3HPRA

Crystal structure of v148g adenylate kinase from e. coli, in complex with ap5a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDGTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational modulation of conformational fluctuations in adenylate kinase reveals a local unfolding mechanism for allostery and functional adaptation in proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 78
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hprA00
3B1XA 1U9IC 4UXJA 3FKQA 5FTLA 5G53C 4BZPA 4A8JC 4RZ2A 3Q85A 3LW7A 1EX6A 4Q1BA 5HCIA 1AA9A 4DEYA 4TMXA 2FDCA 1VPLA 4ABYA 5HKKD 1CJTC 4PO9A 1M2OB 2J45A 2ZYTX 2UZ3A 3U4QA 1JALA 2BKUA 1KMHB 2KBFA 1TQ6A 1X3SA 1J90A 4LJ5A 2WM9B 1A4RA 3NWJA 1E2GA 4OJQA 1DE0A 3EZ9A 4CF7A 3EIQA 2F3RA 3CUEF 2IUUA 3K70C 4A2PA 1XBTA 4XVQA 3GLGE 5K8LA 1Z8FA 1ZC3A 2CCKA 4TLAA 5C46F 3OESA 2ZYWX 1K5GA 1BKDR 1TUEA 4IDQA 4AKGA 4DCNA 3FPAA 3GFPA 2XSZD 1IY1A 4C0BA 2ZSBA 3VFDA 1KOFA 3V00A 4EPXA 2Z4SA 2YC2C 2XTNA 1XNJA 1IN7A 4FMDB 4MYTA 4QOSA 2QRNA 5CDFA 2CL0X 2B8WA 4LK2A 3L43A 3PENA 4C7OB 3AP1A 4AIIA 3NKVA 5EE3A 1EGAA 1ZYUA 1CIPA 2YVUA 3B9PA 2V8OA 1OYWA 3A4MA 3FKSD 2OESA 3IQWA 3AP3A 2ZRKA 3M0EA 221PA 5AUNB 5IHPA 1SVSA 1KI6A 4XTRA 4URZR 1S96A 1NBMD 2XGJA 1HH4A 1ZD9A 4V0KA 4C0KA 5FBRB 721PA 1OLOA 2ZRFA 4DLXA 1PUJA 3BJIC 1KMQA 1ZUNB 3SJCA 4GT1A 3K70B 2OBMA 3D8BA 1OXUA 5G3ZA 4CZ2A 2MSEB 4QHYA 1W36D 1L4UA 2W6JD 5J47A 3QKRB 1G291 1QVRA 5BYKA 1FZQA 4WZ6A 1ESNA 3K0CA 2DWQA 4L8GA 1FNMA 1IXZA 2ZJ8A 4Q66C 3THWA 1R4AA 2QUZA 2QN6A 2FMXA 2QP4A 3ASZA 4HZUA 1E0AA 4LBZA 5EXPA 3QNUA 8OHMA 5L3QB 1HQCA 2FE4A 1IQPA 5BXQC 2VHCA 2BDTA 2VO1A 2FF7A 2KSQA 3ZZUA 4P4TA 1DTSA 4O2LA 3GLHB 1NBMA 4MYUA 3FDIA 1II0A 2FX3A 1NMZA 3TUZC 1UFQA 2J0UB 2IYRA 2CNWD 2G0TA 2PLFA 2YWHA 1ZCAA 4GOKA 4Q9LA 1OYYA 3B78A 2GF0A 2ODWA 4LI0A 2MMGA 521PA 5FOTA 3T61A 4A8JB 3EA0A 2JJ1A 1AZTA 3A1WA 1JQJC 1ZM2A 1NLFA 3BWDD 2JLRA 4GDFA 1U8YA 2EFEB 2J59A 4QGGA 4UNPA 1GILA 3OEHA 3W6OA 3WMFA 1HUQA 4JT2A 1A1VA 3P32A 1US8A 1V5WA 2F43A 1YKSA 3BORA 1UKZA 4JZKA 5JBQA 3LVRE 5KDDA 2A30A 4AYTA 1NSFA 2IEYA 4MRNA 1ZM3A 4A6XA 1SVKA 3A4NA 3S1AB 4A1FA 5L3QA 2UVQA 4JLBA 3KTAA 4DLVA 1P9WA 2OO7A 4LBYA 2AFIE 4Q1CA 1E1QD 4QJ5A 4BLTA 4DZZA 4OK6A 2FSIA 3PG5A 2ZREA 4FCVA 3RDPA 2O8EA 4L9SA 1BH2A 2HF9A 4A6PA 4PR0A 2IL1A 5EQTA 2P6UA 4Q1AA 5FOVA 1UJ2A 2Z43A 1QG4A 3ZVRA 4EDHA 3RS2A 1E1QA 2A3RA 1N6IA 2HT6A 3QKRA 2FFBA 1Z6AA 4IOMA 2QAGB 1AIPA 2NZJA 4ESHA 1NF3A 2O0HA 3LLUA 1W36B 2WWFA 3ND8A 1XTQA 1KNQA 4B3FX 5FUYA 1C9KA 6Q21A 1XPRA 5JRJA 4YMUA 4ZCMA 3OIYA 2V9PA 2ZI3A 2G9NA 1NP6A 3GLHA 3NBFA 2GJ9A 1XD2B 5TXGA 1F6BA 3W90A 2RCNA 1BIFA 1EFRD 2VF8A 2GCOA 1YZNA 1KO8A 3FOZA 2OXRA 3HU1A 4B48A 1F48A 5DH9A 3T34A 4OK3A 4LJ8A 4UJ3A 1JAIA 3MWLA 1KJZA 1LS6A 1ZNWA 2ORVA 4DCSA 2NTYC 3KXIA 1GVNB 2V7QA 5AK0A 4DSTA 4D25A 4ZO4A 3LFUA 2FSGA 3PV0A 2OLJA 1VG0B 3AB3A 3WY9A 3R8CA 4BLOA 5KSYA 1DADA 2NG1A 1SVMA 4PPNA 4XJXA 4CEIA 1Z5ZA 2ATXA 4PSVA 4JBWA 4D26A 3F5FA 4OQMA 1NN5A 3W34A 3U3RA 2J9RA 4M9SA 1E3MA 2IYVA 4QFMA 3K53A 2XITA 1T3HA 2X77A 1SXJA 3CPEA 2ODBA 3CPJB 3IIJA 4OQLA 5FOSA 5JWHA 5GJBA 1E79D 4A0GA 2Q9AA 4LC0A 3TVTA 1SXJE 1BS1A 2QPOA 4DB4A 1GNPA 1LFDB 3SOPA 3PVSA 3T12A 4CRWB 4LRWA 2XAUA 4C0QC 1GZSA 2WJJA 1L4YA 2YC4C 3I61A 2DB3A 2DHRA 3IQXA 2HDNB 4OQFA 2EWWA 4TMKA 5AJWA 3THYA 2WZQA 1MV5A 1OH8A 1GNQA 3QE0A 3WYFA 2WIAA 4O2RA 5GVSA 3QF4B 4PC7A 1HY3A 4CVNA 2CK3D 2RGDA 2UKDA 4TT3A 3ZZ0A 3UK6A 4HDCA 1MR3F 1QHGA 1TQ4A 2GCOB 2HF8A 4TTPA 4YXWD 2IF2A 5FUVA 1G64A 3T5GA 1BYUA 2J0UA 3T1TA 3QPUA 4BGDA 5LD2B 3ECCA 1KAGA 2ZJZA 4O3MA 3FB4A 3SBEA 3HWSA 2C95A 4F4IA 1XP8A 4PTLA 3L2OB 4NCKA 4FXPA 3P4YA 2ZRCA 1Q22A 1PV4A 1N6PA 1QHNA 1DEKA 2IT1A 2VSXA 2AK2A 4PANA 4D0GA 3DZ8A 1Z06A 2XSZA 621PA 4TZ0A 1LNZA 3F3YA 2ZI7A 1IJFA 2AFHE 4RVCA 3BB3A 4U5XA 1W48A 3CB4A 2OG2A 1SQ5A 2F55A 4Q19A 2W83A 4IOJA 4US1R 5JWRA 3UMRA 1TF2A 3DOEA 2HXYA 4O25A 2N46A 1FMLA 1RYFA 2WKQA 2L0XA 4TLEA 4MKIA 4ZI2A 3BXZA 1D9XA 3CX6A 4PPQA 1XCMA 3CIOA 1H8ED 3QXJA 4D4MA 1M34E 2JIZD 5FBQB 5B58C 5DI3A 1AS0A 1ZUHA 1KI1A 1FL9A 4LPKA 3C4JA 4MDFA 3CF0A 4R2HA 1E2NA 4US2R 4HLQB 4NCJA 1T3LA 2CLCX 2JLWA 2IS6A 1N3BA 4HLCA 2A5DA 1RJ9A 5K8IA 1UADA 2WKPA 3PXGA 4Z8XA 1Z0DA 2XZOA 4B3BA 1YRAA 2IEZA 4HUQB 4BLQA 3RABA 2IUTA 4B3GA 1YVDA 1DAHA 1CR0A 1KO7A 1Z22A 1NKTA 1XTIA 2IS1A 3IBYA 4H1UA 4HLDA 4BPBA 3CR8A 4RZ3A 1XJ0A 1KSJA 1IN4A 3GJ8A 3I5YA 2CL7X 3TLXA 1HQYE 2GETA 1BOFA 1W44A 4TLCA 1LB1B 5DN6D 4M9QA 1IY2A 4C0AC 3ONWA 5C2JB 3RRMA 2C9YA 2PMDA 3BE4A 4ZIRA 2WJHA 2VA8A 1PJRA 2AD5A 3K9HA 4KV9A 4JIMA 4HAVA 4D6PA 1CR1A 1U0JA 4DXAA 3GCGA 2IXEA 2AWOA 2O8FA 2P0EA 2ZAMA 3MMPA 2ZAOA 4UKDA 2BHRA 3R7WB 2AR7A 2B7CA 1E96A 1AK2A 3OIVA 1K6MA 2ZETA 5CLQA 2GEDA 1J70A 1CR2A 4GZMA 2VL7A 2PEZA 2ZRJA 4M0LA 3WNBA 1E2JA 4CIDA 2IHBA 1OV4A 5L3SA 1TF7A 1W4BA 2W00A 1XZQA 4I1UA 3MCAA 4WXPA 2R6AA 2VYFA 2QM8A 3QPWA 2CK3A 2Q9CA 4PX9A 4IVRA 1KSFX 1IXSB 3AEZA 1OXVA 3ZS8A 1G8GA 1OB2A 3ADKA 1VG8A 1ZNYA 2QORA 1WDTA 2XB2A 1J7KA 1GWNA 2ERXA 1W0KA 3KQUA 1A82A 3U2QA 2EFDB 2ZE6A 4P4SA 1MRNA 4BFYA 4DHEA 4OI0A 4HI0E 1L2TA 4QM6A 3AF2A 