The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
SAQFDHVTVIKKSNVYFGGLCISHTVQFEDGTKKTLGVILPTEQPLTFETHVPERMEIISGECRVKIADSTESELFRAGQSFYVPGNSLFKIETDEVLDYVCHLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of protein of unknown function (DUF1255,PF06865) from Acinetobacter sp. ADP1
rcsb |
molecule keywords |
UPF0345 protein ACIAD0356
|
source organism |
Acinetobacter sp. adp1
|
molecule tags |
Structural genomics, unknown function
|
total genus |
18
|
structure length |
105
|
sequence length |
105
|
ec nomenclature |
ec
2.4.2.15: Guanosine phosphorylase. |
pdb deposition date | 2009-06-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06865 | Ppnp | Pyrimidine/purine nucleoside phosphorylase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |