3HRNA

Crystal structure of a c-terminal coiled coil domain of transient receptor potential (trp) channel subfamily p member 2 (trpp2, polycystic kidney disease 2)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'GVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transient receptor potential (TRP) channel subfamily P membe
publication title Structural and molecular basis of the assembly of the TRPP2/PKD1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18109 Fer4_24 Ferredoxin I 4Fe-4S cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hrnA00
3U1CA 4N78D 3VP9A 5BU5A 3C9IA 4O9BA 3N4XA 1NKNA 3P8CD 3VP8A 3BASA 2JEEA 1WT6A 5BVZA 3N7NA 4I1LA 5KTBA 3OJAB 3HRNA 3BATA 3U1AA 4N3YB 2POHA 5BU8B 1X79B 4GIFA 2FXMA 3U59A 1IC2A 4ZKUA 4ZKPA
chains in the Genus database with same CATH superfamily
3CD6P 1BCCE 2B88A 4DT0A 5KAIH 2P7JA 1IZNB 1RE3C 3ZDMA 3TSIA 2IYOA 2BEZF 5B66E 1BE3G 3B8EB 1LTAC 3B5NC 1EZVE 4C7NB 1IK9A 5CCHA 1AJYA 2ZXEB 2C0WA 2GA1A 4I2LC 3G3ZA 3CLQA 5AVZB 3E1IA 2ZYAA 2JWDA 3WUVA 3L72D 3L70E 1FDOA 1Q81Q 3TGUG 1KB9D 5H2FH 4YPCA 2YXQB 1PP9D 1NTZJ 3RK3B 1RF0C 1JO5A 3V4WA 1Q86Q 3M91A 2FYUK 1EDIA 3CC4P 1DX7A 1NTKK 2J58A 2NPSD 3RL0g 3JCUE 2YO2A 1Y9BA 4RJTA 2B89A 3AE4C 1S9KD 2FBWC 3P7KA 3B4SA 1DD3A 1BE3E 3H1LE 1BCCD 1K73Q 4K3AA 1KN7A 1JY3N 3HUSA 1K05A 3AEEC 4ZKUA 5KJ7C 5TISH 1P84H 5L8RJ 1R5LA 2JJLA 2JWAA 1YQ4C 1EZVD 4H44C 1JY2P 3BCCJ 1OXZA 3TGUE 4D6TD 3G9RA 2KK7A 3OAKA 3WU2H 4N6JA 1SQPE 2M0BA 5AVQB 1GW4A 2KYVA 1LTJC 4EOTA 3CWBG 1KFMA 5AVSB 1GTWA 2JP3A 2KXPB 3L73G 1SLQA 3S4RA 3VMAA 2KSEA 3RGUA 1LJ2A 1NTKJ 5AVYB 2RKLA 2RH0A 4B86A 1FOSF 3LW5J 3L75G 1KB9I 1USDA 3SFDC 3B5NB 4N78E 4DOJA 3V2RA 2POHA 1H8AA 1FDIA 5AVXB 2QJPC 1BE3D 4GDOA 2P1JA 1CZQA 1DEEG 3L75J 2O1KA 2ZT9C 1LTIC 1KFNA 1YHQP 3L74J 3NMDA 3A5TA 2M5AA 1S5LE 1JM0A 2W27A 2WSEJ 2IFMA 1JEKA 5AW1B 3CWBE 3RBXA 3TGUD 1NWQA 1NTMK 3L73E 4GKGA 5AW5B 1K9MQ 1NVOA 1T3UA 4IL6H 4WVZA 1HJBA 4RKUJ 2C9NY 1EZVI 3BRVB 1WRGA 2OYIA 4L75A 3ITKA 2O01J 4EDFA 1EQ7A 2FFDC 1QEXA 2PGDA 3V2NA 2LKMA 2HPCA 1ZR4A 1JB0J 3CL3D 1N73A 3SSUA 3LW5H 4JYCA 2BCCJ 5KJ7D 1N7SB 2FXPA 3AEBC 1L2PA 1URQC 3U59A 5GTHE 3H1IG 1ZV8A 4H44D 5CCGA 5BU5A 1HH0A 3CX5D 1HUCA 2NRGA 5EFWB 3CC2P 1H0TB 2JEEA 3GHGC 1YIJP 1CW5A 3PRJA 2IPPA 1LTJB 2XNXA 2D2CB 2WSEH 3H1IJ 3NTNA 2E76D 2DW3A 4MN4C 1OWAA 1QLED 3CCJP 3F5HA 3L4FA 3HTKA 1KTMA 3L71G 5K5GB 1NTMJ 1GK4A 3VMYA 3CWBD 2KIKA 1S3JA 1BGYJ 4PD4H 2V4HA 3H1KG 3L73D 4DJGA 1RF1A 3T97A 2YMYA 2W6JH 2R5BA 5CJ0A 3RL0D 2O01H 4ZMDA 1EDKA 2FY8A 4U3FG 3L75D 2E75C 4EIJA 1PGQA 5KLVE 3NFQA 2K1AA 3A0BH 1N7LA 1SFCC 2A45H 3VP9A 2ZT9B 2ZT9D 2KZIA 2FYNB 2Z4EA 2HLOA 1SQBK 3BVHA 4RO0A 1U57A 5AW0B 2E74B 1FJKA 1GD2E 1SS1A 4PD4D 5E79E 1M90Q 3L71E 5CCHC 1X9VA 2KI7B 3L37A 1J1DC 4H0LC 1G2CB 3H6PA 1J1EB 3H1KE 3N7NA 3CX5I 1LTTC 2Q3IA 4UB6E 3H1HJ 2JR8A 2IBZG 2G3AA 1ZR2A 1DEBA 3H32B 4U3FE 1MFZA 4EI2A 3V4QA 4IOIH 3RK2C 1URQB 1OZHA 3O6QA 1LWUA 1FZEA 1PPJE 4IL6X 3H1JG 1FE6A 3H1ID 1SQBJ 4NPDA 1DH3A 2H89C 2WT7B 1L0LK 5KKZC 4UB8E 3HUSC 5AW8B 1S5LX 1JCCA 3LIDA 3CCMP 2XDJA 3H1JJ 3VTPC 4PV1C 1LNQA 3G4SP 1YQ3C 5BVZA 3L71D 4PJ0E 3MHVA 3TNUA 1NAYA 1LT9A 4WY4A 4OGQB 4HH2A 2K3RA 4C46A 3H1KD 2GUSA 5GTIH 5AVRB 3C8VA 4PD4I 1JY2O 2Q7CA 1L4AD 2HODB 2E75D 1QVFO 1VQ6P 1SFCD 2QRXA 4R4LA 2Y9YA 1OMIA 1RHZB 4U3FD 3W68A 1UIXA 1U7JA 2YIUC 1BSHA 1IFDA 3D70A 2MJZA 4BRYB 4K35A 1Q7YQ 1NKZB 3KZIE 5CCHD 3K5BA 4CPGA 4H0LD 1PV3A 5KAIE 1VDFA 5CMZA 2I1KA 3GLMA 1LTGC 1MKMA 2WITA 2I1JA 3I56P 3CCVP 1SQQK 2OARA 1JMMA 1HTLC 1X0TA 2YKQA 1NU1K 5BU8B 2AEFA 4L73A 3IAOA 1S9KE 4IFMA 2IBZD 4NPFX 1KYOH 1W5CE 4H13C 2K37A 3RK2B 3M0DC 3C9IA 2WSSH 3RK2D 2R32A 4RESB 5CHXA 3VMXA 2K9JB 2W83C 1S72P 2UWJE 1OIPA 3IFMA 3KPEA 3HE4A 3R4YA 2J5UA 1A02J 2OTKE 5H2FE 3JSVC 1M1JB 2J59M 1SQPK 2FYZA 4D6TE 1NKNA 1OW8A 1N73C 3H1JD 1NTZG 1USEA 1SP4A 2NZ2A 4PV1B 4PV1D 