3HPRA

Crystal structure of v148g adenylate kinase from e. coli, in complex with ap5a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDGTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Rational modulation of conformational fluctuations in adenylate kinase reveals a local unfolding mechanism for allostery and functional adaptation in proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 78
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hprA00
4GZLA 3JVUA 1EX7A 4UXJA 3K0FB 5KU1A 5CIWA 5LD2C 3LBNA 4FN5A 4LPSA 5J5CA 1IOZA 1GTVA 4OQLA 1DAMA 2AHOA 4BRUA 1BIFA 1T3SA 2XNDD 4L16A 1WP9A 1E0KA 1ZM2A 4HAUA 4N1AA 4ZPXA 2V8OA 2J7KA 2QENA 5FPYA 2NPFA 4DSOA 3LVRE 3LX5A 4OI1A 2F3RA 521PA 1JPNA 1WQ1R 4URZR 3ND9A 4LWZA 1YZUA 4KODA 1KO8A 4PQRA 4PC2A 3AVUA 4BEJA 2BV3A 5JHGB 3W3AA 1E9RA 4M1MA 2ZSDA 2V6IA 1E98A 4M9SA 3A1UA 2GDJA 4LJ9A 2IYZA 2BMDA 3LH5A 4C0KA 2WJGA 5EZ5A 4F93B 2BBOA 2C5LA 3THYB 4PC7A 4TTQA 1IN5A 1H8HD 3C4JA 4MKIA 1NBMA 5P21A 2P67A 3SQXA 4OHYA 2HXSA 1E79D 1UDWA 1U8AA 2Z43A 4GFDA 1Z8FA 2GCOA 4HUQA 4ILEA 2XZOA 2A5YB 1Q20A 1IN8A 2C9OA 4NCNA 4S35A 3X1YA 2QTHA 2ZJ5A 4EDHA 1KI4A 1KK2A 3K09A 4DHEA 3ZVRA 1GRQA 1YHNA 2D4HA 1KKMA 4B3FX 5L3VA 1KTVA 2GJSA 3I32A 4EFMA 3DMNA 3T5GA 1AQUA 4B73A 3BB3A 1HT2E 2O0JA 3CPJB 1M7BA 2D62A 1XXHB 1XD2A 4GDFA 2C77A 1GZSA 3VR1A 4YXWD 4KBFA 2DPXA 3SBEA 3RS7A 3RDPA 2DHRA 3NBXX 3QG5A 3WRXC 5AJZA 2WTUA 1GG2A 4Q01A 2ZRNA 3U3MA 4B3BA 2PCJA 4BEBA 5AR1A 2FOLA 1QHSA 5AJXA 3KFXA 2RHMA 4DWJA 1OJLA 3R9WA 4BGDA 2RGAA 1G8YA 4B43A 4EJSB 1CRPA 4MRPA 3VKWA 1E4YA 1ZW6A 4P33A 4PZZA 1JPJA 4V0ME 4B3XA 4DLTA 3KX2A 4JT4A 3EX7C 3EZ2A 4D81A 2CK3D 3ZIAD 1WBDA 4LRWA 5DI9A 1KDOA 5KUTA 3GMTA 1FQKA 4V03A 4Z54A 4G5GA 2WBLC 3RSOA 4MUBA 3VAAA 4JVLA 4QBFA 4TLBA 1EFCA 1D2MA 1F60A 2R44A 3CX6A 2NG1A 5J4YA 3EWSA 3NC1C 3NG1A 1W2HA 2H17A 4LSGA 4Q1CA 2YWHA 2ZXUA 1KY3A 2CLCX 2FWRA 1NLFA 4BFWA 1CR4A 4UXIA 1CJUC 3I62A 2H18A 5KNDA 5G41A 3KKNA 2O8DA 4BLTA 3MJRA 4MRRA 3B2EA 3AVXA 3KQLA 1JQJC 1AIPA 3DEFA 3MMPA 1KJZA 4H1VA 4CW7A 4YDSA 2OCAA 1B0UA 3AV0B 4HZIA 4GP7A 3MWYW 3NHAA 3V4RA 2RH5A 2J7PD 2BBTA 3BAFA 4M21A 2NTYC 1Q12A 4MQBA 4LBZA 1KI7A 2YINC 2EWWA 1XB2A 4FD2A 1RC8A 3CO5A 3TRFA 4KAXA 4DDUA 1E9CA 5EJEA 2JIZD 4PPGA 4Q1FA 3IO5A 2JLZA 1AN0A 1P9WA 5D3MB 3U6KA 1SGWA 1U94A 3GLGB 3W8NA 4P4SA 4LHYA 4X8HA 2JGNA 1FUKA 2ZE7A 4DCUA 1IJFA 1Q57A 3BGWA 3CX7A 1Q22A 1U0HC 3LQQA 1YZGA 3KXIA 4BFSA 4YMWA 4FCVA 2CBZA 3P4XA 3GJ3A 1NN5A 5EXPA 2WZQA 2HCJB 3MSXA 5FOUA 2OXRA 1E2QA 4HLUA 1NN1A 1QRAA 2ZRBA 3EXAA 4BFTA 1E99A 3EASA 1AA9A 3ZD6A 3ZD7A 3TGPA 1W0KD 2W6JA 4GMXA 2FGJA 5HPYB 3LVQE 4IVPA 2EW1A 4DEYA 3ZZUA 2QMUA 1ZC3A 1GL6A 3QKSA 3B60A 2JJ2A 3PUXA 4OYHA 2J0VA 2CNWD 1A5TA 1L4UA 3CONA 4JKIA 4C2UA 2EWVA 2RB4A 4NBSA 2X1VA 4Q7JB 3I3SR 5BYJA 5HKKA 1JALA 1DTSA 1RYFA 2IXGA 2ZVPX 4OI0A 2D2EA 2EVWX 4C0SA 1W4RA 5C4MA 1ZBDA 1E2MA 1P2TA 4A1FA 4D0NA 4PC3A 3T35A 1US8A 3GEHA 1U8ZA 1CLUA 4RJLA 1R5NA 4MGIR 1E1RA 5JHHB 4M9QA 1GWNA 2RGGA 3WNBA 4RD1A 4BZXA 4DCSA 2HV8A 3K53A 4K8OA 3BK7A 4PHTA 1SZPA 3EC1A 4UNQA 2F1HA 4LJ4A 1E4VA 2HF8A 3OHMA 2AD1A 4LC0A 3CWZA 2WAYA 1KO5A 1M7HA 5L3SA 4QOSA 4LI0A 1EG7A 1YR9A 3B1ZA 2G1KA 4A36A 3A1SA 3H0KA 4RFSB 1NVVR 3T15A 2BKEA 3DM5A 2CJWA 2QPOA 2QT1A 2D06A 1RJ9B 2O0KA 3BXZA 4M22A 2OCBA 2EYUA 2KBEA 1YR7A 3BOSA 4WXRA 2QP9X 2P5SA 1T4GA 5JWOA 2AXPA 3GJ8A 1GKIA 2OSBA 1ZIPA 3GD7A 2GXQA 4RD3A 2J3EA 2O8EA 1P7CA 1RW4A 1LF0A 2X2FA 5FPHA 1LVGA 3QEJA 5AJWA 1UBFA 1P9NA 4DT1B 1JB1A 4P3YA 5FBVB 3K0CC 4A2PA 1OH7A 4JLBA 1Z08A 2CCKA 4TLCA 4TMVA 4GL2A 4C0AC 3GLHE 4B2IA 1ZC4A 3K1JA 1G1MA 2GJ8A 1XJCA 1M8PA 3DVLA 3U4QA 2PJZA 4IDHA 2XZLA 2NGRA 1T5IA 3AVTA 2IA5A 1Q3HA 3Q8XB 1G3IA 5KNCA 3FKSD 4UNNA 2H7VA 2RHDA 4DSNA 1OYWA 4URXR 2CHGA 4XH9B 2N46A 3AF1A 4B48A 2ZJBA 1Z0DA 1EESA 1E2LA 1IAQA 3QXHA 3UMFA 4LJ6A 4EPVA 1GNQA 1GKYA 3P20A 2ZAOA 1LB1B 2FG5A 2IXFA 3IPXA 1GKUB 5FBQB 2V6JA 4E03A 3VU9B 2G83A 1OV4A 4Z8YA 5FR2A 3PUVA 3TK1A 5CM9C 2ZSEA 1AKEA 2AWNA 4FMCF 2GAOA 2W2XA 5E7JA 4BE7B 3RRNA 4HAYA 3G0HA 4HDQB 3OAAA 3U3RA 4JLKA 2QUZA 4JLAA 1TQ4A 4R98A 1FP6A 5DN6A 4TZ0A 4YLGA 1EFRD 4TMKA 1QF9A 4NHOA 4G5QA 2I1QA 1KK0A 4RSGA 2PZFA 2Q0HA 2WKRA 2IEZA 4AYTA 4R2IA 3PQCA 4GRAA 5E95A 1DO2A 4ZDWA 2REXB 3MRSA 2B8TA 4V0LA 2WSMA 3N2EA 1OYYA 2C9CA 3BFXA 1K6MA 3SHFA 4F4JA 3HU1A 4HAVA 2FA9A 4QGHA 3CX8A 1VG9B 3WBKA 1MH1A 3QXXA 3UK6A 1JNYA 5FUVA 2JJ1A 2B6HA 3CWQA 3KTAA 1ZAKA 2R62A 4B44A 3EW9A 4ZIRA 1YR6A 1NNEA 2VP0A 2CLSA 4JL8A 4JJZA 1Q1BA 4B6EA 1W46A 2ZRJA 1HTWA 4TTRA 1XEWY 3GLFB 1SHZA 2GJ9A 2W00A 3H1TA 2GZDA 2GA8A 1XDBA 4BLOA 1OH5A 1BMFA 3AH8A 1G19A 2KE5A 2FJUA 3W8RA 3I4LA 5J47A 3A6PC 4F91B 4KO8A 4W5HA 1X1RA 4MYCA 4MRSA 1NJGA 4LPKA 3OIUA 1P75A 4YONB 5GJWC 3AP3A 3RS4A 3QG1A 4QNRA 1KAGA 4D4JA 2O8CB 1XD9A 4FWIB 2FH5B 2PX3A 4B6FA 4TT3A 2DCUA 1UBGA 2ODNA 1UEIA 2Z6VA 4HZUB 2GETA 2IUSA 5HCIA 4CRWB 4JZKA 3RS3A 4QJ4A 1OH6A 3IEUA 4FWTA 3FMPB 3W5JA 1XU4A 4HAWA 1J90A 3Q3JB 3K70D 1W36C 1ODFA 4D0LB 4NONA 3FB4A 5F2EA 2SHKA 4RZUA 2CJWB 4WZ6A 1IY2A 1Q44A 4W5JA 4I81A 2XOKD 3DOFA 4E07A 4A0FA 4MYUA 4OQMA 1KOFA 