3HRSA

Crystal structure of the manganese-activated repressor scar: apo form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
TPNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 65
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrsA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrsA02
3WTTC 4CZZA 2D1VA 3IKTA 1MD0A 3IWZA 4Q5SF 4B8XA 5J6XA 1BOAA 3J81K 4A5NA 4WWCA 4EMSA 2E7XA 5D5WB 3HIFA 2DBBA 3BJOA 4DQ2A 3CUQC 1IXRC 1TQPA 4YIFA 3ABTA 4NQWA 3EYIA 3PQKA 1F9NA 3KP7A 5BMZA 2FNAA 3I5UA 4HYEA 4U0WA 2GXGA 3ECOA 3HOTA 2D1HA 2RC4A 2ZO4A 4EV0A 2VE8A 4LK1F 3COAC 4HDVA 2EFQA 4WXCA 3FZVA 5LGNA 2ZMEB 3JAMK 2BE5F 3QP6A 5EEGA 1GHCA 1TLHB 2XV4S 5L3BA 2ZXJA 2WV0A 3V7SA 2LDUA 1Z91A 4FHTA 3GVAA 3I64A 1R58A 2OU2A 4N9HA 5AIPA 3KCCA 1I5ZA 1KYWA 4WXHA 5LRSA 2HWVA 5LRRA 3RPQA 1ZHFA 1V3FA 4WF2A 3TO9A 4RB3C 3GX4X 5JR3A 4OOIA 4P96A 4D0PA 2FBKA 3F6OA 2EV6A 3LFKA 3M9AA 2A69F 3V7RA 1DDNA 3ROUA 2ZNYA 1P4WA 1DUXC 4I2OA 1Z9CA 1J75A 3C18A 4G6DA 3DPLC 3T5XA 2CW0F 1SD5A 1YO5C 2IT0A 3FMSA 2GWRA 2A3SA 1SMTA 4RGSA 1G3SA 2K4BA 4UVAA 1RI7A 1T6SA 2O03A 1R5GA 4ENJA 1JE8A 1S8NA 2EFOA 3LAPA 2MBFA 3M8FA 4M6YA 4U0VA 4M9XA 2OZ6A 1XGOA 1OPCA 2Z33A 1IN5A 5ILUA 4I01A 2Z5UA 2EJRA 3CUQA 4BQAA 3FXQA 4UXNA 1WI9A 4UNOA 3K69A 3P9CA 4PGGA 2A07F 2EA2A 2G9WA 3DF8A 3FHZA 4LG0B 4M72A 1K78A 2E1CA 5HLHA 3VOEA 4OIRF 1OYIA 1HKSA 2DQRA 1I27A 4IPAA 3SZTA 4G8XA 2FSWA 1SFXA 1O57A 3BDDA 3ERED 1AWCA 2R7FA 1FWZA 5E8IA 4HQEA 1S7OA 1SAXA 4ZYGA 2XROA 2A61A 5TRDA 2NRAC 2MLGA 2ISZA 4O6JA 5E8GA 3VODA 5LEJA 1ZGJA 3ZMVA 1IN4A 4LJZF 4I7HA 2EWNA 1UCRA 1OMIA 2XRNA 1LVAA 3GZ5A 3BZ6A 2QM3A 4KYWA 4LB5A 3F8FA 1REPC 3QU3A 1O3SA 1G3YA 4BAYA 4KMFA 4HX7A 3DPTA 4EJUA 2HGCA 1G3TA 4XSZF 2HYFA 4LLLA 1IN6A 2OQGA 4L9NA 2P7VB 4RB1A 1XN7A 2M30A 2ESNA 3BWGA 4MGRA 1W4MA 2FBHA 2YU3A 5HDGA 3E5XA 1FX7A 3BJ6A 1KYZA 1J5YA 3GLXA 4O5VA 1TW3A 2EV5A 1L3LA 5BS6A 2JTVA 1W7PD 2PMUA 5FO5A 1YLFA 4LG0A 3GZ6A 1T38A 5LHHA 3LA7A 4BHCA 5K1YA 4BNCA 4KIBA 3ZN0A 1F1ZA 4RB2C 3CO7C 5A2QK 3ZMZA 3M7GA 4UVBA 4OIQF 2QVOA 3JTHA 1TW2A 2QLZA 1J2XA 2HDCA 3HRUA 4Q4ZF 2HKXA 3I59B 2FA5A 1EH8A 3P9IA 1MZBA 2PN6A 3LA3A 3R60A 2HTJA 3QOPA 4CYDA 1E17A 2DI3A 1CF7B 1Z7UA 3I54A 2H6CA 2QWWA 2ZCWA 1FBSA 2VN2A 1BC7C 4I02A 1LQ1A 1RIOH 1ZREA 3PQJA 1BI2A 1F5TA 1LJ9A 4UV9A 1GXPA 1FC3A 3ABUA 1MJAA 2ZKZA 3P7NA 2BBYA 1K78B 3I71A 3HSEA 2UXXA 5LHIA 5ICEA 2O8XA 5K5QA 2F2EA 1QGPA 2HQRA 2A6HF 3D0SA 5D5XB 2A6EF 3HRMA 2KIFA 2HFHA 4IRHA 3QU6A 3LSTA 1AOYA 4KN7X 1IW7F 4ESBA 5HS9A 3KP3A 4R79A 3MHXA 2QENA 1B4AA 2K27A 4P9UA 2K02A 1ZN2A 2XAJA 1ZG3A 1MJ9A 1YFHA 5BQTA 4ASNA 1FBQA 3HHGA 1O3QA 2GQQA 1TBXA 2FNPA 3KZYA 4HW0A 3WE3A 5E20A 2IW5A 1YG2A 4HQMA 3ZMUA 4KN4X 2DK8A 1P92A 4HAMA 4HV6A 3FM3A 3SXYA 2KJCA 5FB2A 4IVNA 2UXNA 2FOKA 1U5TA 1FYMA 2W85A 3B02A 2QYOA 1LDJA 2XASA 3SHFA 1PP7U 3C7JA 1S6LA 3W6JB 4PGHA 3HOSA 5L3GA 4YFKF 1YW7A 1KU9A 1YS6A 1HQCA 4GYGA 2V9VA 3WTSC 1UB9A 2RNJA 3O2PE 4G6QA 2MLKA 4P55A 2W25A 1KA8A 5DCFA 1ZAOA 3F6VA 2WTEA 1R1VA 1DP7P 1BI3A 1P4AA 4A0YA 2AS5F 1JHFA 2GA2A 1ZGAA 5DD4A 5LEKA 5FLXZ 1XCBA 3K1NA 3M1EA 2DO7A 2NNYA 4AIHA 2VXZA 4JBAA 3WTYC 1HKTA 4L0YB 2PJPA 3BROA 2O6GE 2VC1A 1FZPB 1XGNA 5D4SA 1I1SA 2EFNA 3IL2A 3JAMZ 4OIPF 4WCGA 2OD5A 2HZTA 5E1ZB 1W7PA 3WGHA 1LNWA 3E6DA 3EUHA 4KT5C 2FU4A 1WRJA 2EFPA 2P5KA 5ERIA 3KE2A 1B9NA 4OMYA 2OA4A 1XMAA 5F64A 2R3SA 2F5DA 1J7KA 1HW1A 3Q5FA 4BHPA 2VOOA 3G3ZA 1E2XA 3Q9VA 4KDPA 1LEAA 2A5YB 3ISPA 2GA1A 2ETHA 1U8RA 2G7UA 3K1MA 2LNBA 3RKXA 3TOBA 3GFLA 4HDUA 2GIVA 2G7HA 3V8KA 1ZRCA 2XHKA 1BC8C 5BPIA 2CGPA 1P6RA 3KFWX 4B09A 1R1TA 4RGRA 3QPTA 1B1BA 1Y0UA 4Z2YA 3WTUC 4I0BA 2FRHA 4NB5A 2EB7A 1KQ9A 5L3EA 1IUYA 3RTRA 1QVPA 2FMLA 2QBYA 1USTA 1R7JA 3P9KA 5HS7A 4UV8A 3KP4A 2KIUA 1KGSA 4G7HF 2JPBA 2PBIA 4L9TA 4I09A 1TQIA 2GXBA 1ZARA 3HSRA 2M5WA 3U9GA 3W6KB 2DPDA 4BYYA 2H3JA 2XIGA 2IPQX 5FFZA 3CUOA 4E70A 1BJAA 2ZNZA 2RVCA 2V79A 3WU1B 5H20A 2J5OA 3R0AA 4RGXA 5JFRA 4PZJA 4UUVA 2LF7A 3Q9SA 4L9VA 4L5IA 4IRGA 4XRFA 3WTZA 2Y48A 3AAFA 5JVTA 2Z9OA 4NHJA 2CYYA 3H3UA 2ZMEA 3ML6A 1Z1DA 2EFWA 1KU2A 4MEXF 4CHUA 3JSPA 1YW8A 1MDMB 5H6QA 1NHAA 2K86A 2RV8A 2H27A 1HW2A 5ICFA 3CTAA 2CSOA 1WQ2A 4I98B 4L9JA 2D2WA 4G7OF 4KNYA 3WGGA 1FBUA 1P2FA 4Y15A 1PP8F 3QRFF 3FF5A 5K5RA 2H6BA 2XAGA 2JT1A 2FE3A 1O3RA 2DTRA 2XAHA 5CVJA 2Y75A 1GVJA 1OR7A 3LA2A 3ZMDA 2VBZA 1FNNA 4KIGA 1ZRDA 2MH2A 3RJPA 4OU0A 3F23A 1LDDA 3WG9A 3HRTA 3I53A 2XAQA 1V4RA 3F21A 1LDKB 1FT9A 3ZN1A 1ZH5A 1Z05A 1SMYF 1TTYA 4HV5A 2HR3A 3T0YA 1SD6A 5EEHA 4ENKA 1W7PB 1G4DA 1BIAA 4Q48A 2L3DA 3GWZA 1T39A 5ICGA 3BPXA 1R5HA 4ETSA 2DAOA 3E6MA 4U7BA 3E6BA 3GFIA 1XSDA 1GXQA 2IA2A 3L00A 2Q8KA 3WTWC 4Q47A 4HLYA 4ZYEA 4XLNF 2QQBA 4HOBA 5D8KB 4FX0A 1K79A 4OMZA 2YX7A 4LD5A 3GEZA 2OZUA 4M73A 1EH6A 4EVIA 6PAXA 3MZHA 4N9IA 2K5IA 5CVVA 2O3FA 3CO6C 2K7LA 1XGSA 3HTUA 2K5FA 1XDUA 1ULYA 2JPCA 3TO7A 4ZH4F 3MCZA 4EJWA 3JTGA 2CQKA 2WC2A 4BHBA 2STTA 3F3XA 3HSFA 1A04A 4YFNF 2K5LA 3K1PA 4HA8A 3CDHA 1HKQA 1OKRA 3RKWA 4JK1X 4OIOF 3V8JA 4M9ZA 3O6BB 3FX3A 2Q2EA 3U1DA 3V7CA 2RDPA 2P7CB 3EETA 1FYKA 1B59A 3T8RA 3SZPA 