XWBF 3UCEA 3QE9Y 2EW2A 2UVPB 1RAHA 3MINB 1NW9B 4KNWA 1ZHHA 4AJHA 3FTEA 3LD9A 3IDAA 3MLEA 3HCOA 4MQFB 4XKJA 4Z0NA 1QHXA 1GL9B 4J4TA 3E9DA 1XKTA 3K4HA 2WVHA 5BT9A 4IDQA 4RADA 1SBTA 2AC4A 1U7XA 2WKRA 1G8PA 1NUUA 1UOPA 2P4QA 3HWWA 3SQMA 4G0QA 4H6WA 3VUEA 3BOSA 4QDJA 5ABPA 1JG1A 1XAGA 3FMGA 3ET5A 1X19A 2ID9A 3H5RA 3QTLA 4K05A 4WZZA 2OXEA 2JRCA 3A27A 3GZNA 4HJRA 3UENA 1G20A 2Y9MB 1EH5A 1SA0B 2XWJI 4IGEA 5F78A 1T2VA 2FWBA 3PDHA 3GF4A 1UBLS 1NRXA 1BE0A 1F14A 4NATA 5JJLA 2F43A 1T2AA 3F4BA 1G98A 3U3RA 2V7QD 2BMAA 3Q5DA 1N5RA 4EZIA 1WETA 2EV9A 5ARDA 3BA6A 1CJUC 2IS1A 1OTXA 4FDUA 2IHUA 2YJ3A 5BSMA 4DR1B 1BRTA 3OMWA 2AOTB 4IWNA 1LI4A 3HB7A 4OJQA 1E7RA 5F51A 2YVAA 2BFFB 1QLHA 1TVEA 2B0JA 3VKHA 1AV7A 2NIPA 4MCAA 4QWWA 4RELA 1WKBA 1ZIYA 5F33A 4KFRA 5BR4A 3RH0A 3SHOA 2FTKE 2QTNA 1T9GR 2DRIA 2ZUBA 4L9SA 4FFVA 3EBPA 4N0DA 4ZQIA 5EAIA 3VKFA 1XGKA 1RQ2A 1DRJA 3B6ZA 5EE9A 4NK5A 2PYDA 2FW7A 1ZEJA 1F8GA 1K27A 2NTNA 4PG5A 2BFPA 5H82A 3WXMA 5F77A 5JT1A 2QENA 3I2GA 4OPMA 3UK1A 1DGQA 4MTLA 3CKYA 1GFSA 2RHWA 1Y8RB 3AL2A 3DKKA 4DIDA 4DV5B 2W2MA 4UE2A 1VJDA 5EKDA 1CUHA 2KS6A 1SD2A 5E9WA 5FRDA 1UUFA 4LDAA 4M98A 3U49A 1RCFA 5C8YA 3CV3A 1UR5A 3U62A 1KJJA 2Q5IA 1BHSA 1RVDA 1XLUA 3W8EA 4O4JA 1UADA 2BJHA 1H2WA 1YCGA 1QYCA 3WBJA 2FPLA 4BPRA 4IFEA 5K99A 2DJIA 4PNHA 2BJWA 4J7AA 4MI1A 1ADGA 2DM6A 4LJLA 4C4RA 3QYFA 5IYZF 1S1MA 4NZOA 3KJNA 4C01A 5ALRA 4RTOA 3DQQA 5FCDA 4A2QA 4HDNB 2QT0A 3P8ZA 1I80A 2G6BA 3NH6A 3H1AA 5F9FA 4P4LA 1O97C 3CX3A 1F6DA 3W34A 3ZQKA 1UBMS 4G26A 1JJIA 4J1NA 3MOIA 4URVR 2P0YA 3OTIA 2CCGA 5HF8A 3ESRA 2VHTA 2ZT5A 2H57A 2Q1YA 2VPPA 3AFIA 1XEWX 4GWLA 2JKVA 4OJMX 4PCVA 4HNSA 4S2UA 2PK3A 3DZFA 2GEFA 3UXHA 4EL0A 5AKEA 3TD6A 2O6LA 1RYDA 2D2EA 4BFXA 3SLKA 4KN5A 1YVEI 2P7IA 3DH0A 3EF1A 3LK7A 4G6ZA 4TUYF 2PMBA 3DHVA 4LDZA 3HWRA 5GONB 4L0MA 1DC7A 1YE5A 2PZAA 5T67A 1VKRA 2OPHA 5FJJA 2D4AA 1TLLA 5JI3E 3BICA 4PGHA 