3HQXA

Crystal structure of protein of unknown function (duf1255,pf06865) from acinetobacter sp. adp1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
b'SAQFDHVTVIKKSNVYFGGLCISHTVQFEDGTKKTLGVILPTEQPLTFETHVPERMEIISGECRVKIADSTESELFRAGQSFYVPGNSLFKIETDEVLDYVCHLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0345 protein ACIAD0356
publication title Crystal structure of protein of unknown function (DUF1255,PF06865) from Acinetobacter sp. ADP1
rcsb
source organism Acinetobacter sp. adp1
molecule tags Structural genomics, unknown function
total genus 18
structure length 105
sequence length 105
ec nomenclature ec 2.4.2.15: Guanosine phosphorylase.
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06865 Ppnp Pyrimidine/purine nucleoside phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hqxA00
2E9QA 2IXHA 4MV2A 3E5XA 3E97A 3SCGA 5KHJA 3U11A 2Q30A 4XFIA 5E1RA 1O3SA 1ZZ9A 4XFBA 3IDCB 2PQQA 4FAHA 3KGZA 4XETA 4QX5A 4WBBA 4HMZA 4IEVA 2QVSB 4YNIA 3FHIB 3NSTA 2BNMA 2PYTA 4YRDA 3N4MA 4I0AA 2BEOA 5LEKA 5E16A 3FZ3A 2H6BA 3CF6E 5KHHA 3U10A 2Q4SA 4R8HA 1UPIA 4E2QA 4MH0E 1X7NA 1UCXA 2I45A 2BNOA 3ROUA 1EYBA 2XGXA 4P9GA 5I0RA 5I0SA 3EO6A 2UYAA 4AQ2A 3NJZA 1ZZBA 3SCHA 2PAEA 3LA2A 4IEWA 3E6BA 4I01A 1CAVB 1Q3EA 4MUVA 4Q0PA 4HLTA 3NKTA 1PMIA 3CJXA 4CYDA 4HVQA 1G6NA 4LULA 1CAUB 4Q0SA 3H1YA 4HVOA 4IETA 4META 2PAMA 1CAXB 4LLOA 1XE8A 3ZDSA 1RL3A 2XKPA 3H7JA 4BH9A 5I8TA 1VP6A 5CADA 5BY5A 4QM8A 3QOPA 2QNKA 2XLFA 2HJIA 3KGLA 1FXZA 3OF1A 3MZHA 4QMAA 2CV6A 2D40A 1RGSA 1QY4A 4DINB 5KHIA 3DKWA 3I59A 3QACA 1EPZA 2GH2A 2GC2A 5KHGA 4I2OA 1UIKA 2PTMA 5LRSA 4XF9A 5EFUA 4QGMA 5JSPA 2VQAA 1YFWA 1ZX5A 3IWZA 4XF4A 4N9HA 3BPZA 5BPXA 1ZRDA 3CO2A 4JV4A 4XF1A 2OA2A 3FWEA 3WW2A 5I0TA 4YYOA 2P17A 4JTOA 2XKOA 4O9EA 3KSCA 3E5QA 3RPQA 4B29A 1SEFA 4NVPA 4PIXA 4EWDA 5HI0A 3UKTA 3DV8A 4XFAA 2XL7A 4JVAA 1VJ2A 4HZFA 2WC2A 5EZWA 4IEYA 2UY8A 1LB2A 3DL3A 2N7GA 1O3TA 5FLIA 2Q0AA 1SFNA 4EROA 4FAGA 1DGRA 3H7YA 4OLLA 2GC3A 3EHKA 5LRRA 4IEQA 1O3QA 3E6CC 4ORFA 3ELNA 4FT8A 2PHDA 1LRHA 4UBGA 3OGJA 4Q0UA 5KHKA 1FI2A 3HT1A 3PLQA 2F4PA 3LZZA 4XFFA 1X8MA 3UKNA 5BUVA 3ACLA 3EQEA 2DCTA 2Y0OA 4XF3A 1ZVFA 2PA7A 1CAWA 2OZJA 4AVAA 1J3PA 1FT9A 3RYRA 1EP0A 3H3ZA 3U0ZA 5I0UA 2H0VA 1RUOA 4J1XA 3WW4A 3R6SA 3BALA 3LWCA 3TNPB 4XF0A 3PVBB 4I3PA 1DZTA 4UBHA 1H1IA 5JAXA 4OFGA 1LKNA 4ZU4A 3HIFA 3S7IA 3GYDA 3LAGA 3NVCA 4LA2A 3H1WA 3SMHA 3ST7A 4XFCA 1ZZ6A 1I5ZA 4QM9A 1J1LA 3M70A 5BV6A 5FDBA 1DGWA 1YFYA 2KXLA 2MPFA 3B02A 2OZ6A 3G7DA 3RDIA 1O7FA 4HVRA 3JZVA 4QGLA 4I02A 4QXKA 4X6RB 2GU9A 5FPXA 5K8SA 4AVBA 3LA3A 4ZU7A 5FQ0A 2CAUA 4KL1A 5JSRA 2B5HA 5JCTA 2Z69A 3CEWA 4WVZA 2O1QA 1RUNA 3S0MA 3GBFA 3E6DA 4D7SA 2PAKA 1CAUA 2PFWA 4R52A 5I91A 4XEZA 3I7DA 1GQHA 3WW1A 1XRUA 2OPKA 1ZRFA 1CAXA 1X82A 2XHKA 2V09A 1UD1A 2BNNA 5FCCA 1ZNPA 4IEOA 3ES1A 2WFPA 2MNGA 1J3RA 2IXIA 1NXMA 4F8AA 5BXXA 3S7EA 3D0SA 5JR7B 1LR5A 2D93A 1YLLA 3C3VA 5KBFA 2ETEA 4I0BA 1O5UA 1UW8A 5J7MA 5J48A 1OMIA 2IXKA 4IEXA 4Q29A 1IPJA 3H1MA 3BB6A 5D1IA 2ZKLA 3O14A 5CU1A 4KU8A 1VR3A 2GC1A 1OFNA 1XE7A 4HSJA 4BHPA 3ES4A 4Z82A 5CVRA 3RNSA 3CL1A 4MX3A 1ZRRA 2FQPA 4GULA 2CGPA 2K9ZA 4L11A 1Y3TA 1UIJA 4I09A 4Q0VA 1ZZCA 4KWKA 5J3UA 2VECA 3IBMA 1YUDA 3ETQA 1NZCA 4L2NA 2IXJA 1RC6A 2UY9A 4BIFA 2K0GA 5FLJA 4QGNA 4EWEA 3FE5A 2CAVA 4LUKA 5JSOA 3H50A 4PIYA 1V70A 5I8YA 1CX4A 1Q43A 1QWRA 4N9IA 1Y9QA 3OD0A 4FBFA 1OD5A 3E5UA 1QXRA 3OCPA 3NW4A 5C8WA 4IEZA 4PJYA 3EJKA 4EV0A 3MPBA 2XLGA 3MDPA 2IC1A 4YSFA 4ZU5A 1GQGA 4PIZA 5I8SA 2QJVA 4XFHA 5T3NA 2VPVA 1O4TA 2XL9A 2B8MA 4LEJA 4IESA 3BU7A 4H7LA 3NL1A 3DN7A 1IPKA 2IXLA 2H6CA 3KMHA 4IEPA 4XFGA 4KWLA 3EBRA 3LOIA 3FFQA 4E2SA 2D5FA 1ZREA 2ATFA 1O5LA 3SXWA 4D7TA 2GZWA 4MGIE 4MZUA 4KU7A 1EY2A 1ZZ8A 2O8QA 4X6QB 1OI6A 1NYWA 2QCSB 4TLFA 1JUHA 2BGCA 5FPZA 4EWAA 3VHRA 4YARA 1HW5A 3RYKA 4BYYA 5FQ0B 1U12A 3SCFA 3M3IA 3H8UA 2GC0A 3TNQA 1YFXA 1SQ4A 1WLTA 2XLAA 2ET7A 4LUMA 1QXJA 1CAVA 2HKXA 2PHLA 3SHRA 3WW3A 1CGPA 2MHFA 3KCCA 4MGKE 3I59B 2OYZA 1J58A 1DZRA 1WA4A 3D82A 4HBNA 1I6XA 4MGYE 2EA7A 1PM7A 5C6CA 3FJSA 4HSLA 1NE6A 4J1WA 4ONUA 3RZZA 1WGPA 1H1MA 3PNAA 2QDRA 4RD7A 3FX3A 3UKVA 1RTVA 1J3QA 4HN1A 2EVXA 2C0ZA 3I54A 1J59A 4E2GA 3IIAA 2ZCWA 3H9AA 4KWJA 4AQ6A 4WZCA 4IERA 2EAAA 2B9UA 4LA3A 2Z2SB 3L2HA 1Q5OA 4Z07A 3H3UA 3BCWA 3OTFA 3CLPA 4O9GA 2UYBA 1NE4A 2ET1A 3LA7A 4IEUA 3USSA 4F7ZA 1X8EA 5F1RA 4A2UA 2BYVE 2GAUA 2Q1ZB 4JTNA 1TQ5A 1YWKA 1ZRCA 1L3JA 3HT2A 4AXOA 4AVCA 3MYXA 2FMYA 5AVPA 1ZZ7A 4MGZE 1YFUA 3IDBB 1YHFA 2D5HA 4Q0QA 3RYPA 2IXCA 3D0JA 1CAWB 4K8FA 5LEJA 5FLHA 4LTAA 3HQXA 5I93A 1O3RA 4HN0A 4UXAA
chains in the Genus database with same CATH superfamily
