3HRSA

Crystal structure of the manganese-activated repressor scar: apo form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
b'TPNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 65
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrsA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrsA02
3TO9A 2BEOA 1RZ4A 2JTVA 2RN7A 2A68F 1U5TB 1Y0UA 4LFUA 1FY7A 1W7PB 3CO6C 3GXOA 3OV8A 3KP3A 2F5FA 3O6BB 3G3ZA 1QGPA 4EM0B 1W4MA 4P96A 2MH2A 3D5LA 1U5TA 4S04A 3QP6A 4XRFA 4WK8F 5FLXZ 1W7PA 5LHGA 2RKHA 3IC7A 1STZA 2QYOA 4I09A 1YLFA 3GX4X 1XB4A 4BQAA 3LQQA 4LD5A 3K69A 3ZP5A 2NAZA 3AAFA 1MZBA 1ULYA 4KDPA 5DD4A 1O7FA 3I71A 2ELHA 2DT5A 3ZMSA 2HDCA 5LRRA 4LGWA 4PDKA 4GXOA 2BV6A 4HZFA 4CGZA 2UZKA 5JVTA 5J6XA 4O3MA 3R4KA 4IXAA 1SFXA 5LEJA 2DFIA 3HSRA 4FHTA 2PG4A 3J80Z 1ZREA 3BROA 1U3EM 3HSFA 1FLIA 1FT9A 2V1DA 5E1XA 1LB2A 1B4AA 1YIOA 4A5MA 2BBYA 3E97A 2LKPA 1Z7UA 4AIHA 4AWXB 5CJ9A 4A6DA 1U8RA 2FBHA 1OR7A 5DYMA 2EWNA 3P9IA 4U0VA 1XN7A 3I53A 1P4AA 3ABTA 4UV8A 4LG0B 5ILUA 1TW2A 3FXUA 4EMSA 1TNSA 1P4XA 4TV7A 1Z9CA 3ISPA 2XAFA 2XASA 4Y15A 4I01A 2OA4A 2NNNA 2QM3A 4LG0A 5K5QA 2J5PA 5IT9Z 2XAGA 2PMHA 5F1RA 2JPCA 1G3TA 4I2OA 4KICA 2QZ8A 1FOKA 1QPMA 3BJOA 4YFXF 4MNUA 2QQAA 3BY6A 4G7OF 3FZVA 5EEGA 2X4HA 2NNYA 1H9GA 2W84A 2RV8A 4UUVA 4PZJA 1FZPB 1ZG5A 2MH9A 2DQLA 3ZMTA 3E6MA 2FU4A 1LDJA 3O2PE 1SD6A 2LDUA 4HQMA 1OYIA 2H3JA 4MQ9F 4LK0F 1Z6TA 2P5VA 4U88A 2DK5A 3WU0A 2VONA 1TBXA 4OIQF 4RAZA 3K0LA 2GAUA 5FD6A 1I1SA 3S2WA 3DF8A 3COAC 2ZBKA 3BPXA 3BP8A 2CYYA 1S7AA 1QNTA 1KGSA 5DUIA 1L0OC 2VOOA 3H92A 2F5DA 4UXNA 2XROA 4RGSA 2H27A 3RKYA 3GZ6A 3CUQC 4JQFA 3LQRA 4LB5A 3WGGA 4IRIA 4YIFA 2DTRA 2BYVE 3DPTA 4RAYA 2XAHA 2PJPA 1I1GA 1W7PD 2LF7A 2ZNZA 1OMIA 5E18F 1FX7A 4ZYDA 5L3CA 4Q4ZF 2R3SA 4EGZA 3V8LA 1RI7A 2D1VA 5DEQA 2GWRA 2O0YA 2R7DA 3KLOA 3SXYA 3ML6A 1ZH5A 5ILSA 1KA8A 3J7AO 4L5JA 3GUDA 1E17A 2FMYA 5DCMB 4PCQA 3IHUA 2A6EF 4G9YA 3OOPA 1R5HA 3LA2A 3V7SA 2RQPA 2KIFA 4CYDA 2XVCA 5CVJA 1LJ9A 5DCMA 3HTSB 3I5UA 1YW8A 1TQIA 3N97A 3QRFF 5E1ZB 3VOEA 5FO5A 1KYWA 1VTNC 2GCXA 3MZYA 4GYGA 3E3VA 2D2WA 4A2UA 3SHFA 4A5NA 2KJCA 4U7BA 3CLOA 4OMYA 2KJBA 2LF8A 4FX0A 3WTZA 2W24A 2ZFWA 3HOTA 4ENMA 5BPDA 2BGCA 1J75A 5JI6A 4LB6B 3LAPA 1BYMA 3MEXA 2HYGD 2OQGA 4KUMA 2GXBA 2DW4A 4HV6A 1JHHA 3K2ZA 5D8LB 3BJ6A 3T0YA 5LGTA 3TOAA 1SFEA 4RGUA 1TNTA 3ROUA 4ZYHA 1GXPA 2XKPA 1O57A 4LJZF 1R7JA 2WV0A 4IPAA 4HDVA 2EB7A 4KN4X 5ICFA 3VODA 1IF1A 2MA3A 1HW2A 4RGXA 4ZZDA 3M8FA 1HXDA 4M9ZA 2XGXA 5D5WB 5D4RA 4AIKA 2ADUA 5L3GA 2UWMA 3KCCA 3KZZA 2M5WA 3JSPA 3TDUC 3MCZA 1LNWA 2ZJ2A 4HF0A 3VEPA 3KEQA 3P7NA 4H0EA 3B73A 5CVRA 2J5OA 1P4WA 4G7ZF 2EFWA 4BNCA 4CICA 5BPIA 3BPVA 3D0SA 1S7OA 3NEUA 4YFNF 3BDDA 1CF7B 3PQKA 1OPCA 4ETSA 3F6VA 2M87A 2HR3A 4EJVA 1HKSA 1QO0D 2O6GE 2A3SA 3K1NA 3Q9SA 3HRTA 5LHHA 3CO7C 5ERIA 1ZGAA 1USSA 1CF7A 3HRMA 5L3FA 1ODDA 2FRHA 1XD7A 5ICGA 5LLQA 3EQLF 1BBYA 5BOXA 3DPLC 4P5OA 1OYYA 1TQMA 1RUOA 5H6QA 1EH8A 3K9TA 3R60A 1R1VA 3MZHA 2M30A 3P9KA 1B9NA 2EFPA 2VC0A 2HEOA 2PQ8A 3C7JA 2PFBA 4OINF 2QWWA 1S29A 2A5YB 2L54A 1D8KA 2V79A 3TKYA 2EFNA 1FNNA 2L02A 2XRNA 3IL2A 3DV8A 4D0PA 2Y0MA 2VODA 1SMYF 2OZ6A 4BHBA 1J59A 4OMZA 4EVIA 3SZPA 1R5GA 3BOQA 1QBJA 5BS6A 2MLGA 2P4WA 1BJAA 4NB5A 2IJLA 3SFZA 1G4DA 4Y17A 2H6BA 5FD5A 3TDZC 5LRSA 5E20A 5HDNA 1FBSA 1BIBA 1LVAA 3DFGA 1YO5C 1MD0A 2EV6A 1XSXA 4CXFA 5CLSA 1SMTA 3HRSA 1R36A 1R58A 3E5UA 2Y48A 2YX4A 1I5ZA 3IKVA 2FNPA 3EYIA 1ZN2A 1Z91A 5E1WA 5L3EA 2ZO4A 4ENNA 4AD9A 3HUGA 1BM9A 1QVPA 1PP8F 1DPRA 2HFHA 1IRFA 4ZH4F 5K5RA 3J81Z 2C6YA 1ON2A 5TRDA 4EM1A 2DAOA 3KLNA 2IW5A 1FPQA 3SQNA 5DDGA 2EJRA 2JRTA 1S8NA 3JTHA 2KKOA 1HKTA 4L9TA 2W85A 3Q9VA 3GF2A 2IA2A 5KVRA 3JAMZ 2AS5F 2HQNA 3RJPA 1RNLA 5F6FA 3RPUA 3ZN0A 3ULQB 1XMAA 3WODF 1OYWA 2DBBA 2EV0A 3LSTA 3RPQA 1P2FA 2VT3A 1BI1A 4NHJA 3R6SA 1HW1A 1D3YA 2PBIA 1ONVA 2L01A 2COMA 3REOA 3F8BA 2QUFA 4IF4A 2M45A 4UVBA 4ZZLA 2RVCA 1K79A 4I0BA 3QOPA 1IAWA 3GW2A 1KYZA 2PEXA 2O61A 2DO7A 2ISYA 2E7WA 3MAJA 2M8EA 2GZWA 3ABUA 2L3DA 4K2EA 2STWA 1KU2A 3G73A 3GFJA 4KIFA 1XGOA 2F5EA 5AIQA 4ENKA 5D5UB 2STTA 2W25A 3R0AA 5ICEA 3V4GA 2G7HA 3GFIA 3FXRA 4HLYA 3J80K 2YR2A 3HYIA 3K1MA 3GYHX 3U2RA 3RKXA 3M7GA 3QU3A 1ZHFA 5F64A 4M72A 5D5XB 5FFXA 4UVCA 1B1BA 2R7FA 4YG2F 1UHMA 4MEYF 1GXQA 3WTSC 2LX9A 3DEUA 2O03A 2MBFA 2WTEA 4IRHA 4R79A 1FBQA 1YQAA 4L9NA 3HOSA 1BI3A 4WX9A 1V3FA 2DLLA 1TLHB 1F4KA 4S05A 2XHKA 1GHCA 1O3QA 1FC3A 2LNBA 1QQIA 1FYMA 4OIOF 4R1HA 2OBPA 4XSZF 1ZRFA 1I6XA 3HTUA 3WU1B 4BHCA 5LGUA 4G94A 2H6CA 2HTJA 3LA7A 1CGPA 1WQ2A 4RS8A 1DDNA 4RB1A 1FYKA 2A6HF 4ZYGA 4JBAA 1JHFA 4IVNA 4PGGA 4KIGA 1QZZA 1YTYA 2XAQA 2NYXA 4ASNA 1SAXA 5JHUA 1S3JA 4HX8A 4L0YB 3KETA 4WXCA 1TTYA 3B02A 2Q0OA 5HDKA 2E1CA 2FQ3A 3CUOA 5BMZA 1IN5A 2JT1A 3ZPLA 3WE2A 1O3TA 1HSTA 1R00A 1ZRDA 2RC4A 2P6TA 5D5VB 3WGIA 2GA1A 1T39A 2XIGA 1IRGA 3I54A 1X3UA 4KMUX 1W5SA 2VBXA 4I0AA 3IRRA 2OD5A 2ZKZA 2HWVA 5CVIA 1HQCA 3QPTA 2FXAA 3DXJF 4HX4A 5HLGA 2MLKA 4G7HF 2DPDA 1JXSA 3F22A 3MFKA 1IXRC 1YW7A 3EETA 2CW0F 2DPUA 5HDGA 1ZLJA 2EV5A 1F1ZA 1AWCA 1K6OA 3ECHA 2Z5UA 5FFZA 