2EKLA 5JY1A 4BNDB 3OCUA 5HEKA 3KG2A 5AQ1A 1IWPB 3FNHA 2DH6A 4ZN6A 2O3UA 5IT5A 1CBUA 2FP3A 1GV1A 1NSFA 1U0FA 2AC2A 1W4ZA 2I9KA 2VXCA 3I3SR 1A69A 4C4TA 4EQ6A 1BDJA 1CJCA 2V7TA 2Z2ZA 1FXUA 2WYUA 3HUUA 3K9GA 1Q7TA 5AXBA 4V1CI 1JSXA 2XRFA 2BHLA 1TYEB 3KM0A 1WCWA 3MA0A 3DBLB 4RSRA 4ZO8A 4B6JA 1TIBA 1ZBQA 5TMDA 1IHYA 1OBHA 3JD4A 3PHJA 4JJAA 3QLJA 4L27A 2QX4A 4WERA 1JXAA 1UP7A 2JGDA 2RB5A 2E85A 3IUEA 3NHAA 3TNLA 5EOVA 5HYVA 1NONA 3L6RA 3OQBA 3A6ZA 3K6RA 3DAOA 1N34B 3DE3X 2VPIA 3VVMA 5JE8A 1L5WA 1Q92A 1SCUB 1PWYE 5DN6D 1U1FA 3GDOA 3KSRA 4ZQEA 4KFCA 1CY6A 5EG5A 1CZHA 4I9UA 4CMHA 3PBKA 1C1XB 1EVYA 3WTBA 4BEVA 1JALA 1G63A 2M2IA 2PX5A 1TYAE 1UH5A 4LJ7A 4EHFA 2Q0HA 1E4EB 2NVUB 2BGWA 1ZN2A 1JHQA 2D5CA 5KWJA 2XUQA 3FNQA 4QUEA 3MT9A 2BV3A 1RAEA 1XJWA 4LPSA 3DOFA 1HSOA 1I9CA 4PYNA 4AROA 1CJMA 4GZ6A 4E22A 4BX2A 3FWNA 3RS4A 4BAGA 2ZIWB 2C54A 2EFCB 4BNLA 3UGQA 4PBTA 2C95A 2WDZA 3NTOA 3IH5A 2CLMB 2F8SA 3FHOA 4ZT6A 3U4HA 2GN2A 2XGGA 4D42A 2JFZA 6AT1A 4R2KA 2R44A 5C4GB 1UC9A 1OXVA 5E4YA 3LPCA 1ESNA 5DLYA 4ZAFA 2J3EA 3KHUA 1U7TA 1RIIA 1RAFA 4RQUA 1SHTX 4IJWA 3LLVA 4JAVC 4X24A 1U8ZA 3FDFA 3FKQA 2WAXA 4MYCA 4TZTA 1PV4A 2RGWA 3W5DA 1XD9A 3HWSA 4PG7A 4NNPA 1AB5A 1U1GA 4HLQB 5GY7A 2NWQA 5A3JA 5M2QA 2HPZA 5EEHA 2F8TA 2NUPA 2HYIC 1M0SA 2HADA 5JVDB 3TNJA 1RABA 1P77A 2FLVA 4NC9A 4YP6A 3IV7A 5GM2A 5ALEA 2R5FA 1SH7A 3H4VA 4DR5B 4PRKA 3R0QA 2P3OA 2WDPA 3E7DA 3C1UA 4B46A 1UFVA 2B34A 3PS9A 3VDQA 1G2IA 1P80A 1JLHA 3I2KA 4ARAA 4I3HA 1YBMA 2XIJA 2A9QA 3P9KA 2KJQA 1R6TA 3W8RA 4HNTA 2BGNA 1MABA 4E0BA 4F7DA 4L75A 4NXNB 1QIMA 1U11A 2MSCB 3DMTA 2W6PA 2QRLA 3FSJX 3HJBA 3L18A 5K0BA 1YB4A 5TVKA 2C9DA 3GUHA 4J1TC 1E18A 3KO8A 1TU3A 1K5HA 1DX9A 4BVKA 3ANTA 4YJ2B 1PT7A 3LQYA 4ISBA 4URXR 1ORWA 5FJIA 1KAHA 3W4IA 2J7KA 5J2UB 3EDQA 2POQX 3ZJTA 1QYVA 3RHTA 1W8IA 4I55F 5FIUA 4V1CB 5EI5A 2PL3A 3V1NA 4J0HA 4JSYA 3EIFA 2PUCA 1FP1D 1EHYA 4C3UA 