3HRSA

Crystal structure of the manganese-activated repressor scar: apo form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
TPNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 65
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrsA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrsA02
2XUBA 3RJPA 1BIAA 5ICEA 1SFUA 1QZYA 2EFPA 4E70A 5DCMB 1FX7A 5DUKA 5BS6A 3MZYA 1EV7A 4U88A 1SMYF 2FBKA 4KA4A 3SXYA 1DPUA 1W5SA 5LLQA 4CO8A 5FD5A 4RB3C 4WXHA 4LGWA 4I0BA 3BOQA 2A5YB 1OR7A 1E17A 1W7PB 3PQKA 2XHKA 5KK1A 2MBFA 4HZFA 1UHMA 1ULYA 3L7WA 1WKMA 2Q8KA 1YG2A 4Q5SF 4M9SA 3J81Z 1XSDA 3BROA 3I0TA 4L0YB 5BPIA 2DFIA 3GUDA 3ZMDA 4CHUA 2ZBKA 3WTVC 4HQMA 1F9NA 2KIUA 2LF8A 3RPQA 4BAYA 2K5IA 3SZTA 1LDJA 2XROA 1FP1D 2Y48A 1UFMA 3KP3A 1G3WA 2RNJA 1O3RA 5AIPA 5LEKA 2UXXA 2F2EA 4JQFA 3BJOA 4HA8A 2IJLA 1IN6A 3FF5A 4AWXB 2PJPA 4Z2YA 2O3FA 2EV6A 1BOAA 2IT0A 2LF7A 2A6HF 3LA2A 1V3FA 1BN5A 1TLHB 2PI0A 1LEBA 5HDGA 3F22A 1BI1A 1YTYA 1QW1A 4TV7A 3CJNA 1I5ZA 2EV5A 3WE3A 3DKWA 4EJVA 2NNNA 2L4MA 3KZZA 3WU1B 3L00A 1XD7A 4LK1F 2Z5UA 5HDNA 1WSUA 2EV0A 1PUEE 1W5TA 4OIPF 4M74A 5IT3A 4ZYHA 3ROUA 5D5XB 2ZMEA 3ERED 3CLOA 4N0BA 4HX8A 2EFQA 5F1RA 2XVCA 2LDUA 4L5IA 1G3SA 2O0YA 4Y13A 2BV6A 2JZYA 2ZFWA 5L3CA 5LEJA 1MZBA 4YG2F 4ZYDA 4PZJA 3REOA 1IUYA 1U8RA 1B4AA 3NRVA 1R22A 5CVJA 3SFZA 5KVRA 2CYYA 2HKXA 4Q4ZF 2NAZA 2O8XA 5D8LB 1EH6A 2VBZA 2QVOA 4YIFA 3TOBA 1XGMA 1GHCA 4L9NA 4L5JA 2PEXA 4GYGA 2OA4A 3OOPA 1KQ9A 4ENKA 3RKYA 2WC2A 3M7GA 4XRFA 1JGSA 2CW0F 3KEQA 3ZQ7A 1LDKB 4BNCA 1TNSA 2G7UA 4DQ2A 4I01A 1IZ1A 3WTZA 3E5XA 2XV4S 4U7BA 1P4XA 3ABTA 5LHGA 5D5WB 2DPUA 4IVNA 4A2UA 4BYYA 2VT3A 5L3GA 2GXGA 2GA2A 5HLHA 4UUVA 3FM5A 1XDUA 3T0YA 2F5CA 5HS8A 2MC3A 3TDZC 1FT9A 1HW2A 1ZYRF 5H6RA 4BQAA 1FP2A 5HOOA 4KYWA 3P9KA 3BP8A 1MGTA 4EGYA 3IKVA 3PFIA 4PGGA 4CDGA 5D6FA 2P6SA 3RKWA 3GO5A 3F8CA 3K0LA 3GLXA 1SD6A 3E6CC 3E6MA 4ENJA 2MLGA 1F1ZA 1MJ9A 3HRMA 2BGCA 2CG4A 4RAYA 1U6GA 2Z99A 2XAGA 3GWZA 2GAUA 3FMQA 3ML6A 3M1EA 3LSTA 4WK8F 4G7HF 1TW3A 1USTA 1FNNA 2J5PA 1J5YA 4S05A 4LLGF 2IW5A 1YYVA 2RGVA 1QGPA 2ELHA 1HKTA 1X3UA 1B9NA 1WI9A 4LMYA 2EFNA 1ZRDA 5DEQA 3U2RA 4BHPA 1YLFA 4I98B 3FHZA 1F4KA 2QQAA 4YIIA 3MCZA 2A6EF 4ZZDA 5FD6A 5ILVA 4EV0A 2Y0MA 5TJJA 1CF7B 4RGRA 4L9VA 3E5QA 3ABUA 3DF8A 4IPAA 2O03A 1TTYA 3VFZA 4HX7A 3HRUA 3C3WA 2XKOA 1TW2A 4ON0A 2DO7A 4KT5C 5ICGA 5EEGA 1RNLA 2BEOA 4MEYF 3QU3A 1H9TA 1ZRFA 1OYIA 2WTEA 5ED4A 2X4HA 1SD4A 1HW5A 1BC7C 2P6TA 1R36A 4K2EA 1REPC 1GVJA 3Q9VA 2EJRA 1XSVA 3F72A 2HKOA 3LA3A 1AOYA 