2FF4A 1BI0A 4RB3C 1R1UA 4EJOA 1KU9A 2K4JA 1NHAA 2TDXA 1XDUA 5H20A 3WTXC 3I58A 1ZG1A 5HS8A 4I98B 1J2XA 1PDNC 2K02A 2K86A 2VC1A 2MD5A 3IRQA 3GWZA 1J7KA 4HOBA 4OOIA 2V1UA 1FYLA 2FA5A 2FE3A 3R61A 5IT3A 1HKQA 1U5TC 4O6JA 2H09A 1KQ9A 5K5OA 2NRAC 4YIIA 5CVVA 1DUXC 3ELKA 2DK8A 1Z6RA 2B0LA 4MHGA 2ETHA 2IPQX 5LHIA 1R23A 1S6LA 2E7XA 4WF2A 1P92A 1ZRCA 2JPBA 2XAJA 3L00A 3W6JB 4LMYA 3CUQB 3WE3A 5LEKA 3KP6A 2VBZA 3V8JA 2P7VB 1Q1HA 3P9CA 4DQ2A 3F3XA 4AIJA 4EGYA 3WTUC 3EDPA 4CDGA 5HLIA 2KIMA 2ACJA 4YFKF 4EM2A 1MKMA 4M9XA 5ILVA 4MEXF 4HAMA 4DNCA 3QAHA 4L18B 4A0ZA 2CGPA 1IXCA 1U2WA 3M9AA 5EEHA 2KIUA 2OU2A 2P5LC 4KFCA 1G3WA 3U1DA 1WWXA 3CJNA 1H0MA 4M71A 4MQVA 3WTYC 4LLLA 2PMUA 1G3YA 4LLNA 2RDPA 2A07F 4MGRA 1BC8C 2KRFA 4ESBA 2HGCA 1K78B 2E1NA 2GA2A 3NQOA 1PP7U 2VT2A 4HLXA 4IJAA 1O3SA 3LWFA 1K7AA 1WRJA 3KP2A 4KN7X 1XCBA 2QVOA 2W57A 2HS5A 3KE2A 1K78A 4GO1A 4UHTA 1XGSA 1XSDA 1IN7A 3T1BA 1Z05A 3F8CA 4BXUA 2EFOA 5A2QK 4I7HA 4OU0A 4L0ZB 3QPHA 4OIRF 2RGVA 3RTRA 3T8RA 3V7RA 4QLCU 1DPUA 2IA0A 3KEOA 4B09A 2VOPA 5HOOA 1IN4A 1TQPA 3RDIA 3GLXA 1ZLKA 3ZMVA 2K5IA 3RI4A 2AXLA 4ESFA 5K1YA 3GO5A 4IRGA 3WTVC 1YW9A 5LGNA 4RGRA 2HQRA 1H9TA 4I02A 1F5TA 5JFRA 2WWYA 2Y75A 5HLHA 4R8HA 5FGMA 4RB2C 3MHXA 2P8TA 2ESNA 3FWEA 4GCVA 3LA3A 1P6RA 2G9WA 2K7LA 3GZ5A 1B6AA 3ECOA 2P7CB 5DV5A 2HYFA 4MTDA 2FBIA 3E6DA 3V7CA 1WI9A 3U9GA 5JR3A 3TO6A 2O8XA 1BC7C 5J8FA 4XBFA 2QLZA 1O3RA 3FM5A 4CZZA 2DU9A 1EH7A 2LSOA 3Q5FA 2A69F 2VBWA 3F23A 2MC3A 2HZTA 3WGHA 2IVMA 1MGTA 2M1BA 2ZMEB 3BJAA 3FX3A 3FF5A 4LK1F 4Y13A 3F72A 5D4SA 2VN2A 4L9VA 4EV0A 2O3FA 1T0FA 1Z1DA 1HBXG 3VB2A 4HX7A 3E5QA 2ZMEA 2GQQA 4GYIA 1IUYA 2IT0A 1TW3A 1ZG3A 5D6FA 1HSJA 4WXHA 5FLXK 1YS7A 1MJAA 2D1HA 1KU3A 3F8FA 1V4RA 3PQJA 1KU7A 2K4BA 3EUHA 1AOYA 3ZQ7A 3C3WA 5D8KB 2D45A 2GXGA 1YG2A 4EJUA 3E6BA 5E8IA 2IRFG 3HHGA 1DP7P 1IN6A 5DD8A 1FSHA 3LFKA 3RIRA 2EFQA 3DP7A 3KP5A 3J81K 4A6EA 4WXDA 4KMFA 1MJBA 4L9JA 2FOKA 3VFZA 5H6RA 2P6SA 2CSOA 3WTWC 4RB0A 1J9IA 3FMQA 1MJ9A 4P9UA 1XCVA 2F2EA 4OIPF 4M74A 4M9SA 1FBUA 3MQ0A 4XLNF 3KP7A 4U0YA 3FM3A 1WSUA 2CG4A 3JAMK 4ENJA 1L3LA 4XSXF 4EJWA 1BI2A 4WWCA 4HW0A 3TGNA 2GIVA 3E6CC 1SD5A 2OZUA 2VBYA 5HS7A 1UHWA 4HF1A 2Z99A 3F8MA 2FMLA 3H3ZA 2K27A 4O5VA 1IXSB 3JW4A 5D6EA 1F9NA 2EA2A 2FSWA 1SD7A 3IWFA 2VE9A 1SFUA 1ON1A 2YX7A 1GVJA 3I0TA 3W6KB 3NRVA 4E70A 4EQQA 3T5XA 4WCGA 1E2XA 3E5XA 1XGNA 4QWQA 3V8KA 2V9VA 4G8XA 5AIPA 3C18A 4IHTA 4N9HA 1KQ0A 1W5TA 1T2KA 4A12A 1U6GA 2ZNYA 1YFHA 2CQKA 3R0JA 1KQ8A 2Q2EA 4HV5A 3MWMA 5IT9K 2JZYA 2UXNA 1T38A 3KZYA 3ZMZA 2WC2A 1FSEA 1WKMA 2YPRA 1ZGJA 5CVUA 4KT5C 4G6DA 5ED4A 2PI0A 4CHUA 1J0RA 4BH9A 2EA4A 2QQBA 1OKRA 1JGSA 2ISZA 3FXQA 1D8JA 1RIOH 3HSEA 2F5CA 4MTEA 2FNAA 2NS0A 3QU6A 5DUKA 2RNJA 2XKOA 2YU3A 3GEZA 5E8GA 1YYVA 3ERED 2JSCA 4IHSA 3I4PA 4NQWA 1FP1D 3WTTC 2XUBA 1UB9A 1PUEE 5J8CA 1B9MA 1BOAA 3KFWX 4BYYA 3HIFA 3ZMUA 4BHPA 3TQNA 2DI3A 4U0WA 3WG9A 5ICCA 4UNOA 1HW5A 3O3KA 5LBQA 4P55A 1UCRA 3CDHA 4L5IA 3JTGA 3CTAA 1LQ1A 1B59A 1LDDA 2XV4S 4HA8A 2Z9OA 3BZ6A 5BQTA 3L7WA 3ZMDA 3F6OA 2FBKA 2ZXJA 1BIAA 1UFMA 2CWEA 2HKXA 3EYYA 3DKWA 5DCFA 2V1XA 2CFXA 1XDSA 1IW7F 2IP2A 1LEAA 2VE8A 2ZCWA 3IWZA 2Z3YA 4XLPF 4KYWA 2QENA 3M8EA 4BAYA 3PFIA 4FX4A 2OAZA 1RUNA 2HOEA 1I27A 4KIBA 2K4YA 2P5KA 3N4MA 2G7UA 2QQ9A 4N9IA 3L9FA 1T98A 1XMKA 4CO8A 4AVPA 2HTSA 1ZARA 5L3BA 3I64A 5AONA 2PLYA 4M6XA 4N0BA 1ZYRF 3C1DA 2V6CA 5KK1A 6PAXA 3DQVC 1BN5A 2QBYB 3TO7A 1R22A 1QZYA 3L2CA 3QP5A 4GGGA 5L3DA 3KP4A 4UVAA 4ZYEA 2QBYA 4P9FA 3ZN1A 1MDMB 3GFMA 3GVAA 4F7ZA 4Q48A 3F21A 3HHHA 1XGMA 2CO5A 3FMSA 4EJTA 2Z33A 3HRUA 1SD4A 3K1PA 3CUQA 2L4MA 5A2QZ 4A0XA 3FHZA 3RYRA 2Q8KA 2VXZA 1MDMA 1JE8A 1USTA 1J5YA 1C0WA 2X0LA 2H94A 3E19A 5TJJA 4Z2YA 2K5LA 2ESHA 1T6SA 5HVQC 2HKOA 2EK5A 5HS9A 3L09A 1XSVA 2UXXA 4Q47A 4HYEA 3JSOA 4U7DA 2IA1A 1R1TA 3F8NA 4Q5SF 4HBLA 3I59B 4PGHA 1A04A 3RYPA 4FT8A 4B8XA 1U78A 3LAJA 1G6NA 2BE5F 4JK1X 5CYVA 2OQRA 4HF2A 5E17F 1LEBA 1O7LA 5FB2A 2FEZA 4M6YA 1FP2A 2YSRA 3I59A 4LLGF 1EH6A 1G3SA 1ZAOA 4G6QA 2K5FA 3GFLA 2L4AA 1IZ1A 3FMRA 2PN6A 1YS6A 4ON0A 1D5VA 4HDUA 3H3UA 3BWGA 4M73A 4ESJA 4HQEA 3SZTA 1FWZA 3RKWA 4A0YA 1REPC 1IN8A 1LDKB 3TOBA 3IKTA 4KNYA 3M1EA 2DQRA 4UV9A 1EV7A 3T8TA 4KA4A 2A61A 1QW1A
chains in the Genus database with same CATH superfamily
3TO9A 4PJJA 1MMAA 3BCAA 3TP0A 2BEOA 1RZ4A 3LGLA 2KQWA 2F2WA 2JA6J 2EBIA 3ZR8X 2JTVA 5LD2C 1X6GA 2JXBA 2RN7A 2A68F 3WVEB 2WSFE 4RAFA 1SRMA 3PFYA 2VQHA 2XGDA 2HDWA 1U5TB 5JLXA 1Y0UA 4LFUA 5CQEA 5FKLA 3I9QA 2RAEA 3CPWS 4BQNA 5FWBA 1FY7A 3FK6A 1M2VB 2NUPB 1V55H 1WHUA 4C9YA 4C8QE 1VQ6A 1W7PB 4ZJZA 3CO6C 2DVEA 2F4IA 2OUMA 3GXOA 4RLQA 3ZQFA 3QWYA 1ETKA 2HPIA 3OV8A 5C4JJ 1ZSZC 2HYJA 3KP3A 2F5FA 3O6BB 3OYKA 3G3ZA 1QGPA 2J7IA 2YUPA 4EM0B 4UC4A 1M27C 4QVCA 4CCKA 1W2BA 1JJ2P 3J81E 1W4MA 1QKWA 1JTXA 2M7BA 3HP9A 2DYBA 1M90U 3PNTA 3I4MJ 3ASNH 4C8QB 5HK0A 1GRIA 4P96A 2MH2A 3D5LA 2XF6A 1U5TA 2MK5A 4S04A 3QP6A 4XRFA 4WK8F 1VQKT 2X51A 4LIVA 1M2VA 2NUPA 2QAZA 5IHIA 1WJDA 2CS7A 5FLXZ 1W7PA 5FU7C 3M8JA 4OGEA 5LHGA 3WXMB 3LSKA 1D09B 2J06A 2RKHA 2CZ0B 1K8AC 5JLWA 