5CDFA 4M0LA 1D2EA 4GI7A 2GAAA 2AWOA 4D80A 4FW9A 4TN1A 4G01B 4KBGA 4CEHB 3EIEA 1ZUIA 1NG1A 3QOFA 1VKJA 2XX3A 4RZXA 1O87A 2ZRFA 2JATA 4O0MA 4ARZB 3CZQA 2DWQA 1AK2A 3TJZA 2LWIA 3ZH9B 4UNRA 5SZIA 2Q9AA 1VYVA 4NYJQ 1N5KA 1FNMA 5L8VA 2JASA 3NIBA 1P72A 1S9HA 2ONJA 3AF3A 4MGYR 4NKRA 5EP3A 3BH7A 4PHGA 1LTQA 1J7KA 4FI3C 4PHHA 3CH5A 5IK2A 4B75A 2XAUA 4JMPA 2O8BA 3A58B 4D26A 2XXAB 2EQBA 1OH8A 1ZJ6A 4GSYA 2Q6TA 3O47A 1G3MA 3NXSA 5AJVB 4LCBA 2FFQA 5EUQB 2AR7A 4HB4A 2BC9A 3UG7A 5IF9A 2CE7A 2GBLA 4UXHA 1FX0B 3VNUA 1Z0JA 1TF5A 2MSEB 5JWHA 3SJBA 1H8EA 5DHFA 3REFA 3NH9A 3R9IA 1IM2A 1SXJA 3L0PA 4LYJA 1JR3A 1XNJA 4ASUA 2OAQ1 3ADKA 4AG6A 3ZLJA 5TV2A 2ZYUX 1KSFX 3WMGA 5FBWB 2VIIA 2QZ4A 4UJ3A 4RD6A 1VYUA 1DAFA 2IYTA 1OIVA 3Q7PA 4TMTA 1F3OA 5H68A 5C18A 1IJEA 1BO6A 3AVYA 2FPLA 2FPMA 5KDLA 1VG0B 2RGNA 4A0GA 4ZV4A 3B1VA 4EPWA 1NY6A 3QIAA 3LX8A 2DFKB 3TMKA 1XEWX 3FYHA 4RCZA 3B85A 1OKKA 4QHYA 4I1VA 3NWJA 1PV4A 2YJTD 4M1KA 4HAXA 3K0FA 1G16A 4NYIR 4WAUA 4C0HA 2LKCA 2ZRGA 1I2MA 2G0TA 1R10A 4II7A 1M6NA 2Z4SA 3BS4A 3GJ5A 3TBKA 5JMTA 2CDNA 4LYAA 3AVOA 1N6LA 1WRBA 1FPMA 1ZD8A 2QSZA 4PSKA 1J2JA 4BASA 1D2NA 2BBWA 3D7MA 3GJ0A 4QM7A 4IOKA 2PZEA 5A5GA 4QGGA 1SVOA 3C8UA 1XCGB 3QXCA 4HB3A 1AS3A 1BOFA 3A37A 1U0JA 1XZQA 1KI9A 2C99A 4E5UA 4TTPA 2WSSD 1Z2AA 2OZEA 2ZI6A 3C5CA 1P9RA 2OBNA 3MAAC 3GQBA 1II8B 2CL0X 4Q5IA 4A92A 3ZQ6A 5ANRB 3TH5A 2XEXA 2P0EA 3IBGA 4KFUA 3WHLA 5C46F 3CRRA 1IXSB 3LDAA 3SYLA 2REOA 4YQFA 1MO5A 3R7WB 4NE2A 1D9XA 2QA5A 3OFND 5K8LA 2EU8A 1G3QA 3B9PA 4FCTA 5FTJA 1F2TA 5DGXA 3MGCA 2W2TA 3U3JA 1HY3A 4IFBA 2JAQA 2IWRA 2OFXA 1ESNA 2PL3A 1GFIA 3VX3A 2XJ4A 3DM9B 4RZ3A 2NO7A 5LD2B 4S2EA 5CDFE 3CNOA 2BMJA 3HDTA 2LCFA 4AKHA 4PO9A 1ZYUA 4C9BA 1TEVA 1AM4D 5EP2A 6Q21A 1G291 3A1VA 1XXHA 5GVSA 4UNPA 1E94E 3HPQA 1LF5A 5IT5A 3FHTA 5B64A 2AKYA 3BH0A 1GNPA 4TLEA 1K5GA 2ZUBA 3ND8A 4Q1EA 3N5CA 3LLMA 2FF7A 4DLXA 5FPTA 1JJ7A 1DE0A 1QG4A 1SVKA 3EG5A 4TYYA 3L82B 2C03A 2G9NA 1COWA 3O8DA 3E70C 2CEAA 2VQSA 2DWPA 2VP6A 3V4FA 5FR1A 4FXPA 4UJ5A 2KBFA 1KSHA 2OFOA 4DLWA 2AN9A 1S8FA 2IYWA 1U8YA 3EIHA 2HLDD 3L8YA 2ZPTX 4EJSA 4QG7A 3H4MA 4JVMA 4L9SA 3SFVA 2H1LA 5TARA 3SNHA 3U2QA 4CIDA 2I4IA 5KHOC 2O8BB 4EAQA 1TQ6A 3PEYA 2IYRA 1XTRA 2CXXA 4QC2A 3IHLA 1ZNWA 2GZAA 3PG5A 1R7RA 4N0DA 2JLYA 4XD7A 2XTMA 3TUIC 2VP2A 3B1WA 1E2EA 1Q21A 4M9XA 2ODBA 3ZS9A 4YMTA 3QPWA 2WPDA 4ERNA 2OG2A 1GUAA 1NVUQ 2CLDX 2E1RA 3CNNA 1MR3F 1YZNA 4ZI3A 5DYIA 2C04A 4RKEA 4GT1A 1O3YA 3IILA 8OHMA 3ZZTA 4KITB 3ADCA 4CYMA 1SXJE 3CH4B 1NF3A 3PEVA 1JR3E 1XEXB 2QORA 3GJXC 2HCBA 1G21E 4A2QA 4YDHB 5KSPA 2FSFA 4D0GA 5EE5B 3AUXA 1ZM9A 4ESHA 3RWOA 1NVWQ 2F1JA 4AYXA 1PUJA 5IRCD 1UADA 5DO9A 1S1MA 3HWSA 2DY1A 4OI2A 5TVKA 3W6PA 1OHHD 3AF0A 3LLUA 3W6NA 1SQ5A 1W36D 2WJJA 2B7CA 1S1CA 4Q03A 3U44B 1WMSA 4KSCA 2A5DA 4IOMA 1JQLB 2A5FA 3KJGA 4N0EA 3B13B 4TQAA 4CF7A 2VHTA 4Q9LA 1KMQA 1DEKA 4W7SA 3R20A 3U7HB 3AM1A 3SQWA 4Q18A 3M6AA 5BYKA 5D3MA 1VIAA 4AG5A 3GLGA 1BKDR 4BPBA 4V0OA 5HZHA 1QBKC 4RD0A 2I3BA 3OE7A 4TYPA 4AYWA 2F6RA 1VCOA 4RKFA 2TMKA 1N0UA 1RRPA 2QRZA 3N2IA 3QE0A 4WA7A 1TEXA 3D3QA 4BLPA 4BWYA 4FMDF 3QKRB 1TQDA 2JDID 1Y3AA 5HE9A 1VIYA 4Q19A 3IGFA 4OI4A 3PUYA 4OBEA 2K5UA 4AIIA 3WY9A 5C1BA 2WM9B 3E1SA 1W5SA 4OK3A 1OFTA 1GVNB 1ZU4A 4OHZA 1Z83A 3U7FB 1G41A 1GL7A 1V5WA 1T9HA 1CJVC 2V54A 4M53A 4Q47A 2XTNA 3EC2A 3NEJA 1DAIA 2VYFA 3B8HA 1G4UR 1JBKA 4KU4A 2FU5C 4PQFA 2B7BA 2IYXA 1F2TB 2ZRMA 3AVQA 2OAP1 2P6UA 4WW0A 2ZRAA 4A0HA 4OQNA 4C0JA 3LQRA 3ZZ0A 4Q1DA 2PMKA 3P27A 5EXTA 1W7AA 4PZYA 1G64A 821PA 5CJPA 2ZYWX 4GOXA 1R0YA 4CT5A 1G7SA 5UKDA 2AKAB 4NU0A 1QHIA 1P2UA 1XXHE 2WWXA 4F38A 2FPKA 3AKYA 3BH6A 4KSBA 2QROA 3QQ5A 4DDTA 1G3RA 1C4OA 1V43A 2WWGA 2QTVB 1T5LA 5CLLA 3THWB 1QVAA 1ZMXA 2ZROA 4RFSA 5HKKD 1GOTA 2PT7A 2OCPA 3GCGA 3IO3A 5CB6A 4DDVA 4O25A 5A4JA 1RJ9A 3FWYA 4CGZA 1KI6B 2O5VA 4QKQA 4DLYA 1HE8B 4PO1A 1XP8A 1UBEA 3AQ4A 3RHFA 1NI3A 5F9HA 1T3LA 2BM1A 2ZM5A 4A0RA 4P4UA 3GJ4A 4WXPA 3RABA 2Q9BA 5CLQA 3RS2A 4TYQA 4TL7A 1JXMA 4DT1A 3B9QA 4EPRA 1QZXA 1FNNA 2WIBA 2BJWA 5AUOB 2IS4A 4Q02A 1W4BA 2BMFA 1ESMA 4QBGB 2ATXA 3WBJA 1R0WA 1NIJA 1ZD9A 2G3YA 3MWLA 1N25A 2GZHA 4Z1MD 3C7KA 2AK2A 4R2HA 4CVNA 1N0VC 2OLJA 4P0TA 1BYIA 1OE0A 1I4LD 3O8RA 2QMEA 4L15A 2MSDB 4OQXA 3D6TB 3NHBA 3CR8A 1HUQA 3I5XA 1S3GA 4JLNA 4GOKA 1ZU5A 1WDTA 2ZRCA 4US2R 1YQTA 4NL4H 3QENA 2ODEA 4B76A 1DAEA 2VSOA 5BXQC 3PCRB 3AGPA 3A8TA 1XX6A 3AB3A 1Q3TA 1FL9A 4JBWA 5CM8B 1RZ3A 4IDQA 1IN6A 2ASEA 1XMVA 2ZR0A 4KV9A 3VU9A 1C9KA 2VP4A 3K70C 3L8ZA 1QHHB 3WNDA 3CPHA 4V02A 2W2VA 4XIGS 5CB8A 3NBFA 2WWWA 5FOWA 5TMPA 1EXMA 1R4AA 3ADBA 3VNVA 3P26A 3V9PA 2XNDA 1I2DA 1VTKA 3SFZA 4C3ZA 1OXTA 1E1QD 3CB4A 5JCZA 3SJZA 3GLGE 1TPZA 4DKXA 3FMOB 4WIAA 1CBUA 2P5TB 4POAA 1TF2A 2UVQA 3OEHA 3OIYA 1R5BA 4QHSA 2ANBA 2EFGA 2GWHA 5AK0A 1CJKC 2JLRA 1G8GA 4GMDA 1N6HA 2J0UA 2QQ0A 2D74A 1D6JA 1JR6A 3Q9LA 4EUNA 4BFUA 4TYNA 2PX0A 2PJRA 5DISB 1Z0KA 1OLOA 2YOGA 2QMHA 5FUXA 2AL7A 3NBZC 4MA4A 5FL3A 4LHZA 3KKOA 5KPDA 1TU3A 3TR0A 3SBDA 4XWOA 4ZDJA 4DSTA 1H8HA 2VLIA 5J4LA 3KXLA 1XCPA 3E2IA 1HYQA 1E79A 1PLJA 2BWJA 1W48A 2ZJAA 1FQJA 