3HR4A

Human inos reductase and calmodulin complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
189
Chain Sequence
REIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Regulation of Interdomain Interactions by CaM in Inducible Nitric Oxide Synthase
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/metal binding protein
molecule keywords Nitric oxide synthase, inducible
total genus 64
structure length 189
sequence length 189
chains with identical sequence C, E, G
ec nomenclature ec 1.14.13.39: Nitric-oxide synthase (NADPH).
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hr4A02
3B6KA 2MWMA 3UXEA 1QRDA 2QX6A 1XT6A 1RLJA 3GFSA 3OJWA 4FGLA 4QOJA 1AHNA 5FUQA 4FX2A 1BVYF 1FUEA 6NULA 2QMZA 1CZKA 3F6SA 4PU0A 3OJXA 5FX2A 1AKRA 2M6RA 3NHWA 3QFCA 4DY4A 1C7EA 4YAOA 3GAMA 4OXXA 3FW1A 4Y7CA 2GSWA 3S2YA 1DXOA 1WSBA 1FLNA 1J8QA 2FDXA 2V9CA 3P0RA 4QOFA 4ESEA 4F8YA 5BUCA 3FVWA 4FGKA 2QMYA 3UXHA 2F1OA 4YAFA 2M6SA 3SVLA 3EDOA 2HNBA 1ZWLA 3NHPA 4YQEA 3B6IA 2HNAA 1TLLA 1D04A 3OWHA 4M0CA 2Z9DA 4CETA 2OHHA 3L9XA 4Y9RA 1CZUA 5JROA 4PTYA 4GI5A 1C7FA 1FLAA 3K1YA 1F4PA 3OX2A 1SG0A 3ESZA 5F12A 1CZOA 4C76A 3W78A 1KBQA 5LVAA 4NLLA 3GFQA 3NFRA 4N65A 4H6PA 1FLVA 2Z9CA 1DXQA 3TZBA 2FCRA 1QR2A 3NHJA 1JA1A 1FTGA 1RCFA 3W79A 4H2DA 5ULLA 2X2OA 2XODA 1I1OA 3OWXA 4J8PA 4C0WA 4ZVMA 1ZX1A 2Z9BA 3QE2A 5NLLA 3NHKA 4LA4A 1FLDA 1QBGA 1RLIA 4BMPB 3NHYA 3NHRA 1YKGA 2BPOA 4QOEA 3JSXA 1YOBA 1J9ZA 4GQIA 4NULA 4XDGA 5B3KA 1AMOA 2Z98A 3OVMA 1CZHA 2OHIA 4QOHA 5LLDA 1H69A 2OYSA 3NHFA 3OX1A 1TIKA 3LT5A 4U7FA 3KLBA 1YCFA 2N1MA 3RPEA 1AKUA 3K20A 5B3LA 4XDHA 1D4AA 3U7RA 4GR9A 1AKWA 2BF4A 2V5VA 2WC1A 3KAPA 5LJIA 4HS4A 3GFRA 3F6RA 2HPVA 1JA0A 2R96A 4N9QA 4LAFA 2R97A 1AG9A 3U7IA 4CF6A 1VMEA 3B6JA 2QX9A 3W77A 3NHLA 3KAQA 1NNI1 2OHJA 2FAXA 2B3DA 3F2VA 1D03A 4YAWA 2Q62A 3ESYA 3R6WA 2RG1A 5TGZA 3NLLA 4ICIA 2QR2A 3LCMA 2FLVA 2FVXA 4U7HA 3O73A 2QX4A 1AKQA 1SQSA 2X2PA 3ESXA 3EYWA 3HLYA 3QFRA 5NULA 4C0XA 4LTDA 1YRHA 5LBUA 2QWXA 3N39C 2FOXA 3G5MA 2KLBA 1V4BA 4QOIA 4S24A 5LMCA 3FNIA 3F90A 3TE7A 3N3BC 1OBOA 2V5UA 1ZWKA 1DX9A 3L9WA 4Y9UA 3TEMA 1J9EA 2ZKIA 2Q9UA 3D7NA 2QX8A 4ZVLA 3O2NA 4C14A 1AZLA 1T5BA 1XYVA 2A5LA 1CZNA 1YDGA 4FGJA 1KBOA 5FA6A 1YCGA 2XOEA 4YALA 4LTMA 5EAIA 4DILA 1E5DA 4PTZA 2ARKA 2FX2A 2MT9A 3FJOA 1AKVA 2MOKA 2FZVA 4QODA 5EA2A 1X77A 3B6MA 2KQUA 1FX1A 4YAUA 1AKTA 1BU5A 3W7AA 4HEQA 5EMNA 4BMOB 1CZRA 3N3AC 5F51A 4D02A 3NHSA 4QOGA 1J9GA 1CZLA 4U7GA 1XI2A 3KEGA 1H66A 2BZSA 4N82A 4DIKA 5A4KA 5LJLA 4ZVKA 1B1CA 3HR4A 5F4BA 1WSWA 2AMJA 3ZHOA 2BN4A 2D5IA 3FX2A 4LTNA 1T0IA 2W5UA 1YCHA 1OBVA 1QHEA 3HA2A 1OFVA 3NHUA 2FZ5A 3ES9A 3OX3A 1GG5A 1RTTA 4R81A 4ZVNA 1FVXA 5LBTA 2BMVA 1XYYA 2MTBA
chains in the Genus database with same CATH superfamily
5K1ZA 3FHOA 2PGXA 3OTWA 4YB8A 3MT9A 2OV1A 3NXKA 4IIYA 4D8WA 2FNAA 1TVEA 1AM4D 3GLIE 2RHOA 5AOVA 1YZHA 3PUHA 2RK6A 3QVVA 1SOWA 1U9IA 3OZWA 1EIZA 4Q7EA 1IUNA 1PZXA 2CGEA 1T6XA 2NADA 2YC4C 4QRDA 4CMHA 2OV3A 3LL7A 1FS5A 3R3YA 4LVCA 4QWWA 2Y1OA 3KKLA 1KU6A 2ATEA 4MUGA 1P4JA 2AA3A 1ND6A 1HT2E 2J0UA 1XEAA 4WBXC 3ET5A 4WK4B 2WWRA 3WLJA 2WB2A 3GG2A 3EVGA 1JEQA 4GF5A 3JQ9A 3PZBA 4AURA 2F2TA 4FR5A 3G17A 4BV9A 5D3QA 4HAXA 4U63A 5EWMA 3CLKA 2DR2A 1GTG1 2PUCA 3T9AA 3K1AB 4BYGA 3HN6A 4CQMA 3DL0A 4C76A 4CKWB 3TM4A 2O7NA 1T6NA 1DXQA 4BN5A 2HEIA 2OGZA 2VNAA 2I6TA 1JIQA 4KFRA 1SCUA 5IJ9A 4IS2A 3UXYA 2BFPA 1M8KA 4N0DA 2GK6A 4P3XA 1YZ3A 2AF3C 2CXPA 4IJQA 5LWHA 1KIMA 3U7FB 1P0MA 1BNCA 2FN9A 1IPHA 4OIMA 3AJEA 2W6IA 3DM9B 1JI0A 3DVAA 2QZZA 3ABRB 4F2HA 4YR7A 1PUXA 1F2VA 3I1YA 3GPCA 1OF1A 2WIFA 3N86A 3RVRA 2ZBVA 3UO8B 4P4NA 1Y3IA 3HJUA 4LY0A 5AJHA 3EXIB 1X87A 2I7XA 3OCZA 4M88A 2Z6AA 4GS5A 1OXSC 2DLCX 3FOEC 5LZ5A 4FCCA 3HZZA 3OPYA 1U3CA 3BMOA 4AY6A 4PYOA 1E4EB 2I2BA 2DLNA 2Q99A 3PUXA 4JROA 3PPWA 2ECQA 1I8TA 3IQFA 4XLZA 1EK2A 3HC7A 3D1VA 4MWSA 4X94A 2R6R1 3E9DA 1NQXA 2CFTA 3W3ZB 4GWKA 1IWOA 3BAFA 1O6BA 5D00A 3HWSA 1J97A 3QBJA 2ZUCA 3MRSA 5AVXA 1MT3A 1VPVA 3AHGA 3ZY2A 2FOLA 3M2TA 2RFLA 2VZ8A 3KB8A 2KB0A 2NXCA 3HJRA 2W8BB 4NR0A 1ZVVA 5E6RA 4H77A 1Q12A 3RUCA 2QLNA 2M98A 4F2PA 4LXIA 1YRYE 1A7AA 1JUDA 5HIJA 4GNRA 2VSQA 1XLTC 3NDJA 3UGTA 3GELA 1T9AA 2RHDA 3K0FB 3VMFA 1E5DA 1PUIA 2JZCA 5IC5A 4TVBA 3N0VA 2XQGA 1K9VF 3LT1A 1AKTA 5JE8A 1KWGA 4OI1A 1O0SA 1LQTA 2A5FA 2QRVA 3U4GA 3VAAA 4DWVA 2GEUA 3WFZA 2ZJ2A 3LUGA 4H7PA 1LW6E 4CIVA 3K32A 4MUHA 2FEKA 3P97A 1OI4A 3Q9LA 3O8BA 4E21A 5JNLA 4LXYA 1QYRA 2BC9A 4R05A 2H63A 3A1VA 1W4LA 3ESAA 3RC1A 3V6LA 1W5AA 1ZSYA 3D3JA 1ISSA 3JPWA 4BLSA 3C3JA 2OORA 2AFIE 3MJ4A 5AUOB 1XZQA 3FHCB 4RPGA 3SEZA 4NPHA 1ESEA 4P3KA 3B6KA 3C3EA 4ZI7F 1E3QA 1ZL2A 3EARA 4MQMA 4OB6A 3H5IA 3IULA 5LKAA 1U1GA 1MX3A 1Z6TA 3NVMB 5ALYA 4HADA 3TNLA 2HRDA 1KQNA 1NTOA 4MQLA 1QRSA 2FMFA 4X62B 4AN0A 1YT5A 2CXOA 4N49A 4ZAWA 4RACA 3DAPA 1H0KA 3SYTA 3R8FA 1I2AA 2WOOA 2X8AA 4DCVA 4TKUA 4DMLA 3IIMA 5JTTA 4WH0A 1B6SA 1NZFA 1XVVA 1KZ9A 4MW6A 1U7TA 3IGFA 4LOKA 3B85A 4N3CA 3Q7RA 1OLSA 2NW6A 2YTZA 3AEKB 1ORRA 3OO1A 4U2KA 3RBXA 3I53A 5HTKA 3EMKA 4DR3B 2J3MA 3CJQA 3EXEB 5ISMA 3WL4A 1Q3KA 1DO2A 1I9CA 2PZFA 