3WG9A 3RTRA 2FF4A 4HX4A 5E20A 1R5GA 4PDKA 1QBJA 2HR3A 2A68F 4HF2A 5FGMA 2QBYA 4WXDA 3ZP5A 1W7PD 3F6OA 3M9AA 1RUNA 1J59A 1SMTA 1U3EM 2VOOA 3E19A 4AIKA 1KU9A 1J0RA 2WV0A 3EETA 1AWCA 1OKRA 2EA2A 3BZ6A 1W7PA 4M72A 3GFIA 1SD5A 2KKOA 1PDNC 3E3VA 5IT9Z 5D5VB 3N4MA 2BE5F 3BJ6A 2XASA 4LD5A 4WWCA 4EM2A 3TOAA 3G3ZA 4CGZA 2E7WA 2W84A 4A12A 1HBXG 3S2WA 1VTNC 4BHBA 2K02A 1JXSA 2FA5A 3KETA 2KIMA 1G3TA 2H6CA 2MD5A 2OBPA 4IRGA 3DQVC 2W24A 1I1GA 1FOKA 5D4SA 4IHSA 4QWQA 2QM3A 1I1SA 5L3EA 4GGGA 1CF7A 4ESBA 4WXCA 1BBYA 2PMUA 3I71A 2D45A 1BM9A 3U9GA 3K2ZA 2JRTA 3QP5A 4XLPF 3KCCA 1ZG5A 2P5KA 5ICFA 5DD4A 4YFNF 3JAMZ 5LHIA 4R79A 4XSXF 4NB5A 2VODA 5H6QA 3IWZA 1G6NA 3V8KA 3QRFF 5FO5A 3NEUA 1TBXA 3I64A 2UWMA 3GFJA 2NRAC 1I27A 5K5RA 1IN8A 2MA3A 2NNYA 3BPXA 2PQ8A 3IWFA 4M9ZA 4P55A 1SD7A 3LA7A 4LK0F 4G6DA 3WODF 2YSRA 4F7ZA 3E5UA 3HOTA 1WRJA 2CSOA 4RGSA 2HTJA 3KLNA 4FX4A 3RI4A 1K79A 4Y17A 4KNYA 2QBYB 3VOEA 1BJAA 3FM3A 4YFXF 4EVIA 1LNWA 2ISYA 1ZG3A 4RGUA 3AAFA 4A0XA 1F5TA 1KU7A 2V79A 4I2OA 2QWWA 4UV8A 2DAOA 1J7KA 3HUGA 1JE8A 1ZGAA 3NQOA 1J2XA 4HQEA 2CQKA 2F5DA 4HV5A 3H3UA 3SQNA 4FT8A 5E17F 3KP2A 1Z05A 3JAMK 5D4RA 4PCQA 1ON2A 1YW9A 3B73A 3QAHA 2FMYA 1IRFA 3BDDA 4D0PA 3ISPA 4IRIA 1KQ8A 4OMZA 2K7LA 2VE8A 1QO0D 3VODA 1XB4A 3IC7A 3R6SA 3WTWC 2XRNA 1U2WA 2OD5A 1IRGA 4PGHA 1IW7F 2E1NA 3DEUA 3K1PA 2VC0A 2FSWA 1ONVA 2HWVA 3Q9SA 2FEZA 4L9TA 1FC3A 4BHCA 5BOXA 1R1VA 4UHTA 2DTRA 2QYOA 3O6BB 2K4JA 3D5LA 1RIOH 2P8TA 1Z91A 1UCRA 2ZKZA 5A2QZ 4R8HA 3CUQA 4B09A 2GA1A 2V1UA 2YU3A 1XN7A 1LDDA 3HRTA 4L9JA 1IN4A 5TRDA 1YS6A 3E6DA 1GXQA 2VXZA 3K69A 5HVQC 4RB1A 2LX9A 4ZH4F 3D0SA 2P5LC 2ZMEB 3EQLF 2MLKA 3G73A 3WTTC 3CTAA 5D6EA 2CO5A 1FYKA 2V1DA 3V7SA 4EGZA 3ZMSA 3HSFA 4HF0A 5E18F 1ZAOA 3R4KA 3IRRA 2C6YA 2FNPA 3IRQA 3QP6A 3BJAA 2ISZA 4HDVA 1LJ9A 2KRFA 1XGNA 3F3XA 2L02A 2OZ6A 2XAJA 3U1DA 1R1UA 3HYIA 1P6RA 2QQBA 2V9VA 1K6OA 2HQNA 4UV9A 3KLOA 4M71A 4KMUX 1H0MA 1KYZA 4H0EA 2HDCA 2PG4A 4RB2C 3CDHA 2A07F 2LNBA 2ESNA 4LFUA 5CLSA 2XAQA 2JPBA 3C1DA 2HOEA 3CUOA 3GW2A 5AIQA 1KGSA 2IRFG 3ELKA 2XGXA 2VBXA 3GZ5A 2HFHA 3ECHA 1V4RA 2FBHA 1K78B 3J7AO 3I54A 4HYEA 3MHXA 4ESFA 5F6FA 3HOSA 4GYIA 4ASNA 4P9FA 1P4WA 5FFXA 5E1WA 3RYRA 2ZNZA 3W6KB 3I53A 3LWFA 3ZMUA 2H27A 1ZLJA 3O3KA 3ZN0A 1KU3A 4EQQA 1O3SA 4XBFA 3F8BA 2R7DA 6PAXA 1DDNA 3M8FA 3J81K 4CZZA 2DQLA 4MTDA 5DDGA 1TQIA 3K1NA 4OU0A 1ZARA 1MD0A 2PN6A 2VN2A 2ACJA 1ZH5A 1MDMB 4ENMA 2XIGA 5ILUA 1HW1A 2PMHA 4ZYEA 2KIFA 2OAZA 2H94A 1T38A 4XSZF 2YPRA 3GX4X 1G3YA 2HGCA 2G7HA 1XMAA 4MGRA 