3HPRA

Crystal structure of v148g adenylate kinase from e. coli, in complex with ap5a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDGTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
molecule tags Transferase
source organism Escherichia coli
publication title Rational modulation of conformational fluctuations in adenylate kinase reveals a local unfolding mechanism for allostery and functional adaptation in proteins.
pubmed doi rcsb
total genus 78
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hprA00
1BYUA 3OE7A 1IXSB 3AF3A 1UKEA 3BXZA 1KK0A 4Z8XA 2IX3A 1SXJC 2ZJ5A 1WBDA 1N2CE 4Y0AA 4Q1BA 1KSGA 1UBFA 2J87A 3QKSA 4LHZA 4BFXA 4CT4B 1O87A 2IS2A 1NBMD 1U98A 2BJVA 3T1OA 4ZKDA 2RGBA 4O25A 4YDSA 1NJGA 1CULC 4XTRA 1KZGB 2J0UA 1FUUA 4TTQA 4LRWA 2OLKA 3PUWA 4M1MA 3VAAA 3KQLA 4BLRA 4XWAA 4YDHB 4Q21A 3R7WA 4D80A 4CVNA 2VP9A 1FTSA 2W0SA 2ZETA 5FFMA 5AJZA 1F60A 1NMYA 2G83A 2B6HA 3EX7C 3ZZ0A 4FMCB 5JBQA 1WBBA 1WA5A 3NEJA 2O0KA 5EUMA 1UBEA 2DWPA 1W0JD 1US8A 2WSMA 1LV7A 3OIVA 2GRJA 4QBGB 4GDFA 1JI0A 4MITA 3E2IA 3RS7A 4WW0A 3M4YA 3I62A 2GEVA 1ZNZA 1F3OA 4BFVA 1ZM4A 4ZIRA 3TUZC 4KFRA 1ZIPA 2VP2A 4XD7A 3W8NA 4RKFA 3M1IA 4DZZA 3LAWA 2GAOA 4F92B 1XJCA 2FNAA 2G3YA 4EFNA 3RWOA 4R7ZA 1G8YA 1GRNA 3CX7A 3JZMA 1W2HA 4KI0A 5L3QB 4JLBA 2HCBA 1LF0A 2RHDA 2DFKB 1U99A 4XWOA 2IUTA 1E0JA 1S1CA 3SOPA 3FKQA 3UMSA 3HP1A 4CF7A 3CNLA 4X8HA 3I32A 4MGKR 2ZR9A 4RJLA 5KNDA 3ND9A 2IYTA 1XZPA 2J1LA 2WIBA 2WBLC 1W4BA 3AP3A 3PV0A 1OH5A 2JLQA 1UKVY 2XJ4A 4A6PA 4OQLA 2NO9A 4UQOA 4M1OA 4UXHA 3SS8A 4R98A 3NTUA 3UKDA 2HXYA 3GLHE 3L0IB 5JECA 4B43A 4K8OA 5FPTA 4W9MC 1TUIA 2G6BA 4UNRA 3GLGA 1Q3HA 4B76A 5L3SA 5BYKA 1UF9A 4RZ3A 3NC1C 2ZRPA 1EK0A 4D6PA 3MWKA 3OF5A 4IFBA 1KSFX 1M34E 3B1XA 4IOLA 4F7WA 2GK7A 3D8BA 1XPUA 1MO5A 4M2LA 4NYMR 3ECCA 3BORA 1J8MF 4P4SB 3TW8B 3U7EB 3H86A 3SU8A 4LPKA 2ZJOA 4B32A 2PMDA 1X86B 3AH8A 4NHOA 4BFWA 4TT3A 2ZYUX 1GKIA 1ZCAA 2YOGA 4Q1CA 5JFGA 3GLIB 1LS1A 1Y3AA 3HU2A 5C46F 2YHSA 4TL9A 5LB2A 5B64A 2CEAA 2W00A 3Q8XB 1C1YA 1IONA 4MYCA 3W8RA 1X8LA 3VHLB 1UFQA 4PAOA 1T0HB 2QG6A 4LYHA 3VNVA 3A1TA 5DLQC 3UG6A 1GKYA 4HDOB 4OJKA 2E87A 1UBGA 2B8WA 3CB4A 4C3ZA 2J9RA 3R9IA 3SHWA 2C96A 2AXNA 2ZSDA 3GEHA 3MMPA 4EJSA 5JWOA 2IK8A 2BEKA 5HTKA 3IKJA 2ERYA 1CEEA 2WJVA 2QMHA 2JLRA 1F2UB 2R6GA 1H65A 1SVMA 3IIJA 5EP2A 3W90A 4EAQA 2JIZD 3U7HB 4A0FA 2WV9A 3TBKA 3UK6A 4MYHA 5TMPA 3QXXA 2IHBA 2WSSD 4RFSA 4YMSA 4ASUD 4YXWA 3AM1A 2XTNA 1G17A 3O8DA 1L2TA 1R8SA 1LB1B 2UKDA 3TVDA 4JBWA 1G291 4Q4JB 3UATA 1KMHB 4C0LA 1M74A 2NZJA 3HWSA 3FB4A 4KYUA 4RD2A 3SBDA 2VRWA 5DI9A 4QGHA 1AGPA 4V0LA 3LY5A 2O8EB 4NCNA 2C04A 421PA 4S35A 1W4AA 2QZ4A 4M9XA 2WWYA 2NG1A 2JLSA 4MA4A 3QKRA 3L0OA 4LUCA 3C5HA 1KO8A 2J5XA 2WJHA 5KDLA 1G8HA 3K0FB 3WNCA 2ZREA 6Q21A 1P2SA 5JMTA 3DVLA 3KXLA 2CDNA 5K8UA 4D2IA 3UANA 2J0SA 3AF0A 4RCZA 4G5GA 4BFYA 1J2JA 1P3JA 3FMPB 2NOAA 4LPSA 4MGYR 4OHXA 4Q7JB 4JL5A 5D3MB 2IS6A 3BWDD 4MQBA 4BLTA 3B8HA 4S2EA 1E2GA 2V6IA 4HLUA 1CJTC 4X8OA 1R0WA 1VKJA 4C30A 4JMPA 2D2EA 1T9HA 4RKEA 1IY0A 2NO1A 3BH0A 3BAFA 3VTKA 3HU1A 1R2QA 2DHRA 2I1QA 2B7CA 2D3WA 2JASA 1U8ZA 3LLUA 1J90A 4O2LA 3QKSB 2D62A 3TIFA 1RRGA 2P5TB 2XGJA 4B71A 5FTJA 2D74A 4M9SA 5H68A 1CTQA 4XSGA 1ZUIA 2ZI9A 4LV8B 3FHCB 4PSAA 2GETA 4LDJA 2ZR7A 2ZVPX 2O8DA 2VLIA 4A8JC 3AVYA 3B6EA 3PQCA 2WMOB 4URYR 2OZEA 1SULA 3K70C 2CHVA 2OBMA 1U0JA 4DT1A 3PEYA 3LLMA 5CIQA 1E0KA 1JXMA 4ON9A 2PJZA 3B7GA 1XEXB 3GEIA 1AKYA 1E79A 1Q3TA 3AUXA 3LWNA 5FBQB 3WMGA 3K0CC 3QEOA 1UKZA 1Z08A 1DEKA 3ZS8A 1Z0AA 1XF9A 1OXVA 1D2MA 2IYYA 3TSZA 2R44A 4JYBA 4MRNA 5CJ2A 4LC1A 1NN3A 4PZYA 2ZROA 2Z6VA 2WWXA 1FZQA 2VQSA 1E2LA 1IXRC 1KNXA 1RRCA 4C7OA 4A1FA 1IY2A 1YZLA 3X2SA 5F98A 2FGKA 3QPUA 1IN6A 3FYHA 5LBIA 4B6FA 4CEHB 2A5FA 2QPOA 3T12A 4DIEA 4Q4LA 4CEIB 1Q20A 4EPRA 1KK1A 3RWMB 1EFTA 1R0XA 3IDQA 4N0DA 3EZ9A 1OLOA 1Q44A 4JIMA 1ZUNB 5F2EA 4ESVA 2FG5A 2OXCA 1MRNA 4TL7A 3QIAA 1YR8A 3R8CA 1SGWA 3RRMA 3EARA 4H9GA 1KI7A 2H5EA 4LK2A 1VYVA 5KSYA 4HAVA 4POAA 3VR2A 4O2RA 3UWOA 1GIAA 1XU4A 5G3YA 1P5ZB 1NI3A 3Q9LA 2REBA 1N5IA 1YZGA 2QP3A 4G5RA 3TUJC 4G1UC 2QRNA 3SJAA 1JPNA 1ZU4A 5CYPA 1IY1A 2CJWA 3TNFA 1C9KA 5KUTA 3W9YA 2B92A 5BYJA 3LBNA 1AGRA 3SBEA 4ZV4A 3TQFA 4M1KA 2IYVA 1SQ5A 1GOTA 4Q7MB 1T0JB 3K9GA 3CLVA 4KSCA 1OYWA 2W2TA 1FW6A 4R9UC 3QKTA 4FMBB 1ZAKA 2J3EA 2BHRA 3QVUA 2HEIA 1VG8A 4DEYA 2GXAA 2CL0X 4PQRA 5AK0A 5FTLA 4EPYA 1XDBA 3G82C 1MH1A 1G20E 1TQ6A 2YJTD 2VF8A 1YR6A 1ZVQA 1E9FA 2GDJA 4QG7A 1KKMA 4UNSA 4V03A 4CW7A 2OUKA 2LKDA 2LWIA 3AGQA 2XSZD 4KBFA 3UMRA 1N5JA 1US8B 2F1IA 1JQJC 3VFDA 4B3CA 1HYQA 1ESNA 2PX0A 3GD7A 3HR7A 4RD0A 3GLHA 4RD3A 4DWJA 1NN0A 5D3QA 1NN1A 1A82A 1RJ9B 2ANBA 3MSXA 1AKEA 4TMVA 4A8JA 2GCOB 1PV4A 1KDOA 3LQRA 1W2GA 3ZD7A 1CR4A 3NH9A 1CS4C 3F3YA 4KBGA 3TR5A 5DIFA 3QNUA 3FWYA 3K8YA 4FCWA 5HE9A 1NIPA 3UMFA 4W5HA 2GCNA 2CCKA 4Q02A 3TK1A 2IYLD 1E32A 3LO5A 3P32A 5L3VA 1GAJA 4KVAA 2GJKA 3IHLA 3LW7A 1T3HA 2CCJA 5DYGA 4P31A 1E1RA 3ADDA 4TSFA 3UWKA 4TZ6A 2HT6A 2WJYA 3W6NA 4LV6A 2LKCA 2C77A 1KYIA 3NDBB 1NJFA 4BFTA 2CXXA 1XTRA 3CKLA 3ADBA 5HCNA 4MGZR 3L82B 