2PWZA 3CLTD 2Z9CA 5AH0A 3DLHA 1QF6A 3C48A 2PWPA 4EHAA 1XAJA 3OMXA 1EH5A 1PT8A 2DHCA 2JIRA 5AUQA 2H1OA 2J0UB 2ZWVA 3AIOA 3AV0B 4ZVMA 1GTRA 3WZ2A 1KOGA 2Q3BA 1WVMA 1TAUA 3HJNA 5BV8A 3LKDA 1LJUA 1O08A 1Y37A 2PUVA 3JD2A 2WAOA 2P9HA 2PXAA 1W34A 3FHJA 4XDGA 2F59A 3MAJA 1MMFB 4UOEA 3W1EA 2HREA 3HB7A 1V71A 3KELA 3E27A 3C3WA 2HMTA 1WE2A 2BF4A 3WL6A 2BEJA 1DO8A 4BV8A 2VF7A 4P6VF 2CBZA 2WF8A 5KTSA 3HXMA 3FPBA 1FQKA 2EF0A 1IU9A 1P3JA 2YV2A 3EC7A 5LQSA 4L15A 4RULA 1PFKA 2J5BA 3BA6A 1C30A 3NEAA 2H0AA 4NJMB 4TMVA 3U3XA 4F21A 5C5DA 3WB1A 5HQTA 1E7SA 3DVAB 4JJGA 2LXNA 1KGSA 4DSTA 5JU6A 1JQJC 4NV3A 1EVYA 4HLUC 4XJSA 4MUEA 1QYXA 4BGDA 1BIFA 4JB8A 3MWDA 4HR7A 2PUBA 2NTYC 1N6OA 2Q4OA 3GGSA 4V2UA 1D8TA 3OCCA 4R2IA 5IMSA 1WHTB 1NPTO 3TXXA 4AG3A 4CKBB 3TNDA 3VPFA 2JLSA 5DIFA 4Z0PA 1NQUA 3EEFA 1R8JA 2QW0X 5FBRB 4DMFA 3HSKA 3HG7A 1L1EA 3OQVA 4KV7A 4AUKA 2VPPA 4ASUD 1W36B 3FTQA 1MKYA 4URUR 5ARBA 2E4YA 3TECE 1RM0A 2DHQA 2OCBA 4C4RA 5JZ9A 1GG2A 4DIFA 1HC7A 3OIUA 1MP0A 2W6QA 3KOXA 2OKCA 2ZI5A 3TZCA 1QHYA 2FZLA 4ZI7B 1OYWA 2I1WA 1PNVA 2OK8A 4ENSA 1V9CA 2IK8A 3FCAA 5D6OA 7ADHA 3MCAA 3SXPA 4G65A 4D9MA 4YS6A 4ZVKA 4R1MA 1WBJB 3U7QA 2DJ5A 1Q0LA 2WWHA 1MJGA 3PJRA 1J7JA 4KZKA 4MYUA 1W30A 1GEGA 2P27A 2C42A 1T36B 1NVWQ 2OCLA 5FHRA 3E9QA 1D9XA 4U00A 2OGUA 3B51X 3GEHA 4FYIA 1Q0ZA 1Z34A 4RD3A 6NULA 5EZ6B 1EDEA 4DR7B 5ENDA 1E1CA 4ND7A 1QKIA 2X0RA 4Q4LA 4PFJA 1UOQA 4RIGA 2X0IA 3VVCA 3WGHA 1Y3FE 4DQXA 5IG2A 2I6XA 1Z0FA 1KFKB 2W2LA 4JKIA 4BRUA 4D96A 2PUGA 4X8OA 1ODIA 1BJRE 5JV5A 2ZSIA 2B94A 4EH1A 1UXIA 2JS7A 1EUYA 1T5TA 1F3OA 5LC1A 3DUFA 1QQAA 1T2FA 4TYPA 5F2EA 1KC3A 2DCUA 4HAWA 1UKYA 2R68A 1WXFA 4OHOA 4FTWA 4GX2A 1XRJA 3RSZA 3ER8A 1F9EA 3NATA 4ILKA 5E4JA 2Y0DA 1XNGA 3FA2A 1F4VA 2OBFA 1NI4A 1XP8A 3HA7A 3I72A 3IIKA 2DERA 5DNVA 4HAVA 3IA7A 3N2KA 3OT4A 2SCUA 3PHLA 5EKUA 3O75A 3RT7A 3Q3VA 3NNSA 1TOAA 4LSWA 4MP6A 3WYFA 2Y0CA 3M6MD 3MNFA 1NBOA 2J87A 3FIUA 5I7UA 2R5WA 4H0FA 4RLHA 3VUFA 1BGVA 1YACA 1CNEA 2W2NA 3SFTA 3IHLA 4BTEA 4TVKA 2R79A 1DJMA 2G5PA 3KAKA 1VRCA 3WK7A 1W9HA 1OA1A 4V0LA 4LVUA 1F3LA 2HIMA 3RVSA 7YASA 2H8KA 2JGRA 3KKNA 1AH2A 4YRBA 1GSAA 1PWEA 3STXA 2RGRA 1RWOA 1RQGA 1OU4A 2QMUA 4BE7B 1SKQA 2AG0A 4DR2B 2J0SA 2I4RA 1Z74A 3D5TA 5TPWA 3ELUA 1YASA 1K8XB 4GICA 4ZQIA 1X86B 3M4YA 2UAGA 4KO2S 4Z3DA 3UN1A 4DABA 2AH5A 4ECEA 1GLGA 3HXTA 1JHUA 1ZM7A 2R8ZA 2O7SA 3E8MA 1KYWA 4M53A 4PXSA 3UH1A 2W11A 4B40A 1W7AA 5K8TA 4F4UA 1AKQA 2NO1A 2NAFA 4HGOA 3IJPA 2PLNA 1COZA 1NN5A 4J0QA 3QLTA 1NOJA 3M6VA 1AK9A 2PMDA 4P5PA 2MSLA 4FKBA 5ARCA 4BO5A 4L5JA 1AA6A 3NDBB 3TE7A 1NW3A 4MLCA 1I0ZA 1DSSG 1KETA 3DC2A 4MW1A 4BNXA 5KSWB 1NLFA 2Y4OA 3CZQA 1ODJA 4OQEA 1MC4A 2F8SA 3LTNC 5JS1A 2OHXA 1T8SA 1DIOB 1TYCA 4TMWA 5EZSA 5KIAA 1CUZA 3ZW9A 3F5MA 4L5IA 2QZSA 3L6CA 4L07A 4KXQA 4L76A 1XNRB 1BW9B 1OCEA 1ULBA 2E4XA 2D06A 2YJ6A 3DWIA 3PXUA 1MNQA 3R9KA 2R84A 3E9NA 2FN3A 3ZE2B 5B1YA 5L4NA 1CJMA 3K71B 4W5TA 2VP3A 1G21A 1SA0B 1UK6A 3PWSA 1MNAA 3D3EA 3EWIA 4LOAA 3EVBA 2QP3A 1DC4A 1NDUA 2NGRA 4BJ5A 1Z7BA 2DPLA 3U2QA 1VECA 4OBEA 3VYTB 3GLHB 5FA5A 5I6DA 1A8PA 2A7XA 4ALMA 3ZHSA 2JLBA 3O8LA 4P81A 3DW1X 3DFKA 5FLYA 1H42A 3ZYCA 3JD0A 4HDSA 2C00A 5DYTA 5EPUA 1U4OA 4ERXA 3MWEA 3TJRA 2AYXA 3HDYA 5K7SA 1TEXA 1J1IA 4G81A 3BKWA 3I5YA 4DQDA 1GR0A 5KTTA 2YN4A 2XT6A 4LY6A 5CLLA 3U9SA 4FIDA 5A6SB 5FUBA 3LX8A 3WHIA 2ZCVA 4MPTA 2J9GA 2F1OA 1W25A 3DNPA 2APJA 5A9RA 3JAKA 4QJIA 1PF7E 4BX0A 2Y99A 5U9CA 3G49A 1F4PA 1SHZA 3GFGA 3M9XA 4JP8A 3CE6A 1RFGE 5E7JA 3IQIX 1CUHA 3TI9A 2GYYA 3T95A 4C29A 1BD3A 1NMEA 2FGKA 2NM0A 2IXDA 2R1VB 4JVOA 2AZMA 3WNCA 3TVYA 4CLHA 2GN9A 1RJDA 3GFPA 3K0EA 2FUG6 1QHXA 1LWNA 4XTCS 4MIOA 4Y2XA 4J0KA 3TQQA 4UFPA 3T34A 5JZSA 2EKBA 4RHXA 1J9ZA 1ZN9A 4KAJA 4TS3A 4XWAA 1CY1A 3BTVA 3ROGA 4A8HA 4DHEA 5C8ZA 3RYHB 5AVWA 4AXXA 3IRUA 1ZINA 1C30B 1LEHA 1ODKA 5TT1A 3W2GA 4ABYA 3D3WB 4XB6B 1QTIA 4BO4A 2FP3A 5BSUA 2FN8A 1XCJA 5ALIA 5CNIA 3SOZA 3FYUB 1AKWA 3ZWQA 5HRCA 1M66A 2GHRA 3LPMA 1B0PA 1QRTA 1RLMA 2C82A 2E1RA 2YY7A 1JG1A 4LAFA 5AVKA 1JHVA 3U0BA 3ZI4A 4XB1A 5FUMA 2E21A 4CU2A 2PX0A 2QGZA 1FC0A 2UZ1B 5E7MA 3UMBA 3BG5A 4YECA 1WHTA 4HSGA 4CKBA 3T54A 2DWOA 1NUUA 3NLLA 1RPAA 3QLVC 1E8MA 4L8LA 4MROA 4BVFA 3HFGA 1XTQA 4NL4H 2P4EA 5J2TF 2GS9A 5KQGA 2D1TA 5EHGA 5EIOA 3U61B 1GSIA 5EMHA 5HJ7A 4EF5A 1V2GA 1VYVA 3AF3A 5KYGA 4RE6A 3GPLA 2ZGVA 1FFXA 1C1YA 3T3HA 1AF4A 1G4HA 4OMFG 3CUEF 4H3KB 5JMOA 2GAOA 2V4MA 4PPFA 3AFHA 4G9EA 5ES4B 4AY2A 2R8OA 1E1NA 4MJLA 1KAOA 1A8HA 3GI1A 4REOA 5ALLA 4G3XA 1YRWA 1E1RA 3A9CA 3GDHA 3IKJA 1T36A 4JGIA 1T4CB 2BV3A 4XIJA 2NQ8A 3TLGB 4CDGA 4RSHA 3AJ8A 3WTCA 2RE8A 3GWZA 3I42A 1EXMA 5B64A 4M9XA 1A8UA 2FF7A 3OJOA 4MIYA 4DDHA 4KXXA 1A72A 2X41A 3IEVA 2WG2A 1FRZA 5KNCD 2GERA 1OROA 1DQPA 1MW9X 2QIOA 3X1DA 1H9AA 2QEQA 4Z51A 3R7FA 2XGMA 3DCNA 3TIVA 1IONA 1SJ9A 3TYXA 1J2YA 2A9VA 1YZLA 1BMTA 1OBVA 3E3MA 3QRWA 4REMA 4W9RA 3FJYA 2J8ZA 2WTUA 4FHDA 2R8EA 1XUOA 4JSRA 1QRDA 4HYYA 4P93A 1EUQA 1CJKC 2LCQA 2D6FA 4NU5A 1H65A 2WF7A 3C6QA 3H9EO 3IMKA 3KD3A 4AD8A 3WGIA 1FNSA 5JOQA 1EJ2A 1ZESA 2GJSA 2JJ1A 4MYRA 2GRUA 1AE1A 1XX6A 3MIIA 2W2VA 2QXYA 3BH7A 5JS6A 