1XTSA 2ERYA 3FPAA 5JEEA 3S1AB 1G8FA 4IDPA 1NN3A 5DN6D 1ZM3A 5E7MA 3GLFA 4B34A 1KZ7B 2BOVA 1E2FA 1EK0A 3F0TA 1YE8A 1II9A 1NBME 2NO6A 3ICEA 1Q1ZA 4R71A 3A36A 4KFRA 1CJMA 1P2SA 3CF2A 4HAZA 4OHVA 4HUTA 2ORVA 4FMCB 4G0NA 5DE3A 5B2ZA 4B3CA 2XNSA 4CDGA 4QJ3A 1LFDB 5GADl 4H9GA 1IONA 1D5CA 4YXWA 2PBRA 1NL3A 1CXZA 1QDEA 4E22A 2F43A 2O8CA 4MGKR 2EYQA 2B21A 1LY1A 1NSFA 1CKEA 3FGNA 4JT2A 2GEVA 2JJ1D 2QAGC 3WP0A 5GJCA 4HZUA 4JYCA 4FIDA 5E4FA 4IKEA 2IHBA 4L8GA 4O2RA 5GJVC 4W5WA 2BVNA 3L0IB 3OZXA 5FI0B 4PQYA 3B1XA 3H84A 3IIJA 3VHLB 1SVMA 4PXAA 2F7SA 3QJYA 4I4LA 3QPUA 1YRBA 1A2BA 2Z5FA 2A7QA 2GVZC 1A82A 2JCSA 3PVSA 4LDJA 2IXEA 5FH9A 2HJVA 1U0LA 2PT5A 3SN6A 3IDQA 5HTKA 1LV7A 1DPFA 3EZFA 1T0HB 1VCMA 5L3QA 1G7TA 1VHTA 4FCWA 3HU2A 4CEHA 4KYIB 4LJAA 2EFHB 2IEYA 4TT3D 1KGDA 1MRNA 4ARZA 4EFNA 3NVAA 2GJAA 3Q5DA 4V0KA 4DLUA 2WOOA 2Y8EA 5JI3E 2CCJA 4TQUS 1T3HA 1UM8A 3BERA 4KI0A 1W1WA 3T5DA 4QGAA 4ZKEA 1E2HA 1XEFA 2J1LA 2PCLA 1KSGA 2V3CC 4A2WA 1F6BA 3SHWA 3T1VA 1Q1EA 2V7QA 4YC7A 4EQ6A 2C98A 2VTKA 1DBSA 1FP7A 2XXAA 5JRZA 1S0UA 4RCYA 4PR0A 5BN4A 1NIPA 1W36B 3LBHA 2R6FA 2IS6A 4DUGD 3GLIB 5BN5A 1TQ2A 4KVGA 1XD8A 2ZJYA 3QBTA 3FE2A 1D8TA 421PA 3Q7QA 4O3MA 1FX0A 3T12A 2IF2A 1DADA 2VHJA 3DMDA 3PENA 1UAAA 2QL6A 3PEWA 3CNLA 4JSTA 3AVVA 1KJYA 2DYKA 3GJ7A 2WJHA 1Z06A 5DNYB 4XVUA 2P6NA 3C41J 1KJWA 5JJKA 1DO0A 1A7JA 5JS7A 3F3YA 2OUKA 5EE0A 2WJYA 5IK2D 4IXNA 1G8HA 3KJIA 3WYGA 2YNMA 1OFIA 1RYHA 3TSZA 5AUQA 2YWEA 3QF4B 1G9XA 1ZP6A 4PSVA 5F9FA 5CYPA 3K0EA 5EQTA 4ITRC 1KHTA 2J0UB 4BFZA 4TQ9A 1KYIA 4AWXA 1N6IA 1TADA 3K09C 3R9XA 4PSAA 3TVDA 1T6NA 2IK8A 1UKVY 4MITA 1EFTA 5DH9A 1GP2A 2CNWA 2F9LA 1H8ED 3GEIA 4IDOA 5SZJA 1NVXQ 1SXJD 3UWOA 4BLSA 4XTRA 2Q3HA 4NMMA 3UWKA 2BIFA 4NYMQ 1WXQA 2VF8A 2XZPA 3IIKA 3GLFE 1E2DA 4IVRA 3IEVA 2R6AA 2R9VA 3AUYA 1MKYA 1XMIA 2ZI5A 5GVRA 4JLPA 1KNQA 4OQFA 4PC1A 1W2GA 4TLDA 2IS1A 4UQOA 3FMIA 4XWAA 4KLNA 4BRWA 3W90A 1KO4A 2A30A 4DVGA 4DZZA 3IUYA 2G0NA 1KZGB 2GNOA 1II8A 4KCGA 1KNXA 2F43B 5H1YA 4AY2A 4PAMA 4WZBE 3AKDA 1OKKD 4G5RA 1X8LA 5L3RA 4PPFA 4WVFA 1W4AA 4HB0A 1A2KC 3R7WA 2BM0A 4TL6A 3T1OA 2VH5R 4Q66C 1M7GA 2W6ID 1P5ZB 3LD9A 1SVLA 3H2YA 3M1IA 4M2LA 3KB2A 4C0LA 4DBLC 2DFNA 4OHXA 2IUUA 2ORWA 3PIRA 2GF9A 1YZLA 4TMXA 3REGA 3HR7A 2JJ8A 4B71A 2ZU6A 5B58C 1ONBA 4Q4AB 2ZETA 2EFEB 4OK5A 1E2IA 1SKYB 2VP5A 3P32A 1D9ZA 2QPTA 2UZ3A 2ZRLA 4OL0A 3QKTA 2ECKA 4NCHA 4QNMA 1PLLA 2ATVA 3VX4A 1FUUA 4JBYA 3JZAA 5JECA 3C15C 3OIVA 3A4NA 1Y63A 3U6BA 5F3WB 3SJAA 1CR0A 2OXCA 2VBCA 5L3QB 4NDZA 1KDRA 2DR3A 1G8PA 3SOPA 3U61B 5JSZB 2H5EA 4TSFD 5G53C 4O2LA 2NPIA 1YU9A 3KL4A 3RWMB 4U02A 2XTZA 1X3SA 4RVCA 1JXOA 3LRPA 2WKQA 4MRNA 2E87A 1S3SA 2RGBA 2JLWA 1IBRA 3RAPR 2Z4RA 3FKSA 3EZ7A 3DL0A 4KFTA 2QP3A 3VFDA 1KI2A 4Q9HA 3RYTC 2QE7A 1GDDA 4A82A 4MYTA 4B33A 2ZS8A 1G5TA 2HF9A 4BLRA 5FBLB 4J0QA 5G3YA 2MMGA 2QGNA 1J70A 2F3TA 2ZJ2A 4WBSA 1TU4A 2ZRHA 1E0SA 3QNUA 4ZCLA 4EQ6B 2ERXA 2GF0A 3I72A 2GCPA 3L2OB 3PR1A 3TE6A 2FZ4A 4DLRA 3WP1B 4PFSA 4URWR 2C78A 4KHZA 4LV6A 4GZMA 3T1TA 4A6PA 4G1UC 1JEEA 2GRJA 3OEEA 221PA 2X8AA 2F1RA 3EPHA 1XTIA 2O8FA 3LXRA 4H1UA 121PA 4JVNA 5EXXA 4KJZA 1FTSA 1COWD 1EFRA 4HLUC 4OKSA 2ZRKA 3CF6R 4TL8A 3U5ZB 3RC8A 5DIFA 3GPLA 3ASYA 1XEXA 3M4YA 2IYVA 1OF1A 4XVRA 3ZQJA 5D3QA 3B5JA 4Q4HB 2AX4A 3RRZA 1G4AE 4IDNA 4DB2A 1N6PA 2A78A 2BCGY 2NZJA 4B2LA 1ANKA 2RAPA 4LK2A 2I1VB 3D8BA 4X8LA 1RVDA 1NG9A 1GIAA 1E9SA 5KPJA 5CJ2A 3LW8A 2F55A 1KMHB 2CL6X 1ETUA 2GK7A 3U7EB 4BECA 3U44A 2IHYA 1CU1A 3DDCA 4WOPA 4LHVA 1JECA 2H8KA 2ZIAA 4OK6A 3PFIA 3DZDA 3ETLA 1ZINA 2QTFA 1XMSA 3NEYA 5FTKA 3IQXA 2QNRA 1E9BA 4ZKDA 2GXUA 3CR7A 3DKVA 3BBPA 3L0SA 4WZAE 4ZCIA 3K9GA 2YYZA 5CYOA 4C30A 3F5FA 3UPUA 2L0XA 2GJKA 2N1BA 4M4SA 1XWIA 1MO3A 3VKHA 3QKRA 4EPXA 1XTKA 2Z0MA 2DFTA 1G7RA 4AK9A 2BJVA 2HXYA 5FOTA 4DB4A 2ZQ5A 4Q4LA 621PA 1U98A 4LJ5A 2G6BA 4C4PA 3KUCA 5H70A 2OBMA 3LWNA 2VSFA 1HQCA 1N5IA 3FMFA 5FOXA 3X1WA 3ZYCA 1GSIA 1E9AA 1GITA 3TNFA 5FOSA 1CR1A 2ZSAA 4CEIB 3THOA 3SDZA 1BH2A 3MCAA 2QY9A 2FNAA 2KSQA 3CRMA 4PAOA 3DPUA 1CIPA 2J5XA 3I1FA 2RGCA 4DIEA 5FBRB 1GRNA 3SC3A 3CM0A 4MDFA 1EFUA 2BEJA 3JZMA 3EWAA 1WBBA 2J59A 2FGKA 1Z0AA 5KDDA 5LPNA 3U3OA 2IF0A 3J81k 1CS4C 4QBHA 3ASZA 1KDTA 3VKGA 5HCNA 3G5UA 4IW3B 2W83A 1UDXA 4DC9A 3FTQA 2GTPA 3KJEA 4NZYA 3W6OA 4AKIA 3VQTA 1RPZA 2FMXA 2R2AA 5AUPB 4AKEA 2UKDA 2JLXA 3THWA 4QM6A 4IVQA 3CBQA 3PITA 4FMDB 1QHYA 3UIEA 4IOLA 1NBMD 2QGZA 4JL6A 3W34A 2QAJA 2QG6A 5J4HA 3LNCA 4XJXA 3WYAA 2A2ZA 4EPTA 3MLEA 1KI6A 1X8JA 1E9DA 3AP2A 5FL7A 3WNCA 1LNZA 2OLKA 5FTMA 4KYUA 1TAGA 4P4TA 2IL1A 721PA 4XTCS 5KOYA 1KIMA 1PVOA 3I61A 3NDPA 1VHLA 2WAXA 4D4MA 1TNDA 2FFAA 4XVQA 2KJQA 4LV8B 1QG2A 2C95A 1R6BX 2QM8A 3BB1A 2R6GA 5C4GB 3A4MA 4PANA 1ZM4A 4MKHA 3GP8A 2ZUCA 2HJGA 1XTJA 2FEMA 4W9MC 2VO1A 3KKPA 4CEJB 3I5YA 2O8FB 1UEJA 1DG1G 1NRJB 3EZ6A 5TXGA 3TW8B 3BORA 1G5RA 4IXMA 4Y0AA 2BHRA 2ZSBA 5TDHA 1AGRA 2IT1A 3WMEA 1NP6A 1ELOA 3NKVA 4YMVA 3L0OA 4C0QC 1PLKA 1W0JA 3NDBB 1ZIOA 2PLFA 4OHWA 4RFVA 1NJFA 1W49A 4AI6A 1FMJA 2XJ9A 4LUCA 2Q21A 3B7GA 2D2FA 5BQ5A 4BQSA 1GILA 4LHXA 1QHHA 2YKGA 4I1SA 4MUAA 