1RXGA 2E9QA 2B45X 4IGQA 3WXPA 3DPRB 3RI9A 4NIHA 5FV3A 2UWAA 2VZPA 3O1MA 1QEXA 2UU8A 1NKGA 3U11A 1XE0A 5FXWA 3B00A 5E1RA 4FXKB 2VW0A 2O8OA 1OSGA 1S0JA 3IDCB 4XFBA 1EV12 1NA1B 4FAHA 5KC5A 4TZDA 2ADEA 4FPOB 1RUG3 4HMZA 3IN9A 3RJRA 3RZLA 1O4ZA 1WBFA 2QVSB 3PVNA 4IEVA 1JZ3A 3L9JT 3NV1A 4R9BA 2JG8C 1UMHA 3AMMA 4FTSA 4CRQA 3PDQA 4AE2A 4QKBA 1ULCA 3HBKA 2WLPA 2XJQA 1SFPA 4XBQA 2H6BA 4FVVA 4P02B 3I3MA 3WDUA 1W6QB 2Y8KA 1TZOA 3TB0A 1F15A 1UPIA 4XAEA 2WFF1 1IKPA 2NPIA 2D98A 1LOBA 1UCXA 2Y64A 4LIVA 5FJKA 1W9SA 5KWRA 1Y9MA 4WZFA 2Y6FA 2BGOA 2XJUA 3I3DA 3OBTA 2BNOA 4NROA 4YG6A 3VBFA 4QKFA 3IDAA 4A45A 3ROUA 1EYBA 2XGXA 4D6SA 2AREA 2RS32 1WW4A 5F39A 1VBD3 4ATEA 4AVSA 2RS51 4AI3A 3J4UH 1DLCA 2J1EA 2PAEA 1KQRA 4YW3A 5H9QA 2HWF2 3SCHA 3C7EA 3E6BA 1SG3A 1O91A 3PU8A 1DYKA 3W20A 2ARCA 4NPLA 3TAYA 5GZFA 3OJBA 4ZZ8A 4QWNA 2A7AA 4XQWA 3ZYFA 4DEQA 1NLQA 3MI8A 1QIQA 2HEWF 4LK7A 2WA3A 2NMNA 2JG8A 1JXNA 3ZIWA 5DUUA 4HVQA 1D2SA 3T2QA 2WN3A 1WCKA 4DQAA 4IETA 4META 4KI5M 4ARYA 1KITA 2A3YA 2IFWA 1BZWA 4LHSA 5K0UB 4P9WA 2WWUA 1OT5A 1UPSA 4CA9A 5C3SA 3KVBA 1CAXB 1W90A 1XE8A 2Y6LA 4QHOA 4XILA 2XKPA 2QQUA 3B94A 1H8TA 3ACGA 3AJZA 3ZDSA 3IDEA 2JB8A 5FYHA 2B9VA 5FKCA 2HBUA 5CADA 4UI9L 3A0NA 3RS6A 2VBBA 1BKZA 3NAPC 1PVC1 4QM8A 4ZPIA 2XBO3 4Y22B 2BERA 1E57A 1MZ6A 3I2OA 4MGTA 3KGLA 4DUVA 1XSRA 3OEBA 5DAPA 5ANNA 3V56A 5JOWA 4OHVA 1PO12 3AKTA 3JCIA 3VD3A 2CV6A 1RGSA 2W08A 3LE0A 4FFIA 4DINB 5FY1A 3I97A 1EPZA 1N3PA 3PUQA 3ZYRA 3C7GA 4AHZA 4O65A 5KHGA 1X36A 4YLZA 4JKMA 2RG4A 1JOPA 4R4XA 5T55A 1IQAA 3FN9A 2VMHA 5E8AA 2QQWA 1AL0G 1IG3A 5JSPA 1AYM3 3HD8B 2Q1MA 3IWZA 2IZWA 3RRDA 4W65A 4K3UA 2JDYA 4UW5A 3MFAA 1HB3A 3P6BA 4C0HA 4BMEA 4JGYA 1UX7A 1HIXA 2VM9A 3C7FA 3O12A 3WW2A 1VBA1 1T6BX 3MIBA 4UFKA 2Y33A 3URFA 4WM8A 4JTOA 2XKOA 4PDWB 3NAPA 3RPQA 2DCKA 4B29A 5BNPB 3ECQA 4EWDA 5HI0A 4GKXA 1QJFA 1GICA 3RWKX 3DV8A 4FPYA 3WG2A 4XQDA 3R4UA 2XJRA 3J9SA 4IEYA 5EZWA 2UY8A 3RVHA 5FLIA 2I74A 5IAXA 2TUNA 4EROA 2ZMKA 2XJTA 3OUIA 4P9LA 5K4LA 5ABJB 2GC3A 3ZIXA 4QQOA 1ZBE1 4PQQA 3J7NA 1PNFA 1PVC3 1MS4A 2YBKA 1UYZA 4IEQA 2C9AA 2ARAA 3MLJA 4LE4A 3M4FA 1ENQA 1LRHA 3OGJA 2VZTA 4XCAA 2CL2A 1XQNA 2R6QA 3JB8A 5KHKA 1CX1A 1PZ9A 4Y1VA 3WF1A 1GYKA 5LW9A 3U07A 2WAAA 3UKNA 4AYUA 1VBC1 1RMU3 1BK0A 4NWVA 1YO8A 1IKQA 3EQEA 4ASKA 4LBQA 4BXFA 5D8AA 2DCTA 2XXZA 4QPGB 1COV1 4OQ9A 4BA6A 4BK5A 1Y9GA 1X50A 1UNBA 1AX2A 4CCLA 1JUIA 2WUHA 2D7FA 1BK1A 3RYRA 1A3KA 1ZRIA 1ASJ2 1LHNA 3MO4A 5CFDC 3KZ4C 5C5UA 1W0PA 2R0FA 1QU0A 5I0DA 2ZXQA 3U0ZA 4E4HA 4LBOA 4AI1A 4HXCA 1RUOA 5T52A 2E51A 1NA1A 5FFOC 3A23A 4Y1YA 3WW4A 3BALA 3LWCA 3RG0A 4B8EA 5C7GA 2LRPA 3PVBB 1TME2 2YXSA 1QMJA 2TNFA 4N43C 1QJX1 3NRUA 4UBHA 3HQRA 2RJ2A 4YFZA 3LIGA 2PLV1 4HETA 2QQNA 4CXWA 3IIIA 5LBBA 2VZUA 2WT2A 3AMNA 3AC0A 3DYOA 4FPHA 3SMHA 3UGHA 1RHI1 4YZ4A 3B01A 5FWEA 2WNVC 1YFYA 1BXHA 4ZXEA 4IE5A 2J42A 1ZBE3 4K1ZA 2XPJA 2OZ6A 2YUEA 3LPGA 4AGRA 4W50A 5CFCB 3JZVA 2B42B 4NOTA 1UYPA 2W1QA 3ZKUA 4NHMA 3ENRA 3CU7A 2R071 4QXKA 4A7YA 3O0VA 2GU9A 2RDRA 1HB4A 2R30A 4AVBA 4BXSV 3LA3A 3MBWA 4KL1A 1VBC3 3AL5A 2XJSA 5JCTA 5A7PA 3U37A 4GH4C 4BOWA 3A0KA 2DFBA 3ZN4A 2VE1A 4LO5B 4N43A 4WVWA 2BVVA 3SITA 1KXGA 4GB32 1ULPA 1COV3 2W5FA 4Z1VA 1K5MB 3GBFA 3AYDA 5LBEA 4BQ4A 1S2EA 4R52A 2F17A 1W8ZA 4XEZA 3ZYHA 3H8OA 1XNKA 3CHXA 2NZ9A 4NHKA 3MEPA 5M0TA 1CAXA 1OOPC 1X82A 2V09A 1UD1A 2XHKA 5FCCA 1UYXA 4DEVA 5C4WB 2X8KA 2HWE1 5F32A 2C6SA 1OLRA 2XJVA 4IXLA 3EMRA 5K9YA 1NXMA 4F8AA 2HEYF 5A1LA 3T1LA 1MQTA 1F5FA 2DYCA 4Y22A 3ZFGB 1LR5A 3F95A 3GJAA 2VQUA 4CDQA 1QJX3 1WMEA 1FPN1 1YLLA 5JI9A 2W39A 2YBSA 1CPMA 3N9LA 2BWAA 1SCRA 2FCUA 4I3GA 4CTEA 5KBFA 2ETEA 1ODNA 2GSYA 1BYHA 3OPTA 1O5UA 3ZYBA 4DXTA 3WV6A 1KS5A 4IEXA 1U0AA 3ATGA 1VBB1 2G9ZA 3H1MA 3AM2A 2C24A 2PQSA 4COUA 4AR2A 1GNYA 4JRLA 1RHI3 4C90A 4GH4A 1E5IA 1A34A 2ZKLA 4TLGA 1IS6A 2RR12 3FBMA 2Y6KA 4C0BA 5F6LB 2GC1A 4HSJA 5JZGB 3BN6A 3ES4A 2JEMA 1FV2A 5AC93 1UOGA 2Y34A 3CL1A 5EV7A 2D6LX 2GP3A 2ENRA 2VTXJ 5GZCA 4XZPA 4J25A 1G86A 4P5HA 4XAAA 1W9FA 2WSVA 4XHXA 4PDWA 4LR4A 1K5JA 4QD2A 4B4RA 5BNPA 1C8NA 3ZFEA 2VECA 3IBMA 1AX1A 3LGRA 3ORJA 1L7LA 1LOFA 4L2NA 1STMA 4UFMA 1IOAA 3P1IA 5HBAA 2ZX0A 1TMF2 2GNMA 4QXHA 3ZYGA 5A80A 4YVSA 1A8DA 1B35B 4YW5A 5ANQA 2CAVA 2FDIA 1MACA 5A3TA 5FBJA 3UK9A 2P4EA 3ZSLA 3P3PA 4XTMA 2ZGQA 3HN1A 3H42B 1M06G 2PHTA 3O1PA 1OKQA 2DBIA 5ABJA 3I8TA 4N9IA 1LOAA 3GZTB 3OD0A 5FZBA 4FBFA 3WQ1A 4DY3A 1SACA 1OD5A 3BOPA 1VE0A 2VVEA 3JB4C 1CR7A 1OA2A 1FPN3 4FSJA 2RDNA 2PN5A 4XXAA 3O1RA 2CDOA 5FUIA 5FUPA 4CCMA 1H4HA 5A33B 5FOJB 1UMIA 1I9RA 1GQPA 4FTEA 3FFZA 3V65A 2XLGA 1PIV1 4LKEA 3MDPA 2P3KA 5FZEA 4YSFA 4HK8A 4LBMA 4PIZA 4ZU5A 1RUC3 4XJ9A 1NUKA 4YW4A 5HXMA 2JDMA 5FXZA 1O4TA 5LWBA 2B8MA 2VOXA 4QPGA 1AL22 1J84A 2GNBA 1YQ6A 2VOWA 1A78A 1V6MA 3BU7A 1IPKA 3I2DA 4FI9A 4DRVA 3VHNA 1Q8PA 1W2OA 2TEPA 2VXJA 4KWLA 4I30A 3EBRA 2EIDA 3D6EA 2VAUA 2EXHA 4QB2A 1C5HA 3FFQA 1DYOA 1OA3A 1ZREA 2ATFA 1O5LA 1UAIA 2VCCA 3NKGA 3QBQA 5CNAA 4MGIE 2WFF2 1VB4A 4QHZA 5J96B 2JD4A 1GNZA 3O7OA 5A1FA 4KU7A 4DOUA 4FPCA 1HRV1 4Y4RA 4K7JA 1OI6A 4YVWB 1K3IA 2BOJA 2RE9A 2QCSB 1F5JA 1MEC3 2BGCA 3I2KA 5FZ7A 2YU1A 5C5TA 2RS52 2YU2A 5IJRA 3UGGA 2P2KA 3LOBA 1W8NA 2XHNA 2Y0IA 4YARA 4X8NA 4CDXC 2KD7A 2WIIB 3CJIB 2DVDA 3SCFA 3PTRB 2YY1A 4YG3A 2RMU3 1J1TA 1YFXA 2PHFA 3IM0A 3IZOA 1KEXA 4UW4A 3DGTA 2P3JA 2ET7A 2XUMA 3VN4A 3SHRA 2HKXA 5IVVA 1CGPA 4M0NA 3WW3A 1T6GC 1FOD2 3ACHA 3Q9OA 3SEPA 5GJ6A 3WF0A 4OI0A 3PMEA 4Q1PA 4BMBA 3KCCA 3UV9A 2Q5TA 2P34A 4NAMA 3PURA 3I59B 3DUIA 1U5ZA 4SLIA 2DUPA 2FDJA 3M1HA 1WA4A 4XUPA 2IFRA 4HBNA 5A3WA 1I6XA 3WEZA 4MGYE 1CD3G 1G9CA 3UJQA 1PGL1 