3HRDB

Crystal structure of nicotinate dehydrogenase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
330
structure length
330
Chain Sequence
b'MKKRGKGVGSMWYGIGNTGLPNPAAAFVEIHGDGSANVMFGAADIGQGSGTAMAQIAAEELGLDYEKIHVTWGDTMVTPDGGATSASRQTLITGNAVILACRQAKETLAKTAAEKLDCAPEELSFRDNTVFITADPERSMTYGELMAAMKAAGRMAVGAGSYNPNTTGLAPENMSGIPFEVYSYATTIAEVEVDTETGEVDVLKVVSAHDVGTPINRSMVEGQIEGGVTMGQGFVLMEEIEVNTKNGAIKNPSMSKYIIPSNRDVPEIHSILVESEGGPGPFGAKGVGEPALIPMIPAVVAAIEDALGTRFTHTPIMPKDIVAAVKAQEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotinate dehydrogenase large molybdopterin subunit
publication title The Mo-Se active site of nicotinate dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 92
structure length 330
sequence length 330
chains with identical sequence F
ec nomenclature ec 1.17.1.5: Nicotinate dehydrogenase.
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02738 Ald_Xan_dh_C2 Molybdopterin-binding domain of aldehyde dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.365.10 Alpha Beta 2-Layer Sandwich Aldehyde Oxidoreductase; domain 4 Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 3hrdB01
3.30.365.10 Alpha Beta 2-Layer Sandwich Aldehyde Oxidoreductase; domain 4 Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 3hrdB02
3NVYC 4C7ZA 4US8A 1N63B 3NS1C 2W3RB 2W54B 1WYGA 1FFUB 3FAHA 3EUB4 3ETRC 3AN1A 4US9A 1VLBA 2W55B 3SR6C 1FIQC 1JRPB 1N62B 1SB3A 1V97A 4USAA 1FO4A 4C7YA 3FC4A 3AMZA 1DGJA 3L4PA 1N5XA 1RM6A 1VDVA 3HRDB 1N61B 3AM9A 1FFVB 1N60B 1JROB 1N5WB 1SIJA 3NVVC 2E3TA 4ZOHA 3NVWC 1ZXIB 4C80A 3NVZC 2W3SB 3NRZC 3B9JC 3HRDA
chains in the Genus database with same CATH superfamily
3NVYC 4C7ZA 4US8A 1N63B 3NS1C 2W3RB 2W54B 1WYGA 1FFUB 3FAHA 3EUB4 3ETRC 3AN1A 4US9A 1VLBA 2W55B 3SR6C 1FIQC 1JRPB 1N62B 1SB3A 1V97A 1T3QB 4USAA 1FO4A 4C7YA 3FC4A 3AMZA 1DGJA 3L4PA 1N5XA 1RM6A 1VDVA 3HRDB 1N61B 3AM9A 1FFVB 1N60B 1JROB 1N5WB 1SIJA 3NVVC 2E3TA 4ZOHA 3NVWC 1ZXIB 4C80A 3NVZC 2W3SB 3NRZC 3B9JC 3HRDA
chains in the Genus database with same CATH topology
3NVYC 4C7ZA 4US8A 1N63B 3NS1C 2W3RB 2W54B 1WYGA 1FFUB 3FAHA 3EUB4 3ETRC 3AN1A 4US9A 1VLBA 2W55B 3SR6C 1FIQC 1JRPB 1N62B 1SB3A 1V97A 4USAA 1FO4A 4C7YA 3FC4A 3AMZA 1DGJA 3L4PA 1N5XA 1RM6A 1VDVA 3HRDB 1N61B 3AM9A 1FFVB 1N60B 1JROB 1N5WB 1SIJA 3NVVC 2E3TA 4ZOHA 3NVWC 1ZXIB 4C80A 3NVZC 2W3SB 3NRZC 3B9JC 3HRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVY C;  4C7Z A;  4US8 A;  1N63 B;  3NS1 C;  2W3R B;  2W54 B;  1WYG A;  1FFU B;  3FAH A;  3EUB 4;  3ETR C;  3AN1 A;  4US9 A;  1VLB A;  2W55 B;  3SR6 C;  1FIQ C;  1JRP B;  1N62 B;  1SB3 A;  1V97 A;  4USA A;  1FO4 A;  4C7Y A;  3FC4 A;  3AMZ A;  1DGJ A;  3L4P A;  1N5X A;  1RM6 A;  1VDV A;  3HRD B;  1N61 B;  3AM9 A;  1FFV B;  1N60 B;  1JRO B;  1N5W B;  1SIJ A;  3NVV C;  2E3T A;  4ZOH A;  3NVW C;  1ZXI B;  4C80 A;  3NVZ C;  2W3S B;  3NRZ C;  3B9J C;  3HRD A; 
#chains in the Genus database with same CATH topology
 3NVY C;  4C7Z A;  4US8 A;  1N63 B;  3NS1 C;  2W3R B;  2W54 B;  1WYG A;  1FFU B;  3FAH A;  3EUB 4;  3ETR C;  3AN1 A;  4US9 A;  1VLB A;  2W55 B;  3SR6 C;  1FIQ C;  1JRP B;  1N62 B;  1SB3 A;  1V97 A;  1T3Q B;  4USA A;  1FO4 A;  4C7Y A;  3FC4 A;  3AMZ A;  1DGJ A;  3L4P A;  1N5X A;  1RM6 A;  1VDV A;  3HRD B;  1N61 B;  3AM9 A;  1FFV B;  1N60 B;  1JRO B;  1N5W B;  1SIJ A;  3NVV C;  2E3T A;  4ZOH A;  3NVW C;  1ZXI B;  4C80 A;  3NVZ C;  2W3S B;  3NRZ C;  3B9J C;  3HRD A; 
#chains in the Genus database with same CATH homology
 3NVY C;  4C7Z A;  4US8 A;  1N63 B;  3NS1 C;  2W3R B;  2W54 B;  1WYG A;  1FFU B;  3FAH A;  3EUB 4;  3ETR C;  3AN1 A;  4US9 A;  1VLB A;  2W55 B;  3SR6 C;  1FIQ C;  1JRP B;  1N62 B;  1SB3 A;  1V97 A;  4USA A;  1FO4 A;  4C7Y A;  3FC4 A;  3AMZ A;  1DGJ A;  3L4P A;  1N5X A;  1RM6 A;  1VDV A;  3HRD B;  1N61 B;  3AM9 A;  1FFV B;  1N60 B;  1JRO B;  1N5W B;  1SIJ A;  3NVV C;  2E3T A;  4ZOH A;  3NVW C;  1ZXI B;  4C80 A;  3NVZ C;  2W3S B;  3NRZ C;  3B9J C;  3HRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...