3ADCA 1EP3B 3LDAA 4M1TA 2OXRA 1J1ZA 1NAHA 4GP9A 3BTOA 4OGWA 3ZS8A 4NBRA 4WH0A 3SF8B 1Y1PA 1SOAA 4FE7A 4I6JA 4TT8A 3C3WA 3W6NA 2Y2VA 2ZYHA 1F0NA 2X8AA 3P9QA 4YO8A 3TTYA 3WLRA 3NATA 3N5KA 1E3DA 1OYWA 1WIWA 2AJLI 2DHDA 3HCEA 5DCYA 2PNFA 2Y1CA 1GXSB 3P9NA 1W5SA 3AEKB 3KKPA 2A67A 4C30A 4EG7A 1R9JA 1KAGA 3F6PA 1EFVB 4HO1X 3WJ7A 3CBGA 5G0SA 4LYDA 3TLYA 4BKQA 4R8KA 1CUWA 1NXOA 2H9AA 4C7OA 1U9CA 2BEUB 1UJCA 4L2IA 4C0WA 1U28A 4IV0A 3LZDA 1IVSA 4BO8A 3D6FA 1F3OA 1N2BA 2OECA 1RYEA 1KR2A 4IX9A 1GNLA 4P58A 2OZPA 3N76A 4Q93A 4UUBA 4K46A 3DMNA 2ZETA 4HN2A 4X20B 2R6GA 3O21A 2JAXA 4BS9A 2JS7A 3VZBA 2OO5A 2FFQA 4II2A 1XD8A 4L8VA 1QIFA 1XVAA 5KU1A 1VM6A 1PT8A 1QIDA 4O4HB 1YZ3A 2EW1A 1JRLA 1KY4A 4LOHA 4KV7A 1ZMBA 3VDMA 2HHLA 4B34A 4F8YA 4AWAA 2HRQA 2B7LA 3ND6A 2F62A 1DAOA 4UAJA 3IMGA 2W6CX 1VZ3A 9GPBA 1IMJA 4H35A 2IBTA 4YGXB 4CCAA 1BCSA 1WJGA 3BMNA 1GAWA 1M2VB 2BGMA 2VZ0A 4QJBA 4X41A 3TLAA 1JDZA 3VJMA 5AVZA 5AJXA 4AYXA 3BM5A 5JSKA 1ULUA 1NXXA 3PFNA 3SZUA 3U7QB 3VTZA 1XTTA 3X1KA 1S2OA 5JFOA 4FOOA 1E1LA 2WQ6A 3DNMA 1T4CB 3ZEAA 1N8NA 4AN0A 1E4OA 1XCJA 1KK0A 4PONA 4QKQA 2QLJA 3O8RA 1UJMA 3FRIA 3DTYA 3KTAA 1TT5A 2ZGVA 2CXNA 4HXEB 4JYAB 3UYLA 4F5ZA 1ZK1A 5B57C 3TZKA 4YFVA 3ZC3A 1DWQA 3W3AH 2ENWA 3D8RA 3ZHUA 4EHLA 4YB8A 2BE9A 5IH7A 2J9XB 5AFSA 3R3WA 3D4PA 4A8HA 5CX1B 2GPAA 3W9BA 4BFVA 2OOSA 1BROA 4PLWA 3DMRA 4YP7A 1M7BA 3NNDA 4ZYLA 1QGZA 3SQWA 4DA9A 1L1EA 1UBJS 1YS1X 3W06A 4ESOA 5LMCA 2WG2A 3CLKA 1BE1A 5A0TA 1DO0A 5GPBA 1KI4A 3G5LA 2ZWOA 3ELYA 1IY2A 1LFDB 2EFHB 3NGMA 4KJZA 4QQ8A 3ROGA 4AC9A 5IT4A 3Q9LA 5KNCD 3ZD9A 4LV5B 1U8AA 2HSZA 1FY2A 2DLNA 3AI2A 3CO0S 3D5EA 3CNQS 4JP1A 2I4MA 3CRNA 3HHEA 3H9BA 4QNRA 4A2CA 3QPCA 3RUCA 3BREA 4LRWA 5I9SA 4R1OA 1QF6A 2AK3A 2LD4A 1F2TB 2R1TB 3QTTA 3RRNA 3M3DA 4F3KA 2P68A 2K2WA 4O2RA 4PE5B 4CPDA 3N8GA 1AN0A 1CVIA 1XTIA 3OKPA 5CH5A 1S4MA 4LFCB 5TS2A 5KWEA 2IBMA 2J6BA 4GIBA 5TQ2A 