4HH3C 2VUSA 1N4DA 1NA5A 4ZI2A 1WHSA 4MI1A 4BDSA 1KH2A 4BX9A 2QBYB 3HDJA 4P3OA 4WACA 4OAPA 1NG9A 2YZ2A 2HN9A 5EP3A 4V0RA 2O07A 2VZEA 3C5HA 2ZTVA 1LC3A 1YBMA 2GZHA 3JV7A 5DCUA 1BZYA 5DV9A 3BC1A 1MDFA 1TU3A 4Z4GA 2XCUA 3H9QA 4KMRA 5CXXA 1DCFA 1NR5A 3OQ6A 1A1SA 4L4SA 1T34A 3IP7A 4R1PA 1K75A 3JATA 3DE0X 3L0PA 4PG5A 2O8VA 4MYTA 3COZA 3P94A 4Q9JA 3U4QB 1YZFA 1N2HA 4C3ZA 5KZMB 3FCEA 4R31A 3W79A 1XCLA 3YASA 5I7RA 1FX0A 1RJEA 2FGJA 1K27A 2WZBA 3KK0A 5G1OA 4PQEA 4D80A 1IH8A 4XJXA 4M0MA 4DDVA 5I9BA 3RWBA 1J70A 1WRBA 5HDQA 1R4NA 2Z6UA 3B60A 1Q22A 3MEQA 2A2ZA 3W3AD 4B7UA 5LZ2A 2NO5A 3BFPA 1D3AA 2Q4RA 2REOA 1B8OA 4M86A 1EI9A 1IB0A 4FXPA 4PLWA 4F5YA 3ZGOA 1KHHA 4I66A 4R6XA 5REQA 2EFCB 3AXSA 4JMLA 3RKSA 5A0VA 4PG8A 1NATA 1UJ2A 2V59A 3BDAA 1TYDE 3ACCA 4EX6A 3W9BA 4WD3A 4DIOA 1IIRA 2P41A 3DMRA 5JLJA 3WIUA 3ZY3A 4QATA 4F1KA 2OA0A 2I80A 3L49A 4F2GA 3CRMA 1NLMA 5GIPE 1ZRHA 1CX9B 3MGGA 3DMTA 1DT3A 2ZAYA 3L4SO 3LQYA 4D8XA 3K1ZA 2X2PA 4HVCA 4MUYA 2XOKD 1U1EA 2A94A 2RCNA 3F96A 5DNDA 2AC2A 4EI7A 4MWZA 1NJFA 3T3DA 1E1MA 3KR0A 3WJ7A 1FRFS 4LDZA 2JH9A 2WPDA 1TX4B 1MW8X 2D00A 4HXGA 3THSA 4LYEA 2Z5FA 5BWNA 4V38A 1OXXK 3KWLA 3WWEA 4JI2B 2FR0A 1JZQA 4FR0A 4ZQGA 3WGVA 1J1UA 1VCMA 2WYHA 1PS8A 4RIFA 5EHIA 3WGLA 1W5BA 2OOSA 5AI9A 1OC2A 4YJ3B 4RSRA 2PKWA 2I78A 1S3IA 1I3OA 1KF0A 2RGWA 3N53A 4CUKA 3RSFA 1UPXA 1X77A 2QIPA 1ZISA 1MAUA 3UBTA 4LYHA 3EPRA 5EE3A 4F0JA 1XWIA 1XJWA 3L8CA 1DBRA 1WG8A 1VE7A 1K6EA 3M9LA 2H06A 4NBWA 4WFQA 1SPBS 1U7OA 3ZQ4A 4NG5A 1HE1C 1US8B 2B30A 4LDPA 7REQA 1RJ9B 1HTWA 4CG2A 2JJ2A 1XVLA 4GIBA 1WA5A 3LC2O 4BV3A 3FCOA 4C4SA 2BBTA 3PCRB 5FI0B 4DCNA 1QGUB 1TZ2A 3TW8B 4WWHA 2O23A 5KSOA 4NEGA 1X7DA 3HA2A 1BKDR 1UAYA 1I3NA 1WP9A 3I2HA 3VNBA 4K8OA 3MG9A 1FP6A 5C8YB 3T99A 1W0JD 1E9EA 2HIHA 2EFEB 3TSOA 1ENOA 4A8JC 1G5PA 4U8HA 3DMPA 3PDIA 5LU9A 2CHQA 2JGNA 3D6HA 4GBGA 4Q1DA 1CIVA 2FP4A 4YAOA 8ATCA 4RX1A 4NDZA 2Y93A 1K7XB 5KNDD 1IOLA 4HNHA 1R12A 2OGSA 5AVQA 2NV0A 1N2XA 2HBZA 1SCAA 3BD8A 2O2HA 4G5XA 5F3DA 3T0FA 3SU8A 3WLLA 1KJJA 5CCDA 2G9NA 4KPFC 3RT1A 1RXYA 1JYEA 2ESRA 3CR3C 4LJSA 4DAOA 5CD9A 4EHDA 2COKA 1OY1A 3SIRA 1ITZA 4CETA 3M6IA 4LV6A 1T1JA 3GUUA 1E1LA 1C14A 1KPIA 3ZXYA 5DYGA 1CUDA 5JVDB 1Z5VA 1BEZA 3AU8A 3IC5A 3OCXA 1EUDA 4RTOA 5F4ZA 4KHPB 1V37A 5BR8B 2OBMA 3HPQA 4BNWA 3AOEC 3IVXA 1SUWA 3UGQA 4D1YA 3MJCA 3AETB 1Z6PA 3UYLA 2HAEA 1BEEA 1CUFA 2H7CA 2HRCA 4M76B 5AK6A 3PSAA 3U6BA 1G9XA 1ADFA 1EFVA 1V7QA 5J5CA 4IRMA 3T4XA 1Z39A 3H9GA 1GUAA 1MAVA 3WYAA 1KFEB 4PVDA 1NDHA 2QSJA 2O9JA 3OE4A 1A50B 2NU6A 3Q6NA 3BM5A 4WECA 4TZ0A 2EX1A 4TWZA 3OQBA 1WZ2A 2VJYA 4FQ7A 1QX4A 1RQ7A 2D62A 4RY0A 1WUTA 2CEAA 2HA2A 3JAWB 1OYYA 1IXZA 3FR8A 1YNSA 1KJIA 1JA0A 1UP7A 4GE3A 1N6NA 4C4XA 3Q87B 3Q2IA 3SQXA 1UM8A 3O4VA 4MR8B 3EZXA 3S2ZA 1OAOA 2RAUA 2YS7A 3KYDA 4M46A 4WSOA 3DMNA 3IKTA 1CEYA 1FMJA 1YA8A 2QR2A 3EYWA 1SQSA 3DEYX 4F96A 4P35A 2CY0A 5B3JC 2IHTA 1P1IA 2OHVA 4JXKA 1MJGM 2PWBA 2RGGA 3G8YA 3AIIA 5AM3A 3JRWA 3N2KB 4JU8A 1YFJA 2FQQA 4KGDA 1ZBQA 2JFPA 5CVVA 1KVUA 4CBVA 2XHZA 1DKOA 2QL5A 4BJ6A 2G17A 4HUTA 4Z7OB 1M83A 1ZUWA 1SCQA 1V5FA 3O0TA 1NF8A 4TYNA 2Q9UA 3HEMA 4YMIA 4Z5XA 5K3SA 2O59A 1FW8A 5H3CA 2WTBA 2GZRA 2BGNA 3PXXA 4OQMA 3RWMB 2PV0A 1XMJA 4TXJA 3RB8A 1KARA 5JAMA 3LP5A 5GPBA 3AKDA 4BPRA 1NVVQ 3GQBB 3R7SA 1Z5NA 1WCWA 3ZZ1A 1IPEA 3FRJA 4UCXA 3C87A 2FZ4A 3M70A 3WMRA 5BQOA 2IELA 4FHFA 4AWBA 1K4KA 4U5XA 4WY8A 3VVLA 4A92A 1EWTA 1GGJA 1T2UA 1VL0A 3AYZB 4QFMA 5A05A 4WLEA 5L4SA 1V0JA 5G41A 4C88A 2H29A 4OQQA 2GNAA 4CM4B 2VPWA 3OLYA 1GNPA 2C3PA 1ADGA 1XZEA 4J0HA 2GLUA 2O7VA 3FSGA 3QJ5A 4G4SO 4D8YA 2PSEA 1W76A 3PD7A 5ITWA 3AI1A 4URZR 1A7KA 1J8FA 3QLJA 4IG4A 2WW8A 1PLLA 4AZVA 4DMMA 2P9QA 3FSJX 3PGKA 1M2KA 3LWBA 3PJDA 2OWDA 4Q1VA 4QSMA 4R54A 5FEMA 3SLKA 3UAVA 5BVGB 5TC4A 3RK4A 4IWXA 3MQ2A 2DR0A 3QKRB 4KFTA 1MB9A 3HU1A 1Z45A 2IY8A 2IHKA 1NMQA 2MINA 3BICA 5K4AA 1R5JA 2DY0A 2J5XA 2VAPA 3KWJA 3PUIA 5CYFA 3ZDAA 1AKMA 4RKEA 4YRLA 3L8HA 2G4LA 3PJGA 3U3DA 4JEHA 4OKIA 1UPUA 3IUEA 3MTEA 3WWCA 4F9EA 3RS7A 3OX2A 1X7ZB 1BE1A 3CZPA 2E7ZA 1BGXT 5K4HA 4DV2B 1RRVA 4W7IA 1JFFB 2WICA 2HJGA 1CERA 5AJUA 2AJCA 5EWJA 3OG9A 3OT1B 3UOGA 2LGJA 4P0PB 1T4DA 1VM6A 5FYQA 3PFCA 2HMUA 4EL5A 2FYTA 1VDZA 2HO5A 1VIDA 2D0PB 3GRKA 1RP1A 5DF1A 3RS5A 1EFCA 4OP3A 3IHKA 5DMHA 1F5NA 4L8VA 3ROQA 3ZKWB 3GAFA 4RC9A 3U9TA 5C1OA 1R16A 1AMNA 1WIWA 4AIRA 2QI9F 2CXRA 1RWWA 3L0CA 2QD4A 5I8PA 1O9HA 2FRXA 5J2UA 5B3LA 1M7BA 4NRDA 1QYDA 3P9QA 1UJCA 4KSYA 4EBFA 3RAJA 1KI3A 3D59A 3CH4B 3TD6A 2VP4A 1ID1A 2C4KA 5TE9A 3B70A 3HJAA 4K6KA 4UAJA 1GCGA 2NV6A 3M4ZA 4E1VA 2YRWA 3T12A 3HR7A 4DNQA 1CJBA 3DAGA 3LDHA 2AUTA 3EVCA 3F9RA 2CLDX 5HMLA 3R0VA 4B79A 3ZDRA 1JSRA 2F9LA 3L7OA 4TL8A 3QEOA 3SC2A 2IH4A 2QWXA 5LMZA 3DLIA 5AYVA 3E0XA 1M2NA 4YCNA 4A0SA 2XQJA 2PFGA 3TGWA 2H92A 3PHHA 1PSWA 3BDIA 3KSRA 2PGAA 4COOA 2OWEA 3CCBA 1RRPA 4BQNA 4OQ4A 1VJ0A 3Q9UA 1PZGA 3BMXA 4FHEA 1O9GA 2XRFA 1AKYA 2HLNA 3EWAA 1T24A 5TDHA 2YHIB 4Z7NB 4FBMA 4RPLA 3Q8KA 4YJ2F 4AJPA 4U0KA 3BHMA 3RR2A 2QE6A 1HH4A 1ORWA 3C43A 2QD5A 2UZIR 3KDSE 3WG9A 3IP3A 4EECA 2JF0A 3ANXA 4M54A 1JU4A 1NQTA 1B0UA 4AZTA 3OM1A 3RABA 