3JSOA 3RI4A 3LQRA 1XMKA 1WWXA 3HYIA 1BYMA 5CYVA 5L3FA 4A2UA 3E5QA 2ZBKA 1ZLJA 1LB2A 1L0OC 2RKHA 2VT3A 1XCVA 1W5SA 2PQ8A 2NS0A 3ULQB 5D8LB 4KA4A 2P6SA 2IP2A 1OYWA 1J0RA 3FXUA 5FFXA 4YFXF 2DT5A 2DFIA 1U6GA 3V4GA 2AXLA 5LBQA 4HF1A 2JRTA 3FWEA 4HBLA 2COMA 3QP5A 1H9TA 2MD5A 3HUGA 2W84A 3GXOA 1YIOA 3RYPA 1KU7A 1FOKA 3NQOA 4JQFA 2DQLA 2W57A 1G6NA 4HLXA 3S2WA 4FX4A 1XD7A 1ZG5A 1ON1A 1KU3A 1PDNC 1IF1A 5CVUA 4EGZA 5D5VB 2H09A 1ZYRF 1T2KA 3FXRA 3HHHA 2FBIA 2Y0MA 2DPUA 2FXAA 3HRSA 4A0XA 3LQQA 4ESJA 4EGYA 4ENMA 3M8EA 1IXSB 2X0LA 4RS8A 1S29A 1WSUA 5L3CA 3BJAA 3BPVA 5D4RA 4M74A 1B6AA 3GO5A 3LAJA 1KQ8A 4CO8A 2ESHA 4U0YA 3BY6A 2VOPA 3G73A 1ZRFA 2F5FA 5DYMA 3R0JA 2KKOA 1TQMA 4KMUX 3ZQ7A 3FMQA 2FF4A 2V1DA 1MJBA 2V6CA 4MQVA 2LSOA 4CGZA 2LKPA 2DLLA 1SFEA 2K4JA 5DCMA 2CG4A 1USSA 1QBJA 3MZYA 1YTYA 1FP1D 1IZ1A 2PEXA 2YPRA 1MKMA 2L01A 4HF0A 1TNTA 4AWXB 1J59A 2GCXA 3NEUA 3E97A 3F8MA 1HSTA 2NNNA 2CO5A 4EJVA 3H92A 2FMYA 1QQIA 1BM9A 3VFZA 1SD7A 5L3DA 4MTDA 4RAYA 4XSXF 3J80K 3ECHA 3MWMA 4FT8A 1QZZA 3ZMSA 1BI0A 4H0EA 3F22A 4BH9A 1UFMA 4HX8A 1J9IA 5KVRA 4YG2F 5D5UB 1S7AA 2DK5A 1OYYA 4OINF 1R22A 3K9TA 1SFUA 2NYXA 2XUBA 4LB6B 3OOPA 1BIBA 5HDKA 2QUFA 3DP7A 3F72A 2K4YA 1FY7A 2CWEA 2LX9A 2V1XA 3GFJA 4RB0A 1ZLKA 3HTSB 3TO6A 4WX9A 2P6TA 4ZZDA 5FD5A 3MAJA 4HF2A 2EA4A 5DUKA 2OQRA 4AIKA 1JGSA 3WTXC 4CXFA 2RGVA 4AIJA 1UHMA 4EM0B 4UHTA 3DEUA 5DD8A 3ZP5A 2QZ8A 4MTEA 1K7AA 1U2WA 1RZ4A 3T1BA 4GXOA 2KRFA 4N0BA 2HTSA 2H94A 3F8BA 4RGUA 2IJLA 2O61A 5BOXA 3WODF 4G94A 2WWYA 4PDKA 3TQNA 2IRFG 3I4PA 1QPMA 4MNUA 2FEZA 4A12A 1U5TB 1BI1A 2FQ3A 3EDPA 2L02A 4GCVA 5HLGA 4S04A 3BOQA 5DV5A 1RUOA 3TDUC 2ACJA 4GO1A 3I0TA 2DU9A 5LLQA 2UWMA 1DPUA 4EJOA 2VBXA 3ZMTA 4R1HA 3GYHX 1QW1A 1R00A 2VBWA 4K2EA 4HX4A 3IHUA 1R23A 2ZJ2A 4CICA 1UHWA 4F7ZA 3TKYA 5DCMB 2DW4A 5DEQA 1Q1HA 2KJBA 4QWQA 3KP6A 3VEPA 5ICCA 5ED4A 1XB4A 4ZZLA 2VBYA 4IHSA 2M1BA 3KETA 3L7WA 1C0WA 2Z3YA 1ONVA 2D45A 1I6XA 1IRGA 3E5UA 4A6DA 3QPHA 5E1WA 4UVCA 3GUDA 4MHGA 1RNLA 4G7ZF 1O7LA 2GZWA 1O3TA 3E19A 2IA0A 3RYRA 3FMRA 4Y17A 5CVIA 2Z99A 1FLIA 4O3MA 3WE2A 2HKOA 5FGMA 2MC3A 4MEYF 2VC0A 2IA1A 3I59A 4QLCU 5D6EA 2JZYA 5E18F 5FD6A 5LHGA 2XGXA 3E3VA 1HXDA 4A6EA 5HDNA 3KLNA 1RUNA 3SQNA 1ODDA 5E17F 2ISYA 5H6RA 3DQVC 4M9SA 4IRIA 3D5LA 4YIIA 5A2QZ 4KICA 1Z6RA 3GF2A 5CVRA 2IVMA 1QNTA 1I1GA 5JHUA 2QQAA 1DPRA 2QBYB 1FPQA 1U5TC 3MFKA 2R7DA 2QQ9A 3B73A 4ZYHA 1B9MA 3RDIA 3MQ0A 3V8LA 1LEBA 2RN7A 3CJNA 3RIRA 5ILVA 1W5TA 1IXCA 2VE9A 1K6OA 3R4KA 1YS7A 1D8JA 2M87A 1YW9A 5AONA 2YR2A 3F8NA 3SFZA 1D3YA 3MEXA 3CLOA 1CF7A 1EH7A 3TOAA 5HS8A 1KQ0A 2ZFWA 3N4MA 1STZA 2P5VA 1P4XA 3LWFA 1TNSA 1FYLA 2EK5A 3TGNA 4EJTA 5DUIA 2LF8A 1Z6TA 2XAFA 2E7WA 4XLPF 2P5LC 1WKMA 3R6SA 4EQQA 3J81Z 2HYGD 2M8EA 1D5VA 3C1DA 3VB2A 1VTNC 1IRFA 1BBYA 4LFUA 2TDXA 1QO0D 1YQAA 2NAZA 5LGTA 3T8TA 1HSJA 5LGUA 2BV6A 1MDMA 1XSVA 4WK8F 3TDZC 2X4HA 4M6XA 5F6FA 4HZFA 5ILSA 2PLYA 1FSEA 3RKYA 4G9YA 2ELHA 1R1UA 2PMHA 3NRVA 3DFGA 1H0MA 4I0AA 5FLXK 4TV7A 2HOEA 1F4KA 4A0ZA 4EM2A 2OAZA 2L54A 5F1RA 5DDGA 2F5EA 2XKOA 3C3WA 2XKPA 5E1XA 5HVQC 2E1NA 1IAWA 4L5JA 3IC7A 4ENNA 2OBPA 4LLNA 3R61A 2ADUA 3KEQA 2PI0A 2HS5A 1U78A 2VODA 1XDSA 2BGCA 3H3ZA 3L9FA 1FSHA 2J5PA 3ELKA 4KUMA 5AIQA 5HLIA 4S05A 3L09A 4LMYA 5JI6A 5CLSA 1ON2A 2B0LA 2UZKA 4PCQA 1PUEE 1U3EM 1HBXG 4BXUA 3QAHA 4MQ9F 2P4WA 4L18B 2L4AA 1ZG1A 5KK1A 3L2CA 3JW4A 3ZPLA 4IF4A 3WU0A 4LK0F 1G3WA 1CGPA 3IKVA 3REOA 3KEOA 4AD9A 4GYIA 3WTVC 1FP2A 1JXSA 2CFXA 1JHHA 3U2RA 3F8CA 2RQPA 5BPDA 1H9GA 4KFCA 3I58A 3KLOA 1HW5A 2W24A 5HOOA 3RPUA 4Y13A 4L0ZB 2V1UA 1D8KA 3BP8A 5J8CA 2YX4A 2A68F 4R8HA 1XSXA 3GW2A 2HQNA 3J80Z 5IT9Z 2F5CA 1IN8A 3IWFA 2EV0A 5J8FA 5IT3A 1X3UA 2GAUA 4ON0A 4ESFA 4LLGF 4M71A 2JSCA 3WGIA 2O0YA 4U88A 2Q0OA 4KIFA 3O3KA 1BN5A 4LGWA 5K5OA 2XVCA 5TJJA 5CJ9A 3K0LA 4CDGA 2P8TA 4XBFA 3DKWA 4DNCA 2VONA 3DXJF 4IJAA 4AVPA 4EM1A 1T98A 5IT9K 4A5MA 1S3JA 1QZYA 4IHTA 3PFIA 4P5OA 3CUQB 5D6FA 1XGMA 3E6CC 3J7AO 2HEOA 2PG4A 1MGTA 3OV8A 1SD4A 3KP5A 1IN7A 3GFMA 4P9FA 3K2ZA 2PFBA 2MH9A 3IRRA 2BYVE 3N97A 1T0FA 4IXAA 2C6YA 4ZYDA 2L4MA 4WXDA 4RAZA 4GGGA 4U7DA 1R36A 3IRQA 3DV8A 2MA3A 3EYYA 1YYVA 2M45A 2VT2A 3FM5A 1EV7A 2YSRA 3KZZA 3KP2A 1O7FA 2BEOA 2STWA 3EQLF 2KIMA
chains in the Genus database with same CATH superfamily
4OP0A 3WTTC 2M1HA 4CZZA 2D1VA 2X9DA 3IKTA 4DYQA 3I5RA 1VQPT 2B9SA 2V1NA 3PO2J 3OS0A 5GAOn 3CPWA 2Y2ZA 1VQ4A 1MD0A 3L2RA 3ZQGA 3IWZA 4Q5SF 3J7YJ 3D5SC 2ELKA 1BR2A 4B8XA 2RH2A 1UHFA 4IL6C 3ZQIA 5J6XA 2Y69H 4XRSA 1BOAA 3J81K 3CQZJ 1B8IB 1XC5A 3TSWA 4A5NA 1EFNA 3RMQA 4WWCA 1KQ2A 4EMSA 2E7XA 4RKUE 5GJVB 4F52A 7AT1B 4X9DA 1IJWC 5D5WB 3BZKA 5HK0A 3CDLA 3NMZC 4GLKA 4IIMA 5IP9J 2DOEA 3HIFA 3SD4A 2DBBA 4BE2A 2BXYA 3BJOA 4J6XA 4DQ2A 8ATCB 3A0HC 3CUQC 1IXRC 3G4SI 3HOXJ 3JCMe 2KBTA 1TQPA 1N8RR 1NG6A 4E7JA 4ME7A 4YIFA 3ZL7C 1I50J 4OB1B 3ABTA 3FK7A 4GY5A 2LY1A 5LJ5e 4NQWA 4B3XA 1WJFA 1JRIA 3UT1A 1JTXA 2Y0SA 4IOAF 3EYIA 1ZUKA 3PQKA 3JB9G 5FU7C 1F9NA 3K10A 4M77B 5KYYB 3VS1A 2XDPA 3Q1JA 1K8AC 1IB8A 3KP7A 5BMZA 1RAEB 2LNVA 4M75F 5CAIA 2FNAA 1ZA2B 1V55H 2BVLA 