2PUOB 3IC7A 1W6XA 1Y7XA 3JCMJ 1WHGA 1KIKA 3C95A 2DMUA 1STZA 2ME0A 2QYOA 3SEMA 4I09A 3ULRB 1XS9A 3GTKJ 4LN2A 4ELZC 4II3A 1YLFA 1X3WB 3GX4X 1X27A 1XB4A 3FDRA 4JJBA 4C8QA 3CC7A 3LH5A 3JCMP 2F48A 4BQAA 3J7AF 3PNVA 3LQQA 4KITB 4LD5A 3BY7A 3K69A 3ZP5A 2X6YA 2WBMA 1LFBA 2NAZA 3AAFA 3HKZN 3TSWA 2GTOA 1DU6A 3OYAA 4M7AD 2ZPFB 1MZBA 1ULYA 4KDPA 5DD4A 5FLVA 1O7FA 1MNDA 3M9QA 3OS5A 4M77E 2K3YA 1N25A 3I71A 3RZDJ 1RKTA 5J3LA 3PSIA 5GAGJ 2ELHA 2DT5A 4M78F 1RR8C 2GBQA 4FYYB 1V54H 3OYHA 4AT1B 3JB9D 3K4CA 2CT3A 1FOXA 3QOEA 2KMTA 2NUZA 3QXEB 3JCMc 3ZMSA 2L9NA 1I50J 2HDCA 5LRRA 4FYXB 2ID3A 4J5YA 4C5IA 2L8DA 4F92B 3L2RA 4LGWA 4PDKA 3TREA 4GXOA 2X4XA 1X1AA 2BV6A 2OTLA 1E3PA 2Y0SN 4QTRA 3H3VK 4N4HA 4HZFA 4CGZA 1VQ5I 2K3XA 1TWGJ 2WSEE 2UZKA 4M7DE 5JVTA 5J6XA 2ZPHB 5GANe 1G8XA 4X9DA 1RKWA 4PJOC 3MEWA 2WAFA 3M1CA 4O3MA 2ENMA 3RQIA 2EIFA 3A8OB 3CC2A 2PMZA 1KQSA 1OCPA 3QQAA 3R4KA 4I99C 4MFEA 1RAEB 3RMSA 4IXAA 2LRQA 3S1RJ 1O4XA 2GF7A 4ZGJB 3L1AA 2IGNA 3CMMA 3LFUA 4Y7NJ 3M57A 1Y07A 2FUG2 4M78B 4XM3A 1SFXA 1NZ9A 4XR6A 1Y0MA 4ZN1A 1S72Q 4C0FA 2CU7A 1QVGS 5LEJA 2DFIA 3HSRA 2XKOC 1VZ0A 5KCMA 5FRMA 1YX5A 2LOOA 1VYVA 1YJ9T 2IXSA 4FHTA 2LC4A 5IP6A 1NG7A 4LDUA 2PG4A 2BIVA 2W48A 3J80Z 1ZREA 2DZCA 3BROA 1U3EM 4E7IA 4BEHB 3HSFA 1FLIA 1R77A 4F7UF 1VQLQ 1FT9A 2V1DA 2X6OA 2RQRA 5E1XA 1LB2A 1B4AA 3OMGA 1YIOA 2E12A 2GFAA 4A5MA 5JHFA 3JCMb 5F04A 2VLAA 2BBYA 4M78A 5F0FA 2COWA 4P5NA 2F5VA 3E97A 1GFDA 2LKPA 2CUJA 3Q3SA 2DBMA 1SFKA 1RL2A 3S2DJ 3OSSC 2QA4Q 1Z7UA 2COBA 2M4GA 2MYSA 2QSFX 1SANA 5CJ9A 4A6DA 4AIHA 4AWXB 2HL3A 3M4GA 2VPRA 3BZKA 4JOMA 1U8RA 3VS0A 4A63B 3UA7A 2FBHA 4PFOA 4Y92A 5LJ5d 3CQZJ 1F1BB 1OR7A 3F0CA 4PJLA 5DYMA 5JVGF 2LFBA 2DTHA 2K3PA 2EWNA 3LSHA 4CCMA 2IEKA 2QQ8A 3C2HA 3P9IA 4D9JA 4U0VA 2RJDA 2DMQA 4UUTA 2RQUA 1XN7A 5AT1B 5D7UA 3CJRB 3I53A 5GMKj 1W1WE 1P4AA 2YS9A 3ABTA 4UV8A 4LG0B 1WNLA 2E10A 2K57A 3EH1A 2BUDA 4JDSA 4XTYA 5CK9A 2CW7A 1OPKA 3IUOA 5ILUA 1TW2A 3FXUA 3JRGA 2EBPA 2EYQA 4EMSA 2DJNA 1S72I 5HCKA 1TNSA 3VYRB 5HKCA 1VQ4Q 1P4XA 4TV7A 3EG9B 4JRKA 1R4MB 3PM1A 5FJ8J 1JKOC 1Z9CA 3ISPA 2XAFA 3NAUA 3ZBDA 4HCBA 1AWOA 4JX6A 2EAYA 1I6HJ 2XASA 2V6EA 2ZJRF 1YI2T 4Y15A 1W0UA 4I01A 2HNIA 3JB9H 1VQLI 2OA4A 5IXBA 2NNNA 2QM3A 2M9HA 3LNQA 2LQ8A 4LG0A 3E2UA 4A93J 2CQXA 5K5QA 2J5PA 5IT9Z 5FKNA 5HNHA 5LJ5f 3GMEA 2XAGA 1SFOJ 2NUTB 4KH1B 2PMHA 5F1RA 2JPCA 1G3TA 3C4SA 3ME9A 2IG0A 3EG9A 2QK0A 4E6RA 5E79C 2CZ6B 2DN0A 4I2OA 3GF5A 4KICA 2QA4I 2BY3A 2QZ8A 1FOKA 4CC3A 3H9JA 1VQOT 2O7OA 4ABZA 3HGGA 1YCSB 2VQCA 3QZ5B 1QPMA 2P0KA 4KULA 3BJOA 3MKDA 3FXKA 4YFXF 2D6FA 1OX8A 2PMZN 5KAIC 2MCNA 3L2QA 3FXOA 4MNUA 1SVLA 2QQAA 1PG5B 1SPKA 3AKZA 3BY6A 3HEFA 4G7OF 1YFNA 2NUTA 4E7JA 3G6EI 1YJNA 1TG0A 3FZVA 2ZB9A 3BG6A 2RQTA 4AYBN 4GRIA 5EEGA 1T8IA 1GCQA 2M02A 2X4HA 5GAN6 2WB1N 2ID6A 2NNYA 4M78G 2G3RA 5J4YA 4J6WA 1H9GA 1U1SA 2W84A 2QYZA 1ACIA 4MDXA 2RV8A 2DBKA 2ZXHA 4UUVA 4PZJA 4X0GA 4BI3A 1FZPB 1VF9A 5LJ3e 1AWXA 1VQ4I 2JTMA 1SKUB 1WJRA 1MV3A 2CYZB 5L23A 2KMUA 1QMCA 1SSHA 3OA6A 2XRLA 1ZG5A 1YJ9A 2HSPA 2MH9A 2DQLA 5F0HA 1JUMA 3ZMTA 3CD6T 4CCLA 3E6MA 3FK7A 2FU4A 2CKKA 4LUDA 1LDJA 3O2PE 3NWTA 1I8FA 2EJ9A 1PSEA 1SD6A 3FB9A 4BQQA 4BB7A 4KUDK 2FVUA 3WHBA 3MKLA 2LDUA 4HQMA 2UV1A 1OYIA 5FKMA 3NWSA 2H3JA 2JMWA 2E60A 4MQ9F 4LK0F 3QHSA 1Z6TA 3CCVT 2P5VA 2K7AA 4LNPA 3F70A 2GOMA 4U88A 2LQNA 2DK5A 1Z67A 1ZA2B 2E1HA 3WU0A 2VONA 1TBXA 4OIQF 2GXAA 3JCMd 3OYGA 4IO9F 4RAZA 1HDPA 2BOLA 1OU9A 4IHXA 3K0LA 2B7EA 2GAUA 1U5SA 2A6TA 5FD6A 2EGCA 1DGRM 4XK4A 3S2WA 1I1SA 2NVUB 2OX7A 5CO7A 3CCJQ 3CC7T 5J47A 4RKUE 3DF8A 3COAC 2ZBKA 1RI0A 3A8HB 4F7UG 3BPXA 2Z1DA 2R7VA 1MBJA 1ZK8A 2KFDA 1MMSA 3LSJA 3GP8A 1ETXA 5C44J 3BP8A 4BJ6C 3MCAB 1M1KR 2CYYA 1APLC 4XN3A 2CUBA 4YRVA 2ZSHB 2D8HA 3C12A 2DXIA 3EGDB 3BR3A 3JRDA 1IRXA 2HVRA 4DBFA 1K83J 1S7AA 2JUGA 1HSQA 5EZGA 2KXDA 1QNTA 4JUVA 4ZGEB 1KGSA 5DUIA 1L0OC 4A3KJ 2VOOA 3H92A 1WFWA 2F5DA 4UXNA 1SHGA 2BZ8A 2XROA 2YRVA 1MMGA 4RGSA 2DYRH 1TWAJ 1RAHB 1WX6A 4IHWA 1FIPA 2H27A 1PNJA 1CKBA 1YI2A 3ESWB 3JCMf 1BL0A 4FETA 3RKYA 3GZ6A 2PZ1A 4LUEA 3CUQC 1V5EA 1FMVA 4JQFA 3VV0A 3LQRA 3TBIA 1TWHJ 4LB5A 4V19K 3EGDA 3WGGA 2EYWA 3M56A 3PTAA 4IRIA 4YIFA 2DTRA 1EF4A 3JRBA 2VQGA 2BYVE 3GTGJ 1IG7A 1LCKA 1HDDC 2CP3A 4FW2A 2VJ5A 3DPTA 2EQUA 3HL8A 4DYRA 4AG1C 5EG0B 3D5RC 2OJED 2K9NA 2L9VA 4RAYA 1GBQA 1OOTA 2XAHA 3BG9A 1I1JA 2ECZA 3OYLA 2DKGA 2PJPA 4C92C 1MMDA 2DMTA 3BLYA 1I1GA 3FDYA 5TISC 2LK2A 3OYFA 1W7PD 2LF7A 1VQOA 4Y91A 4QQDA 1X1CA 1OMIA 2ZNZA 3UDCA 5E18F 2X3XD 3QYHB 3JB9J 1WPYA 1FX7A 4ZYDA 1QP2A 3MEUA 3CCJI 2KRMA 1GLNA 1IREB 2P4TA 4PJNA 1V5FA 2L3RA 5L3CA 1RAAB 1D1BA 4Q4ZF 1T3LA 8AT1B 2R3SA 4EGZA 2LYCA 3TEDA 2VASA 3V8LA 2Y4YA 4OMPA 5DLQE 4IQ4A 5D6YA 3G71T 3PO3J 2V4JC 3QYFA 1RI7A 2CUZA 5EG0A 2D1VA 1EX4A 5DEQA 2GWRA 2NOJB 2O0YA 2R7DA 3K10A 3KLOA 3SXYA 3HBLA 4XLEA 2IS6A 3ML6A 2DD5A 1VNDA 2V8KA 4L5GA 1ZH5A 2LDMA 5ILSA 3G1MA 5KNLA 8ATCB 2X1EA 1KA8A 3J7AO 1KD1R 4V2FA 4L5JA 3GUDA 1R71A 3M0TA 1Q7YC 1E17A 2FMYA 5DCMB 2QG9B 4EMGA 3OW2S 3QJYA 2R7TA 4XKVA 2YUOA 3GIBA 4PCQA 4RTYA 2SEMA 2DA3A 5KHDA 