3HRSA

Crystal structure of the manganese-activated repressor scar: apo form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
TPNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 65
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrsA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrsA02
2VXZA 3JW4A 4CZZA 1IN5A 1OYWA 3AAFA 3NRVA 1K7AA 1QW1A 1YLFA 5A2QK 3R0JA 3KETA 2XGXA 4UVCA 4ZH4F 2O61A 3I54A 4UHTA 1XN7A 1RZ4A 5D8KB 1T98A 1IXSB 3CUQA 5DV5A 2Q8KA 3GEZA 3HRTA 1S6LA 2MH9A 3WTYC 1BIBA 2FQ3A 3R0AA 1R5HA 3LAPA 4ETSA 3M8FA 1D8JA 1USSA 2TDXA 1BI3A 2NNNA 3WTXC 3IKVA 3LWFA 3NEUA 1XGNA 2EA2A 4YG2F 4LD5A 3GWZA 2A69F 3LA3A 4KYWA 3LA2A 4LMYA 3ZMTA 4WX9A 4P96A 2CO5A 4RAZA 4AIJA 1J2XA 3DKWA 4Y15A 4A0ZA 4RB0A 2D1VA 1IF1A 3H92A 1ZGAA 1K79A 2QLZA 2QBYB 2HOEA 2FMLA 3F8FA 2RQPA 3N97A 2IW5A 3J7AO 1D3YA 4EV0A 2HR3A 3K1PA 2FOKA 1P4WA 2DQLA 4L5IA 2IPQX 3P7NA 1E17A 1IN7A 1NHAA 1U5TC 2H09A 1R1VA 1S3JA 1ZYRF 2PMHA 1MD0A 3RPQA 1KU3A 2ESHA 1BM9A 3TO9A 4G94A 1U3EM 2FBIA 3QRFF 4ENMA 2P6SA 2P5VA 3FWEA 3LSTA 4GXOA 3KP3A 4EGYA 3KP2A 5HLGA 5CVRA 3DV8A 4KIBA 4XRFA 4MQVA 3ELKA 2XROA 2R7DA 5FFZA 2IRFG 2J5OA 4HA8A 3JTGA 5CYVA 4AVPA 3GYHX 5L3BA 4OIPF 1BI1A 2DLLA 3ZPLA 4HLYA 1UB9A 1OYIA 3F8MA 1CF7B 2ELHA 2FU4A 4P9FA 1HSJA 2W57A 1K6OA 1DP7P 1SD6A 1WRJA 4R8HA 1XDUA 3HIFA 2V1DA 3E6MA 2W84A 4N9HA 1IAWA 3F8NA 2G9WA 3BDDA 2VE8A 2VE9A 5DCMA 3RPUA 2DT5A 2HKOA 1RI7A 2DW4A 3Q9SA 2NYXA 1FZPB 1XSDA 5HS9A 4A6EA 4HZFA 2LF7A 3V4GA 2HFHA 3GF2A 4RB2C 3L2CA 5TJJA 1QO0D 4KN4X 2GCXA 1G6NA 2EV5A 4MHGA 3M7GA 1TTYA 2A07F 3WU0A 3DPLC 1R36A 4CHUA 3E5XA 4Q48A 1UHWA 2K5LA 3QU3A 4KIFA 4U88A 5LRSA 1B9MA 5ILUA 2QYOA 2VBWA 3ZMUA 4IRHA 2GA1A 1FP2A 4OMZA 4UUVA 4ON0A 1EV7A 4OOIA 4MNUA 2G7HA 1BC7C 3BJAA 4LK1F 4KA4A 1J9IA 1KU2A 4Z2YA 2ZKZA 2DAOA 4HBLA 1HSTA 5CVJA 2PLYA 1SD7A 3RKYA 1BOAA 2L01A 3WTUC 2L3DA 2PJPA 2O6GE 2DK8A 4BHCA 1TNSA 3HSFA 3CDHA 3QAHA 5D5VB 4PCQA 4A2UA 1HW1A 2DK5A 3B73A 2P6TA 2H94A 1G3SA 1IN8A 4BAYA 3FXRA 2L4MA 1ZLKA 1TQMA 3C18A 4A0XA 4PDKA 1JXSA 5HOOA 3HTUA 3NQOA 5ILVA 2STWA 5HLIA 1O7LA 3T8RA 4Y17A 3BJ6A 1J59A 2UXXA 3K1MA 1OKRA 1JHFA 3GUDA 4KN7X 4ENKA 1B9NA 2DPDA 2Q0OA 1LDKB 3FMRA 3ML6A 4L9NA 5D6EA 4RGUA 2QVOA 5LBQA 3V8KA 2XASA 1QZYA 1XCBA 2HTSA 4YIFA 5HDKA 1X3UA 3ERED 1MDMB 3WTZA 3T5XA 2M8EA 3F72A 1LNWA 4P55A 5BS6A 1TNTA 4L0YB 1WQ2A 5LHGA 1TLHB 4OIOF 3V7CA 4HX8A 4WXDA 2F5FA 4YFKF 4FT8A 3F8CA 1JE8A 4L18B 1W4MA 2A61A 4A0YA 4MEXF 1FLIA 4HLXA 3IWZA 1KYZA 5FB2A 2BYVE 3O6BB 4A12A 3L7WA 3JSPA 4H0EA 5LEKA 2FNPA 3HRUA 3ZP5A 1R23A 1HBXG 3RJPA 4AIKA 4XBFA 2YX7A 5D4RA 2IA2A 1UFMA 2RV8A 3F6VA 3R4KA 5K5OA 2Q2EA 2EJRA 3GXOA 2HQRA 3EETA 2V1XA 1YTYA 1W7PA 4ASNA 2NS0A 5E1XA 1LEAA 2DTRA 5D5WB 3J80Z 3L00A 2NAZA 1PP8F 2RN7A 4ESBA 5KK1A 2PN6A 2ZNZA 2HDCA 2NNYA 4GCVA 1IXCA 3U9GA 2XAJA 3KP4A 3WGHA 3RIRA 2H3JA 3E5QA 2Y0MA 2DFIA 3SZTA 2MH2A 2XAGA 5JFRA 4TV7A 1YQAA 4BYYA 1EH6A 2AS5F 3Q9VA 3DF8A 1O7FA 4WWCA 1T2KA 2CWEA 2QUFA 2ACJA 1P6RA 1XMAA 4IXAA 2GXGA 2E1NA 4M73A 2MLKA 4EMSA 4E70A 4LLLA 1J7KA 1S7OA 1TW3A 4BHPA 4MTEA 5K5RA 4ZYHA 2HTJA 2H6BA 3K0LA 2DPUA 3CUOA 3I53A 1QBJA 1ZREA 4I98B 2JZYA 1FT9A 5D6FA 3IWFA 5L3GA 5FO5A 4EVIA 2FNAA 2VODA 3RTRA 3RYRA 3FXQA 4O6JA 2OD5A 2OA4A 3GZ5A 2EFPA 1FOKA 2VONA 4M71A 1FY7A 2OU2A 2VC1A 2BE5F 3N4MA 4KFCA 1D8KA 3KEOA 1OYYA 1T6SA 3P9IA 2VC0A 3TDZC 2CYYA 1REPC 3J81K 4RAYA 1DUXC 2YX4A 4ZZDA 1F5TA 2F5EA 5F64A 3I59A 4UVBA 2K27A 2OQRA 3ISPA 4BHBA 3MAJA 2QZ8A 5DUKA 3K2ZA 5FGMA 2FXAA 3SXYA 1S7AA 2VT2A 2KIFA 4CGZA 5DCFA 3P9CA 4RGSA 2P8TA 2MD5A 1Y0UA 1ONVA 4LB5A 3I64A 3C3WA 4ZYEA 4Q47A 1XDSA 1FNNA 2O3FA 5E20A 3K1NA 2VT3A 2OAZA 1Z7UA 5DCMB 3ECHA 3KZZA 4WCGA 1FPQA 3LFKA 3L9FA 4XLNF 3MCZA 4YIIA 2PEXA 4N0BA 4S05A 1KA8A 4RB1A 2EFWA 3LA7A 4HQEA 3B02A 4OMYA 3FX3A 2BEOA 4I02A 4G7ZF 5L3FA 4LG0A 2A5YB 4NQWA 1FC3A 5BMZA 5E8IA 2P7VB 3HYIA 3JAMZ 1OR7A 1Z91A 1ZH5A 3F6OA 4IJAA 1YFHA 4G6DA 3WGGA 4RS8A 1BN5A 5AIPA 2ADUA 3GFIA 2EB7A 1O3RA 4WXHA 2ZMEB 4ENNA 1FYMA 3P9KA 4G8XA 3JTHA 1DPRA 1BI2A 2K4YA 2K7LA 2CQKA 4AWXB 1FSEA 2HGCA 2EFOA 2V1UA 4IVNA 1HKTA 1BC8C 1KYWA 5LEJA 2E1CA 4HYEA 4XSZF 2VOOA 2FMYA 1ZN2A 2P7CB 4B09A 1U8RA 2QENA 2QWWA 5HDGA 1V4RA 2Y75A 3CUQC 3TGNA 2STTA 4I0AA 4LLNA 2OBPA 2V79A 3WTTC 2GZWA 2IT0A 2WTEA 4EJOA 5D5UB 1HQCA 2DO7A 1ZG5A 1J75A 3H3UA 4KMUX 3MQ0A 4L9JA 1IN4A 1G3TA 4CXFA 4BNCA 4HF2A 3Q5FA 6PAXA 2RDPA 1U6GA 1FWZA 3EUHA 1R7JA 2JSCA 3ZMDA 2XVCA 2VBXA 1R58A 3RYPA 3L09A 5EEHA 3PFIA 4KNYA 3U2RA 2XRNA 2PFBA 1XGMA 3E19A 1EH7A 1MJBA 1I27A 2HYFA 4CO8A 4A6DA 2W25A 4DQ2A 4OIQF 1YW9A 1G3WA 2K02A 1JHHA 1HW2A 1YW8A 5LGTA 2F5CA 1ZG1A 2ESNA 2X4HA 4Y13A 1LB2A 3ZN1A 3GO5A 3HHGA 2RVCA 1AOYA 1L0OC 3ROUA 2LX9A 2ZBKA 2R3SA 3SZPA 5FLXZ 5FD6A 1T38A 1ZRDA 1BBYA 3D0SA 2K4JA 3TOAA 4MTDA 2XKOA 4M6YA 2F5DA 3BWGA 3KCCA 4DNCA 1LDJA 4U0WA 2K5FA 4AD9A 3V8JA 2FRHA 2QBYA 2VBZA 1S8NA 4ESFA 1LVAA 2JRTA 2KRFA 1FX7A 2CSOA 1LJ9A 2MLGA 3GFMA 2V9VA 3KEQA 1W7PB 3FXUA 3M8EA 3E5UA 2JPCA 3TO6A 1P92A 2LSOA 1STZA 3JSOA 4IHSA 2MBFA 3EDPA 1RIOH 5D8LB 5DYMA 3ZMVA 3F22A 1T39A 4LGWA 2LKPA 2FA5A 