1GRQA 1G1MA 3N2IA 4I1OA 3PEWA 3AGPA 3U7FB 2ERYA 4EJSB 1OSNA 4Q47A 3TSZA 3B9QA 2ZROA 1E2HA 4C0JA 3LV8A 1Y3AA 5BQ5A 5BW8A 3U7HB 2C8VA 1UDXA 1CULC 1CRQA 1EXMA 4HB2A 5LDDC 2A78A 2Q3FA 1EK0A 4G5RA 2CLSA 2G83A 3P27A 4JLDA 1HTWA 4Q7LA 2I4IA 4MGKR 3THXB 3A8TA 2FPKA 3TQCA 1KY3A 4K46A 3BB1A 4JLAA 1VG1A 2WWGA 3KKOA 3R9XA 4PC1A 4KAXA 1MO3A 4ZPXA 1D5CA 2WV9A 1FX0A 3FYHA 3PUWA 3SBDA 3KL4A 3B8HA 1I2MA 1XB2A 5IT5A 2YWFA 3W5IA 2ZR0A 4JT4A 4IXMA 2RB4A 2VP9A 3CLVA 3OIUA 4KYIB 4OHWA 4ACBA 4LV6A 3ZDQA 1HA3A 2D2FA 4NKRA 4A2WA 2GXAA 4QL3A 1KSHA 3KKPA 2N42A 1SHKA 1DBSA 2ZSFA 2FG5A 1Z0AA 4GL2A 2OSBA 3SYKA 1NMYA 1N0WA 3OF5A 2ZS7A 2C04A 3Q7QA 4MGIR 4OYHA 4PC2A 2ZEJA 4Q4LA 4CDGA 2W6ID 3FWYA 3L0PA 1N6LA 2VPPA 4JLKA 4BWYA 4DUGD 1W4CA 5FL3A 3O8BA 5CYPA 2Y8EA 1AS2A 4OQNA 2NMVA 1R5BA 1H65A 4NYJQ 2QZ4A 3GLIA 3OFNA 2ZI4A 4GMDA 2N1BA 1DO2A 1T5LA 2CCJA 3KKMA 3CF2A 1G5PA 4LPSA 3GEIA 3MJRA 4OHZA 1JECA 4QNMA 5AR1A 1P61B 1Z2CA 2O5VA 4QGAA 4B3XA 1KKMA 3CWQA 2MMCA 5C4MA 3B2EA 4DC9A 1OHHD 4EUNA 5FL7D 4V0LA 1I4TD 3KJGA 5HCNA 4HATA 4LX0A 5CLLA 2QG6A 1AM4D 2A7QA 3SS8A 1QHXA 2QNRA 3KZ1E 4KBGA 3FTQA 3DDCA 4GZLA 4Z8YA 4YMTA 3ADCA 5H8WA 2RGEA 5AUPB 2ZVQX 3AVVA 1TQDA 3TKLA 3EXAA 3HPRA 4LUCA 1RIFA 2ONKA 5DLQC 1XXHB 2BMJA 3I72A 3QUSA 3AP2A 4TWZA 3WYGA 4BLRA 1W0KD 1Z0IA 2V55B 2OXCA 2QE7D 4LOAA 4B33A 3AVXA 4EQ6B 4BRWA 4R9UC 4KITB 3ZD7A 2A2ZA 4ZI3A 3SHFA 1HT1E 2QU8A 2VP6A 3SQWA 5F9HA 1S3GA 1QHIA 1VCMA 5JSZA 5JS8A 1JR3A 1E2LA 3CNOA 3BK7A 2WMOB 2CDNA 3DKPA 1T8UA 1FOEB 2XOKD 3NG1A 1W5TA 2GJSA 4KCGA 2JCSA 2PX3A 3GJ3A 4BFVA 4BFSA 1N6NA 2WWXA 2FWRA 2FH5B 5FTKA 1IONA 4MKFA 1P3JA 4Y0AA 4ZDWA 2V6JA 1G6OA 1Q12A 3E2IA 3HP1A 2PJRA 2G3YA 3UKDA 2J5XA 3BFVA 3AKDA 4LJAA 4BFUA 1E98A 3I4LA 2VTKA 5GJVC 3ADBA 3AF4A 4DLYA 2ZPTX 2ZITA 1SXJC 2FGKA 1OH7A 4BZQA 1E9AA 2RH5A 1Z47A 1A2KC 2EFCB 1S9DA 2IYLD 3BH6A 4MITA 1XEFA 2DFNA 1TEVA 4LHWA 1E2QA 2GWHA 3TNFA 2WSMA 2BCJQ 1E0JA 4MYCA 3A58B 4TMZA 3PUYA 5SZKB 1YZTA 4A0HA 4CEJB 2GBLC 2O8DB 1R7RA 4AKEA 2WOJA 5J4LA 1OW3B 3EWSA 2AD1A 2D2EA 1ZBDA 4DCTA 1CEEA 5E7IA 4DDWA 3WMGA 2XJ4A 1S9HA 2GBLA 4TQAA 3TSWA 4B35A 4B32A 4HDOB 4QBHA 3NTUA 1N5IA 1V43A 3V4RA 1X8LA 2ODNA 3TW8B 2HEIA 4Z51A 1ZM4A 2O8CA 4ZKDA 2G0NA 4RD4A 4TMWA 1DO0A 2E9SA 4HUTA 3QKSA 4RY2A 1G20E 3TE6A 5L3VA 3I5XA 2ZRHA 3K0SA 4FWIB 5JI2E 2Q21A 1DPFA 2FPLA 3TGPA 3CX7A 1GUAA 3OEED 5P21A 4EKDA 5JWOA 3THOA 3GLIB 2QT0A 1PUIA 4BEJA 4W7SA 3LD9A 1XF9A 4AK9A 4K81B 1G7CA 4LDJA 2VSFA 3RS4A 4M4SA 2IUSA 1X1RA 2H16A 2NO1A 2JDID 1P9RA 3FMIA 4OI4A 4DDVA 3C41J 3NDPA 3MWYW 3N5CA 4RD2A 3GJ6A 3MLEA 3F0TA 3PQCA 5DI9A 3VKGA 2FOLA 5CIQA 3R9WA 1KI6B 1AKEA 3W8RA 1JXMA 1E1RA 1QHHA 4TL9A 4NDZA 4TQ9A 1R2QA 5GJCA 1EFUA 2GHIA 3L0OA 4BFWA 4ON9A 2OAQ1 3NBXX 3W6NA 3ZYCA 1OFHA 2V4ZA 3G5UA 2EFGA 4L9WA 4RZXA 2VHTA 5FBLB 1XU4A 1IHUA 4P31A 3DKVA 1AZSC 1P2UA 1FX0B 1XZPA 2CJWA 2PL3A 2ZE5A 3K09C 5JCZA 3EPLA 1FQKA 2NGRA 4IOLA 1CP2A 1R0XA 3HU3A 4RCYA 4YLGA 2BOVA 4PQRA 2WSSD 3R20A 3GJ5A 4N3NA 2NPIA 3RSLA 2HCJB 3UMFA 2G6BA 3KJHA 4JJKA 5FOUA 3RWMB 5JSZB 2RGBA 1OT3A 3DEFA 4DDUA 1NVXQ 4DLWA 1IN8A 3KQLA 2VHQA 2QTHA 2OM2A 2IHYA 3SR0A 1OF1A 3QQ5A 5E95A 2BM1A 2ASEA 3BRWD 1N0UA 3KTAB 3ZVMA 2ZJ5A 2LKDA 4UNNA 4F4CA 2A5JA 1GKIA 4PPGA 1F2UB 3AQ4A 4II7A 3SHWA 3ASYA 1JR3E 4Z54A 1M7HA 1ZJ6A 4R98A 3RRNA 1GOTA 1MRSA 3SDZA 4KODA 2GAAA 1OKKA 1G21E 4IOKA 1CJKC 3RHFA 3SYLA 3PUZA 4G0NA 2VP0A 1RKBA 2JA1A 4DIEA 3WMEA 1WQ1R 2KE5A 2QBYA 3WBJA 1GG2A 1OHHA 4ILEA 5J4YA 3CX8A 2XTZA 1YZUA 1VCOA 2OZEA 5KO2A 2ODEA 5TV2A 1WP9A 3VQTA 2X2FA 1IY0A 4JVSB 4MRRA 5JRZA 2WVJA 3K0EA 2FFQA 1GL7A 1NJGA 2FNAA 1B23P 4NCIA 1N5KA 3T35A 2ZR7A 2DFKB 2W2TA 1MO5A 3OEHD 1XCGB 5HPYB 3Q7PA 3VR4A 1G4AE 2Z4RA 3MGCA 4ASUD 4QNRA 3VR5A 1SVWA 1ZP6A 2JLUA 1F2UA 4TZ6A 4OBEA 3BH0A 2QQEA 3GJ4A 1U81A 4Q4AB 2XNDA 5FR1A 4W9MC 3UWKA 4OJKA 4W5WA 3KDSE 3LAWA 4RSGA 2J0VA 3B7GA 2IX3A 4DLUA 2IA5A 2GVDC 2AKAB 1UKVY 4Q01A 5AJZA 1Q1EA 3UG6A 5CIWA 4UXHA 4B74A 4F93B 1B0UA 2QEQA 2WJYA 3QEOA 2OILA 1E9SA 3VX4A 1Z07A 2CBZA 5F3WB 2F1RA 3L8YA 1KY2A 5FH9A 3VKHA 1YHNA 1D2MA 2MSDB 1RRFA 4DRZA 4LYAA 2YOFA 1YR9A 5BN5A 1XXHA 2IYSA 2ZI9A 1GAJA 4DWJA 1UDWA 3LBNA 2ONJA 4DT1B 2V3CC 1II8A 4MH0R 2ZUBA 4Q00A 3AF3A 3X2SA 1YZKA 4XTCS 1CTQA 1A7JA 4A92A 4B34A 2DYKA 4HAZA 3CRQA 2P67A 3OE7A 2BM0A 3PCRB 2CL6X 4Q4AA 1FUUA 1KK0A 4HSEA 2EFHB 3FHTA 4A36A 4L4UA 2V1UA 1OIVA 1GRNA 2JDIA 2GZDA 4M9ZA 4DCUA 1X1SA 5IK2A 3S1AA 4URXR 5KNCA 4FI3C 4G01B 1XMVA 3SJZA 1G3MA 1UKYA 2BV3A 2OLKA 2V7QD 1PLKA 2FZ4A 4LC1A 4Q03A 1XFAA 2GXQA 2YOGA 3MAAC 1GL9B 3EA5A 1ZNZA 5L3RA 2YOHA 2IYTA 3Q3JB 4PAOA 2R6GA 2FV8A 4I4LA 4GI7A 4HB4A 4LJ6A 4LJ9A 1I4DD 1KI2A 4PPFA 3DMNA 3GJXC 5CJ2A 4LZZA 2H8KA 2J7KA 1E9BA 5KUTA 5K8TA 3CRMA 2FPMA 1A5TA 4UQOA 1YZLA 3SN6A 1W0JA 2I1VB 2GNOA 1Z6GA 3RRZA 1W2HA 3EWAA 4QM7A 4JSTA 4AG6A 1ETUA 1HE8B 2GXSA 5UKDA 4JKIA 3T1VA 2HT1A 2QQ0A 2AXPA 3EZ6A 2F6RA 1E99A 1WF3A 3GFOA 4JYBA 2XTMA 5EP3A 2P6NA 1RW4A 4DLZA 2H57A 2QAJA 3GEHA 4PHHA 2D7CA 2V54A 1T0HB 4NH0A 2P6RA 1RE0A 1JPJA 3LXXA 1CU1A 3HU2A 3WXMA 4AG5A 4KJZA 1G3RA 3SYNA 1MT0A 2NO7A 2VP2A 2JLYA 4DB2A 3TW4A 