4FI3C 2O5VA 5FUWA 1F2TA 1D5CA 2FFAA 1F48A 2H17A 4FCVA 4CEHA 2UZIR 1N6IA 5SZHB 1CXZA 3SJCA 4D0LB 2QRZA 3DL0A 3WHKA 1XCPA 1WCV1 1G3MA 2EVWX 5C1BA 4BECA 4QJ4A 1W36C 4IDQA 3SR0A 1Z0FA 5FPKA 4F93B 2AFHE 4OHYA 3C14C 3KXIA 3AF2A 1M7GA 5DN6D 2QGZA 4IEIA 2Z4RA 2W2VA 3D7MA 4IOKA 3AVPA 1KI4A 3LQQA 5BQ5A 5E3HA 1UEJA 2FE4A 2N42A 3CF6R 4LJ6A 3BBPA 4XTCS 5FBVB 1NVUQ 1RC8A 2EFGA 2OAP1 1XXHA 3I92A 1DAGA 2G1JA 2EFHB 1FMLA 3PJRA 3ZZUA 1II8A 1COWD 4DSNA 4F91B 2QNRA 4MRPA 2ZUBA 2QP9X 1XD8A 1SKQA 3MWLA 3QPWA 3T5GA 3AQ4A 4WIAA 2CLSA 3MD0A 1JB1A 3L0SA 3GLGB 4URUR 4AI6A 2GA8A 2HYDA 4E5UA 3QUSA 4LJ5A 2G0TA 3NVAA 2FOLA 1FMJA 2HV8A 3CF2A 5HKKD 4GSYA 4UXJA 3AB3A 1MRSA 2FZ4A 4GI7A 2PX3A 3LV8A 4ZI2A 4MRVA 1G41A 1KI2A 1VCIA 1VYTA 2IF0A 1GRRA 3SYKA 2ZJAA 5DH9A 4B35A 5DE3A 1UM8A 2Q3MA 1VIAA 1OHHA 2JJ8A 1NL3A 3TAUA 4KFUA 1OFUX 4B3XA 5JI3E 3BGWA 2C9YA 1DAHA 2Z5FA 3OEED 5DO9A 3VQTA 4DHEA 3I4LA 4GPTA 1QRAA 1OIVA 2GVDC 5E4FA 3WP0A 4B2PA 1QHHA 2NPFA 4EIWA 2FFBA 4FIDA 1WQ1R 1XEFA 2ODEA 5B58C 4EPWA 3B1WA 1TF5A 3B1VA 1HE1C 5CB6A 1XPOA 4M0LA 221PA 1GKUB 1AA9A 1M7BA 1H8EA 1R7RA 1ZM2A 5IK2D 5J4VA 4GFDA 3KFXA 1CKEA 3RRYA 4ITRC 3K0AA 2IBMA 1XTKA 3MFYA 4B3GA 2NZ8A 4PXAA 1SXJA 1S8FA 5H1YA 3TVTA 4XIGS 3QKRB 5KNCA 4Z51A 4BFZA 1JBKA 3OZXA 3FTQA 4CT5A 4AKEA 4PX9A 3DMDA 1RVDA 3P20A 2BMJA 1E4YA 5AJYA 1Q1EA 3KDSE 3GLFA 4U02A 2JATA 2G9NA 1OIXA 3Q85A 1E9CA 4JT4A 5EP3A 3GLHB 3NBXX 2BMDA 3K9LA 2JDIA 3THYB 1CLUA 1FP6A 2C78A 3JZAA 3HDTA 3OIWA 1QHXA 1R0YA 5A5GA 3L0PA 5FUXA 2ZYVX 4BFSA 4B2IA 3HPQA 4DUGD 1YR9A 2PZGA 3AP1A 2AD1A 4LX0A 1PLKA 4TQUS 1FPMA 3EPKA 3NC0C 1VCOA 1N5LA 4C0JA 1EGAA 4TMXA 4BZPA 2J46A 4Q03A 5JRZA 1P6XA 3ZQ6A 1I4TD 4QL3A 4WZ6A 2Q9CA 2IYQA 4Q4JA 2H1LA 1E1QA 4RY2A 1GL9B 2YC2C 5EQTA 3AKDA 5G3ZA 4ESHA 2F1RA 4LY6A 3T1VA 3R9XA 1G21E 4BPBA 5GADl 4LSGA 4X8MA 3REGA 2KBEA 3U3MA 1WF3A 2A5DA 1IN8A 2ZJ2A 1SVOA 1BH2A 4HUQA 5AUNB 3SHFA 4IFEA 5HPYB 4A0HA 2PL3A 4PQFA 3QXJA 1E9DA 3I3SR 2FEMA 5CLLA 1T4GA 4KLZA 2EWWA 1XZQA 4UJ5A 2JJ1D 2IYXA 4QJ3A 2WWHA 1KSJA 4JL8A 1SXJE 4V0KA 4DLYA 2JIZA 3I5XA 5EJEA 3TMKA 3R9WA 1WDTA 1XBTA 1HEIA 4NPHA 4ZDKA 5JSZA 3KB2A 1OH6A 2RGGA 4DT1B 1FL9A 4V0OA 2HDNB 1AZTA 2IT1A 3LXXA 3WNDA 5C18A 5P21A 4U7DA 4GP7A 2JJ2D 1GDDA 1JEDA 2WM9B 4NYMQ 1TQ4A 1ODFA 4DDWA 2AK3A 4Q7LA 5H70A 3ZGXA 1OB5A 1GRQA 4NYJR 2GNOA 1U9IC 2VH5R 4ABYA 3B1YA 2F7SA 2A5GA 3QXHA 5H8WA 2W2XA 4LYAA 4PPFA 2XITA 4FMCF 2CVHA 2CE2X 1NKSA 3PUXA 1J70A 3CW2A 4Y0VA 4FWTA 2ZS9A 1XD2B 4ZPXA 1ONBA 5KOYA 3B78A 5FPYA 3QE0A 4CZ2A 1AS3A 1KK3A 4KVGA 5B30A 1NLZA 5BN5A 4DB2A 4UXIA 3THOA 1NVWQ 3BK7A 1ZMXA 2X77A 2BCJQ 2YINC 3GFPA 5IT5A 1ZD1A 2AN9A 3VX4A 3AEZA 2D06A 3EG5A 2QEQA 2ZRCA 4QNRA 1QDEA 1DVRA 1N6KA 2ZQ5A 4OQXA 4DCSA 1JR6A 2ZI6A 4D26A 3AVQA 3MJRA 3OAAD 4NYJQ 4C2UA 2BWJA 4YXWD 1IM2A 5CITA 2GF0A 5BN4A 2G1KA 4J0QA 4Z8YA 4OHWA 1W4CA 2WOJA 3QXCA 4AG6A 4ACBA 4TYYA 4TQAA 4A2WA 2GEUA 3I61A 3H0KA 4AK9A 1T8UA 3A37A 1GUAA 3EZ2A 1CRQA 4P0TA 4UKDA 2NGRA 1JAIA 5FR1A 2FDCA 2R6AA 4L9WA 4LYJA 1ZYUA 2ZE5A 4C0KA 1G7SA 1E96A 2FU5C 3AP2A 3IPXA 3U44B 1N6LA 3PUVA 4ARZB 1UBCA 1P9NA 1YRAA 2KB0A 1D8TA 4DB4A 2QBYB 3SQXA 2P67A 1Z6TA 4WXPA 1JAHA 2TMKA 3RAPR 4HAWA 5IF9A 5EP1A 4DEXA 4EKDA 1CR1A 2WWGA 3C16C 4QBFA 1S4QA 3DOFA 5AR1A 4TZ0A 1VTKA 2O8EA 4OL0A 2H92A 2GAAA 3EW9A 3LDAA 1XMJA 3AV0B 3CH4B 1E9AA 4MRRA 1LFDB 4LHVA 4WAUA 5AUPB 3B5JA 1ZD8A 1VHTA 3BRWD 2PLFA 1EFRD 2QMUA 2WKRA 1MO6A 5HCIA 3NWJA 2FFHA 4TMWA 1KI3A 5TXGA 2ZPTX 4GBMA 1T91A 1WE2A 4HLUC 1OFTA 2OFXA 2J0UB 2F3RA 3ZLJA 1HTWA 3CNOA 2QAGA 1EESA 2P6NA 3QF4B 2R6DA 1WB9A 2D7CA 2MSCB 1O3YA 2ZJYA 1G6OA 3IQWA 4LV5B 3WBKA 1LF5A 3U6KA 4Q1AA 4EPXA 3GLIA 5F3WB 2V1XA 4D25A 1DBSA 5GJVC 2OCYC 3FPAA 3CPEA 1ZJ6A 2O0JA 1F5NA 4KXFB 4PTLA 5K8TA 5CM9C 4L8GA 1XMSA 3GLIE 1TTTA 4P4SA 2P6UA 3PXGA 4TMTA 1WMSA 2ORWA 2QT0A 3HR8A 4D81A 1AJEA 3CRRA 1VYUA 2ZAOA 4LZZA 2GESA 1XEWX 4Q66C 2PH1A 4KAXA 2BBWA 2HCJB 1ZRHA 2DY1A 4JKYA 1Z29A 121PA 1X8KA 3ZVLA 2X2FA 5CLQA 1K5DA 4Q1EA 3ASYA 2QMEA 1M6NA 2BMEA 2PCJA 4DKXA 2A78A 5B57C 1EXMA 3OEHA 2V7QA 1W0KA 1E98A 4A92A 1I4LD 3GJXC 1RZ3A 2ERXA 2Q21A 3IIKA 3IO5A 2V1UA 2FA9A 3LX5A 2A5JA 3OHMA 2NO7A 4HUTA 5KPJA 1KMQA 3QBTA 2IYRA 3SEAA 2GF9A 3SI7A 2C2HA 5EE9A 5FUYA 1J7KA 1Q12A 2ZU0C 4IOMA 3T1TA 1GNQA 3THXA 4LJAA 2YYZA 4HAYA 4N1AA 4RD6A 2KSQA 1N0WA 2GJ9A 1FP7A 3RNLA 3WMFA 2OCPA 2RKOA 2EFDB 1FUKA 2A30A 5FPHA 2QA5A 2HF9A 4XD7D 2CHQA 5L3SB 2RB4A 2DBYA 5CM8B 4Z1MA 1DELA 4JVSB 5EZ5A 3GPLA 3KKQA 4M9ZA 3C7KA 4RD1A 2ZRBA 2R6FA 2QTVB 4DVGA 5JEEA 5ELXA 5JJLA 1RPZA 1E2DA 4M8NE 1ETUA 4NZYA 2FSHA 2J41A 3EZ6A 1NRJB 1E2IA 1NIJA 3VX3A 4B33A 4HAUA 1S9DA 4PO8A 1SKYB 2J45A 2VHUA 1DO2A 821PA 1N0UA 2IYZA 4E22A 4TT3D 3WYFA 1JJ7A 2F3TA 4F38A 1RFLA 5L3QA 1B0UA 2AXPA 2O8FB 2QUZA 3EC1A 3KTAB 3IO3A 3WY9A 2BDTA 1OXXK 5FOSA 4ARZA 1P60A 5J40A 4LBYA 2VSXA 5TV2A 1TEVA 4B2LA 2GTPA 3RANA 3IEVA 2FGJA 2DWQA 4ZIRB 1A1VA 1CR0A 2EYUA 1F6BA 1XPRA 1G8FA 1N5KA 2GZHA 1Z47A 4B73A 3AKYA 4Z1MD 3FFBA 3KJHA 3F8TA 1IAQA 4RVCA 1DOAA 1RIFA 1S2MA 4DC9A 1YR7A 4DCVA 1Z63A 3PENA 3AVWA 3IIMA 3A4MA 5KNBA 4NCIA 2ZRHA 1LNZA 3AVUA 5HE8A 1H8HA 