1U78A 2FF4A 5F6FA 4HAMA 3DP7A 3QU6A 2D45A 4IRIA 4ZZLA 1ZAOA 2WV0A 1JGSA 3ZMSA 1KU9A 3I4PA 2FSWA 3BROA 4HX4A 1XB4A 1HKSA 4IRGA 2C6YA 5LLQA 3RKWA 4BQAA 5HLHA 1ZHFA 2BBYA 1QZZA 3PQKA 2L54A 2H6CA 5ICEA 5BQTA 5L3EA 2DBBA 2RC4A 1SMYF 2DQRA 4EM2A 4I0BA 3I5UA 1QQIA 2HZTA 3IKTA 4S04A 4U7BA 3OOPA 3HUGA 4PGGA 2P5LC 2VOPA 1O3QA 1YW7A 2ZXJA 1Q1HA 1PP7U 3DXJF 2G7UA 3W6JB 4CICA 2GA2A 1IRFA 1CGPA 4ZYGA 1KQ9A 3FZVA 4N9IA 3FHZA 1LQ1A 1ODDA 1MKMA 4D0PA 5LHIA 2A3SA 1TQPA 2ZNYA 3ZN0A 5IT9Z 3I59B 3DEUA 3F21A 5HDNA 1HW5A 1P4AA 1XGSA 4A5MA 2VBYA 4EGZA 1RUOA 2XAFA 1WI9A 4HDVA 1WWXA 4LK0F 1J5YA 1IRGA 4HX7A 3V7SA 3GZ6A 1SFUA 3CUQB 4LLGF 3D5LA 2CG4A 3VOEA 3ULQB 1ON2A 2CFXA 3PQJA 3ECOA 2HYGD 1I6XA 3KLOA 4EJVA 5ICGA 4QWQA 5ICCA 2COMA 4P5OA 1ZRCA 2IA0A 1IN6A 2GIVA 2A6EF 2GWRA 3CO7C 1XD7A 1YYVA 4NB5A 4KICA 3WODF 4RGXA 4O5VA 1YG2A 4LG0B 1P2FA 1KQ0A 2BGCA 2QQBA 3RI4A 2MA3A 1SD4A 3LQRA 2V6CA 2ISZA 4B8XA 2Z33A 1W7PD 2D2WA 4F7ZA 4WK8F 5D4SA 2XAHA 2HQNA 2KKOA 4IF4A 2LDUA 4WXCA 3T8TA 3KP5A 2A6HF 2E7WA 1PDNC 3BPVA 1DDNA 3WG9A 2UXNA 3WTWC 4PZJA 1B6AA 5J8FA 2BV6A 4WF2A 1ON1A 1MJAA 4HV5A 2KIUA 1F4KA 1ZGJA 2F2EA 3R6SA 2ZJ2A 3J80K 4BH9A 1SD5A 2IP2A 3TOBA 4A5NA 3M1EA 3ZQ7A 1PUEE 1ZARA 1GXQA 3QPTA 1UCRA 1D5VA 3FM3A 2FE3A 3WE3A 1E2XA 5CVVA 5JI6A 1VTNC 1FP1D 2EFNA 4FHTA 1YIOA 1KU7A 1LEBA 2IJLA 2YPRA 4KIGA 3F23A 1U5TA 4HDUA 4GYGA 3BY6A 3SQNA 1K78A 1TW2A 5E8GA 4UNOA 1I5ZA 4L0ZB 3OV8A 5LRRA 3QP6A 1RUNA 3V7RA 3REOA 3KP7A 2M45A 5JHUA 4MQ9F 1GVJA 5ERIA 2EV0A 5JR3A 3ABUA 1AWCA 2XV4S 1C0WA 2EFQA 3E6DA 2JTVA 2P4WA 4K2EA 1ZLJA 2LNBA 3KFWX 3WTSC 3E6CC 3IRRA 2WWYA 2WC2A 1SFEA 4Q4ZF 2XIGA 3MHXA 2XUBA 5ILSA 1ZG3A 2KJBA 1R1TA 1FYLA 2ZCWA 4RB3C 1WSUA 3FM5A 1B4AA 4XSXF 2OZUA 1QNTA 1IW7F 1FSHA 5JVTA 3TQNA 2Z9OA 3LAJA 2O0YA 4HW0A 2QM3A 4ZYDA 5DUIA 4I01A 3DPTA 1BI0A 2PG4A 1SAXA 1IUYA 2O8XA 3QP5A 3RKXA 1HKQA 2NRAC 5BPDA 2E7XA 3K69A 5CLSA 4HF1A 2M5WA 1T0FA 4UXNA 4HOBA 4EQQA 3F8BA 4I09A 2W85A 3QPHA 2UWMA 2W24A 3C1DA 1XMKA 1XGOA 3MEXA 2FEZA 3FMSA 4GYIA 1FYKA 5ICFA 2DI3A 1LDDA 1XCVA 3RDIA 2IA1A 4G6QA 1XSXA 5J8CA 4KUMA 1F1ZA 2P5KA 4QLCU 3JAMK 3MFKA 1FBUA 1KGSA 1SFXA 1Z6TA 5ED4A 3GX4X 4UV8A 2M87A 1QVPA 3CTAA 1KQ8A 2FBHA 3HHHA 3S2WA 4JBAA 5FFXA 4CDGA 4U0YA 3V8LA 3G3ZA 2PMUA 1QPMA 4FX0A 4M9XA 4M74A 3F3XA 1RNLA 1FBSA 5BOXA 1BJAA 1H0MA 2OQGA 1W5SA 4G7HF 3DQVC 1OMIA 5IT3A 2RKHA 3HTSB 4AIHA 5CVIA 1R00A 1P4XA 3HSEA 4M9ZA 5DEQA 2KIMA 1H9GA 3E97A 1EH8A 3CLOA 3EYYA 1R1UA 5LGUA 3R60A 2ISYA 4PGHA 2LF8A 1MJ9A 3ABTA 5HVQC 2MC3A 2M1BA 4ESJA 2J5PA 3IL2A 1YS7A 2D1HA 3BZ6A 4M9SA 4UV9A 1O3TA 2QQ9A 5DD4A 5DDGA 5E17F 4YFXF 4XLPF 2HKXA 3HSRA 5CVUA 4LB6B 3MWMA 4ENJA 1F9NA 2YR2A 3GFJA 2EA4A 4L9TA 2ZMEA 1YS6A 2RGVA 1H9TA 5EEGA 3WU1B 1FBQA 3TKYA 3HRMA 1MGTA 2RNJA 4KT5C 3TO7A 1A04A 1G3YA 5L3DA 4JQFA 3BPXA 4LFUA 2ETHA 1I1GA 4G9YA 5FD5A 2PQ8A 3GFLA 4OINF 3COAC 1B1BA 4FX4A 4EM0B 3O3KA 5FLXK 2GXBA 3TDUC 2DU9A 3I0TA 2R7FA 1Z1DA 5AONA 1CF7A 3R61A 3KP6A 5AIQA 3GVAA 3WTVC 4M6XA 2H27A 4L9VA 3I58A 4I2OA 3BJOA 4HV6A 4G7OF 2AXLA 2ZFWA 3K9TA 4I7HA 4P9UA 2Y48A 5DD8A 2HWVA 1W5TA 4GGGA 4IHTA 3H3ZA 3HOTA 3DFGA 4IPAA 4EJTA 1O3SA 5E18F 4R79A 4BXUA 2EK5A 1ULYA 5H6RA 1TQIA 1BYMA 2XHKA 3VODA 3SFZA 3SHFA 3LQQA 2IVMA 1YO5C 2Z99A 3BOQA 5F1RA 2JT1A 3VFZA 3WGIA 2CGPA 2HS5A 1J0RA 1SMTA 1G4DA 5J6XA 5K5QA 3CJNA 4Q5SF 2UZKA 2O03A 2OZ6A 5H20A 3W6KB 5LGNA 4RGRA 1U5TB 3MZHA 2K5IA 4UVAA 2GQQA 2KJCA 1K78B 3O2PE 2XKPA 3ZMZA 3VB2A 5CJ9A 5KVRA 2FBKA 1S29A 3WE2A 1ZRFA 2A68F 4U7DA 3KZYA 3M9AA 3QOPA 4GO1A 5HS7A 3GW2A 2B0LA 2K86A 2Z5UA 5LHHA 2HEOA 3I71A 2ZO4A 5BPIA 1Z9CA 3IC7A 1USTA 3VEPA 3G73A 1UHMA 4NHJA 5TRDA 3T0YA 2EV6A 4O3MA 2K4BA 1B59A 1Z6RA 1Z05A 4KMFA 2EWNA 2GAUA 3J81Z 2PBIA 3C7JA 4JK1X 1R5GA 3CO6C 5E1WA 2YU3A 5A2QZ 1BIAA 1QGPA 3E6BA 3T1BA 1TBXA 2JPBA 5K1YA 2VN2A 5IT9K 4OIRF 5L3CA 3EQLF 4R1HA 4EJWA 2XAQA 3IHUA 1MZBA 3IRQA 1GHCA 3KLNA 4MGRA 1IZ1A 1GXPA 1U2WA 4YFNF 1DPUA 2PI0A 4EM1A 2L02A 4U0VA 1V3FA 4EJUA 2QQAA 4MEYF 3KE2A 3HRSA 2X0LA 3EYIA 4CYDA 4KDPA 4L5JA 2CW0F 2L4AA 4OU0A 2YSRA 1OPCA 3MZYA 4M72A 3HOSA 1MDMA 1O57A 2M30A 3FF5A 3FMQA 1R22A 4LJZF 5H6QA 1I1SA 1XSVA 1HXDA 1L3LA 5HS8A 3GLXA 1WKMA 4HF0A 4HQMA 1IXRC 5D5XB 2Z3YA 3U1DA 5E1ZB 3BP8A 3E3VA
chains in the Genus database with same CATH superfamily
2VXZA 3A03A 1IRXA 3JW4A 1YP5A 5GAOp 4CZZA 2NUZA 1IN5A 1TWAJ 1WXUA 3CCVT 1OYWA 3AAFA 1N27A 2LT4A 2CQXA 3KXTA 3NRVA 3D5RC 1RRJA 4FTHA 1K7AA 2DTHA 1QW1A 1GBQA 2KISA 5GAN5 1YLFA 1VQNQ 1M8VA 1QP3A 5GPCA 5A2QK 4M3FA 2CS3A 4HEA2 3SDBA 1VQ8I 3OS5A 1AA7A 1PKTA 4RTWA 3R0JA 4BY7J 3KETA 3QWLA 4UB8C 1PD0A 1W4SA 3OY9A 1X75C 2XGXA 2CDTA 2M7AA 4UVCA 4CSWA 2XB5A 4E7SA 4ZH4F 4MZMA 3VUBA 4QKUA 2O61A 2XGDA 3I54A 4F7UF 4P1WA 4D1QA 2BTTA 3NPFA 4UHTA 4BQOA 3BG5A 2E41A 1XN7A 1AZEA 1NM7A 2MWPA 1ZSGA 2A08A 2HNHA 4KITB 1RZ4A 2JK3A 2DJZA 2DO3A 2PZ1A 1AVZC 2ABLA 5D8KB 2ECCA 1T98A 2V9KA 2W00A 1IXSB 2EQMA 2H3EB 2O88A 5GMKi 3CUQA 1IRZA 3RNJA 5DV5A 2FZCB 2Q8KA 2QKMB 3GEZA 3HRTA 2KRNA 5K7ZA 5GMKj 1S6LA 2MH9A 2BZYA 2CQNA 2VPLA 3D7SB 3WTYC 3JRDA 3CC7Q 3BE3A 1BIBA 2EQUA 2PVOB 