2GF9A 1GFIA 2IWRA 3KUCA 4MRSA 2BMEA 2GDJA 3BB4A 1CLUA 3J81k 1RRCA 2PT5A 1N5LA 5TY0A 2ECKA 3LRPA 2D06A 3R9IA 4RD6A 2OFXA 1SXJB 2ZSEA 3X1XA 3AH8A 2HCBA 3GP8A 3CW2A 2LCFA 4PO1A 4XOIA 2QMOA 3O8DA 3NBYC 3SFZA 4B71A 1DG3A 4WAUA 2ZJBA 3GLFB 4ARZB 2QGNA 4B2PA 3ZVNA 4YMSA 3KFVA 2ZS9A 4QBIA 3OAAA 2R6DA 3ZGXA 1R0WA 5EUQB 2V1XA 1ZCBA 5BN3A 2BEJA 1VTKA 3TMKA 3U6BA 2BBOA 3O8CA 1X6VA 3DPUA 3JZMA 2GXUA 3OIWA 2CVFA 3IIKA 4WVFA 1JR6A 2GKSA 3IPYA 4UNRA 4IFEA 3VHLB 3QVVA 1Q57A 3IDQA 1CJUC 3ZQJA 3W5JA 3QENA 4LV8B 3U5ZB 1K5DA 3IUYA 2VLIA 1Q3TA 2XOKA 4GPTA 2IYWA 4PC6A 5EXSA 3T15A 4IFBA 4P3YA 4AURA 1Z6TA 5FBVB 1XEWY 5KTYA 2KJQA 1XPOA 2VBCA 3SE0A 3LA6A 5CM8B 1NMXA 1VMAA 1R6BX 3PEVA 5A4JA 1SULA 3B85A 2PT7A 3W3ZB 3JZAA 1OIWA 2VP4A 1G7RA 2OFWA 3NC1C 3I8XA 4W5HA 5FPYA 1T4GA 3H0KA 3ZVLA 1R10A 1LW7A 3C15C 1M74A 2IK8A 4RFVA 2A9KA 5EE1A 5ELXA 2Q3MA 4EJSA 1U99A 4J0QA 3Q8XB 1G5TA 3C7KA 3MD0A 3NH6A 5B57C 2YINC 5LD2C 1NY5A 1Z0KA 3UIEA 4A82A 2QPTA 3QKTA 1Z29A 3EASA 4TLBA 2RGNC 1CBUA 2GCNA 2WWWA 5J4HA 1F5NA 1J99A 2REOA 1R8QA 5G40A 3K1JA 1D9ZA 1ESMA 1KO5A 3I3SR 4H1VA 4LJ7A 2F9LA 5EE5B 2SHKA 2J0QA 4NPHA 1E79A 2YWGA 1JEDA 1MH1A 1Q1QA 4HB0A 2HV8A 4JLPA 1Q44A 1U98A 4Q7JB 2ANBA 4BLSA 4LGMA 4NYIQ 4M8NE 1W7AA 1ZMXA 1P2VA 1DAKA 4Q1FA 4OL0A 3LDAA 3O8RA 2J7PA 3TJZA 2RKOA 1NLYA 2P65A 3U4QB 4LBVA 5C1BA 4PAMA 2OE2A 2OHFA 1J8MF 3SZRA 3C5CA 4P33A 4A2QA 5FBWB 4Q4JB 1AN0A 4O0MA 2X19A 4ZV4A 4P32A 4RD3A 4XD7D 4ZDKA 2P5TB 4MGYR 5TDHA 1P2TA 1E9EA 4C0LA 3ND9A 4C30A 2PZEA 3LLMA 1M7GA 3D6TB 2F1JA 2ZUDA 4EFMA 3QXXA 4D4JA 4W5JA 3AV0B 1XMSA 4EPTA 3I1FA 2K5UA 3SFVA 5HR5A 1XD8A 3H2YA 1XRJA 4PHGA 4OI1A 2IXGA 3CH5A 1TF5A 4V0OA 1NRJB 5AJYA 4HZIA 4Z1MA 3B5JA 2VF7A 1S8FA 2C9CA 2JJ2D 5JHGB 4LSGA 3ICEA 1J8YF 3RVBA 2XX3A 3TBKA 1OIXA 1OXSC 2ZR9A 2ZU0C 4GSYA 2O8BA 4ITRC 5CITA 2D7DA 4QGHA 1VIYA 1ZUIA 2NO0A 1W47A 1NVWQ 2OT3B 1YR8A 3QKSB 3NDBB 4KU4A 5HE8A 4GRAA 4XWKA 1G9XA 1YZQA 2DCUA 3IBGA 5FI1B 4AC9A 1N2CE 4Q9JA 1E69A 1P7CA 4Q02A 5DI3B 3RANA 3CM0A 1XEXB 3RLFA 4B44A 5CYOA 1PZNA 2O0KA 3EPKA 1W36C 2ZIAA 4C2UA 1CRPA 1DAEA 4F4JA 1Q20A 1NIPA 3C14C 4FD2A 4MGZR 1ZC4A 3WBKA 1E4VA 1TNDA 2XB4A 1VDZA 4QKQA 3CWZA 2CLDX 1KI7A 4PSKA 4D4KA 2VHJA 1MABB 1UKEA 3AM1A 2ZUCA 1Z3IX 2C96A 2QROA 3HR8A 1AKYA 4XH9B 3EZ2A 4LHYA 4KI0A 5M04A 4P4UA 3BFKA 5CK4A 4Q7KA 2ZJAA 4EAQA 1XJQA 5LBIA 3K9NA 3K0CC 4KLZA 3EC1A 1FMJA 3LWNA 1YQTA 2JLVA 2OFOA 3AF1A 4G5SA 4AWXA 1DG1G 2BWJA 4MDEA 1H8HD 2P2LA 3KXLA 3L82B 3FKSA 5H1YA 3WRXC 1Z83A 2CJWB 2AL7A 2REBA 3EAQA 1Q3HA 1FFHA 1MO6A 1N25A 4LCBA 4PZYA 5E7JA 3VHXA 3GD7A 4GNKA 4BFZA 4HEJA 1GSIA 5D3MB 3DO6A 2IF0A 2RHMA 4IXNA 2A5GA 1S3SA 1WRBA 1U94A 1UBFA 1XTKA 4PXAA 5EP4A 1F2TB 2QTFA 2FFHA 1KSGA 4AKIA 3GFTA 3NEJA 4TYYA 3QF4A 4NL4H 4RCZA 1KI4A 2ZRPA 4JJZA 4LBWA 2ZM5A 4BEBA 1XMJA 2GESA 4NZYA 2WWYA 3H1TA 3THYB 5TVKA 2IXFA 4LJ4A 4CW7A 4TYNA 2G77B 4AY2A 4MUBA 2QTVB 4XVUA 2GJ8A 4KVGA 5IDVA 5KDLA 4LHZA 2R65A 1XD2A 4FMCB 1P5ZB 1Y63A 3U7GA 4M2LA 2F1HA 2QE7A 1T0JB 3PUVA 5KSPA 4KFTA 1G8FA 4KFRA 1VG9B 4IRUB 1G8YA 1E2PA 1W2GA 1Z0FA 4I1SA 1Z2AA 5DYIA 1JR3D 2VSOA 4HAUA 3VR6A 1RFLA 3M4YA 4ERNA 2J3EA 2CCGA 3GLIE 2NIPA 1XMIA 4MQBA 2OEPA 2IBMA 4POAA 1FW6A 2XNDD 1KAOA 1G41A 1G6HA 4DEXA 4F91B 2D62A 1SZPA 3H86A 2ZRAA 3E5HA 5JI3E 3I8SA 3Q72A 1NJFA 3TVDA 1F3OA 1II9A 1IAQA 4WOPA 1OFUX 1SGWA 4G5OA 4TYPA 2ZS8A 4ZIRB 4U7DA 1HYQA 3U3JA 4M1YA 5CJPA 4OHYA 3PEUA 3U7EB 4ARZA 4A8JA 4JS0A 1JPNA 3K9LA 4GOJA 1VYVA 3MWKA 4MRVA 3GLGB 3D31A 1KI3A 2OV2A 4OK5A 1NI3A 3WYAA 3TIFA 1YE8A 4BASA 5A0FA 1JAHA 4QBGB 4GOXA 3U61B 2QP3A 2Q3HA 1KI8A 4CEHB 3QBVA 5JFGA 1G3IA 4UNSA 4JLMA 3U3OA 2O8BB 2CXXA 3DMDA 4TYWA 2PMKA 2QI9C 2FZLA 4BRUA 4Q18A 4XWAA 1TADA 2QSYA 2F9MA 1GDDA 3A1TA 3B1VA 2JLZA 3AKEA 3L8ZA 4A0FA 4RD0A 1TL7C 3QJYA 3RS5A 3RRYA 3B60A 2O8FB 2B6HA 3AKCA 1MABA 4QBFA 2ZRMA 4V0NA 4TL6A 3AUXA 2C5LA 1II8B 4WXRA 1WE2A 2HXSA 4Q9HA 2XZPA 4KO8A 3A4LA 3I92A 1SXJD 1MOZA 1JJ7A 3OFND 1T9HA 4MKGA 5KSZA 3FFBA 3HR7A 1QZXA 4D82A 2AK3A 2GK7A 2JASA 4FINA 3AVUA 3AGQA 4LHVA 4BE7B 2KWIA 2J7PD 1GRRA 2OUKA 2ZYVX 3K0FA 4EPVA 5EXXA 1LY1A 1DAIA 3B1ZA 5JJIA 5TMPA 1NVUQ 1WA5A 2Z83A 3SU8A 3GLFE 1E0KA 2FFAA 1VCIA 1E2KA 5B2ZA 4A4DA 1O3YA 1OXXK 2W0MA 4F7WA 1EWQA 3RNLA 5JMTA 4WBSA 1J2JA 1E9RA 3VU9A 2O52A 5KPDA 1UEIA 5FPTA 2W2XA 2ZANA 3RAPR 4E09A 3NHBA 5SZIA 2YZ2A 4D0LB 4C2TA 4IDOA 4I1VA 4KSCA 4XVRA 4BLPA 3EZFA 3TK1A 2NZ8A 2PX0A 1Q21A 5LPNA 3CBQA 2H1LA 1E32A 4RD1A 4CYMA 3BAFA 1G7SA 1C1YA 1NL3A 3NC0C 4AYXA 3X1WA 1BMFD 3CNNA 4CEHA 5JZVA 3C8UA 1KJWA 1G5RA 4LJYA 4YONB 3DHWC 2QA5A 4G1UC 1R5NA 4URVR 4CEJA 4IEEA 2BKEA 5J4VA 2HLDA 4US0R 4MA4A 4OQXA 3OEEA 4NONA 3X1DA 1AS3A 4Q9KA 2R6CA 2CMKA 2CHGA 1GKYA 5FL7A 1NLZA 5KYKA 3K0AB 4HB3A 1XTRA 1QBKC 4HAXA 5EZ6B 3EARA 3K9GA 2ZRGA 3EIEA 5L3SB 1ZIPA 4JBXA 3KXKA 4JL5A 2OCYC 1ZIOA 2QMEA 4AYWA 4ZDIA 4TL8A 1DARA 2QAGC 3N2EA 1GNRA 1JXOA 4V0MA 5G41A 4F92B 3QVUA 2PCJA 2R62A 3BERA 3U3KA 3A37A 2BBWA 1NSTA 2JAQA 1RVDA 3GLFA 1BMFA 4DLRA 1U0LA 1G19A 2C98A 3GJ7A 1ZINA 3UMSA 4QRHA 1LTQA 2CVHA 2JATA 1IN6A 2C77A 3W6PA 3QG5A 1P4SA 3HPQA 1E94E 1W4AA 1UEJA 3TUIC 