3I5UA 3H35A 4HYEA 3I9V2 4U0WA 1RC9A 1VQ9I 2LVMA 2ZPFB 2OAUA 2KR3A 4QKUA 2GXGA 3ECOA 3HOTA 4FYYB 1VQ8Q 2D1HA 5CPRB 1OQYA 2RC4A 2ZO4A 3W2WA 1LPLA 2M0OA 4AM3A 3WHCA 4EV0A 3W6VA 2VE8A 1E3OC 3CCMA 4LK1F 1VQ4I 1X3WB 3COAC 3M0UA 4HDVA 2EFQA 4WXCA 3ULRB 3FZVA 5LGNA 1VQKT 2ZFUA 4CCNA 2ZMEB 3JAMK 2BE5F 3ZQFA 3CC7A 3UA6A 3MN2A 3QP6A 2CUBA 5GAN4 5EEGA 3BTLA 2HEQA 4NS5A 1GHCA 2YHTA 4RCCA 2IAIA 4D6WA 4NL2A 3F9KA 3HKSA 4ZNXA 2ZJPF 1JUMA 1TLHB 2XV4S 3ZQQA 3QPSA 3PNTA 4NDLA 2DRKA 5GMKl 3J7AF 3K4JA 2RNAA 1MH4A 2CU7A 2DL3A 5L3BA 2ZXJA 1WZ2A 4XL9A 3D7SB 4XLAA 4JS5A 2MK5A 2WV0A 1VQ4T 3OR1C 2OJ2A 3V7SA 2LDUA 4A4EA 1HOMA 1Z91A 3LSHA 4FHTA 1NEGA 3GVAA 2YUQA 4M3FA 3CQTA 3I64A 1R58A 1T56A 2OU2A 4N9HA 5AIPA 4C0GA 3KCCA 1I5ZA 5I2MA 2XK0A 3GNFB 5J26A 3CMAI 2AIRB 4AT1B 1Z21A 4Q5WA 1KYWA 2E5KA 5GAN6 4WXHA 2CW8A 2VXFA 5LRSA 1OPKA 2E19A 5AYFA 1X1DA 2HWVA 5LRRA 3S15J 2HSEB 4II3A 3RPQA 1ZHFA 2GXAA 2EPFA 2EH3A 1V3FA 3FXJA 3M3YJ 3CCEA 1OPLA 3K6GA 3BQYA 1JGGA 4WF2A 4B47A 3M54A 4HVVA 4XKBA 3TO9A 4RB3C 3GX4X 1OULA 3S93A 4OOIA 4P96A 5JR3A 2VXEA 4D0PA 2ZGWA 2E1MC 2FBKA 3CCSI 2JM8A 1VQ7A 2YT6A 4OGCA 3U21A 4B3AA 3F6OA 3K70C 2EV6A 2R7OA 3LFKA 3M9AA 2CUFA 2ECCA 1UG2A 3OMYA 2A6TA 4PSXA 1YRNA 2A69F 3QYEA 3V7RA 1MNEA 4FW1A 1DDNA 1Y0MA 3ROUA 4FL6A 2ZNYA 2DZ9A 1VQ9A 3IH2A 3I55Q 3TW7A 4BQOA 1NYGA 2DMTA 1U06A 2I10A 4OWRB 3QODA 5D6WA 1P4WA 4ESRA 1DUXC 4I2OA 2KNBB 1Z9CA 1J75A 1H8KA 2B7EA 2F4IA 2R57A 3H0DA 3C18A 4G6DA 4UUSA 2HSPA 2K3FA 3CMAQ 2K9MA 1CSKA 3DPLC 3G4SQ 5FU6B 2O31A 3T5XA 2CW0F 1QMCA 1VQKA 4RTUA 4A3JJ 1ABOA 4II1A 1SD5A 4ANJA 1IDZA 4OB2B 2DM1A 3MP1A 2XPVA 1YO5C 4QVCA 2IT0A 1AZEA 4CRIA 3OWTA 1Z9ZA 4C8QE 1IGNA 4EMHA 2QQRA 2MFZA 2LKXA 2QKMB 1B3QA 3M53A 1RPWA 3FMSA 3E9FA 2LT4A 2I2LA 1WJAA 3CPWS 1X1CA 3QDRB 1KC8C 2GWRA 3TVTA 2L9RA 3X24B 5C4JJ 5F0CA 2A3SA 1SMTA 4RGSA 2KY9A 1G3SA 2K4BA 4UVAA 1RI7A 4H4KC 2OV7A 1PSFA 5GANg 1T6SA 4D5CA 2O03A 1YITI 3B6AA 2FRWA 1TWHJ 1R5GA 1T8IA 2QSFX 3P8DA 4ENJA 1M2OA 4MZTA 1JE8A 1S8NA 4OVAA 2DYSH 2E2HJ 2EFOA 1HA8A 3LAPA 2MBFA 4J9EA 4M3EA 1YHQQ 1Z77A 3M8FA 5CKTA 4M6YA 4U0VA 4M9XA 2OZ6A 2DEQA 4JLIA 3VYHB 1M90C 1XGOA 3G6EQ 1OPCA 2Z33A 2X4WA 3GOXA 2CH4A 1M1GA 3G1MA 1IN5A 3H0FA 2KHMA 2RJCA 5ILUA 1YFNA 2K6DA 3W2AA 3CXCS 2E5QA 2JSPA 4F7UE 3NTKA 4J6WA 2Q2EB 4I01A 4RUGA 2L3SA 3OQ5A 2DLPA 2QEXQ 1PM3A 2Z5UA 1KC8U 1AZGB 2JVHA 2EJRA 3CUQA 3BG3A 3H9QA 4NBQA 2HXOA 1JJ8C 4BQAA 2BZXA 4Y91A 3TEDA 3H9NA 2BHZA 5KE3A 3FXQA 4UXNA 1OISA 1WI9A 2CUJA 4A69C 3PIPF 3C4SA 4UNOA 1YJ9T 4XOPA 3DU5A 3K69A 1WYXA 2CRGA 3P9CA 4PGGA 3HTRA 4ZN3A 3EPZA 2DMOA 2A07F 2EA2A 3RQ4A 4LOCA 4R0KA 2D9TA 2G9WA 3KEYA 3DF8A 3Q0WA 4XTZA 3CMET 3BLYA 5JLXA 3FHZA 1IV8A 1FJLA 5IP6A 1VQ7I 1HYOA 3VS0A 1LPQA 3HHTB 4LG0B 3GTGJ 2W48A 4M72A 1NM7A 5K7HA 2EIMH 3HB9A 1K78A 1C0MA 2E4HA 2VUBA 2W10A 4NNJA 2E1CA 3EUKL 1VQKI 3T9NA 4RM2A 4A4GA 1PYVA 2EIKH 1PD0A 2VJIA 5HLHA 5HLTA 1WHHA 3VOEA 4Y4RA 1NLOC 2IS4A 4OIRF 3RCOA 5DS9A 1OYIA 2QF7A 3FKIJ 1X75C 1HKSA 2HBPA 3OY9A 4MMKA 2VC8A 2DQRA 1I27A 4GLMA 4IPAA 3SZTA 2HMAA 4CC4B 2DAQA 4G8XA 2FSWA 3VSKA 2CUZA 4Y52J 1SFXA 2M34A 3L1AA 1O57A 4XU0A 2HBWA 3BDDA 3ERED 1X58A 2E60A 3S8PA 2R7FA 1AWCA 3LSRA 3VRZA 2X3XD 4R56A 1FWZA 3A03A 5E8IA 4HQEA 1YRNB 2M0YA 2EYYA 1S7OA 1VQMQ 1SAXA 1N77A 4X34A 2BTTA 4ZYGA 2Y4XA 5F1JA 4QIWN 2XROA 4NC8A 5DTDA 4FSSA 2A61A 2NUPA 5TRDA 2NRAC 4IIOA 2MLGA 4DZJA 4DYCA 5CK9A 3CCQQ 3QWYA 5CCAA 2ISZA 1EA3A 4O6JA 5M5XJ 3UR3C 2EYXA 5E8GA 3BDUA 3BTIA 3TMOA 3VODA 2C06A 5LEJA 1ZGJA 3ZMVA 1BKBA 2DMPA 1IN4A 1Q81U 2RAEA 5FU7B 2P4RA 2L9SA 1DU0A 1W36C 4E47A 2A5WA 2GIZA 3A02A 1X2NA 1M3BA 4DBFA 4LJZF 5J3LA 1MBFA 2JVVA 4LDXA 4I7HA 2EWNA 5B5EC 3EG9A 1UCRA 2HZDA 2DL5A 1OU9A 1VF9A 4GDFA 2CYZB 1OMIA 2XRNA 1LVAA 3GZ5A 3BZ6A 1FMWA 2QM3A 3CCRI 2IPOB 3QJYA 2KPMA 2RJEA 2ZAEA 2MWPA 1MBGA 4JPBW 4KYWA 4LB5A 3GIBA 5KAIC 3F8FA 4RAFA 4E4HA 1REPC 3S3OA 2DNUA 4PLLA 2R92J 3CC4A 2STTA 3QU3A 3QZ9B 4PJOF 2YXYA 2UUZA 2HZYA 3UWNA 1NJIR 1KFZA 1O3SA 2QDLA 2OF7A 2CGHA 1G3YA 4BAYA 4KMFA 1XX5A 3NWSA 4HX7A 3FXLA 4QSHA 1ETVA 3DPTA 4EJUA 1XPXA 2HGCA 3HL8A 1G3TA 4XSZF 1M2VB 4PJ0C 2AHJB 6AT1B 2HYFA 2DDBA 1IN6A 2OQGA 4LLLA 4L9NA 2AK5A 2P7VB 4RB1A 2EW3A 2M30A 1XN7A 4JRQA 2DD4A 2ESNA 3BWGA 4MGRA 3S3MA 2M0CA 5GAN8 1W4MA 3TP3A 2FBHA 2X4JA 3PIOA 2YU3A 2DA5A 5HDGA 3E5XA 1TG0A 4C0DC 5K7ZA 4CUGA 1FX7A 1MBKA 3MKDA 3BJ6A 1KYZA 3PVQA 1J5YA 2E5ZA 2VL8A 3GLXA 3GLLA 1UZCA 4N4GA 4O5VA 1I5LA 1K4US 2I5UA 2R7SA 1TW3A 2GFAA 1NYFA 3HPGA 2R58A 2EV5A 2FD5A 1L3LA 5BS6A 3CCUI 2YLCA 2JTVA 2D1XA 3QO3A 1W7PD 2F2VA 2KQRA 3OSGA 5CQEA 2VUMJ 2PMUA 3PGGA 3CXCA 1A0NB 3G71I 2WAQN 3VYGA 3I4MJ 2KXDA 4P1WA 3VS7A 1V76A 4EMKA 1X4OA 2O7OA 4HEA2 3PMTA 1LJOA 3LSIA 1W1WE 3UKGA 2DVJA 3OB9A 4C8QB 5FO5A 1YLFA 2BZ8A 4KULA 1VQNI 3H3VK 1ZA1B 4LG0A 3GZ6A 2A28A 1Q1VA 1T38A 4B1RA 5LHHA 2K3YA 2NOJB 5JLWA 2EIJH 3JRIA 1FOXA 1UUEA 2CP5A 5CIUA 4F14A 5GANh 3CCST 2ID3A 3MD2A 2O9LA 2CP0A 2CREA 2YRCA 4PSWA 3LA7A 3OS5A 4OAZA 3INZA 3SWNC 1ETQA 2JN6A 4BHCA 2CZ7B 5K1YA 1H8AC 4BNCA 3E2UA 4KIBA 4BS9A 3ZN0A 3LSJA 1F1ZA 3QYFA 1UFFA 1MBHA 2E64A 4FETA 2O2OA 