1KS2A 2XB9A 2HHAA 1QOPB 2R1VB 3N6RA 2JC3A 2Z3VA 3T34A 4ND1A 1RRGA 2X40A 3ROMA 4F91B 4AS3A 3WLPA 4ZARA 5L3ZA 4EABA 4K6OA 4AZ0B 3W8NA 4I1IA 3WDKA 1C3OB 4H0CA 2QU7A 2HJRA 4DC9A 4IIJA 4DT1B 5F98A 1IQPA 2VTEA 3MUOA 5CCEA 2Z1NA 4K6HA 1SUEA 5IFLA 2A84A 4DCJA 2WF8A 1XSEA 2W93A 4MLPA 1ZO8A 4L4XA 4L51A 1D4AA 2PX6A 2YS6A 4IMRA 4MWCA 4UNRA 5EJ5A 3IUYA 4KH0A 1EZ4A 3LX6A 3TX2A 4BV9A 3B3AA 2XUGA 3N39C 3SM9A 4BAZA 3NHBA 4W5NA 3EOBI 2HREA 3GP5A 3IQEA 3D6VA 1QQTA 2ZSAA 1J0EA 1E1RA 1SRRA 3PLRA 1KO1A 4JDUA 1FX0B 4JR1A 3U16A 4RTRA 4N82A 4F4UA 2X0FA 4E12A 4DYVA 3T5BA 2QSUA 4WMLA 4QXOA 4XWTA 3HNOA 1ZEMA 3D0KA 4LNUB 4ND5A 3DVLA 4RZXA 2ZT6A 2XVZA 3HG7A 4FMBB 4KQWA 4UXIA 5T3UA 3VR5H 4XVUA 3KE8A 5TSDA 4DIEA 3BBLA 3R5SA 2ECFA 4HG2A 3V8MA 1A8UA 3A31A 3VTKA 4D0LB 4L02A 4X1IA 1NJ8A 2A57A 1KAQA 1W25A 1Q22A 2ATEA 3JV7A 4NDAA 5HBGA 1MOSA 2NOAA 2GZRA 1TQ6A 1KYQA 3EODA 3LUFA 7YASA 4QPDA 1PQYA 1VHQA 4RFSB 2A0YA 3ZTYA 3NIWA 1MTOA 4NQRA 1W87A 1M2FA 3KDSE 4NAVA 2VZLA 2C8LA 1RMTA 4KPUA 1XZPA 2V6BA 2L42A 2QG6A 3JQ8A 4GI2A 4GM0A 4OB7A 3UFBA 4Z51A 4U7DA 3R3JA 1GGVA 3M6XA 2B6NA 2I0FA 3HE3A 5HIMA 4JWKA 5CVDA 2G5CA 1FSSA 1K7XB 2QLTA 1CF9A 3CZPA 4EI2A 3E05A 3PT5A 5KQRA 2ZSJA 1WQ3A 5CA0A 3TL6A 4YWHA 1DKMA 2IS6A 4IOLA 1A71A 1M74A 2ZS9A 1GPUA 2Q1XA 4Q4AB 5EP1A 3V2IA 2H1VA 5JVDF 2WTBA 5K8CA 2WZQA 1RRMA 5TPWA 3IMFA 5C53B 2J9FB 2BFAA 3PE6A 5BQ3A 1I5OA 2DTDA 2ETXA 1VIMA 4IS3A 3LKVA 2JKYA 2WJIA 2IYAA 4DKJA 3UJ8A 2XA9A 4IINA 5LB4A 3VR4H 1HXHA 4NHEA 2BKEA 2HJWA 1T8TA 2WB4A 4B31A 1MX9A 1NJGA 4LY0A 4M7PA 4G41A 5MN4A 1JG2A 1CDOA 1H66A 4AG3A 3FLMA 1EFAA 2YFYA 4NCNA 4MJXA 1YL6A 3BS4A 1YRWA 4FDTA 4I55B 4Y30A 2Z57A 5F3WB 2Y6VA 4WBXC 3WAGA 2W42A 3NBXX 1Q44A 3KKQA 1Z3IX 4GL4A 2YJZA 1RQXA 3FCXA 2NZWA 3GJRA 1N1MA 3HFSA 2CSXA 3HYRA 1JSLA 3ABOB 4K86A 4RUKA 3NONA 3GDHA 2PY6A 4XD7D 2EQBA 2YV1A 3D54D 4XEHA 5AVOA 3UMRA 2GWHA 4BQIA 4R83A 3IBSA 2VSFA 4GOL