2A06G 5CCGC 1JOCA 3E1RA 1KD1Q 1AA0A 1DD4A 1CI6A 1VPCA 1AFOA 3FWNA 1SQQJ 2O1JA 1YBKA 5TISE 2QM8A 3HD7A 1P84E 1NU1J 1Z56A 3AEDC 4ASVA 3FXEA 3WMM0 2NPSB 1RY3A 3CPWO 3PP5A 4DZOA 1YTZI 3Q5SA 2Z5HA 1VQOP 5DJUB 1CSBA 3Q2YA 3GMAA 4GODA 2WQYC 3BCCG 2YIUB 4OH8B 4I7ZC 1U7MA 1Y47A 1PFIA 1A02F 5APVA 1NTZE 1GMJA 2OYHB 2IBZI 1GDTA 2ZXXA 4C7NA 1SQVK 4HYTB 1EXIA 4KHXA 1FZGA 1FOSE 2RN0A 1KQGB 4HKZH 1SQXK 4XFJA 2FYUG 1NTKG 2Z5IA 3TF5A 1JNMA 2QJYC 2E76C 1ZRTD 5TJHA 4H13B 4H13D 2LXCB 1N8RQ 2CK3H 3EFGA 2FYUJ 2O3JA 1KORA 4AQRD 4W80A 3BCCE 3S1KA 1P84D 2ZFCA 3RL0C 1KMIZ 2WSCJ 3D6YA 1IFJA 2OGUA 1M1KQ 3CX5E 2HPCB 5APUA 1LTBC 3L74G 1FZFA 3Q5RA 4IL6E 1NOHA 4GT1A 2KNCA 1G1JA 1PGJA 2W6AA 3CXHH 1OX3A 2B87B 1SQVJ 2HFED 1LWUC 4YTPC 5CCGD 1NTZD 3CCSP 1NTKE 1NHLA 4YXDC 1SQXJ 2PP6A 1K04A 3PH0A 1AQ5A 3A7OA 2A06D 1GU4A 4KJMA 3OA7A 2H8PD 2W8ZA 2PRRA 5CJ4A 2M8RA 2W90A 1PGPA 2BCCG 2Q6QA 2Q5UA 3HTKB 5KLVK 4JF7A 2A45G 3AEFC 1JTHB 3L75E 1N86A 1ZXGA 5AVTB 3CXHD 3L74E 1LT9C 2IX7C 2L5GB 4WY4C 2WSCH 4N3YB 3AE2C 3BCCD 1E79H 1KC8Q 3B5NA 4H44B 2JKVA 2AXTH 3IF4A 4PD4E 3SWFA 3I55P 3AEAC 1NTMG 3HRNA 4HB1A 2ITAA 1G1IA 4EYYQ 1P84I 1BGYG 3V2PA 1AV1A 1M57D 3ABVC 2QJYB 2E76B 2QJKC 4JQ0D 1Q2NA 2FYUD 4AYCA 1NTKD 1BDCA 2BCCE 3A0BE 3TK1A 1ZW0A 5KTBA 5KAFH 1RF0A 1L0NK 2WVRA 1NAFA 3KXDA 3MZWB 3MUDA 1MUUA 3RL0B 1YJ9P 5B5EH 3HE5A 3FXDA 2BASA 2QJPB 2O01N 3SWKA 1L4AC 1KZUB 3V2QA 3H1IE 2P67A 1X8YA 2Y9ZA 3L74D 4HJGH 2R3SA 3USSA 1NTME 3O6QB 3KQGA 1N7SA 2WPSA 1PZQA 1Q82Q 4Y99C 1PIXA 5CBNA 1HWTC 3WUTA 1H0TA 3FX0A 3H1HG 3CXHI 5APWA 4YXWH 2ZYDA 2BEQD 4I6MC 5AW6B 4L74A 1FBMA 1YI2P 3WUUA 2P58A 1KQSO 1YYCA 3Q3DA 3SWYA 1RQVA 4BWNA 1BDDA 2KZJA 1L0NJ 2ZJSE 2E5TA 2FFDB 3AEGC 2BCCD 1HJ0A 3C1LA 1H88A 2QEXP 2V7QJ 3FGAD 5KLIC 4WY4B 2YO3A 3S9OA 3MIWA 4WY4D 1OVUA 2IFNA 3MTUE 4DCKA 1SQBG 3CMAP 4JBZA 3HD7C 2XV5A 1IJDB 2Q1KA 1GL2A 3GHGB 5CBOA 3H1HE 1NTMD 3AE3C 5GTIE 2QJKB 4TT3H 1BGYD 2KS1B 5C39A 1VQPP 3L36A 1WT6A 4OWFA 1XTGB 1OVVA 2MKVA 2IBZE 2Y0DA 1FZAA 1OFCX 1T8ZA 2JDIH 1G2CA 2KSJA 1X79B 2AXCA 3GF3A 4LGDE 2IDBA 3CCQP 1SQBE 3CCUP 2V7QH 3M9HA 1L4AB 5AVUB 2VRSA 3H32A 5AW2B 2E75B 1LP1A 2AEJA 3L72J 1R8EA 2KOGA 1SFCB 1FC2C 2P10A 2YKOA 3GF7A 5APTA 1T6AA 4OVNF 1L0LG 3RK3C 3IR9A 4A7PA 3H1JE 3CMEP 3QWOC 3HE4B 1PP9J 4Y99B 3B71A 2KUBA 2WPQA 3EWKA 2A45I 2R44A 1KYOE 1PL5A 5APSA 2E5YA 3UIAA 2ZVNB 4W7ZA 2OTLP 1L0LJ 1FZCA 1J1DB 1IFPA 1QL2A 2PFXA 4H0LB 4JPZB 4WWIA 2N1TA 2XNDH 4IFDK 3H1HD 4R4MA 1RE4A 2H7HA 2OTJP 1BCCJ 3SFEC 3G71P 2H43A 1VQKP 1CI6B 1VQ7P 2Y0CA 1M56D 3A0HH 5APXA 2FXMA 1NO4A 3EFFK 1RH5B 3L70G 5M1BA 3AE8C 1VQMP 4ZNCA 3EQ2A 4TLFA 2IYPA 3HD7D 1JY2N 2PAJA 2E42A 1IFNA 1SQBD 3CCLP 2HODA 1DIPA 2OYIC 1KB9H 2R3CA 3L70J 4WB4A 4GOFA 3O8ZA 3PTZA 5KKZB 1JY3O 3HUSB 2YXRB 2ZAEB 1KILA 1SQQG 1OW6A 4BRYA 3H1LG 1NU1G 1QL1A 4WBAA 1ZRTE 1KYOD 2KB7P 2Y0EA 1HGZA 3CCEP 1YITP 3M06A 3P32A 5DJTB 2HG5D 1BE3J 1IO4A 1RQUA 1JMBA 3RBZA 3H1LJ 2QA4P 1FZBA 3AE6C 5B66H 1SQPG 3RK3D 3WU2E 1VQ9P 3BRTB 2K9JA 1RF1C 3TGUJ 1ZN5A 3MUDC 1K8AQ 1L0LD 1M7LA 1PGOA 5AW7B 1YJWP 1SQPJ 1SQQE 4GOEA 1M1JA 3OJAB 1NU1E 3MD0A 2KNCB 2A06E 2HR3A 5AW3B 1EXJA 1N7SC 3LIEA 1FS0E 2CPSA 3CC7P 2FKWB 1OW7A 2M5AB 3JCUH 1HBWA 1GW3A 1JCDA 2AEMA 4JYBA 2KLUA 3CXHE 4LLHA 3PLNA 2D2CC 4Y28J 2WSFJ 3L70D 1AQTA 4ASWA 2LR2A 1SVFA 2NPSA 2OYIB 3L35A 1KYOI 4QMAA 1VF5C 3BATA 1SQVG 1ZOYC 1LT1A 2GUVA 3E7KA 2QVAA 1SQXG 1N73B 1VQ8P 4L76A 2QG4A 4LC1A 3CWBJ 3KYQA 3D71A 1NGMB 2H88C 2FXOA 1TU3F 3B5ND 3L73J 1ZLLA 2XKMA 2YKPA 2FYUE 2OYHA 1SQQD 1GL2C 3H1LD 3D6ZA 1NU1D 3MP7B 2WZ7A 3PJSK 1XTCC 5AW4B 2FYNC 4IFFA 1QVGO 1R5SA 2AXTE 1JY3P 2E43A 1NH4A 1OVRA 2K88A 3AE1C 3CX5H 2E74C 3R2PA 3U1CA 2L91A 3M0DA 1MZ9A 1FDMA 2K9YA 2QE7H 1FAVA 2WSFH 1SQVE 1SQPD 3FWLA 1RE3A 1RF1B 2QSIA 3T97B 1NJIQ 4U7JA 4I7ZB 1SQXE 1J1EC 2WPVB 3HE5B 1VQ4P 1D7MA 3CCRP 3KDPB 3H25A 1T3JA 4ZKPA 4W7YA 1HGVA 5KAFE 1S5LH 1NYHA 3QH9A 