4D1QA 5GAN2 3CD6A 3IHUA 2A6EF 3HOVJ 2H8HA 1X19A 4G9YA 3JV3A 3OOPA 3GOXA 1T0HA 4RCCA 1R5HA 5KYUB 4YEJA 3MZ8A 3LA2A 1E7OA 5FU6B 3V7SA 2JJ7A 2RQPA 2KIFA 4BDYA 4M7AE 3REAB 4CYDA 2L9RA 1IGUA 1NPRA 2SRCA 5CKBA 1A6IA 3CCVA 5FKKA 2NLUA 2XVCA 1RAFB 5CVJA 1HC8A 4QIWN 1M1KU 1Z0XA 1LJ9A 5EJCA 5DCMA 4ME7A 5LFAA 5M5XJ 1N8RC 3L1PA 2X4JA 1LKXA 3HTSB 2RI5A 3H35A 3GNGA 4MZPA 3I5UA 1YW8A 3X28B 1J3TA 3BC8A 1TQIA 2BY2A 3PUFA 3N97A 3QRFF 1TL8A 1AD5A 2LTPA 5KYUA 3KXTA 5E1ZB 3VOEA 5FO5A 1KYWA 2OTJT 2NS7A 3BW1A 2XMFA 2A5WA 1DJ7B 2FG0A 2LNVA 1VTNC 3CCUT 2GCXA 3MZYA 4GYGA 3E3VA 2D2WA 2VKHA 2QQRA 3A8GB 2GNCA 4A2UA 3M0SA 4M7DC 3SHFA 4A5NA 2E70A 3CCQQ 2KJCA 4HEA2 4U7BA 3META 2RO0A 1R6RA 3JR9A 3CLOA 3LSGA 2DLPA 1NJIR 4HKEA 4OMYA 2KJBA 3ZRGA 2LF8A 4FX0A 3WTZA 4IHYA 1RLQC 2A36A 4M78D 2W24A 3RPUD 2ZFWA 1ZGWA 1D1CA 4ANJA 1H8AC 3OIQA 3HOTA 3GTOJ 4ENMA 5BPDA 2RHYA 4OAYA 1Y0NA 3EH2A 2BGCA 5GAMj 5IOYA 1M1EB 3QUIA 1RI9A 1J75A 2O5RA 5I21A 3BG7A 2X9HA 4A4EA 3H5AA 4B4CA 1YWPA 5JI6A 3X25B 4BJ5C 3BR6A 2E3HA 2MF2A 3OBWA 4LB6B 3LAPA 1BYMA 1O9SA 3J7ZI 3VYHB 3MEXA 1EJ9A 2IIMA 2HYGD 2OQGA 1MMNA 4Y28E 4RTXA 2EZHA 4KUMA 2AK5A 2GXBA 2LJ3A 1JT6A 1NBEB 1ENHA 2DW4A 3H36A 4PJOE 3FHNA 4HV6A 3H0FA 4OMNA 1JHHA 3K2ZA 5FKOA 5D8LB 1JJ2S 1KD1U 1KFZA 4BDZA 3JCMQ 3BJ6A 2DA2A 3T0YA 1M9SA 4EIKA 2HDAA 2DT7B 2DERA 5LGTA 2MC4A 1QU3A 3TOAA 4QVDA 1SFEA 4RGUA 1TNTA 3S14J 1AWJA 1WJAA 4BGDA 3ROUA 4ZYHA 1GXPA 2XKPA 1XTAA 1K73R 1O57A 2KL4A 2C06A 4LJZF 4JX4A 1R7JA 3G71A 4J9GA 2WV0A 4IPAA 3CCQI 4CCOA 3F9KA 1P7IA 3NARA 2EQRA 1HLVA 5GAOl 2WY8Q 4HDVA 1TC3C 1YE9A 4DYCA 1W4SA 2EB7A 2LMDA 1AKHB 3HFNA 4KN4X 1Y8RB 1RRJA 5ICFA 3P8DA 1VQKQ 3VODA 4BUGA 2IVWA 4PJMA 2FQ4A 1IF1A 3S1NJ 1UHSA 1WH7A 2MA3A 1QA6A 1HW2A 2ROTA 4RGXA 3HOWJ 1Q82R 1HK9A 1SEMA 4W1UA 3GZNB 3RESA 4ZZDA 2AHQA 3M8FA 1HXDA 2XPWA 4ZC3A 2K9GA 4C8QC 4M9ZA 3NTIA 5EEAA 4M75F 4B43A 2DL7A 2XGXA 2EYYA 5D5WB 2JMAA 2JZ2A 2K2MA 3BR5A 2X1DA 5D4RA 3G7ZA 4AIKA 3SHWA 2ADUA 5GMKe 1AKHA 2IBDA 2AT1B 1Q81C 4FTHA 4A3LJ 5L3GA 3SEQA 2JN0A 2R5MA 2KROA 4J83A 3FJPA 2UWMA 2R57A 5GAMg 1IV6A 4XLCA 3KCCA 4CI0C 3KZZA 1FJLA 4IKFA 2M5WA 2QDYB 4ATOA 3JSPA 3I56T 3TDUC 2K40A 2XG8D 1NJIU 3UT1A 3DWLE 1VQ7T 2E5KA 3MCZA 4B48A 3K7AJ 2CV1A 3U21A 3VDXA 2EZIA 1QVFP 3THKA 5CQGA 1LNWA 1IGQA 3DLLF 1MHNA 1PD1A 2ZJ2A 4C3HJ 2OTJA 4HF0A 1T0FC 1R49A 1JUSA 3VEPA 2RD1A 1FTZA 1E6HA 3KEQA 3P7NA 4H0EA 3ZQLA 3CCUA 1U9OA 3B73A 4IOAF 5CVRA 5A0DA 1Q86R 4IQJA 2J5OA 2XB5A 2ZMEC 4M75B 1P4WA 3H8ZA 4QQ6A 5B3SH 3MP6A 4N0AA 2VJ4A 3BTLA 1K76A 4LD6A 4HNVA 3B6CA 2L2OA 4G7ZF 3CMAQ 1VQKI 5IP7J 1AT1B 2WA0A 2EFWA 4WTOB 4M77C 5CKDA 4BNCA 3U1KA 4CICA 5BPIA 2YUNA 4PLLA 1BOBA 3BPVA 2JM8A 1EA3A 1T33A 3D0SA 2R93J 1LVKA 1S7OA 4OP0A 1DQUA 1VFCA 3NEUA 4YFNF 3RUXA 1CSKA 3BDDA 3JRIA 2BZXA 1CF7B 3PQKA 3DKXA 1OPCA 1KQ2A 1GFCA 4M75A 4ETSA 1K1ZA 4DZPA 3F6VA 2VPLA 5EZHA 2QXFA 2M87A 5J3BA 1YRNB 1VUBA 2HR3A 1K73U 2E2JJ 3PO2J 2DOFA 2F69A 4EJVA 3CXCP 1HKSA 1QO0D 2QSHX 2O6GE 1ABQA 6AT1B 2A3SA 4Y4RA 3K1NA 4LDWA 3OYNA 3A1YA 1TTHB 3VS2A 4EMHA 2HOAA 2VB6A 2DD4A 4AU7A 3EUHC 3Q9SA 3HRTA 5LHHA 3QPLA 3CO7C 1N78A 2NVTJ 2D8JA 5ERIA 1ZGAA 3M0UA 2RNGA 1N5ZA 1USSA 1ZA1B 3JCMX 2KRNA 1O75A 1CF7A 1UAAA 3HRMA 1SHFA 5L3FA 2L3PA 1W2BP 3JSCA 1ODDA 2FRHA 1AA7A 1XD7A 2XPVA 2KDZA 2YSQA 5ICGA 4LDXA 1YRNA 5LLQA 3EQLF 1BBYA 3G1JA 1Q82U 2BXYA 4M4ZA 4S0HB 2GM4A 1UHFA 5BOXA 3HKZA 3DPLC 4P5OA 1OYYA 1TQMA 1PCXA 2WSCE 3AT1B 2RJFA 3D5SC 1RUOA 4CC4B 5HLTA 5IHNA 5H6QA 3I55Q 1EH8A 3TW6A 1VQPQ 3K9TA 2ZCFB 5F08A 4LIUA 3PL8A 3R60A 1R1VA 3E9GA 3HG9A 3X20B 3MZHA 1B7TA 2OTLT 1UFFA 3CMAI 2M30A 3FBIB 3E1SA 3QYBA 4N4GA 3FKIJ 4II2A 3P9KA 1NG6A 2K9QA 1NK3P 2C0OA 4KRTA 4BQOA 3UNGC 1B9NA 2P0PA 3TSZA 2EFPA 1D1AA 2VVKA 3VS3A 2AXTC 4DIQA 1VQMI 4DOWA 4NOYA 4XICA 4YTLA 4HVVA 2VC0A 4F91B 3CC2T 4PLIA 3MKWB 2HEOA 2Y0SA 2PQ8A 3C7JA 3VU3C 3QG1A 2E1OA 3UWNA 2PFBA 4OINF 2DTOA 2QWWA 4KGZB 2FPDA 2HQ5A 4Z6YA 1S29A 2A5YB 3PGGA 1KK7A 4K11A 1R0CB 2L54A 1NYGA 1D8KA 4FIBA 2V79A 1Q86U 2FO0A 3TKYA 5LL6S 2EFNA 3K4LA 1Q82C 2VWFA 1FNNA 2AHJB 3OYBA 2M8GX 2R5YA 2L02A 2FPFA 3I56A 2LY1A 2JOYA 2XRNA 1VQ7A 1QCFA 3IL2A 3DV8A 4D0PA 2Y0MA 4C2UA 1SMYF 2JQ7A 2VODA 2OZ6A 4RMOA 3QDFA 4BHBA 1J59A 4OMZA 2F2XA 3KUFA 4EVIA 3M58A 2RB6A 3EHQA 3CXCA 3SZPA 4GY5A 1RACB 2GFUA 1R5GA 2JM9A 4M75G 1K4TA 3BOQA 1QBJA 3SDBA 2X6XA 2DZ9A 4UB6C 2MLGA 5BS6A 1KQSP 3VS6A 2P4WA 3CF5F 4F17A 1BJAA 3I55I 3H9NA 4XQ3A 1VQPI 4JJNK 4G12A 3OR1C 4NB5A 2IJLA 2F4OB 3SFZA 1GCQC 5EYRA 4HT8A 1G4DA 5HK3A 2CUFA 4Y17A 3S3NA 3K70D 2VUMJ 2H6BA 4B3XA 1VQ5Q 2CDTA 5FD5A 4HVWA 3TDZC 2IS1A 1M8MA 5LRSA 3SZGA 5E20A 2R7WA 1WLPB 4RUGA 5HDNA 1H3HA 2E41A 1FBSA 4A69C 1BIBA 1MUZA 1RLPC 1LVAA 2LCCA 3VS4A 2M1HA 2PVDB 4Z89A 3JRFA 1VQ9Q 3DFGA 1YO5C 2KGTA 4JRIA 3P5JA 3RERA 2KVQG 1MD0A 3PJRA 2EV6A 2FPEA 3MO8A 1XSXA 1IDYA 4A3BJ 4CXFA 1POGA 5CLSA 1I81A 2YLBA 3DB3A 5GJWB 1SMTA 1X1BA 3HRSA 2M0MA 4F93B 1R36A 2BXZA 3UR3C 4XL9A 3OMYA 1R58A 2FOWA 3HUGB 1NEGA 3E5UA 7AT1B 2Y48A 1UELB 1MSFC 1I4K1 3K4NA 3J7YJ 3IQLA 2YX4A 5GAEJ 3CCMA 2Z16A 2ESWA 3ONQA 1I5ZA 2GGRA 2JA5J 3H0IA 3IKVA 