5KCOA 1PSEA 2YWWA 2FQ3A 2EQIA 3GTLJ 2Z16A 3R0AA 1R5HA 3LAPA 5DM7R 3VYUB 4ETSA 2XF7A 3M8FA 1D8JA 5GAOq 1YITI 1ABOA 2ID3A 2XI9A 4HSRA 1USSA 1X6GA 1A6IA 2ZXHA 1JJ2A 4EMKB 2TDXA 5FKNA 1JJ8C 2DXIA 2GTJA 1BI3A 3AG1H 2NNNA 5LL6S 3WTXC 3IKVA 3LWFA 3NEUA 1XGNA 3CCUQ 2EA2A 4YG2F 5I11A 3JB9G 3A8MB 2A6TA 1CKBA 2RJDA 1TS9A 2NUTA 1VQ6T 2LX7A 3CCQQ 2HXIA 4LD5A 2LTPA 2XGCA 3GWZA 4DOZA 5B1AH 2RM4A 2A69F 3VS2A 4J9FA 3LA3A 3JCMV 2JJ7A 4KYWA 2BE9B 3CCMA 3LA2A 3CJTB 3QXEB 3I5SA 4LMYA 3UPUA 2D9TA 2PMZN 1G5VA 4D9JA 2KDSA 3ZMTA 2P84A 2EIMH 2LOOA 4XKVA 3OYCA 2BZTA 4WX9A 3PIOF 1VQOA 1WCMJ 2CH4W 2IBDA 2JJ9A 4RG8A 4P96A 4XTXA 4C92A 3ZQQA 2KSSA 4RAGA 2HDWA 3AHUA 4DGWB 1YRNA 1UTIA 2CO5A 4RAZA 5CQGA 2EW3A 1H88C 3UA7A 1D0YA 2E36A 4AIJA 2WACA 4AG2C 3PTAA 4IX7A 1J2XA 3DKWA 3OSGA 4Y15A 5GANf 4QVDA 4A0ZA 4RB0A 7AT1B 2D1VA 1WI7A 5L23A 1IF1A 3H92A 3FDRA 2JA8J 1QKXA 3URGA 1N77A 2C0TA 1K1ZA 1ZGAA 4J9EA 3CMAQ 3CBOA 2KRCA 2E3HA 1K79A 2QLZA 1FEXA 3K4BA 2QBYB 1RLPC 2HOEA 4ZDPA 4XKWA 2FMLA 3CXCS 4WTOB 3F8FA 1TWFJ 2VQCA 5AT1B 3M54A 2LZ6B 4F7UB 2OTJA 2X6YA 2RQPA 3N97A 3CCUT 4FQGA 2IW5A 4II2A 3CD6I 1TUGB 2E3IA 3J7AO 1D3YA 4EV0A 4X9DA 4HCZA 2HR3A 3K1PA 3CCLI 3A8HB 4A53A 2K3PA 3BTLA 2XPVA 4J00A 2CS7A 2FOKA 2HMAA 2L9RA 4M78A 1P4WA 2DQLA 4E7HA 4LG3A 5GAEJ 3JCMQ 4L5IA 3CMEI 5B66C 4CI0C 2IPQX 2DFUA 3P7NA 2A5WA 2WSCE 1NG7A 1E17A 4WCIA 1Q1VA 1IN7A 1QZEA 4JX4A 1Z9QA 5IOZA 2E5KA 5LJ3f 1YHQQ 4Z88A 1NHAA 1YCSB 1RKTA 3RQIA 3THKA 3R6NA 1U5TC 3OIOA 2H09A 1Q81U 1R1VA 1S3JA 1ZYRF 2PMHA 1MD0A 2DMQA 1X43A 3RPQA 1HC8A 2J7IA 1RI9A 3KIOA 2V1NA 1KU3A 2ESHA 3TEEA 1BM9A 2QA4A 3TO9A 1OYXA 3GIBA 4G94A 5M3MJ 2QQ8A 3KUFA 3RDVA 1YIJT 2KT0A 5LJ5h 1FMKA 1U3EM 4ATOA 2FBIA 3QRFF 2CZ7B 4J9BA 1KJWA 4ENMA 1AOJA 1NH3A 2DVJA 4QSHA 1OCPA 2BE7D 2P6SA 2P5VA 3FWEA 3LSTA 4GXOA 3KP3A 1Q81C 2K9MA 4EGYA 1M4ZA 3BG9A 4RLQA 2DM1A 2V8JA 2DMPA 2HQAA 4C8QA 3PL8A 5LJ3e 4U87A 3KP2A 2KGTA 5HLGA 5F0FA 5CVRA 3DV8A 5C0MA 4KIBA 3MP1A 4XRFA 2EYXA 3TMOA 1ZUYA 4KUIA 5C4JJ 4MQVA 3ELKA 1XOVA 5FWBA 2KLOA 4XTYA 1X01A 2XROA 4YRVA 2O7OA 1VUBA 2HBWA 2X51A 2R7DA 5FFZA 2IRFG 5GANd 2J5OA 4PJNA 3BTIA 4HA8A 3OA6A 4M7AA 1M90U 1I39A 3JTGA 4M75C 4PJOA 2J6OA 4E7KA 2J05A 3OYYA 5CKDA 5CYVA 4AVPA 2X6WA 1VQ4A 3GYHX 3GBQA 4BD3A 3G4ST 2FD5A 2RREA 5L3BA 4OIPF 4BBSJ 4XICA 1IXDA 1BW6A 1BI1A 2DLLA 3ZPLA 3CCRT 3VS5A 1AWJA 4HLYA 2LQKA 1U06A 2IXSA 1UB9A 1OYIA 3F8MA 4D5CA 1CF7B 2CMPA 2AIRB 1ZBXA 1EZZB 1KHIA 1QCFA 1U3OA 2ELHA 2FU4A 1SEMA 1K76A 4N4GA 1M1EB 2K9GA 5EC7A 4BJTA 1M90C 4ZTJA 2ME6A 1WXTA 1JB0E 4P9FA 1JJ2S 1Z3XA 1OX8A 2FYKA 2MK5A 3E9GA 4HNUA 1HSJA 1V1CA 2DRKA 3HGYA 2F5TX 5IXFA 3CC2Q 2W57A 3H0HA 2DTZA 3CCMI 2R7QA 5TISC 1K6OA 1DP7P 3S93A 4HRIA 1N9RA 3QWYA 2OTLA 3BCAA 4XKCA 1SD6A 1JXMA 2R92J 2DT6A 3QIIA 1WRJA 3H35A 2V1QA 4IOCF 4R8HA 1RAHB 1XDUA 1VQOI 1OV3A 5LJ3d 2XU8A 1NLOC 3HIFA 4C2MJ 2LQNA 3BDUA 1GRIA 4F17A 2R5YB 4QPQA 2LMJA 3HOYJ 2V1DA 1RL2A 2FEIA 2M2EA 3E6MA 2QQSA 3MKDA 1VQLA 2W84A 4N9HA 3DKYA 3O8GA 4XNFA 2DL3A 2DVEA 3SB2A 4AMCA 2RHZA 1IAWA 3F8NA 4A3FJ 1MUZA 2G9WA 1Q81R 2HOSA 3BDDA 2R5ZA 2E35A 2VE8A 1WPKA 2MSYA 1X2KA 1T0HA 2VE9A 5DCMA 4A3MJ 1TSFA 3RPUA 2OX7A 3MEAA 1N75A 1ZUUA 4PFPA 8AT1B 1UGVA 4RTYA 2DT5A 2HKOA 3CDLA 2E71A 3JREA 4CCNA 3H9JA 2X1DA 3ESWB 3J7YJ 1RI7A 3FXJA 2DW4A 1WHKA 2DK3A 4M3EA 5GPAA 1V29B 2RI2A 3UA6A 5IXBA 2RAEA 4S0HB 5IOYA 3JCMg 4YELA 5HK0A 3Q9SA 2NYXA 5FKKA 3A01A 1FZPB 4JUVA 2PJRB 1XSDA 2ZGWA 1ZQ3P 5HS9A 4A6EA 2VXFA 4FIBA 1Y39A 4ZDLA 2DBMA 3CCEQ 3LH0A 4HZFA 2ZJQF 2RQWA 1YJNT 2LF7A 3V4GA 2OF7A 1I4K1 1YJ9Q 2HFHA 4PJOB 3GF2A 4RB2C 1G2BA 3L2CA 4XK8E 4FSSA 1VNDA 2ZSHB 2JMCA 1OPKA 1M90R 5TJJA 1QO0D 4KN4X 1OU8A 2O9LA 2B7EA 2GCXA 3CJQB 1ETKA 1G6NA 1WX6A 2EV5A 5KYWB 4HKEA 4CC4B 3EG2A 3I4MJ 3IUOA 4MHGA 3M7GA 3GTKJ 2KFDA 1TTYA 5HODA 2A07F 2KIQA 3CESA 2DDAA 3SZGA 3WU0A 2QGFB 1V54H 2QQRA 3DPLC 1POGA 2I8DA 1R36A 2QA4I 1MSFC 2CZ0B 2P4TA 5GP9A 3GTGJ 2BZXA 4CHUA 2RMOA 1M27C 1I3QJ 3E5XA 4X6AJ 4NOYA 1T0FC 2CW7A 4KBMB 4Q48A 2KI7A 4FW2A 3EFSA 1UHWA 5DS9A 3G1OA 2MOXA 1JKPC 1TWHJ 3BG7A 2V8KA 3LSMA 2YT6A 1M2OA 2EYQA 2K5LA 3QU3A 5FROA 2A36A 3ER0A 1DGWY 2NVTJ 1KQ1A 3AG3H 4KIFA 4U88A 4FYWB 1B9MA 5LRSA 5ILUA 5E3MA 2QYOA 1MMAA 2VBWA 3H41A 3AFHA 3H8ZA 2V7FA 3CCET 1Y1WJ 5GJVB 3B6CA 4ELZC 1VQ8Q 2KPMA 3ZBDA 4JZ4A 4X9CA 3ZMUA 4DOVA 4IRHA 2GA1A 4YIRX 1MMNA 1WPYA 1FP2A 2HOAA 4OMZA 4MIMA 1ENHA 4UUVA 1LE8A 2K3FA 3G6ET 5FLMJ 2RK2A 2NVXJ 1VQ4I 3G1LA 4PJOC 2K2MA 4ON0A 2ZPGB 1VQMQ 1EV7A 3QDFA 4IKFA 4OOIA 4MNUA 1E3OC 2KE9A 2NOGA 3X26B 1UJ8A 5C3EJ 2KVQG 2RHIA 1U1TA 3FXOA 1X1DA 1QWEA 2RB6A 1IHWA 2AQFA 2K9QA 1SSFA 2CUDA 2G7HA 1I0CA 5IPAA 3BJAA 4LK1F 5IP7J 4KA4A 1BC7C 1J9IA 1KU2A 2EVRA 4Z2YA 2ZKZA 2DD5A 4LDXA 4FE7A 2DAOA 1AD5A 1OEBA 2FL7A 1V5FA 1LPQA 4HBLA 2BUDA 2O9VA 1TWBA 1HSTA 2KT1A 2OJ2A 4ZGDB 3KPHA 5CVJA 1VI0A 1H8AC 3PIOA 1BCOA 2PLYA 1YI2Q 1RKWA 5B5EC 1SD7A 3RKYA 3ZQCA 1BOAA 2L01A 4FYVB 3WTUC 2NVQJ 4M75G 3C95A 4BJ5C 2L3DA 2FUG2 3DEWA 2O6GE 2DK8A 3SEQA 4BHCA 2PJPA 1YITQ 1TNSA 1YNZA 2AHJB 3HSFA 1WJFA 5J1RA 1BW5A 3CDHA 1VIEA 1PG5B 3QAHA 4IO9F 3UR3C 5D5VB 4PCQA 