4RLFA 2VBGA 4TMZA 4Y2SA 2JIOA 5CIYA 4HDMA 4Q12A 1QNLA 5KOYA 4INZA 2PD3A 4KI7A 4EB6B 2ODNA 2YX1A 2GHTA 5FPQA 3UHAA 5LOVB 1P7ZA 5CA1A 4U7WA 4B9EA 2O8BA 1ZA1A 4A6EA 4B4VA 7MDHA 1W44A 2ZRMA 3E8SA 4TTQA 1ZONA 3JATB 4RY8A 4E4YA 2D1YA 1ZM3A 2HA4A 1ZXBA 2J6IA 3I0ZA 1UMKA 4A5SA 3N1UA 2QZJA 1A71A 1E77A 1DJPA 1LPBB 2PJRA 1K2WA 2Q5IA 2QNIA 3WISA 4FS3A 3CURA 3WAJA 2J07A 1V5GA 1UFVA 4IJMA 5G4KB 2QKYA 1MC8A 3HB4X 2W90A 2BAGA 3RADC 1RJGA 1DMRA 1T5IA 1RCUA 4X0EA 5B1SA 3MWKA 1U1FA 3B20A 3G88A 1K8QA 3OU7A 5FOTA 5H1YA 5TGDA 1ULTA 3EVNA 4TRJA 2HTFA 4ZQFA 4IIHA 1SBNE 4CM1A 1PEYA 4M0EA 4ZHQB 4UU0A 4B7ZA 1DQNA 1WX1A 5HJ2A 3U44A 1RE1A 1SZDA 3S2UA 2JJYA 1RAAA 2C5SA 2PA3A 3WBFA 5JCJD 5J5VA 1NBEA 3ZTTA 2O1XA 2XCQA 1ZUNA 4MGEA 4DMGA 4NCBA 4N01A 2O2IA 1FMTA 4OB8A 3JQAA 2VDOB 5DX1A 2DC1A 5GZ6A 1OGIA 1PYDA 2YHAA 3GPDG 4IH9A 5E9WA 3S5JA 3IBTA 1MHTA 1ORHA 4BY9E 1E3DA 4KPYA 2PZLA 1XTBA 2WILA 1ZGBA 1PZFA 3IP8A 1L1FA 1F0NA 2DFPA 1YR9A 4L2IA 1K0UA 4GMGA 5FD8A 2IKSA 4IZHA 1K8YB 1KYXA 3QVWA 2A86A 3OD1A 4RL4A 2X4LA 1XPJA 4YRJA 3EIFA 1RNLA 3FN4A 4YACA 1ZC3A 4MLZA 4FUQA 3QYFA 3SC4A 3CZRA 1Q44A 4EA7A 1HFWA 3AEUB 1JQKA 2FPIB 1G7RA 1TEHA 4IHQA 4YJGA 3M6XA 1XHEA 3A6ZA 1JHDA 3ELDA 3EQ7A 2ATVA 3Q7QA 3R0XA 5KAMA 3QPUA 4BO0A 4PLZA 5SZJA 4WQMA 4ZAXA 4C0XA 1NXOA 5CJPA 3QSYA 1BHO1 3MQFA 4PRKA 4PW0A 4TTIA 5BOVA 4KREA 1PX0A 5F1YA 4B35A 2JD2A 1FDTA 2XNDA 3FFAA 1XRQA 1G8PA 4S24A 3GGPA 2QVCA 4W1SA 2H2IA 4F9TA 2NYAA 5KOHB 5BPFA 3CG4A 1A5ZA 1KRXA 1W2HA 3TE6A 5G1PA 1LQ2A 3ETJA 4IO0A 2CNKA 3GG9A 2OCXA 1LLCA 3KUUA 1W93A 2IPNA 1NW6A 3M3DA 3OEYA 3V4LA 3ZWDA 4B6EA 1AO0A 4D4IA 3ZWKA 3C8ZA 1QO0D 1VHTA 1VQ1A 3GJSA 3WWDA 5BWCA 5EIXA 4UHFA 1X80B 5H9WA 2HW8A 4MVJE 4FK8A 2R60A 3EIXA 3R40A 1JSCA 5TF0A 2HCJB 3IT3A 1HXHA 2DR3A 3CCFA 1BCRA 2XUAA 4EKIA 4KL8S 1EYZA 2WFAA 1UT6A 1VSVA 5CA0B 4JLAA 2OFFA 4N82A 5K0ZA 3EIQA 4X7MA 5CYPA 2I87A 1OR8A 5E3HA 3DHNA 2ZZMA 2Q9BA 3LUCA 1PUJA 2V6IA 2IITA 2XB9A 2XOKA 3L6EA 1GNVA 3GT4A 1QRRA 4OSPA 4TVSA 3LQ1A 4W5OA 3VSBA 4FDUA 5CGZA 4BZQA 2WD7A 1KJQA 3MQ4A 3E5RA 2ZRAA 4I5DA 1RQXA 1CVLA 3F6SA 4QNRA 3WY9A 4O25A 2QUKA 6PFKA 1NIJA 1E79D 3KKMA 1GILA 5BUQA 3NPMA 1UBRS 3HUDA 3HU3A 5EJ7A 3HK2A 4NOJA 5EPEA 1AGXA 1KIAA 2B9EA 3A3OA 1M2WA 2HJSA 3OZDA 1G21E 2AJDA 3FLBA 2QYHA 2VXOA 3GZNB 2FZCA 1JPUA 3SVLA 2OCPA 1IOVA 1BDJA 1VCIA 4DKXA 5ADHA 2QRMA 3D8UA 4NU6A 3T7TA 3OTHA 4C89A 1ECPA 1M76A 5BUSA 1OHHD 2I3AA 2J6HA 5FV4A 4CLDA 4KQCA 2ZKLA 4MICA 1PWYE 1Z18A 3FVTA 4HGQA 5ILQA 5F3WB 2O5VA 4D5EA 2M32A 3VJLA 3IBGA 5F7JA 4DDKA 2AOXA 1B2LA 3AIMA 1D5WA 2OORC 4RWZA 4ZCPA 2VH1A 5ALPA 1G3RA 2W8ZA 5JJLA 2H2HA 1XYGA 4GMKA 3ICQB 4UE6A 1WJGA 3SYNA 2H48A 3CX6A 1CZHA 5IYZB 5EFOA 3SQOA 1LVHA 1NFFA 1QQ6A 2Q9AA 4UM7A 1JQ5A 1M6HA 1UKAA 1USGA 2FEXA 2Y92A 5COQA 4EKGA 1XAIA 2LKDA 1TPZA 3DULA 1TTHA 3EG9A 1IEWA 2A92A 2HK9A 2WNHA 1A88A 1AG9A 4X8LA 1FCJA 1UEJA 4K86A 1IEVA 3G6WA 5TGTA 2JKYA 5LIRA 3R9XB 5FOUA 2ZJ8A 4Y6PA 3AGPA 3GIDA 4OKNA 4E2ZA 4XOUA 1BQEA 1W88A 2XBUA 5LKRA 2GPJA 1KJ8A 4R41A 1U8TA 1UBOS 3ECCA 3EF0A 3M5DA 4JLNA 4JZKA 2GZDA 3DGFC 5DVZA 2JLUA 4IQ0A 3A10A 4FOOA 3GUVA 1GPWB 2C1ZA 5JWOA 3NC1C 4QLBA 5T6MA 2XXAA 1ZU5A 1DBVO 1DUVG 2YY6A 3KZKA 1OGJA 1ZOSA 3PYXA 5D85A 5CPBA 3IPLA 2NVUB 5EUBA 2UUCB 4W4TA 1WB6A 1L7XA 5HYVA 1M1YE 2FPIA 4YJGB 1U0NA 3ZTWA 4TYMA 5FA6A 2V03A 3GFTA 4QNMA 1VL8A 2B7CA 5AVYA 1A8QA 1SD2A 3BBPA 1N0HA 1NQVA 2H18A 2W0MA 5GONB 2R7NA 2X8WA 4REQA 4L6IA 2JA2A 4MUKA 4BFYA 2PRIA 4XVQA 4BBZA 4BMOB 5IT9A 3RANA 2Y1WA 5EKXA 3D6FA 2JK1A 3FGZA 4MKGA 3ZU5A 5HP4A 5DTMA 1BVRA 3QXHA 5GIOE 1K8RA 1VL6A 5AD1A 1O8CA 3SSMA 4FFDA 4E14A 4DPKA 1EJ0A 4MV6A 5JSKA 3C8DA 4BS9A 5EFZA 1BXRB 1F4LA 5EIFA 2ZM5A 4CEJA 2PKEA 4D3DA 1XEXA 2O05A 3T38A 4R81A 4G4JA 4OH1A 5IAKA 1T13A 1E0SA 5TMBA 4R84A 1N2EA 2HU2A 4K3UA 3ICWA 3IT2A 4DWOA 3FTEA 1PHPA 2A35A 4GU5A 4MQUA 2XE4A 1ODTC 5GQSA 3RUPA 2VDWB 2C5BA 5FX2A 2BH9A 3TIGA 4HI0E 5B4TA 4ZVRA 1FFHA 1RMYA 1TM2A 1SVMA 1L1QA 1DKNA 1BXGB 2XVXA 3RYIB 4EJ2A 3RU9A 3NOOA 5H0IA 3ACBA 4WBNB 3EODA 4BE9A 2C88A 1P3Y1 4Y98A 1YJCA 3VR1A 3GP5A 3WHLA 3C4QA 2WIJA 4B3DA 4OJMX 3C4JA 4WNAA 4N8SA 1OLOA 1REQA 2BEWB 3G2LA 1VG9B 4B31A 2IZ0A 1FEZA 4B1FA 1C7RA 1ZVQA 1MQAA 2UZ3A 4BRSA 1WLYA 1KHTA 2ILVA 3RRZA 4S1WA 2NZUG 3VPDA 1U2TA 3NUGA 1Z8FA 1LB1B 3G8DA 2R6JA 4K26A 2ZJ6A 3GNQA 2BFFB 3ZQJA 2GF2A 1GP2A 5AOBA 2FSIA 1VG8A 4DRXB 3VR5A 1C3OB 1JG7A 1GNLA 1E9FA 2RI6A 3B2QA 4JBLA 4BLPA 821PA 5KQPA 1TECE 3QIAA 3SX0A 2AS0A 1H2WA 1JWAB 2VLIA 4CF3A 1L4HA 2JBHA 1KSHA 2CW5A 2HMWA 2VTVA 3CA8A 4Q3NA 4YFYA 3TJMA 1SA0A 1YS4A 5CHYA 3WKEA 3A31A 1ARZA 3ZWXA 1KEWA 3RTGA 1P2VA 3IT0A 3PUYA 4KITB 1U2EA 3CLVA 3GYBA 4IGKA 3OETA 3AM4A 1JBKA 1NW9B 3BGIA 4DLUA 1T3TA 3AYXB 2VAVA 2X4DA 2DQ4A 1H0SA 2KE5A 1V6CA 3BE8A 1WMDA 3AX6A 1XG5A 4G8JA 5GV8A 3RRMA 3N2GA 1P4RA 2L19A 2Q4BA 4TL6A 4RZSA 1NXTA 5DP2A 4S2EA 3F3SA 4GI1A 2C4HA 3BORA 5DH9A 2NUTA 1NZDA 5IAAA 2AHRA 3MM4A 3ASUA 3B38A 2ZYSA 3E7XA 4I81A 2JFOA 5KB3A 3O1HB 2QW8A 1EHCA 1ST2A 4EYSA 5EJ6A 3AESB 4PLFA 3R5HA 1HE4A 4B2IA 4BC1A 4ENQA 3KLOA 4YCJA 2G82A 2Q3LA 1ZR2A 3JYQA 2HWXA 4I5FA 2WTNA 2C5GA 2VNJA 4NQRA 2OFWA 3WTBA 5CX1B 