2FNPA 3S93A 4XN0A 3K4JA 4J7FA 4DBHA 1XMXA 3EYIA 2YWWA 4C3JJ 1I5LA 1ZN2A 2IGKA 1UZCA 2KLOA 1Z91A 5E1WA 4DZJA 5L3EA 2K9LA 2L3QA 2ZO4A 4N4OB 2L0AA 5IPAA 1K4SA 4AFZC 4ENNA 2CV0A 4AD9A 3E9FA 1M90C 1VQ8Q 1XC5A 2N8GA 2PUKB 3HUGA 1BM9A 1QVPA 1WJQA 2V1RA 4RTTA 3I9V2 1PP8F 1YIJT 3BR1A 2P0WA 1DPRA 2HFHA 4XMYA 4JZ4A 2DNUA 4DA4A 4BU2A 1JKQC 2PVGB 2O31A 3G2BA 1W70A 1IRFA 1X4OA 4ZH4F 2O01E 1ZELA 5K5RA 3J81Z 4QQGA 3H0GJ 2EH3A 2R7QA 3TP3A 1H3ZA 1D0YA 2PX9A 2C6YA 4ZDLA 4UY8I 1ON2A 5TRDA 4C3IJ 2GQVA 2QEXA 5DM7R 1MNEA 1FEXA 1H92A 1YJNT 4EM1A 3FKJA 4M78E 3OYJA 2DAOA 3KLNA 3S1MJ 1ACMB 2IW5A 2MFZA 1VQ9I 3OB9A 2ABLA 3WG7H 1VQ6T 2HNHA 1FPQA 3SQNA 5DDGA 1Y39A 1QPIA 4J00A 1UUEA 4F55A 2EZKA 4M3GA 1HOMA 2EJRA 2JRTA 3PVQA 3WHCA 3SWNC 1S8NA 2PNIA 4AYBA 2RM4A 3HDDA 3JTHA 2QGUA 4KUIA 2WB1A 2KKOA 2FRWA 1HKTA 1BCOA 4L9TA 1S5LC 2DA5A 3CCLT 2W85A 1WZ2A 4FT4A 3Q9VA 3GF2A 2IA2A 5KVRA 3JAMZ 1PD0A 3LGFA 1ARKA 1FOYA 2DMNA 2AS5F 2HQNA 4A3JJ 1AZEA 3PVLA 5GAMe 3RJPA 3L2WA 3VYUB 4J19A 2MWPA 1I0CA 2C0IA 1RNLA 5A0LA 2OI3A 5F6FA 1VIEA 4KBMB 3RPUA 2HAXA 3MVPA 2FZKB 3ZN0A 4PSWA 9ANTA 1VQ8I 5GAN7 4C2TA 1E3HA 3ULQB 3IH3A 3HHTB 1XMAA 2D1XA 1QCOA 2M3AA 4QT7A 4C30A 1U1TA 4HCCA 1JTYA 3EG3A 2AO9A 2I2LA 4IIOA 3OIOA 2EZLA 3SFMA 2BTTA 3KPHA 4E6KG 3WODF 1OYWA 4F7UE 4BEHA 1SC7A 1BU1A 1IO6A 2DIGA 5C4XJ 3SEZA 3CMET 3CCVQ 2V26A 1Z77A 4MIMA 2DBBA 2FD5A 2EV0A 3LSTA 3RPQA 1S7EA 4IURA 1P2FA 3G6EQ 2M4KA 3CCYA 5GANd 4F14A 3CCEA 2VT3A 2KXCA 5H2FC 4F7UB 5CIUA 4HNUA 3REBB 1BI1A 4J9CA 4NHJA 1QHHD 2JUCA 3R6SA 4ZTFA 1X75C 2COZA 1HW1A 2KYMA 3CEYA 2O9VA 2DMPA 3AFHA 4HVUA 2HBPA 1D3YA 2PBIA 2EVRA 2LD5A 1FMWA 1ONVA 3EGUA 1Y1VJ 1MH4A 5FU7B 2DDBA 4U87A 2L01A 3EG2A 2XB0X 3Q0WA 3L2VA 3M54A 2BHZA 3KYLA 2COMA 1M90R 2ICWG 3REOA 1GV2A 3F8BA 5IAYA 2QUFA 1BA5A 1BR4A 3I3LA 2M45A 4IF4A 4UVBA 1R9TJ 1DU0A 2DL4A 2JS0A 3VKIA 2XD0A 1MBKA 1Q95G 4F7UA 1M30A 1A0NB 2GIZA 3SYTA 4ZZLA 3SB2A 2RVCA 3HTRA 4XTVA 3AG4H 1K79A 4I0BA 3QYGB 2VKEA 3GBGA 2DA7A 1Y96B 1F36A 2QTVA 3HGYA 1JEGA 1UEBA 2BVMA 3QOPA 1IAWA 3GW2A 1TOVA 1KYZA 1G83A 1WJSA 1WJFA 2PEXA 3LMMA 2DO7A 2ISYA 3DTEA 3ZQQA 2O61A 5CCAA 2E7WA 2FX0A 3MAJA 5FU6C 2M8EA 2GZWA 2ELJA 5GANf 3ABUA 2L3DA 2VL8A 4K2EA 1UGPB 2DRMA 1WXTA 2STWA 1KU2A 2EIJH 3SFIA 3VSLA 2MMPA 3G73A 1YIJA 3GFJA 4KIFA 3GTJJ 1XGOA 2F5EA 2FJ1A 5AIQA 1VYTA 4M75D 4EMKC 2NS8A 3DKYA 4ENKA 3C0CA 5D5UB 2STTA 5FRNA 2W25A 1WHMA 2R5AA 3KYDB 2DT6A 3R0AA 4DOZA 3V4GA 5ICEA 1Y96A 3GNFB 4M7AC 2G7HA 3V42A 3FXRA 3GFIA 4HLYA 2RA2A 4J6XA 2BE7D 2LLKA 3L42A 3J80K 2YR2A 3HYIA 3JREA 3HOYJ 3K1MA 1T95A 2QTXA 2EQJA 3GYHX 3U2RA 2DA4A 1ZUUA 1OCZH 3RKXA 2MPXC 1U0JA 3MEVA 3M7GA 3QU3A 4AFUC 5K7ZA 1ZHFA 1YJWQ 5FW9A 1OEBA 4CC7A 5F64A 3CCRA 3WU2C 4M72A 5D5XB 3CBMA 4AG2C 1M2OA 1NH3A 5FFXA 2R0QC 4UVCA 2CREA 1AZGB 1VA7A 4M3FA 1B1BA 2KK4A 5GAOp 2R7FA 2I5UA 3OIPA 4RTVA 1JU5C 3CCLA 4BY7J 3D7SB 2NVXJ 4A3GJ 4XORA 2BZTA 4FASD 4CH7A 4KISA 4YG2F 2Q1ZB 2LKXA 2WV1A 1CQTA 1QVUA 3ZFJA 2W1OA 2RN8A 1UHMA 2ZPEB 3VYGA 3OOUA 4MEYF 2KI7A 1GXQA 3WTSC 2LX9A 3AL0C 3DEUA 1M4ZA 3MMYB 1NE8A 2Z0WA 2O03A 2MBFA 3DU6A 2WTEA 3N05A 4IRHA 4NC6A 5IYBJ 4CSWA 1FBQA 4R79A 3IV5A 2XI9A 1UGQB 4PKCC 3NTKA 3VJPA 1WJBA 4PJOF 1YQAA 4L9NA 3S15J 1QQJA 1UE9A 2XIDA 3NFCA 3HOSA 2RI2A 1BI3A 4WX9A 3DU5A 1V3FA 1E6GA 3H41A 3FRNA 4C0DB 2DLLA 3BG3A 1X4PA 4UB8C 3SJMA 1ZR4A 4FYVB 2XGEA 2O9LA 1X2KA 1TLHB 2MAMA 1YITI 3CC4Q 2DYSH 2KDOA 3G4SQ 5E3NA 1F4KA 3CCSA 1YHQQ 2JNGA 2JWTA 5J1RA 1FOWA 3CMEA 4S05A 4LE9A 4JLIA 2XHKA 4P1WA 1O3QA 1GHCA 2BKDN 1FC3A 2LNBA 1QQIA 1FYMA 2CMPA 1U8BA 4OIOF 4ORZA 2JN6A 3OYYA 4FYWB 4R1HA 2L89A 2VQLA 5DTDA 5L8RE 1VI0A 1B3QA 1YJWI 2OBPA 4XSZF 1ZRFA 1I6XA 3HTUA 5GMKm 3VRZA 3WU1B 2DL8A 4FE4A 5M3MJ 3U23A 4XU3A 4PJOB 3SDZA 4BHCA 4RA2A 5LGUA 4G94A 5LJ3d 2H6CA 2HTJA 3LA7A 4F52A 5HY6A 5LJ5h 1CGPA 2ATCB 1QKXA 1WQ2A 2MGQA 4RS8A 2DFFA 2XDPA 2YHTA 2Y4XA 2ZXIA 2DO3A 1DDNA 1QVFS 4RB1A 1FYKA 2X4WA 3W2WA 2O2OA 2A6HF 3ZQHA 5GANh 1SRLA 1KJWA 4BY1J 4ZYGA 3EG1A 4JBAA 1WXUA 2BZYA 1OV3A 4J9FA 1MBEA 4NUBA 1WI7A 1BJZA 2VXEA 2EYXA 4PJOA 3DKMA 3ZOBA 2XC7A 2ZC2A 4M6VA 1JHFA 3LSPA 2CFOA 1N6AA 4IVNA 5GAN4 4PGGA 4KIGA 3CJQB 1QZZA 2C0TA 3M0RA 2HXIA 4Y3OA 3CC4I 1S72T 3CPWA 3DBLB 3G4SI 1YTYA 1YHQI 1VQ6Q 9ATCB 2A08A 2XAQA 2R4GA 2LBFB 4J7IA 2NYXA 4ASNA 4B47A 3MJXA 3CZ6A 3QIIA 5LJ3f 1SAXA 1RAGB 4NL3A 4JS4A 5JHUA 1I5OB 1S3JA 1TU0B 1OLTA 3PT9A 4M3BA 1UGSB 1TWFJ 4F16A 1VQLT 4HX8A 2KRHA 2CQQA 4L0YB 3ERMA 1ABOA 3KETA 4WXCA 1TTYA 3M5AA 4XTWA 4QPOA 3B02A 3UATA 2Q0OA 2V1NA 5HDKA 2E1CA 4AIDA 2CSQA 3CXCS 3GTMJ 3EFSA 3ZQGA 2FQ3A 3CUOA 3GLLA 4XRMA 3OSFA 3PUBA 3S3MA 5BMZA 4DEXA 2BVLA 1YN8A 3BCBA 2V8IA 2LBFA 4N4NB 3NGPA 3A8LB 2H8RA 4OB2B 1IN5A 2JT1A 2NOGA 2QA4T 5GP9A 2HCKA 4JPBW 2AKKA 3OYIA 3ZPLA 3WE2A 2W00A 1O3TA 1B8IB 1HSTA 1EIFA 1R00A 2NXNB 2TRTA 2VJIA 1ZRDA 3KEYA 2RC4A 1W2BS 2P6TA 5F27A 5D5VB 2GA1A 4L5EA 3WGIA 1T39A 2JW4A 2LQWA 2XIGA 1IRGA 4AUXA 2PJRB 3CC7Q 2EFIA 3BFMA 2VI6A 2LVMA 3OYEA 3I54A 2JA8J 1X3UA 1VQ5A 1IHWA 4KMUX 1ETQA 1X6OA 1W5SA 1ZUYA 2VBXA 2QQSA 2QGFB 4XTUA 4XLFA 3BTIA 1A6QA 1ERDA 4N4IA 5M9OA 