3ZMVA 2UXNA 4BH9A 1ZGJA 4UXNA 5DYMA 1JHFA 3V8LA 1YIOA 2A3SA 4LG0A 4R1HA 5LRRA 4IF4A 2QUFA 4ZYGA 1R23A 2W85A 4MQVA 5ILSA 1FBQA 2Y75A 1T98A 4M73A 3QU6A 3L2CA 2ETHA 2STWA 1QNTA 3QPHA 5K5OA 5CVRA 4WCGA 2O61A 3I4PA 2J5OA 1RUOA 2VT2A 5LHHA 2CWEA 1O7LA 3N97A 1D8JA 1FZPB 2K4YA 1CGPA 2M30A 4MNUA 2B0LA 3MAJA 3TO7A 1YQAA 2R7FA 4KN7X 4OMYA 4ENNA 4A0ZA 1P92A 3I5UA 2M5WA 4KUMA 5ERIA 1J9IA 2ZO4A 3T8RA 5ICCA 4QLCU 1E2XA 3FWEA 1K78A 3H3ZA 1JHHA 1HKSA 4HAMA 1FBSA 2FBIA 4A6EA 2H6BA 2P7VB 2AS5F 1O7FA 1Q1HA 2DU9A 3V8JA 4UNOA 2EFOA 1BC8C 4Q48A 1Z6RA 1B9MA 3T8TA 3CO6C 1U5TC 2L54A 4ETSA 5HLIA 4WX9A 3F8NA 2GZWA 2HS5A 2M87A 4G7OF 5K1YA 2QLZA 3P9CA 2Q2EA 1GXPA 1B6AA 3V7CA 2O6GE 5LRSA 3T1BA 1IXCA 3KP7A 2MH2A 2K86A 4WF2A 3HTSB 3FXRA 4EJTA 4JBAA 5L3FA 3M8EA 3R61A 1LQ1A 2HZTA 2Q0OA 3EYYA 2IA2A 4O6JA 1MDMA 1C0WA 5LGTA 4UVAA 2FU4A 5LGUA 5DUIA 5HDKA 1TNTA 2GXBA 4NHJA 2VE9A 3ZN1A 2RV8A 4RGXA 3LAJA 1P4AA 2LSOA 5AONA 2FE3A 4CXFA 3TO9A 2VONA 1BI2A 4G8XA 3MWMA 1U5TB 1IN7A 4LG0B 1FLIA 3JSPA 2W57A 1HSTA 1S7AA 2E1CA 5E8GA 2NS0A 4GXOA 1MKMA 4B8XA 4XLNF 5JHUA 3GZ6A 2FOKA 4AD9A 1T6SA 4IRHA 3GXOA 5HLGA 2EK5A 4OIRF 1STZA 1ZHFA 1SFEA 4HBLA 3KP4A 3PQJA 4MTEA 3DP7A 3F8MA 2EA4A 5E8IA 2RKHA 3EDPA 1XSXA 1HXDA 4EMSA 1XCBA 1IXSB 1O57A 4CICA 1MJAA 5E1ZB 1FBUA 1L0OC 1HQCA 3RYPA 2A61A 3HIFA 2ESHA 4I02A 5DD8A 2VC1A 4KMFA 4N9HA 3E6BA 5EEHA 3KFWX 5FLXZ 3JW4A 4GCVA 2R3SA 3C18A 3ULQB 1Z9CA 1IAWA 3KEOA 3COAC 3RPUA 3WE2A 5H20A 3ZMTA 3I58A 3IL2A 4RS8A 3CUQB 4A0YA 1XCVA 3L09A 4HF1A 3WTXC 1Z7UA 4LJZF 3KE2A 2DQRA 2AXLA 4KFCA 3GFMA 3Q5FA 4OIQF 4AIJA 2D2WA 2ZNYA 5IT9K 1OPCA 1XGOA 1R00A 3EUHA 2EB7A 1Z6TA 2GCXA 2P5VA 5D8KB 2V6CA 3FZVA 5BPDA 4UVBA 2XKPA 3QOPA 4P5OA 4ZZLA 1FWZA 3BWGA 3K9TA 2Z3YA 2HEOA 1YO5C 2FNAA 3RKXA 4G9YA 4DNCA 2H09A 1BYMA 3CO7C 2IA0A 1ZRCA 4L18B 1SFXA 4EJWA 3GF2A 3BY6A 1U78A 1WQ2A 3DPTA 3KZYA 2PFBA 5K5QA 3MEXA 4MEXF 3W6JB 3F21A 4G7ZF 4CYDA 3HRSA 1KQ0A 1QVPA 4NQWA 1G4DA 4AIHA 2ADUA 4HW0A 1PP8F 3WGHA 4JK1X 1YW8A 2JPCA 5F64A 2PLYA 2BYVE 3F23A 3TQNA 2IVMA 2HTSA 3ZPLA 1P2FA 3F8FA 2M45A 5JFRA 3WTYC 3R60A 1BI0A 5LGNA 4Q47A 2VOPA 1OMIA 2DLLA 1ON1A 1USSA 2STTA 2DK5A 4I0AA 1WWXA 3P7NA 2WWYA 2DW4A 5J6XA 4KIBA 1ZLKA 4EM0B 5CVUA 5CJ9A 3FX3A 3DPLC 4LB5A 1YS7A 2K5FA 2EFWA 2X0LA 1DUXC 4U0VA 3KP5A 4M9XA 1OYYA 5HS7A 3E97A 4P96A 2DI3A 2RVCA 1FY7A 1H9GA 2QENA 3MQ0A 1KU2A 1FYLA 3RDIA 2TDXA 2F5EA 3HTUA 4ESJA 4HDUA 2BBYA 4IXAA 1D5VA 1S7OA 2VBYA 2RC4A 1R58A 2OQGA 3BPVA 1EH7A 1Z1DA 4OIOF 1ZN2A 3V7RA 1S3JA 2IP2A 5CYVA 4YFKF 5E1XA 2YX7A 