The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
117
|
sequence length |
400
|
structure length |
400
|
Chain Sequence |
ATYDPNQPVTVESFMPVEGKLREKVIVKGSNFGTDKSKVKVYFVDEAAERLSTVIGIDNNTLYCLAPRQLPGGNRIKVIVDGKEVTTDGTFKYEQAQNVSTISGSASKDGNDDGDLASAKFKYMWGIAAVGNNTVLAYQRDDPRVRLISVDDNKVTTVHPGFKGGKPAVTKDKQRVYSIGWEGTHTVYVYMKASGWAPTRIGQLGSTFSGKIGAVALDETEEWLYFVDSNKNFGRFNVKTQEVTLIKQLELSGSLGTNPGPYLIYYFVDSNFYMSDQNLSSVYKITPDGECEWFCGSATQKTVQDGLREEALFAQPNGMTVDEDGNFYIVDGFKGYCLRKLDILDGYVSTVAGQVDVASQIDGTPLEATFNYPYDICYDGEGGYWIAEAWGKAIRKYAVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of Structural genomics protein of unknown function (NP_812590.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.70 A resolution
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bacteroides thetaiotaomicron vpi-5482
|
| molecule keywords |
Uncharacterized protein
|
| total genus |
117
|
| structure length |
400
|
| sequence length |
400
|
| ec nomenclature | |
| pdb deposition date | 2009-06-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01833 | TIG | IPT/TIG domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Mainly Beta | 6 Propeller | Neuraminidase | TolB, C-terminal domain |