1X43A 2MG4A 2Z2SB 2RHIA 4I0AA 4A54A 3OS0A 3IRRA 2OD5A 2ZKZA 4RTWA 5EG2A 2KAFA 2KY9A 5J1YA 3DBHB 2HWVA 5CVIA 1HQCA 3QPTA 2K79A 3Q1JA 2KR3A 3JRHA 3M55A 2FXAA 3DXJF 2MSYA 4HX4A 1B8IA 5IOZA 2VGMA 1N9SA 5HLGA 1WHHA 2MLKA 1JQQA 4G7HF 2LTOA 2DPDA 2QSGX 3S3OA 1VQ6I 2RQVA 1JXSA 2VXFA 3F22A 3MFKA 1J09A 1IXRC 1YW7A 2Y69H 2PJRA 1CKAA 2RHXA 3M59A 3TCJA 2ZPGB 3H5RA 2CP6A 2HKQB 1OCCH 3EETA 1NPPA 2E6NA 2CW0F 4B3AA 1VQNQ 2LY9A 2DPUA 2KZVA 2RJCA 2EYZA 3FISA 3OYMA 1YP5A 1SF9A 2EGEA 1FYNA 3H6ZA 5HDGA 4LXCA 5LJ5j 4HCZA 1ZLJA 4E7LA 4XLAA 1K8AR 4PJOG 3HPGA 2EV5A 2EIKH 1F1ZA 2JVGA 2V7FA 2B9SA 1AWCA 1RADB 3JCMh 1K6OA 2DTIA 2ZPIB 4AFQC 4VUBA 3ECHA 2Z5UA 4YIRX 5FFZA 5B66C 5CKEA 3C2BA 1R0BG 2J05A 2L9SA 2PTKA 2VC8A 3O8HA 1KC8R 2FF4A 3VYSB 1BB9A 4HNTA 1BI0A 4PUSA 3RNJA 1IZ6A 4RB3C 2W10A 1XG1A 1M1KC 1R1UA 3VYTB 4EJOA 2R58A 1ETVA 3ER0A 1KU9A 3A02A 2EPFA 2K4JA 2YT6A 4J9DA 3TVTA 4A4KA 3CBPA 1QVGA 4XTXA 3CDLA 2DCEA 1NHAA 2TDXA 1XDUA 5GADJ 1ZQ1A 3EFRA 4BUPA 2EJGA 3CC7I 5H20A 4A4GA 3C2GA 2ZSIB 3WTXC 1FIAA 3I58A 2E34A 5HS8A 1ZG1A 1RR7A 3MP8A 4PFZA 2HQAA 1WJEA 2ZJQF 1OULA 1TUGB 2KRCA 1NLPC 3EHRA 4QPQA 1KQSS 4A4FA 1M1GA 2KEAA 2E1MC 4I98B 4A53A 1J2XA 1PDNC 2R92J 2K02A 2K86A 1YBYA 1DGWY 4DYQA 1WIEA 3LH0A 1BR2A 2VC1A 2E36A 1TP4A 2WAEA 1GUUA 2MD5A 1NK2P 3IRQA 3MKZA 3GWZA 2XDDA 1TSFA 2QCOA 2E5ZA 1S72A 1J7KA 4HOBA 3A1PA 5KCOA 4XKWA 4OOIA 2V1UA 1TH7A 2LX7A 1VQNI 3DCFA 1FYLA 1OQKA 2OTLI 4CC2A 3DLMA 4JX5A 2FA5A 4Z88A 2FE3A 3GTLJ 3R61A 2LMJA 5IT3A 4RMNA 4C0GA 1LUJB 2RK2A 2DJQA 5KYXB 4R0KA 2Y9ZA 2F2VA 1HKQA 1U5TC 1QCNA 4OF1A 1E3OC 1VQLA 4O6JA 2CT4A 1RUWA 1KQ1A 2HKNA 2H09A 1KQ9A 2LH9A 5K5OA 2HVSA 2W0ZA 3CC2I 3QYEA 2NRAC 3RKQA 4YIIA 1QHGA 5CVVA 5I2SA 5A2QE 1DUXC 2E71A 3ELKA 2P84A 2ROLA 2COYA 2MD0A 1FTTA 2DK8A 5FLMJ 1Z6RA 1PSFA 2QA4A 2B0LA 2FEIA 4MHGA 2ETHA 3S16J 5CPRB 1PKTA 1P7JA 2IPQX 1JI8A 3S32A 4C92F 5LHIA 1WHJA 1H88C 2BHYA 5LJ5g 3OL4A 5KYXA 3QWLA 4MLOA 4ZDPA 2RH2A 2I10A 1R23A 2HSEB 2P4RA 3CCJT 1YX3A 1K9AA 1S6LA 1OCOH 2CS3A 2WAQA 1KD1C 2E7XA 4WF2A 1P92A 2XDBA 3G6EA 3LOCA 3G1LA 4E7KA 2XHCA 3OYCA 1ZRCA 2JPBA 4OWRB 2XSJC 1WI3A 2XAJA 2FZGB 3R6OA 2M34A 3L00A 3W6JB 4D7MA 4DBQA 4LMYA 3CUQB 3WE3A 5LEKA 3KP6A 1B07A 2VBZA 4J8OA 1PC0A 3V8JA 2HXOA 1Q1HA 2P7VB 1JJ6C 1U06A 5KYWB 3P9CA 3PIPF 2OV7A 5DS9A 4DQ2A 3DBRB 3F3XA 2DRKA 4M75E 1VQ4A 4LG3A 5EDNA 1BW6A 1WCMJ 2H1LA 4F04B 1KC8U 1RPWA 4AIJA 4EGYA 1LFUP 1G2HA 2MI6A 1WQWA 2JVHA 1UJ0A 4XONA 1WH5A 3K4KA 2L7KA 4V2GA 3WTUC 1YJ9Q 4C92B 1N75A 3EDPA 1OFCX 1H8KA 3H9GA 4CDGA 4CYCB 1IDZA 2UUZA 3MP1A 3UF4A 1WVRA 1X3ZB 5HLIA 1OCRH 2DYIA 2OJ2A 3MEAA 1QWFA 2KIMA 3P8HA 1IO2A 4RDUA 1K4US 4M3DA 2ACJA 5KYNA 4YFKF 4EM2A 1E0EA 4E2FB 5KYWA 4AFSC 4RAGA 1MKMA 4M9XA 4J9BA 5ILVA 4MEXF 4HAMA 4DNCA 2RF0A 3BTJA 2IGMA 3QAHA 4L18B 3DEEA 2I8DA 4A0ZA 2MOXA 2HDDA 2CGPA 1IXCA 4C92A 5GAHJ 2FYKA 2D0NA 1U2WA 4A3CJ 3A4CA 3M9AA 5EEHA 4CYCA 1UECA 2KIUA 2OU2A 4W97A 2P5LC 4KFCA 1BK2A 1G3WA 2H1KA 3KFVA 2LQKA 2E2HJ 3L2ZA 1NJIC 4J9HA 4HG2A 3U1DA 1HYOA 4NL2A 3DEWA 2WADA 1WWXA 2GBYA 5C0MA 3CJNA 1H0MA 3QPSA 4M71A 4MQVA 4A3FJ 2VYTA 3NTHA 4FL6A 3NMZC 4JS5A 3FXLA 2KYBA 3QWXX 4M78C 3CCMT 3WTYC 4LLLA 2DDAA 1LJOA 1EKEA 1SG5A 2NYSA 3O8VA 2PMUA 1G3YA 4EDUA 4M7DF 2CUEA 1X1DA 4LLNA 2ECBA 3INZA 2RDPA 3OS2A 2A07F 3PIPA 2CRGA 4MGRA 1BC8C 1S1NA 2E64A 3DLLA 2KRFA 4ESBA 2FZCB 4LITA 3BT9A 2HGCA 1K78B 3CF2A 2E1NA 1K6YA 2GA2A 1N27A 3NQOA 2QDLA 1M1FA 2L2PA 3HKSA 3TL4X 1WPKA 2OCEA 1OISA 1OR7C 2VT2A 1PP7U 1WA7A 4HLXA 3A8MB 4LDVA 1LNXA 4IJAA 3QSUA 1O3SA 1K0SA 3WVDB 4XNFA 2K85A 1WYXA 3LWFA 1K7AA 1I3QJ 1YJNI 1WRJA 2OAWA 4BY6B 3KP2A 1GXIE 4KN7X 4I76A 3VSKA 1XCBA 1JKPC 1Y71A 1T08B 2QVOA 2HZYA 2QEXT 2W57A 2HS5A 3KE2A 1K78A 4FISA 4GO1A 4PJOD 4UHTA 1XGSA 2WAQN 1XSDA 2D9TA 3JCMg 1IN7A 3T1BA 1IB8A 3LW5E 4ESRA 1Z05A 4M7DB 3F8CA 4BXUA 2DL3A 2EFOA 3EUAA 4I7HA 5A2QK 4IUUA 1IGNA 1D3BB 2LP5A 4OU0A 5HODA 2YUSA 3QPHA 4OIRF 4L0ZB 4ELYC 2RGVA 1YJ9I 3BTCA 3RCOA 2VKVA 3RTRA 2E3IA 5EF6A 2M0OA 2LJ0A 3CCJA 1KHCA 3OSVA 4XQFA 1UMQA 1EZZB 4IUTA 2DFHA 4ZNXA 3DLAA 3T8RA 4OAZA 2O8KA 3V7RA 1NLOC 4QLCU 1DPUA 1NYFA 1YI2Q 3HFOA 5CAIA 2LY2A 3DPUA 2IA0A 3KEOA 1PYVA 2ELKA 1T56A 3CCQT 1MBHA 4B09A 2D5VA 2VOPA 2LT4A 4M7DA 3AG3H 5HOOA 1IN4A 1TQPA 2E19A 1D3BA 1Y6IA 3M0QA 3RDIA 4L59A 1Y8QB 3GLXA 1ZLKA 1BR1A 4E7ZA 2L5QA 4RLFA 1X01A 4E47A 3ZMVA 1Y56A 3W3CA 5FLXE 4C92G 1VQOQ 3IP4B 2K5IA 4FSXA 2V9PA 4BKXA 3RI4A 1WHKA 2AXLA 1YCYA 3BDLA 3FC3A 4ESFA 3M53A 4CA0A 5K1YA 3GO5A 4IRGA 1NEBA 3WTVC 4C8QF 1JUPA 1YOVB 3HJEA 2VXDA 4IUPA 1A31A 4II1A 1YW9A 5LGNA 2CH4A 2EGAA 4RGRA 4IL6C 4ZYAA 1W36C 1ZX6A 4A3EJ 2HMAA 2JJ9A 3RBBB 2HQRA 1HJDA 1M3AA 3PMIA 1H9TA 4OMQA 1K8AU 4I02A 1RABB 1F5TA 2CP7A 3BZCA 4HXJA 5JFRA 1Q86C 1X1PA 4BS9A 3CCET 3A0HC 5J1UA 2WWYA 2G6FX 4RTUA 2Y75A 5HLHA 4R8HA 5FGMA 1HA8A 4XOPA 3A5ZB 3OW2A 2HI3A 4RB2C 3CPFA 3MHXA 2P8TA 3CD6Q 5E3LA 1EFNA 2JSPA 2CP2A 2EW3A 1ETWA 1Z3YA 2ESNA 3FWEA 2R5ZB 1YI2I 4GCVA 1PRMC 1V1CA 2XSDC 1WGSA 4GLKA 4KH0B 3LA3A 1P6RA 1ZTRA 2G9WA 2K7LA 3GZ5A 1FXXA 4HPQA 3JCUC 1VOMA 1B6AA 1XX5A 3ECOA 2P7CB 2F5TX 5DV5A 