1FTNA 1LS1A 2ZJ8A 3K9NA 1E6CA 1TTTA 1VMAA 3I92A 3WRYC 2YC4C 2FSHA 4A15A 1N3BA 5EP1A 3W5IA 1XPOA 1JEDA 4ESVA 4DIDA 4JLVA 3SE0A 5M04A 3WHKA 3K0CA 1U9IC 2PLRA 3NH6A 3TAHA 4N3NA 2UZIR 3CF0A 4MYHA 2ZE8A 4M8NE 2WJIA 4Q9KA 3UXMA 2QI9C 1X8KA 3VR3A 2ZYVX 2ZEJA 3ONWA 1U2RA 4FINA 2IYUA 1M34E 2CE2X 1XF9A 4XWKA 4LYFA 4C0BA 1E0JA 4TMWA 2GEDA 2D7DA 4DSUA 2P2LA 1E2JA 5JBQA 4URVR 2XSZA 2DB3A 2WSSA 1IY1A 3TQCA 4L4UA 2V1UA 4LBVA 1OSNA 4JLMA 3B78A 1OXVA 1QHXA 2YWGA 4DLZA 4Z51A 2QMOA 5KDOA 2ZI3A 4PPQA 1CJTC 1NMXA 4JLOA 1YZQA 3DKPA 5B57C 2P3SA 3OFNA 2H57A 2ZI7A 1VECA 3CKLA 2FEOA 3P4YA 5EP4A 3SR0A 1J8MF 1XPRA 5GJBA 3TSOA 3MG9A 3UMRA 2QBYB 3KZ1E 3K70B 3S1AA 4Q7KA 5EUMA 4XSHA 3MWKA 4L5BA 5CITA 4ACAA 4IEIA 4ZI2A 3LV8A 3OEHD 2R6CA 1OIWA 4TWZA 4A8JB 4EIWA 4LOAA 4MKFA 3CRVA 1XJ0A 2WWIA 2ZVQX 1AKYA 3T61A 1FZQA 5K8TA 2CCGA 1G6OA 1FOEB 1VPLA 2HDNB 2R8RA 4KFSA 2C8VA 3MWJA 3IHWA 4ZO4A 1X1SA 3HU3A 1Z6TA 4JVSB 1OPXA 4BZPA 3THXB 4PX9A 1UKEA 2W6JD 3LBIA 3EA5A 1R0XA 3RANA 3VR2A 3KKQA 2GVDC 4BZQA 1P2VA 3HR8A 2JJ2D 1E2PA 1RKBA 1YZKA 5E7IA 4NYIQ 1X6VA 1VDZA 3EZ9A 1RRGA 2OV2A 2HLDA 5DLQC 3BD9A 3RLFA 2GBLC 2ZRDA 4US1R 2BCJQ 1R0ZA 1GRRA 2ZJZA 3KQNA 1A1VA 2OESA 3EPKA 3AVWA 1L2TA 1E1RD 1SXJC 4IRUB 1HT1E 3CLVA 3JVVA 4JJKA 4HATA 2JLUA 2RGDA 3O8BA 4A6XA 1RFLA 4Z8XA 1VYTA 4PAQA 1OB5A 3OIWA 1ZUHA 3CZPA 3TIFA 1ZVQA 4ZCMA 4TYWA 1IHUA 2N42A 3AEZA 4AC9A 2RGNC 3BFKA 1PUIA 1XFAA 2QQEA 5HE8A 1E2KA 2IW3A 4B32A 1OXXK 1L8QA 3LXXA 2VA8A 2QAGB 1KK1A 2QU8A 4LJYA 3ZJYA 2QPAA 4I1UA 4Q00A 1BYUA 3DOEA 4KVAA 4PC6A 1T0JB 1OHHA 4Y0VA 1XBTA 3GLHA 3BIFA 4LGMA 4PHFA 2C96A 1XCMA 3EA0A 2X77A 4Q4JB 1G17A 3B1YA 1AS2A 3GLIA 4C2TA 3K9HA 1N5JA 2VHUA 4NCIA 4PZLA 3RRMA 4URYR 1Z0IA 3U60B 1OFUX 1PJRA 3LO5A 4Q7MB 4NYMR 4RD4A 1ZUNB 4IJMA 4XOIA 1Q0UA 2EFDB 5FUWA 4A8JC 4ZDKA 5K8UA 2NO9A 1TUIA 4X8OA 3RC3A 2W0SA 3TR5A 3DZ8A 1NKTA 1IXZA 3MJHA 2GHIA 3FFBA 5J4KA 1HA3A 2WVJA 3K8YA 4GP6A 1EWRA 2B8WA 2VSXA 1ZCAA 1N2CE 2V7QD 2JDIA 4OJKA 2HYIC 2HEIA 1AS0A 2RKOA 3I73A 5DSZA 3HYTA 3QF4A 3IKJA 1YKSA 3LW7A 2G77B 4FMBB 5DI3A 5FUYA 1TUEA 1UPTA 3WYFA 1F2UA 1HV8A 2OE2A 4QBIA 3VR5A 4JYBA 3QY0A 4US0R 2JLQA 1RRFA 4RD2A 1MT0A 4MKGA 1WB9A 2FE4A 1L4YA 1NLZA 3P1JA 2XITA 4F4CA 3OAAD 4R9UC 1MRSA 3LFUA 2PEZA 4LHWA 1LS6A 1S96A 2FFHA 4HLDA 4ACBA 1TMKA 1VG1A 2ZUDA 2YWFA 3CRQA 1E3MA 3UKDA 1MABA 4I1OA 4DEXA 2E9SA 2FDCA 2IYSA 2WWYA 4TZ6A 4YMUA 1PZNA 5FPKA 2BKUA 2ZREA 5JLJA 2FV8A 5LB4A 1NSTA 2REBA 4K46A 4U5XA 2GKSA 4EJSC 4NYJR 4Q48A 4LBYA 1JAHA 1ZNYA 1SULA 4QGFA 3TAUA 2YHSA 1E9FA 4LYHA 4F7WA 3T06B 4U00A 2ZYTX 4A9AA 3AKEA 3B82A 3CPEA 3C16C 1G5PA 2WIAA 4HUQB 4D4KA 2GCOB 2GXSA 1JAIA 2BBSA 4D25A 1Z07A 5KSZA 2Z83A 3KKMA 4LJ7A 3QEOA 1K5DA 5FTLA 3QXSA 4NTZA 2W0MA 4B3DA 1DOAA 4Q4AA 4M9ZA 3EAQA 1BMFD 2WHXA 5B30A 5SZHB 1CP2A 2XB2A 4RZ2A 2ZI9A 1HURA 2CK3A 3ZIAA 1P73A 2ZTSA 1EGAA 1VG8A 3KUDA 3K0SA 3DHWC 4QL3A 3ADDA 1TL7C 1Z6XA 2OT3B 3RRYA 1WA5A 1Z6YA 1ZNXA 2KB0A 5LDDC 1XD2B 3PEUA 4TL9A 5A0FA 1UBCA 1IY0A 4QXAA 2OFWA 2IX3A 3OF5A 4Z1MA 4B47A 5JSZA 2QT0A 1XTQA 4AURA 3QVVA 2ZRIA 5AWFC 3FHCB 1S9DA 5BWMA 1IN4A 1MV5A 3IBYA 5CIQA 3PJRA 3TUZC 4MDEA 3F8TA 1BS1A 3IPYA 4B35A 1CF4A 1YZTA 3PUZA 2WWHA 1NN0A 4JL5A 2G88A 1T91A 3TW4A 2ZE6A 1CRQA 4EFLA 1AJEA 3X1ZA 3CRW1 2IWHA 3LAWA 3TQFA 2RGEA 1OXSC 3K9LA 3QBVA 4DXAA 1SVSA 2DWOA 5FOVA 1G6HA 4JKYA 4NP6A 2OO7A 2FFBA 2J7PA 2ZITA 3KQUA 3QKUA 3BJIC 4UNSA 3NBYC 1E96A 4LZZA 4IEEA 2GCNA 4DLSA 2RGXA 3AF2A 5EE3A 1MO6A 3GLHB 3SJCA 3QI2A 1QHNA 1W44A 2QRNA 3HYRA 1A4RA 4GOJA 1RE0A 3TSWA 2HYDA 3U3KA 2ZAMA 3FKQA 3GLIE 2A9KA 2ORIA 2JIZA 2V1XA 1KI1A 3G82C 4BUJA 1E1QA 3IQWA 3VTKA 2XB4A 1DELA 4A4DA 1DVRA 4HLCA 2O8DB 1NMZA 3ZVLA 4M1TA 5IDVA 4HSEA 1XPUA 4JLJA 2QE7D 3VR4A 1P3JA 1U81A 2VPPA 2YOFA 2OBLA 1CULC 2KI5A 4Q4HA 5SZKB 2BMEA 2ZSFA 4HYYA 1AZTA 1DAKA 1KKLA 2ONKA 1E69A 2NO0A 3WMFA 2GK6A 3ZVMA 2NZ8A 2YV5A 4HEJA 4M1WA 4BFVA 1P61B 2AFIE 2YOHA 3BFVA 2QN6A 2A3RA 2ZS7A 1W0KA 5DI3B 4EKDA 1KMHA 2G1JA 5JI2E 1F2UB 1W5TA 3OEED 1S2MA 3N70A 4K81B 4URUR 2F9MA 3X1XA 1RIFA 4G5SA 4LY6A 1N6NA 5J40A 2BEKA 3EARA 4X8MA 3C5HA 1IQPA 3FFAA 4YMSA 4P4SB 1Z6GA 1LW7A 1Z28A 2FSGA 1FMLA 3Q5EA 1JR3D 1P62B 2QEQA 4ASUD 2WJVA 3EIQA 5DYGA 1ZCBA 4TMZA 3RVBA 2O0HA 2JEOA 2X2EA 3Q72A 1YR8A 2IUTA 2C9YA 3QPVA 4IFEA 1MABB 2KWIA 4DLVA 3HP1A 1GM5A 1Z29A 1MO4A 1IXRC 1Z3IX 2WMNB 5LBIA 4DDWA 4NCJA 1QVRA 2RCNA 4LC1A 5EE9A 4ABYA 3HPRA 3C14C 4CZ2A 1B23P 2C2HA 2IYQA 2D3WA 1JI0A 1SHKA 1XRJA 2EFCB 2OILA 2NO1A 2VHCA 3QKSB 2QSYA 2W58A 5TY0A 1KDPA 4QJ5A 3WXMA 3KJHA 4CEIA 4F4IA 1EX6A 3O8CA 4P31A 1AZSC 5C2JB 3AKCA 5ELXA 4Q1BA 2YZ2A 3B6EA 3V00A 5KNBA 1ZNZA 3FVQA 3CUEF 4BLQA 2AK3A 2ZI4A 4D82A 1US8B 2LKDA 1GAJA 2GILA 3AVPA 4HI0E 3E5HA 1Z6AA 2WMOB 3ZVNA 1P60A 2ZR7A 1SKYE 3K0AA 1M2OB 2AFHE 3QXJA 4D6PA 1U9IA 3IIMA 2J0QA 2BDTA 3RSLA 2IBMA 2J9RA 2ZR9A 3HJNA 5EXSA 2ZU0C 4NH0A 4EPYA 2VP9A 4U7DA 1SVWA 2XGJA 1CR2A 1FW6A 2AXNA 5L3SB 5JJLA 2PEYA 3Q85A 3SI7A 1NKSA 4DCTA 3RS5A 1NY5A 4OJQA 3D31A 4TLAA 2FX3A 2QP4A 5EE1A 4C7OA 3T34A 1II0A 1NMYA 1DAGA 2CHQA 2O52A 2X19A 3W9YA 4CT4B 1OXUA 5KTYA 2VRWA 2WKPA 1M74A 