3RC8A 1P62B 2B92A 2BVNA 1VECA 1WB9A 3BOSA 2GJKA 4URYR 4FCTA 5KDOA 3QF7A 2QY9A 3NEYA 1CS4C 1TU4A 3UWOA 4WW0A 4ZKEA 2GILA 3SJBA 1QHHB 3DM9B 4GBMA 2FSHA 5B64A 3KQNA 1QDEA 1SVLA 2JLQA 1NN3A 2GAOA 1DELA 1P75A 2H7VA 4JL6A 3MJHA 4NYJR 4P4SB 2O8EB 3DVLA 1RC8A 1CJMA 1M7BA 4IVQA 4HYYA 5J40A 2PZFA 1KDPA 4Y0VA 4IKEA 3LVQE 1TEXA 1UF9A 2C03A 4A15A 4TT3D 2IYXA 3FE2A 1EWRA 3ZZTA 1E6CA 2I3BA 3QG1A 1UBGA 1E9CA 1KI9A 2PEYA 1FUKA 3W9YA 3P20A 4G5GA 2DR3A 2WKRA 3EC2A 2XJ9A 1ZNXA 5DIFA 2PZGA 1KO1A 3SC3A 4JLJA 2RGAA 3LNCA 2O8DA 2ZQ5A 3ZH9B 1M1YE 2CNWA 2B21A 4OHXA 3B1YA 2YKGA 1G16A 1P73A 1XD9A 2RHDA 4PQYA 5AWFC 1KHTA 1NKSA 1UPTA 4XIGS 3GLGA 3RSOA 4B43A 3ZLJA 4LY6A 3C16C 3RWOA 1N6RA 3VR3A 3JVVA 5JJKA 3VX3A 4B73A 1Z08A 4UNQA 2ZXUA 2AHOA 4Q4JA 1E4YA 1BYIA 2J41A 3HDTA 3L0SA 3B82A 4M53A 1TU3A 3MWJA 3RS3A 4DJTA 1TTTA 1H8EA 3RS7A 4KHZA 3VMFA 1IOZA 2E87A 2C99A 4NYMR 1T8TA 5JS7A 3ZJYA 2CHVA 4QG7A 4NTZA 5FUWA 2O0JA 1R8SA 4CT4B 4IHQA 3CONA 1KK2A 4Q5IA 5J4KA 3U6KA 3JVUA 3CRVA 4K8OA 2XXAA 3F8TA 3PJRA 2C9OA 3GLHE 3K0AA 4B6FA 2REXB 4C0HA 3M6AA 3AVWA 3AF0A 1XJCA 3Q9LA 5JLJA 1JNYA 2D4HA 1KZGB 5DE3A 5IF9A 2AKYA 4GFDA 4NHOA 2EQBA 4JL8A 4TL7A 4QHTA 2ZRLA 4R2IA 2DWPA 2CE7A 2WJIA 5AUQA 2Q6TA 2HLDD 1SKYE 2DY1A 1VYUA 2ORWA 1S2MA 1P9NA 3AKYA 1NY6A 4HAYA 1Z6XA 1QRAA 4M1SA 4Q9IA 3BD9A 3V4FA 3AUYA 1BO6A 3P1JA 1T6NA 3I32A 3QPVA 2NO9A 3THWB 3TSOA 2PJZA 2NOAA 1D6JA 4QC2A 5HKKA 1XEXA 1E2MA 5FTJA 1DVRA 3MG9A 3KB1A 5FTNA 4DSUA 1KJYA 4V0ME 2OBNA 2Z6VA 4M21A 3VU9B 1ZM7A 2WJVA 2QSZA 4Q48A 3WHKA 3X1ZA 5J5CA 4KYUA 1ELOA 2F1IA 2UZIR 2JLXA 1DS6A 3QSYA 2R2AA 2IS2A 2ORIA 4C9BA 5AJXA 2WHXA 3H4MA 1OE0A 2J1LA 3TQFA 3U44A 4JLOA 3ZIAA 821PA 2YJTD 3T1QA 4D2IA 4PSAA 2C78A 5H68A 5HZKA 1Z6YA 1NBME 2H17A 1RRPA 3CPHA 4A9AA 1NN0A 2KB0A 4Z1MD 3G0HA 4Q4HA 4NCHA 1QHSA 3EW9A 1KK1A 1KNXA 3CRW1 2FGJA 3I62A 3Q5DA 2DFTA 1TPZA 4L15A 3R7WA 4IJMA 5FTMA 1EG7A 2BJVA 1Q1BA 3ADDA 4B75A 1LS1A 1W46A 1ZU4A 2HJVA 3W3AA 5CK5A 4DVGA 2OCBA 4DT1A 2QPAA 3FHOA 2AXNA 3K8YA 4LYJA 5B30A 2ZE8A 2W0SA 2KI5A 1SVOA 2D74A 1JEEA 1Q0UA 1ZW6A 4Q21A 2JGNA 4D0NA 2Z5FA 4OI2A 4X8OA 5EJEA 3I73A 3UPUA 4LYFA 4YC7A 5F98A 1OH6A 2GRJA 4BUJA 2GJAA 3B6EA 2WSSA 3CZQA 3VR2A 5E7MA 4M1WA 3AVOA 5IRCD 2YYZA 4XSGA 4JYCA 4R71A 1MKYA 2AN9A 3TAUA 1G17A 1T3SA 3ZIAD 2H18A 3B1WA 3WP1B 1I2DA 2R44A 3LQQA 3LY5A 1XDBA 5CB6A 2YHSA 1ZD8A 4FCWA 3C5HA 5DYGA 4ZCLA 1W1WA 5DO9A 1KO4A 1KK3A 1XX6A 1OH5A 3ZQ6A 1FTSA 2PBRA 2DPXA 4I81A 3SEAA 2IYQA 3KKQA 1FNNA 2ZJYA 4DCVA 2ZRIA 2ZRDA 2ZI5A 5HTKA 1SKYB 1W0JD 1SHZA 1ZRHA 1U90A 3GMTA 1N6OA 3QOFA 5CB8A 1E2DA 1IJEA 2ANCA 3L0IB 3CO5A 2IWHA 5G3YA 4R7ZA 4FMDF 2W6JA 1Q1ZA 3QY0A 2EW1A 2XXAB 4D4LA 1KKLA 1HT2E 5AUOB 2J0SA 3W8NA 2GEUA 1GL6A 4NYIR 4L16A 4TYQA 4B3CA 1JI0A 3EPJA 1KDTA 2JJ8A 4E22A 1L8QA 2JLSA 1ZVQA 1AGPA 1M6NA 1YU9A 1IN5A 4N1AA 4FMBB 1X8KA 3IO5A 4BQSA 4LV5B 3LBHA 3QI2A 5JEDA 3CF6R 1JBKA 3EG5A 1AJEA 3WHLA 4OHVA 4N0DA 4EFNA 2DWOA 1GITA 3BH7A 1YRBA 4D81A 4DBLC 3DL0A 2VIIA 3H84A 1R0ZA 4BZXA 1LF5A 1XEWX 4AD8A 1Z0JA 2QMUA 3TR0A 2I1QA 4WZBE 5FUXA 4M22A 3IPXA 2FA9A 1PLJA 3MSXA 1KDOA 1W4RA 3HJNA 1WXQA 2CE2X 3A1UA 1R5OA 5KNDA 3SI7A 5GVRA 3WNCA 1EFTA 3BGWA 4ACAA 1CXZA 5LB2A 2BBSA 4LWZA 2F7SA 1JQLB 1GTVA 3NHAA 4DLTA 4EPWA 3TH5A 5D3MA 1S0UA 3A1SA 4G3XA 4IDHA 1CKEA 3EIHA 4TMVA 4TTRA 2BBTA 2RGGA 4PZLA 1KGDA 1YZGA 5FOWA 3LH5A 2WJGA 1M8PA 4FWTA 2R9VA 1KZ7B 3KB2A 1HURA 1OJLA 4URWR 1Z63A 4AKHA 4C3ZA 3IHLA 5ANRB 2GVZC 4NU0A 3QBTA 1MO4A 5F2EA 2ZVPX 2QM7A 1Z28A 4A0RA 4B2IA 1CJVC 1S1CA 4Q4HB 1IM2A 1PLLA 4Q7MB 2VHUA 5TB5A 3T06B 3M1IA 4C0SA 1WCV1 3VNUA 4MUAA 2BJWA 1HV8A 2FN4A 3AVYA 4RFSB 1D8TA 2BCGY 3GPLA 4PQFA 3UATA 3N70A 4Q1DA 5K8UA 3UXMA 2P5SA 4JSYA 2AWNA 2GEVA 4YDHB 5DSZA 4JBYA 5JJLA 4QGFA 2GK6A 2LWIA 3KJIA 4PAQA 1RJ9B 3FMOB 2GA8A 3ETLA 4NE2A 2O8CB 4FN5A 4XSHA 1G4UR 2ZE7A 2E1RA 5BWMA 3LW8A 2NO6A 1P60A 2OCAA 4JVMA 4KXFB 1FPMA 2AX4A 1EFHA 2DFLA 4WZAE 5FI0B 4TTQA 1QG2A 1HE1C 3GJ0A 4KLNA 4IEIA 5EZ5A 2PLRA 3CZPA 3T1OA 3TUJC 5GJWC 1E9DA 4PO8A 2YNMA 3D3QA 2JIZA 1N0VC 2OBLA 4LYHA 1AQUA 1WBBA 3LO5A 4WIAA 5FOXA 2W58A 2OCPA 3A1VA 3MUFA 4PHFA 5JEEA 2CHQA 2BMDA 3AVQA 5EP2A 3NBZC 1ODFA 2FEMA 3CR7A 3UG7A 3IEVA 2QT1A 3LBIA 1EFCA 4C7OA 1GM5A 5KU1A 2EWVA 5DHAA 4B2LA 2X2EA 2FU5C 2BIFA 2ZYUX 3UANA 3EPHA 3BS4A 4IDPA 4QJ3A 1NG1A 5DNYB 2JEOA 2WAXA 3KJEA 4DLSA 4B76A 4N0EA 4YQFA 1GKUB 3TAHA 3QXSA 3U44B 1E2FA 2G88A 4XWOA 2G1KA 3GEEA 3QKUA 4NP6A 5C4GB 1IBRA 4BFTA 5E4FA 1ZAKA 4S2EA 4V02A 1ZU5A 2NQ2C 4XD7A 3ZD6A 1KTVA 2ZI6A 4M1MA 3X1YA 3KQKA 5FPSA 1TQ2A 1LVGA 3OAAD 4EPRA 2PH1A 4DUGA 5HE9A 5FPKA 121PA 2WWIA 2WBLC 4TQUS 5FFMA 5C18A 3CH4B 3QXHA 4C4PA 2XEXA 5DGXA 2QRZA 1VYTA 4FIDA 2IYUA 2WIBA 1NVVQ 3BIFA 3CNLA 4ZCIA 3K70D 1XCPA 5KPJA 3K09A 4KVAA 1NIJA 1E0SA 3FMPB 2VEDA 3NH9A 1U8ZA 3QXCA 4JLVA 2ATVA 1ANKA 1COWD 5HZHA 4OKSA 1KIMA 2ZRBA 1ZD1A 3ICQB 3PITA 2W2VA 4JMPA 3IEUA 1GP2A 1IXRC 2WAYA 4L5BA 1D2EA 5EE9A 3MFYA 3V9PA 4ESVA 4RJLA 1AGRA 1DOAA 1E2EA 1EX7A 2GTPA 3DOFA 5LB4A 4DDTA 1P2SA 2LKCA 3IIMA 2BEKA 1YJ5A 3SJAA 2IYZA 4DSOA 1OB5A 1YR6A 1UAAA 4TSFD 2IS4A 4GP6A 4X8HA 3EZ7A 1KDRA 