3FXUA 3L9FA 2FXAA 4KIFA 3HHHA 3HSEA 5JR3A 4RAZA 1YFHA 5DCMA 3ECOA 4EJOA 3SZPA 2JT1A 2NYXA 4S04A 1RI7A 2K27A 2XAFA 4OINF 3R0JA 1U5TA 2HYGD 3FXQA 1QQIA 4U7DA 1SAXA 2XAHA 2KJBA 1XGSA 3HHGA 3MFKA 2UZKA 4M6XA 1IN5A 1T0FA 3CUQC 5FLXK 2K5LA 2HYFA 3C7JA 1S8NA 2QQ9A 4A5MA 5L3BA 1EH8A 1S29A 1FYMA 5BQTA 2G9WA 3IKTA 3WTUC 1TQPA 2IA1A 1HSJA 1L3LA 4I7HA 2RN7A 4HOBA 4U0WA 2FRHA 4P9UA 1R7JA 1IF1A 4I09A 3R0AA 1KYWA 5JVTA 1FPQA 5CVIA 3QPTA 1D8KA 1R5HA 3IHUA 5DCFA 4OOIA 2YR2A 5A2QK 5HS9A 2FQ3A 3TDUC 2JSCA 2CGPA 2DPDA 2GIVA 3WGIA 1MJBA 4BXUA 3TKYA 5J8FA 2A69F 2LKPA 2OQRA 3H92A 3V4GA 5D5UB 3SHFA 2D1HA 3HSRA 4RB0A 1K7AA 1ODDA 3I59B 3WTSC 3WU0A 2KJCA 1QPMA 4MQ9F 1XDSA 4LLLA 1A04A 3DFGA 4KDPA 1O3TA 2P4WA 3VB2A 1R1TA 2HQRA 1ZG1A 1UB9A 3EYIA 2GQQA 5FB2A 4MHGA 2PBIA 1LB2A 3JSOA 1BI3A 3O2PE 1NHAA 1ZREA 2D1VA 5FFZA 2VBWA 2DBBA 4EJUA 3J80Z 4O3MA 3DXJF 1KA8A 3MZHA 1IXRC 4G6QA 4O5VA 3P9IA 4AVPA 3DV8A 2IPQX 1QZZA 3OV8A 4L0ZB 4Y15A 4IJAA 1XMKA 3TO6A 3LQQA 3T5XA 2MH9A 4KIGA 3ZMZA 1B1BA 2P7CB 2W25A 1I6XA 3RIRA 2ZCWA 2RQPA 4A5NA 4EM1A 4HV6A 2COMA 2F5FA 2DK8A 1OYWA 2M8EA 1RZ4A 4HLYA 5L3DA 4G94A 3GFLA 1BIBA 5DV5A 1T2KA 3JTGA 2FMLA 2L4AA 2L3DA 4FX0A 2H3JA 5JI6A 1TQMA 4U0YA 1S6LA 2RDPA 4LLNA 1DPRA 2JTVA 3LFKA 4KICA 4FHTA 1YW7A 2OU2A 4UVCA 2CFXA 5CVVA 3JTHA 1O3QA 1J75A 4LB6B 3VEPA 4GO1A 3J80K 4KN4X 3LAPA 1PP7U 3GVAA 3K1MA 1LVAA 3GEZA 3B02A 2QZ8A 4HLXA 1DP7P 3KP6A 4A6DA 2GWRA 2ZJ2A 1HKQA 2L01A 2EWNA 2ZXJA 4N9IA 1D3YA 1B59A 2OZUA 3GYHX 2M1BA 2K4BA 3FMSA 2YX4A 5BMZA 1Y0UA 1W4MA 2Z9OA 2DT5A 1LEAA 4IHTA 1FSHA 2V1XA 3WGGA 5LBQA 1T39A 2Z33A 1FSEA 2E7XA 4M6YA 5J8CA 3LQRA 1UHWA 3FMRA 3F6VA 3TGNA 3I59A
chains in the Genus database with same CATH superfamily
2XUBA 3K4BA 3RJPA 1BIAA 3DWLE 5M9OA 5ICEA 1SFUA 2DRKA 1QZYA 1SRLA 1K73C 2TCTA 4J00A 1PVEA 2EFPA 2G6FX 2WB1N 4RMNA 4E70A 5KCHA 2Z16A 5DCMB 2NUPA 1FX7A 4F14A 5DUKA 5BS6A 1Q86C 3MZYA 1EV7A 2PNIA 4U88A 1SMYF 1TXQA 3H6ZA 1K4US 3CD6Q 2FBKA 2K7AA 4J6YA 3MKZA 3SXYA 2DA1A 2ZJRF 4KA4A 3HL8A 1DPUA 1W5SA 5LLQA 3CC7A 5EF6A 4AG2C 4CO8A 2CQ7A 5FD5A 2E60A 4RB3C 4OWRB 2V26A 3Q1JA 4WXHA 4LGWA 4RLFA 5F08A 1VQMI 2JOYA 4I0BA 4KGZB 4C5EA 3W3CA 3CCLI 5GP9A 3CCJI 1MSEC 3H9JA 3BOQA 2A5YB 2BUDA 2QTXA 3CCEA 4CCOA 1S1NA 1FIAA 2UV1A 1OR7A 3EG0A 4LD9K 1E17A 1W7PB 2X3XD 4QQDA 3CCRT 3PQKA 2XHKA 1ZSGA 1VQ8I 1IO6A 4RTXA 1TH7A 1VZ0A 5KK1A 3EG3A 5CQGA 5EDNA 3GTQJ 2L3SA 1TWAJ 4RMOA 2MBFA 4HZFA 1UHMA 3BR2A 1ULYA 1UFFA 3CCLA 1R9TJ 3FXJA 3L7WA 3H1CA 1WKMA 1NPPA 2HDAA 2Q8KA 2V7FA 2ZB9A 3IH2A 