4TXWA 4MO3M 1CN1A 5C6CA 5HCFA 1VRH3 1PIV3 1UQXA 5BNQA 4HSLA 4OYUA 4JHTA 4Q4X1 3RZZA 4JQRA 2XMLA 1WGPA 1H2MA 4KMQA 4RD7A 5C33A 2BBVA 4HFSA 5IATA 4QX8A 4OUSA 1WW7A 1K5MA 1GOFA 1XBFA 3ZXDA 2GP5A 4HN1A 3KHCA 4XIKA 1QKQA 2JXAA 2E7TA 1IPSA 4BQ5A 1QXPA 4AQ6A 4MHUA 1YRZA 1ENRA 1KD7A 2YHJA 4HT1T 2EAAA 2XH6A 2BFUS 2Z2SB 5FMOS 4HKLA 4CUAA 1MS1A 1HRV3 2WO7A 1Q5OA 4R9CA 3VV1A 1JZ2A 2RJLA 4Q4Y1 3ZFGA 1WMDA 2ZGPA 3CLPA 3VHOA 4EN6B 1NLSA 2V4AA 1Q56A 1BCXA 2ET1A 5CB7A 1VBA2 1Q8OA 4K8RB 1WMFA 1H9PA 4XXPA 1U5IA 3ZSEA 5F1RA 3AYEA 4JTNA 2BPA2 4YPJA 1HRI3 4MVTA 3HT2A 3N35A 3OBRA 1HLCA 1JBCA 4FFFA 3UJOA 3FLTA 3MYXA 3FUQA 5GLTA 5FBZA 1ND3B 4XMAA 5E88A 3VLBB 5AVPA 5BNOC 5JZGA 5EHDA 1YIPA 1DYPA 2OUJA 5A3NA 1H0BA 2NYYA 3PVOA 1J59A 1YHFA 2D5HA 4A7KA 3D0JA 3ST7A 3T2OA 1O3RA 1CAWB 1ULDA 2ZX3A 4CP0A 4LTAA 4JGZC 1CZSA 4Q4X3 2X05A 4HN0A 4J1XA 4UXAA 1HKDA 1UXXX 5DAWA 1S1AA 1UU4A 1VBE3 4GIQA 1FATA 3GXUA 4LBLA 3SCGA 3Q8FA 5KHJA 3JBG2 2Q30A 4XFIA 4BLIA 1AR61 2ZAAA 3OGGA 1ZZ9A 2WNUA 2VUDA 1VBC2 3KGZA 2UWCA 1RUH1 5EPAA 1JYWA 1LOGA 3WNKA 4YNIA 2EALA 3ZFFC 1COV2 3AFGA 4EN7B 3NSTA 2OQ7A 4AAPA 2BTVC 2VL4A 2WNEA 3CBNA 3RMYA 3N4MA 1L7QA 2VZSA 4K40A 4W8JA 4L92A 5BNOA 5F2WA 3P3NA 4AFDA 4LMFA 1NCQB 3FZ3A 5E16A 1X9TA 4YW7A 1JW6A 5KHHA 2AR6A 1C1LA 2ZEWA 3LD8A 5A33A 4E2QA 1CZTA 4BQ1A 2CGOA 1NZIA 1WD4A 4XDOA 5FZ6A 1LGCA 5GLUA 4N53C 4BK4A 1US3A 1D2QA 2W9XA 3OD4A 3OPWA 5LA0A 1Z0HA 2J1RA 1GOGA 2A6ZA 4RQPC 4XJUA 3WF3A 4P9GA 1QJX2 5I0RA 3EO6A 4BISA 1GOHA 1V6JA 3GBGA 4AQ2A 2JDKA 3NJZA 1ZZBA 2PLV2 4YGDA 4FO9A 1RUD1 2ZBJA 1A6CA 4I01A 4Y5Z0 2VOKA 5IW0A 4BLJA 5JXJA 3S30A 2ERFA 1CAVB 4CDUB 1QNWA 4MUVA 1CIWA 4GD4A 2W47A 2QBXA 2X5IB 4HLTA 3NKTA 4CYDA 1QJY2 1CAUB 4Q0SA 3H1YA 4SBVA 2Q8CA 1OHFA 4XBLA 4Y1XA 1GZCA 4LORA 2VNGA 4YVWA 2R072 1C1FA 4LLOA 4CDWA 4IE4A 1RL3A 2JG9A 1GZWA 1R093 4LK6A 1AR63 1W8TA 3VBSB 3LEMA 4OCTA 5BY5A 5LY2A 3CJIA 3WOGA 4ZXKA 4FFHA 3QOPA 1RUH3 3EB7A 2G9GA 2E7AA 2XLFA 1DQ5A 3V0AA 4IV1B 5FMBA 4MYEA 1GSLA 3GF6A 5IVBA 2O14A 1V6KA 4XDQA 3OF1A 1W6OA 4AGGA 1ULEA 1QY4A 1VB2A 2WR9A 3AZXA 5KHIA 1W6MB 4GJZA 3DKWA 3I59A 3RFRA 4PLOA 5F8PA 3ZX7A 2GH2A 4UWDA 4QPYA 2GC2A 2LW8A 1RUG1 1M4WA 3M8LA 3HR9A 2VR4A 2HWE2 2Z42A 4LBQD 3I2IA 5LRSA 4XF9A 5EFUA 4DB5A 2ZOEB 1OXCA 4QGMA 2VQAA 4V1PA 5ERLA 4O7XA 5JMOA 5FZKA 1N1YA 1W8OA 3VKLA 4XF4A 4N9HA 3QLQA 2Z4FA 4LO7A 1QQP1 2CU5A 4AEKA 3ZVXA 4JKKA 3M3OA 4CZSA 2OA2A 3FWEA 4A44A 4JRAA 1RUD3 3LSEA 4FQZA 1EUTA 2P17A 4M01A 1VBB2 1S0BA 2HWB1 3KSCA 2HWD3 2RS11 1AYN2 2CWMA 4NVPA 1REFA 1JZ4A 1G9FA 3HBZA 3LFIA 2W3JA 2WYSA 5F5AA 5A32A 3UKTA 4XFAA 5FYBA 2XL7A 2CSGA 1VBD1 5KC6A 4YW1A 5A7QA 4NIAA 2WSUA 2E32A 2AEYA 3OG2A 3UYJA 2BW8A 5AFEA 1O3TA 4QQ2A 1OURA 3O0XA 4AWDA 2Q0AA 4QT6A 1PX3A 1OQ1A 2XG3A 1NQJA 3NV2A 4JZRA 4QAWA 3EHKA 4HL0A 3TN93 5LRRA 5J09A 4TYSA 4JAAA 3MLLA 3VBFC 1CJDA 3ZPYA 4URTA 1FNYA 1KFUL 2JDPA 1VRBA 4AQTA 4NN0A 4A4AA 5L9VA 1B09A 1RB8G 4KG8A 5J36A 2A3WA 4LPLA 1ND3A 5JIUA 3AKSA 3LZZA 4XFFA 1F9KA 3WHUA 4UFIA 1GANA 2V5YA 3HWJA 2XBO1 4CEWC 3ACLA 4Y24A 2OW4A 3AKQA 5FXXA 3MW2A 2ZPXA 1UZZA 2Y0OA 3SISA 2ZGOA 5C8CB 1CAWA 5FPLA 3WY6A 2DTWA 3WNNA 2ZKNA 2DWRA 5L9BA 4P9JA 1OPMA 1EP0A 1QQP3 3BIWE 1Y43B 4CXYA 1H8TC 1GP6A 2VUJA 4OULA 5I0UA 2H0VA 3BUCA 1PIV2 1HJFA 2LALA 3BIEA 2CHHA 2HWB3 4K1YA 5DXDA 3VKOA 1L7RA 4E9KA 2P5BA 2RS13 3R6SA 1XXNA 3WNLA 1AYM1 1C8M2 1DZTA 4MOAA 2LTNA 5A3PA 4PT6A 1H1IA 3VZOA 5JAXA 3DYMA 2Y6GA 4IE7A 3S7IA 4YG0A 3GYDA 3NVCA 1R1ZA 4FPGA 4L97A 2BQPA 2MEV3 4QB1A 4YZ5A 4XFCA 2WBKA 4CEWA 5BV6A 5FDBA 3VZJA 1OLQA 1DGWX 1SHWB 1PK6C 3H3LA 4QU2A 1JYTA 1DQ0A 2MPFA 2RM21 4C8DA 3KQ4B 2RHPA 1GBGA 2QFEA 4HVRA 4XC9A 3O1SA 1HQNA 4JHZA 1AXZA 4NHXA 4XJWA 1MS8A 2DDUA 4JGYC 1LCLA 2VVDA 3ALQA 1DLLA 4HKWA 2YFZA 5EJZB 1UL9A 5IVYA 2XONA 3MIHA 4WM8C 1C4RA 3ZSMA 4ZU7A 3U4SA 4E8DA 1AR83 5IFTA 4E4SA 2WWJA 1QJZA 1ZBA3 1FAYA 3FC0A 3RZKA 3J26N 4CDUA 4B1MA 1YJLA 3CEWA 4WVZA 5C9AC 4DXSA 2X5IA 2YDEA 1GMMA 1NT0A 1BEV1 1R1A3 1MZ5A 1DQ1A 5D2AA 3WDXA 1CAUA 5EWSA 5DN2A 3I7DA 4CEYA 4QKNA 2AYHA 3T30A 1RMU1 1W8WA 3I3EA 2BNNA 2EXKA 1UXZA 1QGLA 1HXS2 1UU5A 1ZNPA 3ES1A 3J8F3 4IEOA 1K45A 4Y3OA 1PK6A 4CCDA 1SMVA 1AHSA 2P6CA 1J3RA 3ASIA 3T0DA 3R4DB 3KT1A 1D0HA 2ARXA 2CWSA 4Q4X2 5EQUA 5JOZA 5JR7B 1OQDA 2D93A 1G9DA 3JD71 4QQLA 3VBRC 4ATFA 4IV1A 3IB3A 4UYBA 5A7NA 3ZPOA 1TVGA 5J7MA 1W03A 4HONA 4K9SA 3W58A 2H0BA 5CIRA 4V2WA 1W39A 3I2HA 4R4ZA 2JDZA 5D8AC 3ZN6B 4N90A 4UW6A 1RUE2 5C9AA 5JDBA 1A8MA 1SPPA 1UZVA 2RM23 5FK7A 4AEMA 3K77A 3T4HB 1MVQA 3ILFA 4BQ3A 1VR3A 1VAVA 1XE7A 3IMNA 3J7MA 4Q4Y2 2OS2A 2A6WA 4BHPA 3O0WA 4FOVA 5A7WA 2W68A 4FFGA 4Q4V1 3BVCA 4QPIA 1AJOA 1XB9A 2R1DA 3GHNA 2K9ZA 2VNVA 1NA1C 4D3WA 1Y3TA 3KV4A 1UIJA 4O61A 2FDKA 3S5QA 4Q0VA 3PUSA 4NR1A 4UF0A 4NRPA 4QX2A 3VBOB 4OMCA 4AFCA 3UNPA 1D4M1 3VBRA 1MVEA 1YUDA 2W94A 1BEV3 1NZCA 2D6OX 1WCSA 2WA4A 3ETQA 3N9NA 1N47A 2Q8OA 1US2A 4S2DA 5T5LA 5FZHA 1UY3A 4HPKB 2K0GA 3LIHA 4BPZA 3ILNA 5IT6A 1UY1A 4GQ7A 1LOEA 2VJXA 4GWNA 3T0AA 4PQ9A 1JH5A 1HQWA 1HN0A 1XC6A 1OUSA 3H50A 4LE3A 1KDMA 4XURA 5JXIA 3PJQA 1QWRA 1YIFA 3R0RA 2YGMA 4C1WA 2R7EB 3THDA 3ZN5A 3C7OA 4RFRB 1OD3A 3MIEA 2B4KA 3QD6A 4YW6A 2ZEZA 