3U21A 1HW1A 2DK5A 4W1UA 4XMYA 4A2UA 3B73A 3L2QA 3GTOJ 1J3TA 2LG4A 2P6TA 2H94A 3N05A 3CC4A 4D8KA 1G3SA 1IN8A 3BR2A 4BAYA 1VQLI 3GMEA 5F27A 1W70A 2R5AA 2OAUA 3FXRA 3PVQA 1VQ5Q 2L4MA 5J39A 3OSFA 1SVLA 1ZLKA 3E1SA 5GAOn 1TQMA 1ETXA 4IURA 3C18A 1AKHB 2EPFA 2O4XB 4A0XA 1BA5A 1R77A 2YUQA 3CQTA 4EMKC 4PDKA 3ZQHA 1JXSA 2EBIA 4KT0E 5HOOA 1X2MA 3HTUA 3NQOA 2O8KA 1OU9A 3I56A 5ILVA 2STWA 1X19A 2R7ZJ 1VQ6I 5HLIA 1E3HA 4IQ4A 3L1PA 4J7IA 3HL8A 1O7LA 4ZNXA 2LMDA 3TEDA 3A5ZB 3MP8A 2O01E 2HQXA 4BQNA 4V2FA 1Y96B 2KMTA 2KRSA 3F70A 3FXMA 2GF7A 4F3QA 3DBHB 3T8RA 1HK9A 4Y17A 3BJ6A 3CLQA 1J59A 2UXXA 3K1MA 2NXNB 3IV5A 1E7OA 5B3SH 1OKRA 4CCOA 5GAHJ 1JHFA 3GUDA 3LSHA 4KN7X 4C9YA 2ED1A 2GFAA 2LCLA 4ENKA 2MD0A 3ZQGA 4XRSA 1B9NA 2DPDA 1Z77A 5GAN7 2Q0OA 2H1LA 2H8HA 4XU1A 1LDKB 3VPRA 3VKIA 4BS9A 3S1RJ 3CD6Q 3FMRA 3ML6A 3DB4A 5C6SA 4L9NA 5D6EA 4RGUA 3CCLQ 4QVZA 2Y0SN 2DA2A 2EZIA 2QVOA 4QPOA 5LBQA 1IO6A 2DIQA 3V8KA 4UUTA 1N5ZA 1IG7A 2XASA 1QZYA 1C1AA 2LKSA 3WVEB 2RJEA 3UT1A 3VYHB 1XCBA 2HTSA 1S72A 4YIFA 2B63J 5HDKA 3RZOJ 1X3UA 3ERED 2CT3A 2YUOA 1MDMB 3WTZA 3T5XA 1SG5A 2M8EA 3F72A 2HL3A 1NJIU 1LNWA 2MGQA 3H5NA 2KXCA 4M78G 4P55A 3VRYA 1AHJB 1GUUA 5BS6A 1TNTA 4L0YB 2M9HA 1YFNA 4R55A 1WQ2A 2CH4A 5LHGA 1TG0A 1TLHB 4I76A 5GTIC 4ZN1A 1D0XA 1XTDA 4CC7A 4OIOF 3QPLA 1UGSB 1WNLA 4JOMA 3V7CA 1ACIA 3M8JA 4HX8A 4WXDA 2F5FA 4YFKF 1A6QA 1X6OA 2ZC2A 2CJJA 2DZ9A 1D0ZA 1FIAA 4FT8A 3HJEA 3I5RA 3L2ZA 3AG4H 1YX3A 3F8CA 1JE8A 2LTOA 2VUBA 4L18B 1VQ9T 1W4MA 2A61A 2ZMEC 4A0YA 1SEUA 4MEXF 3NWSA 2FPFA 5CKHA 4CH7A 1MMSA 1FLIA 4B3AA 3OYNA 4HLXA 3I55T 4JRPA 3IWZA 2VLAA 1KYZA 5FB2A 3OYKA 2MF2A 3M9QA 4L6V5 2BYVE 3VDXA 4AFZC 3O6BB 4A12A 3L7WA 2EGEA 1LOJA 1VQKA 3JSPA 4BY1J 1YIJI 4H0EA 3FK6A 1Z7LA 2DN0A 2NLUA 2HAXA 5LEKA 4Y4RA 3EG9A 2FNPA 2RQUA 4C8QG 3HRUA 3ZP5A 1R23A 1HBXG 2KHMA 4IUTA 4LUDA 3RJPA 2DRMA 4AIKA 1TUDA 2LRQA 2DX1A 4XBFA 2YX7A 2QDYB 3M55A 5D4RA 4PL6A 4OAZA 4I6ZA 1RAFB 2IA2A 1UFMA 2RV8A 3QDRB 1FMWA 4M7AG 3F6VA 2L89A 3C12A 4PJOG 2AKLA 2KRMA 2CRGA 2EFIA 2CV1A 3G71T 1P9QC 2RO0A 3R4KA 5K5OA 2P0KA 2Y4XA 4VUBA 5KYUA 2Q2EA 2R7SA 4M75B 3ZL7C 2EJRA 3GXOA 2HQRA 3GCMA 3G4SI 3EETA 2V1XA 1YTYA 3JCMX 4KULA 2XDVA 1W7PA 2JQ7A 3CCRI 1GFCA 3ZQFA 5HK3A 2M4KA 4ASNA 2ESWA 3CCMQ 2NS0A 5E1XA 3FXKA 1GCPA 3H0FA 1LEAA 5M3FJ 3JV3A 1WJAA 2M16A 4K11A 5E79C 2DTRA 5D5WB 3J80Z 2JTFA 3L00A 3I56I 1ZR2A 5E3OA 1VQOQ 2NAZA 1PP8F 2LQWA 1D3BB 4N0AC 2R4GA 2FPDA 3PNWC 1MH3A 2A37A 2O2OA 4IUVA 2RN7A 4ESBA 5KK1A 2HPIA 1R9TJ 1NZ9A 4XTWA 2PN6A 3BR1A 5LFAA 3S3NA 3IQLA 2LP0A 8ATCB 2FHDA 2L0KA 2NUTB 1HCRA 2VKNA 2ZNZA 4N4NB 2EYZA 2LQ8A 1NG6A 2HDCA 1GT0C 3EGXA 1TT5B 4GCVA 1IXCA 3U9GA 2NNYA 2XAJA 3KP4A 2OC6A 3WGHA 2H1KA 1X27A 3RIRA 3K70C 2H3JA 3E5QA 4RCBA 2Y0MA 5EDNA 3MD2A 2FG0A 2FPEA 2DFIA 4ESRA 3SZTA 3L2WA 1FIPA 1KONA 2MH2A 2ZJRF 5HLTA 2XAGA 2E12A 4DBHA 1YJ9A 4XLAA 5JFRA 4C92B 1AT1B 4TV7A 1JUMA 2RNAA 2R7RA 1YQAA 2OTJQ 2EQJA 2YLCA 1BOBA 2QF7A 4BYYA 1YRNB 1ETWA 2VJJA 3JSCA 5CCAA 2LNVA 1EH6A 2AS5F 4Y3OA 3Q9VA 4PSXA 4M75E 3DF8A 1O7FA 3I3LA 4WWCA 1T2KA 3GBGA 1UG1A 1VFCA 4KJZA 2DE0X 2FRYA 2CWEA 5GAMf 2N8GA 2QUFA 3PUBA 2ACJA 1P6RA 3L1AA 4CRIA 1OFCX 1XMAA 2QTVA 1WJDA 4BI4A 1FTTA 4IXAA 2GXGA 1S72I 2E1NA 4M73A 2MLKA 2GGRA 3VS4A 4EMSA 1J09A 9ATCB 1MGQA 3X25B 4E70A 4DOWA 4LLLA 1J7KA 1S7OA 3QODA 4Y33A 5DTDA 3W3CA 4LDYA 2GTOA 2PQWA 3JCMP 2XPUA 1TW3A 1TUCA 1YJNI 3UKGA 3MO8A 2ED0A 4BHPA 1RLQC 2X4WA 1NJIC 4MTEA 5K5RA 4ZYHA 3LW5E 3META 4J6XA 5GAOm 2QA4Q 2HTJA 2CUFA 5IY5H 4XN0A 3W2WA 1WHHA 5IHNA 1KG1A 4M78B 2HQEA 3BR0A 3QUIA 2H6BA 3DKMA 3QYGB 5FLVA 5GAMe 3K0LA 1FOYA 2MWOA 1W1FA 2DPUA 1NK3P 3PNTA 9ANTA 3Q3SA 3MCAB 3CUOA 4JZ3A 2A05A 3I53A 1QBJA 3H5AA 1ZREA 4I98B 1UMQA 2JZYA 1XG1A 1OQYA 4RBOA 4F7UG 2VQGA 1XJWB 1FT9A 5D6FA 3IWFA 5EZHA 5L3GA 3OBYA 3REAB 3ZXSA 5FO5A 2VC8A 4EVIA 3BCBA 2HVSA 5GAN6 2FNAA 2CU7A 4RAFA 2VODA 1B07A 3KYDB 1O75A 4IHYA 3RTRA 3G2BA 2B8AA 1HA8A 1YJWT 3SYTA 3RYRA 3FXQA 4O6JA 4LD9K 5DY9A 4A54A 2OD5A 1OZ3A 2NOJB 2KY9A 2OA4A 1K61A 1ZLMA 2DOAA 3GZ5A 4LD6A 4AT1B 1VQMT 3H0DA 2EFPA 2H8RA 3FB9A 1FOKA 2VONA 2R7TA 2YUPA 4M71A 2X35A 2JTMA 1FY7A 2OJED 2OU2A 3D1NI 4A3CJ 2VC1A 2CSIA 2KROA 2BE5F 2JM9A 3S17J 2BIVA 3GF5A 3S1MJ 4C8QB 3N4MA 3HGGA 4KFCA 2MG4A 1D8KA 3KFVA 4FASD 4M7DF 1UEBA 1F1BB 2LVMA 3CMEA 3KEOA 1VQ7T 1Y8RB 1OYYA 1XNIA 5LD2C 2KXDA 3BR6A 2DL5A 2WAEA 1T6SA 1ZGWA 4QQDA 3QYHB 3P9IA 2VC0A 1B72A 1NE8A 3TDZC 2VYTA 2CYYA 4B48A 3CQZJ 1REPC 1A5JA 1DU6A 2PUKB 1VYTA 2MFZA 1T56A 3J81K 4ORZA 4OMFB 4M7AB 5GAMd 4RAYA 1DUXC 2YX4A 2ZPBB 3FIFA 4MZTA 4ZZDA 1VQPT 1VZ0A 2XPWA 1F5TA 2F5EA 1I1JA 3S6WA 3KYCB 2HBPA 3SD4A 5F64A 5IN1A 2OTLQ 2VUMJ 3I59A 4UVBA 2K27A 3DPUA 2RI5A 3K7AJ 4IUUA 2OQRA 3OYDA 2E1OA 3ISPA 1FXXA 3PVLA 4BHBA 3MAJA 2QZ8A 1OI1A 2NVYJ 2RN8A 5DUKA 4GBQA 2YUSA 3K2ZA 5J3LA 4Z6YA 3MKLA 1PHTA 5FGMA 1VQLQ 2FB7A 2FXAA 3SXYA 1W6XA 2HZYA 1S7AA 2VT2A 2CW8A 1ZK8A 2R7XA 1I81A 2KIFA 3QWXX 4CGZA 3J7AF 1CSKA 1Y0MA 5DCFA 1UHFA 1YWPA 3P9CA 3CCJA 4RGSA 1ORKA 2P8TA 1I6HJ 2MD5A 3PT9A 4XU0A 3JCMJ 3INZA 3JAME 1Y0UA 3F9KA 4PK4A 2E2JJ 1ONVA 4A3BJ 