2PWYA 4WI1A 4BVGA 2J5RA 2CJXA 1XHFA 3VU8A 5JYCA 4UKDA 3UC5A 1TQHA 2WLTA 3HMQA 4C2TA 3WLEA 1RYDA 1W1UA 4XLTA 1TO2E 3OZIA 2XF2A 5JNVA 2HT1A 3G9QA 1FNCA 3VR6A 2ARKA 2CV0A 3BREA 1AXGA 2YJZA 1LTKA 3FTFA 4OGLA 1ZA2A 3LLSA 3BQNB 1KI9A 1XWWA 1FFSA 2ANCA 2Z95A 3GBVA 2ZIXA 1J0XO 3IMGA 3KEOA 4V0QA 5DMXA 2JHGA 1KOLA 2CV2A 4DLLA 3RROA 3WOVA 1R74A 2CKDA 4N5NA 1UXGA 1PR9A 4HQOA 3WJAA 2H2AA 5DNYB 2D7DA 4CQJA 4RDIA 3E9CA 1J0EA 1FDSA 2WU0A 1V5WA 4C7MA 5BR1A 2VT3A 5LQDA 3VKWA 2E3JA 2BFBA 1F9AA 4W5JA 3F67A 2QORA 4C1NA 2J31A 1CUEA 5IJZA 4J7AA 1GHTA 2C7OA 3GCWA 5HUHA 5IKEA 1TCUA 1P1FA 4D9EA 2Q27A 1POXA 2Q49A 3ANSA 3E84A 4HATA 2DPHA 4JIGA 4KC0A 1N1GA 4HXYA 2YJGA 3H4TA 3DP7A 1P7VA 2AC7A 3V6MA 3KVYA 5BQFA 8ABPA 1A9XA 5JY1A 2HSZA 4I1SA 3WV5A 2XMQA 2H51A 3SJ7A 3CLSC 5ICMA 4HUQB 3Q41A 3KOYA 3S2GA 1N7GA 1S0UA 5HM8A 2RHJA 5IM4A 4X66B 3LM8A 2BEUA 1ZD3A 2PFSA 4AJIA 4M0PA 1A9RA 1RBMA 4LYAA 2Z8ZA 4MS4B 1SWVA 2CMGA 2H1CA 2UUPA 4XJVA 5ALVA 5ABPA 4XM0A 3L1UA 4IZ6A 4Q00A 4IXTA 2WV7A 1H0HA 3SKXA 4RCYA 2GJ9A 1HWYA 4PO8A 3KKKA 4FEEA 1ONNA 5DLDA 3TOZA 1JBEA 4A2PA 2Y1LA 1EWKA 1NI4B 2FPSA 1QQ7A 1M9NA 3B5IA 3ESZA 3O4GA 2OG2A 3VHXB 1XJCA 1MVOA 4DQ0A 3QA9A 4ABTA 2BDUA 4EB6A 2VTBA 2QY9A 1YQUA 2JFUA 1Z0DA 4BNKA 4CEHA 1SCNE 4GYJA 4RXTA 4XCVA 1NSFA 2GEFA 2OHOA 3QU9A 4EF6A 4WE3A 1VBKA 5AW3A 2ZRBA 4HQLA 1IJKA 1YBFA 2GEKA 1PYOA 4PNHA 4R8KA 5AXAA 1YOBA 1D1SA 1XJ5A 4YUWA 2VN8A 3PDHA 4KVFA 3DZGA 1D5CA 4MIKA 3PEYA 3F3YA 3DO8A 5JH7B 2VYQA 2Z1DA 4YO8A 3MTIA 3EVAA 2WMYA 3FZGA 4DG9A 4L75A 2XT0A 4RY2A 5FFMA 5AW7A 5A2QA 1G63A 1UBUS 4AZ3A 1J23A 2MHCA 3AONB 3JR7A 1FYDA 2PN1A 4EYOA 3ZGZA 2ZB4A 1PCXA 1PV1A 3DEKA 2C97A 3IPRA 1N3IA 4U2BA 2Q1UA 3G89A 3E3LA 1OX4A 4DS3A 4OAQA 1Z63A 2DFNA 1KYYA 1N2CB 1Z4IA 4LI3X 4EW1A 4YMLA 1SBYA 4FGZA 1KH1A 2FVXA 5IULC 3TIIA 4MZXA 2CLHB 5JSYA 2AOWA 1VE6A 2WPNA 3ROZA 3WXMA 4UC0A 3LCVB 5B2ZA 2DB3A 3F49S 4BB0A 4RLQA 3CTMA 1RR6A 3GXOA 2GJKA 2VZ9A 2QB5A 3JD4A 3WKBA 5A62A 3KSUA 1A0OA 5ESRA 4DQUA 2HK7A 3LDFA 4NBLA 5DSXA 3UMFA 1G1MA 1PL6A 1BFUA 2VTDA 2WJVA 3KYDB 5B6PA 1T43A 1D1PA 2I2FA 1PU2A 1RXEA 1T1SA 5A02A 3GUHA 5HZKA 1RAGA 2IX9A 4L9SA 1T29A 1J2JA 4FP9A 5E2AA 4G97A 4A91A 2GPYA 3CGWA 2O3TA 1IK4A 3D3WA 2LE0A 4IHJB 3BWMA 1RKXA 3ZD9A 1TYEB 1M33A 4UUNA 1FTYA 4B44A 1PEDA 4JYPA 4HAIA 3D4BA 5JAOA 3UAGA 3VZBA 3EQ8A 3ASZA 4O2BB 3DPIA 1M5UA 5KCMA 2ZREA 4RH1A 2EV9A 3EMVA 4FI3F 3I52A 4LTNA 5HX7A 2CSUA 3KZMA 4JDPA 3HUUA 4XQ9A 4N6GA 1FU7A 2N42A 2SCUB 2OCKA 4KTTE 4U6QA 3A0UA 2BKAA 3L6RA 3QLVA 4BU0A 5JCZA 3SGLA 5DTJA 3ZY4A 1V35A 3WDLA 4F5EA 1DZIA 3JWPA 2WUVA 3ETHA 3O7MA 4Q4CA 3B1ZA 3QV2A 3ZOZA 2PL1A 4N48A 1K7CA 1KP2A 1U0GA 2X7JA 5IVKA 2NX2A 2R4QA 4E70A 3ABQB 3I62A 1JVNA 1TA9A 4G37A 2K2WA 1H6BA 2M6RA 1NVEA 2HBQA 3CX4A 4TLCA 5DWQA 1E8NA 5JY6A 1YWGO 5IT4A 1A77A 2H1RA 3HZOA 2IW1A 3ZHZA 2ACVA 3FRHA 3X1XA 4CDMA 4TRMA 2PBFA 5CLGA 2CNDA 2ASVA 1A69A 3Q3IA 4UUQA 4OLHA 4CVNA 2HNBA 1BAPA 3N7UA 3PKJA 1CF2O 4GL4A 1VDMA 4QO8A 3WC4A 1P5RA 4LW8A 4RY9A 1XE3A 2O0JA 4RKQA 5CT5A 4D43A 1EFRA 4JD5A 4Q1EA 2BBWA 2VQFB 4H1WA 4ZTUB 3LRTA 4F2WA 2WAMA 1JQ3A 3QUBA 521PA 3IR5A 4KH0A 4OHVA 5GVRA 1HTTA 1P1BA 2G06A 4XQGA 4IZOA 2YXPX 3THXA 3DAHA 2O8CA 3TCKA 5IBRA 2AW3A 2IEIA 3T1YB 3L07A 4J3NA 1NOIA 3NYRA 3HVRA 4G41A 2FJ0A 1CLEA 1NPYA 3PFIA 5CH5A 1ABFA 3O8OB 3H19A 2XNJA 3CRQA 3ZDFA 4D6PA 2JI6A 2D2IA 2BGIA 1ND5A 2GO7A 3BMQA 4ZZ0A 5C4MA 3UJ9A 2Q45A 3QA3E 4YUYA 5B3KA 1KAMA 2BTEA 1PJSA 3JWIA 4WXYB 4ZYZA 4IJWA 5K01A 3C3BA 3R0IA 3U4MA 2CNWD 1XQWA 1UWKA 4DHWA 4EW6A 3AILA 3BOSA 2X6RA 4C05A 3ZDEA 3WWZA 2BE9A 4R01A 3WA6A 1FQJA 1C3EA 3CIOA 4BJ1A 3N28A 5C8YA 1Z0JA 4QUAA 1WMEA 3OHSX 4GGOA 4KWCA 1KDZA 3PUVA 4HNRA 4JC5A 2F3TA 6REQB 2Q5FA 4V0MA 1DT5A 5E6RB 3N7AA 1I4DD 4WOBA 5EQFA 2GN0A 2QE7A 3A8TA 3A6KA 1EWYA 4GH5A 4O59O 5FNVB 2DF8A 2GZ3A 2FFHA 3SKVA 1W5TA 2GYUA 2PEYA 3T1HB 4C9BA 2B21A 3H8VA 3WP0A 5AK3A 5MGBA 1MH1A 1SOUA 1RAEA 2XRMA 1ESDA 2BKEA 3V8MA 1H23A 2WD8A 2C3MA 3DTNA 4NPCA 3LCUA 3ISJA 4JHXA 3HJGA 3HKCA 2D13A 3FIJA 1QHSA 3H6KA 4E03A 3QMVA 1HX7A 1JKJA 5KTRA 3GC6A 3RJMA 4FCTA 1P9OA 1ZN8A 5DSZA 1USUA 2OC4A 4AYWA 3O2NA 4BKPA 4PO1A 3RIXA 4RFLA 4WW0A 4IILA 3QBDA 3M7IA 1UJBA 1NXQA 5HDBB 3H5WA 3PYLA 1UBHS 1JDBB 3C5WP 3RARA 3NASA 2O4CA 1R2QA 1EDZA 4JQYA 4HVLA 1QKKA 3QGMA 3CNNA 3LIIA 1LUAA 1SMKA 2ZI3A 3L43A 4ZYWA 1K8ZB 3G7SA 4MLDA 3ZE9A 2WV9A 2YOHA 2ZROA 5EXXA 2YFYA 3WJ2A 3T5BA 2IUEA 4X3CA 3SFZA 3ZLBA 5BQXA 3U5TA 1UODA 4KRFA 1JEAA 4L08A 2ABWA 2QN3A 5CA0A 1WZUA 2WKWA 1Y6GA 3HXPA 3KR9A 2AKAB 1C29B 1FXWA 1ZD5A 3ZV4A 5LZ9A 3NTVA 1CFZA 3ZGXA 2JEZA 1XMQB 4KXVA 4GSKA 3B6EA 1WWKA 4OGFA 5LUBA 5A4AA 4NDAA 3CPSA 4MA4A 2ZJBA 1F20A 5TVKA 1J22A 2PY6A 4A6XA 2C7PA 4YN3A 5LD2C 3CW8X 2VP9A 4Z53A 2XJ4A 1SG9A 4IZIA 1JDSA 5CFPA 2XX3A 3BMNB 2FKAA 1HOTA 1V26A 2QT0A 2XUDA 1WW2A 4U1RA 4ESEA 1QZZA 4H7KA 1PEAA 1WZEA 4NEHB 2WSSA 2FWBA 2ZUSA 3IESA 4PCUA 4HZUA 4BEVA 4F86A 1WHSB 4HRAA 4RDHA 2WZCA 4ZA2A 3HBAA 2V45A 1XKXA 1H8EA 2AB0A 3DFZA 3E35A 3MCVA 4QGHA 4BUZA 4BEBA 5F73A 4MDHA 1FLAA 1E94E 5G0TA 3WIVA 2WKRA 2A9PA 3AM3A 3UJ7A 4YLGA 4OD0A 4HDRA 4FQ8A 2PV7A 2B9VA 2C57A 4N7BA 1H8HD 5C8VA 1OFHA 