3JD73 1QXRA 5CA6A 5T5JA 3DPRA 2DUOA 1PO21 2A70A 1BBT1 4IEZA 4PJYA 1AR62 2E26A 2QQJA 3N7MA 1W2NA 1O6UA 5L9RA 3WR0A 2VQTA 2IC1A 3FLPA 4WVMB 2VU9A 2X10A 2NM1A 4GJYA 5JIAA 2QJVA 2QKDA 2VPVA 3N7JA 5T3NA 3THCA 4EN9B 3BTAA 3KS7A 1MR5A 4G3YC 2QE3A 2WS92 3GCXA 2I2SA 4GZ9A 2XOMA 4S2GA 2H6CA 3KMHA 3G6JB 4XFGA 4ZZ5A 5LK7B 3SH5A 5K0UC 4XBNA 3CZUA 3LOIA 4W6XA 3B9CA 1EAH1 4DUWA 4HOOA 4Q4V3 3ON7A 4D7TA 1GP4A 3MUZ1 1W6QA 2J1TA 3WCSA 5DPNA 5EIYB 4MZUA 2V4VA 4FPLA 2VCAA 1ZZ8A 4XMIA 2Z5WA 5GLWA 3A7QA 1V9U2 1MQTC 3R05A 4KQ7A 1RYYA 1SLAA 4CDQC 5IWFA 4DNYA 1D4M3 1IGOA 1S55A 3I3BA 5A7OA 2HEVF 3HOBA 3TEXA 2WN2A 1W6PB 5T54A 2WQ8A 5AC91 4QDSA 1LULA 2LUWA 3AK0A 2D6NA 5FYYA 1QJU3 1OH4A 1RUD2 3VL9A 2AACA 4Y20B 5FQ0B 3ZR6A 3QH7A 4Y1ZA 3TNQA 4YZ2A 4YGCA 2OPWA 5FJHA 1SQ4A 4S2HA 1FMD1 4ISRA 4QX3A 3IPVB 3T0BA 3BTXA 4PBOA 3SH4A 2MHFA 2ORZA 1H6XA 3UETA 3MV11 3H8XA 1AR91 2G1MA 3LQCA 4YGEA 1O59A 3RWNA 1X33A 4AEDB 2VTXA 5K0UA 5FZOB 1QOSA 3SNMA 1LHWA 1PO23 4P00B 5CG8A 2WRAA 1BBT3 1RJ8A 1U5YA 3MLKA 1PM7A 5APAA 3N9MA 3RZGA 2QQPA 4QPWA 1C57A 5T5OA 3WVJA 1NE6A 4BQXA 3HN3A 4PDWC 4JX0A 4ONUA 4AEJA 5BNPC 3ZXFA 2FDFA 3ZFEC 4AHXA 2AH2A 2FHRA 3GZEA 1GFF2 1XU1A 2QDRA 1LOFC 2ORXA 4K6BA 4P9IA 2FBEA 3WSOA 4LBKA 4X8PA 1LJ7A 3WF4A 1J3QA 1X9PA 2W95A 3MICA 4CDXB 2W1SA 1DF0A 4YVSC 4ASLA 5L7OB 2ES3A 1LU2A 2E53A 3A22A 3NNGA 4FPKA 2HYXA 1EAH3 1W8UA 1S0CA 3H9AA 5IHRA 1RUG2 1GR3A 1C3HA 2ZJCA 1NCRB 1RUC1 1ULFA 5FREA 5ABJC 1CONA 4MXWB 2GDFA 3SKJE 4CE8A 3NNLA 1RVF1 4Y5TA 3H3UA 2BZDA 3O1UA 2WQ4A 5F5IA 2ZMNA 2UWBA 2YROA 4O9GA 1RUJ1 2A5ZA 3PUIA 3ZYPA 3PU3A 4IEUA 5JVVA 2IWGB 3BYWA 4FCAA 4M4PA 4A42A 4UAPA 4XZUG 4PF5A 1POV0 1RUI1 3T08A 5EJ3A 4C1XA 2WZEA 3AP6A 1FMD3 4AK3A 2XWBB 3Q8CA 4YZ3A 3AXDA 1YWKA 3DEMA 3J7LA 1YQCA 1BMV2 3C7HA 4CPBA 1L3JA 2PHUA 1PX4A 4GWJA 5IVCA 3D5OA 2Y6HA 4QPGC 4WM7B 1MEC1 1VBD2 4NIGA 1PGW1 2FMYA 5E6HA 1AR93 3KHBA 1OF4A 5FZ0A 3VBUB 3ZXLA 5F5QA 2VW1A 3VDBA 1REDA 2KR2A 5TSWA 3SQOA 3HPNA 1GZ9A 1RJ7A 4D8MA 1XU2A 5H9RA 5BNNB 2RMU1 1CPNA 1D0GA 2QQVA 4FXGB 1N3OA 3TBDA 3WLUA 1W6NB 3AFKA 1S0FA 5CBLA 1QNYA 5LEJA 2Q1FA 5FZCA 3PIJA 3HQXA 5I93A 1I3HA 4LUMA 4QKDA 2IXHA 5CKNA 3E5XA 4QXBA 3E97A 1GNHA 3KQRA 5F37A 3VBOA 5FP3A 3VZMA 4AI8A 4Q1RA 4QU1A 4TTGA 4BIOA 4DUXA 3M3CA 1O3SA 1WW5A 4XOGA 4AFMA 4HPKA 4BJ0A 1VRH1 3J7HA 2PQQA 5IUQA 2I07B 3VKFC 1G8WA 4PHZA 4N7IA 1JMUB 2OXBA 2XBO2 4QX5A 4WBBA 4XETA 2QDNA 4GA9A 4JKLA 3KT7A 3WNXA 4CP9B 2W91A 1TE1B 2HYKA 3VD9A 3FHIB 4ITCA 4GWIA 2PMWB 4CCEA 5ACA3 2CTVA 3Q8BA 2LROA 2R061 4LIUA 2PYTA 4MADA 4FOQA 4MSVA 4YRDA 1MS0A 1RVF3 4QX0A 2BDRA 4I0AA 1NG0A 1YC61 2BEOA 1GUIA 5LEKA 3RQ0A 5FR3A 4ZS3A 3CF6E 3WDVA 4UFLA 1RUJ3 3KB5A 3OUHA 3H0OA 4LNVA 2VZVA 4MH0E 1APNA 4ZS2A 2FZ2A 1RUI3 3HQUA 1AX0A 2VW2A 3IMMA 2ZGRA 4E4DX 1AYM2 2D3SA 2GNTA 2WL1A 1JYIA 1DG6A 1UY4A 1WD3A 2DVFA 2DF7A 2UYAA 1K5MC 3VBHB 4CUGA 4XHBA 2VMFA 5JR2A 1UY0A 1DDLA 4IEWA 2F6BA 4COWA 4KWUA 3O5SA 2ID4A 5FMCA 3WG3A 3DXUA 2AUYA 3JXSA 5FY8A 2DFCA 3CQOA 1Q3EA 2XVKA 3M2MA 4IV3B 4DXZA 4XJAA 2XR4A 2HWC1 3M3QA 1HRI1 3ZFFB 2RM22 2W87A 1YCIA 4Q5OA 1GZTA 1UN1A 1OFSA 3POFA 4HVOA 4HANA 5JXHA 3PJYA 5FKBA 2BV4A 3MPPG 3ZFGC 5CFCA 5FZIA 2GH8A 1VMHA 1WLWA 2PAMA 2RDQA 3ZXAC 4JQTA 4XTPA 1N1TA 3H7JA 2VC9A 5I8TA 1EUUA 1LOCA 4W6YA 1SBDA 1VP6A 1W2AX 1HB1A 5CISA 4UW3A 1PVC2 2ZS6B 2QNKA 3OPZA 1FNZA 4OI4A 2W1UA 2HJIA 4RQPB 2WZR1 4W4ZA 3IPVA 1MS9A 2VGDA 1F4HA 1XNCA 1H8VA 4AHWA 1BEV2 1VBE1 3TRSB 2R063 3NJYA 4QMAA 5FYTA 1W05A 2D40A 5FAXA 4RR3B 4BDVB 1RITA 3C8XA 4RGKA 3Q8AA 3AP4A 3UT0A 4XW3A 3ZMOA 5JZGC 4AEDA 2VNRA 4DY5A 1RMU2 3AMQA 3APBA 5FZOA 3T4VA 2PHWA 1H4GA 1VLNA 3C2UA 4B7KA 1LODA 2QZ2A 1BQPA 4R9AA 1LEMA 5DDJ1 3WDYA 4I2OA 5C4WA 1PZ8A 2P37A 2VMGA 1K12A 3R4SA 5DZGA 5DG2A 3VDDB 2VCBA 1OVSA 3SKVA 1W0OA 2O0OA 3N9PA 5FYIA 3UGFA 4AG4A 1N1SA 1DCSA 3BPZA 2RS33 2RVAA 2WT1A 2Y26A 5FRAA 2DURA 2YMZA 5G04L 5BPXA 4CSWA 5IK7A 3CO2A 3MV01 4LKSA 5A70A 2VZRA 4L9BA 5FY5A 1S4CA 2HWF3 2WNUC 4QDQA 4CCNA 5I0TA 4YYOA 3DYPA 1B35C 1CJPA 1F35A 5L7OA 2AEZA 2YV8A 3E5QA 4Y5SA 4D6QA 1SEFA 3K4DA 1QDCA 3OSDA 2DV9A 4PIXA 3TOJA 3FL7A 2HWC3 2W46A 1NCRA 4CUCA 3K48A 1LESA 4ZY9A 3V0BB 3PUAA 2DVAA 2NLRA 3USUB 2J22A 4JVAA 1XJAA 3ACFA 1TG7A 4HZFA 2VCMA 5E89A 4MG2A 1VAMA 1LB2A 3DL3A 1ND2B 2N7GA 5FP4A 5FY4A 5FZ9A 4RS5B 5FYCA 5FO9B 3M7AA 2IVJA 2JENA 2R1BA 3MIGA 2E7QA 4UFHA 1DGRA 3H7YA 4OLLA 1ZBE2 2ZGTA 3KLSA 5T50A 3ME2A 1CVNA 4JDNA 1XYOA 4LQRA 4ORFA 1V00A 2WZR3 3ELNA 2VMDA 2A71A 4UBGA 4KBBA 3WP6A 2SLIA 4WM7A 1PO13 4IW3A 4Q0UA 1JHJA 4CU8A 1R091 1XOYA 2VD7A 1KFXL 3VBUA 1FI2A 1LEDA 3PLQA 3K75B 2F4PA 3GM8A 1B35A 5JWPA 4GXLA 5BNNA 1RINA 4CU6A 5FZAA 1W6NA 2A3XA 1UKGA 5DDJ3 3WG1A 4DIQA 4RYDA 4XF3A 2ZGKA 2PA7A 4NPRA 3RZMA 2OZJA 2A6YA 2J1VA 3AYAA 4JDOA 2IVIB 2WDBA 3A21A 1DIWA 3LDKA 1J3PA 4DO0A 1XNAA 1RXFA 4YVWC 5LK5A 3WINE 1HB2A 4MHRA 1XPWA 3EYPA 4CDWC 2JD9A 2JG9C 2R16A 2YGLA 2JKXA 2VXRA 3A4UA 5DAVA 5FPAA 1S2BA 3CJIC 4Y4YA 4TWTA 3VBFB 4XF0A 3N3HA 2B39A 4I3PA 1H30A 5F3IA 4XE9A 1N1VA 2VZOA 2B7YA 1URXA 2EAKA 3KCXA 4LJHA 4OFGA 1ZA7A 5FK8A 2JE9A 4ZU4A 2D6PA 3HIFA 4BQ2A 3AVRA 5J98B 3SLIA 1UY2A 4LA2A 1PHMA 3H1WA 4AOCA 3AZZA 5DQ0A 2HWD1 