3GLGE 3FMIA 1G7RA 5FL3A 1RE0A 3A4LA 2JLYA 3EIEA 3KQHA 4MH0R 1P73A 1XXHB 1SVWA 1E2NA 1KI6A 4OI4A 3CO5A 4OI2A 4FD2A 3B60A 4TLDA 3PCRB 1ESMA 3NHBA 1KDPA 1TADA 521PA 3MWJA 1QVRA 4HZUA 1BMFD 2ANCA 4EFLA 2WTUA 1YJ5A 4HZIA 3AVXA 2IEYA 3L2OB 2IUUA 2OILA 4XOIA 1B23P 2P3SA 1UADA 1AS2A 1HQYE 4P32A 1EX7A 4KLNA 1JNYA 4I4LA 5M04A 1FFHA 4QRHA 1U0LA 4IDHA 3W5IA 2I3BA 4JL6A 2QT1A 3Q3JB 4C7OB 2EU8A 4ZO4A 5GVSA 2O8DB 3AKCA 3OFNA 2O52A 4YLGA 4G01B 2QI9C 1AN0A 4MUBA 4NDZA 2OCBA 4Q4HB 2YZ2A 2QGNA 4Q7KA 3MGCA 1YZTA 3VKGA 1KSHA 2ZE8A 4I1UA 3FMFA 2DR3A 2O8CB 1QF9A 2H7VA 2PMKA 3Q72A 5J47A 5SZJA 3TW4A 3MG9A 3U4QA 3K0CA 2VBCA 4HLQB 3W3ZB 2O8FA 2ATVA 2X1VA 5FOTA 4YC7A 1MABA 3JVVA 1NY5A 1C4OA 1UDXA 3WHLA 2RGNA 1GILA 3TRFA 1GVNB 2BKUA 3MLEA 4FMDB 1R4AA 3TJZA 2ZRIA 3LXRA 4DSOA 2W6JA 3B1ZA 5E7JA 1G5TA 4GZMA 5EE1A 1RW4A 2C95A 2ZI7A 4BZQA 1XJQA 1OE0A 4EPTA 2RGAA 1E3MA 3WRXC 3KJGA 4L16A 4FXPA 1TAGA 4PZLA 1COWA 1Z2CA 2HLDA 4Z54A 3VR6A 1W47A 4GOJA 2QENA 2ZYTX 3I73A 4ACAA 3QBVA 5HR5A 3LFUA 2NIPA 2VF7A 4H1VA 4TTPA 4BLPA 3F0TA 5DI3B 2PT5A 5A0FA 3EA0A 4Q01A 3CR8A 4LBVA 4HB4A 3DEFA 5ANRB 1S0UA 4QHSA 2B21A 4Q1FA 2AKYA 3P4YA 4PO1A 4A4DA 1PJRA 1OF1A 3O8RA 3OE7D 2AR7A 2V54A 4YQFA 4ASUA 2R8RA 4V0ME 2FN4A 4JLNA 3KTAA 1W5SA 1G3QA 4TLAA 2HYIC 1TNDA 3BJIC 3K9HA 1QG4A 3CIOA 3Q5EA 1Z0JA 3P1JA 1XCGB 1E0SA 1E79D 3KQNA 3QF7A 1TL7C 3EWAA 3ZVRA 3A6PC 1BOFA 2V7QD 3U61B 1E6CA 1TQDA 4RD4A 2RMKA 3DMNA 2W83A 4NBSA 5B2ZA 2W6JD 2RCNA 4FCTA 1XD9A 1DPFA 3U4QB 4CGZA 2QTHA 4IVRA 2CNWD 4M9QA 2IUSA 1W48A 1IOZA 3U60B 5EZ6B 1AM4D 4QM6A 4PC6A 2P0EA 4QBHA 4R2HA 3W6PA 1NVVQ 4NP6A 3SE0A 1ZM9A 4AC9A 2PEYA 3AGPA 3M0EA 4QHYA 4Q4AA 1JECA 4HLDA 2WJIA 3QVVA 2OCAA 4BWYA 5EE3A 2ONJA 4A2PA 2AD5A 1BS1A 3QOFA 3HJNA 4G5OA 1R10A 2QMOA 5IK2A 1NP6A 2QM8A 4PZZA 4DLWA 1VG1A 1Z6XA 2ZRKA 3K1JA 4DDTA 4URXR 2WMNB 3U3KA 1II9A 2IXFA 4P4UA 3CZPA 4L15A 4PANA 4C0SA 3DZ8A 4CEJA 4TYPA 4G0NA 4HB3A 1Z28A 1FNMA 2ZRGA 4D0NA 1KO1A 3LBIA 2PT7A 2A3RA 4BQSA 2RGXA 1ZCBA 3DDCA 4US1R 2ODWA 5JHHB 4NKRA 1BO6A 2CK3A 2C9CA 1M1YE 1KI8A 2C8VA 3DOEA 1DAEA 1QZXA 3L8YA 4DLRA 5BWMA 3GJ8A 1QG2A 1FX0B 2PEZA 5FI0B 2R6CA 3MAAC 1XP8A 4M1TA 5AUQA 1TPZA 4PC3A 3RS2A 5FH9A 4M22A 4MRSA 2GWHA 4AYWA 4DSTA 2OSBA 1Q21A 2RHMA 1GITA 4LWZA 3C5CA 2ZR0A 4L5BA 4YMVA 2UZ3A 3RS5A 3ZYCA 4KFSA 2XTZA 3CBQA 2J7PD 1KTVA 3PEWA 1P2TA 3KL4A 4L4UA 4FN5A 4JJKA 3V00A 3CRQA 2RGEA 3TLXA 1A2KC 2WPDA 3TSWA 4UNNA 4E07A 1Z0DA 3KQUA 1VDZA 4TTRA 1QVAA 3C41J 5CK4A 1LW7A 4DXAA 1SVLA 4IRUB 3QI2A 1IN5A 1YE8A 1YQTA 2P2LA 4URZR 5DHFA 1LY1A 4YONB 5JLJA 3GJ5A 5IHPA 2Z43A 4QFMA 5DHAA 2BJWA 4YMWA 5EXXA 2QE7A 3CX8A 4U00A 3QPVA 3QJYA 4G3XA 2GXQA 3E5HA 5CYOA 4GMXA 3BB3A 3N5CA 4TN1A 4QXAA 3GCGA 5LPNA 3ZJYA 5CJPA 8OHMA 1TX4B 3KKNA 4K81B 2QROA 2ZSEA 2GCPA 1EFUA 2RH5A 1NLYA 2PBRA 4GRAA 4US0R 4OYHA 1AQYA 4JBXA 3DHWC 4X8LA 4DJTA 3R8FA 1MKYA 4JSYA 2DPXA 4TWZA 2YOHA 3LW8A 2H57A 3QENA 4DLTA 4I81A 3RHFA 2IS4A 1HV8A 1NSTA 4A36A 2OE2A 1E9BA 1D6JA 1W46A 5AUOB 1E99A 3W3AA 3NEYA 5KYKA 1KGDA 1F2UA 1P62B 1ZC3A 2AWNA 2IXGA 5JS7A 2IYUA 4JT2A 4JBYA 4OQMA 3KKMA 1MOZA 1VHLA 4YMUA 4Q9JA 4KYIB 1MR3F 2CJWB 2RAPA 1FNNA 1S1MA 1XTQA 3ETLA 3PFIA 4BEJA 3BOSA 2XZOA 1FX0A 3P26A 4IXNA 5EE0A 1L8QA 3TH5A 4MKGA 2XOKA 2F1JA 2N46A 1HT2E 3CONA 2EW1A 5KTYA 2XSZA 3SC3A 1BIFA 1G5RA 3THWB 2ZRFA 5KU1A 1T8TA 1FOEB 1E2JA 2Q3FA 3ZD6A 1HURA 4DLZA 1YZKA 1KMHA 5GJBA 1CP2A 2GBLA 4ILEA 1KNQA 4MDEA 3M6AA 4RZUA 1KO4A 3R7WB 4BLOA 2WIAA 1KO7A 4IVPA 5SZKB 3TAHA 1Z3IX 3G5UA 4PC1A 5HZHA 4A9AA 2BMFA 4HDQB 5AJWA 3WMEA 1NVXQ 3PEUA 4IEEA 4JLVA 1Q22A 3ZS9A 5KHOC 3A1VA 4F4IA 1KK2A 3CNNA 3UIEA 2ZE6A 2AKAB 4LJ4A 1W49A 3AVTA 2PJRA 2V3CC 1XMIA 3NIBA 3S1AB 2HUPA 4EQ6B 1E2EA 3OAAA 1P4SA 2ZSAA 3RC8A 4O3MA 2QORA 3CM0A 1OXUA 2FX3A 2GXSA 2XNDA 2VEDA 2F1HA 4Q4AB 1XEWY 2FPLA 3WRYC 2FJUA 3SDZA 2ZS8A 4QKQA 4TL6A 3DKVA 4M1WA 4N0EA 2XB2A 4WZAE 1W7AA 2AX4A 1ANKA 1KAOA 2CL7X 3C15C 1IN7A 2JLVA 5KO2A 3X1ZA 3B82A 3U5ZB 1XNJA 2FSFA 3ADCA 1PLJA 2A5YB 4IDPA 4D4MA 1GSIA 3FHOA 4DUGA 3JVUA 4BUJA 5CDFA 2EYQA 3CRW1 3T35A 5FOVA 1K8RA 2OAQ1 2VIIA 1M2OB 2NO6A 1OXSC 2ODNA 1CF4A 2VYFA 3OESA 4GP6A 3WYAA 1SHZA 2ZAMA 3W5JA 2ZM5A 1P9RA 1VPLA 3K09A 1E9SA 2A7QA 2XNDD 1AQUA 1ZW6A 2FSGA 2ZRLA 4AIIA 2O8BA 1SVKA 2AHOA 3NHAA 3FHTA 4IKEA 1MO4A 3HPRA 3IBYA 2R9VA 3RSLA 2JAQA 3THYA 1HQCA 4A2QA 1KHTA 2Q3HA 4RZ2A 4BE7B 4IXMA 4TLCA 2NTYC 1HE8B 1SHKA 5FBRB 2DYKA 3WBJA 3UPUA 1U9IA 3LA6A 4DCTA 2V4ZA 4K46A 4PSKA 1NY6A 1OFIA 2ZJBA 4NCHA 1VCNA 4UNQA 3KQKA 3QG1A 3QG5A 2BM0A 1EX6A 3LX8A 4Q18A 4URVR 2JLUA 3DZDA 1CU1A 4DSUA 2O8BB 4NL4H 3T15A 3C8UA 3EC2A 1T5IA 3LNCA 4WVFA 2FPMA 2QSYA 3IGFA 1AIPA 3Q7QA 4ERNA 1Q57A 2IA5A 3NBZC 5CB8A 5DGXA 4HLCA 4LGMA 5E7MA 1X3SA 2HJVA 4A82A 4KFTA 5JI2E 2ZXUA 3B2EA 4G5QA 2QN6A 3SFVA 5FOWA 4OHVA 2FFQA 2JA1A 1NLFA 1EWQA 2L0XA 2QPTA 2WAXA 1BMFA 4EFMA 1GP2A 2GXUA 1ZNXA 1Z8FA 2DWOA 5LB4A 3X1YA 4C9BA 3J81k 1JXOA 2PLRA 5TY0A 3CF0A 1XMVA 1KI9A 3KZ1E 4P33A 3MJHA 4NCKA 4TLEA 2Z4SA 1J8YF 1KDRA 2QTFA 3OIYA 3VR4A 1K5GA 2VL7A 1GTVA 3KFVA 3AKEA 1SVIA 4NYIQ 3U3RA 2C5LA 3H4MA 4PC2A 2B7BA 3OFND 3VNUA 1J99A 1DS6A 4B3DA 4PPQA 1KJWA 1QBKC 1PVOA 2K5UA 5FOXA 1HUQA 2OM2A 3I1FA 1W0JA 1YZNA 4HAZA 3RS3A 2KE5A 4ZCLA 5HZKA 3PUZA 3BFXA 4AKHA 4UNPA 2F55A 5JJIA 2G77B 2QY9A 3SZRA 1E2KA 4DLSA 4WOPA 1NMXA 1TU3A 4EUNA 2IW3A 3A58B 4TMZA 3ZIAD 1XTIA 4HEJA 5UKDA 3IBGA 4LYFA 3V4RA 1TEXA 1UDWA 1KY3A 5GJCA 3X1XA 3ONWA 2XX3A 4QOSA 5G41A 4AYTA 1DAIA 4WXRA 3K9NA 5JZVA 1OH8A 5LD2C 3QEJA 3REFA 2OG2A 4US2R 2WKQA 5FTNA 4DLVA 1ZM7A 2GJSA 2ZIAA 3LVRE 2QAGC 4GOXA 4W7SA 3B9PA 4I99A 2ZYWX 4DCUA 1KO5A 1ZD9A 2GEDA 4MYTA 4B47A 1WXQA 1N25A 5JSZB 1P9WA 3RYTC 4HZUB 2BIFA 4A0RA 1KOFA 2JJ1A 1HY3A 2OBNA 2FWRA 2QQEA 3AF4A 4PQYA 4ZCMA 1G5PA 5CK5A 4C2TA 5BW8A 2GJ8A 1PLLA 2XNSA 4JLPA 1OT3A 2MMGA 5KDDA 1G16A 1E0AA 4U5XA 2F43B 2VP5A 1Z2AA 2WZQA 4P4TA 3CWQA 1D2NA 4JKIA 2OBLA 1OSNA 2Z83A 1Y63A 3HYRA 4TSFD 1CJMA 3K70B 3LH5A 5FI1B 3FGNA 1Z0KA 2ODBA 2VA8A 2OO7A 5FOUA 5KSOA 5EUQB 4KO8A 4TYQA 2ZEJA 2DFNA 3I8XA 4OQFA 3RRNA 1S3SA 2F9MA 4DIDA 1G1MA 4JLJA 1II0A 1HA3A 1PUIA 4Q47A 2YWGA 4WBSA 3KJIA 2NO0A 1CJUC 1XFAA 4I1OA 1NKTA 3QXSA 1OFHA 4JSTA 2RGNC 3BH6A 2Q9AA 3O8BA 1YU9A 2ASEA 2B8TA 1P61B 3KX2A 2W6IA 2FEOA 4FWIB 1TF7A 5LDDC 1OXTA 2HF8A 2P65A 2J0QA 1SKYE 1W5TA 4V0NA 2IYWA 4JS0A 4XVQA 2DB3A 1G7CA 2JCSA 3PUYA 4M53A 4OK3A 4F4JA 5G53C 1D2EA 1OYYA 2BKEA 4B34A 1OPXA 3MCAA 4QBIA 1P72A 1U94A 2F43A 1UAAA 3FKSD 3T06B 2RGCA 4UJ3A 4CRWB 1P2UA 5AJVB 4I1SA 1Z6GA 4A8JB 1KJYA 3U3OA 4BRUA 1L7VC 4D82A 3FOZA 3THXB 1DAFA 2JLZA 3ZVNA 3DM9B 1G4AE 1W0KD 3IPYA 1T3SA 1ZINA 1IJFA 4KCGA 2C03A 2ZANA 3I5YA 2ZUDA 1U81A 1XTSA 4NTZA 2QAJA 1HT1E 4LI0A 1ZUHA 1UEIA 4OI0A 4WA7A 1N6RA 2JEOA 3BS4A 1OH7A 3CH5A 1OHHD 4GOKA 4W5WA 3SNHA 3U6BA 1KAGA 1CIPA 1YZQA 2BBTA 1RKBA 4E03A 1DADA 3NH6A 3FDIA 3TGPA 2W6ID 2WKPA 4ZDJA 2ZRNA 1XWIA 1G19A 2KBFA 3H1TA 3ICEA 4ZDIA 2ZE7A 2YVUA 2E1RA 1EWRA 1Z22A 4I1VA 4EJSC 4CIDA 1WRBA 2X2EA 1JJVA 5IDVA 1E2QA 3A4NA 4QGGA 5J4HA 3PITA 3VHXA 5JCPA 5JWHA 2ZUCA 1E4VA 5DSZA 3VR5A 3HYTA 3H2YA 3U7FB 4IVQA 4IW3B 5E95A 4KHZA 1CJKC 2CLDX 1AK2A 1U90A 4XH9B 2KI5A 3B13B 5L3RA 4PSVA 1SXJD 2H18A 4LHWA 3QSYA 2QM7A 4PAQA 3K53A 2J0VA 4PHFA 1E9EA 4CEJB 2R62A 3EASA 3GJ4A 1NF3A 5JRJA 5EE5B 2WWIA 1S3GA 4PHHA 5JJKA 4BGDA 2Y8EA 5TB5A 1Z6YA 1YZUA 4D4LA 4BASA 3FKSA 3EIQA 2QU8A 4R71A 3CUEF 1AS0A 5C4MA 1Z0IA 2BEJA 4CEIA 4AWXA 2JLWA 3QKUA 4LHYA 3D3QA 3LRPA 1QHYA 4O0MA 1ELOA 5EP4A 1P7CA 2OFOA 4Q00A 4A0GA 3MUFA 1Q1BA 1DTSA 1VIYA 4IJMA 1MT0A 5JHGB 5A4JA 1VMAA 1XEXA 1JEEA 1E1QD 5AJXA 4B6EA 4LJ7A 3IEUA 3AF1A 5D3MA 4AURA 4OK6A 3RC3A 3P4XA 2D7DA 3ZZTA 4GT1A 4OKSA 3V9PA 3BC1A 1RRPA 2ONKA 4BLQA 4G5SA 3FE2A 4FMDF 4QM7A 4OI1A 2IS1A 3CX6A 5J4KA 2ZJ8A 1N6NA 2F9LA 2QP4A 3BB1A 3X1DA 3P27A 4TLBA 2UVQA 1ZM3A 1E2MA 3D6TB 5E7IA 2VP4A 2CLCX 3RABA 4Q5IA 4BRWA 1N6HA 4FINA 2QQ0A 2VSOA 1G6HA 3EPLA 1PUJA 3CRVA 3GJ7A 5SZIA 1I2MA 3OEHD 2XXAB 1LTQA 5BXQC 4KV9A 2IF2A 3U44A 4HB0A 4QHTA 3EIHA 1RYHA 2R2AA 3ZIAA 2JJ2A 4M1YA 5FPSA 4RSGA 4PAMA 4NYIR 4RFSB 2YWFA 4HDCA 3W34A 2V55B 1DG3A 2GZDA 4D4JA 2DFTA 3LBHA 3NG1A 3MWYW 4LJ8A 2QE7D 4II7A 1ZU5A 4NH0A 1RJ9A 1XRJA 1TF2A 2ZVQX 4BZXA 1Q1QA 3H84A 3UG7A 5IRCD 4GZLA 4A15A 1ZNWA 1E94E 1MABB 1KZ7B 1QHIA 4FW9A 2LCFA 3KUCA 5JEDA 1KJZA 1KDTA 1ZP6A 1QHNA 1X6VA 2H16A 4B48A 2CHGA 1FTNA 1I2DA 2RGDA 1TMKA 3UXMA 3NXSA 3GFTA 1R5OA 1N0VC 4OHZA 3ZVMA 5AWFC 2WWWA 3EXAA 3BFKA 3QQ5A 1GM5A 1K6MA 2V9PA 3QY0A 2OLJA 2BVNA 3GJ3A 2MMCA 1U0HC 3NBYC 5FUVA 2EWVA 1EFHA 1OJLA 3MRSA 1SVSA 4XSHA 5F9HA 1Z06A 1R5BA 1DAKA 1RRFA 3DPUA 3GQBA 3KKPA 5FBLB 3U3JA 5G40A 2BBOA 5BN3A 1GL6A 2HT1A 3A1SA 1Z07A 2WICA 3T1QA 4PO9A 3GFOA 3I8SA 1D9ZA 3EPHA 2OXRA 2VSFA 2WVJA 3LD9A 1TQ2A 5HKKA 3L43A 2G88A 3ZQJA 1G3UA 2DCUA 2C99A 3DM5A 3KUDA 4HB2A 2ZRAA 3R20A 1GZSA 3T34A 1H8HD 4NCJA 1VG9B 4DCNA 4B44A 1L4YA 3CR7A 4Q9LA 2FV8A 1Q1ZA 2BOVA 4TYWA 5DISB 3IUYA 4AD8A 4C4PA 3EZ7A 4HUQB 5KSPA 2BM1A 4Q9KA 3K70D 4KSBA 1W4RA 3GEEA 1YKSA 4HATA 1ZNYA 4GL2A 2QL6A 4JZKA 2EFCB 4L9SA 4JLOA 4OBEA 2YKGA 2VHTA 4ZCIA 5K8LA 3THWA 3VU9A 2AFIE 2WOOA 4Q9IA 1UKYA 3GMTA 4P3YA 3VR1A 2YWEA 2VHQA 1R5NA 2OEPA 3WP1B 4CYMA 2ORIA 3TSOA 4MKIA 2QPAA 1XXHE 3VKWA 1YVDA 1BKDR 1KI6B 2W0MA 2MSEB 1YHNA 1CRPA 2GKSA 4H1UA 2WWFA 5GVRA 2I1VB 2GHIA 1IHUA 2YC4C 3RSOA 1JR3E 1TU4A 4MDFA 2CBZA 1N6OA 3SJBA 5F9FA 1DARA 4GMDA 1IQPA 4JJZA 4KITB 1W44A 3QF4A 4B74A 3SQWA 5KPDA 2ZSFA 5FL7D 1Z5ZA 3EPJA 2OV2A 1CBUA 5J4YA 5FBWB 2VTKA 2CL6X 1EFRA 2ZTSA 5EXPA 3BERA 2ZI3A 4C0AC 4OK5A 1RYFA 1EG7A 4LHXA 1X1RA 1GG2A 3NDPA 4LBZA 1P2VA 4JLAA 1NMZA 1G7TA 4KODA 3GLFB 1QHSA 3GJ6A 5J4LA 1NG9A 1G9XA 4PPGA 3HU3A 1E2FA 2V8OA 2Q9BA 2WSSA 3KB1A 4RZXA 2OHFA 4XJXA 4XWKA 2E9SA 4QC2A 1Z6AA 4W5JA 5FR2A 4Q1DA 4Q48A 4HAXA 1U2RA 2QBYA 3RDPA 2GZAA 1NBME 3I72A 3DO6A 4JVLA 1N3BA 1E9RA 2CK3D 2ATXA 5CIWA 2XB4A 4URWR 2XTMA 3AUYA 1N6PA 2A2ZA 1JQLB 1VECA 2CNWA 4V02A 3O47A 4D4KA 1NBMA 3U7GA 2IEZA 3B85A 4DLXA 3CPHA 3SYLA 1QHHB 1NSFA 1R8QA 2FPKA 3N2EA 2ECKA 1IJEA 2ZRDA 4JYCA 1V43A 1XD2A 5LD2B 3AVVA 3A1WA 5FTMA 2BBSA 2J7KA 2SHKA 2D4HA 5C4GB 3EAQA 1XCMA 2PZEA 1P75A 3CWZA 3EA5A 2BV3A 3AVOA 1ZBDA 3LVQE 2IWHA 2AK2A 3VR3A 3GLFE 1G64A 2KJQA 4QGFA 1OV4A 3ND8A 4B3FX 3IILA 2EFEB 