3H5RA 3H9QA 2CP0A 2EAYA 2JUCA 4DZPA 2CP5A 4D5FA 1Q82R 1KHCA 4LB5A 3W2AA 3IP4B 2CQ7A 2CP7A 3I64A 3C3WA 2GXAA 3OMGA 4B9XA 1AEYA 4HG2A 4KGZB 3OYEA 4RMOA 4BE2A 4ZYEA 4Q47A 5KCMA 1XDSA 1LPLA 1TZLA 3BLYA 3QYEA 1FNNA 4EMHA 4QT7A 2O3FA 5E20A 2R5ZB 1ZSZA 3LX7A 4J6WA 4DBFA 4PJOE 3K1NA 2VT3A 3KZIC 2OAZA 3UF4A 4EPCA 4NDLA 3S3MA 1Z7UA 4DYQA 5DCMB 1W0TA 1WDXA 1T33A 3REBB 4BI8B 3ECHA 1VQNT 3Q0VA 3QSUA 3KZZA 4WCGA 3DKXA 1B34A 3VJPA 1UJ0A 1FPQA 5IAYA 4J01A 3QHSA 2JTEA 3LFKA 3BZCA 3L9FA 3JRGA 4XLNF 3MCZA 4YIIA 2PEXA 4N0BA 4S05A 1IC8A 2IS4A 1KA8A 5LJ5g 3QKJA 4RB1A 1GV2A 3K6GA 4XRSG 1QCNA 1EF4A 2DMUA 1R49A 3PUFA 3A01B 4HVUA 2AXTC 2EFWA 2RQTA 3LA7A 2ID6A 3JRHA 4HQEA 1CQTA 3HEFA 1BKBA 2LT1A 3B02A 4NL3A 3M56A 4OMYA 3FX3A 4PSWA 2BEOA 4I02A 4G7ZF 2QEXI 1X4OA 4E7LA 1TP4A 5FRMA 2CP3A 3BT9A 4LIUA 4M77F 5L3FA 2DD4A 3Q1JA 1U0JA 2MC4A 3JB9J 4LG0A 2A5YB 3PSIA 4XM3A 3Q0WA 4NQWA 1BR1A 1FC3A 5BMZA 2YRCA 2XGEA 2W4SA 5E8IA 2P7VB 3FXLA 5F1JA 1ABQA 1WLPB 3C4SA 4G12A 1LNXA 4FETA 3HYIA 3JAMZ 4IQJA 2DNUA 3A98A 3MKWB 1OR7A 4FYYB 1IO2A 4M75D 1ETVA 2V26A 1Z91A 4JX6A 3OSVA 1ZH5A 3EAEA 3P5JA 3CCSA 3F6OA 3H1CA 1JI8A 1QVFA 3CCQT 1ZHIA 4IJAA 4ITVA 1YFHA 2JOYA 4OP0A 4ZGEB 4G6DA 5M5WJ 4RTUA 4A4EA 2RHXA 3WGGA 3EUAA 3OQ5A 4FL6A 3NMZC 4KGVB 5GANe 3BFMA 2DIGA 4RS8A 2ZXIA 2HKQB 2W10A 3HPHA 1BN5A 5AIPA 3HOUJ 2JA7J 1OULA 2ADUA 2L7MP 3GFIA 2EB7A 2K3BA 2X4XA 4DEYA 2L7FP 1SC7A 4BUPA 1O3RA 4RKUE 4WXHA 2ZMEB 1RESA 2RNGA 1JUSA 3MMYB 3I55I 1T0JA 4C5GA 4ENNA 2DCEA 2KBTA 1FYMA 2QYZA 1OJLA 3P9KA 4G8XA 3JRCA 1MNDA 3JTHA 2QAZA 3ABMH 3AT1B 1LE8B 2P0PA 1A31A 4XONA 2Z1DA 3EGDA 1DPRA 4UC4A 1JKOC 1BI2A 2VB6A 1IREB 3A8GB 2YDLA 2K4YA 2K7LA 1BU1A 2EJFA 1H89C 5CQYA 2CQKA 1FSEA 4AWXB 2HGCA 2EFOA 3BR5A 2V1UA 1OZ2A 1PVEA 4IVNA 2FZGB 3M57A 3ZOBA 3CMAT 1W1WE 1IUFA 2XHCA 2IGMA 1HKTA 1BC8C 1ARKA 3CC4Q 1KYWA 5LEJA 1YBYA 3PGGA 5GAMh 1W5CC 3L42A 2E1CA 4HYEA 4XSZF 2VOOA 4F7UE 2FMYA 1ZN2A 4BY6C 4JP0A 2F5KA 2K3XA 2P7CB 4B09A 2Q1ZB 3CCJI 1U8RA 3HKZA 3EPZA 5FW9A 3JCMc 2QENA 2I5UA 5K7FA 3PO3J 1TT0A 2QWWA 2DA1A 2D6FA 2BKDN 1PUFA 5HDGA 5J4YA 1V4RA 1E0EA 4DZJA 2Y75A 3SFMA 2M8GX 3CUQC 3TGNA 1FMVA 3PE0A 3CCVA 2STTA 4I0AA 1DGRM 2OBPA 4CA0A 2V79A 4LLNA 3WTTC 1WXBA 2GZWA 2IT0A 1QCOA 5D6YA 4JRKA 1YHQT 1KQ2A 5HKCA 2WTEA 4RM2A 4EJOA 5D5UB 2L3SA 4MZPA 1HQCA 2PVDB 2IIMA 3QG1A 1HDPA 2BY1A 2DO7A 4YEJA 1ZG5A 4GLKA 3VSLA 3QOEA 1J75A 3H3UA 3JRIA 1YOVB 2ZPHB 3SDGA 4KMUX 2LLKA 3MQ0A 2BW3A 2M0CA 3M53A 2I10A 4L9JA 4V19K 3CXCP 4OMNA 4LIVA 1IN4A 1G3TA 4CXFA 2E5ZA 4BNCA 3SEZA 4HF2A 3Q5FA 2AZVA 2CP6A 6PAXA 5FLXE 5CK9A 2RDPA 1AWXA 1V5EA 1U6GA 2BHZA 1FWZA 1H8KA 3OL3A 3HP9A 3EUHA 4RG2A 4PJLA 3S14J 1R7JA 2JSCA 2WAFA 3ZMDA 3KYLA 3TW7A 3H0IA 2XVCA 3HC7A 4KH1B 4NL2A 2Y2ZA 2VJ4A 1K4SA 3A1YA 5E3NA 2J6FA 2QG9B 1JJ6C 3SEMA 2VBXA 1R58A 4EATA 4D7NA 3RYPA 3L2UA 4C92C 4JRIA 2M4GA 3LL7A 3L09A 5J47A 3WVDB 5EEHA 3FJ5A 1OLTA 3DCFA 3PFIA 4KNYA 1C6VX 2YSQA 4JPBW 2QCOA 4DYCA 3U2RA 2XRNA 3TL4X 1QVGA 4A3JJ 1EIFA 2ROLA 2YRDA 3VS6A 4D8DA 4D7MA 2PFBA 1XGMA 3E19A 1EH7A 1MJBA 1ETYA 2R7WA 2F2WA 2LH9A 1NPPA 1I27A 2CUJA 2HYFA 5FU7B 3N5BB 4CO8A 4A6DA 5J3BA 2W25A 4DQ2A 4OIQF 1YW9A 2M51A 5EGOA 2RJCA 1G3WA 3GTPJ 2K02A 1JHHA 1VQ6A 1HW2A 4BDYA 3M0PA 4QVCA 1YW8A 4PJOD 2E34A 5LGTA 2F5CA 3M3YJ 3CCSI 3AKZA 3I4NJ 2NVUB 4Z8AA 3P8DA 2VXEA 1ZG1A 2BXZA 4Z89A 3OW2A 4M7DA 1MBHA 2WAQN 3DBRB 1Q7YU 2CQQA 3CC2T 4L5EA 4IHWA 2ESNA 2X4HA 4Y13A 1LB2A 1IHVA 2DYIA 3LH5A 4Y92A 1QVFS 3BR3A 2P4RA 3ZN1A 3GO5A 1VQKQ 3HHGA 5CAIA 3VWBA 1QLYA 2RVCA 3LLRA 4M78C 1AOYA 4HSTA 1L0OC 3V42A 4DBRA 3OYJA 1PC0A 2E1HA 2HNIA 2ECZA 3ROUA 2GBQA 2LX9A 2KQWA 2GNCA 2ZBKA 3K10A 1M3CA 1WH5A 2PU9B 2XG8D 1KD1R 2WB1A 4PJ0C 3HPWA 2NS8A 2R3SA 3SZPA 5FLXZ 2QI2A 3SWNA 1Q7YC 5FD6A 1T38A 1ZRDA 2CFOA 4M3GA 4FSXA 4XLFA 1BBYA 1K73U 2AHQA 4CCMA 3D0SA 3M59A 2V4JC 4R0KA 1QVUA 1D1AA 1SANA 2P81A 2K4JA 2IG0A 1JKRC 1YJWI 3L2VA 2RQVA 1WHLA 3HHTB 4HVWA 3QQAA 1Y6IA 1SVOA 3TOAA 4MTDA 2XKOA 1OCZH 4M6YA 2F5DA 3BWGA 1M8MA 3EG9B 2K7AA 3HOZJ 3KCCA 1WJEA 2JRMA 4DNCA 3LSJA 5C44J 4FM4B 1SHFA 1LDJA 4U0WA 2K5FA 4AD9A 2Y30A 1JJ2P 3V8JA 3DU6A 2HDDA 3PJRA 1N9SA 2IGNA 1U9NA 3CJRB 3RPUD 2A7YA 2GFUA 2R0QC 2FRHA 2KK4A 4C8QC 1BB9A 3JRBA 2HZDA 2QBYA 2DTIA 1VQ7I 1WIEA 4RTXA 3EH1A 2VBZA 3QO3A 3PIPF 2LD5A 1KQSA 4KUDK 1S8NA 4ESFA 1U5SA 3RR6A 5IH2A 1LVAA 5F0HA 2JRTA 1KC8U 1HDDC 2KRFA 1FX7A 2MI6A 2CSOA 2XB0X 1LJ9A 4MFDA 1G2HA 2L9NA 3CBPA 4R56A 1YJ9T 2FVUA 2W7NA 2MLGA 3GFMA 1Y7XA 5IYCJ 2V9VA 4XLHA 3CCVI 4JYKA 2LNHB 2YLBA 3ASKA 1VQPI 2DMNA 2Q2EB 3KEQA 4XLEA 2RQQA 3EHQA 4M7AC 3S3OA 2E10A 1EX4A 3VUZA 4P5NA 1SAUA 1W2BA 4J5YA 1W7PB 3FXUA 3M8EA 2DJIA 1PYVA 1WYXA 3E5UA 1RAGB 2JPCA 3UDCA 1YIJA 3TO6A 2X3WD 2JS0A 2NUPA 4A3EJ 1KC8C 1P92A 4OAYA 2LSOA 3ZGKA 1UZCA 3OL4A 1STZA 5GANh 2DERA 3JSOA 4IHSA 4D6WA 2MBFA 1Y57A 1TWGJ 2COWA 2ME0A 3EDPA 2Z2SB 1QQJA 2GIZA 3QYFA 1RIOH 4L59A 2LBFA 1D1CA 4J19A 5D8LB 4JS5A 5JVGF 1EA3A 3JCUC 5DYMA 3ZMVA 1I07A 2HL5C 3ERMA 1Q7YR 4PUSA 5IP9J 3OB9A 3F22A 1T39A 3EGXB 4LGWA 3OS0A 2LKPA 2JS2A 4LDWA 1ZTRA 2EQRA 4NUBA 4M77A 3OIPA 2FA5A 5GADJ 