1Z9BA 1Y7TA 4UU7A 3SS8A 4HNTA 1GEEA 1KJNA 4LJLA 2OCYC 4UVEA 2PTHA 4H7HA 4HDNA 2J7KA 5FWDA 4BVLA 5C7OO 5KYWA 3A06A 3KOUA 1MAWA 1YKSA 2V6FA 2HXGA 2AT1A 4H59A 2BMEA 3ZI7A 1G20A 1DRJA 4HAYA 3PEWA 4ENWA 4NIMA 1XTSA 1L7DA 1Z0IA 1PQUA 2XV1A 4D9FA 1P5HA 2FMTA 4CUZA 1FDWA 3GGCA 2AVDA 2Y9MB 4JR1A 4AJ1A 2CL6X 1ILWA 2CN1A 4GLBA 3RYFA 4LJ6A 4Z49A 16PKA 3OZAA 4ECAA 2XWJI 4NH4A 2AI3A 3H1GA 1GZUA 3NFYA 5JAQA 2O1WA 1E2BA 1SPXA 1T0BA 3T8YA 2PZBA 4HMPA 1EFPA 3UB2A 4EUEA 3VZQA 2D0OB 5CTAA 3FMVA 3TB4A 4G2TA 5DE3A 2H1HA 5HF6A 1WL8A 4EVIA 1U63A 1NNLA 4I4IA 3K6KA 4GKJB 4WCVA 3AHEA 5A5GA 2VOEA 2WM9B 2XTNA 4OKSA 5LMCA 3DLBA 1Y1LA 5EY5B 2X13A 3HSSA 1DBQA 1U0HC 1T9GR 5A1JA 3ICOA 1ZD4A 3ZHXA 2I91A 4LNAA 4LRUA 4I50B 5B4UA 1L4MA 2I0FA 5CBPA 5I7VA 1Q20A 1P0QA 1UZMA 1DRVA 3UPDA 2PGLA 1XPOA 4AKSA 1HDXA 3FGOA 3PGA1 6GPBA 1U8EA 4Q1FA 1Z07A 1W0CA 1IB6A 1V7ZA 4IV0A 2BGJA 4YP6A 5IVDA 2GCIA 1QOPB 2G25A 2I5PO 2EIHA 1J42A 3M1LA 1EP2B 1AV6A 1G42A 5CB0A 4O4HF 4WXPA 4PC6A 4M0DA 2IPXA 2B1IA 3UJ3X 3K70B 4IKOA 1HETA 1V45E 3AF6A 4P58A 5K5EA 2OVFA 1LDEA 4ZXPA 3RU2A 1XXLA 3OPQA 2KBEA 4BKRA 2DTEA 1AQNA 4PS1A 2YXNA 4UBKA 3OEHD 4W1RA 1U6KA 1YO6A 3Q5EA 4DPMA 3CRW1 3GT0A 3GBSA 4POAA 3E03A 2Q50A 3DGEC 4Z6KA 1FMFA 4RBNA 1PLJA 3A4TA 4X63A 1KPHA 3IIEA 4DFDA 3T9FA 4CR8A 4IO1A 1BVYF 1GTVA 1PR4A 1PR2A 4URYR 4DSUA 1JHPA 2CB0A 2FMIA 1SC3A 2YWBA 3OE5A 3T52A 4IIJA 2OCIA 3Q8MA 4QYMA 4OXKA 2AK2A 1VSQA 2V7QA 2WK1A 4MWTA 1I2DA 1V2HE 2QAJA 5E6SA 3WLRA 1KA9H 4OL0A 4F46A 2JFYA 2A5GA 3HJCA 3K96A 3MILA 3LFHA 1U9CA 4MPRA 3GFFA 4CDRA 4M6WA 4RSGA 5CDTA 1BDBA 2B0JA 4IG9A 5H81A 3I1JA 3OA2A 4TYQA 2CYBA 2GD2A 2PRZA 3KBBA 3W2FA 1SCKA 1JXAA 4QHTA 4MS1A 2P2CA 1J20A 4DBLC 1E3LA 4ZU6X 1HBJA 2GBGA 1H2YA 3VR5D 3ROXA 4C0LA 3NFRA 2ZJZA 4CFSA 1Z4MA 5JCOC 1ZMBA 2DQKA 3M89A 4LWQA 5JT1A 5MDHA 1GZ3A 4KQFA 1R64A 1LPSA 2OBXA 4UOQA 4EJSB 3EZ6A 5DM60 1DAGA 1GQOA 3PBKA 1K9SA 2VI5A 3OE7D 3P4UA 2I2XB 1PJ8A 1W4RA 2PKXA 3QPWA 4G0VA 1C1XB 2PVCA 1L5SA 2EOAA 2VJKA 3VTKA 2FMKA 4J75A 2Q3EA 2GBPA 2V3VA 2B35A 5BN3A 1IM8A 2CNWA 4CEIB 1Y8AA 4KK3A 3NX4A 3P2EA 3A27A 4B4OA 2FRVA 4A16A 2H4FA 4JJEA 4BVKA 1T5LA 3NC0C 5IT5A 1JDVA 1VTKA 2IZZA 3BGSA 3LGSA 3MMZA 4LWPA 2PZMA 3D81A 5CG2A 3DTVD 5DX8A 3B9RA 3AJDA 3V5NA 3C6YA 1K5PA 3GIWA 2GAAA 3S1SA 3IE1A 2FU5C 2HM7A 2YUIA 4ICIA 3BL5A 3ZDYB 1VCNA 1XAHA 1JSZA 5F5LA 3CF4A 1DCMA 1Q1ZA 1YU6A 2M2IA 1I4LD 5ALWA 3T1VA 4LRWA 2O7RA 4FYMA 3QU7A 5ADVA 3DR5A 2CJFA 4QJ5A 4OXRA 3QEKA 1V4BA 5DSTA 5L53A 2SBTA 2ZT6A 4RHCA 2ET6A 4CGZA 2CL5A 2ATIA 4H6VA 4FUTA 1NASA 3RHSA 3L7BA 2CMHA 1DQZA 3CTPA 2JGDA 4MV1A 4NBRA 4M9CA 4Q4AA 1KO8A 5HF8A 3UG6A 3ZLJA 4RV4A 1YCDA 3F5QA 4EHLA 1NN0A 4AP5A 2FZVA 3HFRA 5DLPA 2JFGA 4CTJA 1E0DA 4MDFA 1M0TA 1Y4SA 1Z2NX 3NBQA 3NTUA 3AEKA 2QF7A 3H2BA 4C7KA 1UBKS 1IN6A 2HZBA 4W8OA 1IVYA 2PXXA 3JYHA 2IH5A 3NT2A 4BFCA 1KSJA 4MX8A 3TZKA 4G0WA 3PVCA 4HLDA 1ZOIA 4IYRA 4ZT3A 3RRBA 2EDCA 1AB6A 2W2QA 3PQ3A 4BNGA 2DU8A 5JSQA 1QYVA 5KPDA 3CVVA 2GCNA 3QI7A 1U2ZA 3OKFA 4QG7A 1ZITA 5KTNA 3LW8A 3H0KA 4D0RA 5KVAA 5G1NA 3V4SA 4PNEA 2PGOA 2YOGA 5JS8A 1XT6A 2EP8A 3S40A 4WN9B 2E4ZA 2NN3C 3NMUF 1ZK0A 3WYCA 3EVEA 4DY6A 4CEIA 2C0QA 3RJ5A 2IZ5A 3V8EA 3PE6A 4JVSB 2ZWMA 1DDGA 4IV8A 3ZV3A 3IEUA 3ADPA 4DA7A 1R4AA 3D8NA 3HCCA 2VATA 3L6OO 2WF9A 1Y33E 2JBAA 2NZXA 1SZJG 3PWZA 1JL3A 1Z4OA 4HC4A 5IBPA 2P75A 1LA2A 4JLOA 5AI5A 1EDBA 3REOA 1E3MA 3KQVA 2X6QA 3M3HA 3MB8A 3LXUX 4AMZA 2P91A 1CRPA 1WMFA 1H8ED 3EN0A 4B43A 1Q0SA 4IR7A 1XU4A 4BE4A 1GU0A 3GEDA 3EXHA 3M3PA 2XCSB 2ZE8A 2EXXA 2ZB8A 2N46A 5DTEA 2J9ZB 2Y1XA 1A8IA 4RFVA 1PEKE 1TM5E 2GXUA 4R7TA 4HWKA 4LZAA 3EAGA 4WNAB 4TWIA 1IBKB 4BL5A 2OAEA 3GLGE 1G8MA 3I0MA 3MS7A 3JVVA 3N0WA 4K6FA 5IXSA 1C1DA 3S7TA 1V11A 1ZAYA 5COBA 3D4OA 3QOXA 1QS0A 5JD4A 4QVGA 1MH9A 5JWRA 2FMHA 3WR5A 5EKDA 3AY0A 1Z6GA 5JIBA 3VJMA 2ASEA 4X84A 1ZW1A 3JALA 3LUFA 5CM9C 4BN0A 3D8TA 4MPJA 3H8SA 3F73A 5FBLB 1INLA 4GWLA 2H1LA 4R0VA 4OLAA 1S6YA 3O92A 1YZUA 3LLUA 3L02A 3IDZA 4TT3D 4R2HA 4Q3CA 3HB1A 4UHDA 2I8LA 1R10A 3OZXA 5ALTA 3D7RA 4ZYXA 2X4GA 4X97A 3D6AA 4AU1A 4DUGD 4P80A 2HK8A 9LDTA 3H5LA 4NBSA 1TZBA 3AL3A 3I1IA 1Z28A 2WM2A 5FFFA 4FSHA 3KPUA 1E6KA 5BPHA 2OBYA 3F90A 1PYGA 5L3RA 2VEOA 2JGIA 3MGBA 4I1VA 3RSOA 2I6GA 3WDKA 1U8CB 2HQSA 5CT6A 4BVAA 1TCBA 4US0R 4LCEA 4PX5A 2EG5A 3FPHA 3ZZUA 2NWQA 1P1JA 2X4IA 1E7MA 2X19A 3K94A 3LFTA 4OATA 4Y2TA 5EQJB 4CNQA 4R69A 5EJEA 1H4QA 4L4UA 1QPZA 4LKRA 5L3ZA 2WP8J 4W8GA 2J3DA 2HJHA 3JQ9C 2OFPA 1Z8NA 2NPOA 2OXEA 4W9NA 2FEMA 2LIPA 4CV2A 4Q4HB 2PUHA 4WKNA 4KDCA 2JLZA 1ZIXA 1JAIA 4M98A 1URPA 1XA3A 5AW0A 2FDRA 3PSHA 3VU3A 4CI9A 4IKPA 5FWNA 4RTQA 1FNBA 3H5VA 3GP3A 1NUHA 3ZNNA 4DLVA 1YR8A 3ZV5A 2ZAGA 4DXDA 5EPOA 3CT4A 1T5HX 1YJBA 4ZRMA 2RSLA 3TW6A 3NVDA 1YV9A 3DQPA 2XPCA 3FG9A 1RTTA 3OIFA 1FOEB 1B43A 2VNHA 5IHPA 1HF3A 3PGMA 2P2ZA 5J4HA 4FEYA 1E4EA 2YV5A 2BLLA 4N40A 2JAPA 2ZI6A 4V03A 4YCAA 3STVA 4D79A 3M0EA 3W5BA 5TPZA 2FETA 1H2XA 1UMCB 3VX4A 1E9RA 1D7OA 3DFFA 3BXEA 1N8TA 3BZBA 5ALFA 4YUVA 3SF8A 3BFXA 3WGMA 2ZPAA 3G5UA 4Y1GA 5CFOA 4J29A 1JHXA 3KXLA 3P0RA 2ZSJA 3AUSA 1UBSB 2HIGA 4ASUA 2RHBA 1T8WA 3W6NA 1SD1A 2XNCA 1XR3A 