2YNMA 1NN5A 3FMOB 1SXJB 2FF7A 3RVBA 3BIFA 4LC0A 1DO0A 2VP6A 1E2PA 2X19A 4RFVA 5FL7A 3ZH9B 5J5CA 2JDID 1IN4A 4PPNA 3BB4A 1GWNA 3RRZA 1TUEA 4LJ9A 4GNKA 2IYSA 1G3RA 3NBFA 3WNBA 2O0HA 1WP9A 4AKIA 1Q0UA 4DDUA 2W58A 3VU9B 2XZLA 2N1BA 3PG5A 1GNRA 1V5WA 1LVGA 4EPVA 5TVKA 1X8JA 2HJGA 2BCGY 1QHGA 4F4CA 1XX6A 4ZI3A 1OIWA 621PA 2ZITA 1KI1A 3K0SA 1L4UA 3TE6A 2X8AA 3D31A 2ZS7A 1KIMA 1A4RA 4HI0E 2JGNA 1KKLA 1UPTA 1JR3D 2WJGA 1W36B 4E09A 2O8CA 2AL7A 4DRZA 1UJ2A 3VMFA 3RS4A 2J59A 4QGAA 2WHXA 4RCYA 4PR0A 2Q0HA 4HSEA 4EDHA 1CR2A 1T3LA 1U8AA 4LCBA 2VHJA 2HXSA 2R65A 2GK6A 4ZKEA 2AWOA 1OKKA 3TKLA 2QAGB 3KKOA 3BH7A 3CZQA 3TQCA 4D0GA 2WPDD 2XZPA 2ZJZA 2IWRA 1M7HA 3PR1A 1A5TA 1E1RD 4C0HA 3TUIC 2QSZA 3C4JA 1M8PA 1ZIOA 2REXB 4TQ9A 1YRBA 1GFIA 4PHGA 4XVRA 4NMMA 2ZI5A 3BE4A 1R0ZA 4AYXA 2REOA 3PIRA 3W6OA 2XAUA 3N2IA 3GJ0A 4YMTA 3DKPA 5DNYB 1X1SA 2OFWA 2OESA 2VPPA 3TR0A 4XVUA 3FFAA 4OJQA 1JR3A 1LS6A 1S9HA 4BFUA 2ZU6A 4IHQA 2XJ9A 2CCGA 1G18A 2I4IA 1Z83A 2WAYA 2VO1A 2H8KA 1IXZA 1G4UR 1XB2A 3ICQB 3T5DA 5DI3A 4IDNA 5DN6A 2Z0MA 5K8IA 3WXMA 2CE7A 1HH4A 2IHYA 1JALA 1DE0A 1G3IA 5KSZA 5EXSA 2NMVA 2ZI4A 3SN6A 3B9QA 3GP8A 1IBRA 3IQXA 1KY2A 3SYNA 3A8TA 4KU4A 4TL8A 2IC5A 2OT3B 1GL7A 4JLKA 2J7PA 4C0QC 5TDHA 2FMXA 3RS0A 4QNMA 5JCZA 4AY2A 2ZRMA 4JVMA 2FSIA 4PFSA 4Q19A 2GCOA 5L8VA 3KJEA 2WJJA 2XXAA 1OKKD 4OQNA 3CRMA 5CDFE 1W1WA 2PZFA 2Q6TA 1E2HA 3ASZA 4IDOA 1OB2A 3A36A 2C98A 4A6XA 2NPIA 2XOKD 1G8PA 2JLXA 3X1WA 4LOAA 4N3NA 3V4FA 2GBLC 2GJAA 1T6NA 2A9KA 721PA 5DYIA 4BEBA 3SJZA 2G0NA 3A1UA 2KWIA 4LJYA 5JWRA 2YOFA 4PC7A 3BFVA 3K0FA 2YV5A 4M21A 4NU0A 2CMKA 1DG1G 4C0BA 2ZSBA 5TARA 3OEEA 4B3BA 1U8YA 4BLSA 4R2IA 3EWSA 3K0AB 4QJ5A 1W36D 3OIUA 5EXTA 2CVFA 2MSDB 3E1SA 3Q5DA 5FTKA 1G8GA 1MV5A 2V6JA 2EQBA 1A7JA 3IHWA 5KDOA 2FH5B 4M1SA 1EFCA 1R6BX 4PHTA 4AKGA 2IXEA 4B75A 2FZLA 3FVQA 4M4SA 3BD9A 3ZDQA 3EZFA 1MO3A 2HLDD 4MYUA 3T61A 1XJ0A 3CPJB 2XEXA 2ZRJA 3E70C 2GVZC 1FQKA 4MKFA 4WZBE 4AG5A 5GJWC 1GNPA 2P6RA 4IOJA 3RLFA 3N70A 3L8ZA 2F6RA 1CJVC 2GILA 4TYNA 3G0HA 3WYGA 5JS8A 4JLMA 2D2FA 3KXKA 1S96A 4DDVA 1II8B 4ZDWA 4EJSB 3NKVA 1DAMA 1I4DD 2NQ2C 4LBWA 1OW3B 5C2JB 4JVNA 1BYIA 1T5LA 1SZPA 3K0EA 1ZC4A 3O8CA 1D9XA 4MGIR 3PVSA 3SFZA 1E69A 1H8ED 1NNEA 2C9OA 4V0MA 4TMKA 4Q9HA 2BC9A 2IL1A 3S1AA 4EQ6A 3VKHA 1VCMA 1NVVR 2P5SA 1A2BA 2DFLA 3Q7PA 1AZSC 3K09C 4DBLC 2VHCA 2PCLA 4NE2A 1PZNA 4DLUA 3F5FA 4CDGA 1JPJA 4MKHA 3PEVA 1NG1A 1VG0B 2YWHA 4NONA 3U2QA 2VP0A 3ADKA 4HYYA 2ORVA 4KJZA 1F2TB 4JLDA 4MUAA 1XTJA 4Q4HA 1FQJA
chains in the Genus database with same CATH superfamily
1BYUA 3OE7A 4PGFA 2PFGA 3BXZA 3S0JA 2IEDA 1LBTA 3OQNA 3N3BC 2O8NA 2HHJA 2RAVA 2WVAA 4MGHA 1JIQA 3F5QA 4R9SA 4M36A 2V7PA 1ORTA 1KSGA 4YT2A 3OSUA 5ILOA 2J87A 3QKSA 4G8BA 4BFXA 4YR9A 3TLEA 5E2IA 1NBMD 1U98A 3FNBA 4FDAA 3IMEA 4ZKDA 4F1KA 1OT5A 1USVA 3A6HA 2VYVA 4UOQA 3WLNA 4YDSA 2VATA 4F4DA 3QFRA 4XTRA 2HQBA 3DC7A 2HIAA 4KIUA 4TTQA 4B7UA 2YHIB 3MVEA 3PUWA 1CNFA 1H6AA 4QFDA 4BNNA 5LZ5A 1WUJS 3AZPA 3OIDA 4WBNA 3R7WA 3B12A 1XTUA 2A0YA 3KYDB 4XB6B 2J08A 1ISSA 2WU0A 1OBOA 1RWPA 4ZICA 1N2BA 1B00A 1NXSA 5CB0A 1RXCA 2WP0A 4TOIA 1F60A 1R00A 1XHLA 4D9NA 2B4QA 2O2GA 2G9ZA 5J2UB 3GWGA 3ZZ0A 5HUQA 1RZRD 4FR0A 4FMCB 1WBBA 1GD1O 2W2KA 1UBEA 1R6XA 1W0JD 3PI7A 4E5SA 4L8YA 2A9OA 2VJQA 3PGXA 2QRVA 4BY9E 1LV7A 5CRIA 4ENWA 4LXHA 2VAWA 5AKEA 1QR6A 4GDFA 4BV9A 3JYQA 4M7RA 3L1IA 3G8YA 4WW0A 2RAUA 1F4VA 1Y33E 2A92A 3FNEA 4J0EA 1GRVA 1PZHA 2Q3EA 2GEVA 2VEOA 1VQ1A 1T0PA 1ZNZA 2IPLA 3ZQKA 1QM5A 4HWPA 5J59A 1ZM4A 3WICA 5E1MA 1ZIPA 4ZEOA 3W8NA 3T3DA 3L1JA 2OV6A 3R6LA 3TIIA 1MQSA 3K6SA 4TWAA 3C3AA 2G3YA 1CW2B 1IUKA 4EFNA 2CUZA 2R60A 3D6FA 1G8YA 4R7ZA 3RVKA 3CX7A 1UZNA 4KI0A 1W2HA 4QE3A 5AI8A 1SOMA 5F33A 4NOMA 1RXEA 1XDZA 1PQYA 4A23A 5B7PA 3VNSA 2IUTA 3HUUA 2DSTA 2SECE 2WKSA 1L0BA 3AETA 3PUIA 1M2GA 4KQ6A 4ZGGA 2Z2YA 2Z8XA 4HCJA 2D1YA 3HY6A 4LQDA 3HP1A 4IG4A 3CNLA 4X8HA 3I32A 3UMSA 1AT1A 5KNDA 2IYTA 2WIBA 3PV0A 2WBLC 1W4BA 3MQ4A 1EKXA 1RYDA 2EBFX 1OLXB 4I55F 2JKYA 1NM5A 4PQGA 2BL4A 3F3KA 1EJ2A 1V1MA 3OPXA 4A6PA 4JIGA 4EHIA 2QTZA 3M89A 4LRQA 4KN8A 1PJAA 3F8SA 1IMOA 3NTUA 4KXNA 1MAAA 2HXYA 3GLHE 1R88A 5LP6F 1FX1A 5EHXA 2X8JB 3PQEA 5EMJA 4UNRA 3BHNA 5JNWA 3UOAB 2VRBA 2BGLA 1PSZA 3CO0S 2J6BA 2PKYX 1IY9A 3BBLA 3NC1C 2HA4A 2JANA 4D6PA 4IR7A 3OF5A 4IFBA 1DAOA 4QYTA 4F7WA 4IOLA 2GK7A 1XN4A 4N40A 5C8YF 2BISA 3LWBA 4LNUA 4WRRA 4AY5A 1BJTA 4C0WA 1QGZA 1I1NA 2NSHA 5EXDA 4FOPA 3QJ5A 1TD9A 1GO2A 3H86A 4Z7JA 2YV2A 3JQFA 3OZ7A 2ZJOA 1X86B 1FXWA 2Q8PA 4NHOA 4OM8A 3RHTA 3U17A 1G5QA 5HBGA 4DADA 2DAPA 3TLCA 4PRKA 1KKUA 5IVPA 4K03A 4ZD6A 3D6NB 1FA9A 2H85A 2W00A 3BICA 3LG2A 2A0WA 4IXTA 3H99A 1E5VA 4MUFA 4DV3B 4AAYA 3Q6MA 4RIFA 1OVGA 5E1OA 1UFQA 4AQYB 4PAOA 4LF9B 1RM5A 5K4HA 1SXPA 3R4CA 1EB8A 2R8OA 2ST1A 3OQ6A 3EG9B 4QU0A 3T7CA 3UG6A 3MT7A 4LXTA 3VNVA 1J49A 1GKYA 4BO6A 3MBOA 4LG1A 2ATCA 1A9QA 1PR9A 3R9IA 4AFNA 3SHWA 4EJSA 2ZSDA 3GEHA 1L4EA 4HX9A 1SZJG 1KYZA 3T7RA 3ZHTA 3LQ2A 1X70A 1PT7A 4ZTZB 2ERYA 4YFYA 1F2UB 1EM8B 4RJIA 3IIJA 1GPH1 4P53A 4WNIA 5EP2A 4EAQA 2R6R1 2WV9A 4HPWA 4ISBA 4BO3A 3IMKA 