1OIXA 3A1TA 2CHVA 1Z22A 3DO6A 3TVTA 3R8FA 4AD8A 3GEEA 1E2NA 4LBWA 3GJ6A 3I8XA 2O8EB 2H92A 3CIOA 1F48A 5AUNB 4DUGA 3NC0C 1OB2A 2V55B 4DCVA 1E0AA 1QHGA 5LB2A 3VR6A 4B3GA 4QRHA 2PMDA 3ICQB 4MH0R 1VCIA 3SEAA 1N6OA 2JLSA 5BN3A 3X2SA 4D4LA 2NOAA 3ZGXA 3U4QB 2OEPA 3SZRA 3PV0A 2D7CA 1AQYA 1N5LA 3KDSE 2IYLD 1R5OA 4Q9IA 2OM2A 3OESA 4CEJA 5JZVA 4ON9A 1KI8A 5IHPA 2ZRPA 1R8SA 4G5OA 3SYKA 3KB1A 4LX0A 2ANCA 4I99A 1NVVQ 3AF4A 3T1QA 5FL7D 2ZS9A 4Q7LA 4D2IA 1DAHA 1GNRA 5FPSA 5DHAA 2DBYA 2OHFA 2J45A 1Z5ZA 4L9WA 4NCKA 1G7CA 4Q1AA 1YVDA 2Q3FA 1CEEA 2CVFA 5JWRA 4XD7D 5E3HA 4RY2A 3KXKA 2NIPA 3BB4A 4F92B 1N0WA 3BWDD 4BFYA 5J4VA 1J99A 2WPDD 5CK4A 2J46A 3PXGA 4JSYA 3R8CA 4M1YA 2GESA 2CL7X 1C1YA 5K8IA 2YVUA 1E9EA 5FFMA 1J8YF 3H86A 3UATA 2FN4A 1N6RA 2A5JA 4DCNA 1W0JD 2R6DA 4GPTA 2IYYA 4KLZA 2V4ZA 4JIMA 5KYKA 2WWFA 5JRJA 3QUSA 3BE4A 3GFTA 1HH4A 2VF7A 1R8QA 5KSOA 5TB5A 4IHQA 3M0EA 5G3ZA 3VMFA 3NTUA 3KTAB 2J0SA 1ZRHA 1T8TA 2FZLA 3A1WA 4ZIRB 2W6IA 1DG3A 1G18A 3SU8A 3SYNA 3QVUA 3EPLA 1WF3A 5CK5A 1UKYA 4E09A 2J41A 1UJ2A 3EPJA 2QBYA 1NLYA 1Z47A 1SKQA 1F5NA 1XJQA 1S4QA 3RS0A 2AD5A 2GEUA 1WCV1 3AP1A 2XOKA 3OE7D 2CMKA 2GXAA 4A8JA 4GNKA 4HDOB 4QHTA 1H65A 5EZ6B 1ZM7A 2VEDA 4PO8A 1TF7A 2A5GA 2XSZD 3K0AB 1FFHA 1G20E 3L43A 5JS8A 4G3XA 4Q9JA 1KI3A 3TUJC 3UG6A 5JFGA 4TSFA 2PH1A 1DS6A 1OT3A 3THXA 2ZJOA 2FSIA 1VCNA 2JA1A 3FHOA 3UMSA 2J87A 4IOJA 3THYA 3BRWD 4HDCA 4PPNA 5JJIA 5BW8A 2NMVA 2NQ2C 1YJ5A 2ZE5A 1SVIA 2DFLA 4C7OB 4AKGA 5G40A 2P65A 2MMCA 1UF9A 4LJ8A 1W47A 2QM7A 1KK3A 4V0NA 3U7GA 3ZDQA 1M1YE 4XSGA 2IC5A 4MRVA 1YRAA 3MD0A 1HQYE 1HEIA 5JCPA 3FOZA 1XMJA 2MSCB 3LY5A 1CTQA 2VL7A 2RMKA 2Q3MA 3RNLA 1WE2A 5FTNA 2IS2A 1Z63A 4Q21A 5AJYA 4GBMA 4HB2A 5HR5A 1I4DD 2HT1A 2OCYC 3KQHA 1AGPA 1ZD1A 1Z2CA 4M1SA 3VHXA 2WV9A 3QSYA 1EWQA 3TKLA 4P32A 4UKDA 5KSYA 5FI1B 3AGQA 2HT6A 3SS8A 1P4SA 3BC1A 5F98A 3KQKA 1XZPA 4JBXA 2F1IA 3MFYA 1OFHA 1DARA 4BFXA 1KAOA 1I4TD 2VHQA 1P6XA 2H16A 1KY2A 4MGZR 4V0MA 5H8WA 2QAGA 2JLVA 1KSJA 1OW3B 1N6KA 3UANA 3CW2A 3PUWA 3QF7A 1R2QA 2CVHA 1U90A 3TLXA 1L7VC 3I8SA 3X1DA 1Z0FA 4QFMA 1KO7A 1G3UA 2PZGA 2Q9CA 4JLDA 1K8RA 1TX4B 3A4LA 2ODWA 4KXFB 4NPHA 4Q4JA 3ECCA 2WICA 5HZKA 5KO2A 2R65A 4DJTA 4M1OA 2HUPA 5JEDA 4LV5B 3MUFA 2WOJA 1HE1C 1IN7A 1SXJB 2YC2C 3KFVA 1E32A 1JJVA 4HLQB 4JS0A 1EFHA 1MOZA 4B74A 1W4CA 1Q1QA 1KO1A 1UKZA 4DRZA 3W3ZB 1T8UA 3ZS8A 4R7ZA 2V9PA 1RRCA 3GFOA 1X86B 1E2GA 2B92A 3FDIA 1GL9B 3GFPA 4B2PA 2ZANA 2P6RA 1U99A 3LA6A 4PTLA 4ZDIA 1UFQA
chains in the Genus database with same CATH superfamily
1I51A 3OLYA 4LDNA 4GZLA 5JXJA 4PYIA 1EX7A 2ZT5A 2SKDA 3K0FB 4ZC8A 1TW2A 3CIFA 4FN5A 4LPSA 5J5CA 3TTUA 3IKLA 3ZU5A 1EB8A 4MI9A 4OQLA 4NRDA 3GG9A 1H5UA 3PHCA 1GG9A 2AHOA 1U0OC 1P2GA 1P4GA 1T3SA 1ZGHA 1JLLB 3GEPA 3DT6A 1NU8A 1VMIA 3CGWA 5IT9A 2NPFA 1M9NA 3SR4A 1RI3A 4OI1A 3O7MA 2P41A 5FA6A 3H9JA 1JPNA 3HE3A 2I2CA 5BSTA 1KO8A 1EQUA 3KYDB 3FF1A 3TEFA 4BEJA 3KV1A 2QX8A 5F2OA 3W3AA 3IOBA 1E9RA 4M1MA 1T8SA 3TDMA 1SBNE 2V6IA 4NMLA 1ENZA 1E98A 1WDWB 3GQBB 4RV5A 5T3UA 5K20A 3K5HA 4DY4A 1V39A 3ESAA 2GEFA 1XZEA 2JCBA 2IYZA 4Z7JA 3HY4A 5LOVF 2WJGA 2AUNA 4GM4A 5CG2A 2YUTA 1TK9A 5L4SA 3CN7A 1JKIA 2DR0A 4L4SA 1NBMA 2J48A 4OHYA 4OHKA 2X8JB 3GRFA 1M1ZA 4GFDA 3AEUB 3R9KA 1BROA 4K6KA 1XHLA 2HCTA 3EWNA 4R7GA 2QTHA 3FSGA 4NOJA 4Q16A 4ND8A 1KI4A 2WRZA 3ESCA 2O1XA 4DHEA 2IH2A 4RGVA 1GRQA 4IVNA 2HU2A 4NE7A 5ENVA 4FEYA 3NUZA 2X0RA 4EFMA 2EZ9A 3NETA 5FLEX 2BUCA 3W1VA 4BLUA 1E1NA 2QX9A 4EL0A 1HT2E 4L28A 4YALA 5BSUA 3FYUC 4B8YA 5AM2A 2AEMA 1DC5A 3SS9X 4P8RA 3NGMA 4OJYA 3HFRA 1GZSA 2PU5A 3DAYA 5TQ0A 3TNLA 3LY9A 4GD3Q 3SBEA 4PNEA 1PFKA 2ZFUA 3ZWPA 3QG5A 1Z2DA 3WRXC 3ZXSA 1GU1A 4HEA1 4GKKB 2IBSA 3NQ41 2V7VA 3O8OA 1NQOA 1S2OA 1XN1A 4FEAA 3GPIA 1ISSA 5A5EA 4M49A 3MIZA 4MWDA 3J80A 4Z2YA 1JYEA 1XSEA 4B8ZA 5IBRA 2QQFA 1LK7A 3T7SA 3H6HA 5AJXA 1A1SA 1P2FA 2HMWA 1EQAA 5C1IA 4F71A 3FSEA 4MW7A 3ISJA 4OQZA 3I4CA 4OREX 4ZU6X 1G8YA 4B43A 3M33A 3P0FA 2J67A 3P2OA 1E59A 1JPJA 4Q3LA 5DJ5A 3ZUPA 2ZYGA 2ZTMA 4WNAA 3RJ5A 3DQPA 3ORHA 1WBDA 3F4LA 4LRWA 1GNVA 5DI9A 2AZDA 1W4LA 2YJGA 4GMGA 4CLRB 4CN8A 3IE1A 2A1TR 4UCQA 2J5BA 4G5GA 1V3TA 2WBLC 4IG9A 3OBBA 3ICVA 4JVLA 1I8TA 3DFIA 1EFCA 1PW7A 4RKYA 4TLBA 2F64A 3I6YA 4E94A 1TKBA 1HDIA 5DRTA 2Q46A 1SURA 2ZZKA 3E7PA 4F84A 5EIFA 4B6RA 4D9KA 1FDUA 1T2VA 2UAGA 4Q1CA 2YWHA 3T7DA 4AZSA 5C5IA 3N87A 1FFXA 3PX2A 4YAKA 2JD0A 3ZHYA 4IFTA 1WUIS 2FWJA 3BWXA 5G41A 4IJ6A 4NAHA 3L07A 3EG9B 4BLTA 4K9PA 4MRRA 3B2EA 4KBYA 4F5DA 3ED1A 3DEFA 1MOQA 3MMPA 4H1VA 2GNAA 4EG0A 4BO6A 1M2EA 1HR0B 1X1BA 3KEQA 5BMVB 2JFHA 1E7RA 2AGVA 4KOAA 3F9CA 1LCIA 1RWOA 4LBZA 4MQBA 1EVJA 1KFEB 2ZGVA 4DANA 4HQOA 2IDJA 4HGOA 1M33A 3ZZMA 3CO5A 2QUIA 3DZFA 3OJOA 1BG6A 2R48A 3TQQA 1E9CA 5EJEA 1DO8A 1XKQA 3PPVA 5AOAA 2V58A 5DK6A 1JR2A 3DTVD 1YC5A 3CTPA 5B3JA 1YAHA 5JXHA 1P9WA 1WUYA 1U94A 5ESWA 2NTVA 3RODA 4FS3A 1YMQA 4LHYA 4ZO7A 1B8PA 1YI8A 3BIOA 5KOJB 3NW9A 4DR3B 4QQNA 3ENVA 3UWPA 2GO1A 1H4TA 1Q22A 2HSDA 3DMTA 3K0BA 4FCVA 1E3SA 1NW5A 3L1IA 4RY0A 4YRGA 3FKJA 3GJ3A 3I9NA 1RI1A 1XKXA 2P35A 4OSEA 3K5PA 2CXUA 3JXEA 4LSWA 