2R5MA 3NTHA 2QA4I 4RB2C 3K4BA 3CO7C 5A2QK 4YELA 3UPUA 1G59A 3ZMZA 2LMDA 1PWTA 3M7GA 4ZN1A 1VQ6T 3QDFA 4C8QC 4UVBA 4D9JA 5GAOr 1IHWA 4OIQF 2K7AA 3H0IA 3CCVT 2QVOA 1BCOA 3JTHA 1TW2A 3OIOA 1AEYA 4C5HA 2QLZA 1JJ2A 1J2XA 5FLXE 2LP0A 3CP2A 2HDCA 3HRUA 2X9HA 3M9QA 3L1PA 4Q4ZF 2JVGA 2HKXA 2F5KA 3I59B 2RHUA 2FA5A 2QTXA 1EH8A 3META 5GAN3 2ZJRF 3OYBA 1BR1A 3P9IA 4OMOA 2BY1A 1MZBA 3VS5A 2NOGA 2PN6A 5CR2A 3L2ZA 3LA3A 3R60A 3HPWA 4XQFA 2HTJA 2W4SA 3QOPA 1T0HA 4CC3A 4J9BA 4CYDA 1E17A 3HJEA 1SHGA 2DI3A 1Y96A 5J3BA 5GANe 1CF7B 4A3DJ 1Z7UA 2X1DA 2JUFA 4G12A 3HL2A 2JQ7A 1G2BA 3SB2A 3S3NA 3SEMA 3I54A 3VYUB 1RRJA 4JRKA 2H6CA 2QWWA 2ZCWA 4XTXA 2ZSHB 3QSUA 1FBSA 2DXCA 2VN2A 1BC7C 3JCMX 4I02A 1LQ1A 1RIOH 3U1KA 4HRIA 4N0AA 4N4IA 4MDXA 3ZQCA 3DLLF 3ZGKA 2ZPIB 5D6XA 2XB5A 2DFFA 1ZREA 1M1FA 4FE4A 2KISA 3DLMA 4X0GA 3K70D 4XTVA 3S16J 4LNPA 1NG7A 1QVTA 5F04A 3M56A 3PQJA 3SJMA 1JQQA 2Y4YA 1BI2A 1F5TA 3LSKA 2D0QB 2PX9A 2R5AA 1LJ9A 2EQIA 2Y90A 2FUG2 1MHNA 2PVDB 2VGNA 3L42A 4UV9A 1GXPA 3GTLJ 1FC3A 3ABUA 2J06A 3REAB 1VQ8T 1K76A 4FT2A 4DBQA 3CCUA 1N5ZA 4A4HA 2ZKZA 1MJAA 1D1BA 2JA2A 1PVEA 3P7NA 2OCEA 2BBYA 4B44A 1A35A 3GPLA 1K78B 3I71A 5GAN7 4M77A 2NS8A 3HSEA 2UXXA 1GFDA 1Q81R 1QPIA 5LHIA 2ZXIA 1X69A 2DBMA 3TSZA 5ICEA 2O8XA 2E3IA 3OS2A 3L2QA 5K5QA 3DEWA 3GZNB 4LDUA 2F2EA 4BDZA 3JSCA 4JDSA 4C92C 1QGPA 3CCYA 2HQRA 1K0XA 2KFDA 2A6HF 3D0SA 1YIJA 4PKCC 1GXIE 1HD3A 2HOTA 5D5XB 2X4XA 2A6EF 3HRMA 3KZIC 2CW7A 2HFHA 2KIFA 2VQLA 3IP4B 4IRHA 3QU6A 1QA6A 3FIFA 3LSTA 4BACA 4BY6B 3K7AJ 3M1CA 1AOYA 4KN7X 4BGDA 1KD1C 1IW7F 3BR5A 1M90U 4ESBA 5HS9A 3OYFA 3RZDJ 4M3DA 1DU6A 1SRLA 2NUPB 3KP3A 4A4KA 4R79A 5I2SA 3MHXA 2QENA 1B4AA 2JNGA 3MEAA 5C0MA 3TREA 3JCUC 3LH0A 2FOWA 4RLQA 5IY5H 2WB1N 2EQJA 1IGQA 2K27A 1FMKA 2JOYA 2JXBA 4Z89A 4P9UA 1GV2A 2K02A 1D3BB 2DETA 2DERA 1VQMT 3S2DJ 4AFQC 2OX7A 1ZN2A 2C0OA 4B4CA 5C4XJ 1WJBA 2XAJA 2KZVA 2DK3A 1ZG3A 2M02A 5GPAA 1MJ9A 5F27A 4PJJA 5BQTA 4ASNA 1FBQA 3HHGA 3O8GA 1YFHA 2GQQA 2K9SA 1O3QA 2HQEA 4OB3B 4BY6C 4RTTA 4DOWA 4YRVA 3M4YA 1TBXA 3H0HA 4XQ3A 1TWCJ 2FNPA 3KZYA 4LIUA 3LH5A 4RTWA 4DA4A 4HW0A 3WE3A 5E20A 2IW5A 1PSEA 1YI2Q 1YG2A 2HVQA 3DBLB 5IYCJ 4MFEA 3RDVA 4HQMA 1VQOI 3ZMUA 1R4MB 3NARA 3DTKA 3OOUA 2DO3A 4XRMA 4KN4X 2DK8A 4XN0A 1MMDA 2KLOA 4CSWA 1I8FA 3MP8A 1K4TA 2LCSA 2EGAA 1ENHA 1P92A 4V19K 5FWCA 3HKZN 4HAMA 3MKLA 1I5OB 2XKOC 5GMKj 4HV6A 3X25B 2JRMA 3CCUQ 1JUPA 3M07A 3FM3A 2E36A 4U87A 3SXYA 4WCIA 3N05A 2KJCA 1QVFP 5FB2A 4PJOA 4IVNA 2UXNA 3GMEA 3G71Q 2FOKA 5FKNA 2HI3A 1JKQC 1U5TA 1FYMA 2KT1A 2WA0A 2W85A 3B02A 1HDDC 1SFOJ 2QYOA 1LDJA 2XASA 3SHFA 4J7FA 1PP7U 4MLOA 3UATA 3C7JA 2VIXA 2R5YB 1YNZA 1S6LA 3W6JB 3O8VA 1VQOT 4PGHA 3HOSA 5J1RA 4C8QD 1K9MU 1TWGJ 2Q1ZB 4C3JJ 3OS1A 3OYEA 1ITYA 2NUTB 1YJWA 3CC4Q 3ZQHA 2M9UA 3VUZA 2RHIA 5L3GA 1OCPA 4YFKF 5IH2A 4HSRA 1RAGB 4XMYA 1YW7A 4Z02A 5GP9A 1JKPC 2GF7A 1KU9A 2ME6A 1YS6A 1HQCA 4GYGA 4IHVA 1VQ5A 2V9VA 2EINH 3WTSC 4OMQA 1UB9A 2RNJA 4YTLA 3EH1A 1H3HA 3BY7A 3O2PE 3CMYA 4G6QA 2MLKA 1V1CA 4B48A 2V6EA 3JB9F 1V54H 2K3PA 3FXKA 2W25A 4P55A 2KE9A 1YWOA 2G6FX 4BD3A 1K73R 1KA8A 3G2BA 5DCFA 3MO8A 4BB7A 1RESA 1ZAOA 4RA2A 3GF5A 4W97A 3SDZA 3F6VA 3DU6A 1RAHB 1WA7A 2WTEA 3LGLA 4CYCA 1TOVA 1R1VA 2FEIA 1DP7P 1BI3A 1P4AA 3ME9A 2O01E 1TL8A 4DEXA 3CCQA 1SVLA 1T95A 2ZXWH 5KYWA 2VJ5A 3MMYB 4E2FB 4DOZA 4A0YA 2AS5F 4FSXA 1JHFA 2COYA 5BNGA 3EG1A 4M78B 3DKXA 1U9OA 2GA2A 2CDTA 1Q86U 4KGZB 1ZGAA 4D5FA 3EGDB 2BXZA 5DD4A 4C3IJ 5LEKA 5FLXZ 1N27A 1XCBA 3K1NA 2XG8D 4EMGA 3CCMQ 5J47A 4XOTA 1FXXA 3M1EA 2RK1A 4D8DA 2DO7A 2NNYA 4N0AC 1JJ2S 4M77E 4AIHA 2VXZA 4JBAA 4M4ZA 1UJ8A 1Z67A 4JYKA 3WTYC 5GAOm 1E7OA 1HKTA 4L0YB 2YSQA 3JRHA 2PJPA 3BROA 1M9SA 2I0NA 3CMMA 4HCBA 2ZXHA 2O6GE 2FO0A 2Z16A 2VC1A 4IUPA 3OYCA 2ZMEC 1FZPB 2R5ZB 3HOVJ 2ELJA 1XGNA 2DA9A 5D4SA 1I1SA 1D5YA 3OYIA 1VYVA 2JW4A 2VQHA 1VQLT 3JCMJ 4QPQA 2EFNA 5IYBJ 5A0GA 3IL2A 5HODA 1WJCA 3QYHB 3JAMZ 4OIPF 3LL7A 1MNDA 1NK3P 3MVPA 2OD5A 1TP4A 2K9QA 4WCGA 4F16A 2HZTA 2LVSA 2VYTA 5E1ZB 2ZZDA 5KH6A 5IXFA 4XICA 1P7IA 3A2KA 5HY6A 1W7PA 3WGHA 4AU7A 2O88A 1K73C 1LNWA 3E6DA 2CSQA 3LLRA 1LFBA 3WXMB 2QQ8A 4JX4A 3CCMT 4M77C 3EUHA 4ZDOA 3PO3J 3HFOA 3JREA 1UE9A 4P5NA 4RMNA 2NS7A 1ZKGA 2F48A 4EEFG 2MF2A 2NLUA 2LY9A 1QHHD 4KT5C 5GMKi 1E3PA 4A63B 1RKWA 2FU4A 2E2JJ 1WRJA 2XMFA 2ICWG 4IUVA 4AC0A 3NPFA 4A3KJ 2EFPA 2P5KA 1VQMA 2BOLA 5ERIA 2H1LA 1U0JA 3KE2A 3K4MA 5DM7F 1UECA 1LOJA 3CC7Q 3HSBA 1B9NA 2XAUA 4OMYA 3CMEI 3G6EA 2CKKA 3UA7A 4I6ZA 4DOVA 1TTHB 5EG2A 1U8BA 2OA4A 2DJNA 5LJ3h 1UAAA 1XMAA 3GCMA 1U3OA 1UJYA 3OYDA 3PFSA 3CBOA 2KL4A 5F64A 1UTIA 3JCMf 2R3SA 1X2QA 4J19A 3N5BB 3CC2A 2F5DA 1NPRA 2ECZA 1VQ6Q 1J7KA 2WAFA 4OF1A 1HW1A 4LDYA 1M5Q1 2V4JC 3Q5FA 1B8IA 3BTJA 4RBOA 3VS2A 3GTJJ 4BHPA 3OL3A 2VOOA 3G3ZA 1E2XA 3Q9VA 4HNTA 4KDPA 1Y8RB 2KMUA 1LEAA 2MYSA 1S7EA 3BT9A 4BXFA 1WHLA 2A5YB 2QDYB 2Y30A 2UV1A 3ISPA 1BK2A 2ETHA 2GA1A 4AFZC 1U8RA 4M7DD 2G7UA 3ZXSA 4C92D 2F2XA 2WY7Q 3K1MA 2X51A 2LNBA 3RKXA 3TOBA 4X1EA 1MH3A 3GFLA 4F7UB 4HDUA 2GIVA 2G7HA 3V8KA 2R7TA 1WXUA 1ZRCA 2XHKA 3FXOA 1BC8C 2V8JA 5BPIA 