3EDOA 2IHVA 3KYCA 1XP5A 3NOVA 4L78A 5GTDA 4NBVA 3EXFB 2COEA 1N25A 3N70A 3QVGA 5JNWA 1CG6A 2BFMA 4HEHA 2IWRA 4CJXA 1RC1A 2F8TA 4XD7A 1GTSA 1IJBA 3UCXA 1IZZA 1CZOA 4NONA 2YIMA 2OZPA 3VYSB 1Y4ZA 4KO3S 2V97A 3OU6A 3HL0A 1HPLA 3UC9A 2BR3A 5ESDA 2XTAA 1PGPA 4XAQA 1YBVA 2VEDA 2GOYA 3ZVRA 2JD0A 1XZ8A 3SAJA 3IE0A 1E3TA 4NNPA 3V7UA 3NH9A 1TMKA 4L3VA 5CPFA 1YZQA 2BE7A 4FDLA 4L9AA 3B48A 1RMTA 2X14A 2PO7A 4BLVA 3PFFA 2M1XA 1CEQA 4F11A 2A14A 1GSOA 2O3JA 2OYSA 3LVBA 1DKQA 3DZ8A 2A57A 1IDN1 1O5TA 1UXJA 3PDUA 2DKOA 2VDUE 1C9EA 3CSDA 4IBOA 3WLNA 1YL7A 2XGSA 3UJPA 2P9JA 4J16A 4CLEA 1V43A 1R1DA 3UK7A 2XE8A 1O4WA 1L4NA 1ZZEA 1GA1A 3DTVB 3DFUA 3KAQA 4FYHA 4DAEA 2HJRA 3P4XA 4EG3A 3ESYA 4AWXA 5A3RA 2R8XA 3MOGA 4G9BA 2V8OA 1MQSA 1OLUB 4PTLA 1TJ3A 1I1HA 4NMLA 4ZCMA 4J0DA 2B5OA 3GVCA 1PHRA 3L8MA 3UHJA 1YQQA 4R7GA 1P6UA 1WXEA 1CW2B 2FWJA 1V3TA 2EJTA 3PE3A 3BEDA 4I8IA 4RZ2A 2QRPA 2ZCUA 1W2WB 2WEKA 5SV2A 3GEIA 3QU4A 3S81A 1G59A 2FXIA 3TI7A 1N9KA 4Q3OA 1XTPA 1ZXXA 2ZE6A 3PQ8A 1ZO8A 3W5AA 1X80A 4J03A 5BOSA 4D0SA 3RSCA 2ZWAA 3DVSX 3ESCA 6LDHA 4EABA 4R5HA 3ELWA 3NUZA 5B57C 2WR8A 3E05A 3LOUA 1FP7A 1Z2AA 2IGTA 3AHDA 4HWOA 1DKUA 2CE7A 5FA8A 5C5IA 4Z4EA 2W22A 2PLAA 4L57A 1S01A 4U3JA 1WPXA 3WLHA 4LK3A 3AKYA 3IFSA 3MW8A 1A27A 1RMQA 1YJAA 1FSZA 2J08A 2XUHA 4M1MA 3SYMA 1QP0A 3HPRA 2EBHX 3UW1A 4C4OA 2PRSA 2VDQB 1ECLA 4L7QA 3I3OA 4JUDX 5DN6D 4G56A 4IGAA 4TZKA 4AJ9A 3EHEA 3U44B 1YK1A 4HNAB 3N0TA 4EENA 1UPBA 1UJNA 1MORA 3DDNA 1RZUA 3Q15C 4KHZA 3B1WA 2RARA 4NX2A 3ZG6A 4DSOA 3QKSB 4IGFA 1MOPA 4WLNA 3K0AA 2O5CA 1I33A 2RBKA 5TV2A 4C7VA 2YIJA 4FKZA 4C4PA 2R62A 3GMTA 1DPFA 5KYKA 2OV4A 1ESMA 4AJ4A 1CJCA 1Q6ZA 1A9OA 2F8LA 5FRDA 1V1RB 4ALLA 1NLZA 1SUBA 2C54A 1HE8B 1YQDA 2AI2A 3CH5A 2GCOB 3IS3A 4NKRA 1KJZA 1EM6A 4TQ9A 4CT0A 3HZRA 2DPYA 4A03A 4E09A 3DB1A 4D25A 1YRAA 2Y4NA 2DETA 2JLAA 1C1XA 1AA9A 3OI7A 2UYYA 5FNZA 2NXWA 3HDVA 4I3HA 4IRUB 2GJ4A 1V1MA 1SB9A 4YAJA 3TRFA 1DS6A 4AROA 4PG4A 4W99A 4QYIA 1QH9A 1M2FA 3I6BA 2AFVA 4R8VA 2WJHA 4DC0A 2HF7A 4ZT4A 1EU1A 1ECGA 3IKMB 3VDRA 3KAJA 1OJ7A 2I6UA 3L3BA 4RD6A 5P8WA 4L73A 1SELA 2POCA 4YJFA 1UFQA 4OFWA 1X94A 1H6CA 3QM1A 1N6PA 1P1RA 4D9NA 2O54A 2WHYA 3L79A 2IOFA 3NH6A 4KPEC 1T6BY 2HYDA 1R4MB 1GGEA 1JEYB 5A3SA 4YPOA 2BW0A 1AS0A 4TTAA 3FPFA 4EB3A 1J0AA 1S1MA 3PQFA 2WHPB 3CNLA 1L5LA 1JILA 3M1AA 4YJ2B 1G20B 2BGLA 1FDVA 3T7KA 4OHCA 2ZJFA 3LTEA 3ON5A 4BPBA 5DWDA 5SZHB 5GM1A 4FOSA 4N3AA 3KQPA 3RIEA 1Z29A 1ZNYA 5EMKA 2XZPA 4URXR 2XSZD 3SZGA 1U3UA 3TNYA 2ZVQX 1G20E 4LC9A 3S1LA 4DM7A 2A5JA 1ZCJA 4EZIA 3RIHA 3A4YA 1U8ZA 3GGGA 1U1DA 1M8GA 5HJ5A 2CUKA 3OCYA 5I7HA 3MLBA 4JR2A 1QIHA 1IBCA 1RJWA 2RHLA 3N05A 4M6WB 4ARSA 3N2YA 4JJAA 1Q0PA 1T2EA 2WABA 1YNOA 4I0WB 1NFQA 4RFSA 4ZCQA 2ENWA 4QU0A 5JZVA 2JGEA 1II8A 1KYVA 1WUIS 1V1RA 1CY4A 4CM9A 3BT7A 1CF4A 2DKFA 5IDYA 1BW9A 3FNIA 2ZDQA 4LNUA 4O63O 1PGOA 5IKMA 1Y1RA 3G13A 3KHTA 4FT2A 2EBWA 4YXWA 4K81B 3VOAA 4B83A 2IEBA 2WI8A 1JDUA 1YJ8A 1YVUA 2ZBGA 4RO0A 2UVQA 3DHWC 5FTWA 1QQ5A 4WT7A 4I36A 4V0ME 1NXPA 1F8XA 3RF7A 5E4FA 1YB4A 1SM4A 4AO7A 2VA8A 4YUXA 1E18A 1HDCA 2VCEA 2ZSHA 4JYMA 3GLHA 2QM0A 5HZMA 1U2QA 1CQJA 3VPSA 2G09A 3VSCA 2F1JA 1CQIB 2H2FA 3E2PA 3T9CA 3ZZTA 2VNSA 1JKMA 1L7QA 5A03A 1B1CA 3Q5GA 1GUYA 4J76A 4X61A 3IEPA 3FOWA 2JJ2D 2JFHA 2YOFA 3OZGA 3FCYA 4WK0B 1BDHA 3AI2A 2W5UA 1QFXA 2KJQA 2NTEA 3EPJA 4LJRA 1I7LA 4BQSA 4BRZA 4KQIA 4GR9A 4UJ5A 3WYEA 4F92B 1GDTA 1GTJ1 1YVEI 1GPAA 4E11A 2PS1A 3E22B 4X60A 1OPRA 2EZTA 2QMZA 8OHMA 1OV4A 1NBME 3QVMA 4TS9A 3EX7C 1L5WA 1VYTA 5J4VA 1JEQB 3A1WA 3LJKA 1EBBA 1EA7A 1A8SA 3KKPA 3C1TA 2XQFA 4MW5A 5DN6A 3DXXA 4QDKA 2IP4A 2XLCA 5TF4A 2O3QA 4A27A 7AT1A 2HPHA 1AT1A 2BR4A 2XQVA 3I58A 1O03A 1T8YA 2R47A 2VK1A 3JVEA 3TR5A 4MK4A 4OBXA 3IA2A 2L17A 3WLFA 1RI1A 5K05A 5I7WA 1Y3BE 1IWPB 1QFZA 3AM5A 4CWAA 5AUNB 1MTOA 5BWOA 3A26A 3WZLA 1GT6A 1FSFA 4DJJA 4KR3A 1O3YA 5JANA 2Q4TA 5AQEA 1L8XA 2QP4A 3RBZA 4YDRA 5TQ2A 3R6TA 4Y6GB 1QP8A 1A9QA 2PR7A 3FROA 3C3PA 2VHQA 1UWCA 2JHPA 4G4IA 4ZQEA 2QTZA 4N3BA 2ZRQA 1ZNXA 3HB9A 3UTDA 3ZU6A 3NHAA 1Z62A 3BIFA 2O2EA 5DNCA 5LQCA 2JVJA 3DMDA 1TJYA 2QTRA 4RF5A 5LIPA 1RHJA 2IYAA 3CUSA 4LSMA 2MYNA 2QLTA 3KE8A 3PF9A 5K03A 3EPLA 4L8YA 1FPQA 2WZQA 3IE2A 3R4CA 3U26A 4NXMB 1WY7A 4Y6QA 4XX0B 4FBLA 4I2VA 1Z4JA 6YASA 1N1EA 1F2UB 1OI3A 2JCYA 1GNTA 3DZJA 4OMDA 4BP3A 1GADO 4EHNA 1JJIA 5CVDA 2OB1A 3MJHA 1F0PA 1RRMA 3BJZA 3UJHA 1ECFA 1QHGA 3KXIA 2H0RA 2YYSA 2WYOA 2FK8A 1AN0A 2NAPA 3CCCA 2ZFUA 5BT8A 3TZLA 4DR4B 2EBFX 2JEYA 2Z43A 3MRVA 3FCSB 1EJ6A 2WHPA 1CU1A 4LY3A 3T7RA 1ANKA 4X6LA 3PNSA 4EG1A 3WGJA 2VWGA 4WZAE 1S7GA 3DO5A 4BZPA 3IV6A 1B1AA 2BRUC 3C3AA 4K03A 4RM3A 2QD2A 3GZJA 5J9FA 1KXZA 2Q6OA 1F8YA 1E2GA 3W6OA 1KDRA 3PHBE 3RS2A 5FTNA 4HFRA 2ZUWA 2HA0A 4BKOA 3IJEB 5DULA 3KYIB 1YUBA 1HQYE 2G04A 5TQ0B 1QH0A 4LYJA 2WE7A 1DEXA 4YRCA 2XITA 4B73A 4F4DA 3H0EA 2ZYVX 1EFUA 3WIOA 3KKEA 2O2DA 1EVKA 3C6BA 4Q3KA 2W2KB 1TW2A 1NHWA 3DYIA 3BVPA 5DT2A 5KSPA 4HOYA 4I55A 4B46A 5I9IA 1AZTA 1Z6AA 5JEDA 4LRYA 4MKFA 3SKYA 3PT5A 3B7PA 4OHBA 4RIIA 1R9JA 2I9PA 3SDBA 1F8FA 4TRNA 3USES 1SRRA 3VX3A 1HYHA 2C59A 2R7LA 3D8RA 5EXPA 1CUJA 