4HLUA 2FJUA 3G82C 2QBYB 1DAMA 1C4OA 5SZHB 1R0YA 4YMWA 1D2NA 4TSFA 3FHCB 2X1VA 2GZAA 1N5JA 3IHWA 3KX2A 1FP7A 3MRSA 3KKNA 4F38A 2WWHA 3PR1A 4KFSA 2IC5A 4URUR 3E1SA 1UM8A 3GQBA 1U0HC 3IGFA 4HZUB 5EP1A 5H70A 3WP0A 1QHYA 3NIBA 2NPFA 1OFTA 5JECA 1EFRA 2WPDA 4Q1EA 1ONBA 1KYIA 2ZTSA 2XNSA 3WRYC 1G3QA 2ZU6A 3B13B 1S4QA 5CM9C 3PFIA 3NXSA 5E3HA 3QIAA 4YMVA 1CF4A 1PVOA 3BBPA 1FQJA 2Q0HA 3T5DA 4QXAA 1RPZA 1RYHA 3BFXA 1G3UA 3OZXA 5BN4A 4M1KA 4EFLA 1OPXA 2H92A 1O87A 4S35A 4H9GA 4B6EA 2PCLA 1DAGA 2CEAA 4JVNA 3SNHA 3BC1A 5D3QA 4B3DA 3EX7C 3AVTA 2WOOA 4PHTA 2C2HA 4YDSA 1DAFA 4HLUC 1U2RA 2RGNA 3QEJA 2TMKA 1NG9A 4NYMQ 2X8AA 3PUXA 1NNEA 3P4XA 3NVAA 4EJSC 4RKFA 1N6HA 2RAPA 2YV5A 3SQXA 2ZSDA 1X8JA 1NN1A 4U00A 2FEOA 1ZM9A 2J87A 4GMXA 2GCPA 4RKEA 4NBSA 2ZSAA 4IW3B 2G1JA 3KFXA 4RFSA 4WA7A 2WPDD 1UBCA 5KSOA 1UBEA 1G8PA 2VH5R 4HDQB 2QP9X 3LXRA 3TRFA 5EE0A 1VIAA 3FFAA 1YR7A 2VRWA 4JVLA 4M1OA 5BYJA 4DIDA 1E9FA 1E1RD 3FVQA 4U02A 1F2TA 2W6IA 1RRGA 3DM5A 3O47A 5KOYA 1T5IA 4FMCF 2B8TA 1U9IA 1WMSA 2J46A 5KNBA 3Q5EA 5TARA 5DISB 5JCPA 1L7VC 5SZJA 5CDFE 2ZJ2A 5L8VA 4EPYA 5F9FA 1JJVA 2JJ2A 4HUQA 5FPHA 1G7TA 2BMFA 4QHSA 5JHHB 1COWA 2DBYA 4LHXA 2V6IA 5GADl 4BFXA 4I99A 1QVAA 2HYDA 1S1MA 2QL6A 2RMKA 1VHLA 2QENA 2YWEA 4ASUA 2WTUA 2JJ1D 1RZ3A 4HAWA 4IVPA 3FMFA 4UXIA 3ZS9A 2RGXA 4RZUA 1TMKA 2A5FA 4TN1A 3U3MA 4KBFA 4E5UA 3R8FA 4P0TA 3VKWA 1G18A 3LX5A 1AQYA 3D7MA 4PFSA 2VQSA 3KUDA 3IKJA 4JKYA 1U8AA 2HUPA 2H5EA 5KHOC 1XWIA 2BC9A 4KSBA 3A6PC 2QGZA 1HEIA 2R6FA 2EYQA 1VKJA 4NMMA 5EXTA 1LV7A 1W5SA 4MYHA 2R8RA 1A2BA 1N6KA 3A36A 3K0FB 4M1TA 4FW9A 4G5QA 3PIRA 3HYTA 3OE7D 2D3WA 3DZDA 4X8MA 1JB1A 5AJVB 1NVVR 2EVWX 2HJGA 1K8RA 1F60A 3VTKA 1FP6A 2EU8A 1FTNA 4D80A 4GP7A 2HYIC 3TR5A 2ZRNA 4YXWA 4IDNA 4QJ4A 4DSNA 4CT5A 4EQ6A 2WMNB 2Z0MA 2QAGA 4JLNA 4B47A 5A5GA 3FGNA 4UJ5A 4V03A 1I4LD 4M9XA 1OKKD 1KMHA 2VP5A 2A5YB 1H8HA 1US8B 1XXHE 2F43B 3OHMA 2FSFA 1QF9A 3CKLA 5EUMA 2RGCA 3LQRA 1WBDA 2GZHA 4E03A 2EYUA 1OFIA 2OAP1 1T91A 3HYRA 4TMTA 2B7BA 2XZLA 4PZZA 1OXTA 3KQHA 3PEYA 4EIWA 4PC3A 1VHTA 2P3SA 2IW3A 1CR4A 4MRPA 4E07A 3THXA 2F3TA 2WICA 3IILA 3U60B 4BECA 1XTJA 1TX4B 3REGA 5IK2D 1E2IA 2KBEA 4ZDJA 1XPUA 4MKHA 3VNVA 4DKXA 3E70C 3RC3A 1X86B 1XTSA 2ZJOA 5DN6A 1TAGA 3RS0A 1SKQA 3AVPA 4AI6A 2MSCB 3LX8A 3RYTC 1SVIA 2Q9BA 4TLDA 2QMHA 5FR2A 1VCNA 1G8HA 4NCNA 421PA 1P72A 4CGZA 1LF0A 4CEIB 5DHFA 1EESA 3VR1A 3CRRA 3REFA 3VAAA 2IYYA 1GIAA 1TUIA 1W49A 4KFUA 3IO3A 3P26A 3WNDA 1P6XA 4X8LA
chains in the Genus database with same CATH superfamily
3B1XA 1B74A 1SB9A 3FRHA 3TM5A 4CDNA 4BZPA 3FUVA 4RKWA 1EX6A 5AM4A 1XALA 1WO8A 1AA9A 2XRFA 5CBPB 3T7IA 1RTKA 2YXNA 3FOBA 3HVUA 1TM3E 4Q6WA 3P0EA 4BX9A 1A7KA 1QPBA 3KQWA 2PQ0A 3V3TA 1M2OB 2MYPA 3KZXA 3ZHRA 1CDEA 1KGSA 3G7SA 3RGGA 3E9YA 4XRGA 1SELA 5F7OA 3I2GA 4DC0A 4WCFC 2ZFUA 4LJ5A 1XO1A 1WTCA 2QTMA 1KZYC 1CFJA 2WK1A 1UM9A 2WU4A 3NWJA 4GLLA 4BDTA 2DUJA 5FAKA 3EISA 5I45A 2HSJA 3CUEF 3K70C 2I76A 2FWJA 2OGTA 2AQHA 3H4TA 4A2PA 1JG4A 2JZNA 2NZVG 1Z45A 3GJYA 4H0FA 4JXJA 5EIWA 3RRJA 3TYXA 3UJ3X 3LPMA 2DG2A 2Q27A 4QUEA 3L4BA 1XCOA 2OYRA 1H66A 1TJYA 1JXQA 3AW8A 3LC0A 4V3CA 1DEOA 1TUEA 2B3TA 5A4MS 4HPWA 3VZBA 4DCNA 1I7DA 4N48A 4GG1A 3BJEA 2ZIXA 1QFSA 1KOFA 3VFDA 2J07A 2RBGA 5HBRA 1YR3A 2Z4SA 1B6SA 4XXHA 5F7ZA 1H4VB 2XTNA 1KOLA 1I13A 4MPRA 2XYRA 4UZFA 4QRDA 3NBAA 1W76A 4DCJA 3PHJA 2DT8A 1XZFA 1KZ9A 3OZCA 4ROSA 5CDFA 5ALUA 1JX6A 3N74A 3PENA 4JUFA 4C7OB 2VR1A 1KDZA 2XQIA 3ROXA 1FRNA 1M2GA 1QMPA 5AI5A 2EW8A 2VJNA 4S0ZA 4TXHA 1CIPA 2YVUA 3B9PA 4XASA 1GU0A 2V8OA 3NBUA 1H42A 1NW5A 2F3PA 2OESA 3IQWA 4GP9A 2PD4A 3VVCA 5AVVA 5IHPA 3TW8A 4X1OA 5ELMA 1EQAA 2HMYB 1U0OC 1CR6A 2CF5A 5CU7A 5CLHA 1WJGA 4CL8A 4UPDA 1C7JA 4Q3AA 2V4MA 1Y6GA 4M3NA 1NXTA 3TCKA 4DLXA 2J3JA 3G3EA 5EERA 4JJFA 3A6JA 1JHQA 2ZT7A 4WEOA 3SLKA 4EKNB 2VLBA 1T1IA 3V2UA 1ZUNB 5JH7A 2VT6A 2C1ZA 4G1MB 2CFIA 1TCVA 2PKCA 4GT1A 3K70B 2WU3A 3I05A 4FR5A 3GEPA 2C2KA 3HY6A 3NCHA 4QHYA 3BD7A 1L4UA 4HGPA 4Z2YA 3QKRB 1HX7A 4ZT7A 5BYKA 2XW6A 3GOQA 1GUFA 4PZCA 1P9LA 1JGTA 4C22A 3GZNB 4QUJA 4L8GA 1QGDA 2AUTA 2H7XA 5JJ5A 3PIIA 4DLAA 4IIJA 1YS4A 1JLHA 3ELYA 3JQGA 2PV7A 3N2KB 1GYRA 2GBPA 4ITUA 4G0QA 4ZCTA 5DBOA 4YUXA 4LBZA 1TJNA 3IE2A 2DLNA 4NAUA 4RWZA 5KNDA 1ZZGA 3HRIA 4AUMA 1NI4B 3U7QA 3OIFA 2ALJA 2BDTA 2VHCA 3ZZUA 4W9NA 1NDHA 1U7DA 2YX1A 3FHJA 1CRZA 1D7AA 3PNLA 3N1UA 4J0JA 4TM8A 1Z15A 1NMZA 4L3WA 4P38A 1U7XA 3DEHA 4BVHA 1WWKA 2GPNA 4J0IA 2CNWD 4BB6A 1ZRMA 4BAUA 4IGAA 2G0TA 5HZMA 1Q2XA 4F9FA 4Q9LA 2O2CA 2HTEA 2ZBPA 4X1YA 4WX2B 2QYTA 2GF0A 1QYWA 2XVYA 5ALJA 2ODWA 2P2NA 2MMGA 521PA 2ZGVA 3E0XA 3N86A 3ELUA 4LDPA 4BVJA 1ZM2A 3G2KA 3SEQA 2EBFX 2RGWA 2JLRA 2WJWA 2HIGA 2YN0A 1K3TA 2J59A 4QYXA 4F46A 2FP3A 4JT2A 4RGVA 3KEQA 3P32A 5KTMA 1V5WA 4LF7B 3BORA 1UKZA 3QJ5A 1YTUA 2MSLA 4I4IA 2DEUA 2YRXA 2ZG6A 4ME6A 1TB4A 3L7DA 4JR2A 5A6SB 1C3LA 4AYTA 4O2BA 4A6XA 2POQX 4ARVA 4OLJA 2UVQA 4EB8A 1C3VA 5G1PA 1NX6A 1IY8A 2R1ZA 3FZEA 1EVJA 1E1QD 4BLTA 3EFOA 4R2XA 1WW8A 2O8EA 2ZREA 4FCVA 1U8EA 2Q1WA 4L9SA 1BH2A 4LSWA 3R6TA 3RAFC 4R3UC 2P5UA 3F97A 5JANA 4KO4S 2VP3A 