2CGPA 4HG2A 1P6RA 2RREA 3KFWX 4W1UA 2KDSA 1OCCH 4F7UG 1R49A 2DA1A 4B09A 2D8JA 1R1TA 4RGRA 3CCRQ 4JOMA 3GTOJ 3QPTA 1B1BA 1B34B 1Y0UA 2IIMA 5GANf 3MPUB 3X28B 4Z2YA 3WTUC 1LFUP 3KX2A 3JAME 1XJWB 1VQ9Q 4I0BA 4UUSB 3M0SA 2FRHA 4NB5A 3M0QA 4OMNA 2EB7A 2LNHB 1KQ9A 5L3EA 3MKWB 1IUYA 2MI6A 3X2QH 2XHCA 3UDCA 3RTRA 1QVPA 2FMLA 2V9PA 2QBYA 3L2UA 2DIGA 2XU8A 4XKVA 1WNLA 3A0BC 3EAEA 2CV0A 4MO7A 5EGOB 4ZC3A 1USTA 1R7JA 3P9KA 2DODA 5HS7A 5GAHJ 2DZCA 2MSYA 2OTLI 4M7DC 1HSQA 2E41A 4UV8A 1Q7YR 2FG0A 4XKCA 3KP4A 2AXTC 4BJ5C 2KIUA 3MCAB 1KGSA 2MWOA 3C0CA 1PHTA 3CCJI 4L59A 4G7HF 2WY8Q 2F5VA 1PJRA 3JCMh 5LJ5g 1OCRH 5FRNA 2JPBA 1IRZA 2PBIA 3K4KA 2K3XA 2NXNB 4L9TA 4J83A 4I09A 5KYWB 1TQIA 2O8KA 1R0CB 1QQJA 2GXBA 4M77G 1K73U 1LUJB 1ZARA 2E71A 2CP6A 3HSRA 3TU4K 2M5WA 3U9GA 3P8HA 3W6KB 2H8RA 4JRPA 2DT7B 4C8QG 2LR8A 3A01B 1T0FC 3HXLA 2DPDA 2YUSA 4F92B 5GAMg 4BE1A 2LC2A 4XLFA 4BYYA 1DP3A 4F04B 2RD1A 4KGXB 2IGNA 2H3JA 2DTOA 5GAMf 1UGRB 2XIGA 5M3MJ 2IPQX 1ETYA 3CUOA 5FFZA 4E70A 1BJAA 3M4GA 3M57A 2NUTA 1KQSS 2ZC2A 2X6XA 2M7AA 4CYCB 2ZNZA 4OB0B 2RVCA 5GAMj 3S6WA 2V79A 3WU1B 5H20A 2J5OA 3R0AA 4RGXA 5JFRA 4PZJA 1FEXA 4X1VA 4J9GA 1OJLA 1TH7A 2DJZA 1Y0NA 3OYJA 4UUVA 4QQDA 2BIVA 2LF7A 3Q9SA 3FRNA 2KQWA 4M78A 4D1QA 5LJ3d 3UF4A 1ERDA 4L9VA 1YJ9A 4IEJA 4L5IA 2V7FA 3KPHA 4IRGA 4XRFA 4UUTA 3WTZA 2E1HA 2WSFE 2Y48A 3AAFA 3G4ST 5JVTA 2E65A 2OTLT 4CH7A 4M75C 2Z9OA 4NHJA 2YUPA 2CYYA 4LITA 1POGA 3H3UA 1RAIB 2DFHA 2E6NA 4JX6A 1YJNQ 2ZMEA 3CD6A 2XGEA 2LJ0A 3ML6A 1Z1DA 2Y9YA 4J9CA 4RCBA 2EFWA 1ORKA 1Y39A 2YRDA 2PTKA 3OSSC 1KU2A 1VQLQ 5C6SA 1QHGA 1YW8A 3JSPA 4MEXF 4CHUA 5H6QA 1MDMB 3JB9I 2XSDC 4HCKA 1NHAA 4RTZA 2K86A 2RV8A 3PMIA 1V5EA 2H27A 1WQWA 1A6IA 1WVRA 1HW2A 1G2HA 5ICFA 3CTAA 2CSOA 1WQ2A 3NWTA 4I98B 2DJIA 1RR8C 4L9JA 2D2WA 2ZPBB 2R4GA 2VWFA 4G7OF 4AG1C 3IAS2 4KNYA 3WGGA 2LG4A 1FBUA 2QG9B 3E9GA 5D7UA 1P2FA 4KH0B 4PJOB 3JCMc 4BJ6C 4DZPA 1SC7A 5M3FJ 2MOXA 1WCMJ 3H9GA 4E6KG 3JRBA 4Y15A 1PP8F 1LNXA 1B07A 1UELB 3QRFF 4MDWA 3FF5A 1QVUA 1JJ6C 5K5RA 1BL0A 3H5RA 4KRTA 4M78C 2H6BA 1ZK8A 5GAOq 1VQ9T 4HT8A 1OYXA 4JJCA 4PJOG 5J4YA 1UGSB 2R5YA 2XAGA 2E5NA 5B3SH 2L89A 3ZCOA 4ZGJB 1D09B 2JA5J 1N8RU 2XGCA 1OZ2A 4AMCA 2JT1A 2FE3A 1R71A 2QEXT 4DYRA 1O3RA 5J40A 1QZEA 4Y3OA 1BA5A 2ZPHB 2DOFA 2K79A 4M78F 2DTRA 2XAHA 2RQUA 4FU6A 3ZBDA 2KP6A 2LRQA 1D1AA 2NUZA 1U1TA 5CVJA 2Y75A 2RO0A 1GVJA 3PNVA 4E7ZA 3I9QA 1Q82C 1W2BA 1OR7A 4CC7A 1RL2A 1ZGWA 3LA2A 3ZMDA 1VQ4Q 1YHQT 3BDLA 2VBZA 3DWLE 1FNNA 4KIGA 5FW9A 1ZRDA 2MH2A 3RJPA 1S9HA 2VB6A 4OU0A 5LD2C 1H92A 3F23A 1LDDA 4F7ZA 1FOWA 3WG9A 3HRTA 3I53A 2XAQA 1V4RA 5IP7J 3E1SA 5KYYA 3F21A 3JR9A 1B72A 5ECAA 1MV0B 1LDKB 2OJED 1FT9A 1TUGB 3ZN1A 2EIFA 2ABLA 2M51A 2VKNA 2QEXI 4RTXA 2LTPA 4YIRX 1OQKA 1ZH5A 1Z05A 1SMYF 2XICA 2KRSA 3BTCA 1TTYA 4HV5A 2HR3A 1ZLMA 4KITB 2AT1B 2CZ1B 3T0YA 1X27A 1VQ6A 1SD6A 5EEHA 4ENKA 2GTOA 1W7PB 1X1PA 2VQGA 3O8HA 2CJJA 5J1UA 1G4DA 1PRMC 1BIAA 1QCOA 1SG5A 2R7ZJ 3KUFA 4Q48A 2QSHX 2L3DA 2N8GA 1KIKA 3M4OJ 1RETA 4HKEA 3GWZA 4J01A 1T39A 1WJSA 4QVZA 5ICGA 1W0UA 3BPXA 1T08B 3VYTB 3H8ZA 2WACA 4XU1A 1YX5A 2LCCA 1R5HA 2ECBA 4ETSA 4DBHA 4E7HA 3ASKA 2DAOA 4XKWA 3E6MA 3DLLA 4RM3A 5IOYA 1IO2A 2HQHA 3M0TA 1OCZH 4U7BA 3CEYA 1VQLI 3E6BA 4AUXA 3GFIA 1GXQA 1S5LC 1XSDA 1VQ8I 4UY8I 1CKBA 4FW2A 5IXBA 2HXIA 1DGRM 2IA2A 2R7WA 1K83J 3L00A 2HDDA 1AD5A 1J09A 1NLPC 2Q8KA 1UG0A 3WTWC 4Q47A 3IV5A 2EGCA 1TWFJ 1XMXA 2HNHA 3EGDA 4XU2A 2KIQA 4HLYA 2M9HA 3SEZA 1GT0C 2DYIA 1TC3C 3A8HB 3JCMW 2RA2A 3CCMI 2RQVA 1M8VA 4AG2C 2O4XB 4FT4A 1K6YA 1MBEA 3PE0A 2YLBA 3FDYA 4BI4A 4Z88A 4ZYEA 4XLNF 3FC3A 2CFOA 2QQBA 4HOBA 5KYUB 5A2QE 5D8KB 3ABLH 1WH7A 3MJXA 4FX0A 1K79A 2EAYA 3S1MJ 4OMZA 4JUVA 1Q7YU 2YX7A 4LD5A 3X26B 2OTJI 2DDAA 1MIJA 1BB9A 2WAQA 3GEZA 2OZUA 1G8XA 4M73A 1M30A 3CCJQ 2LOOA 1EH6A 4M7AE 3I56A 4NC6A 4EVIA 4FYVB 6PAXA 3MZHA 5CKDA 1FIAA 1R8OB 1JTYA 2DA7A 4N9IA 4BUPA 1YJNA 2K5IA 5CVVA 4PLIA 3AT1B 2R7VA 4A54A 4J5YA 1PUFA 2K3BA 5LJ5j 1OCTC 2O3FA 3CO6C 2K7LA 4L6V5 1YJ9Q 5EC7A 1XGSA 2JMWA 4JX5A 2XF6A 3EG3A 1NZ9A 2CZ6B 2PZ1A 3HTUA 1A36A 2VKEA 2K5FA 1XDUA 1YE9A 4ORZA 4CCOA 1ULYA 2JPCA 3TO7A 5EDNA 4HCZA 2DA3A 4ZH4F 3MCZA 2DF6A 1YX3A 4EJWA 3JTGA 4OGEA 2CQKA 2WC2A 3FJ5A 5CQYA 1AKHB 4BHBA 1YITQ 2FYKA 4DBRA 2F6CA 3F3XA 3HSFA 1A04A 4YFNF 5K7FA 1X19A 1ZQ3P 2CV2A 2K5LA 3K1PA 4HA8A 3CDHA 2BHYA 1EZZB 3CXCP 4M7AF 1HKQA 3K4CA 4CA0A 1OKRA 5JHFA 3RKWA 3G1OA 4JK1X 5FROA 4LD6A 1EJ9A 3BR0A 4OIOF 3G4SA 3S17J 2VKHA 4B43A 3QWXX 3M0PA 2EJFA 3V8JA 1QP2A 4HCCA 1AU7A 4M9ZA 3O6BB 3JCMV 2MGQA 5GPCA 3BR3A 3OMCA 3FX3A 2Q2EA 3U1DA 3AHUA 2E1OA 4J9FA 2L2OA 2R7QA 1Y57A 3V7CA 2DX1A 1DQUA 2RDPA 1JT6A 2L0KA 3CP8A 3EETA 4M3BA 1FYKA 1WH5A 2P7CB 2NVQJ 2EPDA 1B59A 1IHVA 3T8RA 4JRIA 2PUKB 1GVDA 3FEOA 3HDDA 4CC2A 3SZPA 4IX7A 2HL5C 5IT9E 4XORA 3SZGA 3JSOA 3RI4A 3LSPA 3M59A 2P0KA 2X85A 2KXCA 2HYJA 3LQRA 1XMKA 2KAFA 4XAXB 1WWXA 4N4OB 2DBKA 3HYIA 2B63J 3L2WA 2KK4A 5CYVA 5L3FA 4K11A 5A0DA 1BYMA 2VVKA 2DA2A 1VQNT 2CUEA 2JUGA 3HPHA 3I3LA 3DTEA 2RQWA 4A2UA 3E5QA 4X6AJ 1N25A 3LWIA 2ZBKA 1Y1WJ 4IUQA 2M8GX 1YJNI 