5IN1A 2L0KA 2VKDA 5CKFA 2F4MB 2ZFUA 1PKSA 2RI3A 2HYFA 3E0JB 1IRZA 2EQIA 2VV5A 2YU9J 1Q1VA 4MTDA 2XPUA 2FBIA 3E6DA 3V7CA 1C1AA 1WI9A 2OC6A 3U9GA 2VGNA 3VUBA 1FMKA 5JR3A 3TO6A 1UJYA 1ZBXA 1VQOI 1HCRA 3TW7A 4OB1B 4M77F 2R5ZA 2O8XA 1BC7C 3PIOF 2RMOA 4V2SA 5J8FA 1R4NB 4XBFA 3SDGA 2QLZA 2DFEA 1O3RA 2M16A 3JRZA 3FM5A 4CZZA 4GBQA 3S6WA 4CRIA 5GMKh 2DU9A 1EH7A 4BXFA 2LSOA 2DILA 4JYKA 3ZGKA 3Q5FA 5CQXA 4M3EA 3JAME 4NS5A 3LL7A 3A2KA 2K5CA 2CH4W 3J80E 1SAUA 2A69F 1KZHA 2ED1A 4C0DC 2VBWA 3F23A 4M7DG 2ME6A 3ZXSA 2MC3A 2JTFA 1R5ID 1H89C 2HZTA 3CESA 3WGHA 2HQHA 3S17J 2IVMA 3HM5A 1MGTA 2M1BA 2ZMEB 3BJAA 3O8GA 1QLYA 2A28A 1Z9QA 4MZTA 4AM3A 3FX3A 4X1EA 3I4NJ 2JA2A 2EILH 1D5YA 3CCRT 1ITYA 1ZKGA 3FF5A 4LK1F 1R8OB 3KX2A 4Y13A 3F72A 5D4SA 3CD6I 4M77B 4DBRA 2VN2A 2ZJPF 5LJ5e 1C0MA 4L9VA 2HD0A 1VQNA 4EV0A 2O3FA 4DJAA 1T0FA 2L7ZA 1Z1DA 1HBXG 3CP8A 3VB2A 5J40A 1Z9ZA 4E7SA 4HX7A 3S8PA 3CCQA 3E5QA 1M3CA 2R7UA 2ZMEA 3CCVI 2GQQA 2QKLB 1TXQA 5GMKi 4R56A 2CQ7A 5ECAA 3CMAT 2CZ7B 2EIMH 4GYIA 1IUYA 1UB4A 3I5SA 3BE3A 2IT0A 1QP3A 2DF6A 2QI2A 2DMOA 2TCTA 1WFXA 1VQMT 1TW3A 1ZG3A 3HZJA 4M77A 3PIOA 3EFOB 5D6FA 1JJ2A 1T0JA 2KIQA 1HSJA 2J6KA 5IXFA 1YITQ 4FQGA 3OYDA 2ZGWA 4WXHA 4B9XA 5FLXK 3URGA 1YS7A 1LFPA 1D0XA 1ZR2A 1MJAA 2DJZA 2D1HA 1UG0A 2DJIA 2JK3A 3VWBA 3LX7A 2KQRA 2LNHB 1KU3A 3CCST 3F8FA 3CQTA 3VRYA 3G71Q 5J26A 1V4RA 4E7HA 1PVEA 5HNFA 5TGTA 4HRIA 1VQMQ 3PQJA 3EFOA 2K2VA 3EG0A 3FBNB 4H4KC 3DB4A 2RREA 5IT9E 2HZDA 2K4BA 1KU7A 3EUHA 1AOYA 2ZAEA 2Y30A 1BKBA 3JB9I 3HOZJ 2M7AA 3C3WA 3ZQ7A 5D8KB 2D45A 1HF0A 2KSSA 1WJ5A 2GXGA 1UG2A 1YG2A 3CJTB 2DK3A 4KT0E 4EJUA 3E6BA 1JBMA 5FWCA 2DTZA 3ZEHA 5E8IA 2F5KA 1SEUA 2IRFG 1TUDA 3NHNA 3HHGA 1DP7P 1RAIB 2V1QA 4OMFB 1GT0C 5EC7A 4C8QG 5KCHA 1IN6A 2K6DA 3K70C 1IV8A 4JJCA 1LE8B 3I55T 1PJRA 5DD8A 1FSHA 1SVOA 3LFKA 3RIRA 1VQPT 1XOVA 2V9KA 4BL0B 4BE2A 2HQXA 4OMMA 1ETYA 2DAQA 3K2AA 2KT0A 2EFQA 3DP7A 3KP5A 3KYCB 3J81K 4A6EA 1JO8A 1XNIA 4WXDA 5DLOA 1VQKA 4KMFA 1MJBA 4D7NA 5IY5H 2X48A 1MNMC 4L9JA 3FJ5A 5GAMd 2FOKA 1RC9A 3VFZA 3QJ6A 1ZSGA 5H6RA 5IYDJ 2P6SA 2CSOA 3KZIC 3WTWC 2EKHA 4RB0A 3D1NI 2LT1A 1J9IA 5F1JA 3FMQA 1MJ9A 4P9UA 3MKYB 3W2AA 1GL5A 1TT0A 2LCLA 5GAOm 2YUQA 1G5VA 1LE8A 4X34A 1XCVA 1P9QC 2F2EA 4BBSJ 4C92D 2OTJQ 2KPMA 4OIPF 4M74A 4M9SA 2HBWA 1FBUA 3MQ0A 1PHTA 3CCUQ 4XLNF 4UUSB 4D6WA 1OU8A 4E4HA 4JZ3A 3H0HA 3G71I 4ZDOA 3P8BB 5CKHA 3ABMH 2HEQA 2LJ1A 3KP7A 4U0YA 3FM3A 1TZLA 1WSUA 2R7SA 2DPPB 3ASKA 2CG4A 3JAMK 4ENJA 1L3LA 3PMTA 4XSXF 4G6TB 2LC2A 4EJWA 4RBOA 1BI2A 3S2HJ 1G2BA 2J6FA 1F43A 4WWCA 3ABKH 1WHLA 4HW0A 3TGNA 2GIVA 3E6CC 1SD5A 2OZUA 2VBYA 5HS7A 1UHWA 1D0ZA 1IC8A 1ZSZB 4M77G 5IHKA 4HF1A 2Z99A 3JCMe 1WXBA 3F8MA 3JCMW 2R7XA 4ZGDB 2VKNA 5A0GA 2FMLA 3H3ZA 2K27A 1WJCA 3BQZA 4O5VA 1ZQ3P 3LLRA 4UUSA 1IXSB 2CP0A 3GBQA 5GAMf 3CBOA 3N5BB 4RM3A 3JW4A 3OY9A 3H1CA 3HXLA 5D6EA 1VIFA 1F9NA 2EA2A 2DVJA 4XIDA 2FSWA 4HSTA 1SD7A 3IWFA 2VE9A 4QVZA 2JVVA 1SFUA 2M0YA 1ZLMA 2E5QA 1Q7YR 1ON1A 4IEJA 1MBFA 2YX7A 2X3WD 1GVJA 4IIMA 3CLQA 4NC7A 3UKGA 2H8WA 3I0TA 1JGGA 3W6KB 3HC7A 4C2MJ 1ZSZA 2JMCA 5I22A 5J39A 3CMAA 3CPWP 1UGVA 5M5YJ 3MPUB 3RDVA 3NRVA 4FCYA 1VQ5T 4E70A 3CMYA 4QKUA 4EQQA 3GTPJ 1BW5A 1LOJA 3T5XA 2DM1A 4WCGA 1VQMA 1E2XA 1AWWA 3RSNA 2X35A 3E5XA 2E2IJ 1XGNA 1VQ9T 5GAOn 2EKOA 2H3EB 3AG1H 3BR0A 2X9DA 4DOVA 4QWQA 2PU9B 3V8KA 1XJWB 2Q2EB 2V9VA 2OTJI 4G8XA 1NG2A 5AIPA 2CZ1B 4NNJA 3C18A 4IHTA 2DA9A 4N9HA 1N8RR 3CCUI 1KQ0A 1W5TA 2CH0A 2OCCH 1T2KA 4CZCA 3FIWA 4BD3A 4A12A 1Y57A 4CCJA 5IH2A 2LRDA 4XRSA 4ITVA 3OSGA 1IHVA 1SVMA 2DXUA 4DEYA 1GBRA 1U6GA 2ZNYA 2MWOA 3VPRA 1AHJB 1YFHA 2CQKA 2L7FP 3R0JA 1B34B 5B5EC 2K9MA 3OMCA 4MMLA 4M7DD 2A0FB 2ZPBB 2E4HA 1PRLC 1KQ8A 2JS2A 4NDLA 1GV5A 1JKRC 3FLGA 3QZ9B 2Q2EA 5C3EJ 4HV5A 2IPOB 1Z3XA 2OF7A 3MWMA 5IT9K 2JZYA 2UXNA 3OL3A 1T38A 1AHDP 2NVQJ 3RZOJ 2DFUA 2L3SA 4IUVA 2VIXA 3KZYA 3ZMZA 2WC2A 2RHUA 1OPLA 2R7RA 1FSEA 2RK1A 1VQ8T 1WKMA 4C0ZA 2YPRA 2QASA 2DL5A 3I5RA 4B6MA 5GTHC 3I55A 1ZGJA 1OQYA 1T3SA 1VQPA 1B34A 2GLOA 1A35A 5CVUA 1XQHA 1ZHIA 4KT5C 1I3AA 4XKBA 3SWNB 4G6DA 1JXOA 3HPWA 1S9HA 4D8DA 5ED4A 3VS5A 2PI0A 5KE2A 4FW1A 4CHUA 4IOCF 2QF7A 3LSIA 1J0RA 4IHVA 1N77A 4A3DJ 4BH9A 2VUBA 3I56Q 2EA4A 2QQBA 1PM3A 1VQ7Q 1OKRA 1JGSA 2E65A 5KYYB 2ISZA 1K9MR 3FXQA 1D8JA 1Z7LA 1RIOH 2HL5C 4NBQA 3M4OJ 3HSEA 4A4HA 2F5CA 4MTEA 2O9SA 3IAS2 2WY7Q 1UHCA 4OB3B 5I2MA 3SWNA 2F1LA 1X69A 3QBYA 2FNAA 2NS0A 5C6SA 3QU6A 4FM4B 4NQWB 5DUKA 3O5ZA 4N0AC 2CUDA 2RNJA 2XKOA 2YU3A 2HU9A 3A0BC 1X58A 4MZMA 3GEZA 1Q7YU 5E8GA 1YYVA 5GAMh 3OR2C 2A7YA 5KYYA 1NTCA 2DA6A 3ERED 1NM7A 2JSCA 2RHZA 1QVGP 2A37A 2DXBA 4X9CA 5M3FJ 2A3LA 4JRPA 3L2UA 4IHSA 4PNOA 3EGXB 3A03A 2HVQA 2RPNA 1OCTC 4FU6A 1XTDA 3I4PA 1JRIA 4M75C 4BBRJ 3X24B 4NQWA 2K3BA 1FP1D 1KSWA 3WTTC 2AZVA 5DM6F 4FE7A 2IAIA 2XUBA 3PNYA 1TS9A 1UB9A 4XAXB 4A3MJ 2J6OA 4BI8B 1N8RU 4PL6A 2LG4A 1KG1A 4IZZA 2IGOA 1PUEE 2JTEA 4Z8AA 4C8QD 1GDTA 2EPDA 1U3OA 5J8CA 2KNBB 2XDVA 2X85A 4XRSG 2KT8A 4RTZA 1B9MA 1BOAA 3KFWX 1JT0A 4YELA 2JA7J 4RG2A 3TQ7P 3CCMQ 4BYYA 3EGXA 3HIFA 3ZMUA 4BHPA 2KP6A 4BJTA 2A05A 