3CDZB 1ZZ6A 1I5ZA 1RHI2 1J1LA 4G4FA 1TEIA 4GMP3 4AZZA 5HCHA 3O1VA 3HNYM 3LEGA 3MF9A 3RSJA 2JG8B 2KXLA 4FPJA 4TN7A 3MIFA 5LASA 3G7DA 4XUNA 5L73A 1O7FA 3VDAA 1G9BA 1WZXA 1F4AA 4CU7A 5KXBA 1PMJX 3KCYA 3ZO0B 5GZGA 2C4XA 1LNSA 5FZ1A 4I02A 5AC92 5C3OA 5F3GA 1UZYA 3VBHA 2KM2A 5FPXA 1UMZA 5AFBA 4KG0A 4B4QA 1DFQA 1JN2P 4Y33A 3B9IA 3TN91 3WG4A 4Z8BA 4D7YA 4JCKA 1SLLA 3OUJA 4IV3A 4OUEA 3FBYA 3LDRA 2Z69A 4RFT0 4Q2FA 1DBNA 4XDPA 1RUNA 3S0MA 1WLDA 3E6DA 2PAKA 4P9XA 5F2SA 1ZM1A 1NY71 2YC0A 3NNJA 1GQHA 2P6HA 4AF9A 2OPKA 1WLCA 1HDKA 5EYXA 4YFWA 1VPHA 1WWYA 3D4KA 3NNFA 2WZPP 1ZRFA 3VZKA 2DVGA 2QUOA 2ARBA 4K21A 4M0HA 5FP7A 1GWKA 3KD4A 3S5AA 2MNGA 1YQ2A 2IXIA 1IG0A 2YYOA 2XVLA 1OVPA 2D3PA 4K20A 2DTYA 2E31A 4D6RA 1FPN2 3Q8EA 2WKKA 3FMGA 3KV6A 4AI9A 1DQ2A 3ETPA 2GN3A 2YG0A 2V5DA 3K4ZA 4OQ8A 1ND3C 4I0BA 3OY8B 4RR3A 2QQIA 3AJYA 1QF3A 1OMIA 1CQ9A 5J48A 1Y7BA 3BOWA 4Q29A 1BVP1 1QOOA 3NAPB 1NOVA 4H55A 4BE3A 3DXTA 5GZEA 1JZ7A 1RUC2 4A7ZA 2D97A 4AFAA 2ILMA 1VMJA 2RR11 3EXUA 3O14A 3WZ1A 4LO8A 4QX7A 3W9AA 1S0IA 4KU8A 1RVF2 3ZXJA 1LAJA 1OFNA 1SDDB 2VULA 1JOJA 4PI2A 4AGVA 5A3OA 4M3CF 4PLMA 4Z82A 5BYNA 2MEV1 5CVRA 4IE6A 3BGAA 3SC7X 1OC1A 1DU3D 3UL2A 3WT3A 4ES8A 4GULA 1RUI2 2BRTA 1G7YA 4L11A 1GWLA 2WJSA 3WDWA 4I09A 5FZ4A 3ZSJA 2D6KA 1W0NA 4JDMA 4OVEA 5J3UA 4BCUA 4P08A 4IQPA 4EJRA 3DCQA 1MEC2 3AKPA 5GM0A 1MZFA 2C9KA 4GB33 5FO8B 5JUVA 1XNDA 1YI7A 2GALA 2IXJA 3NNMA 5FLJA 4D69A 1DZQA 2RMU2 3FE5A 4LUKA 4OZOA 1ND2A 1AR81 4FPFA 3FUOA 4CCKA 5JSOA 4RS5A 1ZBA1 3BODA 1FV3A 1V70A 4N8MA 5I8YA 1CX4A 3VL8A 3KV9A 3WF2A 4DZGA 1HQLA 1ALYA 1R1A1 1Y9QA 5FYUA 3WQBA 3OYWB 1OH3A 5DMYA 3E5UA 5F3CA 3QCWA 4MLOA 2VOVA 2BU9A 2VTFA 3HMYA 3FLRA 3N7LA 1OUXA 1S0GA 1POQA 2G4IA 2QTWB 3JU9A 3NW4A 4V2VA 4XCBA 5FZDA 3VZLA 3OBAA 5C8WA 3CNAA 4GMP0 3POBA 1JZ8A 3J8F1 1VRH2 4DXRA 4EZ4A 3MW4A 1SBFA 3OBZA 3AMPA 4W6WA 4OZXA 3NMBA 3HNMA 4COYA 4Y26A 2FDGA 4CDUC 2X5IC 1U5XA 1GU3A 2RR13 4LEJA 2R062 1AL21 4MGQA 5DZEA 4IESA 2JIGA 4M3CE 4A3XA 5A3LA 5KXCA 4IEPA 3K46A 3N9OA 3NL1A 1NXD1 3MUY1 5CYYA 1P8JA 4CEYC 2G9FA 4P14A 3LCPA 2LM3A 2VBDA 4EE2A 1NCQA 2G19A 5JPMB 1R64A 2D5FA 3LPFA 4UOJA 3SXWA 2ADDA 2ZX1A 3JQXA 2J1UA 4CU9A 1UZWA 3VBSC 4AQSA 1JZ6A 2VY0A 1W3XA 2WZ8A 3FHQA 4M3CB 1EY2A 4U2AA 4XYXA 1HRV2 2YZ4A 3ZYJB 1NLRA 2A73B 2DVBA 3B7MA 2HLEA 1NYWA 4FP2A 4TLFA 4IV1C 5CFDB 1OLME 4HK9A 1VALA 5FPZA 1R081 3ITQA 1W04A 4DMIA 3AL6A 1ULOA 3VHRA 4LT5A 1WCQA 2JX9A 4ASMB 5FZFA 1TMF3 3RYKA 1SFYA 4BYYA 3M3IA 3H8UA 2GC0A 2ZGNA 2R041 5CEHA 1F8VA 4EN8B 1WBLA 2XLAA 3GDBA 3HAGA 1QXJA 1CAVA 1DQ4A 2PHLA 2HWC2 1HRI2 4N43B 5CAZA 2QQOA 1FOD1 4CPBD 1S2KA 5CG9A 4RA0A 3WP4A 3F2ZA 2ZZJA 3IKWA 4C91A 4XPVA 5FZ8A 1EPWA 1DZRA 4WVVA 2E6VA 2WO1A 2WINB 2EA7A 3TEWA 1PGL2 1DHKB 4YM1A 3NJXA 2WNVB 4QPIC 4BB3A 1LECA 1PZ7A 5A7SA 2DCJA 5JXGA 2R49A 1OA4A 3FJSA 1POV1 4QHBA 3VBSA 3AVSA 2ZHKA 1PVXA 1DGRN 1TNFA 5FPVA 4J1WA 3THPA 3ZOIA 4BWOA 1MQTB 1SCSA 2WZR2 5AVAA 3CMGA 3RJ2X 4CDQB 2RJKA 3ABZA 1H1MA 4BQWA 5IK5A 2ZGLA 3PNAA 1VBE2 1YYNA 5T5PA 3WNMA 3AZWA 3FX3A 1AL23 4YGBA 5FY0A 1RTVA 1O4YA 3MW3A 2Y60A 4GWMA 5H9SA 2EVXA 1RUF1 2C0ZA 4CCCA 1W6MA 4QDRA 4AW7A 3B93A 3IIAA 4G9SB 1WW6A 5DZFA 2P3IA 4KWJA 5IK8A 4WZCA 3OGRA 4GH4B 2FCVA 5DDJ2 2WFF3 5A6QA 3W5NA 2B9UA 4NPMA 2NP0A 1W28A 4RGAA 1XSQA 3L2HA 3B3QE 2ZTNA 4P5YA 2VO5A 1V6IA 3AMHA 3DKQA 3AYCA 1E5RA 4H3WA 4Z07A 5FOBB 1IS3A 3OTFA 2K2SA 3DPRC 5H9PA 2UYBA 1OOPB 3PMSA 1R083 2RS53 4NIDA 2ZGSA 3TEYA 1SLCA 4CUBA 2W2IA 1X8EA 3N9QA 3OY8A 2VNOA 4A2UA 2JKBA 1OPOA 2WWSA 4PI0A 2R043 1W2UA 3WNOA 2BYVE 2GAUA 4AAXA 3AP5A 3ZFEB 4LBNA 2ZMLA 1ZRCA 1FOD3 2ZGMA 1ZYBA 3NQHA 3POYA 4RL7A 5DUWA 4AXOA 2AENA 5FUNA 3TYJA 5C8CC 1HV0A 1Z7S1 2XQRA 2W0XA 3T2TA 3POEA 4KGQA 2J1SA 4YVSB 1QJU1 2YPDA 2A6XA 2ZX2A 1ZZ7A 4MGZE 1YFUA 3BTZA 3IDBB 4AL9A 4Q0QA 1JU4A 3RYPA 2IXCA 1Q8QA 3BTYA 1IS5A 1POV3 5C71A 4COZA 4K8FA 5FLHA 3K2OA 3VUOA 1YQ5A 5GLZA 2OX0A 1JYNA 3OGVA 1IZ3A 4MV2A 2GN7A 3U78A 1R092 3JBG1 3IAPA 5FZLA 4E8CA 1RUF3 2AGSA 1S0DA 1W8HA 1RUH2 4URAA 1PGSA 1SDWA 4YM2A 5G05L 2QQMA 3DF0A 1Z78A 3X29B 5LCWL 2WQZC 1GV9A 2BNMA 5FYVA 5C8CA 2D44A 3THTA 3RMXA 3OYWA 1WUVA 3ZKYA 4A3ZA 4OI2A 3HJRA 1G9AA 3U10A 1SLIA 2Q4SA 4R8HA 3O1TA 1VBA3 5C3PA 1SLBA 3N7KA 5LY1A 1X7NA 4H7MA 2WT0A 5F6KA 1W9WA 2JECA 4NHYA 5SV5A 1W9TA 2I45A 1OBNA 2K46A 4LLFA 4IUGA 2UURA 5FPBA 3VD5A 3WX5A 2GMEA 3POSA 5I0SA 5FY9A 3I2JA 4NIIA 2BP6A 1Z7S3 2JB4A 2ZGUA 4H2AA 3LA2A 3PHMA 5CKMA 2Z79A 4FTBA 3I4IA 3SEEA 5JOXA 3K51A 5L19A 2HWD2 2YC4A 4ZONA 4BZ4A 1W8FA 4Q0PA 4HG6B 1JU3A 2DCZA 4LHNA 1PMIA 3CJXA 3WDTA 1YQ8A 5A1AA 1G6NA 1QJY1 4LULA 4M3CA 5GALA 3U4XA 3ZM8A 5HV4A 4IGPA 5LA1A 4LOSA 2J1AA 4NJ4A 5CFDA 4GALA 3GNEA 3KWVA 4BH9A 1KGYA 3JBG3 4N7UA 5FZGA 1KRIA 2J7MA 1K42A 3TN92 1REEA 4INDA 5EP9A 4EN0A 2Q8DA 2P3YA 4H14A 4L8QA 4A6SA 4BU2A 2BOIA 2GMMA 3MFCA 4NO4A 4AFBA 5L36A 4ZHNA 4I0WB 1OLMA 5EYYA 1FXZA 5A6ZA 3TEZA 1WA6X 2X53S 2X29A 3MZHA 3DECA 3AX4A 1NY72 2ZEYA 4UT5A 1LHUA 2XB6C 2D6MA 3QACA 4MGSA 5FZ3A 1BLZA 2FZ1A 1RIRA 3KVAA 3O1OA 2C1FA 2WNVA 5ACA1 1UIKA 2PTMA 3LEKA 3T3YA 1MS5A 2VZQA 4GAZA 5JPNB 4LOTA 4XUOA 4NRQA 1YFWA 3WHTA 5FTTC 1ZX5A 1QJEA 3VBOC 5HCAA 2W52A 