3M58A 1ZLJA 5D6YA 1LB2A 1V29B 1L0OC 2GM4A 2RKHA 3JCMP 3BQZA 2VASA 3RR6A 2P0WA 1FTZA 2DTIA 2VT3A 2D8HA 3J81E 3CCJT 1LKXA 1XCVA 1W5SA 2OPTA 3HGGA 4C5EA 2LZ6B 2JTEA 1Q86R 2PQ8A 4C2MJ 4XLHA 1WQ7A 2K2MA 1AVZC 2RI5A 2NS0A 2KMTA 1EF4A 1X1BA 3ULQB 3J7AY 4JZ4A 5D8LB 4KA4A 3PT9A 2XPWA 2DFUA 4RTVA 5FWBA 5CQXA 2P6SA 1N8RC 3BR2A 2DKGA 2IP2A 3ABMH 3I56I 1M2VA 3MEUA 5GAEJ 4ZJZA 2GQIA 4AFUC 1W6XA 4CCMA 1OYWA 2FJ1A 5HNHA 1J0RA 2TCTA 3FXUA 4OMFB 2PU9B 5FFXA 5IHNA 1WDXA 1VOMA 4IQ4A 4YFXF 2DT5A 2DTZA 2DFIA 3MEWA 5IHKA 5CKEA 2KROA 4M3GA 1UHCA 1U6GA 4IO9F 3V4GA 1QCNA 2FPDA 4WTOB 2AXLA 5LBQA 5KYNA 5KCMA 2V8KA 4HF1A 4C9YA 2JRTA 3JRZA 2R7XA 2AKKA 3FWEA 4HBLA 1G83A 1VFCA 2D0NA 2ED1A 2COMA 3QP5A 1PCXA 4A4FA 5GMKe 3VV0A 5HCKA 1H9TA 1EIFA 3RUXA 2MD5A 2X1CA 1UJ0A 1WJQA 1X6BA 3EGXA 3HUGA 1NTCA 2W84A 3VRYA 3GXOA 1YIOA 3L2VA 3RYPA 2LT1A 3CCSA 1KU7A 1I3QJ 1FOKA 2KRNA 2GGRA 3SDGA 1ZSZB 2B86A 3NQOA 2V1QA 3H6ZA 4JQFA 1KZHA 2E3HA 3PTAA 2DQLA 3LFUA 2L7MP 2M0MA 3JRGA 3HFNA 3RESA 1AT1B 3SEQA 2W57A 4KJZA 1QVFA 3DTIA 1JT0A 1G6NA 4XNFA 2MCNA 2OTLA 2XDBA 3DB4A 3OIPA 2HQXA 2YDLA 1WIEA 3AKZA 2NVXJ 3ZFJA 1YI2A 4HLXA 3S2WA 4HT9A 4FX4A 1XD7A 1ZG5A 1ON1A 2PVGB 5DLQE 1KU3A 1NBEB 1R0BG 1RAAB 3CCLA 1PDNC 2NWMA 3ASOH 2FZGB 4M77F 1IF1A 3I55T 5TISC 2CP3A 1MW7A 5KAFC 1N78A 5CVUA 5C44J 2KSSA 2LCLA 3HOUJ 1S72I 1WFXA 3AFHA 2VKDA 4EGZA 2JS0A 5D5VB 3GNGA 3E0JB 2DVEA 2HQAA 2H09A 2QGFB 4Y28E 1KC8R 1Z3XA 5IHIA 3JCMg 2CS7A 2ROTA 2V1RA 5LJ5h 1IRXA 1ZYRF 1T2KA 1KG1A 2EILH 1AHJB 2RQRA 3FXRA 3OW2A 1VQLA 3CC2Q 3VS6A 3C2BA 3HHHA 2FBIA 2Y0MA 3CD6Q 3CBMA 2DPUA 2FXAA 3TL4X 4LE9A 2FX0A 2LYCA 3RPUD 2Y9ZA 2DILA 5LJ5d 3HRSA 4A0XA 2VPLA 3HEFA 3LQQA 4ESJA 3EHRA 5EJCA 4EGYA 3F70A 3BG6A 3M5AA 4OMMA 5FLVA 4ENMA 2RMOA 3EG9B 1ZTRA 3KYCB 1IXSB 2X0LA 3M8EA 1U1SA 1UGPB 2VKVA 2DXUA 1PUFB 4LUDA 4RS8A 5GAMh 1S29A 1WSUA 2M4KA 1I81A 1T33A 4BE0A 2L0AA 1Y56A 2X4YA 4M7AA 4A3BJ 2AKLA 5L3CA 5C3EJ 1WX6A 3LSMA 2K2VA 2DN0A 3BJAA 3BPVA 3PM1A 1X6OA 5DM7R 3K4NA 5GAN5 3PUFA 4XK8E 3CJQB 3CCQT 5D4RA 4M74A 8AT1B 3WVEB 5JVGF 3W3CA 1B6AA 2EYZA 2D6FA 3JB9H 3NHNA 4M77D 5LJ5f 4ZTJA 2RM4A 1WGXA 2BE7D 1LE8A 3ERMA 3QUIA 2KEAA 1TT0A 4II2A 4EIKA 1KK7A 2JMAA 2JK3A 2EVRA 3GO5A 1OZ3A 1X1AA 3LAJA 1KQ8A 4CO8A 2ESHA 4U0YA 4QQ6A 3OR2C 2DCEA 3BY6A 2L7FP 4IURA 2OTJT 2VOPA 2CT4A 2HVSA 5HKCA 4M7AG 3G73A 3NFCA 1VQ5T 4YEJA 1DJ7B 1ZR2A 1ZRFA 2F5FA 5DYMA 1VQOQ 2P84A 1H88C 3RZOJ 1SSFA 3R0JA 4PFZA 3HM5A 4RG2A 5KE2A 1IDYA 4G6TB 1RI0A 2KKOA 2DYRH 3M8JA 1RADB 3DEEA 4FTHA 2ZB9A 4PFOA 3Q0VA 1TQMA 4KMUX 2DIQA 2E6ZA 2HKNA 3ZQ7A 3FMQA 1WPKA 3G71A 1FTTA 1D0YA 3KFVA 1HDPA 2FF4A 2V1DA 3S1RJ 3QXEB 2A37A 1MJBA 2ID6A 1I0CA 1TWAJ 4M78G 4LUEA 3ABKH 1AWXA 4V2FA 2MIOA 1VZ0A 2V6CA 2LSOA 2DMUA 4MQVA 5FKKA 4CGZA 2RF0A 5LJ3j 1PNJA 2L9VA 1SHFA 2LKPA 3RSNA 3H1CA 3VKIA 2DLLA 1SVOA 1SFEA 2K4JA 2FPEA 5KYXB 3KXTA 5DCMA 3CJTB 3A8OB 2CG4A 1UG1A 1YJWI 1MNMC 1AKHA 3A8MB 1V5GA 2K40A 2WSEE 1USSA 2R93J 1QP3A 1QBJA 3VPRA 4L5GA 3MZYA 1YTYA 1FP1D 1IZ1A 2EKHA 3HOYJ 1OLTA 2PEXA 3WVDB 4BJTA 2YPRA 1MKMA 2L01A 3AG2H 2BY2A 4HF0A 3D1NI 4J8OA 1JXMA 2RB6A 1TNTA 4AWXB 3G6ET 2OCCH 1J59A 3EGUA 4F17A 4FQGA 4LD9K 1XTAA 2Z2SB 2GCXA 2HDWA 1MMSA 3BC8A 2BY0A 2RPNA 2X35A 1FIPA 3CCVA 5GADJ 3NEUA 3E97A 3C94A 3F8MA 3REBB 2FB7A 4BKXA 2LQKA 1D0XA 1HSTA 2AZSA 3S1NJ 2NNNA 3JRCA 2CO5A 4EJVA 2GOMA 3LMMA 1N9SA 3VYRB 3J80E 2M2EA 2DTHA 3H92A 5M9OA 2FMYA 1QQIA 1PC0A 1BM9A 3VFZA 1SD7A 2BVMA 3PVLA 4Y7NJ 4Y33A 5L3DA 4MTDA 4C92B 4RAYA 1K8AR 4XSXF 1M4ZA 2YWWA 3RBBB 1R5ID 1W5CC 3C95A 1NG2A 3J80K 4LG3A 3ECHA 3CCEI 4KUDK 3H9JA 4XU3A 3MWMA 4C2UA 4FT8A 1QZZA 3ZMSA 2RK2A 3KBGA 5EF6A 2XIDA 1BI0A 4H0EA 3F22A 5CKBA 3FIWA 4BH9A 2VV5A 3FISA 1Q95G 1UFMA 5LJ3g 4HX8A 1HC8A 1TU0B 4DW6A 1J9IA 2R0QC 4V2GA 3AG1H 5KVRA 3SYTA 4YG2F 2NVTJ 2WADA 3H5AA 2OUMA 2HL3A 2COWA 5D5UB 1CKAA 1C1AA 1S7AA 2DK5A 2DYBA 1N6AA 1OYYA 4OINF 1TSFA 2JM9A 3CC4T 4C8QF 3SWNB 1R22A 3K9TA 1I6HJ 4LN2A 1SFKA 4M6VA 1SFUA 3EFOB 1Y7XA 3PL8A 1PRLC 4JZ3A 4N4HA 4HPQA 2NYXA 4XTYA 2XUBA 4LB6B 1GV5A 1BBZA 3OOPA 1BIBA 1ETWA 4M7AD 1Q81C 2LY2A 1RAFB 2JMCA 1J3TA 1OCOH 2IEKA 3QOEA 5HDKA 3AL0C 1ZX6A 1M1KR 2QUFA 3G7ZA 2L8DA 3DP7A 1OU8A 3C2HA 3VU3C 2DEUA 3BCAA 1S72Q 4M7AB 3F72A 4HNUA 2LRDA 3BW1A 2K4YA 1F36A 1M1KU 1FY7A 1Z3YA 3CC4I 2CWEA 2LX9A 2HU9A 2CT3A 2V1XA 2R5ZA 1KHCA 1M3CA 1W2BP 1YJWQ 1MMNA 1NK2P 3GFJA 4RB0A 1ABQA 1ZLKA 3TO6A 3HTSB 4BY1J 3GBQA 4M78D 4EDUA 1OEBA 1Y8QB 2XF7A 4WX9A 3CC7I 3V42A 4KGVB 4IOCF 2P6TA 2HPIA 4ZZDA 2KT8A 5FD5A 3MAJA 1SPKA 5A0LA 3QHSA 4BI3A 1UMQA 5GJWB 1VQ7T 4HF2A 1QVFS 1VQPA 2EA4A 2I8DA 2HVRA 1S72T 1H3ZA 1NEBA 2VXDA 1PD1A 2CP7A 3OYYA 5DUKA 3A01A 5GAMd 3G1LA 3HG9A 2H3EB 4EPCA 5GMKm 1SSHA 2OQRA 4AIKA 4FE7A 1JGSA 4XTWA 4FYWB 3WTXC 2ESWA 1LVKA 4CXFA 3FXMA 2RGVA 2SEMA 4MIMA 4AIJA 4AFSC 1UHMA 1Q82R 4M7AC 2EQRA 4EM0B 5E3NA 3RQIA 4M75D 4UHTA 1QWEA 5KNLA 1JU5C 4ZTFA 2L3RA 2BW3B 4A3MJ 2GBYA 2LTOA 3DEUA 5DD8A 5KHDA 3ZP5A 2R7UA 2QZ8A 1M1EB 2P81A 4MTEA 1K7AA 4A53A 1JKOC 1U2WA 2IBDA 1RZ4A 3T1BA 4GXOA 3EHQA 1AWJA 1ZBJA 5GANd 2KRFA 4PJLA 4N0BA 4EATA 1ETXA 2HTSA 