1PTJC 3V8PA 4B4UA 2BE7A 1ABBA 3MSXA 5FOUA 3UJHA 5AVQA 3ABQB 3I2HA 3ZNQA 3PYXA 1E99A 4H0FA 3JPWA 3IKTA 3QYFA 3ZD7A 3HP4A 3QEKA 3ENQA 2W6JA 3BDVA 4GMXA 2QNIA 5EQDA 4TKVA 3E9RA 1PT6A 4JR2A 4P83A 4ZT2A 5BVHB 2EW1A 3OC0A 1E4OA 1M8JA 1ZC3A 4AIRA 1Q7BA 1Q6ZA 1SCBA 2JJ2A 4GX2A 4PCLA 5HK9A 1Y6QA 2AG6A 4OYHA 3SQMA 2WAOA 1CNEA 1QVVA 1UXIA 2BFCB 4MZDA 2CNWD 2NXWA 4IFIA 4BQOA 2R0QC 4C2UA 4JKIA 2XCRB 2EWVA 4NBSA 2X1VA 3N74A 1J8QA 3VJMA 1FU7A 2P4UA 3F8WA 2V7EA 3QVXA 4G0PA 4NJOA 4XDGA 1W4RA 2NTJA 1PK9A 3AUTA 4XEHA 4PC3A 3T35A 1US8A 2V96A 5CYGA 3ETEA 3Q0TA 1FFCA 4V0RA 2IPLA 4X1OA 1XZCA 1GWNA 4M9QA 2RGGA 2DHQA 2PSSA 4RD1A 3MW8A 5M29A 4ZAYA 3ZHQA 4FZRA 2PUTA 4MB0A 5JZBA 3LLCA 1JDNA 2JKZA 5IYZB 4NBWA 3PI7A 3RUAA 1FLVA 4LC0A 4YJHA 3LI2A 3CWZA 3Q9UA 3ISVA 3CZMA 5L3SA 1XLUA 1F8GA 1RM4A 3QUBA 1UK8A 3QVLA 4ZXFA 3NYWA 1FLNA 3DQQA 2C5EA 2RSLA 5AKLA 2G1KA 3FPCA 2I4LA 4I9GA 5MGNA 4DC1A 4FKZA 5FQNA 4YRLA 5MF6A 1UT6A 4A36A 3CF4A 3GA0A 2DP4E 2Z2JA 5GV8A 3T41A 1NXPA 2CJWA 2ONZA 1I3NA 2RC5A 2QT1A 3I9FA 3OI7A 2D06A 4MA0A 5D85A 5JPCA 2Z09A 3LQKA 3PDCA 3PD1A 2ECPA 4ZAZA 7YASA 2QP9X 2H7XA 3GD5A 5JWOA 1URPA 3DMYA 4MVYA 5GONF 1L7PA 1ZIPA 2GXQA 3GD7A 2J3EA 2VJQA 4K6FA 3WA6A 4R9VA 2X2FA 2ECOA 4L27A 5FPHA 4TZTA 1L5NA 4CM1A 4F2PA 1UBFA 1P9NA 2NVWA 1JB1A 4KO1S 5FBVB 4A2PA 4YLEA 1XF1A 3ZEAA 2CMFA 2P75A 1H1TA 2WJPA 1CUZA 1JWLA 5JXWA 2Z2IA 2A9JA 4F06A 1KYVA 4R81A 1A5ZA 2EW8A 3PC6A 4ISBA 3NJ4A 1VYHA 1TT5A 4B2IA 5LUBA 1ZC4A 1AKWA 2QZ9A 4FTWA 5KQMA 5EIAA 2XT9A 3DVLA 1IAVA 3IQFA 4KQ6A 4HRVA 1IHPA 5T67A 1QK4A 1JG6A 4AO8A 4CMCA 1IPFA 1ML4A 1OBCA 2QG4A 4OHUA 2RHDA 4JP2A 1OYWA 3QI7A 1L7AA 4URXR 5K5EA 4EO4A 2PO7A 3C8HA 4GPBA 1EE1A 2V4MA 1DJQA 1WDMA 1E2LA 5A05A 1EESA 1HETA 4EPVA 3ZK9A 1U7ZA 1ZA1A 4GS5A 2B5OA 2VJMA 2XUDA 1O77A 1GT91 5TC4A 2FG5A 4QDOA 3IPXA 5KVCA 5BVGA 4E2WA 3AETA 3H2BA 1OV4A 5FDFA 1T10A 4M0UA 4YPFA 1PF7E 4Z8YA 3L9WA 2N75A 2RG1A 4MSUA 5G02A 4DMFA 2XW6A 2UDPA 5I3ZA 1ISFA 2YJ6A 1C30A 3HJGA 4YRQA 3JRXA 2F4NA 4QDTA 4Z53A 1IZ7A 4RF2A 4FHFA 5FNZA 2IE8A 1WNTA 1U2GA 2GYVA 1RPAA 2I6TA 3AUSA 3AXTA 3EISA 3MT9A 4JBLA 4LKRA 3CGGA 4UAJA 3OQNA 3U4IA 1SWWA 2J07A 5DN6A 3K1YA 4YLGA 4HH0A 1QF9A 1ETHA 4G5QA 3T7IA 2I1QA 4UVDA 2Q0HA 2XMBA 3I6BA 3KOUA 3P2KA 4ZDWA 2VFAA 5DOZA 2BYTA 2OGTA 1N1MA 3CY6A 2REXB 3TLYA 1ZRSA 4ARIA 2B8TA 4P5PA 5KYUA 3WQHA 2V7XA 2VZ0A 1OYYA 2C9CA 3DKKA 3SHFA 4RPHA 4F4JA 3ADOA 5JJ5A 3WLJA 3WV5A 5KB3A 4F8EA 2JGIA 1VG9B 3GBVA 1ZN8A 3HADA 1O6CA 4YASA 3JD4A 1JNYA 3WIBA 5L4NA 2WU1A 1L4FA 5KYWA 1M1NA 2G9UA 4J91A 1XVAA 3EXIB 3KTAA 2D1SA 1ZH2A 4XCXA 2R62A 1UBMS 4OQ4A 3EW9A 1UJBA 4ZIRA 4C78A 4DF3A 3EOZA 3LIPA 1XV5A 1WDLA 2J9FB 1JUDA 2IEBA 2JFYA 3PC8C 1FDVA 1W96A 2VP0A 4R5HA 4U6SA 3F7TA 1Q1BA 4FKMA 4UEWA 4BIIA 5KREA 2VF5X 4NK4A 3DDHA 1Y8RA 4QREA 4DL9A 3LSTA 2JBAB 2PS9A 4YAEA 1SHZA 1ATZA 3H1TA 2GZDA 2GA8A 3TSCA 1BMFA 3PDUA 4JLUA 4MW0A 1O97D 1PGPA 2FJUA 4HFNA 3W1EA 4CKBA 5J47A 1NKVA 4CFSA 3A6PC 2Q3LA 4MS3B 3AHEA 1ZVVA 2HWYA 4JY7A 4EB6A 5KYVA 5HM8A 4DR5B 4KN5A 2EGUA 2UYOA 3AP3A 2Z3ZA 4RPKA 1MEJA 4BTEA 1DIRA 5LLDA 2JFPA 3UAVA 4X3CA 3O1HB 1SQ0A 2FSVA 2RHRA 1I1OA 1N2BA 1GZDA 1UBGA 1UODA 1VKHA 3C6ZA 3T5CA 3LNTA 3ELUA 2GETA 3GJZA 3E82A 2RGRA 3F4BA 3RTBA 1NDHA 4MWSA 3CEMA 4UASA 1OH6A 1X15A 3BMQB 1OILA 3DGEC 3PFWO 2O2DA 1RQRA 5HA5A 5A7HA 1J1IA 4DN6A 4M99A 3NORA 1XU4A 4UM9B 3B12A 1X7WA 3RUFA 1PV1A 3OZEA 3QFSA 3UO8B 2G4CA 1HC7A 2DSNA 1ONSA 4FFSA 1DC6A 1WXDA 2VF2A 3DEYX 4G1FA 1L6RA 1QQ5A 2ZWAA 4RZUA 4W5JA 1B3RA 1IU9A 4W1SA 3V8BA 3DOFA 3PD0A 4MYUA 3OQHA 1KOFA 5EKXA 3ZXXA 1D2EA 2SNIE 3KLBA 4PLTA 2GAAA 4D80A 2VT2A 2YBDA 1HLDA 4FW9A 4RHYA 3EXG2 3CH7A 4D97A 2AQIA 2H06A 2PO5A 1HG0A 1RZRD 3ZW8A 4CEHB 4DJJA 2BKVA 3TLBA 1IZ9A 1ORTA 2FG6C 2IY8A 1NUQA 1W1IA 5K0EA 1ZIXA 5HTOA 3PZBA 4EX7A 2Q7DA 2P9TA 3K7EA 4YHBA 4G84A 4NE9A 3Q87B 2LWIA 2ZIVB 5SZIA 4CF5A 3ILHA 1JN0A 1P1JA 1I7PA 2HLPA 3K73O 3E53A 2O3UA 2Z1DA 1QYVA 3AF3A 2E4VA 4MGYR 2NZ2A 3BH7A 3IHKA 4NKRA 3SC6A 1MJ5A 2VWHA 1U31A 1NRXA 1DL5A 4J07A 4JMPA 2F1KA 2O8BA 4K9QA 2W98A 3GFBA 1KS9A 4D26A 1C41A 1QKKA 3DGFC 3GLQA 2DOKA 1DT5A 4FNOA 4MHOA 4Y9TA 1R88A 3Q3GE 4J4TA 1PGQA 1DFGA 1Q0RA 3HVIA 3RT7A 5BN4B 2WA2A 1MPTA 4W1RA 1G3MA 4UMEA 2OHGA 3L40A 4N5HX 1NW9B 1KEPA 1MX1A 3Q2OA 4AY5A 1Z5WA 1DLJA 1E5XA 3SXPA 5BYAA 2BC9A 3D8RA 3UG7A 3CVVA 2O6HA 5JC8A 2GBLA 4UXHA 5TMBA 1CUGA 2RGWA 4UAUA 1Y6JA 5K51A 1H8EA 3KWLA 3WL3A 4G1BA 3REFA 1SC9A 3NH9A 3FPBA 3KSUA 1N7JA 1JR3A 1XNJA 1WUHS 4ASUA 3FF4A 3GVPA 1G21A 1N2GA 2ZYUX 5K8VA 3ACBA 1KSFX 3QYJA 5IAGA 2F00A 1J21A 5BVHA 1HZZC 4BLVA 2QZ4A 1DAFA 4MS1A 1Q7EA 4Y2XA 4FFWA 2PH5A 3STVA 1C4WA 3HKCA 2J9GA 1NQ5A 3RRJA 1VIDA 1C7JA 2XMQA 3IJPA 1GD1O 3PEFA 3QX9A 1T36B 3FYSA 2NU8B 3DMPA 4GKBA 3K2EA 4M8LA 5ALGA 3LL7A 3LX8A 3TMKA 2GPJA 2VCEA 1D1SA 4ZRNA 5MDHA 3ZWOA 3ZBPA 5KYGA 1TQ8A 2VG8A 4QHYA 5HF6A 2FOXA 1RP1A 4JP8A 2YJTD 4M1KA 3UMJA 4BGEA 3LWBA 2YMLA 1G16A 3K0FA 4NYIR 3OA2A 5DBGA 4C0HA 2ZRGA 4DABA 2UXBB 3P9CA 4JZYA 1HO3A 3MRVA 1N1EA 4ND7A 5CDUA 1L8LA 1JLLA 2VRBA 4JXJA 1XI2A 3Q15C 5ALFA 2QSZA 4FC6A 1PYDA 3QNWA 4PSKA 1WM1A 5JATA 