1N7SD 5B5EE 4GIFA 1AVYA 2B87A 5KLVG 4N78D 3Q5PA 1QX8A 1FJPA 4AUWA 3KHUA 1T2KC 1FZCC 1ZMEC 1KV4A 2D2CD 2N1TC 1Y8AA 5AVWB 2YMKA 1N2DC 5KLVJ 1RE4C 3AE9C 1GU5A 1VF5B 1X22A 1S4XA 1VF5D 2QM7A 5GTHH 4I1LA 1JTHA 5APQA 1W2BO 3V6IA 1SQVD 3M9BA 3VYIA 1IFMA 1IC2A 2OQQA 1MFTA 2OYOA 3M9QA 2QIWA 4OGQC 1FU1A 2WPRA 1SQXD 5KJ7A 3L71J 3VOPA 1LWUB 2M3EA 1EC5A 1BGYE 2WWWA 1GL2B 1VQLP 1GL2D 2ZYGA 3G6EP 3H1KJ 1L0NG 3I5CA 3TYYA 1IFIA 3AE7C 2I8DA 2C0XA 3F89A 1LTJA 4KT0J 3GG2A 1PPJG 2SPZA 3JC22 2XZRA 4U3FJ 1HVVA 1GZLA 1KILC 1IK7A 2N9BA 1VL2A 2E74D 2GM4A 3GW6A 3CI9A 1HF9A 3P8MC 1Q90D 3IN6A 2JO1A 3TNUB 1LT9B 1MV8A 3A2AA 1LGHB 2IZ0A 2LXBA 3P8CE 2WTYA 3OW2O 4C7RA 1LP1B 3A3YB 2YNYA 1VQ5P 5E79H 5AW9B 1L0NE 1J2JB 1QGKB 1URQD 2HYNA 2P2UA 3II6A 1W2EA 1KILE 2IZ1A 1KQLA 1YJNP 2WMMA 4Z1MH 4UB6H 5AVVB 1T2KD 1VQNP 3N4XA 5KLVD 3VP8A 1LTSC 1M1JC 3BASA 1FZCB 2N1TB 3AECC 2N1TD 3L72G 3VMZA 1GK6A 2G8YA 2N9YB 2FFDA 1PP9G 1ZP0C 3Q1MA 1JUNA 2RMZA 4OGQD 4BXLA 3AE5C 1URQA 2ZVOB 3V5BA 4UB8H 1BSNA 3MGNA 3P8CD 1EDJA 2CPBA 2NPSC 2XU6A 4XE5B 3A0HE 1BCCG 1EDLA 3VN0A 3GHGA 1S2EA 3U1AA 1YTZT 1M8OB 5APYA 1L0ND 4PJ0H 3W67A 2KP8A 1AVOA 1KILB 4O9BA 2WT7A 1KILD 3L72E 2M3BA 2KLVA 1EZVG 1H89A 1PPJD 4D6TG 1KB9E 2Q3EA 2KS1A 2OYHC 4NPEA 5KLIB 2B9BA 3PHLA 1UIIA 1PP9E 2C9LY 2W6BA 3NXSA 3RK3E 2Q9IA 3M0AA 3HD7B 1NTZK 4D6TJ 1KQFB 1L0LE 1WMKA 1S1CX 1L4AA 4XA4A 4M3LA 1SFCA 1E5WA 3KZIH 2R5DA 3TDKA
chains in the Genus database with same CATH topology
4AYCA 2P7JA 1RE3C 1SVFA 3TSIA 2NPSA 2OYIB 3L35A 3TK1A 1DH3A 5KTBA 1RF0A 1L0NK 3BATA 2WT7B 1L0LK 1NAFA 2GUVA 3B8EB 1LTAC 3HUSC 5AW8B 3B5NC 1JCCA 1N73B 4C7NB 1IK9A 3MUDA 1MUUA 3RL0B 3LIDA 5CCHA 2XDJA 3VTPC 2ZXEB 4LC1A 3KYQA 2C0WA 3HE5A 4I2LC 3G3ZA 3CLQA 5BVZA 2BASA 5AVZB 3B5ND 3E1IA 1ZLLA 2XKMA 3TNUA 1LT9A 2YKPA 4WY4A 1L4AC 1KZUB 2OYHA 3V2QA 2P67A 4HH2A 1X8YA 4C46A 2GUSA 1GL2C 5AVRB 2WZ7A 3KQGA 1N7SA 1JY2O 2Q7CA 1L4AD 2HODB 1XTCC 2WPSA 5AW4B 3RK3B 1RF0C 1SFCD 1JO5A 4Y99C 3V4WA 4IFFA 3M91A 1HWTC 2FYUK 1JY3P 5APWA 2E43A 1DX7A 1NH4A 1NTKK 2J58A 2NPSD 3R2PA 3U1CA 2YO2A 3M0DA 1MZ9A 1FDMA 1S9KD 4I6MC 5AW6B 1FAVA 2WSFH 3P7KA 1FBMA 1IFDA 2MJZA 1RE3A 1RF1B 1YYCA 3SWYA 1NKZB 5CCHD 1J1EC 2FFDB 1JY3N 3HE5B 3KDPB 3HUSA 4ZKUA 1T3JA 4ZKPA 1VDFA 4W7YA 1HGVA 5CMZA 5KJ7C 2I1KA 1H88A 4WY4B 2YO3A 3MIWA 4WY4D 2JJLA 2IFNA 3MTUE 1LTGC 2WITA 2I1JA 1SQQK 1JY2P 2OARA 1OXZA 1JMMA 1HTLC 2YKQA 3HD7C 1N7SD 1NU1K 5BU8B 1S9KE 3OAKA 2XV5A 1IJDB 4GIFA 4IFMA 4N6JA 5AVQB 1GW4A 4N78D 3RK2B 1GL2A 1FJPA 3M0DC 3GHGB 2KYVA 3C9IA 1LTJC 2R32A 3RK2D 4EOTA 4AUWA 4RESB 5CHXA 3VMXA 3IFMA 1T2KC 1KFMA 5AVSB 1GTWA 3KPEA 3HE4A 1A02J 1SLQA 1FZCC 2N1TC 5AVWB 1M1JB 1N2DC 2J59M 1SQPK 2FYZA 5AVYB 1RE4C 1GU5A 1NKNA 3L36A 2QM7A 4B86A 1N73C 1FOSF 1WT6A 1XTGB 4I1LA 3B5NB 1FZAA 1JTHA 1T8ZA 4N78E 4DOJA 5APQA 3V2RA 1G2CA 1SP4A 2KSJA 2POHA 1H8AA 1X79B 3M9BA 3VYIA 5AVXB 1IFMA 4LGDE 1IC2A 5CCGC 1JOCA 3M9QA 1FU1A 2P1JA 2WPRA 5KJ7A 1CZQA 1CI6A 3M9HA 3VOPA 1L4AB 1LWUB 5AVUB 1VPCA 2VRSA 3H32A 5AW2B 1AFOA 2O1KA 2KOGA 1SFCB 2O1JA 1LTIC 2YKOA 2WWWA 1GL2B 1KFNA 1GL2D 5APTA 3NMDA 3A5TA 2QM8A 3HD7A 3I5CA 3RK3C 1Z56A 3IR9A 3TYYA 2W27A 2IFMA 3WMM0 5AW1B 2NPSB 1IFIA 1RY3A 3HE4B 1NWQA 4Y99B 2C0XA 1LTJA 3PP5A 1NTMK 2WPQA 1YTZI 4GKGA 4DZOA 5AW5B 1T3UA 2XZRA 2Z5HA 1HVVA 1HJBA 1GZLA 1KILC 1CSBA 2A45I 2N9BA 2C9NY 5APSA 3UIAA 2GM4A 3CI9A 4W7ZA 3P8MC 3BRVB 1WRGA 1FZCA 1J1DB 1QL2A 4OH8B 2OYIA 2N1TA 4IFDK 1PFIA 1EQ7A 1A02F 2FFDC 5APVA 3TNUB 1RE4A 3V2NA 2LKMA 1LT9B 2HPCA 2H7HA 1ZR4A 1MV8A 3A2AA 2OYHB 1GDTA 1LGHB 3CL3D 1N73A 4C7NA 1SQVK 3LW5H 4HYTB 4JYCA 4KHXA 1FZGA 1FOSE 5KJ7D 3P8CE 1N7SB 1CI6B 2H43A 1SQXK 5APXA 2WTYA 4C7RA 2FXMA 1URQC 1NO4A 3U59A 3A3YB 1ZV8A 5CCGA 5BU5A 1HH0A 1HUCA 2YNYA 2Z5IA 3EQ2A 1JNMA 3HD7D 2JEEA 5AW9B 1J2JB 3GHGC 1URQD 1JY2N 2PAJA 2HYNA 1CW5A 2E42A 2P2UA 3II6A 1IFNA 1W2EA 2IPPA 1LTJB 2XNXA 2HODA 