1TXQA 2GFUA 4RDUA 4PFPA 1MUZA 2Y31A 2H94A 3F8BA 4RGUA 4AVZA 1ZUYA 2IJLA 3E7LA 3QZ5B 4KT0E 2DJQA 5KCOA 4IHYA 1PG5B 1ZSGA 3JRFA 3G6EI 4C5GA 2O61A 5BOXA 2DXBA 2EYWA 3I55A 3WODF 2XDVA 3OBYA 1ZSZA 2M16A 4G94A 2GOXB 4JLGA 1NE8A 2WWYA 4PDKA 4BEHB 3TQNA 2LREA 5M5YJ 3OYKA 1IV6A 2GLOA 2LC4A 2IRFG 2JJ7A 4F91B 3I4PA 1QPMA 1OV3A 2H8HA 2LJ3A 2VQCA 1GDTA 3GTKJ 3C2GA 4MNUA 4A3IJ 4XK4A 1MSFC 2A0FB 3HOZJ 2FEZA 4A12A 5CQGA 2PMZA 2QA4A 1HLVA 3J7ZI 1O4XA 3CC2T 1U5TB 2EZHA 4UB6C 5E3LA 1IREB 1T3LA 3MKYB 1Y07A 1BI1A 2F1LA 4XLCA 1GLNA 1MSEC 2FQ3A 2J7IA 5FLMJ 3EDPA 4RAGA 2L02A 2KRMA 3FLGA 3TEEA 1Y1VJ 4GCVA 4XLEA 1IGUA 3CDIA 2HOSA 1A31A 1QVGS 4IKFA 1JKRC 2KRCA 5GTIC 5HLGA 2KYBA 2QQSA 4S04A 3BOQA 5DV5A 1RUOA 4A3GJ 2LLKA 3QQAA 1YCSB 3TDUC 2ACJA 4GO1A 2F2WA 3M0RA 3ZQLA 3I0TA 3GBGA 2EGEA 2DU9A 5LLQA 5GAMe 9ATCB 4CCLA 4F93B 2UWMA 4C92A 1K9MC 4UC4A 2L9NA 1VQ5I 1DPUA 5L23A 2DXTA 4EJOA 2RHZA 2QK0A 2VBXA 1UDLA 4NL3A 1JXOA 3CF2A 3ZMTA 4I76A 4ZDLA 3SFMA 2YS9A 4R1HA 3GYHX 1QW1A 2GQVA 2LQ8A 3JCMQ 1R00A 2VBWA 3A1PA 1YJNT 2KT0A 1HJDA 1BW6A 1O9SA 3S32A 4K2EA 4F7UA 3EFSA 4HX4A 3A1YA 3IHUA 4AYBN 5EG0A 3SFIA 1BJZA 1R23A 2JJ9A 2F4OB 2ZJ2A 1UHWA 3BR1A 1SAUA 3CJRB 5FKLA 4CICA 4F55A 3TKYA 5DCMB 1ZBXA 2NVYJ 1G5VA 1K4SA 2DW4A 5DEQA 2C0IA 2X6OA 4KT6A 4PJMA 3LGFA 1QCFA 4PJOE 1Q1HA 2KJBA 3EUHC 4QWQA 3CCQI 3HOWJ 3KP6A 3VEPA 5ICCA 5ED4A 1VIEA 1XB4A 4E7KA 4ZZLA 3NGPA 2VBYA 2A7YA 1I1JA 4IHSA 2EYQA 1NPPA 3C12A 1UGVA 5FKOA 1BU1A 4GBQA 2M1BA 1X6GA 2PJRB 1NJIC 1NH3A 4QW2A 1FOYA 3KETA 3BCBA 2WBMA 2Z3YA 3L7WA 4BQNA 1C0WA 1IO6A 4F3QA 1ONVA 1TS9A 2D45A 1XNIA 3P5JA 2L7ZA 3OW2P 5EZHA 1W1FA 1R9TJ 1YIJQ 2LQNA 2LBFA 1I6XA 2ROLA 3DPUA 1VQMI 3HBLA 2JS2A 2W7NA 3CMAT 4DJAA 1IRGA 3E5UA 3LX7A 1X2KA 2A3LA 2PQWA 4A6DA 3H36A 3QPHA 1LFPA 3CCLI 3A4CA 5E1WA 5LFAA 5LJ3e 4UVCA 3NTIA 1KHIA 3GUDA 3VS4A 1E6HA 4MHGA 1RNLA 4G7ZF 1YITA 1BR4A 2HD0A 4KUIA 2RI2A 4MMLA 1O7LA 2GZWA 2W1OA 3FKJA 2FPFA 1O3TA 4M75G 3DKYA 3E19A 1LE8B 1WJ5A 2IA0A 2PVOB 1ZQ1A 3GTQJ 5GAN2 2K5CA 3ZRGA 1W36D 1UEBA 3RYRA 3RERA 1KD1R 1KQSA 3FMRA 4Y17A 4CCKA 2CH0A 3NAUA 2L2PA 2FZCB 1EX4A 1XG1A 5CVIA 1X4PA 2LP5A 3FK6A 2Z99A 1FLIA 4KH1B 1OX9A 4O3MA 5IN1A 5KYXA 3S14J 1RLPC 3JB9J 3WE2A 3TBIA 2H1KA 2HKOA 1UGQB 5FGMA 2EZIA 1SANA 2BW3A 2MC3A 4A3LJ 1XOVA 4B9WA 1GUUA 4S0HB 2WAEA 4MEYF 2JA8J 2QCOA 2VC0A 2IA1A 4J9HA 2IS1A 3I59A 3EH2A 2CUDA 4QLCU 2F5TX 5D6EA 2ZPGB 5FU6C 2WSCE 2JZYA 5E18F 2EBIA 5FD6A 2XGXA 3ESWB 5LHGA 2JT4A 2DA6A 5FRMA 5DY9A 1IXDA 3CCET 1AA7A 5E3OA 3E3VA 1JI8A 3PNYA 4BUGA 3R6NA 4MZMA 1Y96B 2RN8A 1HXDA 3BZCA 4A6EA 5HDNA 4DEYA 3CCLQ 2DE0X 2OAWA 4BL0B 2ED0A 1JUSA 3KLNA 3PNWC 1YI2T 1RUNA 3SQNA 2COZA 2DPPB 2CQNA 1ODDA 4HVUA 3WU2C 5E17F 2BKDN 3CPFA 2A05A 2ISYA 4ELZC 1JEGA 1GBRA 3RKQA 5H6RA 4DIQA 1I39A 2YU9J 3JCMb 4M7DE 3DQVC 4M9SA 1WLPB 1M3AA 3JV3A 2HOAA 1RACB 3THKA 1S1NA 2QEXA 4M7DB 3OYAA 4GFBA 2XDDA 4NC7A 4IRIA 3D5LA 2IXSA 2LMJA 4QQGA 4YIIA 4ABZA 3ONQA 4RTYA 2X6WA 3SWNA 2TRTA 5A2QZ 3DB3A 4KBMB 1GL5A 4KICA 2J05A 1Z6RA 3GF2A 2L3PA 5CVRA 2IVMA 5FKMA 2LX7A 1IC8A 2EZKA 1QNTA 2WB1A 3IAM2 1VIFA 2O9VA 1I1GA 5JHUA 2QQAA 3H41A 1DPRA 1Q7YC 2QBYB 1E0EA 1FPQA 1U5TC 2E10A 3MFKA 2QA4Q 5EGOA 2EQKA 2R7DA 3QJ6A 3I56T 4HNVA 1IG7A 5DM6F 1U5SA 2QQ9A 1WHJA 5I22A 2EJ9A 4C8QA 1KONA 3B73A 1RKTA 4ZYHA 3CCLT 1B9MA 2E2IJ 1ZSZC 5CKFA 3RDIA 2VGMA 1P9QC 2L7KA 3MQ0A 4J6YA 2DRMA 1ACMB 3V8LA 1LEBA 4RMOA 5IPAA 2RN7A 1B34A 4XR6A 1UHSA 1Z7LA 3CJNA 3IH4A 3TP0A 2QTVA 4LXCA 1UB4A 4C92G 2LK2A 3RIRA 4PJOD 2XB0X 3W2VA 5ILVA 4JJNK 2MC4A 1VUBA 4F7UF 1WJEA 1WHMA 1JB0E 2QA4T 1GCPA 2JTMA 1K61A 2FVUA 1W5TA 1IXCA 3SDBA 2VE9A 3MEVA 4FM4B 4A3EJ 5LL6S 4M7DF 1K6OA 2VLAA 3HP9A 2LQWA 3R4KA 2PNIA 1YS7A 2LBFB 5EG0B 1D8JA 3MZ8A 1A5JA 1SF9A 1R4NB 2M87A 1YN8A 4BY7J 1QU3A 2LKSA 2ENMA 4M75A 2E12A 5FJ8J 1YW9A 1Y6IA 2AO9A 3OIQA 3LSGA 3JRDA 1R6RA 3I4NJ 2KGTA 4BEHA 2DMNA 2P0QA 2LD5A 2FZKB 5AONA 2QXFA 2L5QA 4PUSA 5F0HA 2XF5A 2YR2A 3PJRA 2NVUB 3F8NA 4J7IA 1F43A 2ZSIB 5CKHA 3G71T 3SFZA 1BCMA 1D3YA 1VQPQ 3MEXA 2KDOA 3CLOA 4DGWB 3VDXA 1CF7A 2JA7J 4FYXB 1EH7A 4VUBA 3TOAA 4E7IA 5HS8A 3CCUT 4ZYAA 1KQ0A 3VSLA 2ZFWA 3N4MA 4BBSJ 1STZA 2P5VA 1P4XA 1B7TA 2BUDA 4IUTA 3LWFA 1IZ6A 2HCKA 1TNSA 1T3SA 3GP8A 1RUWA 4HVWA 4FIBA 3JCMd 1FYLA 2EK5A 3AG4H 3TGNA 4EJTA 2QAZA 1I07A 3LW5E 4D8KA 2EBPA 5DUIA 4B6MA 2LF8A 2IGKA 1Z6TA 3OBWA 1QKXA 2XAFA 4C92E 1WHGA 2E7WA 1WFWA 3U23A 2EQMA 4PK4A 2K85A 1KQSP 2V8IA 2HKQB 4XLPF 1S72A 4C0DB 2P5LC 1WKMA 4Z6YA 3CC2I 3R6SA 3F0CA 1HF0A 1OX8A 4EQQA 1YP5A 2LH9A 2L3QA 3AL0B 1APLC 3OL4A 2HYGD 3J81Z 2M8EA 4IHWA 2JA6J 3OYHA 1D5VA 3C1DA 3VB2A 3RNJA 1VTNC 1IRFA 3CMAA 2XPUA 1BBYA 1ETOA 3B6CA 2XGDA 3PFYA 2JUCA 4LFUA 1WHUA 2TDXA 2NYSA 4Z8AA 1OR7C 1QO0D 1YQAA 2LJ1A 2NAZA 3A8LB 2QYZA 4JP0A 2KYMA 3EGXB 5KYUA 5LGTA 3T8TA 4ZGEB 1HSJA 2CQQA 5LGUA 2BV6A 2F69A 1MDMA 3SHWA 1XSVA 4WK8F 5GMKh 2QSGX 1WHKA 2OTLQ 3A5ZB 3TDZC 2DA4A 3X20B 3OSFA 4AIDA 2X4HA 4M6XA 5F6FA 2YUOA 1KD1U 2X3WD 2X1EA 1JBMA 4HZFA 4N4NB 5ILSA 3RMSA 4EMKC 2PLYA 1LCKA 5E3MA 1GBQA 2B8AA 2AQEA 1FSEA 1GCQC 5J39A 3ZOBA 2CQXA 1X43A 1F1BB 3RKYA 