4E46A 3QLTA 3RVQA 3LUGA 1KC3A 2NZWA 3HWWA 3IEXA 2EKPA 4FLEA 1DBRA 3AB8A 3LECA 5HS6A 4C21A 3PGMA 5A5GA 4HYEA 2ZCUA 2XCSB 4HB3A 2HIAA 4OV6B 5I7HA 1Z0ZA 5DEIA 2BDEA 3I9KA 2Q2OA 3KYDA 3DJYA 1I30A 4E5UA 1T9AA 1KJJA 2PT9A 2Z3WA 3G8BA 3GQBA 5CM2Z 3KHUA 4ZQHA 3GGDA 4HMOA 3A1CA 3PQ7A 1QUEA 2P0EA 2VUUA 2XYRA 1JHUA 5DW3A 1TXGA 3EN0A 3WHLA 3RTAA 2OGUA 3DD5A 1A50B 1D9XA 4IF6A 2VTBA 1FRQA 2Q5CA 3C3AA 1DLIA 5TIIA 2EARA 5E6UB 1QFJA 5C7OO 4EHBA 4BX9A 4E2YA 1JLHA 2FW7A 3RU7A 5HMLA 1BU8A 3AEUA 4FYWA 5DM1A 2IWRA 5AOCA 2JGKA 4B6QA 3IUPA 4RGBA 5EESA 2XJ4A 2Z9CA 4YRSA 5BOSB 3DM9B 5DOVA 1AHHA 1P91A 1CY6A 1YXMA 1IK6A 4RZ3A 2NO7A 3SQLA 4BMPB 4LF8B 2GBIA 1C8LA 1BFKA 4C6HA 3FTEA 5IZ4A 2Y0EA 4BUZA 5CDFE 2JHAA 2BMJA 4JITA 1OVMA 2EL7A 3WGYA 5M7EA 1HYBA 4MVJH 4YX9A 1TEVA 4NU5A 4X1KB 6Q21A 1G291 3A1VA 2IW1A 4QLAA 4E5DA 3O7WA 5IT5A 4BQNA 2DLDA 3D6AA 4ARUA 5K9ZA 1L3BA 4M60A 1RYMA 2Z57A 1K5GA 3ZHZA 3CNHA 3F4KA 2FF7A 2JZOA 3L8FA 2LP4Y 3N7TA 2PUGA 2XA1A 1DE0A 1P81A 2BHNA 2IDKA 3F46A 3JARB 3PXBA 1KXZA 2WSLA 2G9NA 3NFYA 1RHUA 1V7PC 2CEAA 2MT9A 4KPUB 3Q7IA 2W6QA 3LYLA 2C00A 4GOND 4FXPA 4UJ5A 3SHVA 3ZI7A 1KSHA 1Q50A 4TUYF 2PX5A 1ZSVA 4EECA 2C9MA 4S2UA 2GYUA 5AVYA 1RXVA 2V7BA 1U8EA 4CIDA 1H0SA 2C57A 2V8BA 5KHOC 3NPMA 2H6EA 4NCXA 3R7BA 1SU7A 1KVUA 4RENA 3TLCA 4CLRA 4M8IA 1FYEA 2G7ZA 3IHLA 1ZNWA 3PG5A 3H04A 1JIIA 4FOTA 4QDKA 4XD7A 2DF8A 2VUSA 1ZJZA 2BGUA 2VK1A 2WTMA 3R5TA 4K9OA 4MW1A 4LCEA 5ECGC 4DA8A 1QAMA 4YMTA 1DEXA 5B1DA 3HR4A 3FTPA 9ABPA 4KR3A 2XMCA 1SU6A 3FZYA 3VR4H 4DSZA 2LVBA 1GUAA 2CLDX 3H9BA 4EGAA 1RWQA 1YOVB 2BR4A 3B20A 1E1DA 2C04A 4KDFA 4RKEA 3ZHCA 1Y4SA 3ADCA 1JJIA 8OHMA 1SXJE 3EG9A 5ALMA 3GG2A 5IVHA 1XEXB 2QD4A 2H63A 3MHTA 3R40A 4D0GA 3AUXA 1FLAA 1LGYA 4ER0A 4Z6KA 1E63A 4KG7A 4MUGA 1NVWQ 5IRCD 1KH1A 3W2GA 2GPWA 3OG9A 1T9KA 2Y0BA 5BMVA 3HTXA 3V4LA 4RAQA 1VSVA 4IINA 3D7KA 1P1RA 2HAEA 1U2ZA 2QMZA 3GWGA 3CX3A 3HKEB 3LX4A 1JDPA 3O4GA 4UE3S 5CXSA 1C3XA 2OQVA 3MGKA 2ZK7A 4UQPA 3SVZA 5IH7A 1QPGA 4MI1A 4DQLA 2QX6A 1I4OA 4GC9A 3NWPA 3ZCUA 3RGWS 4GGOA 2VHTA 2XLBA 1PJ2A 4LRUA 1DEKA 2PS3A 1TYZA 3M3DA 2UZ0A 4KZPA 3U7HB 3AM1A 3CJQA 4MYSA 5CCBA 2XUFA 1N2EA 2P7IA 1EUDB 1V1JA 2ZP1A 1OAOC 5HZHA 5HMMA 4XQGA 5KOJA 1M34B 2PNJA 4Q3DA 4ZQFA 1ULZA 2OXFA 3P94A 1VJ5A 4J1TA 1Z5OA 3NUGA 2XTJA 1KR2A 5E3IA 2NAFA 4Y2UA 1N0UA 1RRPA 2QRZA 3N2IA 4WA7A 5TE9A 3D3QA 1SG9A 3WC4A 3I2GA 1LSOA 2HSEA 1ONNA 4FMDF 3S1LA 5HOQA 5CLJA 1Y9AA 1Y3AA 2GR9A 3QUQA 5LYYA 5FOQA 1E5TA 3GAFA 1RKVA 2WAMA 2K5UA 4AIIA 4UTXA 1FNCA 4M7RA 2P9YA 2YV2A 1QWSA 1GVNB 3FOAA 1QYDA 3JZFA 2VDLB 2AJ8A 3HBFA 2QXTA 3ZE6A 1G41A 1GL7A 3OQJA 1CQIB 4KQKA 5F7ZA 1SG0A 4MQ6A 4U8GA 3C4VA 4QNNA 2FMTA 4RKWA 3INTA 5KWSA 3EC2A 3WWCA 2BFCA 3MYYA 4PWZA 4DIUA 4RJTA 8ADHA 5IUNC 1DAIA 4JV5B 3B8HA 3QE4A 4D6XA 2VYCA 1K9VF 4KU4A 5DNCA 4PQFA 3HG7A 4B17A 2IYXA 3SIPA 1IRXA 2IITA 2OAP1 2P6UA 1NJSA 4WW0A 3RWBA 3O0DA 4H3SA 3QHAA 2QQ5A 4A0HA 5CR9A 1FRNA 4M0FA 1P0PA 3NNSA 4JR0A 3A3KA 3I6QA 3ZZ0A 4LJKA 1DQNA 5JQGB 1W4ZA 3Q5GA 3GDWA 4RXUA 5JSYA 3QBDA 3USES 1W7AA 3UZUA 1UK9A 4XYBA 4GUDA 5HP4A 1E3WB 3ULKA 1SHJA 4G4SO 4AWBA 4GOXA 1WD7A 1X1TA 2AEJA 1BMQA 4ML3A 5G4KB 2VKQA 1HDCA 3PXCX 5IYZA 4JUAA 1P2UA 1XXHE 2WWXA 1DXOA 2FPKA 2G4VA 4KSBA 1HQKA 2QROA 3IYLW 4L2IB 5ABPA 1OI7A 2WWTA 1R74A 1G3RA 3O4IA 4DIKA 4DDTA 2WWGA 3HVKA 5HKBA 1RABA 4M88A 5I7AA 1NONA 1R0CA 5TT1A 3THWB 1KZ6A 1ZFNA 1QVAA 1UT8A 3OZTA 4HSGA 1SC3A 5JALA 3BXFA 4ARBA 1GOTA 2VHXA 3CXUA 3DB2A 3FPFA 3ZU3A 2D2IA 2JHCA 4RDCA 2OO5C 5CB6A 3LSYA 4DDVA 1FQOA 5ALXA 1OBOA 1V47A 1O54A 3EDOA 3CR3C 4X5OA 2PA0A 5CDYA 5HOEA 3HKBB 1XP8A 3AQ4A 2QXUA 3RHFA 1NI3A 3HUUA 5IJXA 5F9HA 2BM1A 2AQHA 1Y5RA 5EZYA 3P0JA 4C2BA 5FEUA 2AJTA 5EMMA 1FDIA 1BVHA 4YJ2F 3RS2A 1UR5A 1GSHA 4K9DA 4TYQA 1RYDA 1JXMA 5CT9A 1A3CA 1SD1A 3DOHA 4IJ5A 2D2XA 1XCJA 3PYLA 2YXDA 4C4AA 1XLWA 3ROKA 3Q11A 1W4BA 1U9ZA 1O97C 2J3QA 2G3YA 1N25A 4Z1MD 3L18A 4MVJD 3SAJA 4EYKA 4NULA 1JHDA 1M73E 1I4LD 1ABFA 1PWXA 2HDWA 2JRCA 4NI5A 3VZPA 4L15A 5IC4A 3Q7EA 4XRRA 4OQXA 3HSYA 4C76A 1F4LA 3U09A 3SXJA 3BEDA 4WKCA 1DGQA 1DTWB 1ZU5A 1WDTA 2ZRCA 2K7FA 4NL4H 4GI5A 3QENA 4PBRA 1MH9A 2ODEA 2MINB 2HNKA 4YV1A 4TXJA 2R751 2YVAA 1R50A 2AMLA 4KPEC 1C9JA 3L6CA 2GM9A 2JFGA 3FPJA 4N8SA 2C0QA 3E3LA 5CM8B 4OHOA 3WLIA 1ZN9A 2F3QA 1JPUA 3ZWXA 1XA4A 1Z0UA 3RAGA 4BATA 1K7SN 3L8ZA 4HP8A 1QHHB 1TYCA 2LRHA 4UARA 1I14A 1N57A 2D8AA 5H7XA 1PT8A 3CPHA 1J56A 1Q0SA 3PU6A 3NBFA 4FYYA 4RELA 5AK6A 5FOWA 3MTGA 4MAAA 3HL0A 3B36A 2ZIUB 1R4AA 4RPJA 5CU7A 4AB1A 4CWAA 2OCLA 3V3KA 5BW4A 2X9GA 1KQOA 2MYUA 1I2DA 1VTKA 2XNDA 3IUJA 1OXTA 3FYCA 3OX3A 4C3ZA 1HNZB 5CMLA 3CB4A 1SKBA 4Y7CA 2H59A 2H4ZA 5DP2A 5AM3A 3KKEA 1CBUA 4BBJA 3QUCA 1JE1A 3AFOA 4POAA 1QIFA 1QZZA 3OEHA 2I1WA 1R5BA 4BHTA 2Q8PA 2OK7A 4LF5B 5AK0A 2JLRA 4ZT7A 3D3WB 1GUYA 2J0UA 2QQ0A 1A04A 1D6JA 5K99A 4Z9YA 5KINB 3D4IA 2PX0A 4LDRA 4LYEA 2YFHA 1Z0KA 2WT8A 3AC0A 4GP9A 2QMHA 3T3DA 3FBWA 5AI0A 3URKA 1GYPA 1CZKA 1NI5A 1MNQA 2Q5JA 3V2HA 1ONPA 1UK7A 2HL6A 3EXIA 1UC4B 4DSTA 2AT1A 1NP3A 5JD3A 1VJRA 1E79A 1RSZA 1C0PA 2J9FA 1L1RA 1PLJA 1Q7CA 1W48A 2GERA 1FQJA 