1KQLA 2OYIC 3EFGA 2R3CA 4WB4A 2WSEH 5AVVB 3NTNA 1T2KD 3N4XA 1OWAA 4AQRD 3L4FA 4W80A 3VP8A 1LTSC 3O8ZA 3HTKA 1M1JC 3BASA 2ZFCA 1FZCB 1GK4A 2N1TB 3VMYA 3RL0C 1JY3O 2N1TD 3HUSB 3VMZA 1KILA 1IFJA 2HPCB 5APUA 1LTBC 1GK6A 1FZFA 1RF1A 3T97A 2YMYA 1QL1A 2R5BA 4WBAA 5CJ0A 3RL0D 2KB7P 2O01H 1NOHA 4GT1A 2FFDA 1G1JA 2W6AA 1HGZA 3M06A 3P32A 1JUNA 2HFED 1LWUC 5CCGD 2HG5D 4EIJA 1IO4A 3NFQA 1N7LA 1NHLA 1SFCC 2PP6A 1FZBA 1URQA 1AQ5A 2A45H 3VP9A 3V5BA 3A7OA 1GU4A 2Z4EA 3MGNA 3OA7A 2H8PD 2HLOA 3P8CD 2CPBA 1SQBK 2NPSC 3BVHA 2XU6A 4XE5B 5CJ4A 2M8RA 3RK3D 3VN0A 3GHGA 3BRTB 3U1AA 5AW0B 1FJKA 1GD2E 1YTZT 2Q5UA 3HTKB 1RF1C 5KLVK 5APYA 1ZN5A 2KP8A 4JF7A 2A45G 1M7LA 5CCHC 1JTHB 5AW7B 1KILB 1N86A 1X9VA 4O9BA 3L37A 2WT7A 1KILD 1J1DC 2M3BA 2KLVA 5AVTB 1G2CB 3H6PA 1H89A 1J1EB 1M1JA 3N7NA 1LT9C 2IX7C 2L5GB 3OJAB 4WY4C 1LTTC 2WSCH 2Q3IA 4N3YB 2OYHC 3MD0A 1ZR2A 5AW3B 1DEBA 3H32B 2C9LY 3B5NA 2W6BA 3NXSA 2Q9IA 1N7SC 3LIEA 1MFZA 2CPSA 3V4QA 2FKWB 3HD7B 3M0AA 1NTZK 3SWFA 3RK2C 1URQB 3HRNA 1HBWA 1G1IA 1L4AA 1LWUA 4XA4A 1GW3A 1JCDA 3V2PA 4JYBA 4M3LA 1SFCA 1E5WA 1FZEA 4LLHA 2R5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1C A;  4N78 D;  3VP9 A;  5BU5 A;  3C9I A;  4O9B A;  3N4X A;  1NKN A;  3P8C D;  3VP8 A;  3BAS A;  2JEE A;  1WT6 A;  5BVZ A;  3N7N A;  4I1L A;  5KTB A;  3OJA B;  3HRN A;  3BAT A;  3U1A A;  4N3Y B;  2POH A;  5BU8 B;  1X79 B;  4GIF A;  2FXM A;  3U59 A;  1IC2 A;  4ZKU A;  4ZKP A; 
#chains in the Genus database with same CATH topology
 3CD6 P;  1BCC E;  2B88 A;  4DT0 A;  5KAI H;  2P7J A;  1IZN B;  1RE3 C;  3ZDM A;  3TSI A;  2IYO A;  2BEZ F;  5B66 E;  1BE3 G;  3B8E B;  1LTA C;  3B5N C;  1EZV E;  4C7N B;  1IK9 A;  5CCH A;  1AJY A;  2ZXE B;  2C0W A;  2GA1 A;  4I2L C;  3G3Z A;  3CLQ A;  5AVZ B;  3E1I A;  2ZYA A;  2JWD A;  3WUV A;  3L72 D;  3L70 E;  1FDO A;  1Q81 Q;  3TGU G;  1KB9 D;  5H2F H;  4YPC A;  2YXQ B;  1PP9 D;  1NTZ J;  3RK3 B;  1RF0 C;  1JO5 A;  3V4W A;  1Q86 Q;  3M91 A;  2FYU K;  1EDI A;  3CC4 P;  1DX7 A;  1NTK K;  2J58 A;  2NPS D;  3RL0 g;  3JCU E;  2YO2 A;  1Y9B A;  4RJT A;  2B89 A;  3AE4 C;  1S9K D;  2FBW C;  3P7K A;  3B4S A;  1DD3 A;  1BE3 E;  3H1L E;  1BCC D;  1K73 Q;  4K3A A;  1KN7 A;  1JY3 N;  3HUS A;  1K05 A;  3AEE C;  4ZKU A;  5KJ7 C;  5TIS H;  1P84 H;  5L8R J;  1R5L A;  2JJL A;  2JWA A;  1YQ4 C;  1EZV D;  4H44 C;  1JY2 P;  3BCC J;  1OXZ A;  3TGU E;  4D6T D;  3G9R A;  2KK7 A;  3OAK A;  3WU2 H;  4N6J A;  1SQP E;  2M0B A;  5AVQ B;  1GW4 A;  2KYV A;  1LTJ C;  4EOT A;  3CWB G;  1KFM A;  5AVS B;  1GTW A;  2JP3 A;  2KXP B;  3L73 G;  1SLQ A;  3S4R A;  3VMA A;  2KSE A;  3RGU A;  1LJ2 A;  1NTK J;  5AVY B;  2RKL A;  2RH0 A;  4B86 A;  1FOS F;  3LW5 J;  3L75 G;  1KB9 I;  1USD A;  3SFD C;  3B5N B;  4N78 E;  4DOJ A;  3V2R A;  2POH A;  1H8A A;  1FDI A;  5AVX B;  2QJP C;  1BE3 D;  4GDO A;  2P1J A;  1CZQ A;  1DEE G;  3L75 J;  2O1K A;  2ZT9 C;  1LTI C;  1KFN A;  1YHQ P;  3L74 J;  3NMD A;  3A5T A;  2M5A A;  1S5L E;  1JM0 A;  2W27 A;  2WSE J;  2IFM A;  1JEK A;  5AW1 B;  3CWB E;  3RBX A;  3TGU D;  1NWQ A;  1NTM K;  3L73 E;  4GKG A;  5AW5 B;  1K9M Q;  1NVO A;  1T3U A;  4IL6 H;  4WVZ A;  1HJB A;  4RKU J;  2C9N Y;  1EZV I;  3BRV B;  1WRG A;  2OYI A;  4L75 A;  3ITK A;  2O01 J;  4EDF A;  1EQ7 A;  2FFD C;  1QEX A;  2PGD A;  3V2N A;  2LKM A;  2HPC A;  1ZR4 A;  1JB0 J;  3CL3 D;  1N73 A;  3SSU A;  3LW5 H;  4JYC A;  2BCC J;  5KJ7 D;  1N7S B;  2FXP A;  3AEB C;  1L2P A;  1URQ C;  3U59 A;  5GTH E;  3H1I G;  1ZV8 A;  4H44 D;  5CCG A;  5BU5 A;  1HH0 A;  3CX5 D;  1HUC A;  2NRG A;  5EFW B;  3CC2 P;  1H0T B;  2JEE A;  3GHG C;  1YIJ P;  1CW5 A;  3PRJ A;  2IPP A;  1LTJ B;  2XNX A;  2D2C B;  2WSE H;  3H1I J;  3NTN A;  2E76 D;  2DW3 A;  4MN4 C;  1OWA A;  1QLE D;  3CCJ P;  3F5H A;  3L4F A;  3HTK A;  1KTM A;  3L71 G;  5K5G B;  1NTM J;  1GK4 A;  3VMY A;  