3MCWA 2HGZA 4MYHA 2A33A 3SG0A 1RVV1 1Z2DA 4ASUD 1R4NA 2XIJA 1CUHA 1DWUA 3MYRA 1E7WA 1ZICA 2HRRA 1JG7A 2NVUA 2UKDA 3PPWA 4GLFA 4JBWA 1VJTA 3TVDA 2B1GA 1EWTA 2E2WA 2X5KO 5ICMA 4C7MA 4Q4JB 1IN1A 4J0CA 1KMHB 1G5HA 1HMPA 1KH3A 1R15A 2EKZA 4G8JA 1RM3A 1M74A 5FBKA 3SXUB 3S99A 5EWMA 5CXUA 4KYUA 3LOUA 3UHJA 3B1JA 3IAHA 3L18A 4HGRA 4QGHA 1AGPA 1T2NA 2C2GA 2LD4A 4V0LA 2FN9A 4NCNA 2CL5A 4S35A 4M9XA 1FTQA 3GMIA 3HI4A 3S68A 2D59A 3R3WA 4XYBA 3L0OA 4M8KA 4E30A 3IT1A 2WJHA 3KDPA 2P2SA 5CR9A 1KQNA 2OAGA 3GDWA 4C89A 2JJMA 4DR4B 1P2SA 4HYQA 3DVLA 2HPVA 2CDNA 4NWIA 1QHEA 4MKRA 2PBFA 3T5AA 2J0SA 5E6SA 4FR2A 1PTJC 4FEYA 1CDOA 1JHUA 4EG3A 4BO4A 5LNK1 4LPSA 2IS6A 3BWDD 3T3OA 4MQBA 2ZSHA 1P9OA 4JYAB 5A04A 4HLUA 2V6IA 1M76A 1E2UA 3KV3O 1V96A 4FBLA 1HDZA 1R0WA 5BSVA 4JMPA 1F8FA 1EDZA 2NO1A 1C7RA 1SCBA 2PMFA 3BH0A 3G9XA 3VTKA 5BQ3A 4FYPA 3ICPA 3U7QA 3UJHA 1XG5A 5CT5A 4REOA 4XM0A 3LLUA 5ALVA 4O2LA 3AHIA 5HF6A 4FW8A 4B7CA 4UULA 2WYWA 2JBHA 4BO5A 4F45A 2XUGA 2KLHA 5E6UA 2R00C 3OURA 4JBLA 3ZXYA 2L42A 4EFDA 4PO3X 1XL1A 5FYDA 4WESB 4XSGA 1IK6A 1RAFA 1ZA2A 2ZI9A 4GMGA 1TZMA 3G0DA 1SURA 3PXUA 3U7JA 3RV3A 4Y2VA 4HDKA 2ZR7A 3ROQA 3AMVA 3Q7SA 4KAJA 3I9MA 3AVYA 4UM7A 4JC0A 1BE1A 1OXBB 1XOIA 1LKZA 1ST3A 4X84A 2WMOB 3P9PA 1UXGA 1G2QA 2OBMA 2QLLA 4DGQA 3I2FA 4JJGA 3LLMA 2HWWA 1W35A 3HXPA 2NAPA 3BDVA 3ORQA 2V96A 3RHZA 3ZEIA 5B1DA 2HRCA 3LCCA 4X5OA 5K45A 2WD8A 1EXVA 3IJRA 1EZ4A 1X9GA 3OVMA 5FBQB 5KNCD 4KREA 3QEOA 5EQDA 1Z08A 5EPOA 1TCBA 2XA1A 1EUZA 1UBTS 2J48A 4IDBA 1XCOA 1D2MA 4YFVA 4YB8A 4L1KA 1CP3A 4UBKA 5CJ2A 1RRVA 3FRJA 3NJRA 2ZKIA 3JZFA 3MWDB 2VQSA 2I4NA 5EMKA 4Q9NA 1RRCA 1J1UA 2YIJA 4C7OA 4A1FA 1F8XA 1IY2A 1QH9A 1EZ1A 4XW2A 3CB2A 5FPPA 4RS3A 3ZKWA 3EEQA 1KR5A 3QPUA 3ZGNA 1IN6A 4FFRA 4D6YA 1SBHA 5JR3A 2AN5A 4DIEA 2FQXA 3L46A 5AICA 1QLHA 5JLAA 4KQJA 3VR6H 1JSCA 3B52X 3TMYA 4EPRA 3KETA 4P6VF 1JU3A 5AI6A 2XD4A 3DL2A 5EQFA 3F4BA 5KAMA 4J0GA 1R0XA 3RH0A 4XVHA 4RPLA 1C9MA 1T9ZA 2X5NA 4V3CA 2BELA 5FCDA 3UF0A 3U1VA 4DM3A 1QO9A 2G5PA 1KZ6A 2OXCA 3O73A 1NR7A 2H31A 4PLCA 2G1PA 1MRNA 3QIAA 2C58A 4YIKA 4MKXA 1FVHA 2C9BA 1JLLB 4QPDA 1OX4A 1YQXA 3R6WA 3VR2A 5LMUB 3HY4A 4RZIA 5JAUA 3P2YA 3BMOB 3P96A 2CV0A 1BMQA 1O0SA 2NU8B 2WJ6A 3E9MA 4EI7A 5K4GA 2QP3A 1YZGA 3SD7A 2EIXA 1CNMA 3E3NA 1PQWA 1YKFA 2MDTA 1JPNA 2QRNA 4MVWA 5CYPA 1DTWA 3C7DB 4J4BA 3WYNA 5C1PA 1ZH4A 2CLOB 2CJWA 3R5KA 4F60A 1C9KA 4I9UA 5HX7A 2JHAA 2WT8A 4B7ZA 4M1KA 2IYVA 5AFSA 3RHSA 1DWOA 3QPDA 4U7PB 4MW5A 1NJ2A 1OYWA 3Q3EA 4R9UC 2Q5LA 4XJSA 4D79A 1I10A 2GHTA 1I3MA 2BHRA 2J3EA 3ZDYB 4UQLA 2HEIA 1VG8A 4DC0A 4PQRA 5AK0A 1OI4A 3MGKA 4JJIA 5IJWA 4FT4A 3NIWA 4LXGA 2C3OA 4JQCA 2UYHA 1E8NA 3UK0A 3HGMA 1G20E 2GRAA 3MMXA 1HL3A 2VF8A 3KCQA 3ZEAA 5EZYA 3FG9A 2BKVA 2QYHA 3S40A 1E9FA 1ZR2A 2QN8A 4UNSA 4JC4A 4V03A 1YB1A 2XUDA 4N3BA 2X41A 2LKDA 2LWIA 1SQ0A 2FI1A 4HFJA 4IJ6A 4GLBA 4M6WA 4O4IB 3RTDA 4X64B 4MYDA 2YYSA 2QRVB 3PQ7A 2Q28A 1C1XB 1HYQA 1ESNA 3QLUA 3HR7A 5B4VA 5T4HA 2QLMA 4YRBA 1NN1A 3UJAA 1AKEA 3EXEA 4UTXA 4YV1A 2PVCA 1W2GA 4G8CA 3NH9A 2HQ1A 3PE3A 4PYOA 4EJMA 1CS4C 4Q12A 3WGLA 1N9GB 3IYLW 4FCWA 3DR3A 3O26A 3KZNA 5ALYA 2PQ2A 3H9UA 2GCNA 4I08A 4C3OB 3KE9A 1REQB 1QTRA 1ZI8A 2DG2A 1XZMA 1EXWA 5HQTA 3LO5A 4GPD1 2FTKE 3P32A 4KFCA 3EWNA 3H5IA 4KVAA 2F90A 3M3PA 1T3HA 1KJQA 4HWOA 4DCMA 5C8YB 2EDAA 2P9CA 5EJ6A 4ZC1A 5D6OA 5DYGA 3RUPA 4PN3A 1YA8A 2JH8A 1JA9A 4HWSA 5H3CA 3MSCA 2DH5A 1OLUB 3UWKA 3W6NA 2WJYA 3QZUA 2ZT8A 1CJSA 5I4KA 2OQVA 1UMDB 3JWHA 2CXXA 4BHTA 1TTPB 1PR1A 1LPAB 2XVYA 4ND6A 3NNSA 3MEQA 1VKHA 2UZ4A 1JFRA 3FCAA 3L82B 4K6KA 4DWWA 4UPEA 1OGIA 1F2TA 4RHYA 1EVJA 2FFAA 2H17A 3HA3A 4QX6A 4D0SA 4EA7A 2UZIR 2IIBA 4L4XA 4UE6A 3WQQA 2C2ZA 2IEAA 5SZHB 5IAAA 1CXZA 1X0VA 3NV9A 4UZSA 2Q50A 4BMXA 1QIHA 1U28C 1H69A 5CNKA 4BECA 2NYAA 3WLOA 1ISPA 3GXOA 4IDQA 4ZOBA 1Z0FA 3SR0A 2AFHE 4TV9A 1W59A 3C14C 4FC6A 2RHOA 3ZHBA 1VCHA 4IEIA 4JI7B 1FB5A 2L17A 1E5QA 4IOKA 3AVPA 4GX0A 1Z4IA 3EB9A 4LZOA 2AFHA 1L5ZA 5FBVB 5C80A 1NVUQ 1NVBA 3ES9A 2OB1A 5KYYA 2QXTA 3NGXA 1FC0A 4WOBA 5IKOA 4B6OA 4MHTA 2O5CA 3RSFA 2QDKA 3JRXA 4OF4A 4F91B 2QNRA 4N41A 4DR6B 2QP9X 1ZJ5A 3S29A 4WIAA 4AULA 1V7ZA 2IQ5A 1JB1A 3CRZA 2XCIA 2CLIB 5AM4A 4B84A 3AEUB 3G68A 5IM4A 3S8YA 1P19A 2G0TA 4NSNA 1GEGA 3CTPA 1MC8A 2HV8A 4MB6A 5IN4A 4N01A 4O29A 4GNRA 5KTTA 3OM8A 5T5QA 1VL1A 1MW9X 1YHYA 3AB3A 4WESA 5JZ9A 4MRAA 5CTJA 4ZI2A 3IDZA 1JEOA 1A8QA 1KQPA 1SIUA 2YVQA 3LC2O 2VPXA 1KMIY 2C31A 3LGSA 1KI2A 4HS4A 3FWPA 4WXHA 5HMLA 4ZEWA 2GDZA 3BD8A 4CMBA 1G63A 1FNBA 3RYFB 3RAGA 1I2ZA 1LSUA 1VIAA 2ZBQA 5JS1A 3IRUA 2JJ8A 3RVRA 3OLZA 2IIQA 3TAUA 1IZ8A 3LDHA 2DUWA 4B3XA 1XVVA 3OZWA 1CE8B 4YJKA 1CB0A 1DAHA 3OEED 3VQTA 4DZRA 5ALFA 3H8VA 2Z3ZA 1XCLA 3WP0A 1UXJA 4GLLA 2L69A 4FIDA 1GZ7A 1QPBA 2R6ZA 1QDLB 3G1UA 2HO4A 4YAEA 3RSQA 1CUJA 3B1WA 3BRCA 4EPWA 4LECA 4A5SA 2WYUA 1F1JA 1Q77A 1FQWA 5J4VA 1M7BA 5IK2D 1ZM2A 4MIEA 1Y8ZA 4KQKA 4IVNA 1RLMA 1W87A 1EFLA 3L1UA 3MUNA 4KH0A 3I76A 9ATCA 1WZUA 5K9ZA 1PEYA 3K0AA 4NZOA 5K7SA 1QYRA 4GWLA 1J6UA 4JHLA 3TVTA 1JH9A 1UP4A 4XIGS 1FYWA 4X24A 4DIMA 3BHIA 4KTVE 1E89A 3FTQA 4TUYB 