4A53A 1YG2A 4Q5SF 2MSYA 4M9SA 2G3RA 3J81Z 1XSDA 4M77E 1LKXA 3BROA 3I0TA 2UUZA 3CCST 1N8RR 2K79A 1OEBA 1RI0A 1IJWC 1UG1A 3AHUA 2COYA 2DOEA 2CUJA 3NFCA 3K2AA 4L0YB 3RDVA 2LRDA 2L3RA 5BPIA 1R0CB 5EYRA 4GY5A 2DFIA 1BBZA 3FLGA 3GUDA 2ZPGB 4N0AA 1TS9A 2D0NA 1K9MC 4NS5A 2LVSA 3ZMDA 4CHUA 4IIOA 1M1EB 1MMSA 2ZBKA 2F2WA 3GLLA 2YRDA 2QKLB 2HDDA 1W0TA 4XN0A 2J05A 3ASKA 3WTVC 4HQMA 1MH4A 1QRYA 3VYSB 2HQAA 1F9NA 4HNVA 2PJRA 2HSPA 2KIUA 1T8IA 2JJ9A 2LF8A 3RPQA 4BAYA 3J7AY 3S1NJ 2K5IA 5D6YA 1NJIU 3SZTA 1LDJA 2XROA 1FP1D 2Y48A 3ZQGA 5EEAA 3C0CA 1UFMA 2H1LA 2R7VA 3KP3A 2NUTB 1IO2A 4IUVA 1VQLA 3S3MA 2DFEA 4QT7A 3PNVA 3CCUQ 1G3WA 2RNJA 3G4SI 1OCCH 3H0HA 4C92A 4EEFG 2DX1A 1O3RA 1KD1U 5AIPA 2X1EA 4LXCA 4Y91A 1ZTRA 5LEKA 1RR8C 3CC4I 2UXXA 2F2EA 4JQFA 4IHXA 3BJOA 1M30A 3FJ5A 3EGDA 4K11A 3J81E 4HA8A 2HL5C 1O75A 1W1WE 2IJLA 4OGEA 1IN6A 4PJOE 2DOFA 3FF5A 4E6KG 4AWXB 4XTYA 2CP2A 2KQWA 1YIJA 3DCFA 2PJPA 3LYIA 1VI0A 4OVAA 4C0DC 4Z2YA 3NGPA 2I2LA 1OZ3A 4C2UA 2E10A 2ZPFB 2O3FA 2EV6A 4FISA 1BOAA 2DPPB 2YSQA 1MNDA 2FD5A 3KBGA 4BUGA 2IT0A 4C2MJ 5J3LA 1M5Q1 2LF7A 2A6HF 2Y0SA 3LA2A 1S72I 1V54H 1V3FA 3JRCA 1BN5A 1TLHB 2PI0A 3H3VK 1U9OA 1LEBA 5HDGA 3F22A 3DLAA 2L7MP 3FBNB 1BI1A 2MGQA 2R7RA 1YTYA 2FPEA 4C8QA 1B34A 1N27A 1QW1A 4TV7A 3CJNA 4PFOA 2LKXA 2XG8D 3M0UA 1I5ZA 2YHTA 2ECCA 2KROA 2DL8A 2EV5A 2K2VA 3WE3A 2W4SA 2RHIA 3DKWA 4EJVA 4A3GJ 2NNNA 2L4MA 4F55A 3KZZA 3NWTA 2ZCFB 3WU1B 3L00A 1XD7A 2EJ9A 3SEMA 1A0NB 4LK1F 1YITQ 4XK4A 4BY7J 2I5UA 3JR9A 4N4GA 4CUGA 2KYMA 2Z5UA 5HDNA 2QI2A 1MBGA 2EV0A 1WSUA 2Z0WA 2EZHA 3HPHA 4JDSA 1MMAA 1PUEE 5KNLA 1W5TA 3W6VA 4OIPF 2MI6A 2X4XA 4M7DC 4M74A 5IT3A 4XLFA 6AT1B 2RQRA 3TP0A 4ZYHA 3ROUA 2IBDA 5D5XB 4I6ZA 2CQNA 2ZMEA 4DYCA 1HK9A 3ERED 2KNBB 4PJOC 1Q81C 1NEBA 3CLOA 4C0DB 2CMPA 4XU3A 1RETA 3R6OA 5TGTA 1NG6A 4N0BA 5CKDA 4HX8A 2EFQA 1VQOI 2DL4A 5F1RA 2XVCA 4JJNK 1M8VA 2EPDA 4XLEA 2LDUA 4HVWA 2ID3A 2EGEA 2BIVA 1W2BA 2IIMA 1PHTA 2CU7A 4L5IA 2XICA 2YDLA 3FRNA 5H2FC 1G3SA 2O0YA 2XK0A 4Y13A 5E3OA 4ZN1A 3VS2A 3LWHA 1DQUA 4MZMA 1Y0MA 3ZGKA 2BV6A 1YJNA 2JZYA 2ZFWA 3WXMB 4AFQC 3SFIA 4A3KJ 5L3CA 1SEMA 2LREA 5LEJA 1AT1B 1YJNQ 2MYSA 5A0DA 3OYIA 1WLPB 1CKAA 1MZBA 4BJTA 5FKNA 4YG2F 4IHWA 3A5ZB 1Q81U 4ZYDA 4PZJA 2YUOA 1VQ7I 3MZ8A 1SPKA 3REOA 3RZOJ 2Q2EB 3JRFA 1U8RA 4XKWA 3CC2I 1IUYA 2L0KA 1M2OA 1OX9A 4CCNA 2M16A 4DGWB 2NWMA 5KYWA 2D8HA 3G7ZA 3FXOA 3MKYB 3BR6A 1PUFA 2JUCA 1B4AA 2R7SA 2IS1A 3NRVA 1Q86R 2VI6A 1R22A 1IHVA 5CVJA 1M90R 2R93J 2CP3A 3VWBA 1BR4A 2ZMEC 1SKUB 3SFZA 2EYQA 5GAMf 