3CWB D;  2KIK A;  1S3J A;  1BGY J;  4PD4 H;  2V4H A;  3H1K G;  3L73 D;  4DJG A;  1RF1 A;  3T97 A;  2YMY A;  2W6J H;  2R5B A;  5CJ0 A;  3RL0 D;  2O01 H;  4ZMD A;  1EDK A;  2FY8 A;  4U3F G;  3L75 D;  2E75 C;  4EIJ A;  1PGQ A;  5KLV E;  3NFQ A;  2K1A A;  3A0B H;  1N7L A;  1SFC C;  2A45 H;  3VP9 A;  2ZT9 B;  2ZT9 D;  2KZI A;  2FYN B;  2Z4E A;  2HLO A;  1SQB K;  3BVH A;  4RO0 A;  1U57 A;  5AW0 B;  2E74 B;  1FJK A;  1GD2 E;  1SS1 A;  4PD4 D;  5E79 E;  1M90 Q;  3L71 E;  5CCH C;  1X9V A;  2KI7 B;  3L37 A;  1J1D C;  4H0L C;  1G2C B;  3H6P A;  1J1E B;  3H1K E;  3N7N A;  3CX5 I;  1LTT C;  2Q3I A;  4UB6 E;  3H1H J;  2JR8 A;  2IBZ G;  2G3A A;  1ZR2 A;  1DEB A;  3H32 B;  4U3F E;  1MFZ A;  4EI2 A;  3V4Q A;  4IOI H;  3RK2 C;  1URQ B;  1OZH A;  3O6Q A;  1LWU A;  1FZE A;  1PPJ E;  4IL6 X;  3H1J G;  1FE6 A;  3H1I D;  1SQB J;  4NPD A;  1DH3 A;  2H89 C;  2WT7 B;  1L0L K;  5KKZ C;  4UB8 E;  3HUS C;  5AW8 B;  1S5L X;  1JCC A;  3LID A;  3CCM P;  2XDJ A;  3H1J J;  3VTP C;  4PV1 C;  1LNQ A;  3G4S P;  1YQ3 C;  5BVZ A;  3L71 D;  4PJ0 E;  3MHV A;  3TNU A;  1NAY A;  1LT9 A;  4WY4 A;  4OGQ B;  4HH2 A;  2K3R A;  4C46 A;  3H1K D;  2GUS A;  5GTI H;  5AVR B;  3C8V A;  4PD4 I;  1JY2 O;  2Q7C A;  1L4A D;  2HOD B;  2E75 D;  1QVF O;  1VQ6 P;  1SFC D;  2QRX A;  4R4L A;  2Y9Y A;  1OMI A;  1RHZ B;  4U3F D;  3W68 A;  1UIX A;  1U7J A;  2YIU C;  1BSH A;  1IFD A;  3D70 A;  2MJZ A;  4BRY B;  4K35 A;  1Q7Y Q;  1NKZ B;  3KZI E;  5CCH D;  3K5B A;  4CPG A;  4H0L D;  1PV3 A;  5KAI E;  1VDF A;  5CMZ A;  2I1K A;  3GLM A;  1LTG C;  1MKM A;  2WIT A;  2I1J A;  3I56 P;  3CCV P;  1SQQ K;  2OAR A;  1JMM A;  1HTL C;  1X0T A;  2YKQ A;  1NU1 K;  5BU8 B;  2AEF A;  4L73 A;  3IAO A;  1S9K E;  4IFM A;  2IBZ D;  4NPF X;  1KYO H;  1W5C E;  4H13 C;  2K37 A;  3RK2 B;  3M0D C;  3C9I A;  2WSS H;  3RK2 D;  2R32 A;  4RES B;  5CHX A;  3VMX A;  2K9J B;  2W83 C;  1S72 P;  2UWJ E;  1OIP A;  3IFM A;  3KPE A;  3HE4 A;  3R4Y A;  2J5U A;  1A02 J;  2OTK E;  5H2F E;  3JSV C;  1M1J B;  2J59 M;  1SQP K;  2FYZ A;  4D6T E;  1NKN A;  1OW8 A;  1N73 C;  3H1J D;  1NTZ G;  1USE A;  1SP4 A;  2NZ2 A;  4PV1 B;  4PV1 D;  2A06 G;  5CCG C;  1JOC A;  3E1R A;  1KD1 Q;  1AA0 A;  1DD4 A;  1CI6 A;  1VPC A;  1AFO A;  3FWN A;  1SQQ J;  2O1J A;  1YBK A;  5TIS E;  2QM8 A;  3HD7 A;  1P84 E;  1NU1 J;  1Z56 A;  3AED C;  4ASV A;  3FXE A;  3WMM 0;  2NPS B;  1RY3 A;  3CPW O;  3PP5 A;  4DZO A;  1YTZ I;  3Q5S A;  2Z5H A;  1VQO P;  5DJU B;  1CSB A;  3Q2Y A;  3GMA A;  4GOD A;  2WQY C;  3BCC G;  2YIU B;  4OH8 B;  4I7Z C;  1U7M A;  1Y47 A;  1PFI A;  1A02 F;  5APV A;  1NTZ E;  1GMJ A;  2OYH B;  2IBZ I;  1GDT A;  2ZXX A;  4C7N A;  1SQV K;  4HYT B;  1EXI A;  4KHX A;  1FZG A;  1FOS E;  2RN0 A;  1KQG B;  4HKZ H;  1SQX K;  4XFJ A;  2FYU G;  1NTK G;  2Z5I A;  3TF5 A;  1JNM A;  2QJY C;  2E76 C;  1ZRT D;  5TJH A;  4H13 B;  4H13 D;  2LXC B;  1N8R Q;  2CK3 H;  3EFG A;  2FYU J;  2O3J A;  1KOR A;  4AQR D;  4W80 A;  3BCC E;  3S1K A;  1P84 D;  2ZFC A;  3RL0 C;  1KMI Z;  2WSC J;  3D6Y A;  1IFJ A;  2OGU A;  1M1K Q;  3CX5 E;  2HPC B;  5APU A;  1LTB C;  3L74 G;  1FZF A;  3Q5R A;  4IL6 E;  1NOH A;  4GT1 A;  2KNC A;  1G1J A;  1PGJ A;  2W6A A;  3CXH H;  1OX3 A;  2B87 B;  1SQV J;  2HFE D;  1LWU C;  4YTP C;  5CCG D;  1NTZ D;  3CCS P;  1NTK E;  1NHL A;  4YXD C;  1SQX J;  2PP6 A;  1K04 A;  3PH0 A;  1AQ5 A;  3A7O A;  2A06 D;  1GU4 A;  4KJM A;  3OA7 A;  2H8P D;  2W8Z A;  2PRR A;  5CJ4 A;  2M8R A;  2W90 A;  1PGP A;  2BCC G;  2Q6Q A;  2Q5U A;  3HTK B;  5KLV K;  4JF7 A;  2A45 G;  3AEF C;  1JTH B;  3L75 E;  1N86 A;  1ZXG A;  5AVT B;  3CXH D;  3L74 E;  1LT9 C;  2IX7 C;  2L5G B;  4WY4 C;  2WSC H;  4N3Y B;  3AE2 C;  3BCC D;  1E79 H;  1KC8 Q;  3B5N A;  4H44 B;  2JKV A;  2AXT H;  3IF4 A;  4PD4 E;  3SWF A;  3I55 P;  3AEA C;  1NTM G;  3HRN A;  4HB1 A;  2ITA