The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
196
|
sequence length |
496
|
structure length |
496
|
Chain Sequence |
TYEKEFFDLLKRISHYSEAVALMHWDSRTGAPKNGSEDRAESIGQLSTDIFNIQTSDRMKELIDVLYERFDDLSEDTKKAVELAKKEYEENKKIPEAEYKEYVILCSKAETAWEEAKGKSDFSLFSPYLEQLIEFNKRFITYWGYQEHPYDALLDLFEPGVTVKVLDQLFAELKEAIIPLVKQVTASGNKPDTSFITKAFPKEKQKELSLYFLQELGYDFDGGRLDETVHPFATTLNRGDVRVTTRYDEKDFRTAIFGTIHECGHAIYEQNIDEALSGTNLSDGASMGIHESQSLFYENFIGRNKHFWTPYYKKIQEASPVQFKDISLDDFVRAINESKPSFIRVEADELTYPLHIIIRYEIEKAIFSNEVSVEDLPSLWNQKYQDYLGITPQTDAEGILQDVHWAGGDFGYFPSYALGYMYAAQLKQKMLEDLPEFDALLERGEFHPIKQWLTEKVHIHGKRKKPLDIIKDATGEELNVRYLIDYLSNKYSNLYL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
Bacillus subtilis M32 carboxypeptidase
|
publication title |
Insight into the substrate length restriction of M32 carboxypeptidases: Characterization of two distinct subfamilies.
pubmed doi rcsb |
source organism |
Bacillus subtilis
|
total genus |
196
|
structure length |
496
|
sequence length |
496
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.4.17.19: Carboxypeptidase Taq. |
pdb deposition date | 2009-06-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02074 | Peptidase_M32 | Carboxypeptidase Taq (M32) metallopeptidase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Neurolysin; domain 3 | Neurolysin; domain 3 |
#chains in the Genus database with same CATH superfamily 3AHO A; 1K9X A; 2H1N A; 1KA2 A; 2H1J A; 3SKS A; 3AHN A; 3HQ2 A; 5E3X A; 3AHM A; 3HOA A; 3DWC A; 1KA4 A; #chains in the Genus database with same CATH topology 1KA2 A; 5L44 A; 2O3E A; 1K9X A; 2H1J A; 3AHM A; 2H1N A; 2O36 A; 3AHN A; 1S4B P; 3SKS A; 5L43 A; 4KA7 A; 4KA8 A; 3HQ2 A; 1KA4 A; 3AHO A; 4PUT A; 1I1I P; 1Y79 1; 4FXY P; 5E3X A; 2QR4 A; 3HOA A; 3DWC A; 3CE2 A; #chains in the Genus database with same CATH homology 1KA2 A; 5L44 A; 1K9X A; 2H1J A; 3AHM A; 2H1N A; 3SKS A; 3AHN A; 5L43 A; 4KA7 A; 4KA8 A; 3HQ2 A; 1KA4 A; 3AHO A; 4PUT A; 1Y79 1; 5E3X A; 2QR4 A; 3HOA A; 3DWC A; 3CE2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...