4KQXA 4TV9F 1UM9B 4K9LA 3B3FA 3QNUA 5CFZA 2RGEA 1KEEB 3FMOB 2GK7A 1RPJA 2A9JA 3IMEA 3OCWA 4NYJR 3WIDA 4DNFA 4HJXA 3BWXA 3T5CA 1F7VA 4M1EA 2AGVA 1D9ZA 1EM8B 1PGJA 3LLMA 4GXRA 3GUZA 1MXFA 4FW9A 4BCBA 1P33A 4DTCA 2C4WA 1M1ZA 2AN1A 4G8DA 3HH8A 1MV5A 3ZBQA 4Z4CA 1RT9A 2XJ9A 3BF7A 4F38A 4BGIA 1FLNA 3MINB 1I6LA 3T7SA 2FI1A 2FUKA 1XAGA 1HDIA 1VLLA 2EF1A 2CXTA 2FW0A 2FWPA 2MSCB 1ZMXA 3EFOA 4R98A 4Z99A 2GQ0A 2PRKA 4M99A 4RDCA 4FMPA 2FKNA 3ZX4A 4JBWA 4DLWA 2A4MA 1Z7GA 3FDZB 1SZPA 4UREA 1W8DA 2Z58A 1IZ8A 1TK3A 3CE9A 2IHZA 3QKIA 3ID6C 4Z1MA 1OZHA 2NP7A 3MA0A 2G9ZA 4XYBA 1Y7IA 4WFJA 5SZKB 2JKVA 3AVWA 2B61A 1NW4A 5BXYA 2X9GA 1U5BA 2DH5A 2MMCA 3SS7X 4NS1A 4O1IA 5CB6A 5J2TA 3U1TA 3C45A 4J8PA 1PJLA 3O4IA 1LPPA 2CJWA 2GLXA 4WX2B 1VPEA 3VTZA 1MU0A 4QTXA 4ZDWA 2F48A 1GPYA 4XCQA 3RG8A 1R6VA 3C3KA 1Q1BA 3O8OA 1VYUA 5JQGB 5BRAA 3EEBA 1SXQA 1QHHA 2VQDA 3VBEA 1U4SA 5HRUA 5HNKA 2CVOA 3PIIA 1LK0A 1L5HB 4WNIA 1T9GS 3DBLA 4A2QA 5JC8A 3TTXA 1S8AA 1BE6A 5BSKA 4E1BA 1GZSA 2VJAA 3OZVA 3ND8A 5G2OA 3M6FA 2P9ZA 3PRKE 4BO6A 3F6RA 2B2XA 2R96A 1NVTA 4QXOA 2BFFA 5EZQA 3UJ6A 4BAUA 4BYMA 2C4VA 2OV2A 3LCCA 3QEMB 3GWGA 1JHYA 4LJ8A 1HE3A 1E9VA 3QPVA 5FLEX 2PD6A 4G1UC 4YUZA 5A04A 4HAOA 5FI5A 4PG6A 2ZZNA 4MS3A 4DT1B 2ZBEA 2IYEA 4PXYA 2H9IA 3ZTYA 3FTPA 2GDZA 2WHEA 4AN4A 1P75A 4RYLA 4TTRA 1CP3A 1U8UA 1U7UA 3BSWA 3FH0A 2OECA 5I4CA 1CJVC 2G1PA 5IANA 2Y1KA 2XQKA 3SS9X 1QZTA 3WMWA 4TWJA 2NO6A 4IVRA 2ZVJA 3GLGA 3QF4A 4LWZA 2HYIC 4IL5A 3U1VA 3HBLA 3JQ7B 3NBXX 4YROA 4BWYA 2OT3B 4CV1A 2Y77A 1UJ6A 4PAMA 4CM9D 3FTNA 2XA1A 4KRXA 2ODAA 4MGHA 3RVMA 4S12A 3UWSA 1VIAA 3R5JA 3MUNA 4D74A 3QXCA 1H8HA 4W7SA 5LXTF 2AFHA 2I2CA 4NZOA 1DCKA 3E82A 2BGMA 2NTNA 2V6BA 2QYOA 5E1BA 1HMPA 1NNSA 1U8XX 2Y3IA 3FJ1A 5DKFA 5B1HA 4FLMA 2OXTA 4CKEA 4DTIA 1OFIA 3BMCA 4L9RA 5IASA 4P2BA 3U7EB 4CEJB 1UBGA 1U90A 2RHRA 2CMDA 3K5HA 3PUKA 2QVLA 4XR9A 3LX4A 4OSEA 3VZPA 1BMQA 2OSBA 3ENNA 1M5TA 2BKLA 1EHIA 3BCUA 3U7HB 2ZIFA 1SVWA 1YCHA 3TB6A 4YQZA 1I3CA 1UMDA 2HLDA 3OJ0A 4KV9A 1N5DA 1Y0BA 2WYIA 3IB3A 3O3MB 3V1YA 3SD7A 4UE2A 3VNQA 3WL7A 1TJNA 4CQLB 2QX6A 1WABA 3KSBC 4H17A 3ZCSA 2P77A 2WKPA 3KJHA 3T9BA 2VS1A 1NVAA 4U2FA 4QTYA 1YB2A 2J45A 2Q5HA 2XI4A 3DLCA 5AKHA 5EEGA 1CEXA 3SJUA 1Y1SA 5ESXA 4ALJA 1P1KA 2ZVPX 3TZQA 1X7XB 3Q40A 4D6XA 3TN7A 3P9KA 3FW1A 2Y1FA 4EGJA 3A1TA 4QA9A 3WGNA 2CVPA 2AEMA 1E8DA 3UJ8A 1Y9DA 2DUMA 2RG7A 4JUCA 3I01A 1BE8A 3OKAA 4HS9A 8AT1A 2Q6IA 4DF3A 1W581 5FR2A 3AETA 2H17A 3O8RA 2IE8A 4Z7JA 1KTIA 3Q1KA 4YRNA 3TRJA 4YLYA 2O8CB 3M5WA 2VDRB 3WL5A 4BV2A 4EUFA 5KKAA 1EBUA 3SX4A 1PGNA 3P52A 4A8PA 3O0DA 4JL5A 4MUXA 3ER9A 3FPEA 5FOWA 4JJZA 2C94A 2P5YA 3D1LA 1M2EA 1WDMA 3D1JA 5P21A 1FXUA 3LYAA 3EG9B 4RVGA 3EC1A 3JQEA 5ULLA 2H1WA 3I34X 2NSLA 4WVFA 4W5QA 3UVEA 3QV1A 2X5NA 3QH4A 2P4UA 4EEKA 3EHDA 4D4GA 4JH0A 3VV2A 4MB2A 4NCJA 4E5PA 4Z1MD 3NDIA 2OP1A 5K20A 3PITA 2HF2A 4F7WA 5B6IA 3ENWA 4Q3LA 5JYEA 3MGKA 3JYLA 5AUPB 5JADA 4TQGA 1DRWA 3ICPA 2R1TB 2YMPA 3HDHA 3PNOA 2ZYDA 4B6PA 2Q28A 4H7JA 4O5OA 2A33A 2W98A 4WESA 1WB5A 5T3YA 4UE3S 2XNDD 5JBQA 3BFJA 3EIWA 2Y2UA 3DDZX 5J2UF 3VTAA 2VPQA 1R15A 1LI7A 3ROEA 3GPBA 3CF0A 3D6JA 4Z9BA 3FYUC 5IW8A 1QV9A 3O94A 5DW0A 1LJ8A 2PT6A 3QVUA 2W6OA 2XUZA 1K08A 5CT8A 1IYZA 2E18A 1HY3A 4YAGA 1ZM2A 3PCXA 5J2TB 4BJ3A 2B1QA 1QE3A 4DLSA 1OGYA 4JJ6A 5AWFC 2QQGA 4UARA 2VJNA 2G77B 1XQ9A 3E4CA 3AR6A 3M81A 5FO0A 5IRCD 3EQZA 1C7IA 2VUIB 2GF9A 2I71A 1UXHA 2RGYA 2YWFA 3JVUA 1HYEA 3KHUA 3LV8A 3TQFA 4D81A 2OB2A 2ETVA 4GPEA 4ZO6A 3FNFA 1ENPA 1M2OA 3AV3A 4J7XA 1N57A 2IXFA 4PRYA 3S68A 3O7WA 3LHSA 4M3NA 2EKQA 2XOEA 4X24A 4F06A 1N2OA 2D2EA 3AHHA 4MI6A 3IT1A 4Y2JA 3ZD8A 2R2AA 2CT8A 1UM9A 5IC6A 2DUNA 3KJFA 2X1LA 2AXNA 3F8WA 3KNZA 4NE2A 4ZGWA 1GKIA 1QVWA 1Z37A 4NMHA 1W85B 3DHEA 4JP2A 1X42A 1IJEA 2QT9A 2OMEA 3IVRA 3KQSA 4U7GA 5FOQA 1Q50A 1OFGA 1WW8A 1ETUA 1NYRA 2RKOA 5AT1A 2OQVA 2HEGA 3V4PB 4XD2A 1MOSA 1RXIA 4RUKA 2B5VA 3FUUA 3USZA 4YRKA 5K0BA 4RADA 4ZT2A 5H80A 4FYYA 3GJ6A 4EW3A 3PFHA 4R3WA 3IL2A 4GKAA 3WAGA 3DLAA 2A9FA 2BKVA 3OO0A 2NUAB 1B6RA 3ZQ6A 1L7OA 1CS0A 1SVIA 2IIVA 3ZWWA 4EI2A 3QKSA 4AO8A 1GPUA 4CL8A 3FDZA 4IDNA 4UATA 2F1IA 2WMOB 1Z2EA 2CXUA 3HS3A 2W6MA 3N6RA 1M1XB 3NM5A 3NWJA 1YHYA 1D2NA 4QJBA 5TJHA 2NQTA 4Y2UA 1V96A 3H05A 3L0IB 3OM0A 4Y7CA 3G2NA 4ER6A 5JHGB 1NBHA 3OFND 1GN8A 1Y48E 4J49A 4ACBA 3A04A 4JL6A 2XZDA 5FB3A 4UUAA 3HGTA 4AZ0B 3ODPA 1UQRA 4YLEA 2OL4A 3OIVA 5DM70 2FPKA 2AOTA 4JBNA 4OYLA 4RM2A 4ZO4A 3SXUA 3KUCA 2IL1A 2J85A 3K9BA 1S3FA 4R1OA 3NWPA 4L8GA 3TMYA 3QYPA 4A4DA 3AR7A 1GUBA 2VJMB 3OZCA 5GY7A 3R9XA 3GLVA 3IUQA 1J09A 3TSCA 3PD0A 1BYUA 1P8AA 1XZMA 3U49A 3ZJTA 3MBOA 1JXOA 1UK9A 1OTYA 3S8YA 4DM4A 3MLEA 5KYNA 5ANRB 4ZJUA 4WCFC 3UIEA 2BMDA 3EH2A 1P17A 2HA6A 4JCCA 4B3HA 2VXCA 1N9GA 4IUYA 4EHFA 1HZJA 4LJ5A 4YRAA 2PXHA 3QUSA 3U7JA 5BNZA 1PDVA 3TUZC 3LO5A 1GG8A 3LXXA 2OD7A 3UJNA 1E1QD 3A25A 3EPPA 1QONA 3R0ZA 3WK5A 3OZEA 4J6EA 4HDKB 1ZYUA 3OOEA 3EQ6A 3E9RA 4QREA 4F85A 2KX7A 2RH4A 4CIBA 1T25A 2V5VA 4QELA 3RFXA 3WKCA 1AC5A 3I6QA 3AB7A 3HACA 1R0LA 2G0NA 1RRCA 1ZJ5A 1X7WB 2FV8A 4OB7A 3AF5A 4HHEA 3P2MA 4LX0A 3UV6A 3G0DA 4CMIB 5B58T<