1XMXA 5KVRA 2RN8A 2CYYA 3FHNA 3UDCA 4F7UG 1GBRA 2HKXA 3AG4H 3BQYA 3DPUA 1QQJA 4IUPA 1VQ9A 1VQ6Q 4Q4ZF 2NAZA 4YIRX 2O8XA 3L1AA 5IXFA 3OYFA 1VQKI 1H641 3VS7A 5D8LB 4N4NB 1EH6A 4BQNA 1RADB 2KRNA 3BG5A 1V76A 2A3LA 2VBZA 3LH5A 4BD3A 4A4FA 2VKDA 4X1EA 5B66C 4RM3A 2JVHA 4BDZA 2BTTA 1AWOA 2QVOA 4FT4A 1IB8A 1WJEA 1VA7A 3RMSA 2NS7A 4YIFA 3TOBA 1GCQA 3CCUA 3OWTA 1R49A 3EFOA 1FTZA 4OMLA 1N78A 3CCSA 1XGMA 3G6EQ 5E79C 1GHCA 4L9NA 4J9FA 4L5JA 2PEXA 2NOGA 4GYGA 1WHMA 4KT0E 3OS0A 2XF7A 2OA4A 3OOPA 1JT6A 2KZGA 3NHNA 1KQ9A 1KD1R 2HXIA 4Z8AA 3EPZA 4A3EJ 4JRPA 3RKYA 4ENKA 4HRIA 2WC2A 3M7GA 4XRFA 1C6VX 1JGSA 2CW0F 2M7AA 2JTFA 3KEQA 3ZQ7A 3OOUA 1LDKB 4A3IJ 3VYGA 4C8QF 5DS9A 5I21A 2RJCA 2LBFB 4BNCA 3JRAA 1QMCA 4NC7A 4II3A 3S1RJ 5B1AH 1TNSA 1K4SA 1QVGA 2P4TA 1RAHB 4UB6C 4AIDA 3DKXA 4DIQA 2AQFA 2G7UA 3A0BC 4DQ2A 2DJQA 4I01A 1IZ1A 5GAOl 3WTZA 2QKMB 2DXUA 2W1OA 1ZKGA 3DTKA 3ERMA 3ZXSA 2GXAA 1X6BA 5GMKm 3E5XA 2XV4S 5IHKA 3A2KA 3CCSI 2OTLA 1NG7A 2EILH 2KPMA 1UEBA 4U7BA 2CREA 2JXBA 1ZSZB 3M4GA 3BY7A 1SRMA 4P5NA 5HK3A 1P4XA 1IDYA 1MHNA 3ASNH 2VC8A 3K70D 3ABTA 3SD4A 5LHGA 4M7AF 5D5WB 1P9QC 1W6XA 4AU7A 1GBQA 2DDBA 2DPUA 2JRMA 2RK1A 2V1QA 2YLCA 3EUHC 3QO3A 1WZOA 3RBBB 3CCRQ 2L5QA 4IVNA 4A2UA 4BYYA 4BBSJ 3BG6A 2VT3A 3CMAA 1I0CA 2F5VA 2V8KA 2VXFA 1KHIA 1XNIA 5L3GA 2RI2A 4LDUA 5IXBA 3VSKA 3OSVA 1YOVB 5CR2A 1PKTA 3EUKL 2GXGA 2AKLA 3CCQT 3LSMA 1ABQA 1X1PA 5DLQE 2RJEA 4C8QB 2GA2A 3CCET 2NXNB 5HLHA 3JREA 4UUVA 3TL4X 3VUZA 3FM5A 1XDUA 2DT7B 2CH4W 3PNTA 3JB9I 1UGRB 2X51A 3T0YA 1ZLMA 4Y92A 1UJYA 1K9MU 2F5CA 4XOTA 5HS8A 2MC3A 4JRIA 3TDZC 3LH0A 4KBMB 2CJJA 3G2BA 1YJWA 2CH4A 4XTWA 4QPOA 1FT9A 1Q86U 1HW2A 1YWPA 3RQIA 1ZYRF 2MAMA 4JPBW 4HSTA 3PIPA 3TSZA 5H6RA 4CCKA 2JA5J 3BE3A 2A6TA 1N25A 4BQAA 4BI4A 1Q82R 1FP2A 1ZHIA 3JB9H 2JWTA 2X9DA 3H9NA 5IT9E 2E5ZA 5HOOA 5FWCA 4D8DA 5LJ5d 4KYWA 1WFWA 4LUDA 1ZUUA 3H0IA 1QP3A 2WB1A 4RBOA 2XSDC 3OS2A 1K76A 3OBYA 2NVTJ 3P9KA 2WBMA 3BP8A 3G71A 1S72T 1MGTA 2PVOB 2C0IA 4E4HA 4EGYA 3IKVA 1X2KA 1XTAA 1XC5A 1KQSP 2DFHA 2R4GA 4G6TB 3GTPJ 2EGCA 4V2GA 3PFIA 2P0KA 1OR7C 4V2FA 4DBRA 3BDUA 1QKXA 3A8LB 3CC2T 4PGGA 1S9HA 1B72B 3QPSA 1RACB 4CDGA 1UUEA 4DEYA 5D6FA 2P6SA 4FL6A 3RKWA 4RTYA 3CMET 1KC8C 2VXDA 3HGGA 3JRDA 3GO5A 3HOXJ 1E6GA 3F8CA 2ENMA 1TUCA 3K0LA 2KXDA 4OMQA 1VQ7T 3JB9F 3GLXA 5FKLA 1SD6A 2GIZA 4CYCB 4DYRA 3E6CC 3E6MA 2KDOA 1VIEA 3SFMA 3A0HC 4ENJA 4XTZA 2MLGA 1F1ZA 3H0DA 5IP7J 1FOYA 1G83A 1MJ9A 1FOXA 3HRMA 2K9QA 1AWWA 1V55H 2BGCA 2JA8J 2CG4A 4RAYA 3VS1A 5GAMg 1U6GA 2Z99A 2XAGA 