A;  1G1I A;  4EYY Q;  1P84 I;  1BGY G;  3V2P A;  1AV1 A;  1M57 D;  3ABV C;  2QJY B;  2E76 B;  2QJK C;  4JQ0 D;  1Q2N A;  2FYU D;  4AYC A;  1NTK D;  1BDC A;  2BCC E;  3A0B E;  3TK1 A;  1ZW0 A;  5KTB A;  5KAF H;  1RF0 A;  1L0N K;  2WVR A;  1NAF A;  3KXD A;  3MZW B;  3MUD A;  1MUU A;  3RL0 B;  1YJ9 P;  5B5E H;  3HE5 A;  3FXD A;  2BAS A;  2QJP B;  2O01 N;  3SWK A;  1L4A C;  1KZU B;  3V2Q A;  3H1I E;  2P67 A;  1X8Y A;  2Y9Z A;  3L74 D;  4HJG H;  2R3S A;  3USS A;  1NTM E;  3O6Q B;  3KQG A;  1N7S A;  2WPS A;  1PZQ A;  1Q82 Q;  4Y99 C;  1PIX A;  5CBN A;  1HWT C;  3WUT A;  1H0T A;  3FX0 A;  3H1H G;  3CXH I;  5APW A;  4YXW H;  2ZYD A;  2BEQ D;  4I6M C;  5AW6 B;  4L74 A;  1FBM A;  1YI2 P;  3WUU A;  2P58 A;  1KQS O;  1YYC A;  3Q3D A;  3SWY A;  1RQV A;  4BWN A;  1BDD A;  2KZJ A;  1L0N J;  2ZJS E;  2E5T A;  2FFD B;  3AEG C;  2BCC D;  1HJ0 A;  3C1L A;  1H88 A;  2QEX P;  2V7Q J;  3FGA D;  5KLI C;  4WY4 B;  2YO3 A;  3S9O A;  3MIW A;  4WY4 D;  1OVU A;  2IFN A;  3MTU E;  4DCK A;  1SQB G;  3CMA P;  4JBZ A;  3HD7 C;  2XV5 A;  1IJD B;  2Q1K A;  1GL2 A;  3GHG B;  5CBO A;  3H1H E;  1NTM D;  3AE3 C;  5GTI E;  2QJK B;  4TT3 H;  1BGY D;  2KS1 B;  5C39 A;  1VQP P;  3L36 A;  1WT6 A;  4OWF A;  1XTG B;  1OVV A;  2MKV A;  2IBZ E;  2Y0D A;  1FZA A;  1OFC X;  1T8Z A;  2JDI H;  1G2C A;  2KSJ A;  1X79 B;  2AXC A;  3GF3 A;  4LGD E;  2IDB A;  3CCQ P;  1SQB E;  3CCU P;  2V7Q H;  3M9H A;  1L4A B;  5AVU B;  2VRS A;  3H32 A;  5AW2 B;  2E75 B;  1LP1 A;  2AEJ A;  3L72 J;  1R8E A;  2KOG A;  1SFC B;  1FC2 C;  2P10 A;  2YKO A;  3GF7 A;  5APT A;  1T6A A;  4OVN F;  1L0L G;  3RK3 C;  3IR9 A;  4A7P A;  3H1J E;  3CME P;  3QWO C;  3HE4 B;  1PP9 J;  4Y99 B;  3B71 A;  2KUB A;  2WPQ A;  3EWK A;  2A45 I;  2R44 A;  1KYO E;  1PL5 A;  5APS A;  2E5Y A;  3UIA A;  2ZVN B;  4W7Z A;  2OTL P;  1L0L J;  1FZC A;  1J1D B;  1IFP A;  1QL2 A;  2PFX A;  4H0L B;  4JPZ B;  4WWI A;  2N1T A;  2XND H;  4IFD K;  3H1H D;  4R4M A;  1RE4 A;  2H7H A;  2OTJ P;  1BCC J;  3SFE C;  3G71 P;  2H43 A;  1VQK P;  1CI6 B;  1VQ7 P;  2Y0C A;  1M56 D;  3A0H H;  5APX A;  2FXM A;  1NO4 A;  3EFF K;  1RH5 B;  3L70 G;  5M1B A;  3AE8 C;  1VQM P;  4ZNC A;  3EQ2 A;  4TLF A;  2IYP A;  3HD7 D;  1JY2 N;  2PAJ A;  2E42 A;  1IFN A;  1SQB D;  3CCL P;  2HOD A;  1DIP A;  2OYI C;  1KB9 H;  2R3C A;  3L70 J;  4WB4 A;  4GOF A;  3O8Z A;  3PTZ A;  5KKZ B;  1JY3 O;  3HUS B;  2YXR B;  2ZAE B;  1KIL A;  1SQQ G;  1OW6 A;  4BRY A;  3H1L G;  1NU1 G;  1QL1 A;  4WBA A;  1ZRT E;  1KYO D;  2KB7 P;  2Y0E A;  1HGZ A;  3CCE P;  1YIT P;  3M06 A;  3P32 A;  5DJT B;  2HG5 D;  1BE3 J;  1IO4 A;  1RQU A;  1JMB A;  3RBZ A;  3H1L J;  2QA4 P;  1FZB A;  3AE6 C;  5B66 H;  1SQP G;  3RK3 D;  3WU2 E;  1VQ9 P;  3BRT B;  2K9J A;  1RF1 C;  3TGU J;  1ZN5 A;  3MUD C;  1K8A Q;  1L0L D;  1M7L A;  1PGO A;  5AW7 B;  1YJW P;  1SQP J;  1SQQ E;  4GOE A;  1M1J A;  3OJA B;  1NU1 E;  3MD0 A;  2KNC B;  2A06 E;  2HR3 A;  5AW3 B;  1EXJ A;  1N7S C;  3LIE A;  1FS0 E;  2CPS A;  3CC7 P;  2FKW B;  1OW7 A;  2M5A B;  3JCU H;  1HBW A;  1GW3 A;  1JCD A;  2AEM A;  4JYB A;  2KLU A;  3CXH E;  4LLH A;  3PLN A;  2D2C C;  4Y28 J;  2WSF J;  3L70 D;  1AQT A;  4ASW A;  2LR2 A;  1SVF A;  2NPS A;  2OYI B;  3L35 A;  1KYO I;  4QMA A;  1VF5 C;  3BAT A;  1SQV G;  1ZOY C;  1LT1 A;  2GUV A;  3E7K A;  2QVA A;  1SQX G;  1N73 B;  1VQ8 P;  4L76 A;  2QG4 A;  4LC1 A;  3CWB J;  3KYQ A;  3D71 A;  1NGM B;  2H88 C;  2FXO A;  1TU3 F;  3B5N D;  3L73 J;  1ZLL A;  2XKM A;  2YKP A;  2FYU E;  2OYH A;  1SQQ D;  1GL2 C;  3H1L D;  3D6Z A;  1NU1 D;  3MP7 B;  2WZ7 A;  3PJS K;  1XTC C;  5AW4 B;  2FYN C;  4IFF A;  1QVG O;  1R5S A;  2AXT E;  1JY3 P;  2E43 A;  1NH4 A;  1OVR A;  2K88 A;  3AE1 C;  3CX5 H;  2E74 C;  3R2P A;  3U1C A;  2L91 A;  3M0D A;  1MZ9 A;  1FDM A;  2K9Y A;  2QE7 H;  1FAV A;  2WSF H;  1SQV E;  1SQP