3I56I 1X2QA 2P0QA 3FXMA 3DTIA 3G6ET 1VQ7I 2HQEA 4M7AF 1HD3A 2BW3B 1VQ9A 2FHDA 4FSSA 3TQNA 1C6VX 2KRSA 3HL2A 2DI3A 4U0WA 1Q81R 3JB9F 3Q0VA 3WG9A 2M9UA 4B44A 5ICCA 4UNOA 1K73C 5K7FA 3SD4A 2DA1A 1AVZC 1HW5A 1VQ4T 3O3KA 2K3FA 1W1FA 2LP0A 2MIOA 5LBQA 3KIOA 2R7ZJ 4P55A 1MGQA 1OI1A 5DM7F 1UCRA 1BCMA 3LYIA 4MMKA 5AYFA 1MW7A 3CDHA 3W2VA 2OTLQ 4L5IA 4QSHA 2YDLA 3JTGA 2BW3A 3CTAA 2MW8A 4L6V5 1GVDA 3OWTA 2QEXQ 3LSMA 1LQ1A 1B59A 1UTIA 1LDDA 2XV4S 1JJ8C 4EMKB 4HA8A 3KBGA 2Z9OA 3BZ6A 1IUFA 4GFBA 4EATA 5BQTA 3ZQCA 3OQ5A 4M7AB 3CC2Q 3L7WA 3ZMDA 3F6OA 4OVAA 1I07A 2BY0A 2FBKA 4B1RA 2FRYA 1K9MU 2HOSA 4M77D 4D5CA 2ZXJA 2ZXWH 2DEQA 4BY6C 5GANj 1VQ8A 1BIAA 1UFMA 2CWEA 2DX1A 1AOJA 2P81A 4X1VA 2HKXA 3OS1A 1OX9A 3EYYA 2KT1A 3DKWA 3LSRA 4KT6A 3S1QJ 4JRQA 5DCFA 1YITT 2BY1A 2V1XA 2CFXA 4EPCA 1XDSA 1IW7F 3A01B 4EMKA 2IP2A 1VYUA 4J01A 3PSFA 4JJDA 5F0CA 4BI4A 1LEAA 3CCMI 4BE0A 2VE8A 4AVZA 2ZCWA 3IWZA 3RR6A 2Z3YA 4GLMA 4XLPF 2DE0X 3AG2H 2YRDA 4C5HA 4KYWA 4M7AA 2QENA 4FT2A 3M8EA 1MH3A 4BAYA 3JCMV 2DODA 4B9WA 1MBGA 2CQNA 3PFIA 2GTJA 2M2EA 3RMQA 5I11A 2K9SA 4BE1A 2OAZA 4FX4A 1SSFA 1RUNA 1YJWT 5LJ3h 2JT4A 2HOEA 4IUQA 3HOXJ 3T9NA 1UJ8A 2DIQA 2LCSA 3H9QA 1I27A 4KIBA 2K4YA 1W5CC 4BXXJ 2P5KA 3AL0B 4XU0A 3R6NA 3A01A 4IX7A 1IJWC 3Q0UA 1KONA 2IS2A 4X6AJ 3LWIA 3N4MA 2G7UA 2QQ9A 1UGRB 2Y2ZA 1X6BA 4N9IA 2IS4A 1K9MC 4RG8A 3L9FA 1T98A 1XMKA 4CO8A 2I0NA 2JUFA 2YXYA 2AQFA 1Z21A 2CW8A 3DTKA 3HOUJ 2EJFA 4AVPA 1A5JA 3FEOA 2QEXI 1MV0B 2EQKA 2KDSA 3FIFA 4JP0A 5M5WJ 1MIJA 3BQYA 2HTSA 1ZARA 3CP2A 5L3BA 2M51A 3I64A 2E5NA 1ZBJA 1B72B 2YLCA 1WQ7A 2V8JA 4KGVB 5AONA 3G1OA 3CCEQ 2X4YA 3QDRB 2X6WA 2EQMA 2PLYA 5B1AH 4CCNA 3I35A 4M6XA 4QW2A 4N0BA 4XU2A 1ZYRF 4Y52J 3C1DA 2V6CA 3X2QH 5KK1A 5IP9J 4GDFA 2YRCA 1Q81U 3HSBA 2DXTA 3GTQJ 6PAXA 4XTZA 1W0TA 5GPCA 4OMOA 2EINH 3DQVC 5CQYA 3CC4T 1LPQA 5CR2A 3G4ST 2LR8A 1BN5A 1TWBA 1YHQT 2KZGA 2QBYB 1TT5B 3MN2A 3IAM2 2AKLA 2OPTA 3JRCA 1B72A 3QKJA 3GPLA 1QVTA 2CGHA 3TO7A 1OYXA 1OJLA 1M3BA 1JB0E 4D5FA 4TVRA 1V76A 1R22A 5GANg 1M8VA 2QGGA 3GCMA 2GOXB 3IH4A 1QZYA 3L2CA 2LVSA 4EEFG 3PE0A 3QP5A 5E3OA 2B86A 1OZ2A 2CP5A 1X2NA 4GGGA 5L3DA 1UDLA 2O88A 3KP4A 5GAN3 5DY9A 3J7AY 2ZZDA 4C92E 1V29B 3NPFA 1QZEA 2DOAA 4F3QA 2B63J 3M07A 2FL7A 3QODA 4UVAA 5GAN5 4ZYEA 2QBYA 1QWEA 1YIJQ 1WDXA 3H5NA 4P9FA 3TMOA 1QRYA 3ZN1A 3K6GA 3GFMA 3GVAA 4F7ZA 1MDMB 4Q48A 2PQWA 3F21A 3HHHA 1XGMA 3MD2A 2CO5A 3FMSA 4MFDA 4EJTA 2RQQA 1RETA 2Z33A 3HRUA 2RNAA 2XF5A 4OGCA 1PUFB 2WACA 1YWOA 3ZL7C 2XU8A 4M7AG 1SD4A 1JXMA 2KISA 3PFSA 1YJNQ 3K1PA 4A3IJ 3CUQA 3W6VA 1K0XA 2L4MA 4XK8E 4C5EA 1TWCJ 3CCEI 4DGWB 5EGOB 3C94A 3PNWC 1W36D 5A2QZ 4HT9A 3JB9G 2DEUA 2XGCA 5CKTA 4A0XA 3FHZA 2ED0A 3OBYA 2CSIA 3RYRA 2O4XB 3CCRQ 2Q8KA 2VXZA 1MDMA 4ZTJA 5KAFC 5GAN8 1JE8A 1USTA 1V5GA 1GCPA 4XU1A 1J5YA 1C0WA 1MSEC 1YITA 2AZSA 5FROA 2X0LA 2KHMA 2W4SA 2H94A 1PUFA 3E19A 5TJJA 2AIRB 2LZ6B 5GAOq 3CCLQ 3TU4K 3VS1A 3H0DA 5LJ3j 4Z2YA 3K4BA 2K5LA 3A98A 5EGOA 2ESHA 4PFPA 3ZQIA 4NC8A 3ZCOA 4WCIA 1T6SA 1KC8C 5HVQC 5K7HA 2B8AA 2HKOA 4I6ZA 3LWHA 1G59A 2EK5A 5HS9A 2O4XA 2Y31A 3L09A 1XSVA 4ZN3A 3K4MA 5KE3A 3X26B 2UXXA 2LKSA 1YJWA 3VS7A 4Q47A 4HYEA 4LOCA 3JSOA 4PJ0C 4XLHA 3RQ4A 4U7DA 2IA1A 1UG1A 1R1TA 3F8NA 1YNZA 4JLGA 5D6WA 4Q5SF 4HBLA 3I59B 4RCBA 3CDIA 4PGHA 4LDYA 1A04A 1YIJI 2HPMA 3BDUA 2NVYJ 2DOEA 3ABLH 3BR2A 3EAEA 5D6XA 3RYPA 3AHUA 4FT8A 4B8XA 3CCSQ 2KBTA 1U78A 3QO3A 5GPAA 3LAJA 3CMEQ 1G6NA 2BE5F 4JK1X 2E35A 3HPHA 1LPLA 1ZUKA 2NWMA 5CYVA 5GMKl 2F6CA 4Z02A 2OQRA 1Y1WJ 4HF2A 5E17F 2AQEA 4PK4A 1XPXA 1LEBA 2E6ZA 2XK0A 3E7LA 4Q5WA 1O7LA 3VUZA 2Y90A 3OW2P 1DP3A 5FB2A 2FEZA 4M6YA 3ASOH 1N9RA 5J4VA 1K61A 1FP2A 5B1BH 2YSRA 2XAUA 3EUKL 3I59A 1EH6A 4LLGF 4AC0A 1TUCA 1G3SA 2RQWA 3HB9A 1ZAOA 3B6AA 3UPUA 3CCRI 4G6QA 4HSRA 2K5FA 3GFLA 5GTIC 4AMCA 2L4AA 2BE9B 1BBZA 1OZ3A 5IYCJ 4D8KA 3BG5A 4LD9K 1I39A 2QKMB 2D0QB 3CC4A 3FXJA 1IZ1A 3FMRA 3G4SA 1YHQA 2PN6A 1YS6A 3CCLI 3M0PA 2Y9YA 4Y33A 4ON0A 3TEEA 1D5VA 2KE9A 2XF7A 4J6YA 4HDUA 1RESA 3M4YA 1VQNT 4OMLA 5E3MA 1M5Q1 3H3UA 2CV2A 1QVFA 2HOTA 2DXCA 3BWGA 3M3YJ 1H641 2ECCA 2M0CA 4RM2A 4XKCA 2W7NA 2LREA 3JRAA 4M73A 4ESJA 1KHIA 4HQEA 1PWTA 1WZOA 5BNGA 3SZTA 4J9EA 4MDWA 4HCKA 4CUGA 2L7MP 1FWZA 2R5YB 1X2MA 3RKWA 2W82A 4XOTA 2PVOB 4J9IA 5GAOr 4A0YA 1WGXA 1REPC 4R55A 3EPZA 1IN8A 1IXDA 1LDKB 3TOBA 5LJ3g 4KGXB 2DETA 2X1CA 2R7OA 2JRMA 2MABA 3IKTA 5KH6A 4KNYA 2RJEA 2E1MB 1A36A 3M1EA 4KJZA 2GQIA 1ETOA 2DQRA 2CJJA 3CCSI 4C5GA 3UA6A 4BACA 2OAUA 1AEYA 4UV9A 3CMEI 1EV7A 2VJJA 4OB0B 3IH2A 2XICA 4PSXA 3T8TA 2G0EA 2FB7A 4KA4A 1AU7A 2A61A 1QW1A 1ORKA 5GJVB 4DW6A 4MO7A 1U9NA
chains in the Genus database with same CATH topology
3TO9A 2BEOA 1RZ4A 3LGLA 2KQWA 2JTVA 2RN7A 2A68F 3WVEB 2WSFE 1U5TB 1Y0UA 4LFUA 3CPWS 1FY7A 1VQ6A 4C8QE 1W7PB 2DVEA 3CO6C 3GXOA 3OV8A 3KP3A 2F5FA 3O6BB 3OYKA 3G3ZA 1QGPA 1W2BA 4EM0B 4UC4A 4QVCA 3J81E 1W4MA 3HP9A 1M90U 4C8QB 5HK0A 4P96A 2MH2A 3D5LA 1U5TA 4S04A 3QP6A 4XRFA 4WK8F 1VQKT 2CS7A 5FLXZ 1W7PA 4OGEA 5LHGA 3WXMB 2RKHA 2CZ0B 1K8AC 2PUOB 3IC7A 1Y7XA 3JCMJ 3C95A 1STZA 2QYOA 4I09A 4ELZC