2X6XA 3GWZA 2GAUA 4PJLA 3FMQA 1LPQA 3ML6A 1X1DA 3M1EA 4HEA2 4Z6YA 2DODA 3LSTA 2ROTA 2EAYA 3QDFA 4WK8F 4G7HF 3QWXX 1R77A 1TW3A 4DOVA 2O88A 4D5CA 2RQVA 2HQ5A 1FMVA 1USTA 1FNNA 2GOMA 1B8IA 2J5PA 1J5YA 2E2JJ 2HD0A 3A01B 2NUZA 2K9MA 1NH3A 4S05A 5IYCJ 4LLGF 2KMTA 5JHFA 2LCLA 3RPUD 2IW5A 1PC0A 2W10A 3TSWA 4A4HA 1VQOT 3CMEI 4RM2A 1AD5A 4M75G 5LD2C 1YYVA 1Y56A 2RGVA 4V2SA 4MDWA 1QGPA 2ELHA 1HKTA 1X3UA 1B9NA 3CXCS 2ZXIA 1OX8A 4FTHA 1WI9A 3A8MB 1ORKA 2V8IA 4LMYA 2L8DA 2XHCA 4EMKB 1YNZA 3H36A 1PM3A 1TWHJ 2GOXB 2EFNA 3CMAI 3CCQA 1ZRDA 5DEQA 4DZPA 3NTKA 3C4SA 3M58A 4JLGA 2LC4A 3U2RA 3ZBDA 4C8QC 1MMDA 3A4CA 3LWIA 3HOZJ 4QPQA 4BHPA 1SHGA 1YLFA 2IGMA 4I98B 3SYTA 3FHZA 4AUXA 2HU9A 1F4KA 5IHIA 2EGAA 2EIFA 1YHQQ 2QQAA 1QWFA 3CC4T 4YIIA 2JVVA 3MCZA 2A6EF 5KCMA 2DMUA 2R5YA 2JNGA 2XPVA 2CRGA 4ZZDA 5FD6A 4GDFA 4IUQA 4OB3B 3WVEB 5ILVA 2J6FA 4EV0A 2Y0MA 5TJJA 3U21A 1CF7B 5HK0A 1YITA 4RGRA 4L9VA 3E5QA 4EATA 1MV0B 3ABUA 2DTZA 3AFHA 2O03A 1TTYA 3DF8A 4IPAA 3VFZA 4HX7A 1VQ5I 4AM3A 1WNLA 2RI5A 1YHQT 4M77G 3HRUA 2AHJB 4XORA 1NJIR 2JA6J 4FM4B 3C3WA 2XKOA 1TW2A 4D6WA 4ON0A 4RCCA 4IQ4A 3LSPA 1NE8A 3HJEA 1F36A 2DO7A 4XL9A 5GTHC 3G4SA 4KT5C 2K57A 2WY8Q 2KFDA 2QAZA 2Y4XA 5ICGA 3BTJA 2Y90A 5EEGA 3MP8A 1RNLA 2DMTA 2D8JA 2BEOA 1RPWA 3ZQHA 1B3QA 2PZ1A 3QQAA 1IGNA 2QEXA 1X1AA 4MEYF 3M53A 4KH0B 3QU3A 3BTLA 3CCVI 2E71A 3Q0WA 1MIJA 1H9TA 2ZXWH 1ZRFA 3M4OJ 1OYIA 2L7ZA 2WTEA 5ED4A 1Y07A 2X4HA 1JT0A 2CDTA 1VQ7A 4AT1B 2LC2A 2KT1A 1X3WB 4PJJA 1RAEB 5KE2A 5GAOn 1SD4A 2DJIA 5LJ5g 3JRIA 1HW5A 1BC7C 2P6TA 1R36A 1VQMQ 2E2HJ 4M77F 3EGXB 1FXXA 4K2EA 1UHSA 4BGDA 1REPC 1GVJA 2DKGA 1E3OC 1ZGWA 4HCBA 4F16A 3Q9VA 2L89A 4BACA 2EJRA 3P5JA 1EZZB 1XSVA 3CP2A 4C92G 3OW2P 3BR0A 3JCUC 1W2BP 5J26A 3F72A 2LT1A 1ZSZA 4IL6C 2IAIA 2HKOA 5FU6C 1G8XA 1QCFA 3WG7H 3LA3A 2QEXI 1AOYA 3N5BB 3WG9A 1ETQA 2VQLA 4XLAA 3ZQCA 3K4CA 4Z88A 4YTLA 3JCMd 1TOVA 3PVQA 3RTRA 3VJPA 2FF4A 4HX4A 2RB6A 5J39A 1K0XA 1OOTA 5GAN6 1YJ9Q 1JKRC 1R0BG 3H0GJ 3CQZJ 1I3QJ 1NK3P 5E20A 2QSFX 3A01A 3HUGB 4IKFA 3M9QA 1JKPC 2JSPA 1R5GA 4ZDLA 4PDKA 1QBJA 2HR3A 4BUPA 1I8FA 2A68F 1HDDC 4CI0C 1QVGP 1RLPC 5KYYA 3K7AJ 1H89C 4HF2A 4FU6A 4JYKA 3RCOA 4AFSC 2QA4A 2L0AA 2R7OA 4KULA 2FYKA 1WJBA 2F48A 5LJ5e 5FGMA 1YX5A 3UT1A 5GAMd 2QBYA 4EMKA 3OYHA 5FJ8J 4WXDA 2G0EA 3MKWB 1W7PD 3ZP5A 2EBPA 3F6OA 5FW9A 2OTJT 3M9AA 1LNXA 4A3FJ 1RUNA 1J59A 1SSFA 3HOYJ 2CZ7B 2KYBA 1SMTA 1U3EM 2DVJA 1RKWA 3QYFA 2VOOA 1YE9A 3SDBA 9ANTA 3JCMJ 3E19A 3DBRB 2EKOA 2F2VA 2RNGA 2VUBA 2O2OA 1UHCA 4AIKA 3P8DA 