1U78A 2FO0A 3ZQLA 2FF4A 2QSHX 2K9LA 3NAUA 3U1KA 3OR1C 2E2IJ 1Y0NA 5F6FA 2F4OB 1VQ8T 4HAMA 3GZNB 4UB6C 3DP7A 1IJWC 3QU6A 3G4SA 2F2VA 2D45A 2VKHA 4IRIA 1N8RR 4E6RA 4ZZLA 1XTAA 1ZAOA 2WV0A 2XMFA 3HFNA 3CCRA 1JGSA 2VKVA 4UUSA 3ZMSA 1KU9A 3I4PA 4FCYA 1OPLA 3TVTA 3S2HJ 3DTEA 1K73R 5KAFC 2LFBA 2FSWA 2HPMA 4LE9A 5LJ3h 3BROA 1VQNI 4HX4A 4RUGA 1XB4A 1QVGS 2DYSH 1HKSA 4IRGA 4C0DB 1JTXA 2C6YA 2EBPA 3LSKA 3BY7A 1ZELA 2L8DA 3EGUA 4XR6A 1XPXA 2B9SA 2RK1A 5KYXA 5LLQA 3RKWA 1T8IA 1JGGA 5HLHA 4BQAA 5CO7A 1WJBA 2VI6A 2M0OA 4C92G 2M7BA 3S1NJ 3OYFA 2KZGA 1ZHFA 2BBYA 4OWRB 1QZZA 3TU4K 3PQKA 1YI2T 4RTTA 4ME7A 3LSGA 1AWOA 4Y7NJ 3OW2S 1YITT 2L54A 5IT9E 2H6CA 2RPNA 5ICEA 5BQTA 5L3EA 1KC8R 4Y52J 5EYRA 2DBBA 2RC4A 2GOXB 2YXYA 1JU5C 1VYUA 4A4FA 2K2VA 4F52A 3CPWA 3S1QJ 1KK7A 1UJYA 2KYMA 1SMYF 1APLC 2DQRA 3LWHA 3CC7I 3EFRA 2V8IA 4EM2A 4I0BA 1KIKA 1I3AA 3ASNH 1BK2A 2JN0A 2AKKA 4HNTA 4XU3A 1K83J 3I5UA 5GAGJ 1LJOA 5CKBA 1QQIA 2HZTA 4DEXA 1VQ5T 3IKTA 2YUNA 4HNVA 2K57A 2DA9A 4S04A 4U7BA 3BG3A 1EKEA 4KISA 3OOPA 3CMEQ 3HUGA 4PGGA 2BOLA 3CCUI 4FU6A 2JA5J 2P5LC 2DF6A 4J9HA 5A0DA 2VOPA 3CCQI 2L2OA 4ELYC 5FKMA 3LSPA 2COYA 2CV2A 3OR2C 2PMZA 1O3QA 1RETA 1YW7A 1PWTA 3DLLF 1HSQA 5GTHC 2ZXJA 1K0SA 1YJNA 1QA6A 4LOCA 4ZDOA 2ECBA 1Q1HA 1PP7U 3DXJF 2G7UA 5F04A 2IEKA 3W6JB 4CICA 2GOMA 4BXXJ 1GDTA 5CIUA 1M2VA 2LKXA 2HDAA 2CZ6B 2QGGA 2GA2A 1IRFA 4BL0B 1CGPA 2QGUA 4IUPA 4ZYGA 1KQ9A 1D1BA 3FZVA 3IH4A 1KQSS 4N9IA 3K70D 3M1CA 1R8OB 3NWTA 1B3QA 3FHZA 1LQ1A 4JJDA 3JB9D 3EFOA 3M0UA 1JXOA 3H6ZA 1ODDA 1Q86U 3CD6T 1MKMA 4IIOA 1R4MB 4D0PA 4FW1A 1LKXA 5LHIA 2A3SA 2IS6A 4XTUA 3CCLT 3CCJQ 1GL5A 2CP2A 5CKTA 1WJRA 3NARA 3LGLA 3CMAI 1TQPA 5KYYA 2ZNYA 2JT4A 1X58A 3ZN0A 5IT9Z 2RH2A 3I59B 3TP3A 1W2BS 3DEUA 3F21A 5HDNA 1ERDA 1HW5A 1P4AA 1XGSA 4A5MA 2VBYA 4F93B 2KP6A 3FIWA 4EGZA 2HOTA 3G7ZA 1RUOA 3HFOA 3NHNA 1QVGP 3Q0UA 3IAM2 1UGPB 2CYZB 1Q86C 2QK0A 5EZGA 2XAFA 4XIDA 1R0CB 1WI9A 4HDVA 1WWXA 4EDUA 4BY6B 4OB2B 1EFNA 2BHYA 1A36A 4CCJA 3LSRA 1I50J 4LK0F 1J5YA 5F0CA 5LJ5j 3CCEA 1TTHB 1IRGA 3PM1A 3CDIA 4HX7A 1SSHA 1VA7A 2IVWA 3E9FA 3V7SA 3GZ6A 1SFUA 4JX5A 2VJ5A 3HOXJ 4KH0B 1JKQC 3CUQB 3G6EA 4LLGF 3GLLA 2JUFA 2W0ZA 2X3XD 2X9HA 1YHQI 3D5LA 2CG4A 2O31A 2M0MA 3VOEA 3ULQB 2WA0A 2A0FB 1MBJA 1ON2A 4XOPA 2R7UA 1JEGA 3I9V2 4BEHA 2CFXA 2ZB9A 3PQJA 2D1XA 3ECOA 2HYGD 1I6XA 3KLOA 3WXMB 1HLVA 4EJVA 5ICGA 3C2BA 1ZSZB 4QWQA 5ICCA 1RC9A 2COMA 2LC4A 4ZN3A 2VIXA 2M34A 3OYBA 3E2UA 4A63B 4P5OA 1ZRCA 3CZ6A 2IA0A 1IN6A 2EQKA 1B34B 4XRMA 3LSIA 2GIVA 2X4JA 2DL7A 2A6EF 4F92B 2GWRA 3CO7C 3OBWA 2KYBA 2LP5A 4HT9A 1XD7A 1YYVA 4NC7A 1Q95G 3GPLA 2EKOA 1AZGB 3M0QA 1U1SA 2M9UA 2LY9A 1BR2A 1UG2A 1GV5A 4AFQC 4HT8A 4NB5A 4KICA 1BBZA 3ZFJA 2XRLA 3WODF 4J7FA 4RGXA 2XDBA 5J26A 1WFXA 2XF6A 3JCMb 4O5VA 5GAN3 2FRWA 3CP2A 3OIQA 2EZKA 2WBMA 5BNGA 2M3AA 4NNJA 3CCSQ 1Q86R 1YG2A 3VU3C 1KQSP 4IL6C 2DMTA 4MO7A 4LG0B 3M07A 2DBKA 1P2FA 1KQ0A 3CCYA 4B1RA 3QZ9B 2BGCA 2H8WA 2QQBA 4NQWB 3CPWS 3RI4A 3CCMT 2DLPA 5FU7C 2MA3A 5H2FC 1RACB 3HKSA 1SD4A 3G1MA 3LQRA 3S2DJ 3NFCA 1Z0XA 2V6CA 2ISZA 4M7DG 2A28A 2UV1A 4B8XA 4XOTA 2CGHA 4JRQA 1VQOT 4IHVA 1YCYA 2Z33A 2W82A 1WGXA 2EZLA 2X6OA 4BJ6C 1K9AA 1IGQA 4HCKA 1W2BP 1W7PD 2EINH 3GTJJ 2EZHA 2DEUA 3PIPA 2D2WA 4F7ZA 4WK8F 3CP8A 5D4SA 4BI3A 2XAHA 4AYBN 3K2AA 1T08B 2HQNA 2KKOA 2L7ZA 4LDVA 1B8IA 4IF4A 2KT8A 3LWIA 1Q82U 1Y56A 2AK5A 1T95A 2LDUA 4WXCA 3T8TA 1UECA 3JRZA 1MBFA 3KP5A 5FKLA 2A6HF 1MBEA 2E7WA 2F48A 3BPVA 2KDZA 1PDNC 5IYDJ 2ATCB 3EG0A 1DDNA 4C92E 2OTJT 3WG9A 2UXNA 3WTWC 3AL0B 4PZJA 2UUZA 1ZBJA 3SJMA 1Z21A 3UNGC 1G83A 1V55H 1B6AA 3EGDB 3MEWA 1Q82C 1VF9A 2K3YA 5KHDA 5J8FA 2BV6A 4XK4A 3ZRGA 4ZJZA 2E2HJ 1QHGA 4WF2A 4Y28E 2BVMA 5ECAA 1WI3A 2V1RA 1HOMA 4MDWA 1ON1A 5CQEA 1M3AA 3CCVQ 3RESA 1MJAA 2VVKA 4FYXB 4HV5A 2FOWA 5I21A 5KH6A 2KIUA 1VQ4Q 2TCTA 1F4KA 1M9SA 1ZGJA 3FDYA 2F2EA 3R6SA 2ZJ2A 3J80K 2SRCA 2HSPA 4J6YA 1OX9A 4BH9A 2TRTA 3CCEI 1SD5A 4BUGA 4LXCA 3BTJA 1X6BA 2IP2A 1N25A 3FJPA 1VQ9A 2E1MB 3SDZA 2SEMA 3HSBA 2QA4T 1E6HA 3M4GA 5KE2A 3VYRB 3TOBA 2LREA 4A5NA 3M1EA 4BB7A 3I55A 3ZQ7A 2R5MA 4M78E 2K40A 3G6EI 1ZARA 1PUFB 1PUEE 1WQWA 1GXQA 3QJ6A 3JCMW 2DTOA 4PJJA 2VGMA 3MEVA 3QPTA 5HNFA 1K9MR 1UCRA 1D5VA 3FM3A 2NYSA 2FE3A 2DFEA 3WE3A 1E2XA 3LYIA 5CVVA 4RTZA 5JI6A 4CYCA 1VTNC 3FBIB 2K9NA 4C3HJ 2BZ8A 2JMAA 3M0TA 1FP1D 2HQ5A 2EFNA 4FHTA 2LJ1A 5M5XJ 1NK2P 3WU2C 3NTIA 5CKEA 1LFBA 2YS9A 2JMWA 3BDLA 1U8BA 3K4LA 1YIOA 1KU7A 3FBNB 2HVQA 1LEBA 2IJLA 2EIJH 4XTZA 2VPRA 1K0XA 2YPRA 4KIGA 3O8HA 2BW3B 3F23A 1U5TA 1O4XA 4HDUA 1QWFA 2AZSA 2XDPA 2DYRH 4GYGA 2HI3A 2OCCH 5JLXA 3TW6A 1GCQA 2E70A 3M58A 3BY6A 3WHCA 1VQ4T 3SQNA 4E6KG 5GANj 1K78A 1TW2A 2ENMA 4XN3A 5E8GA 4DA4A 3G71A 4X1VA 3M4OJ 1AWWA 1H92A 4C8QE 4UNOA 1I5ZA 2D8HA 4OF1A 1VQ6Q 3VYTB 2DJQA 4L0ZB 3OV8A 4BXFA 1O9SA 1UGQB 5DM6F 1XC5A 5LRRA 3OYGA 3A0BC 2EGAA 2XDDA 3E0JB 2KMUA 3QP6A 4AIDA 1VQMI 3LOCA 1AHDP 1RUNA 2ROTA 1YX5A 3REOA 3V7RA 1Y71A 2EJ9A 5GAN8 4M7AE 3KP7A 2LDMA 3QJYA 2M45A 4W97A 2W1OA 5JHUA 2DILA 2OTLT 3RSNA 2DETA 3DU5A 2F6CA 2J6KA 4HVVA 3CEYA 4C0DC 3DLLA 3DEEA 