2X48A 3I5SA 3LWHA 2MPXC 3A8GB 3K2AA 4G9YA 2AQFA 4E7LA 1N75A 2DT6A 1K9AA 2FRYA 1VQ7Q 3CC7T 5GAOp 1R77A 3QWLA 1E6GA 1CQTA 3VUBA 2ELHA 1R1UA 2YRVA 2PMHA 1QWFA 3NRVA 3DFGA 3DCFA 5DLOA 3CCEQ 2X6YA 4QVDA 1K1ZA 2RNGA 4AYBA 4I0AA 1H0MA 1B72B 5FLXK 3QBYA 4TV7A 2HOEA 3FJPA 2W00A 2J6FA 1F4KA 1SRMA 2G3RA 2E35A 4A0ZA 4M78E 3CMEQ 3CD6T 4EM2A 4BQQA 4Y92A 3OYNA 1ZUUA 2DFEA 1M1KC 2OAZA 2EKOA 1GRIA 2CSIA 1YBYA 2L54A 5F1RA 1XS9A 2IS6A 1Y71A 3EFOA 3QYGB 5DDGA 4JS4A 2F5EA 1YOVB 4QT7A 1X3ZB 2XKOA 2F4MB 2MW8A 1ACIA 3CF5F 1KJWA 2O4XA 2KRHA 4HXJA 3VJPA 3C3WA 4HSTA 3URGA 2O9SA 2XKPA 2MABA 5E1XA 1V5FA 3WHBA 1VYUA 2AZVA 5HVQC 5HK3A 3OYMA 1BOBA 1QVGA 1VQPI 1M90R 2MG4A 2E1NA 2VPRA 1IAWA 1ZELA 4OAYA 1H641 4L5JA 5TGTA 2BZYA 4M75E 2BE9B 3FHNA 3IC7A 5B1AH 4J9IA 2CZ0B 2K9NA 2OTJQ 2RJFA 3D5RC 2BZTA 4ENNA 2KVQG 2OBPA 1RABB 4LLNA 3JRAA 3R61A 3LYIA 1W2BS 3KIOA 2HQ5A 3QKJA 2ADUA 3KEQA 2PI0A 1SEMA 4A3FJ 2PMZN 4V2SA 4UB8C 3HKZA 2JTFA 1N9RA 1M8MA 2HS5A 3CZ6A 5F0FA 3PUBA 1U78A 3CCRA 5H2FC 2VODA 5AT1B 1XDSA 3I55I 4CCJA 3G1JA 5L8RE 2FL7A 1BW5A 4PJNA 2BGCA 1YJ9I 2GBQA 5LJ3f 5IAYA 2FHDA 2K57A 1O75A 3H3ZA 3L9FA 4BDYA 1FSHA 1MMAA 2J5PA 2KZGA 5EYRA 3ELKA 4KUMA 1FMVA 1KQ1A 4RG8A 1TWBA 2LFBA 5AIQA 5HLIA 4S05A 4IZZA 3K4LA 1JO8A 3L09A 4LMYA 5E79C 5JI6A 3EFRA 3CCJA 5CLSA 3VWBA 1ON2A 2B0LA 2UZKA 1OI1A 4M7DA 4PCQA 1TUCA 1PUEE 2K9LA 5GAOl 3CCVQ 1U3EM 1D3BA 3PIPA 1I3AA 4MZPA 1HBXG 4BXUA 2RQQA 3QAHA 4MQ9F 2XSJC 3TW6A 2ZPEB 2P4WA 3GTPJ 4L18B 2PJRA 1VQNA 2L4AA 1ZG1A 5KK1A 4IQJA 1GFCA 5F08A 2E70A 3L2CA 3JW4A 1AHDP 3BG7A 3ZPLA 4IF4A 3WU0A 4A93J 4XN3A 4C92F 1VQKQ 1OOTA 4R55A 4LK0F 1G3WA 2EQUA 4ATOA 1VNDA 1CGPA 1AOJA 3IKVA 2GTJA 1EKEA 4FISA 3OYLA 2QI2A 4LIVA 5J4VA 3REOA 5GANj 1QVGP 2DL8A 1ZHIA 3KEOA 3BR6A 4GYIA 4AD9A 1Q86C 4XONA 3LNQA 2C0TA 1PKSA 1QKWA 3IH3A 2ZCFB 3FBIB 3IUOA 3WTVC 3QIIA 4NOYA 3HZJA 1FP2A 4ITVA 1JXSA 5IOZA 2OC6A 4D7MA 1XTDA 3TCJA 1D0ZA 2CFXA 4M7DG 1JHHA 1MBJA 3U2RA 2W82A 3F8CA 2RQPA 5BPDA 2RJDA 1H9GA 1WJRA 2IVWA 2K9GA 4BI8B 4I99C 4KFCA 3CD6I 1DGWY 5I21A 2FQ4A 2DL4A 1WI3A 1YWPA 1JJ2P 3I58A 2DL7A 3KLOA 4J9DA 1XQHA 3HC7A 4JJDA 2ME0A 2ZJQF 3GTMJ 4C2TA 1I4K1 1K8AU 4PJOC 1HW5A 4L5EA 4PL6A 2W24A 3H0GJ 5HOOA 3DBHB 3RPUA 2M4GA 1IUFA 2XRLA 1WI7A 1X01A 2P0PA 3JB9D 2A36A 1VQNQ 4Y13A 5M5WJ 2ATCB 1YI2I 2WV1A 4L0ZB 2V1UA 1D8KA 3S1QJ 3BP8A 3I35A 3TQ7P 1YJWT 3S2HJ 5J8CA 2KDZA 2RQTA 2YX4A 2A68F 4R8HA 1VA7A 2CP2A 1XSXA 1U9NA 2DD5A 1VQOA 5HNFA 4E6RA 3OYGA 4NUBA 4FASD 3BE3A 2J6OA 3CBPA 3CCRT 4BXXJ 3CPWP 3GW2A 2R7RA 2HQNA 3J80Z 2GNCA 2JN0A 5IT9Z 2F5CA 1IN8A 1Z9QA 2QGUA 3IWFA 2MMPA 2EV0A 1RLQC 1TZLA 2RHXA 2W0ZA 1NJIU 5J8FA 1Z0XA 2QKLB 5IT3A 2DOAA 1X3UA 2CMPA 2GAUA 4ON0A 3DKMA 5GTHC 1VI0A 4ESFA 1C6VX 2RI3A 2XD0A 3OW2S 4LLGF 4M71A 2JSCA 2VJJA 1RR7A 3WGIA 3O5ZA 4JJBA 2O0YA 2E34A 3DBRB 4U88A 4FCYA 3A98A 2HNIA 3EG0A 2Q0OA 4KIFA 2EJGA 3O3KA 1BN5A 2J6KA 4X9CA 2BY3A 2M7BA 3ASNH 4LGWA 5K5OA 3VS3A 1K0SA 2XVCA 5TJJA 5CJ9A 4E7SA 3K0LA 4CDGA 4TVRA 2P8TA 1W4SA 4QTRA 4XBFA 4IUUA 2CS3A 2KI7A 3DKWA 3WG7H 2HPMA 1YCYA 3OSVA 4DNCA 5IYDJ 4C0FA 2D5VA 4GRIA 2G0EA 1WXBA 1YIJT 2VONA 3CCSQ 3DXJF 4XRSG 2IS2A 4C5IA 3OA6A 4IJAA 1ETKA 4CZCA 4C30A 4QPOA 4AVPA 4EM1A 1T0JA 1T98A 3PSIA 4D7NA 2V9KA 1GCQA 2MD0A 3P8BB 3QG1A 5IT9K 3QPLA 4ZDPA 1AWWA 4A5MA 2V26A 4BU2A 2YUNA 2P4TA 3ZEHA 3Q0UA 4XIDA 1WJDA 4NQWB 1W0TA 5EEAA 1S3JA 2IGOA 3EUAA 2Y0SN 1QLYA 2HAXA 1TT5B 1WXTA 1QZYA 2COBA 3KYDB 4C0ZA 1MGQA 1VQ6I 1YIJI 3BG9A 4IHTA 3I56Q 3PFIA 2SRCA 2XC7A 4P5OA 1MMGA 1E3HA 5B1BH 4PNOA 2JWTA 3CUQB 3H5NA 3MP6A 4OMPA 2Z1DA 2QGGA 5D6FA 1XGMA 3E6CC 5I11A 2A08A 5KCHA 2CH4W 3CLQA 3IQLA 1TUDA 1WGSA 3J7AO 1W70A 4KISA 2QASA 2CV1A 2MAMA 1SEUA 2RHYA 2HEOA 1WPYA 2JZ2A 1D1CA 1MGTA 2PG4A 1ZR4A 4A3CJ 3EG2A 3ER0A 4MFDA 3ZR8X 4XM3A 3CCVI 3FDRA 4EMKB 3OV8A 5EZGA 1K9MR 3UNGC 3HGYA 1SD4A 3KP5A 1IN7A 3PIOF 4M75B 3GFMA 4P9FA 1H89C 2IG0A 3LOCA 4J00A 1HCRA 3K2ZA 2Z0WA 2PFBA 3BG5A 3R6OA 1VQ8A 2AHQA 1OFCX 2MH9A 3IRRA 3AG3H 9ANTA 1RI9A 2DMQA 1VQ5Q 2BYVE 5B66C 3N97A 1WZOA 2CQ7A 2E1MB 3CESA 3OMGA 1YHQA 3BFMA 3DLAA 4LDWA 2IGMA 4BBRJ 2OTJA 4RLFA 2M3AA 1A6QA 1T0FA 1SKUB 4IXAA 1YHQI 4ZYDA 2C6YA 1HK9A 2HDAA 3FB9A 1YITT 2OI3A 4B9XA 3HUGB 4XTUA 1SVMA 2L4MA 2O5RA 4WXDA 4LDVA 3KYLA 4ELYC 1FYNA 1AWOA 2EZLA 4RAZA 4GGGA 4U7DA 1R36A 5J1YA 3IRQA 3DV8A 2MA3A 3PSFA 3VYSB 4ZGDB 4IHXA 2H8WA 1VYTA 3EYYA 3FBNB 5CO7A 1YYVA 2EFIA 4C3HJ 3Q3SA 1ARKA 2M45A 2VT2A 1KSWA 1P7JA 1Q82U 3FM5A 3MKZA 1EV7A 2YSRA 5GAGJ 1PKTA 2XI9A 3M55A 1QRYA 1M27C 3QYBA 3KZZA 1X2MA 3KP2A 1MV3A 2LDMA 4CI0C 1O7FA 2BEOA 2DXIA 2VJ4A 2STWA 2VI6A 3EQLF 2PUOB 4OMLA 2KIMA 3CMEA
chains in the Genus database with same CATH topology
4OP0A 3WTTC 2M1HA 4CZZA 2D1VA 3IKTA 1VQPT 5GAOn 3OS0A 3CPWA 1VQ4A 1MD0A 3L2RA 3IWZA 4Q5SF 4B8XA 2RH2A 5J6XA 1BOAA 3J81K 4A5NA 4WWCA 4EMSA 2E7XA 4RKUE 4X9DA 5D5WB 5HK0A 4GLKA 3HIFA 3SD4A 2DBBA 4BE2A 4J6XA 3BJOA 4DQ2A 3CUQC 1IXRC 3JCMe 1TQPA 4ME7A 4E7JA 4YIFA 4OB1B 3ABTA 4GY5A 5LJ5e 4NQWA 1JRIA 3UT1A 3EYIA 3PQKA 3JB9G 5FU7C 1F9NA 4M77B 1K8AC 2XDPA 3Q1JA 3KP7A 5BMZA 2LNVA 4M75F 5CAIA 2FNAA