3WUCA 3S57A 3ILRA 1QQP2 1JYXA 4DFSA 1CESA 3RI8A 1ZRDA 5EJ1B 2VOTA 4JV4A 4XF1A 2PLV3 5F3EA 1MS3A 5C3RA 3BKZA 4LKFA 4ET7A 4D94A 2HWB2 4O9EA 1QHDA 1O8PA 2RS12 4RHV1 1LGBA 1AYN1 1Q8SA 2BJSA 3NO8A 3WD5A 4M00A 3L2YA 3ZN6A 2A6VA 4CVUA 2GMPA 1QJY3 1DQ6A 1AR71 1VJ2A 1QOTA 1ZA4A 2JWPA 3D8CA 2WC2A 4GKYA 3JQWA 3ZXKA 3LKJA 3K3OA 2X09A 2VQ0A 3M3EA 2CGNA 2MEV2 2R073 5DG1A 2FCTA 3U14A 1IS4A 3ZR5A 4B4PA 2KA3A 1SFNA 1OOPA 3WP5A 4B1LA 3U75A 4FAGA 5FP9A 2JDUA 3POGA 4Q4W1 4A6OA 4EYUA 4OI1A 2BWCA 4Z92B 1XYNA 4E27A 3OGSA 3AP7A 1O3QA 3P5BA 3E6CC 1UKRA 4JC1A 4FT8A 1YJKA 1W2TA 5FY7A 5F7UA 2PHDA 4OHYA 3T2PA 5C3QA 5F5CA 3INAA 1PNGA 2WNUB 3HT1A 1YXWA 4QQPA 3WQ7A 1UO9A 3GZUC 1AR82 2WAOA 1EV11 1PM4A 4KNCA 5LB6A 1X8MA 3I2FA 1V6OA 1ZBA2 5BUVA 4Q26A 2NMOA 3MF6A 3VD7A 1HJGA 2HWE3 2ZX4A 4ISQA 1ZVFA 1R1A2 1IQDC 4OHZA 4AVAA 4COVA 5BNOB 5CFCC 2D3RA 3HEIA 1FT9A 2DU1A 3ACIA 5F9TA 2EICA 2PELA 3CKHA 4QB6A 1UOFA 2VG9A 5LATA 2OT7A 3H3ZA 3J8F2 2ZHMA 3NV4A 4FOWA 5ISLA 1PMHX 2EF6A 4DRRA 2ZEXA 1VBB3 2OUHA 2RV9A 1JOBA 4JGZB 1FX5A 4RHV3 1ST8A 4U36A 1AYN3 4CXXA 3TNPB 4WVMA 3VHPA 2XUEA 4E4ZA 4CCJA 1C8M1 4R9DA 2YPJA 4XABA 4KBZA 2ZA9A 4IDZA 3U1XA 3VKNA 5FYMA 4QXCA 2RS31 5B4NA 3WQ0A 3QH6A 1AR73 1LKNA 4DS0A 2ZHNA 3D3AA 2HWF1 2PHXA 4AI0A 1OF3A 2BVBA 3LAGA 2XVGA 3GHMA 4AEDC 4LHLA 4LO6B 4QM9A 1UWWA 2WO2A 4AI2A 4XACA 1QH6A 2VZ1A 3M70A 1DGWA 1NQDA 4LBJA 4Q4W3 3HNBM 5C4WC 1W99A 1AVBA 3PIGA 5LA2A 1ULGA 3B02A 2TBVA 2FMDA 3RDIA 1Y4WA 2AZ5A 1H2KA 3GCWA 3MGUA 4QGLA 5A6XA 5DAQA 1HN1A 5HV0A 1AF9A 4XVHA 2ZAHA 2BGPA 2XQXA 4CDWB 2JG9B 1R082 1C5IA 1GZWB 1VAKA 4X6RB 4DPNA 2DU0A 1W6PA 4YM0A 1HX6A 2JDAA 2WO3A 1F2NA 3NWKA 1H1AA 1LHOA 2VMIA 4N53B 2R042 4Y20A 5FQ0A 5K8SA 1EV13 2CAUA 5L7OC 5JSRA 2B5HA 2ZHLA 4P9YA 3I3QA 3V0AB 1O8SA 1C28A 1NCRC 5KR7A 2QQLA 2WYFA 4OMDA 5DUVA 2O1QA 1W6OB 5HPOA 3KV5A 1PO11 2DBNA 4D7SA 2A1XA 5LZ6A 1MZEA 3UESA 1H2LA 2PFWA 5I91A 1JZ5A 5IYYA 2B46X 2CNAA 1UX6A 1H6YA 1XRUA 3WW1A 2CDPA 3WNPA 3HVDA 3LF7A 1HXS1 1AJKA 1UF2C 2WFPA 1V0AA 1JYCA 1E5HA 1DP0A 2Q8EA 5FWJA 5K7PA 2ZACA 2JDHA 5BXXA 3S7EA 3D0SA 2NN8A 1W3VA 3JD72 1C8M3 2XDVA 5DUXA 5IAVA 3LDBA 4AVTA 3W59A 1FYUA 5J37A 3C3VA 4WM7C 3W21A 2FD8A 2WNOA 1CWPA 4BM8A 3VBUC 5C70A 1Q8VA 1RUF2 1UW8A 4A41A 4CDXA 1H2NA 2OQ6A 2VUCA 2EIBA 1WCUA 2IXKA 2PXJA 4QQHA 5A6YA 1IPJA 2PHRA 1W06A 3GGLA 5CZKA 5BNNC 3BB6A 4LO4B 5D1IA 4LKDA 1XNTA 1I5PA 5A32B 3VKMA 1RUE1 5IVEA 1JYVA 2Y38A 4WV8A 4MXWA 5CU1A 4LXLA 2FDHA 5FPUA 3GZAA 2RDSA 1UOBA 2E33A 4CCOA 4Y1UA 4RN5A 1SLTA 1ENXA 3RZJA 1XYPA 3RNSA 4Q4V2 3ZXEA 5B2GB 4MX3A 4GMP1 1J83A 3VB9A 1ZRRA 3GBWA 1UOJA 2FQPA 3GALA 1AZDA 2CGPA 1AUYA 4KH9A 3N36A 2LS6A 1KS4A 5KXDA 4B3NA 3BU0A 1SBEA 2YBPA 1ZZCA 2VH9A 4KWKA 4Q8LA 5GZDA 3VGIA 1D4M2 3E1F1 2DUQA 1H9WA 1Z7S2 1LENA 4ZKTB 4EZHA 4F3JA 5FIXA 5IFPA 1QDOA 1QJU2 1RC6A 2UY9A 4BIFA 2QQKA 3LEIA 4QGNA 4EWEA 1S0EA 2R0HA 4XUQA 3OEAA 2EXIA 4TSVA 4PIYA 4L0PA 1JS9A 3AZVA 4NE9A 1HXS3 1JI6A 4AHYA 4FOYA 1Q43A 1I1EA 5FMDA 2EIGA 5JOYA 1V6LA 3PVEA 2C26A 3KF3A 1BVVA 1VMFA 4J6GA 4NUBA 5CKQA 4XJZA 3I49A 4Z2AA 5EXOA 5A3UA 2EIEA 3AXEA 1ASJ1 1PO22 3OCPA 1BBT2 3GJBA 3KF5A 1CZVA 1OKOA 1ENSA 1D4VB 2BBAA 2VUAA 3EJKA 2W92A 3MPBA 2JDNA 2VZ3A 3VBHC 4EV0A 3AZYA 4NHLA 4YZ1A 1ONAA 5IVJA 1NX9A 1SZBA 5HXVA 3SH3A 4YWAA 3BI3A 5GLVA 2YFUA 4IV3C 3TWIA 1AXKA 3WUDA 1GQGA 5I8SA 4CP9A 4XFHA 1TME1 1RUE3 1LU1A 1XNBA 2XL9A 2ZZQA 4IE0A 3PUHA 4YW2A 3VZNA 4Q27A 2WS91 3ZSKA 4FQ4A 5DAXA 2Y6JA 4H7LA 3ZXGA 3DN7A 2IXLA 1WKYA 3IT8A 2YC2A 1BJQA 3IAQA 4M4RA 4Q4Y3 4XJ8A 4QX1A 2DCYA 3KT4A 1EAH2 2VVFA 2W1WA 4OUMA 4UFJA 3ZMNA 4CEWB 4E2SA 4YM3A 4Z2WA 3H8RA 5GKAC 4BQYA 3POIA 4F83A 2GZWA 1JODA 3T1MA 2EXJA 5LBCA 2ZABA 3B69A 4MXVA 3FHAA 2JE7A 1TNRA 3B5LB 1KJLA 2O8QA 1GKBA 3WCRA 1UYYA 4JGZA 1V9U1 4X6QB 5IVFA 1NAEA 2JICA 2OIIA 2P1BA 1JUHA 2OVUA 1ODMA 2VMCA 2VMEA 1H8TB 2F4LA 3K3NA 1JHNA 4EWAA 5J1XA 4RSUA 4RR3C 1HW5A 3T09A 4PF1A 1U12A 2R32A 5DABA 5FO7B 3LSDA 2GNDA 1FMD2 1V6NA 4LITA 5FZMA 1WLTA 3AP9A 3PTYA 4XIOA 1CIYA 2JIJA 1LGNA 3ZFFA 1WMXA 1YEWA 2AC1A 4GB31 1AR92 4MGKE 5FYSA 2XJPA 4ARXA 3VDDC 1UU6A 4CEYB 2OYZA 3ZLIA 1J58A 2HBTA 2V73A 4HKOA 3MIDA 5KXEA 3BPSA 2L9LA 4XQ4A 3D82A 4Q8KA 1ASJ3 4CP1A 4PBPA 4XUTA 3VDCA 3CZJA 1PK6B 3V64A 4B7EA 2YB7A 4N53A 4LHKA 2CYFA 2SBAA 5HCBA 1HV1A 5LA9A 4RQPA 1TME3 4IGOA 5FP8A 4NMIA 3MHZA 3UKVA 2WS93 4JGYB 5JLVA 2D43A 1W9YA 3CIHA 2V72A 2NQYA 5A3MA 4CP2A 3VD4A 1OQEA 4WM8B 3I54A 3NJVA 2XWJB 1ND2C 3NV3A 4E2GA 1E5SA 2ZCWA 3AB0A 5JMCA 4NAOA 1KDKA 4RS5C 4AVVA 4IERA 1BHGA 5C9AB 1SPPB 2IUWA 1F31A 3AKRA 3I2GA 2JE8A 4LA3A 4S2FA 4D0QA 5ACA2 2VBPA 4IL7A 1AXYA 1QH7A 3RZHA 1V9U3 1VIWB 3VDDA 1DGLA 2QZ3A 3POJA 2WABA 5B4XA 1YNAA 2BFUL 3BCWA 2E63A 5FMOL 5JI7A 5LBFA 5A7WB 1RUJ2 1NE4A 3LA7A 2WLQA 3RGBA 4QPIB 4NWWA 3USSA 5IK4A 4EQVA 4F7ZA 5FXVA 4OHWA 2JJ6A 3OOXA 1GP5A 1WCDJ 2BUKA 4RHV2 2Q1ZB 4KGGA 4UF0B 1GLHA 1TQ5A 1GWMA 2CY6A 2HH9A 3PL0A 2OKXA 3VBRB 1BMV1 3W5MA 4FP3A 4NRMA 1ACCA 1MPXA 4AVCA 4ES9A 3V0BA 1PGW2 1AR72 3USUA 3WP3A 4OHXA 1LTEA 1TMF1 1UZ0A 1KJRA 2A75A 4L99A 1LHVA 5D21A 1NCQC 4FPEA 3ZDVA 3ZYIB 4PCRA 5SV8A 4LBQB 5D8AB 3OB8A 3KM5A 1N3QA 3LB9A 4Q4W2 1IHMA 1YI9A 3JUUA 3K4AA 3S6PA 3POWA 3LFMA 4RGGA 5FYZA 2C5DA 4PLNA 1JTZX 1D7PM 1T2XA