4MQ9F 2EKHA 4BU2A 4M75A 1HJDA 1KSWA 2EYYA 5EGOB 4CCKA 1GVJA 4E7JA 2R7VA 1BJZA 1MMDA 5ERIA 1HF0A 2HVRA 2IS2A 2E60A 2EV0A 5JR3A 2PUOB 3ABUA 1AWCA 1OCCH 2CSQA 1NEGA 2XV4S 1C0WA 2OUMA 1YI2I 3OWTA 2YU9J 2J06A 2EFQA 1VQLT 5LJ3j 2XAUA 1TWCJ 3E6DA 3ONQA 4B44A 4CUGA 2R93J 3H9NA 4M7DB 3RMSA 4AG1C 3K4CA 2JTVA 1UELB 4ZYAA 2P4WA 2LJ0A 4OB3B 5GAMg 2VL8A 3OYMA 4K2EA 1ZLJA 3BQYA 1D3BA 1F36A 3RCOA 2LNBA 4LITA 3KFWX 3OMYA 2CZ1B 1Y1VJ 1X1BA 3JRFA 3MKZA 3WTSC 2F4IA 3OYHA 3E6CC 3IRRA 3MPUB 2D0QB 2K5CA 1IGNA 2WWYA 1MBGA 2EJGA 2WC2A 2WY7Q 2PVGB 4RMNA 1IGUA 1SFEA 1NYGA 4N4IA 1VQ5I 4Q4ZF 4KT6A 5KE3A 1OCOH 4AUXA 1WA7A 2XIGA 3SWNB 3P8HA 2YHTA 4AU7A 5GJWB 4KRTA 4IOAF 3MHXA 4MMKA 2XUBA 3H9GA 2DA7A 5ILSA 1ZG3A 2KJBA 1R1TA 4RLFA 5HCKA 1XS9A 1FYLA 2ZCWA 1X1PA 4RB3C 4NS5A 2K9SA 1WSUA 1FYNA 1VYVA 4HXJA 1PKSA 3FM5A 2JWTA 4II3A 1B4AA 4NC6A 1R71A 1N6AA 4XSXF 2OZUA 1RAEB 2W48A 1GVDA 2ZAEA 3HL2A 1M3BA 1QNTA 4XQFA 1PSFA 2WV1A 2XSJC 2DA5A 3EUKL 2NWMA 4J9DA 1RAAB 3JCMf 5GAN4 2DXTA 2VKEA 1YWOA 1IW7F 4QW2A 2XK0A 4DYRA 1FSHA 2KQRA 4A3GJ 1RUWA 5DLOA 4Q5WA 4XL9A 4J9GA 5JVTA 1MV3A 1YIJQ 4M7DE 1UHSA 3FKJA 3TQNA 2Z9OA 1R0BG 1VQ9I 3VS7A 2MPXC 3LAJA 2GBYA 2O0YA 2LCCA 4HW0A 2VWFA 2CUZA 1A0NB 2IS1A 2QM3A 2E6ZA 1SKUB 1DP3A 2Y0SA 1SRLA 4ZYDA 5DUIA 5JLWA 1N78A 5C4XJ 2K6DA 1M1KU 2DA3A 1R6RA 3ULRB 4I01A 3BG6A 4IIMA 1ACMB 2VASA 4A4GA 1RADB 3DPTA 5FJ8J 3GTMJ 2BVLA 2LCSA 2JSPA 4XAXB 5AYFA 1T3SA 3JCMe 1BI0A 3SHWA 1YJWA 2PG4A 1SAXA 2KAFA 1BR4A 4C92D 1IUYA 2G0EA 2IPOB 5GAOl 2O8XA 4QIWN 2NUPB 4IUQA 2L9SA 3NGPA 3QP5A 4RM3A 1X4PA 3RKXA 4PFOA 3JB9F 1HKQA 5EG0A 2NRAC 1YN8A 3NTHA 4ABZA 4BGDA 5GMKe 1M1KC 3G4SQ 1QMCA 3RUXA 1X3ZB 5BPDA 1MIJA 4JLGA 2LBFB 4F04B 3CCRQ 4BBRJ 5HNHA 3RMQA 1LVKA 1GCQC 4X34A 2E7XA 1VQ7A 3HBLA 3K69A 4M6VA 2DL4A 2L3RA 2ZPEB 5CLSA 3GP8A 4HF1A 3G71I 2DODA 1T0FA 2M5WA 3I56Q 4M77B 3RQ4A 3M5AA 3HOWJ 2FJ1A 4UXNA 2FQ4A 5IYBJ 2E6NA 2WSEE 4HOBA 4EQQA 4JJBA 1NG2A 1S5LC 1KD1U 1GFDA 1VQPA 3F8BA 3FEOA 1NBEB 4I09A 3DB3A 3K4MA 4AM3A 2W85A 4NBQA 3QPHA 2UWMA 1QHHD 2VQHA 2W24A 4DBQA 3C1DA 1M5Q1 1S9HA 2Z0WA 3PO2J 1SFOJ 2P0WA 1MNEA 3PFYA 1XMKA 4UUSB 1X1AA 3LGFA 4M78D 1XGOA 3MEXA 2A3LA 3CMYA 3DLAA 2MCNA 3SFIA 2FEZA 1ZSZC 4QQGA 1JT6A 3FMSA 1WJQA 4GYIA 1FYKA 1JQQA 4ZTFA 2L5QA 5ICFA 4AFSC 2DI3A 2HKNA 1LDDA 3JCMd 2DFHA 4DIQA 1XCVA 1KD1C 2CUBA 1RR8C 3RDIA 4OVAA 1OQKA 3GOXA 2P0QA 2IA1A 4G6QA 2DA4A 1XSXA 5J8CA 3CC4T 4KUMA 5CQXA 2AO9A 5KYXB 1F1ZA 2P5KA 3MVPA 4QLCU 3JAMK 3MFKA 3OYAA 3I9QA 1FBUA 1KGSA 1SFXA 1Z6TA 5ED4A 2DXBA 2HD0A 2GQIA 4Z02A 3GX4X 4UV8A 4CC3A 1NEBA 2VKDA 1UGRB 3JB9H 2QXFA 1UHCA 1FOXA 2M87A 3OMCA 4A3LJ 3ZEHA 2L0AA 3CPFA 3A4CA 4A3IJ 1WVRA 3FC3A 2VV5A 1QVPA 1S72Q 3H36A 3CTAA 2L7KA 2FBHA 1KQ8A 2JM8A 5A0LA 3HHHA 3S2WA 3J7AY 5L8RE 3I56T 4M77E 4A4HA 4JBAA 3BQZA 1M1KR 3HB9A 5FRNA 2X1CA 3QPSA 5KAIC 2PX9A 2DOEA 5FFXA 1B7TA 3K4KA 4C8QD 5JHFA 4CDGA 3MEUA 4U0YA 4UY8I 4MFEA 2XSDC 2ZPIB 3V8LA 3HTRA 4GFBA 4PKCC 3G3ZA 3L2RA 3W2VA 1YJNQ 2D8JA 3DTIA 2PMUA 1VQNA 1QPMA 2KR3A 4FX0A 5DM7F 4M9XA 4M74A 1SPKA 4OB1B 3F3XA 1RNLA 1FBSA 3HG9A 3HXLA 2LYCA 5BOXA 3M0SA 5KYNA 1BJAA 2DT7B 4BACA 1H0MA 2OQGA 1W5SA 1OR7C 4G7HF 1T3LA 4M7AD 3DQVC 1OMIA 1M1FA 3GNFB 2C0IA 1JBMA 4RCCA 5IT3A 4V2GA 5KNLA 2RKHA 3HUGB 3EH2A 3HTSB 2R7OA 4A93J 3BTCA 4AIHA 5GANg 3UWNA 2O9SA 3R6OA 1EJ9A 1ZA2B 2COBA 4LN2A 4EMKA 4OMQA 2CKKA 2QKLB 3QYBA 1PRLC 2XICA 4C0GA 5CVIA 4I99C 3S15J 1R00A 3JR9A 3PFSA 1P4XA 3FISA 1UG0A 3HSEA 4BE1A 4M9ZA 2CREA 2ZZDA 2KNBB 5DEQA 2G6FX 1WZOA 2RJFA 2KIMA 1H9GA 3E97A 1M2VB 1EH8A 5J1YA 1WGSA 3RZDJ 1S72T 2OTJI 1MMGA 3CLOA 3CC7A 3EYYA 1JT0A 1N8RU 1R1UA 1H641 3RKQA 1KZHA 3BC8A 4LDUA 3AL0C 4RA2A 5LGUA 3A1PA 3EFOB 1QPIA 3X2QH 1IDZA 1WFWA 2DMOA 4OGEA 3RERA 3C2HA 3R60A 2D5VA 2ISYA 2EPDA 3D5SC 3W6VA 1ITYA 3FRNA 4PGHA 4CCLA 4C2TA 4A4KA 2DJNA 1E3PA 2LF8A 1QKWA 3CCUA 1DQUA 1MJ9A 3OOUA 3ABTA 5DLQE 5HVQC 3CCQA 2MC3A 1N8RC 2WADA 2M1BA 4ESJA 2E64A 2GQVA 2J5PA 3IL2A 1YS7A 5LJ3g 3G6EQ 2D1HA 1R4NB 3HM5A 2CV0A 2JNGA 3BZ6A 5B1BH 1K73C 1MV0B 1ETQA 4AYBA 1IB8A 4IEJA 1IDYA 4M9SA 1PNJA 2DDBA 3IH3A 1X2QA 2D0NA 2RD1A 4UV9A 1O3TA 2DPPB 2QQ9A 3X28B 4HCBA 1M1GA 1HYOA 2C06A 3M0RA 4PLIA 4B6MA 2E5NA 2E1MC 4FT2A 5FU6C 1VQKT 4F7UA 1A35A 2LC2A 1W36D 5DD4A 3A2KA 3S16J 1SF9A 2MAMA 5EG2A 5DDGA 4JS4A 1XQHA 5E17F 1QP2A 4YFXF 3CF5F 4XLPF 4M7DD 1PM3A 4M3BA 3VSKA 2XD0A 1HD3A 1Z9ZA 5M5YJ 2HKXA 4B9WA 3HSRA 4C5IA 3KX2A 5CVUA 2HXOA 4OMMA 4JLIA 5KCHA 4LB6B 3CMAA 3MWMA 4ENJA 2PTKA 1OCTC 3PMIA 1F9NA 2DEQA 1LFUP 2YR2A 3GFJA 4BEHB 2E65A 4X0GA 3TP0A 5I2MA 2EA4A 2ZSIB 4L9TA 2ZMEA 3MP6A 1X1CA 1NPRA 1YS6A 2RGVA 1H9TA 1JRIA 2Y4YA 1IV8A 3TBIA 4E7ZA 1SRMA 2OV7A 5EEGA 3VS3A 1JO8A 1OISA 2LY2A 3WU1B 1FBQA 4AVZA 3S32A 3TKYA 3HRMA 1JUPA 1MGTA 2LK2A 2RNJA 3KEYA 3RBBB 4KT5C 3WG7H 1R5ID 2VGNA 3EUHC 1A04A 3TO7A 3TSWA 4CC2A 1YE9A 2CH0A 4A69C 3JCMh 1G3YA 2BY3A 2IGOA 2O5RA 4RDUA 2L3QA 5I22A 1QVFP 1KFZA 5L3DA 2Y69H 4JQFA 3C2GA 3MJXA 4ZGJB 3BPXA 1YHQA 1WZ2A 4LFUA 3S8PA 2ETHA 5CKFA 2MIOA 4HCCA 5GMKh 1FJLA 1I1GA 2DYBA 4FT4A 3J80E 2ZXWH 2BY0A 4G9YA 2Y9ZA 1Y07A 4M3DA 5FD5A 