1XTSA 2ERYA 2G1UA 2IZ5A 3FPAA 5K3AA 1KVTA 3WKCA 3WZ2A 4GX1A 4BNDB 4HVCA 3A1NA 5JNSA 3GXBA 4G09A 2JBAA 1E2FA 1EK0A 1JLKA 1RXIA 3ELWA 4PGHA 1NBME 2NO6A 5IDXA 2R5NA 4QZVA 3ICEA 3IUEA 4DUPA 3GVXA 1OX6A 4NICA 3ETNA 4HUTA 3PKZA 4FMCB 4G0NA 4CKWB 3R3ZA 2VC2B 4PLFA 5FJJA 2Q62A 1LFDB 2Q0QA 3F97A 2R5FA 3L0DA 1IMJA 3FI9A 3G8CA 3BWVA 2F43A 4YRNA 5JAOA 2EYQA 4ICIA 1LY1A 1NSFA 1CKEA 4JX8A 1U2DA 3H7AA 4MUFA 3P9QA 5JNTA 2WD8A 4GOLD 4JYCA 2H65A 3HI6A 4RSMA 3UMYA 4ZVPA 3PLRA 3ZGYA 4MVWA 1AUOA 4L8GA 5GJVC 5HK8A 2BVNA 2RHJA 1UBNA 2VH1A 3L0IB 2CF5A 5ALJA 5FI0B 2NUAB 3N8NA 3L4SO 2WG1A 1GPLA 2X6TA 3LUBA 2F7SA 3N76A 5K3EA 2RIRA 3QPUA 1U2PA 4H0NA 5ETJA 2JCSA 2O1EA 1A82A 3WIOA 3L0BA 2CSXA 2X13A 1U11A 4WKGA 2I3ZA 4G8BA 4CR7A 3JQ9C 1U0LA 4NFLA 2XNKA 3LHKA 2VDUE 4W4TA 3UFBA 5HTKA 1KOGA 1QXSA 2NNWB 1VCMA 3ASVA 1G7TA 3QVMA 5L3QA 2ZWVA 4URHA 4YS6A 4FCWA 4CEHA 3VOSA 5AKEA 1TA4A 2JLBA 4MR9B 3I9LA 3ZWQA 3MTJA 3LS2A 3ETCA 2YWRA 1MRNA 3BZBA 3LCRA 4B3HA 1C0IA 4DLUA 1QIGA 3TTSA 2DQKA 2PUJA 4MCJA 4HDMA 1HE2A 1UM8A 3MPOA 2ARKA 5K2MA 3T5DA 1J6UA 3C39A 4YMHA 1NULA 1UKAA 4ZKEA 3R23A 1Z13A 4DNPA 1DIOB 1KMMA 1WXXA 5GZ1A 2DKFA 2B34A 3N3BC 1EBBA 1FQWA 1L6IA 1DKNA 3PL5A 1F6BA 1OQAA 2IELA 4R54A 2W71A 2P9FA 1DEAA 3GJSA 3AU9A 4YC7A 3O95A 1KEEB 3T7RA 4BVFA 3CLHA 1FP7A 4P53A 3D6MA 4F5ZA 3IUMA 4M87A 5AVXA 1DKRA 5FWXA 4UVEA 4TM8A 5BN4A 1FDRA 1D7OA 4WNIA 1XZ8A 3H18A 4JODA 3N39C 3DLAA 4OKIA 1I2ZA 1TZCA 1NJ5A 1TQ2A 2ATCA 2VHEA 4MUJA 2R6R1 3DWIA 4AJJA 2BSXA 2PRJA 3RH0A 1G9SA 3OWXA 4BTLA 3NATA 3T12A 4X6YA 1Q2UA 2QB5A 1TO2E 1MDBA 2PSEA 4U7GA 4Y2PA 2VSQA 2H1RA 2QL6A 1NZFA 3FJYA 2IZOA 3Q6NA 4YMLA 5KWJA 2ILVA 4AECA 3OZCA 5EJ9A 3GJ7A 4JB0A 2OD9A 2XVAA 3STTA 2JD1A 4XVUA 5DNYB 1XR3A 2QD1A 4QODA 4LZLA 1A9YA 5JJKA 5I9NA 2W70A 3T8YA 5IK2D 1OAAA 2OD7A 3O03A 1BDMA 5CVJA 5F4ZA 2ADFA 2YNMA 3CW9A 1RM3A 1RYHA 2XLCA 1FF9A 3K92A 3N8HA 4IO0A 4RVNA 5AUQA 4EYQA 1YS4A 2GPYA 2EGHA 3HCPA 3VYVA 2WFMA 4Z3DA 3K0EA 3RVSA 3TEJA 1WABA 3R3UA 1Q1NA 4KNVA 1KHTA 1T36A 4BFZA 2NU8A 1M6YA 4X97A 3C1UA 5KYXB 5A0VA 1NOKA 3NRJA 4PSAA 4P3NA 3H5WA 2IK8A 4MITA 1UKVY 4JD5A 3EGIA 1VL5A 3I53A 1KQPA 3BQNB 3O4JA 3TI7A 3TKYA 4WACA 4A26A 4ZTUB 2RDMA 4IDOA 1T9GS 1OVGA 1JHAA 1XL0A 2V3WA 3NCTA 4BLSA 2DQ4A 3VYRB 1U1FA 4LY3A 2SCUA 2PZBA 4RV9A 2YXLA 1JA1A 3COYA 5D5QA 4CLHA 4DVJA 1YSCA 4FFPA 1E6UA 3DVAB 2XNCA 5GAJA 2VF8A 4J6FA 4IVRA 1J0XO 1ZKMA 2XYGA 1YH3A 2XDQB 2R9VA 3CJRA 1MKYA 4JJIA 1JEYB 5G1PA 1O94D 5F5LA 2ONCA 3HCOA 1Y98A 5CFNA 1K8ZB 2Q1UA 1XVUA 4OQFA 1YDMA 1W2GA 4P6VF 2IS1A 1OASA 2PXAA 1ADGA 4XWAA 2Q4BA 2B83A 4DVGA 1SZDA 2A30A 4BMYA 1CETA 4DZZA 2R25B 3IUYA 1CZLA 3F5QA 1GLVA 3CNBA 1G8SA 2GNOA 3PC2A 1KNXA 1P0CA 4RHFA 5H1YA 4LTDA 4AY2A 1V11B 3NJRA 4L7QA 1OKKD 4H77A 4G5RA 5I47A 1X8LA 4Q05A 4HB0A 4BBPA 4Y1FA 4GNRA 4UDOA 4XPIB 4BB9A 2YYYA 1DJNA 2W6ID 4EOGA 5JDCA 4WXEA 5E6UA 4W8OA 5AW0A 1L1FA 3NV7A 3OT4A 2DFNA 4G4IA 1Y1LA 3EK2A 1FUIA 3QBEA 4L7VA 1VE3A 4G5FA 1WZ2A 2ORWA 3PIRA 2GF9A 4BNFA 2D1FA 3HR7A 2GPSA 4QUHA 5F1PA 5L40A 4F46A 4ZCRA 4Q4AB 3IMFA 5BOSA 2EFEB 1UOOA 3WMRA 1G20A 3KJNA 2HXGA 1HG1A 2HMAA 3IEKA 1YR3A 4M6WA 2V59A 4NCHA 5IT0A 3VX4A 4EGCB 3HDJA 3DXZA 2OCKA 3C15C 3KUUA 3OIVA 1Y63A 3STWA 3DZGA 4AM8A 5JECA 4YAWA 1G66A 5JSHA 3U6BA 5CD1A 3JSXA 1QB8A 4X93A 4RBNA 1WZNA 3U9TA 2I9PA 1B42A 5FRDA 1RHQA 4C5AA 5A5VA 3PPXA 1R5JA 4OHFA 5JSZB 1D03A 5G53C 2XTAA 2NPIA 1YU9A 3P8ZA 2XYQA 4U02A 4ZQEA 3V4SA 5A3QA 3L6BA 1JXOA 3LRPA 1NTOA 1BMDA 4MRNA 2RGBA 3DR3A 3RAPR 4RXMA 3GGPA 4KH1A 4WLFA 5F1OA 3UTCA 3JARA 5AVOA 3IB6A 1W581 4IRMA 4MIYA 1FFSA 2V6FA 1KI2A 2FLWA 3ENKA 4KPUA 1GDDA 3LQFA 2GN8A 4KYTA 4MYTA 2GM3A 5T4BA 4B33A 5MN5A 3BPSA 5G2OA 1SXQA 3GELA 1QFSA 5G3YA 1TPYA 1UBOS 4BVJA 5LP6C 2ZJ2A 4D9FA 4WBSA 3O4HA 4IWXA 1E0SA 2QVYX 1T6BY 3QNUA 4ZCLA 3DOOA 2ERXA 3I72A 3S1SA 5BNWA 2RG7A 2C78A 4J94A 4KHZA 5HBRA 3BG5A 1NPTO 3EAFA 3GNTA 3KU4A 4FDAA 4LV6A 4GZMA 4LXIA 4PZZA 4W1PA 1GNTA 4LE0A 5BQOA 1LX7A 4RNCA 1DKOA 2DPHA 1MB9A 3GFVA 3L7CA 1JDSA 4Q3AA 1GEGA 3EF1A 2IVZA 2ZPAA 5F1KA 3EPHA 1GZHB 3DTVB 4B6PA 3KOZA 3CB2A 2O8FA 2FVYA 1YOVA 4KJZA 1FTSA 2R3SA 5H5JA 4OKSA 2R8EA 4GGMX 4HLUC 1EDDA 4K3UA 3B2NA 3V8QA 3U5ZB 2PANA 3C3YA 1JLRA 4AY4A 3RC8A 3G2HA 5LU9A 3MTBA 3ASYA 1XEXA 5KC8A 2AYZA 3EC7A 3E2PA 4AMUA 5JSFA 5D3QA 1K86A 1Y34E 5CVEA 1FTWA 3WRXA 1LJ8A 4LVUA 3HA3A 1G4AE 4RIEA 4Y30A 3O84A 1CW2B 3PNKA 2J3LA 2NZJA 4H6VA 4H4EA 4R2JA 4B2LA 2R00C 3ZTWA 1OXBB 3N0WA 3HKEA 4XQEA 5TR9A 2F55A 1PL8A 2J09A 3WWOA 1APBA 1PJSA 3AX6A 3OF3A 4EDFA 4P81A 1ETUA 3R74A 2VQEB 4AL4A 1K0UA 4ZEXA 3I6IA 3TXAA 4C0WA 4WLUA 4KN8A 3IVGA 1U28C 3K20A 3ZU6A 4Z7QB 3N3AC 3AIMA 1HNNA 1DMSA 2VXYA 3EDCA 3RUEA 1ISHA 1ZINA 4EB6B 1B26A 2PZKA 4J2HA 5FTKA 4ZKDA 1EUDA 3ZWVA 1JBQA 1KYWA 2J85A 3BBPA 3L0SA 3VH4A 1M34A 2E5WA 4HOYA 4ZCIA 3BCUA 1SXPA 3F5FA 3MB8A 2BHTA 2GPNA 3QM1A 1ZD5A 1L9XA 2AJCA 4LA4A 4ECAA 3K1ZA 2HHHB 1TUGA 1N75A 2I1LA 4ARVA 4B1FA 4XPZA 4KB5A 2WLTA 2I3DA 3Q88A 2BJVA 4WXHA 2HXYA 1VRCA 3EVNA 2Z2KA 2Q29A 4DB4A 2ZQ5A 3SG0A 4LJ5A 1H4VB 2B9VA 4NVRA 4C4PA 4FKBA 1W6UA 1N5IA 1CQIA 3D4NA 1E2UA 1GITA 2EZTA 3OLZA