chains in the Genus database with same CATH topology
2E9QA 2B45X 3WXPA 3DPRB 3RI9A 2UWAA 2UU8A 3U11A 3B00A 5E1RA 4FXKB 2VW0A 2O8OA 1OSGA 1S0JA 3IDCB 4XFBA 1EV12 1NA1B 4FAHA 5KC5A 4TZDA 4FPOB 1RUG3 4HMZA 3IN9A 3RJRA 1O4ZA 1WBFA 2QVSB 3PVNA 4IEVA 3L9JT 3NV1A 4R9BA 2JG8C 3AMMA 4FTSA 4CRQA 4AE2A 1ULCA 2WLPA 2XJQA 4XBQA 2H6BA 4FVVA 3WDUA 1W6QB 3TB0A 1UPIA 2WFF1 1IKPA 2NPIA 2D98A 1LOBA 1UCXA 5KWRA 4WZFA 2XJUA 3OBTA 2BNOA 4YG6A 3VBFA 3ROUA 1EYBA 2XGXA 2AREA 2RS32 1WW4A 4AVSA 1VBD3 4ATEA 2RS51 3J4UH 3SCHA 2PAEA 1KQRA 4YW3A 5H9QA 2HWF2 3E6BA 1O91A 1DYKA 3TAYA 5GZFA 3OJBA 2A7AA 4XQWA 3MI8A 2HEWF 2WA3A 2NMNA 2JG8A 1JXNA 3ZIWA 5DUUA 4HVQA 1D2SA 4DQAA 1WCKA 4IETA 4META 1KITA 2A3YA 2IFWA 1BZWA 5K0UB 4P9WA 1UPSA 1CAXB 1XE8A 4XILA 4ASLA 3ZDSA 2XKPA 3B94A 1H8TA 3AJZA 3IDEA 5CADA 3A0NA 3RS6A 4QM8A 1BKZA 3NAPC 1PVC1 2XBO3 4Y22B 1E57A 1MZ6A 3KGLA 3V56A 5JOWA 4OHVA 1PO12 3AKTA 3JCIA 2CV6A 1RGSA 2W08A 4DINB 1EPZA 1N3PA 3ZYRA 4AHZA 5KHGA 1X36A 4YLZA 4R4XA 5T55A 1IQAA 2VMHA 5E8AA 1AL0G 5JSPA 1AYM3 3HD8B 2Q1MA 3IWZA 2IZWA 3RRDA 4W65A 4K3UA 4UW5A 3MFAA 4C0HA 4BMEA 4JGYA 3O12A 1HIXA 3WW2A 1VBA1 3URFA 3MIBA 4WM8A 4JTOA 2XKOA 4PDWB 3NAPA 3RPQA 2DCKA 4B29A 5BNPB 3ECQA 4EWDA 5HI0A 4GKXA 1GICA 3DV8A 4FPYA 3WG2A 4XQDA 3R4UA 2XJRA 3J9SA 4IEYA 5EZWA 2UY8A 5FLIA 2I74A 2TUNA 4EROA 2ZMKA 2XJTA 4P9LA 5ABJB 2GC3A 3ZIXA 4QQOA 1ZBE1 4IEQA 1PNFA 1PVC3 1MS4A 2C9AA 3MLJA 4LE4A 3M4FA 1ENQA 1LRHA 3OGJA 2CL2A 1XQNA 2R6QA 3JB8A 5KHKA 1PZ9A 4Y1VA 1GYKA 3U07A 3UKNA 4AYUA 1VBC1 1RMU3 4NWVA 1YO8A 1IKQA 3EQEA 4LBQA 5D8AA 2DCTA 4QPGB 1COV1 4BA6A 1X50A 1AX2A 1JUIA 2D7FA 1BK1A 3RYRA 1A3KA 1ASJ2 1LHNA 5CFDC 3KZ4C 1W0PA 2R0FA 1QU0A 3U0ZA 4LBOA 4AI1A 1RUOA 5T52A 2E51A 1NA1A 5FFOC 4Y1YA 3WW4A 4B8EA 3BALA 3LWCA 3RG0A 3PVBB 1TME2 2YXSA 1QMJA 2TNFA 4N43C 1QJX1 4UBHA 4YFZA 4HETA 2PLV1 2WT2A 3AMNA 4FPHA 3SMHA 1RHI1 4YZ4A 3B01A 2WNVC 1YFYA 1BXHA 1ZBE3 4K1ZA 2XPJA 2OZ6A 2YUEA 4AGRA 5CFCB 3JZVA 2B42B 4NOTA 4NHMA 3ENRA 3CU7A 2R071 4QXKA 4A7YA 3O0VA 2GU9A 2R30A 4AVBA 3LA3A 4KL1A 1VBC3 2XJSA 5JCTA 4GH4C 4BOWA 3A0KA 2DFBA 3ZN4A 4LO5B 4WVWA 4N43A 3SITA 2BVVA 1KXGA 4GB32 4Z1VA 1COV3 1K5MB 3GBFA 3AYDA 4R52A 4XEZA 1XNKA 2NZ9A 4NHKA 3MEPA 1CAXA 1OOPC 1X82A 2V09A 1UD1A 2XHKA 5FCCA 5C4WB 2X8KA 2HWE1 4IXLA 1OLRA 2XJVA 5K9YA 1NXMA 4F8AA 2HEYF 3T1LA 1MQTA 1F5FA 2DYCA 4Y22A 3ZFGB 1LR5A 4CDQA 1QJX3 1WMEA 1FPN1 1YLLA 5JI9A 2W39A 1CPMA 2BWAA 1SCRA 4I3GA 4CTEA 5KBFA 2ETEA 2GSYA 1BYHA 1O5UA 3WV6A 1KS5A 4IEXA 1U0AA 3ATGA 1VBB1 3H1MA 3AM2A 4COUA 4JRLA 1RHI3 4C90A 4GH4A 2ZKLA 1IS6A 2RR12 3FBMA 4C0BA 5F6LB 2GC1A 4HSJA 5JZGB 3ES4A 2JEMA 1FV2A 5AC93 3CL1A 5EV7A 2D6LX 2ENRA 5GZCA 4XZPA 1G86A 4P5HA 2WSVA 4XHXA 4PDWA 4LR4A 4QD2A 4B4RA 5BNPA 1C8NA 3ZFEA 2VECA 3IBMA 1AX1A 3LGRA 1LOFA 4L2NA 1IOAA 5HBAA 2ZX0A 1TMF2 2GNMA 3ZYGA 4YVSA 1A8DA 1B35B 4YW5A 2CAVA 1MACA 3UK9A 3ZSLA 3P3PA 4XTMA 2ZGQA 3HN1A 1M06G 2PHTA 1OKQA 5ABJA 3I8TA 4N9IA 1LOAA 3GZTB 3OD0A 4FBFA 3WQ1A 4DY3A 1SACA 1OD5A 3BOPA 2VVEA 3JB4C 4FSJA 1CR7A 1OA2A 1FPN3 2PN5A 4XXAA 5A33B 1H4HA 5FOJB 1I9RA 4FTEA 3FFZA 3V65A 2XLGA 1PIV1 3MDPA 2P3KA 4YSFA 4HK8A 4LBMA 4PIZA 4ZU5A 1RUC3 4XJ9A 4YW4A 1O4TA 2B8MA 2VOXA 4QPGA 1AL22 2GNBA 2VOWA 1A78A 1V6MA 3BU7A 1IPKA 3I2DA 4DRVA 3VHNA 1Q8PA 2TEPA 4KWLA 4I30A 3EBRA 3D6EA 2EXHA 1C5HA 3FFQA 1OA3A 1ZREA 2ATFA 1O5LA 1UAIA 3NKGA 3QBQA 5CNAA 4MGIE 2WFF2 1VB4A 5J96B 2JD4A 1GNZA 3O7OA 4KU7A 4DOUA 4FPCA 1HRV1 4K7JA 1OI6A 4YVWB 2RE9A 2QCSB 1F5JA 1MEC3 2BGCA 2RS52 2P2KA 3LOBA 2Y0IA 4YARA 4X8NA 4CDXC 2WIIB 3CJIB 2DVDA 3SCFA 2YY1A 4YG3A 2RMU3 1J1TA 1YFXA 2PHFA 3IM0A 4UW4A 3DGTA 2P3JA 2ET7A 2XUMA 3VN4A 3SHRA 2HKXA 1CGPA 4M0NA 3WW3A 1T6GC 1FOD2 3Q9OA 5GJ6A 4OI0A 3PMEA 4Q1PA 4BMBA 3KCCA 2Q5TA 2P34A 3I59B 3DUIA 1U5ZA 4SLIA 2DUPA 3M1HA 1WA4A 2IFRA 4HBNA 1I6XA 4MGYE 1CD3G 1G9CA 3UJQA 1PGL1 1CN1A 5C6CA 5HCFA 1VRH3 1PIV3 5BNQA 4HSLA 4Q4X1 3RZZA 4JQRA 1WGPA 1H2MA 4RD7A 5C33A 2BBVA 4HFSA 4OUSA 1WW7A 1K5MA 3ZXDA 4HN1A 4XIKA 1QKQA 2JXAA 2E7TA 1QXPA 4AQ6A 1YRZA 1ENRA 1KD7A 2YHJA 4HT1T 2EAAA 2XH6A 2BFUS 2Z2SB 5FMOS 4HKLA 1MS1A 1HRV3 1Q5OA 4R9CA 3VV1A 2RJLA 4Q4Y1 3ZFGA 1WMDA 2ZGPA 3CLPA 3VHOA 4EN6B 1NLSA 1Q56A 1BCXA 2ET1A 5CB7A 1VBA2 1Q8OA 5F1RA 1WMFA 1H9PA 4XXPA 1U5IA 3ZSEA 3AYEA 4JTNA 2BPA2 1HRI3 4MVTA 3HT2A 3N35A 3OBRA 1HLCA 1JBCA 3UJOA 3FLTA 3MYXA 3FUQA 5GLTA 5FBZA 1ND3B 4XMAA 5E88A 3VLBB 5AVPA 5BNOC 5JZGA 1YIPA 1DYPA 2OUJA 1H0BA 2NYYA 3PVOA 1YHFA 2D5HA 4A7KA 3D0JA 1O3RA 1CAWB 1ULDA 2ZX3A 4CP0A 4LTAA 4JGZC 4Q4X3 4HN0A 4J1XA 4UXAA 1HKDA 1S1AA 1UU4A 1VBE3 4GIQA 1FATA 4LBLA 3SCGA 5KHJA 3JBG2 2Q30A 4XFIA 4BLIA 1AR61 2ZAAA 3OGGA 1ZZ9A 2WNUA 1VBC2 3KGZA 2UWCA 1RUH1 1LOGA 4YNIA 2EALA 3ZFFC 1COV2 3AFGA 4EN7B 3NSTA 2BTVC 2WNEA 3RMYA 3N4MA 4K40A 4L92A 5BNOA 4AFDA 3P3NA 1NCQB 3FZ3A 5E16A 1JW6A 5KHHA 2AR6A 1C1LA 5A33A 4E2QA 4BQ1A 2CGOA 1WD4A 5GLUA 1LGCA 4N53C 1D2QA 3OD4A 1Z0HA 4RQPC 2A6ZA 4XJUA 4P9GA 1QJX2 5I0RA 3EO6A 1V6JA 3GBGA 4AQ2A 3NJZA 1ZZBA 2PLV2 4YGDA 4FO9A 1RUD1 2ZBJA 1A6CA 4I01A 4Y5Z0 2VOKA 4BLJA 3S30A 2ERFA 1CAVB 4CDUB 1QNWA 4MUVA 1CIWA 2X5IB 