2OTLI 2PQ8A 3TREA 2X48A 3GFLA 4OINF 2F1LA 3PMTA 2ZFUA 3COAC 1V76A 4J8OA 1B1BA 3BZKA 4FX4A 2KEAA 4EM0B 5GMKl 1ZR4A 3EHRA 2BY2A 3O3KA 2EYWA 1WJSA 2RI3A 2MW8A 5FLXK 1U9OA 5IHKA 2GXBA 2QEXQ 2XF5A 3TDUC 4II1A 2DU9A 1W36C 4J83A 2HYJA 4F16A 2HCKA 3I0TA 4A3KJ 1LCKA 5K7HA 5J40A 4X1EA 2R7FA 1Z1DA 4M7DC 5AONA 3VS1A 2DXUA 1I5OB 1TC3C 1CF7A 3R61A 4EMGA 1QU3A 2RF0A 3KP6A 5AIQA 3OS2A 1LUJB 4N0AA 3GVAA 1ZA1B 1UFFA 3F0CA 3WTVC 2DZCA 4PFZA 2DFFA 4M6XA 4F14A 2H27A 4L9VA 1B8IB 3I58A 4I2OA 3CMMA 1BL0A 3BJOA 3GTQJ 1ZQ1A 4HV6A 4G7OF 3O5ZA 3A8LB 2AXLA 4DJAA 2LR8A 2FX0A 5LJ5f 2ZFWA 3DBLB 3K9TA 1FOWA 1UDLA 4I7HA 2K79A 1WHJA 3VS0A 4EIKA 5A0GA 2E19A 5KYYB 4P9UA 4M77G 3SWNC 1ETOA 2Y48A 5DD8A 3A8OB 5EEAA 4M77D 2HWVA 4EEFG 1RPWA 2OAWA 1TU0B 1W5TA 3ZQIA 4IHXA 2RA2A 4PNOA 3H3VK 4GGGA 3MN2A 1S7EA 4C3IJ 2R5YA 4BDZA 4IHTA 1CKAA 1VQ9Q 5EF6A 2B86A 2ZJPF 1OCRH 3H3ZA 2RQRA 3HOTA 3I55Q 6AT1B 2XKOC 3DFGA 3DTKA 2IAIA 4IPAA 2F5VA 3FHNA 1O3SA 5E18F 4EJTA 4AFUC 2QEXT 1NTCA 1WJCA 4XKBA 1E6GA 3CC2A 2L3PA 2DA6A 4M75F 2MMPA 3ABKH 3HPGA 1PJRA 4KGXB 4R79A 2FZKB 4BXUA 3O8VA 2QDLA 2DKGA 2EK5A 1ULYA 2JXBA 4YTLA 5H6RA 1TQIA 1OOTA 3MZ8A 5GAOr 2XHKA 4N4HA 3H0GJ 1BYMA 3VODA 3A0HC 1RAIB 4C5HA 3SFZA 3SHFA 3LQQA 2IVMA 4M4ZA 1YO5C 2ELKA 1B72B 2ZCFB 2PJRA 4JJCA 2Z99A 5IP6A 3BOQA 3VV0A 4DW6A 4C30A 3EG1A 5F1RA 3BW1A 2KZVA 2JT1A 4BQQA 3VFZA 2CUEA 2EGCA 1X2NA 3WGIA 2CT4A 4MMLA 1LFPA 2HS5A 2CGPA 4HPQA 1J0RA 1SMTA 4CYCB 1ZKGA 3G71Q 1G4DA 2DOFA 3HKZN 5J6XA 2GLOA 1XX5A 1MW7A 3ME9A 3OS1A 3VYGA 5K5QA 3CJNA 4Q5SF 3CMET 2UZKA 2O03A 2OZ6A 1UUEA 5H20A 5KYWA 1MH4A 1TL8A 4MDXA 5J1UA 1Z67A 3W6KB 1PCXA 5LGNA 4C92F 4RGRA 2VQLA 1H3HA 1U5TB 2VXDA 4ANJA 3LNQA 3MZHA 5E3LA 2OI3A 2K5IA 3J7ZI 4UVAA 3J81E 1MSEC 2OPTA 1SFKA 2GQQA 5TGTA 1AU7A 2HU9A 2KJCA 2KL4A 2F2XA 1K78B 1WH7A 2ELJA 4GRIA 2OCEA 1XMXA 3O2PE 4N4OB 1IZ6A 1SHGA 4M77C 2EIKH 4F55A 2JA6J 2X4YA 5GAMj 3OW2P 2XKPA 3ZMZA 1C0MA 3A02A 5A2QE 2V9PA 1MBKA 3VB2A 5CJ9A 1K8AU 5KVRA 2F4MB 2FBKA 4IZZA 1V5GA 2LY1A 1S29A 1PRMC 4RTVA 5IHIA 3WE2A 3K4NA 1X69A 2L2PA 1ZRFA 1ZX6A 2COZA 2A68F 4U7DA 3KZYA 4A3DJ 2F69A 1IV6A 2R58A 1WQ7A 4BKXA 3M9AA 3QOPA 4GO1A 5HS7A 2QASA 2VJIA 3CCJT 3GW2A 1UAAA 2MYSA 4B43A 1TH7A 1P7JA 2DAQA 2B0LA 2K86A 3OSSC 4XU2A 3TQ7P 1W0UA 1RABB 2Z5UA 4PJMA 5LHHA 3X24B 4JJNK 1K8AC 1VIFA 3CC4I 4M78F 1X3WB 3PSFA 3VRZA 2C0OA 2HEOA 3CBMA 2YRVA 2JVHA 1BCMA 2JUGA 3I71A 4XORA 2ZO4A 4OGCA 2NS7A 1NYFA 5BPIA 3P8BB 2QSGX 2M02A 1D5YA 1K4US 1Z9CA 3AG2H 1TXQA 3IC7A 1USTA 3HOVJ 4E7IA 1UE9A 3VEPA 1TOVA 1VQ8A 3G73A 1UHMA 2L9VA 2X1EA 2PNIA 2JN6A 4NHJA 2Y31A 5TRDA 2I0NA 3I35A 1D09B 3T0YA 3C0CA 2EV6A 3NTKA 5FWCA 4O3MA 1GBRA 4L5GA 3ZR8X 4FE4A 3B6AA 1NJIR 2KRHA 3FLGA 2X9DA 2K4BA 4XTVA 5D6XA 1K9MU 1B59A 4LUEA 2JVVA 2ZPFB 1Z6RA 2LJ3A 1VQMA 1Z05A 2EH3A 4KMFA 2EWNA 2M0YA 4G6TB 3JB9I 2GAUA 3VYSB 5CPRB 2PBIA 2X85A 3C7JA 3J81Z 4JK1X 2XIDA 1H3ZA 3K4JA 1R5GA 3CO6C 5F08A 2LVSA 5E1WA 1WHMA 3ABLH 4B47A 2M1HA 1F43A 5HY6A 4C8QF 2YU3A 2JA2A 3CF2A 5A2QZ 4AC0A 3KBGA 4OB0B 1BIAA 2HQHA 2R57A 1QGPA 1K9MC 1I5LA 3E6BA 1VOMA 2HEQA 3T1BA 1TBXA 1WHGA 3MKYB 2DL8A 1YI2A 3TCJA 2JPBA 5K1YA 3UATA 2VN2A 3CC2I 4OMLA 3WHBA 1G8XA 4ZC3A 1AKHA 2LRDA 2WB1N 3PNYA 4OIRF 5IT9K 5L3CA 3EQLF 4R1HA 4EJWA 3DLMA 5I2SA 4E2FB 2XAQA 1YITA 4M7AF 3IH2A 1RI0A 4C2UA 4PJOF 3IHUA 2G3RA 1MZBA 1Z3YA 3IRQA 1GHCA 1DJ7B 1PD1A 3OYIA 3C94A 1YJWQ 4Y91A 4V2SA 3KLNA 4QQ6A 1Y96A 4OMOA 1SVMA 3TSZA 1K8AR 4MGRA 1IZ1A 2AQEA 1GXPA 1FTZA 4LNPA 4C0FA 1MHNA 1U2WA 2O4XA 2HSEB 5D7UA 1VQ5A 3CCST 4XLCA 1I8FA 4YFNF 4GDFA 3EG3A 1DPUA 4XQ3A 3U23A 1K6YA 2PI0A 2QEXA 1G59A 2X6XA 3IAS2 2QTXA 4EM1A 3CC7T 1VQ7Q 4NC8A 3QBYA 5GMKm 5LJ5e 2L02A 2JW4A 2Y9YA 4U0VA 4GLMA 2EIFA 5EJCA 1MNMC 1V3FA 3DWLE 2MABA 3GNGA 5GAN2 4BE0A 4TVRA 3PNVA 4C3JJ 4FISA 4EJUA 3QZ5B 2WAQA 5J4VA 5FKOA 3ASOH 2QQAA 2E4HA 4GY5A 4OMPA 5M9OA 1JTYA 4MEYF 1VQPQ 5EG0B 3G1JA 4B4CA 2Y90A 4CZCA 2GM4A 1QRYA 3KE2A 3OYLA 3HRSA 1NLPC 4E47A 3FK7A 2QSFX 3LFUA 4QTRA 2ICWG 4PLLA 3CXCA 2X0LA 1UB4A 3EYIA 4CYDA 4KDPA 4L5JA 2CW0F 2I2LA 2L4AA 1VQKI 5CR2A 4OU0A 4F91B 2YSRA 1OPCA 3MZYA 4M72A 4MLOA 2XC7A 3HOSA 1YJ9I 1Y8QB 4H4KC 1MDMA 5D6WA 5FU6B 1O57A 2M30A 3E7LA 3FF5A 2EILH 3FMQA 1R22A 1S1NA 4LJZF 2BXYA 2K85A 1QVTA 3X20B 3CD6A 5KYUB 3JRAA 3HZJA 5H6QA 1ZUKA 2WSFE 1WHUA 1I1SA 1XSVA 1M30A 3CCLA 2KDOA 2JVGA 3FKIJ 2RHUA 3LMMA 1HXDA 1L3LA 2V6EA 2E5QA 2JZ2A 4JDSA 1P7IA 5HS8A 3GLXA 4E4HA 2AT1B 1WKMA 1GLNA 1GXIE 4HF0A 2RHYA 4J9CA 2WY8Q 1K4TA 3M4YA 4HQMA 3CPWP 4B3XA 1IXRC 3ZCOA 2DXCA 5D5XB 1DU0A 3HDDA 2IGKA 4C5EA 1RR7A 3T9NA 4C0ZA 5LJ5d 4J9IA 2Z3YA 1WJ5A 3U1DA 5E1ZB 3BP8A 3E3VA
chains in the Genus database with same CATH topology
2VXZA 3JW4A 5GAOp 4CZZA 1IN5A 3CCVT 1OYWA 3AAFA 1N27A 2LT4A 3KXTA 3NRVA 1K7AA 2DTHA 1QW1A 5GAN5 1YLFA 1M8VA 1QP3A 5A2QK 3OS5A 3R0JA 3KETA 1W4SA 1X75C 3OY9A 2XGXA 4UVCA 4ZH4F 3VUBA 4MZMA 2O61A 3I54A 4F7UF 4UHTA 2E41A 1XN7A 2MWPA 1RZ4A 2DJZA 2DO3A 5D8KB 1T98A 2EQMA 1IXSB 5GMKi 3CUQA 5DV5A 2Q8KA 3GEZA 3HRTA 5GMKj 1S6LA 2MH9A 3WTYC 1BIBA 2EQUA 2PVOB 5KCOA 1PSEA 2FQ3A 3R0AA 1R5HA 3LAPA 5DM7R