2PT9A 4PR0A 4RKYA 1JEYA 1CQIB 4Q1AA 2QXYA 3VJKA 2DP4E 3MB5A 5KCZA 1YCGA 1IPHA 1ESDA 4IMIB 3TKAA 2FFBA 2CXRA 4NV0A 2J33A 2B25A 2QAGB 2YWJA 1MZPA 2WW8A 1XHLA 4RK5A 2NSDA 4D42A 5ENVA 3LLUA 4R1QA 1W36B 1Z5WA 2WWFA 3BMNA 1TEHA 4AFNA 5FUYA 3ICPA 1XLTA 2GZMA 1LDYA 1YJCA 1Y6RA 4IYJA 5T6BA 4YMUA 2V9PA 3IJ5A 4PX2A 3GLHA 2WJPA 3TOCA 4FHCA 4AJEA 4KRFA 1XD2B 2CL5A 2Y93A 1ID1A 1XI2A 3W90A 2XT0A 2IELA 3DAOA 3GGDA 3JYOA 1KVTA 1SZJG 1K97A 2R8EA 1VPTA 4EEZA 2NLOA 2VF8A 3DP9A 2F8TA 3C43A 1WPGA 4FFDA 1YZNA 3KV1A 3CH7A 4YA6A 5I4CA 1E66A 3M3HA 4B48A 1PK7A 4IFIA 1DSSG 2XYPA 4OQDA 4EA6A 2JGFA 3LCCA 3WSVA 2XWPA 5BUQA 2XKJE 3JASA 3BAZA 4LJ8A 4OP2A 3T5AA 4IGEA 4HN9A 3OQOA 3I64A 4DCSA 4LOLA 4B7AA 2JGMA 2V7QA 5HZGA 4O33A 1T36A 1YT5A 3PDUA 3PV0A 3VU0A 5K6AA 4KGVA 4XKJA 1X7YB 4RC9A 5L4NA 4I66A 1YMUA 1YR2A 3D59A 1B8NA 2RK4A 3BCUA 2EX1A 3HHPA 4I8DA 1P1HA 1Z82A 3CZ9A 4XJVA 4XJXA 5DYYA 4ABTA 2V6BA 4J91A 4IO1A 2YYAA 3N75A 2ATXA 1DUSA 1N2SA 3GFGA 4FX5A 2MINB 4JBWA 3F7TA 5HJEA 4OQMA 4NXNB 1NN5A 4MMYB 2JLAA 2J9RA 3U3RA 3R41A 1XQVA 5K3AA 3QMWA 2D6FA 1E3MA 2ISQA 3DVRX 4QFMA 4DANA 3A2KA 2H9IA 2JI4A 2XITA 4GXTA 1H2XA 1U2ZA 2AMLA 3VVLA 2X77A 1Z2OX 3KVOA 3JD4A 4JYPA 2ODBA 3VV3A 2O0LA 1F8YA 4DF3A 3UMGA 2L17A 5GJBA 5AH0A 4A0GA 1Z33A 2Q9AA 1GCIA 4LC0A 3HBMA 3E84A 2ILVA 1LFDB 5AVYA 1NULA 4GHWA 3VPHA 2O59A 2HPHA 1USVA 1EVZA 3FCYA 3SOPA 2H4YA 3EXFA 3ELBA 4LRWA 4C0QC 3QITA 4CRWB 1GZSA 2I71A 3OJCA 3DFMA 5EUCA 4BMDA 5DKFA 3CUTA 3I9V6 1GSHA 2BFAA 3I61A 2DHRA 5ARDA 2HDNB 2JHPA 4TMKA 4RA9B 3DG9A 3HGMA 3OC0A 4B17A 1MV5A 3E1GA 3H1GA 1OH8A 3KJXA 1CZNA 4KPUB 3H97A 2X9GA 2WIAA 2P0AA 1VE7A 3QF4B 4MXDA 5EXEA 5BT9A 1Q0RA 2YZKA 4KE8A 2XMCA 4HV4A 1KARA 1HDEA 2O9JA 5GY7A 5EINA 4TT3A 2HF8A 4TTPA 3JZDA 4FFMA 1HNZB 2B83A 4R1MA 1G64A 2Q45A 1BYUA 2J0UA 2V9ZA 2X15A 2Y4NA 3E0QA 3FETA 1RXCA 3HCEA 3ONEA 1QC5B 4F21A 2HU2A 2OM6A 1T25A 1MA0A 5BW4A 2PSJA 3UW1A 3HWSA 2HR1A 4V24A 4PTLA 4JX8A 5HGJA 2XMBA 4NCKA 4OPMA 4X7RA 3HI4A 1U2SA 2P6PA 1N6PA 1PJ8A 2OUIA 2PXCA 5A04A 1V11B 3KETA 4HMQA 2EFJA 2FPIA 4LF9B 2XSZA 1LNQA 3VKUA 621PA 2Y3IA 1LNZA 2PXXA 3NANA 4BO6A 3DAPA 1IJFA 2AFHE 4RVCA 1Z5GA 3CB4A 3FX2A 2F55A 4KQJA 3COYA 3DZCA 3IP7A 2XCOA 1D09A 5FFNA 1J5XA 1J2RA 1ESEA 3OFKA 4UPEA 4CIBA 5LQRA 4UHJA 5KWSA 2G04A 4O25A 3AR2A 3QX3A 4Y18A 5L51A 4W8OA 4ZI2A 1EGQA 3BXZA 5DNAA 1U0EA 1DIRA 4ZCRA 4M1ZA 1FY2A 1CERA 3OOSA 1BW9B 2IPNA 3CIOA 3KQTA 4G0XA 3L8FA 3P2EA 3P97A 2X7JA 2RH4A 5FBQB 4WTOA 4Y6LA 2Q41A 2QN3A 2OV1A 4LPKA 3AEQA 4PICA 5AOCA 1A4XA 1QIGA 3C4JA 5LP1A 1NW8A 1KFKB 1W2WB 2REQB 4R2HA 4EJ2A 1Z8HA 4HLQB 5AKXA 3Q5GA 1IQRA 1NLUA 1K5PA 5M3BA 4ETMA 4C2AA 2IS6A 4WXYB 1RJ9A 5K8IA 3IUJA 1XRLA 4F91B 2DKNA 4IH4A 1G2QA 4Z8XA 2VQ6A 3NYRA 4MR7A 2XZOA 5HKBA 1G6Q1 1YRAA 1KAHA 1MZVA 4HJXA 4OP3A 5G0WA 3RABA 3S8EA 2H5JA 2EJBA 4ZAZA 4KO1S 2IS1A 2VHEA 4BPBA 2MYNA 4DADA 4E46A 4OAOA 3SYTA 2YN2A 2JFOA 3LWBA 1HQYE 1Q1GA 3WYBA 4E1AA 4KGDA 1BOFA 4TLCA 2ZIXB 4M9QA 1DG9A 4S1WA 1YACA 1CZLA 3OE1A 4AT1A 5JD3A 1SU8A 4RTPA 3Q8MA 5I3ZA 4D6PA 1FFGA 2QR3A 4J6EA 1SPBS 4J9UE 4GYWA 4ZANA 3V32A 3VSDA 1H9CA 4F56A 3PK0A 2ZAMA 4FS8A 5CX1A 2O2EA 2VPQA 5EL0A 3VPSA 2DUWA 2B7CA 3AFNA 4RQBA 1E96A 3JVDA 4CIXA 2BZ1A 2AFHA 2CVPA 2OHOA 1IMJA 1CR2A 4M0LA 3RKRA 2PEZA 3W4JA 4CU5A 4X1IB 4CIDA 4EI7A 1N2BA 1ILWA 1W4BA 2W00A 2AZ4A 3MM4A 1XZQA 2VI5A 3W2IA 5DM1A 2G40A 2HGZA 4KW7A 4U6SA 2ENWA 2VJOA 2VYFA 3QHAA 2FUG1 1G1AA 2F48A 2JKVA 3STUA 1CZOA 3W4IA 2DTEA 4IVRA 4Z7QB 1OX6A 1PV1A 3AEZA 1GSAA 3GELA 1UBHS 3LY9A 2EDCA 1IVYA 3KZCA 1C3JA 3GEBA 3M1YA 3H2KA 5GINE 1JVBA 3QWHA 2QORA 1RAHA 2XB2A 1J7KA 1YBVA 1GWNA 2ERXA 1GXSA 4P4SA 1TECE 2HU8A 5CDHA 3T54A 4DHEA 4HI0E 1L2TA 3AF2A 2OOKA 3M3DA 2A58A 4CEHB 2ERYA 3MOSA 4EJSB 1AZWA 3EGCA 2JGKA 1GLGA 2ZROA 3A06A 4Z6KA 1PT6A 3UV6A 1EVYA 1Y3AA 4BVBA 1J0DA 4AUNA 5EJ4A 2XBMA 1E7QA 4ZYUA 1EXMA 3SM3A 2IIBA 3GLTA 1PDWA 2DUNA 3I52A 2HRRA 4BCDA 3LGAA 4G5RA 2R68A 3BX1A 3ICCA 3MGGA 1ZMOA 1E5QA 3P27A 3R5SA 1URPA 4JLDA 3SXPA 4JBGA 4B7CA 4EW6A 5JBNA 3EXHB 1KY3A 4K46A 2ZB8A 5LP6A 5CR9A 2VJAA 3BB1A 2AT1A 4KI7A 3OEWA 2X3UA 2X1MA 3MILA 4JLAA 1VG1A 3E2MA 4BVEA 2H6EA 1U4SA 5T3UA 1WMAA 2B1JA 4FZ3A 1FX1A 2CUNA 2NACA 1MO3A 3HA3A 4H31A 4ZPXA 4DJAA 4QZVA 1VMEA 1LNSA 2VNKA 4FYIA 2EXXA 4TV9F 4WZAA 1IHDA 3MT7A 1CUBA 3B8HA 3D3EA 5FULA 1W581 2QVCA 3ABOB 4IMJB 3RARA 2YWFA 2ZR0A 3EMBA 4HXGA 4YB8A 3CLVA 2B4QA 1UJBA 5GM1A 1XYGA 3DPIA 1QORA 4KYIB 3ZI4A 3ZWCA 3TMYA 4L9RA 5ICMA 1HA3A 2J08A 3K32A 3MAGA 1XTTA 2M9MA 2DRIA 1B16A 1NX9A 2P7IA 4QL3A 5D85A 2XQKA 3T5TA 4L2IB 2FG5A 4NWIA 4CT0A 2V7UA 4KQKA 3C6MA 4FWBA 4JWKA 5J5VA 2QKYA 5H5JA 1TM7E 4EHBA 3DOJA 1GAQA 2BW0A 3OF5A 1SA0B 2A86A 4QTTB 3TD9A 3IQEA 3R3ZA 4CDGA 2OXEA 3WE7A 4C78A 1C14A 3L0PA 5IS2A 1U7WA 2VPPA 3VJRA 2IXDA 1OTYA 2XTAA 4L4SA 3BWBA 1W4CA 4TT8A 3ZBPA 1R8JA 2WMYA 3MTBA 4RF2A 5K0LA 1K8QA 4HYTA 4YRBA 2H1OA 1JKJA 2XDYA 3BRSA 3SZMA 1E8DA 2X22A 3BPSA 5AK3A 2X0FA 5I6DA 3OFNA 2I2DA 3PD1A 2N1BA 2YMQA 2B82A 3E3OA 4HBGA 3LDUA 1MIHA 3B38A 1XYYA 1XKTA 1DAOA 1XZEA 5I7FA 4QNMA 3TEJA 1ADCA 5TMBA 5COAA 1XRQA 1Z2CA 4IV5A 4QGAA 