1Q0SA 1SBCA 4PX9A 4FPXA 1V1RA 2VPQA 4JR1A 4X1IA 3M4XA 3JARA 3BD6A 4B3HA 1AKVA 1E4YA 5JZMA 1CVIA 1RS0A 3B3FA 2DXIA 4PYLA 4FC7A 4RWZA 3E1KA 1VKNA 4LE2A 1A8UA 3RJZA 3GLFA 3EQ7A 1M3SA 4U02A 2OFFA 4ZT5A 1XDUA 2JATA 2B4KA 1PWHA 1T43A 2QMZA 2QVCA 3ABQB 4JT4A 4YY3B 3CR3C 4YP6A 4PLHA 1Q2XA 4AP9A 5I7RA 4Z9XA 1T1IA 2I3ZA 3K9LA 3CA8A 4PAWA 3PA6A 5DNEA 4TMYA 1Z75A 1I30A 1YJXA 3HDTA 3JZAA 5ARCA 4Q1VA 4W5OA 3AT1A 4UE3S 4B2YA 5BOSB 2ZYVX 2ZZMA 3ZI4A 3HFGA 2H11A 3UJ3X 1YK1A 2YZGA 3KKKA 3IQFA 4G1VA 5CMLA 2PKRA 1KBOA 3TGWA 2PZGA 1X9IA 2VWQA 4MVJH 3EXG2 4A8HA 4XIYA 1PLKA 2HPHA 1A5SB 2ZIZA 4MVJE 4TQUS 3QMWA 3ONFA 4YRPA 5JIBA 3IKLA 1FPMA 3RT7A 2FFJA 1XZEA 3EPKA 4E6EA 2C57A 4TMXA 3VR2D 2VCEA 3W5DA 4HQOA 5JV5A 2AR0A 1QAOA 1IBCA 4Z7NB 4S0ZA 5JRZA 3D7RA 3I58A 1CIJA 2PUBA 3ANNA 4ZT2A 4QUDA 5HVNA 5MN6A 4WZ6A 4K9RA 1LDYA 1YRHA 2XUQA 3G8CA 3SFTA 1GL9B 5I7WA 2XE8A 3SZLA 4YRIA 3AKDA 4ESHA 2WINI 2PXCA 3HE3A 3FNIA 2VJKA 2VYNA 1MVOA 3L40A 2QG4A 3R9XA 3L4JA 3H17A 2WE8A 4XX1A 1QOQB 4W5RA 1G21E 4PZEA 4RX1A 1D1QA 1F12A 5CT9A 5LMNB 4ZWNA 4RESA 4WHMA 3V1LA 3REGA 2GA9A 1T26A 4IGKA 4OHUA 3VXKA 4COOA 2EKQA 3P9NA 3C7CB 3TTUA 3WQSB 1UFKA 1SVOA 3I1IA 4FKBA 4U2GA 4IFEA 4K9QA 3SHFA 5HPYB 2PL3A 2LGJA 3I3SR 3Q7TA 2FEMA 4AMZA 2PZLA 3S55A 2YIVX 2F17A 3O7MA 2YFYA 2EWWA 1QNFA 4CLHA 5CBPA 3K1ZA 4UJ5A 4YJHA 2JJ1D 5JYEA 4QJ3A 3F67A 4JL8A 5TS3A 3HN6A 1NM5C 1YACA 3DZGA 1VFPA 3OJWA 3NVKI 2WF9A 3WFJA 4GECA 3CSSA 3W0LB 2FZVA 4OTZA 4RQAA 4EL5A 4ZDKA 4P8RA 5A02A 1F14A 3DB2A 3NXKA 1C9EA 4NDAA 1PR5A 5DBFA 4YAGA 3A2KA 1FCJA 1JF8A 4C6TA 2OXFA 3K71B 3IQEA 4B3JA 5EIOA 5LNK6 7MHTA 2C9DA 5ALIA 1H85A 1F0YA 4DTCA 3A4IA 3ADOA 4J9VA 4WINA 1E3EA 1IATA 5FI5A 1ZG3A 4FOTA 5BSUA 3JZDA 4W9RA 3W5AA 1ZO8A 4G63A 3WZLA 4XWGA 3FPJA 1QPGA 1UZAA 2EJWA 1VSBA 2YN4A 3GVHA 3I83A 3JQFC 2GNOA 4ABYA 5AT1A 2VDPB 3B1YA 3T1YB 1CS0A 1QVZA 4BXOA 2FJPA 2FUEA 1DKRA 5DTEA 2EJTA 1R6DA 1YTLA 2W2XA 3GRUA 1JW9B 3RYHA 3T3IA 7REQA 1FVOA 3LUBA 3AONB 4FMCF 5BPFA 1FRZA 3PIDA 2OZKA 4KE8A 4OLAA 2OHJA 2V6FA 3RIEA 3R09A 2HLPA 2JHGA 5FT9A 4ZPXA 3C5WP 4AJ1A 4B9EA 2WU4A 5JSFA 2QLBA 3GUUA 1NUAA 3K8OE 3QLVA 3OPVA 4WKCA 3UY4A 1NLZA 1OD6A 2HD4A 1DLJA 1ESEA 1ZMXA 2X77A 2YINC 3GFPA 5EXEA 3NCTA 4RTKA 4GWKA 1NDUA 2QL9A 4DR5B 1PL7A 3DF7A 3EG5A 1RBQA 2X13A 5KWJA 1QDEA 1THTA 3A3KA 2ZQ5A 3DJYA 1YCFA 5IBPA 4DCSA 1BD3A 2RJ3A 3QU4A 1JR6A 3MJRA 1PZFA 3VNQA 1M66A 5K0JA 2QVYX 4ALLA 3GG2A 2JGDB 1W4CA 1BCSB 4OHWA 2OXTA 3S2FA 1THZA 4GX2A 4TYYA 2I71A 3TTVA 4ZQEA 3I61A 2C88A 1U3VA 5AI9A 1GUAA 2V6BA 1X2BA 3KCNA 1BOOA 2PNJA 1CRQA 1KU6A 1VGRA 3HTXA 3R41A 2NGRA 2YHIA 5FR1A 2Q2WA 4J91A 4LYJA 2ZJ0A 1IBKB 1PP4A 2WIKA 3E7PA 3N75A 2ZE5A 1QB7A 4KR6A 5H9VA 3VO9A 4ARZB 1E1KA 1RXVA 3RYFA 1DJNA 1PI3A 2KB0A 4Z2AA 1LLQA 3QWFA 2YY7A 4TZKA 4OSPA 2VXYA 5KYUB 1JAHA 3F1KA 1P3Y1 3DEYX 3ACBA 3PR2B 5JQGF 4QVGA 3JD1A 2O8EA 2NV2B 2IH2A 1FUYB 1Q7EA 3CH7A 4OL0A 2H92A 4GMHA 2H59A 2I0FA 1S7GA 2PMWB 1I51A 2B0JA 4WAUA 1LFDB 2RONA 1T1JA 4LHVA 5E0OA 4ALIA 2C61A 2WTAA 3H6KA 5FBZA 4XDZA 3V2HA 3MTJA 1EFRD 3R3ZA 1PTJA 1MO6A 4C14A 4ALNA 5CA0A 1XVUA 2MYTA 3NHKA 3ANTA 1L4BA 4MW4A 5EG5A 2DY0A 4GBMA 1E1YA 1VMDA 2PX5A 4HLUC 4MULA 1SCDA 2OFXA 1HE2A 1X77A 1Z36A 2F3RA 3KLPX 1HTWA 4LTNA 4R8RA 2PGLA 1EESA 1PGPA 1WDKA 2P6NA 1U4SA 1UMBA 3MWEA 1WB9A 1YNSA 1JKIA 3FHLA 1M5RA 3ZTTA 2C8KA 4ARSA 2E82A 3IALA 4Q1AA 1QH1A 2VJMA 5AMXA 2V1XA 1PHPA 5GJVC 1IQRA 4YR7A 2VPYA 4MIYA 3PNVA 4R8SA 3TL6A 1ZJ6A 1M6YA 4H0NA 4RAQA 5B3JC 4GS5A 4X63A 2GN8A 1CZRA 3NUZA 4KXFB 5BWLA 5CM9C 3DDHA 1Z5UA 1XMSA 4JR2A 4L8GA 2O3JA 1TTTA 3JZIA 2P6UA 3GROA 1EVIA 4D81A 1AJEA 4I9GA 4JUFA 3VBEA 5IC6A 2GESA 5CLFA 4KRYA 4ZODA 1FEZA 3ET4A 3RYIB 3FUVA 5CFRA 4KAXA 1EM8A 1SU8A 1V7PC 3ETJA 2I1WA 3NM6B 3DTTA 4AMVA 3BIOA 4B6JA 1PFQA 3SF0A 1Z29A 3H5TA 121PA 3K15A 4LOJA 1WBJB 3ASYA 2FCRA 1K4YA 2QMEA 2RHLA 3IBTA 5B57C 3OEHA 4JI8B 1QWSA 4JP1A 2XWJI 5BORA 3ITNA 1WW8A 3T5BA 5C8YA 3V8NA 1PL8A 3WGGA 4CM1A 2FEPA 4L6IA 4MDYA 3T1NA 2DPGA 1H9CA 5BV0A 1W85B 4WGGA 3IIKA 1V9CA 1TKBA 3GLVA 3PT5A 1R8JA 4RV4A 3LX5A 3LQFA 3I5AA 5AJUA 2NO7A 3VJKA 4FU0A 3U3ZA 5JSHA 1W4LA 3IE2A 3SEAA 3RC2A 3F3SA 3VHXB 1N0HA 2K2QB 5FLKA 1JIVA 3ASVA 3E5MA 4LJAA 4Y0NA 2YYZA 4HAYA 4MA5A 1NE2A 4F71A 3KQSA 4QPJC 3I12A 5EJ2A 1EQUA 2XWPA 4EZIA 4P0QB 4I55A 3EEBA 1N0WA 3HB9A 1P2FA 4FHZA 3I23A 1QH0A 2XBUA 3GDHA 4Z3DA 1LLFA 4XE5A 2VBGA 4BP8A 1TECE 2PX4A 2YS6A 1Z82A 2O1EA 1OI7A 3AHFA 5FPHA 1G21B 2AZ4A 2CHQA 2QD2A 4ABTA 4YCLA 2P9BA 3BA6A 2WE7A 5HCUA 3W78A 5CVUA 3PUHA 3AUFA 3NTRA 1RTTA 2Q4OA 3DLTA 3EXFA 3C7KA 3GPLA 2BSQA 1L3BA 1XTTA 1RXSA 3IOMA 1R74A 3DZIA 3I3OA 3ROKA 4ECEA 1E2DA 3STHA 4MMXB 1H2RS 2ILVA 4ZANA 3VX3A 4HAUA 3P0RA 5FI3A 2P79A 1J39A 3D7NA 3PHBE 2CMGA 2QRMA 3L6BA 1M2WA 1DO2A 3QRWA 1PJSA 4XQEA 4UTRA 821PA 1HNWB 2ETVA 4TT3D 3H9QA 2O2JA 4A0SA 1EEXB 4IILA 4GG1A 2RSLA 3I2YX 2C84A 2PY6A 3KD3A 3PFNA 4F38A 2VT6A 3FI9A 1B0UA 1ZFNA 1RPNA 3MTBA 4GRIA 3GPIA 4WKGA 3WY9A 3EC1A 1P33A 3IO3A 2MU1A 4TS1A 4WLNA 3RVNA 3V32A 1SPXA 1IULA 1J4AA 2VSXA 1IJBA 1L8LA 1LI7A 1TEVA 4QYIB 5DWVA 5KYWA 3BSSA 2H7CA 4KPYA 4IGIA 4ENTA 2HQRA 