4HLTA 3NKTA 4CYDA 1QJY2 1CAUB 4Q0SA 3H1YA 4SBVA 1OHFA 4XBLA 4Y1XA 1GZCA 4YVWA 2VNGA 2R072 1C1FA 4LLOA 4CDWA 1RL3A 2JG9A 1GZWA 1R093 1AR63 3VBSB 5BY5A 3CJIA 3WOGA 4ZXKA 3QOPA 1RUH3 2G9GA 2E7AA 2XLFA 1DQ5A 3V0AA 4IV1B 4MYEA 1GSLA 3GF6A 4XDQA 1V6KA 3OF1A 1W6OA 4AGGA 1ULEA 1QY4A 1VB2A 3AZXA 5KHIA 1W6MB 3DKWA 3I59A 4PLOA 3ZX7A 2GH2A 4QPYA 2GC2A 1RUG1 1M4WA 3M8LA 3HR9A 2Z42A 2HWE2 4LBQD 5LRSA 4XF9A 5EFUA 4DB5A 2ZOEB 4QGMA 2VQAA 4V1PA 1N1YA 3VKLA 4XF4A 4N9HA 3QLQA 4LO7A 1QQP1 4AEKA 3ZVXA 3M3OA 4CZSA 2OA2A 3FWEA 4JRAA 1RUD3 3LSEA 4FQZA 2P17A 4M01A 1VBB2 1S0BA 2HWB1 3KSCA 2HWD3 2RS11 1AYN2 2CWMA 4NVPA 1REFA 1G9FA 3HBZA 5A32A 3UKTA 4XFAA 2XL7A 5KC6A 1VBD1 4YW1A 2WSUA 5AFEA 2BW8A 1O3TA 4QQ2A 3O0XA 4AWDA 2Q0AA 4QT6A 1OQ1A 2XG3A 1NQJA 3NV2A 3EHKA 4HL0A 3TN93 5LRRA 5J09A 4TYSA 4JAAA 3MLLA 3VBFC 1CJDA 3ZPYA 4URTA 1FNYA 1KFUL 4AQTA 4NN0A 1B09A 1RB8G 4KG8A 5J36A 2A3WA 1ND3A 5JIUA 3AKSA 3LZZA 4XFFA 1F9KA 3WHUA 1GANA 2V5YA 3HWJA 2XBO1 4CEWC 3ACLA 4Y24A 2OW4A 3AKQA 3MW2A 2ZPXA 1UZZA 2Y0OA 3SISA 2ZGOA 5C8CB 1CAWA 3WY6A 2DTWA 2ZKNA 2DWRA 4P9JA 1OPMA 1EP0A 1QQP3 3BIWE 1Y43B 1H8TC 2VUJA 4OULA 5I0UA 2H0VA 1PIV2 2LALA 2HWB3 4K1YA 5DXDA 3VKOA 4E9KA 2RS13 3R6SA 1XXNA 1AYM1 1C8M2 1DZTA 2LTNA 1H1IA 3VZOA 5JAXA 3S7IA 4YG0A 3GYDA 3NVCA 1R1ZA 4FPGA 4L97A 2BQPA 2MEV3 4YZ5A 4XFCA 4CEWA 5BV6A 5FDBA 3VZJA 1OLQA 1DGWX 4QU2A 1PK6C 1DQ0A 2MPFA 2RM21 2RHPA 1GBGA 2QFEA 4HVRA 1HQNA 1AXZA 4XJWA 1MS8A 4JGYC 1LCLA 2VVDA 3ALQA 1DLLA 4HKWA 1UL9A 3MIHA 4WM8C 3ZSMA 1C4RA 4ZU7A 1AR83 4E4SA 1QJZA 1ZBA3 1FAYA 3FC0A 3J26N 4CDUA 1YJLA 3CEWA 4WVZA 5C9AC 2X5IA 2YDEA 1BEV1 1R1A3 1MZ5A 1DQ1A 3WDXA 1CAUA 5EWSA 3I7DA 4CEYA 2AYHA 1RMU1 2BNNA 1ZNPA 1QGLA 1HXS2 1UU5A 2EXKA 3ES1A 3J8F3 4IEOA 1PK6A 1SMVA 1AHSA 1J3RA 3ASIA 3R4DB 3KT1A 1D0HA 2ARXA 2CWSA 4Q4X2 5JOZA 5JR7B 1OQDA 2D93A 1G9DA 3JD71 4QQLA 3VBRC 4ATFA 4IV1A 5J7MA 4K9SA 3W58A 2H0BA 5CIRA 1W39A 4R4ZA 2JDZA 5D8AC 3ZN6B 4N90A 4UW6A 1RUE2 5C9AA 5JDBA 1A8MA 2RM23 4AEMA 1MVQA 3ILFA 1VR3A 1VAVA 1XE7A 3IMNA 4Q4Y2 2A6WA 4BHPA 3O0WA 4FOVA 2W68A 4Q4V1 4QPIA 1AJOA 2R1DA 3GHNA 2K9ZA 1NA1C 4D3WA 1Y3TA 1UIJA 4Q0VA 4NR1A 3VBOB 4AFCA 1D4M1 3VBRA 1MVEA 1YUDA 1BEV3 2WA4A 1NZCA 1WCSA 2D6OX 3ETQA 2Q8OA 1N47A 4S2DA 5T5LA 4HPKB 2K0GA 4BPZA 3ILNA 5IT6A 4GQ7A 1LOEA 4GWNA 4AI3A 4PQ9A 1JH5A 1HQWA 3H50A 4LE3A 1KDMA 3PJQA 1QWRA 1YIFA 3R0RA 2YGMA 4C1WA 3ZN5A 3MIEA 3QD6A 3JD73 5CA6A 1QXRA 5T5JA 3DPRA 2DUOA 1PO21 2A70A 1BBT1 4IEZA 4PJYA 1AR62 3N7MA 3WR0A 2IC1A 3FLPA 4WVMB 2VU9A 2NM1A 5JIAA 2QJVA 2QKDA 2VPVA 3N7JA 5T3NA 4EN9B 3BTAA 3KS7A 1MR5A 4G3YC 2QE3A 2WS92 2I2SA 4S2GA 2H6CA 3KMHA 3G6JB 4XFGA 5LK7B 3SH5A 5K0UC 4XBNA 3LOIA 4W6XA 3B9CA 1EAH1 4Q4V3 4D7TA 1W6QA 3WCSA 4MZUA 4FPLA 5GLWA 1ZZ8A 4XMIA 2Z5WA 1V9U2 1MQTC 3R05A 4KQ7A 1SLAA 4CDQC 4DNYA 1D4M3 1IGOA 1S55A 3UV9A 2HEVF 5T54A 1W6PB 5AC91 1LULA 2LUWA 3AK0A 2D6NA 1QJU3 3VL9A 1RUD2 4Y20B 5FQ0B 3QH7A 4Y1ZA 3TNQA 4YZ2A 4YGCA 1SQ4A 4S2HA 1FMD1 4ISRA 3IPVB 4PBOA 3SH4A 2MHFA 1AR91 4YGEA 3RWNA 1X33A 4AEDB 5K0UA 1QOSA 3SNMA 1LHWA 1PO23 5CG8A 1BBT3 1RJ8A 1U5YA 3MLKA 1PM7A 2QQPA 1C57A 5T5OA 3WVJA 1NE6A 4PDWC 4ONUA 4AEJA 5BNPC 3ZXFA 3ZFEC 4AHXA 2AH2A 2FHRA 4K6BA 1GFF2 1XU1A 2QDRA 1LOFC 4P9IA 2FBEA 4LBKA 4X8PA 1LJ7A 1J3QA 3MICA 4CDXB 1DF0A 4YVSC 5L7OB 2ES3A 1LU2A 2E53A 1J59A 4FPKA 1EAH3 1S0CA 3H9AA 1RUG2 1GR3A 1C3HA 2ZJCA 1NCRB 1RUC1 1ULFA 5FREA 5ABJC 1CONA 4MXWB 2GDFA 1RVF1 3H3UA 2WQ4A 2ZMNA 2UWBA 2YROA 4O9GA 1RUJ1 2A5ZA 3ZYPA 4IEUA 5JVVA 2IWGB 4FCAA 4PF5A 1POV0 1RUI1 5EJ3A 4C1XA 3AP6A 1FMD3 4AK3A 2XWBB 4YZ3A 3AXDA 1YWKA 1BMV2 1L3JA 2PHUA 3D5OA 4QPGC 4WM7B 1MEC1 1VBD2 1PGW1 2FMYA 1AR93 3ZXLA 3VBUB 5F5QA 2VW1A 1REDA 5TSWA 1GZ9A 1RJ7A 1XU2A 5H9RA 5BNNB 2RMU1 1CPNA 1D0GA 4FXGB 1N3OA 3TBDA 3WLUA 1W6NB 3AFKA 1S0FA 5CBLA 1QNYA 5LEJA 3HQXA 5I93A 1I3HA 4LUMA 2IXHA 3E5XA 3E97A 1GNHA 3KQRA 3VBOA 3VZMA 4AI8A 4Q1RA 4BIOA 3M3CA 1O3SA 1WW5A 4XOGA 4AFMA 4HPKA 1VRH1 2PQQA 5IUQA 2I07B 3VKFC 1G8WA 4N7IA 2XBO2 4QX5A 4WBBA 4XETA 2QDNA 4GA9A 3WNXA 3KT7A 1TE1B 2HYKA 3FHIB 4ITCA 5ACA3 2CTVA 2R061 2PYTA 4FOQA 4MSVA 4YRDA 1MS0A 1RVF3 4I0AA 1NG0A 2BEOA 5LEKA 3RQ0A 3CF6E 3WDVA 1RUJ3 3KB5A 3H0OA 4LNVA 4MH0E 1APNA 2FZ2A 1RUI3 1AX0A 2VW2A 2ZGRA 4E4DX 1AYM2 2D3SA 2GNTA 2WL1A 1JYIA 1DG6A 1WD3A 2UYAA 2DVFA 2DF7A 1K5MC 3VBHB 4XHBA 1DDLA 4IEWA 2F6BA 4COWA 3O5SA 3WG3A 2AUYA 2DFCA 4IV3B 1Q3EA 3M2MA 4DXZA 4XJAA 2HWC1 3M3QA 1HRI1 3ZFFB 2RM22 1YCIA 1UN1A 1OFSA 4HVOA 4HANA 3PJYA 3MPPG 5CFCA 3ZFGC 2GH8A 1WLWA 2PAMA 3ZXAC 4XTPA 1N1TA 3H7JA 5I8TA 1LOCA 4W6YA 1SBDA 1VP6A 4UW3A 1PVC2 2ZS6B 2QNKA 3OPZA 1FNZA 4OI4A 2HJIA 4RQPB 2WZR1 3IPVA 1MS9A 2VGDA 1XNCA 1H8VA 4AHWA 1BEV2 1VBE1 3TRSB 2R063 4QMAA 5FAXA 2D40A 4RR3B 1RITA 3AP4A 3ZMOA 4XW3A 5JZGC 4AEDA 2VNRA 4DY5A 1RMU2 3AMQA 3APBA 4B7KA 2PHWA 1H4GA 1VLNA 3C2UA 1LODA 2QZ2A 1BQPA 4R9AA 1LEMA 5DDJ1 3WDYA 4I2OA 5C4WA 1PZ8A 2P37A 2VMGA 3R4SA 5DZGA 5DG2A 3VDDB 4AG4A 1W0OA 2O0OA 1N1SA 3BPZA 2RS33 2WT1A 2Y26A 5FRAA 2DURA 2YMZA 5BPXA 5IK7A 3CO2A 4L9BA 2HWF3 2WNUC 5I0TA 4YYOA 1B35C 1CJPA 5L7OA 2YV8A 3E5QA 1SEFA 4PIXA 1QDCA 3TOJA 2DV9A 2HWC3 1NCRA 3K48A 1LESA 3V0BB 2DVAA 2NLRA