4I36A 2XUHA 2ZWPA 3CWQA 3NGXA 4H3VA 1P2FA 1SA0A 2PAAA 2RHCA 4QOIA 5E38A 1I4TD 2AFIB 5E6SA 3UY4A 4CG1A 4DV3B 3EEYA 1FYWA 1DFIA 2QG6A 2W6QA 4NOKA 1SXGA 4EG4A 1R9MA 4QARA 4YMTA 3FTQA 3DDCA 4GZLA 4Z8YA 4O2BB 1T5SA 2D3TA 1XZKA 3V46A 1EG2A 3ND6A 3HPRA 3PR3A 4XGNA 4LUCA 4WLOA 4YCAA 1BEUB 2ONKA 3ROTA 2CY0A 5DLQC 1WCYA 1XXHB 3EB9A 4Y3UA 3AP2A 3WYGA 4BLRA 1ISGA 4TV8A 2V55B 5F3RA 2P11A 4K1XA 1J5EB 2DKFA 2YTZA 1JHOA 3ZUGA 3ZX4A 7REQA 4BRWA 3VRHA 4D96A 3KQYA 4EFKA 2A2ZA 3FOAA 5CNIA 1CB0A 2FPGA 1HT1E 2QU8A 1C3OA 2VP6A 3SHFA 3WTCA 1JZTA 2X41A 1ECLA 1VCMA 1D2RA 2Y68A 3UT6A 2RC5A 3R7NA 4N5NA 2C5EA 4C07A 5JS8A 1IULA 2P9EA 4EGAA 2JIPA 2ZYSA 3JQFC 5LA6A 4F3RA 2WYUA 1Z0UA 3S2YA 5I5GA 3MCVA 4XIYA 3OCZA 4XCXA 4QOJA 2CMDA 4QDXA 3NO4A 1TGVA 1RWQA 2GJSA 2JCSA 4CCWA 1KJ9A 2QU7A 4OAQA 3TL2A 4EUEA 4MQEB 1N6NA 2WWXA 3R5KA 2V7EA 2QD4A 4S1VA 5F51A 4EK9A 3QOWA 1IONA 4R2MA 4D0SA 2XT6A 4ZDWA 1DKQA 1ZW1A 2J8ZA 1S6YA 5A9RA 3KSAC 4BYGA 3AKDA 1EP1B 2WA1A 4LJAA 3CEMA 4Y6RA 4XYLA 3AF4A 4N8EA 4YQEA 1DPGA 5JO0A 3COJA 1U7OA 1FTGA 1YC2A 2WSIA 3L7JA 1OH7A 4JLSA 3B5IA 4F1WA 2ID7A 2JFQA 1S9DA 3BH6A 5IYZB 2DFNA 3L0YA 2A9JA 4CG2A 4OD0A 3ZV4A 5LLSA 3C70A 1R0CA 4MYCA 1OLUA 4F4FA 4I55F 3VH3A 2OQRA 5D84A 2QZPA 3ENKA 3A6DA 3RG8A 4E1BA 2VOEA 4EYSA 4H7JA 1R7RA 4BJ3A 5J4LA 3O8NA 1ZKMA 5DHSA 4IUYA 2D2EA 2ID4A 3CSDA 2SECE 2EG5A 5J23A 4ER0A 3G2JA 5CEJA 3E15A 5SYAA 4TQAA 3WMGA 1XK6A 3TSWA 4AX4A 1WCIB 3N2NA 4CFZA 3KRTA 3DMRA 2G25A 5FWDA 3NHMA 4X93A 3EBPA 3CIFA 5IP5A 3TQOA 3CWCA 3LUDA 5L4LA 1K68A 1JIJA 3A31A 1DRUA 5I7HA 3FCSB 1ORDA 5HCUA 3MN1A 1ZM4A 3H3FA 4TUYF 4ZKDA 4WESB 1OLXA 3IR7A 4TMWA 1DO0A 1U0FA 4L4YA 3QKSA 3C8ZA 4C6TA 1UAYA 2FR8A 3GEGA 2WU8A 4TS3A 4HMPA 3THRA 4DJ5X 4ENTA 4YFYA 3G5AA 5FRDA 5CCEA 1PWEA 2AMFA 3UH0A 3WOHA 1DRKA 1HO3A 1Z6ZA 2W8BB 2WFMA 1QYIA 5E9QA 3TE6A 3WIOA 3I5XA 3IAUA 4R8VA 2QMQA 5AVRA 1DPFA 1T29A 4MEAA 5C7YA 1HNNA 3DMHA 1U1EA 3B5EA 3F4LA 2AMYA 5MDHA 1T8RA 5HF6A 1J22A 5JWOA 2P91A 2W11A 3CKMA 4IILA 1FVXA 4MGEA 1J5PA 4BEJA 1NQVA 3K6JA 3AESA 1LVUA 3IS3A 1XDWA 3LIPA 3FZQA 3G0IA 2OQ2A 3LPLA 3WSWA 3C1OA 2WQ6A 3GLKA 1BVRA 1X1RA 4QU5A 3WC4A 4IH9A 3WK8A 3WLJA 1WB5A 4XWWA 2QSUA 2JDID 2WIGA 3NM4A 3FMIA 3TNJA 3D2CA 4ACBA 1NWHA 4RD2A 1U3TA 2AG8A 4JP3A 3VZSA 4YPOA 3F0TA 5DI9A 2JFHA 3VKGA 4MTLA 3LL4A 5EIEA 5DW3A 1CHNA 3MJCA 4IZ6A 1JXMA 4GLOA 4R68A 3W8RA 5B7NA 1MB9A 4GPIB 4MRMA 3WQBA 2J5KA 3HU5A 4NDZA 1R2QA 3KYDA 4TQ9A 4OY3A 2X1HA 5AW4A 2W22A 4CM9A 5AW5A 5CH3A 3IAS6 2H1FA 3L0OA 1VJ0A 1C0PA 1NKVA 3FSEA 3PHLA 1TZJA 4P3KA 2V4ZA 2C7BA 2EFGA 3VR4H 3WA7A 1YNSA 2PUDA 4JC4A 1T9KA 3U4GA 1P2UA 2BCEA 2DULA 3SFTA 5JCZA 4RAQA 2NGRA 1NQ5A 1U04A 4M49A 4PLPA 1YK0A 3IDFA 1M6WA 4BC1A 1EDZA 3NV9A 1QTIA 3OZTA 1PJTA 2OHXA 2BOVA 3SNKA 4PQRA 2WSSD 2Y1GA 3R20A 3GJ5A 3ISTA 4MLPA 2HCJB 4RV5A 2G6BA 1I3NA 2CNOA 1HG0A 4JJKA 5FOUA 1NU8A 4D8TA 3R5TA 1EDOA 3ZXYA 3OBIA 4QFDA 1KVQA 5KVCA 1NVXQ 3ZBUA 3UHPA 2C5HA 4Q7EA 3GB9A 2X0IA 1BN7A 5JCJD 1HXHA 1OJ7A 2VHQA 4HKTA 2YXBA 1H9BA 2IHYA 4DN6A 4ENPA 5B7PA 1TYAE 4LDRA 4N39A 2E6UX 3CNEA 1OF1A 4QUAA 2G5GX 3QQ5A 2NYUA 2BM1A 4FNMA 1RNLA 3ZV6A 4B0PA 2ZJ5A 1RQNA 2LKDA 4C43A 4X24A 2HA4A 4PPGA 5DJ5A 3AQ4A 4Z54A 3ASYA 1V7QA 3DFFA 4PTYA 4FJ1A 3IPAA 4LRUA 4RMGA 5KINB 1HFKA 1MRSA 1RABA 2NUTB 3IP8A 4JITA 4HX2A 3SDZA 4EYOA 1R3DA 2AYYA 2PMWB 1TCUA 4MP8A 1PVDA 3D5QA 4RPLA 4TKLA 1R6VA 2VP0A 3KQLA 1GQFA 1NOJA 5ALKA 2NXCA 3IE0A 4ILEA 1QANA 4FX2A 1HRKA 4K3VA 2L18A 2XTZA 2IU0A 1SIUA 2EOAA 3DOCA 1TK2A 3GLQA 4UATA 3HTXA 2G6TA 5KQGA 4OX9B 4LG1A 3JWHA 3ZOKA 4G0PA 3O73A 4GR4A 5JVDA 3RSHA 4G0MA 5TIIA 3K0EA 1AKVA 2R87A 1F4PA 2BFEB 2WUFA 4GWKA 1GL7A 1NJGA 3REQA 3KLOA 2VYVA 4KNVA 3T35A 3KTOA 4HF7A 4K6KA 2PANA 1NJ2A 2DFKB 1MO5A 5HPYB 1QAMA 4RY9A 3VR3D 3D7LA 5JQGF 1VPWA 3EJWA 3BMXA 5BOSB 5JC1A 4OB6A 3W78A 1ZP6A 4B5LA 1RJDA 2JLUA 3HUTA 3L6EA 1VBKA 4LW8A 4OBEA 1R16A 3BH0A 1O95A 2P4QA 3OT4A 1KBQA 3P94A 5HUQA 2I62A 3C3JA 1U81A 3HM2A 2XNDA 1C8LA 5FR1A 1YB6A 4IZOA 2NZYA 3UUEA 1HT3A 3R3JA 4DMKA 1AO0A 1RQ2A 3UB2A 2AMVA 2C7PA 2J0VA 5C8ZA 2HL6A 2QF7A 4YJGA 1UKVY 2O6HA 3BXOA 2YR0A 3JD2A 3NGMA 4ZD6A 1B0UA 2WJYA 2AC2A 1S89A 4NOLA 5FF9A 1L4KA 1E9SA 1EZZA 2H2FA 4PAGA 4L28A 1T13A 1FS6A 5ERGB 1YHNA 1KA9H 5FH9A 2A6PA 3GFQA 3CEAA 1V7CA 4XQGA 4DRZA 1Z8DA 4LYAA 4H0NA 4LZAA 5CUQA 1MOSA 5K8VA 1SVNA 1XXHA 2IYSA 2Q62A 2PKEA 2ZI9A 2ZULA 1GAJA 3H4IA 3PE3A 1IK4A 1ISFA 2FCAA 2ONJA 2BF7A 1YJ8A 2W6OA 3N8IA 4V2UA 5JZBA 4ZO8A 3VOAA 2BMWA 3DHYA 2V97A 2ZUBA 3PZBA 4RVUA 1Y82A 4XTCS 4A92A 1A7JA 2Q7DA 1V7PC 2JCVA 1C4KA 2DYKA 3BWEA 2HRZA 3HKCB 3T5BA 2P67A 3A4IA 3MELA 3S8MA 2BM0A 4EJFA 4Q4AA 1HL7A 2QQFA 3GFSA 3OQJA 2P2GA 5K4GA 4JC8A 2AA3A 3ZKAA 4BPRA 4A36A 4FXOA 3X2EA 1Y34E 2LR0A 5GOTA 4A16A 4BWVA 4QODA 4F8JA 4HVCA 4PINA 3ECSA 1WMFA 4JB3A 4DCUA 1CQJB 1X1SA 2Q4TA 3HMKA 2XGOA 4O3FA 3RTDA 1V1RA 3S1AA 3SJZA 3LBFA 3UICA 1VKOA 4GI2A 1MB0A 4FFLA 2LDXA 3U4DA 4MW9A 2GXQA 2XECA 3MAAC 2H11A 4OLBA 2JGLA 2RKWA 1UBKS 1W6UA 3HUEA 4PAOA 5IAGA 2R6GA 3AB8A 2FV8A 4L27A 4N0QA 3GLVA 4IQ0A 5A4IS 4YO8A 1PZFA 3H04A 3ZHBA 3NYIA 1NF9A 1W88B 3DMNA 3H8SA 2WMDA 