D;  3FWL A;  1RE3 A;  1RF1 B;  2QSI A;  3T97 B;  1NJI Q;  4U7J A;  4I7Z B;  1SQX E;  1J1E C;  2WPV B;  3HE5 B;  1VQ4 P;  1D7M A;  3CCR P;  3KDP B;  3H25 A;  1T3J A;  4ZKP A;  4W7Y A;  1HGV A;  5KAF E;  1S5L H;  1NYH A;  3QH9 A;  1N7S D;  5B5E E;  4GIF A;  1AVY A;  2B87 A;  5KLV G;  4N78 D;  3Q5P A;  1QX8 A;  1FJP A;  4AUW A;  3KHU A;  1T2K C;  1FZC C;  1ZME C;  1KV4 A;  2D2C D;  2N1T C;  1Y8A A;  5AVW B;  2YMK A;  1N2D C;  5KLV J;  1RE4 C;  3AE9 C;  1GU5 A;  1VF5 B;  1X22 A;  1S4X A;  1VF5 D;  2QM7 A;  5GTH H;  4I1L A;  1JTH A;  5APQ A;  1W2B O;  3V6I A;  1SQV D;  3M9B A;  3VYI A;  1IFM A;  1IC2 A;  2OQQ A;  1MFT A;  2OYO A;  3M9Q A;  2QIW A;  4OGQ C;  1FU1 A;  2WPR A;  1SQX D;  5KJ7 A;  3L71 J;  3VOP A;  1LWU B;  2M3E A;  1EC5 A;  1BGY E;  2WWW A;  1GL2 B;  1VQL P;  1GL2 D;  2ZYG A;  3G6E P;  3H1K J;  1L0N G;  3I5C A;  3TYY A;  1IFI A;  3AE7 C;  2I8D A;  2C0X A;  3F89 A;  1LTJ A;  4KT0 J;  3GG2 A;  1PPJ G;  2SPZ A;  3JC2 2;  2XZR A;  4U3F J;  1HVV A;  1GZL A;  1KIL C;  1IK7 A;  2N9B A;  1VL2 A;  2E74 D;  2GM4 A;  3GW6 A;  3CI9 A;  1HF9 A;  3P8M C;  1Q90 D;  3IN6 A;  2JO1 A;  3TNU B;  1LT9 B;  1MV8 A;  3A2A A;  1LGH B;  2IZ0 A;  2LXB A;  3P8C E;  2WTY A;  3OW2 O;  4C7R A;  1LP1 B;  3A3Y B;  2YNY A;  1VQ5 P;  5E79 H;  5AW9 B;  1L0N E;  1J2J B;  1QGK B;  1URQ D;  2HYN A;  2P2U A;  3II6 A;  1W2E A;  1KIL E;  2IZ1 A;  1KQL A;  1YJN P;  2WMM A;  4Z1M H;  4UB6 H;  5AVV B;  1T2K D;  1VQN P;  3N4X A;  5KLV D;  3VP8 A;  1LTS C;  1M1J C;  3BAS A;  1FZC B;  2N1T B;  3AEC C;  2N1T D;  3L72 G;  3VMZ A;  1GK6 A;  2G8Y A;  2N9Y B;  2FFD A;  1PP9 G;  1ZP0 C;  3Q1M A;  1JUN A;  2RMZ A;  4OGQ D;  4BXL A;  3AE5 C;  1URQ A;  2ZVO B;  3V5B A;  4UB8 H;  1BSN A;  3MGN A;  3P8C D;  1EDJ A;  2CPB A;  2NPS C;  2XU6 A;  4XE5 B;  3A0H E;  1BCC G;  1EDL A;  3VN0 A;  3GHG A;  1S2E A;  3U1A A;  1YTZ T;  1M8O B;  5APY A;  1L0N D;  4PJ0 H;  3W67 A;  2KP8 A;  1AVO A;  1KIL B;  4O9B A;  2WT7 A;  1KIL D;  3L72 E;  2M3B A;  2KLV A;  1EZV G;  1H89 A;  1PPJ D;  4D6T G;  1KB9 E;  2Q3E A;  2KS1 A;  2OYH C;  4NPE A;  5KLI B;  2B9B A;  3PHL A;  1UII A;  1PP9 E;  2C9L Y;  2W6B A;  3NXS A;  3RK3 E;  2Q9I A;  3M0A A;  3HD7 B;  1NTZ K;  4D6T J;  1KQF B;  1L0L E;  1WMK A;  1S1C X;  1L4A A;  4XA4 A;  4M3L A;  1SFC A;  1E5W A;  3KZI H;  2R5D A;  3TDK A; 
#chains in the Genus database with same CATH homology
 4AYC A;  2P7J A;  1RE3 C;  1SVF A;  3TSI A;  2NPS A;  2OYI B;  3L35 A;  3TK1 A;  1DH3 A;  5KTB A;  1RF0 A;  1L0N K;  3BAT A;  2WT7 B;  1L0L K;  1NAF A;  2GUV A;  3B8E B;  1LTA C;  3HUS C;  5AW8 B;  3B5N C;  1JCC A;  1N73 B;  4C7N B;  1IK9 A;  3MUD A;  1MUU A;  3RL0 B;  3LID A;  5CCH A;  2XDJ A;  3VTP C;  2ZXE B;  4LC1 A;  3KYQ A;  2C0W A;  3HE5 A;  4I2L C;  3G3Z A;  3CLQ A;  5BVZ A;  2BAS A;  5AVZ B;  3B5N D;  3E1I A;  1ZLL A;  2XKM A;  3TNU A;  1LT9 A;  2YKP A;  4WY4 A;  1L4A C;  1KZU B;  2OYH A;  3V2Q A;  2P67 A;  4HH2 A;  1X8Y A;  4C46 A;  2GUS A;  1GL2 C;  5AVR B;  2WZ7 A;  3KQG A;  1N7S A;  1JY2 O;  2Q7C A;  1L4A D;  2HOD B;  1XTC C;  2WPS A;  5AW4 B;  3RK3 B;  1RF0 C;  1SFC D;  1JO5 A;  4Y99 C;  3V4W A;  4IFF A;  3M91 A;  1HWT C;  2FYU K;  1JY3 P;  5APW A;  2E43 A;  1DX7 A;  1NH4 A;  1NTK K;  2J58 A;  2NPS D;  3R2P A;  3U1C A;  2YO2 A;  3M0D A;  1MZ9 A;  1FDM A;  1S9K D;  4I6M C;  5AW6 B;  1FAV A;  2WSF H;  3P7K A;  1FBM A;  1IFD A;  2MJZ A;  1RE3 A;  1RF1 B;  1YYC A;  3SWY A;  1NKZ B;  5CCH D;  1J1E C;  2FFD B;  1JY3 N;  3HE5 B;  3KDP B;  3HUS A;  4ZKU A;  1T3J A;  4ZKP A;  1VDF A;  4W7Y A;  1HGV A;  5CMZ A;  5KJ7 C;  2I1K A;  1H88 A;  4WY4 B;  2YO3 A;  3MIW A;  4WY4 D;  2JJL A;  2IFN A;  3MTU E;  1LTG C;  2WIT A;  2I1J A;  1SQQ K;  1JY2 P;  2OAR A;  1OXZ A;  1JMM A;  1HTL C;  2YKQ A;  3HD7 C;  1N7S D;  1NU1 K;  5BU8 B;  1S9K E;  3OAK A;  