1YIAA 3GU3A 1A71A 3RF7A 4JV5B 1U1FA 4BMNA 1N5KA 2ET6A 2GZHA 2LV8A 3ZGYA 5CT4A 1AHIA 2CXPA 5A5VA 1Y7IA 1IAQA 1ST2A 3I6IA 3PC8A 3VZRA 1UBUS 4MVJG 2F3PA 3F2VA 1ACJA 4J7AA 4DCVA 2GBPA 4BLVA 3FLBA 3L6CA 5BPHA 3MJVA 2ZRHA 1LNZA 3X1JA 3AVUA 1EFPA 1N1MA 3R3JA 1W73A 4MVJI 1M5UA 2IZ1A 4R8KA 3GPBA 1XLVA 1RE0A 2G7MC 5JAHA 3Q40A 4ME6A 1H3NA 1WUKS 3LLCA 4QELA 3FVWA 5LKAA 3KQHA 4WECA 4HUJA 1CDZA 4ZO7A 1XXHB 4UE2A 1PAUA 5A5EA 3CO5A 4LRXA 4FD2A 1FBTA 2X5JO 3KQYA 3CX3A 1TADA 521PA 5AVVA 3MWJA 1R18A 1QVRA 2O5RA 3FM9A 3L7NA 4ZCQA 1B16A 2R66A 5LZ9A 2WTUA 5DP2A 3AJAA 4O0LA 2GARA 4B8YA 5BURA 2O2IA 3FZNA 4JX9A 5BUZA 4EB8A 4ZQCB 2OILA 4UHHA 1JB9A 4XOIA 5CURA 4YUWA 4LJKA 4P32A 1AS2A 1HQYE 3GNQA 1B23P 5E9WA 1MTOA 4KLNA 1Z16A 2XWBF 3TX6A 1ZVJA 4X9XA 1BE8A 5ALNA 4CN8A 2LUOA 3A9UA 1GGMA 4N9QA 5JANA 3PFCA 5DGTA 4O1HA 2CY0A 1X7ZA 1PBTA 1XZDA 2ABWA 2Q1YA 4N82A 4TVKA 3OTWA 3W5IA 1NYQA 2EU8A 3GO4A 2FPWA 1YQUA 2O52A 4S1NA 2OCBA 4Q4HB 2I1LA 5KNBD 3MGCA 4HV4A 2HIMA 1UXOA 3WA7A 3ECAA 3VPGA 1C50A 2O8CB 1XCJA 1PT8A 1K0UA 5MFPA 3TXYA 2AEFA 3RVJA 1XYYA 3UNXA 2P9YA 3UXHA 3KYJB 3UB4A 1L4LA 1RPJA 3EQ9A 1L1RA 3PQFA 5G1PA 2FCAA 4JBHA 2PZ8A 1JKXA 3JD3A 4Z7OB 1GCAA 1CUCA 2AEMA 2ATVA 4L5YA 1QV7A 3A6FA 3LE8A 4KP7A 4R3WA 3WHLA 1GILA 2XQJA 2JFHA 2BKUA 3I6YA 2GUWA 3MLEA 2P2DA 3LXRA 3EXIB 2XMBA 3B1ZA 4X1OA 5E7JA 5JCOC 4CL0A 1ENZA 5FA8A 3TD2A 2OY0A 2C82A 3K3PA 4EI2A 4MQ6A 3T4UA 2RGAA 4O3FA 5ITSA 2GI4A 2BHSA 4L16A 3G85A 1A9SA 1J0EA 1J07A 1O96B 2Q1SA 3N7AA 1COWA 4FXPA 4KQMA 4PZLA 2W70A 4HWGA 4EW2A 2HLDA 1AXGA 1D7AA 3QWHA 4JC5A 5BYBA 2E7ZA 4M83A 3KFLA 1X13A 4C6HA 3JTEA 1P3DA 3OFJA 4PFKA 3ORFA 2ZJ1A 1BHSA 4OSOA 2XCSB 4ACAA 1T10A 5HR5A 3LFUA 2NM0A 2Z58A 2NIPA 4TTPA 4H1VA 4BLPA 1P77A 5EQJB 3F0TA 5DI3B 4RTRA 2PT5A 5IYZA 1DCKA 1GAQA 3CR8A 4TRRA 3BSYA 3BN3A 4DNPA 4RY9A 4HGZA 4EJ2A 1AU9A 1J33A 1S0UA 2HSJA 3O9MA 2B21A 4QHSA 3E8MA 1C3EA 3IQZA 4FKMA 5CDYA 1YB7A 3P4YA 3T9AA 3TKYA 4BQNA 3O8RA 1Y3DE 1MB9A 1UBJS 2FETA 3AC0A 3HNPA 1UFRA 5EAIA 5L4NA 1YVPA 3EFEA 3HZHA 2UZAA 4ASUA 3ISVA 1UPUA 2FN4A 4BRZA 4ZYYA 3OU6A 1DUIA 2G06A 4LSWA 4OYLA 5TJHA 1RQLA 4HOYA 1LBEA 1G3QA 1UBSB 1W5SA 3IR6A 4CV2A 2HYIC 2EATA 1NJSA 3U49A 1Z0JA 1K3FA 1XCGB 3GP5A 2GYUA 3L8EA 4FSXA 3HLTA 1NBAA 5ICCA 1TVEA 3A6PC 1BOFA 4J2TA 1TA0A 1IZ0A 1Y7HA 4G9GA 1SU7A 4NAVA 2HMSA 2RMKA 1ILWA 1UPAA 3DMNA 4X3OA 2UYYA 2W83A 1WXXA 4LCEA 3RVPA 3WGUA 3C0KA 3N87A 2RCNA 1YL7A 1L6RA 4FNOA 3G2KA 4EYQA 4MWSA 5KS2A 1W48A 1IOZA 1Z7BA 1Y6JA 4HMQA 1B6GA 3JRWA 3I04A 4FE7A 4MQFA 4LSZA 4DN6A 4Y2YA 2DERA 4WI1A 1ZJWA 1T2EA 1HEYA 2Y66A 1ZM9A 4PG5A 3RNOA 1YB5A 3DW3X 4QATA 2IFTA 4OAPA 5ALOA 3AGPA 3ZY6A 1SEVA 2Y1FA 4QHYA 3GVXA 4FCCA 2I4RA 1E18A 2ZG6A 4PX2A 4YAWA 4BWYA 5HFJA 2NX2A 3KP1A 4JYMA 4XQGA 3UGQA 2GKGA 3NHZA 1N92A 4RXTA 1R10A 2QMOA 2QAIA 5IK2A 5LOVB 3V8QA 1QZTA 1VG1A 1Z0UA 1Z6XA 1MB4A 4HGPA 5I9NA 1VLVA 4V38A 4F3TA 1DJPA 1J20A 1T1SA 3K1AB 3WIBA 3B6IA 1YI8A 3U3KA 3WIDA 4CQNA 1CF2O 1II9A 5HWSA 4C0SA 4RSRA 1LLCA 1DT3A 5DT9A 3QX3A 1Z28A 1E1NA 1GT6A 5AXDA 3COJA 4D0NA 3LBIA 1M1YA 1DV2A 4DHWA 2ZYSA 2RGXA 2PKQO 2EEPA 3PNLA 1JE1A 3U7IA 4AMUA 1DWPA 3WOHA 3GHYA 4NKRA 3MYYA 3HVIA 3GUHA 2C8VA 3PVCA 4CCYA 4EX6A 1OAAA 1QRSA 1DG9A 1KAEA 2VHWA 1QG2A 3FETA 4WV3A 1FX0B 5FI0B 1UKCA 1T4MA 3ZXIA 3MAAC 1O1YA 3GPCA 3PXAA 5KCZA 1XP8A 2WQZA 1PGJA 1RCFA 4M1TA 4PC3A 5DDIP 4M22A 4Y67A 5AUQA 4ZVVA 3GR6A 4MRSA 3TZKA 4RDIA 2OSBA 4D8UA 4EHJA 3I2HA 2Q2QA 3C6YA 2AH5A 2OLEA 1GITA 1Y6GA 1UMDA 3C5CA 1NV9A 1NW6A 2UZ3A 3DP7A 2DLCX 2FEKA 4KFSA 4TQGA 2XTZA 4ZQBA 2J7PD 2I80A 2EFYA 2O57A 1FDVA 4O4JF 1P2TA 3PEWA 3V00A 3ZHQA 5G0TA 5HF8A 2Y27A 3CRQA 1TVKA 3W3AD 3TSWA 2WPDA 3A1DA 3N5KA 1KRXA 3JQGA 4CG1A 3KQUA 1QVAA 1D4OA 1SOAA 3C41J 5LUBA 1QRUA 4X3PA 1TEZA 3K4QA 2X0KA 3AR8A 3G2MA 3OJXA 3O75A 4BQIA 5I7UA 5JLJA 1BKYA 1P1BA 1CPYA 2LRHA 2X40A 1Y5IA 3GJ5A 1XKXA 3HUFA 3OP4A 2BJWA 1H42A 2W6OA 4NENB 5DHAA 5EXXA 4B6RA 4U00A 1AV6A 4G3XA 1B26A 2BZ0A 4DDMA 5DYWA 4L8FA 5E7QA 2W7TA 4MVXA 2HU2A 3QU9A 3ZJYA 5CJPA 1IXYA 2B83A 4JROA 1Z33A 4D46A 1V3QE 3NWOA 1ZI6A 3B6MA 3WJ1A 2PBRA 1LUAA 4YAIA 1SBYA 2XXJA 3O84A 2I6TA 3KWMA 5CEJA 1XMPA 1MKYA 4JSYA 4TWZA 1ABEA 5FEMA 1SQGA 1IUNA 4TMFA 2XYPA 4CLRB 4J9UE 1Q50A 3KQMA 4DLTA 1OWNA 4MR9A 3NIDB 4M88A 3UAXA 3AJRA 3M34A 3AUAA 4G25A 3IAEA 4ENPA 4M87A 4D42A 4IFIA 1DUVG 1ZDMA 2IE8A 4RCVA 1C7QA 4YJFB 3MMZA 4HBZA 2CNOA 4QDOA 4YV0A 1VBKA 1GU1A 1PSWA 2IYUA 2QG9A 5DK6A 2OHVA 4TRMA 2OGZA 1PSDA 1JMVA 4UVGA 3KKMA 2SCUA 2R84A 4D3FA 1FSGA 2CDBA 3AHEA 4Q9JA 2BTQB 4QDKA 1FNNA 4WOKA 5IC5A 2BFFB 1DTWB 3ETLA 3PFIA 4C22A 1DC3A 4DAOA 1YVEI 3DW1X 4EW3A 2FJ0A 1YFZA 3P26A 4IXNA 2XOKA 5K0GA 1PL6A 3CONA 1C1HA 1TO2E 2XSZA 1B2LA 4MR8A 4PNHA 1PWXA 3DAPA 1JDSA 1JTEA 3VU3A 3JVEA 1IQUA 2QL5A 2RH8A 4JUBA 1BEZA 4MCHA 4DLZA 5GJBA 4BAZA 1PD1A 1IZ7A 5EJGA 1YFLA 1NUTA 4BQQA 3G17A 3R7WB 3TLMA 4BLOA 3LMKA 3IKTA 4QZVA 1J23A 1VI5A 3B5EA 2ADMA 3HVHA 2YHAA 3G5UA 5G0WA 4OXNA 1FJHA 1N2XA 4R4JA 4B3GA 3PEUA 4NG4A 1HLDA 1Q22A 3NHFA 3E22A 4UEOA 1XRNA 4F4IA 1FTYA 2ZE6A 4LJ4A 2WFLA 3T5MA 4QODA 2BCEA 1H9AA 1NPYA 4Z9AA 2FZEA 3S1AB 1VPEA