2LCIA 4LZZA 5D1NA 5DGHA 2QQ5A 4O4HF 4U9IS 5H81A 4R69A 3ZBTA 4L5AA 4CKEA 1A5TA 4UQOA 1XZCA 1IM8A 1A9PA 1FW8A 1NVFA 2MYUA 2PLAA 5B1IA 3A6HA 2PWBA 3UJPA 3I9FA 1DIOB 2HHJA 5AMXA 3OOWA 3QFHA 3FTEA 2PA0A 1Z75A 2OBYA 3KWJA 1HE8B 1OXKB 1I4WA 4JKIA 4MCJA 2HT1A 4GDMA 1N33B 1XTUA 3WX0A 1E99A 4IHKA 4JYBA 1R37A 5MGNA 2EKZA 1FYVA 4FILA 4NG4A 4R1NA 4CNQA 1RW4A 1N77A 2PLWA 2P6OA 3QVWA 4PHHA 2XOXA 1NVGA 1T0HB 2JIMA 1VLZA 2Q8NA 3PE4A 1ORIA 4MV8A 1JVNA 3T5GA 3UKOA 1QWSA 2ISCA 2L69A 3LXXA 4HDSA 4MCHA 1HYBA 1CU1A 4UREA 3BHMA 3SQDA 3TTVA 2Q2WA 4KJZA 5KQMA 2PWPA 1HDXA 4YFVA 3BCSA 3EIXA 1F3LA 3FVRA 1ABEA 4O4LA 4GLJA 3HB0A 1EFKA 4FDTA 2QRQA 4MW1A 3KUCA 1CZKA 5B7QA 4MRSA 3TQRA 2BMEA 1JT2A 4K86A 3V2GA 3BB4A 1CLUA 1E7SA 5F78A 4BN5A 3TECE 1BDMA 1RRCA 1UPUA 3W1WA 4GMKA 2OPHA 4YRNA 2ECKA 3LRPA 4ZYZA 3R9IA 2I7TA 5AJUA 1AOXA 1UMDB 3HJUA 1GARA 1KQ3A 5IUKC 2B4RO 2IQIA 1PNOA 4FOTA 3UMBA 3DCYA 1EBBA 2CFTA 1G8MA 1R4NA 3GP5A 4I9NA 5LA6B 4RF5A 1AH2A 3H8WA 3CPSA 1KQPA 1D4AA 1TYBE 2VAXA 2E1PA 2ZJBA 1IPFA 2EKDA 4LGYA 1ENPA 4R2JA 4ALMA 4EY6A 1I9GA 3BE5A 4QBIA 3V1TC 1WZEA 3NUZA 3LCVB 1OFGA 4MUEA 3ZGXA 3CKKA 1L6RA 3PR2B 3U0BA 4RESA 2BEJA 5C8VA 4JGGA 2BBOA 2JFZA 2X0RA 1HE5A 4MI9A 4DBZA 3WWDA 2GXUA 2GMWA 1UK6A 2QTWB 1PJQA 3IIKA 3PC2A 4MUGA 3RF7A 5IVHA 3IPYA 2QZZA 4KC0A 2G5TA 3DD5A 4RDCA 4UNRA 1T4BA 3EF0A 3W1EA 1DI0A 2GZRA 3VHLB 4B6SA 1EINA 4S1NA 1CJUC 2NV0A 4B5KA 3RUAA 1RACA 4U8HA 3WL4A 3QENA 2DQYA 1HFEL 4I14A 4I19A 3DS8A 1YZ3A 3EBLA 3IUYA 2WP8J 1NYQA 4EY4A 1MC1A 2XOKA 1WXGA 3L6DA 5IAJA 4AURA 1AKQA 3OJLA 4HRAA 1QTNA 1NAHA 1GTJ1 1UC5B 4N5HX 3RFVA 3HM9A 2VJLA 3OT1A 1BMQA 1UBJS 1XEWY 4DR6B 2HFKA 2KJQA 1WL8A 4RULA 1Y5LA 5CM8B 2RHHA 4OHKA 1M8JA 3D8UA 3DBHB 1MOQA 3MXTA 2P2ZA 3N6RA 1PL0A 3PRJA 3QE9Y 4C4OA 1SM4A 5DM4A 4F9TA 3T5CA 3UMYA 1PEDA 3WDSA 1JH8A 2XYHA 3E3LA 1EP3B 1SMKA 1P29A 1SULA 1WAMA 1BVYF 3B85A 3FSGD 3R2JA 1OIWA 4KB5A 4PCLA 1MC4A 3EHEA 4REQB 2Q2NA 4B6GA 1VKRA 4JC0A 1Y5RA 1T4GA 3H0KA 1YRWA 2FLKA 3ZVLA 3NWBA 1LW7A 4UM9D 4BKRA 2VXOA 1M74A 5GMOA 4RFVA 2A9KA 5ELXA 2FHSA 4JQSA 5IW8A 5TJ9A 4IIFA 3H87A 3C7KA 3MD0A 4FLEA 4EJSA 5B57C 3OP4A 1DIAA 2IZ0A 3QKTA 3A1EA 3EASA 3ZWAA 2PA3A 4XWGA 5FUMA 5J4HA 2CXSA 4LQDA 3AETB 1R8QA 1HDCA 2REOA 4O2AF 5BNTA 3I3SR 5D3KA 1CUVA 1ZH0A 2FWBA 3NTVA 4NPHA 5HRAA 2FPUA 4OKIA 4FUQA 4LDNA 4HB0A 2YHUA 4MX8A 4TMFA 4YJHB 4BLSA 1QYCA 3KTFA 3LT2A 3I2FA 3MSCA 1T1GA 4Y2GA 1NATA 1ZMXA 4L02A 3WYCA 4OL0A 4Y67A 1CX9B 2IW1A 2EG9A 1NLYA 3WBFA 3U4QB 4EQZA 2DSTA 3K16A 3HEMA 3EVAA 3GGJA 3K4QA 1YMQA 3QUQA 5I9NA 3PKZA 1M6YA 1B0ZA 2OHFA 3L7BA 3C5CA 3OCYA 4P33A 3MIIA 4ZAVA 1AN0A 4L76A 5TMEA 1BMDA 2FSSA 2X19A 3NGLA 4AN4A 4W5TA 1W75A 5D2CA 4P08A 4IMRA 2JHCA 4XD7D 4C0LA 1P2TA 1IL0A 4JUCA 5LBUA 4PIPA 1U4OA 3WL5A 1M7GA 4YJ3B 4WY2A 2ZUDA 3CCBA 4EFMA 1K2WA 1YMVA 4EPTA 4M0EA 3I1FA 3QLJA 1WTAA 1XRRA 3H3JA 3L3BA 4L8LA 1Z5UA 4LOHA 3SZGA 5HR5A 3WKDA 2J6IA 2NP6A 3CH5A 5I47A 1IVSA 4ZZ3A 3OICA 1YK1A 4KBYA 5C1DA 1T0PA 4V0OA 1NRJB 4HZIA 3VR6D 1THMA 2FOXA 3AC0A 4C88A 2X5NA 3ABSB 3L40A 1ML3A 3IKMB 4DPLA 2JJ2D 4LSGA 3LSTA 3R5JA 3TOVA 2XDAA 3PS9A 3TNYA 1DZIA 1J8YF 3BK2A 3TBKA 1SKBA 3F78A 3H1AA 4J90A 2ZU0C 1RM5A 1C8BA 1YDWA 4GSYA 1UJ5A 4P80A 1FXWA 1QE5A 3ZY6A 1SURA 4YCDA 3HB7A 3UJDA 2AYXA 4MW6A 1ZUIA 4J29A 2CJFA 4ZT3A 2I4MA 2YYYA 4COOA 3NDBB 2DSNA 1N8SA 3L8CA 4KU4A 1E5VA 1VP9A 1UPXA 1ZUNA 4OH7A 2ZYHA 5HE8A 4XWKA 2C88A 3D1VA 1E69A 3K2IA 1CY1A 2X1LA 1QH0A 3CM0A 4R7TA 4D43A 3FMVA 2PX2A 3ZZ1A 1NYTA 4G67A 1GQ2A 4YUZA 5CYOA 1PZNA 2EDAA 2ZIGA 5IABA 1DAEA 1RQGA 4F4JA 3NWPA 1OR8A 3IXQA 5EHNA 1ZC4A 4NECA 4TS9A 4WN3A 4YRTA 1VDZA 5CVJA 1Z7WA 3CWZA 3LGXA 4PSKA 3V6LA 4QPNA 4C5BA 4C7BA 4E2WA 2ZUCA 1Z3IX 1USWA 4I4TA 1MV8A 2C59A 2JANA 3QEAZ 4Z99A 1DWUA 3HVIA 5K4AA 5M04A 2ABWA 3QFSA 5I9SA 4AN1A 3LKZA 1XJQA 2YHAA 2QX8A 3FDFA 4B9EA 3K0CC 1WX1A 3EC1A 3LWNA 4XJTA 1YQTA 4N5IX 3H7AA 2JLVA 3PDIA 2VDRB 2Z3ZA 2OENG 5JAOA 3FPJA 3TM4A 1V4BA 3TNDA 4ALNA 1TGYA 4PBSA 5JNTA 2QI9F 4UMFA 3RM3A 3L82B 4FDMA 4UUMA 3WRXC 1Z36A 3DH0A 3EZYA 4CKWB 1AMUA 1E60A 1FFHA 1MO6A 4UEWA 5IZ4A 2BGGA 3GD7A 3K30A 1HDYA 4BFZA 2NUBA 1GSIA 1TK9A 1OZ0A 2RHMA 4I4TB 1MHTA 2BGKA 1U94A 1UBFA 4PXAA 1F2TB 2QTFA 1QFYA 2FFHA 4CKXA 3BF8A 3V3KA 5C1PA 4R41A 1T9DA 2HA6A 3GUVA 1JTVA 2J30A 4ZODA 1U1DA 2MSNA 2VA9A 1JIXA 1Y8RB 2J5BA 4LBWA 1FK8A 4M37A 1NJ1A 4X44A 4YAEA 5BNIA 4NZYA 5BSGA 5CG1A 2WWYA 5B4UA 3THYB 2I66A 3NTRA 2X8BA 3AFMA 2ATEA 2G77B 4K2HA 3DT8A 3BHIA 4MUBA 4MMXB 3OMWA 2QTVB 1T9CA 4OFXA 2F8LA 1EVEA 3AHGA 5H82A 5IDVA 5KDLA 3LUAA 4LHZA 3AG6A 1GHTA 1WB6A 1B14A 4UE2A 1XD2A 3ROKA 1RLOA 1PJBA 4FOOA 1P5ZB 4KUEA 2FPPB 3G9XA 3U7GA 2FLVA 4M2LA 4XYMA 2F1HA 2QE7A 4G0YA 3GARA 4WN9A 3FBWA 4KSYA 1OBVA 1G8FA 1X1EA 1BQEA 2K6GA 4MAAA 1ADBA 2QMYA 2I78A 4M87A 3IOCA 1D7OA 2NNWB 3CVYA 1JR3D 2OO5A 2HM7A 2VSOA 1IM5A 1RFLA 1WVIA 1I3OA 2ZIEA 3IJRA 3AINA 3K0KA 3M4YA 4IH1A 3OTGA 4IG4A 3VC3A 3AYZB 2E21A 4GXRA 5BV1A 3T3OA 1P7WA 1KDVA 2WD8A 2KLHA 2IBMA 2VPIA 3BHNA 3B9BA 2CXQA 1JSXA 1H1LB 2JGDB 2D2VA 2OKGA 3P9XA 4PWYA 4QFCA 3RRXA 4DEXA 2D62A 4EHNA 3E5HA 4AY3A 1A69A 1L5RA 2SICE<