2XV5 A;  1IJD B;  4GIF A;  4IFM A;  4N6J A;  5AVQ B;  1GW4 A;  4N78 D;  3RK2 B;  1GL2 A;  1FJP A;  3M0D C;  3GHG B;  2KYV A;  3C9I A;  1LTJ C;  2R32 A;  3RK2 D;  4EOT A;  4AUW A;  4RES B;  5CHX A;  3VMX A;  3IFM A;  1T2K C;  1KFM A;  5AVS B;  1GTW A;  3KPE A;  3HE4 A;  1A02 J;  1SLQ A;  1FZC C;  2N1T C;  5AVW B;  1M1J B;  1N2D C;  2J59 M;  1SQP K;  2FYZ A;  5AVY B;  1RE4 C;  1GU5 A;  1NKN A;  3L36 A;  2QM7 A;  4B86 A;  1N73 C;  1FOS F;  1WT6 A;  1XTG B;  4I1L A;  3B5N B;  1FZA A;  1JTH A;  1T8Z A;  4N78 E;  4DOJ A;  5APQ A;  3V2R A;  1G2C A;  1SP4 A;  2KSJ A;  2POH A;  1H8A A;  1X79 B;  3M9B A;  3VYI A;  5AVX B;  1IFM A;  4LGD E;  1IC2 A;  5CCG C;  1JOC A;  3M9Q A;  1FU1 A;  2P1J A;  2WPR A;  5KJ7 A;  1CZQ A;  1CI6 A;  3M9H A;  3VOP A;  1L4A B;  1LWU B;  5AVU B;  1VPC A;  2VRS A;  3H32 A;  5AW2 B;  1AFO A;  2O1K A;  2KOG A;  1SFC B;  2O1J A;  1LTI C;  2YKO A;  2WWW A;  1GL2 B;  1KFN A;  1GL2 D;  5APT A;  3NMD A;  3A5T A;  2QM8 A;  3HD7 A;  3I5C A;  3RK3 C;  1Z56 A;  3IR9 A;  3TYY A;  2W27 A;  2IFM A;  3WMM 0;  5AW1 B;  2NPS B;  1IFI A;  1RY3 A;  3HE4 B;  1NWQ A;  4Y99 B;  2C0X A;  1LTJ A;  3PP5 A;  1NTM K;  2WPQ A;  1YTZ I;  4GKG A;  4DZO A;  5AW5 B;  1T3U A;  2XZR A;  2Z5H A;  1HVV A;  1HJB A;  1GZL A;  1KIL C;  1CSB A;  2A45 I;  2N9B A;  2C9N Y;  5APS A;  3UIA A;  2GM4 A;  3CI9 A;  4W7Z A;  3P8M C;  3BRV B;  1WRG A;  1FZC A;  1J1D B;  1QL2 A;  4OH8 B;  2OYI A;  2N1T A;  4IFD K;  1PFI A;  1EQ7 A;  1A02 F;  2FFD C;  5APV A;  3TNU B;  1RE4 A;  3V2N A;  2LKM A;  1LT9 B;  2HPC A;  2H7H A;  1ZR4 A;  1MV8 A;  3A2A A;  2OYH B;  1GDT A;  1LGH B;  3CL3 D;  1N73 A;  4C7N A;  1SQV K;  3LW5 H;  4HYT B;  4JYC A;  4KHX A;  1FZG A;  1FOS E;  5KJ7 D;  3P8C E;  1N7S B;  1CI6 B;  2H43 A;  1SQX K;  5APX A;  2WTY A;  4C7R A;  2FXM A;  1URQ C;  1NO4 A;  3U59 A;  3A3Y B;  1ZV8 A;  5CCG A;  5BU5 A;  1HH0 A;  1HUC A;  2YNY A;  2Z5I A;  3EQ2 A;  1JNM A;  3HD7 D;  2JEE A;  5AW9 B;  1J2J B;  3GHG C;  1URQ D;  1JY2 N;  2PAJ A;  2HYN A;  1CW5 A;  2E42 A;  2P2U A;  3II6 A;  1IFN A;  1W2E A;  2IPP A;  1LTJ B;  2XNX A;  2HOD A;  1KQL A;  2OYI C;  3EFG A;  2R3C A;  4WB4 A;  2WSE H;  5AVV B;  3NTN A;  1T2K D;  3N4X A;  1OWA A;  4AQR D;  3L4F A;  4W80 A;  3VP8 A;  1LTS C;  3O8Z A;  3HTK A;  1M1J C;  3BAS A;  2ZFC A;  1FZC B;  1GK4 A;  2N1T B;  3VMY A;  3RL0 C;  1JY3 O;  2N1T D;  3HUS B;  3VMZ A;  1KIL A;  1IFJ A;  2HPC B;  5APU A;  1LTB C;  1GK6 A;  1FZF A;  1RF1 A;  3T97 A;  2YMY A;  1QL1 A;  2R5B A;  4WBA A;  5CJ0 A;  3RL0 D;  2KB7 P;  2O01 H;  1NOH A;  4GT1 A;  2FFD A;  1G1J A;  2W6A A;  1HGZ A;  3M06 A;  3P32 A;  1JUN A;  2HFE D;  1LWU C;  5CCG D;  2HG5 D;  4EIJ A;  1IO4 A;  3NFQ A;  1N7L A;  1NHL A;  1SFC C;  2PP6 A;  1FZB A;  1URQ A;  1AQ5 A;  2A45 H;  3VP9 A;  3V5B A;  3A7O A;  1GU4 A;  2Z4E A;  3MGN A;  3OA7 A;  2H8P D;  2HLO A;  3P8C D;  2CPB A;  1SQB K;  2NPS C;  3BVH A;  2XU6 A;  4XE5 B;  5CJ4 A;  2M8R A;  3RK3 D;  3VN0 A;  3GHG A;  3BRT B;  3U1A A;  5AW0 B;  1FJK A;  1GD2 E;  1YTZ T;  2Q5U A;  3HTK B;  1RF1 C;  5KLV K;  5APY A;  1ZN5 A;  2KP8 A;  4JF7 A;  2A45 G;  1M7L A;  5CCH C;  1JTH B;  5AW7 B;  1KIL B;  1N86 A;  1X9V A;  4O9B A;  3L37 A;  2WT7 A;  1KIL D;  1J1D C;  2M3B A;  2KLV A;  5AVT B;  1G2C B;  3H6P A;  1H89 A;  1J1E B;  1M1J A;  3N7N A;  1LT9 C;  2IX7 C;  2L5G B;  3OJA B;  4WY4 C;  1LTT C;  2WSC H;  2Q3I A;  4N3Y B;  2OYH C;  3MD0 A;  1ZR2 A;  5AW3 B;  1DEB A;  3H32 B;  2C9L Y;  3B5N A;  2W6B A;  3NXS A;  2Q9I A;  1N7S C;  3LIE A;  1MFZ A;  2CPS A;  3V4Q A;  2FKW B;  3HD7 B;  3M0A A;  1NTZ K;  3SWF A;  3RK2 C;  1URQ B;  3HRN A;  1HBW A;  1G1I A;  1L4A A;  1LWU A;  4XA4 A;  1GW3 A;  1JCD A;  3V2P A;  4JYB A;  4M3L A;  1SFC A;  1E5W A;  1FZE A;  4LLH A;  2R5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...