4JLIA 1KU9A 1J0RA 1MBHA 2WV0A 1EA3A 2L3PA 4X34A 1Y96B 1T0HA 3EETA 1AWCA 1NZ9A 1ZELA 2XDDA 1OKRA 2HPMA 2EA2A 2PVGB 3BZ6A 1OULA 2R5ZA 2FEIA 1W7PA 3EH2A 4M72A 1EX4A 1PNJA 1QLYA 2YUPA 4DOWA 3THKA 2AQEA 3GFIA 1SD5A 2GFAA 1YI2Q 5M5XJ 2RO0A 2KKOA 4A3LJ 1PDNC 2HSEB 3E3VA 5IT9Z 3MD2A 3ME9A 1HF0A 3FDYA 1Q1VA 1UMQA 5D5VB 3F0CA 3LL7A 3E9GA 4QW2A 3PNWC 5IPAA 2F5KA 3PSIA 4KT6A 1WXUA 1M8MA 3N4MA 3J7ZI 1OQYA 2BE5F 1CQTA 3MP6A 5KYUA 4ANJA 5GANe 3BJ6A 1MUZA 1ERDA 4Y28E 1I81A 1VQNI 3CDIA 2XASA 2DL3A 2DZ9A 1KG1A 1VQ8Q 4LD5A 4PNOA 4WWCA 4LDWA 1DGRM 4IOCF 4EMHA 1X27A 4EM2A 3CJTB 1Q7YC 4PSWA 1DP3A 3TOAA 3D7SB 4II2A 4FQGA 4OF1A 4C5HA 3G3ZA 3BFMA 3EFOB 4PLLA 4CGZA 1XOVA 2E7WA 4M3EA 2RPNA 1JRIA 3S93A 2IEKA 1VQ8A 2W84A 4A12A 1HBXG 3S2WA 4OB0B 1VTNC 2YUQA 4XKCA 3OYYA 4BHBA 2QA4Q 5J3BA 2H3EB 3CDLA 3MMYB 1GFDA 2QCOA 1U9NA 1N8RU 1Y1VJ 1WHLA 1Z9QA 2K02A 2Y0SN 2RREA 1JXSA 5GAMj 2FA5A 3KETA 1JJ2S 1ETVA 2KIMA 2JW4A 4IHVA 2PMZA 3CCJQ 4XNFA 1G3TA 2H6CA 2MD5A 2OBPA 2XGDA 3DQVC 2W24A 1I1GA 4IRGA 3OYEA 1FOKA 5AT1B 5FLXE 5GAOp 5D4SA 2HAXA 2RM4A 3BG7A 4IIMA 4IHSA 3JB9D 4QWQA 2R5YB 2QM3A 2LJ1A 1I1SA 1X58A 1JJ6C 1A6QA 4UUSB 4N4IA 2BXYA 5L3EA 4OGCA 2E65A 1AZEA 2D9TA 3U23A 4GGGA 1CF7A 1ITYA 2EFIA 4ESBA 4WXCA 1X6OA 1SC7A 1PG5B 5A2QE 1BBYA 2E1MC 2PMUA 3I71A 2D45A 5KYXA 3PL8A 4PFPA 4FSXA 5C4XJ 3URGA 1BM9A 3U9GA 4F93B 1D5YA 2D6FA 3CD6T 3K2ZA 2JRTA 3QP5A 2VV5A 2VQCA 2CYZB 4XLPF 3ZRGA 3JSCA 3KCCA 1ZG5A 2P5KA 5ICFA 2WSFE 5DY9A 4KRTA 1ZA2B 4A54A 3PTAA 5DD4A 2ZSIB 3EUAA 3BR5A 3PM1A 4YFNF 3JAMZ 5LHIA 4R79A 1Q7YU 4RLQA 4XSXF 2DA4A 3CCQI 4E7KA 4BB7A 7AT1B 1KFZA 2NOJB 4M78D 4NB5A 1E0EA 2VODA 2VJIA 5FRMA 1IZ6A 3MEUA 2DAQA 2LYCA 2EQKA 4UC4A 5H6QA 2H1KA 5GAMe 1MSFC 4M78E 2MK5A 3TEDA 1UELB 2EZKA 3IWZA 2DA5A 1GCPA 3JCMQ 1G6NA 3O8VA 1YJWQ 1GVDA 3V8KA 2KXCA 2DBKA 1WHGA 3QRFF 2KAFA 3NPFA 2BHYA 3NEUA 5FO5A 4JS5A 1TBXA 3I64A 2UWMA 4M3DA 4C92B 2DIGA 2ESWA 2LMDA 2FUG2 3PUBA 2EYYA 2GNCA 2QSHX 3BTCA 1WJ5A 3GFJA 3A98A 1S72Q 1HDPA 2NRAC 3PFYA 1JB0E 1R4NB 3OIQA 1I27A 2EZIA 5E3NA 3OYMA 4A3MJ 1B8IB 4ELYC 5D7UA 5K5RA 1IN8A 1B07A 2MA3A 3MCAB 2NNYA 2Z2SB 3VRZA 3BPXA 4M7DE 4HCKA 2PQ8A 3IWFA 4M9ZA 3DTEA 3WU2C 1QP2A 1WXBA 2DFUA 4P55A 2YRCA 4FT2A 4YRVA 1WXTA 1SD7A 1FMKA 1VFCA 1V29B 2YUNA 3KYDB 3LA7A 4LK0F 1K73R 4I99C 1DJ7B 3X26B 1JGGA 1OCTC 2JM9A 3VS3A 4Z89A 2M9HA 3S17J 2FB7A 2Y9YA 1VQ9T 2GM4A 2LMJA 3S2HJ 4G6DA 3CXCA 3WODF 1K8AR 1VQOA 2XRLA 4OMNA 1VYUA 2P0PA 4J6XA 2DMQA 1OQKA 2M51A 2QASA 2IG0A 2YSRA 2DL5A 1ETOA 4F7ZA 3E5UA 3HOTA 2L2OA 2HNHA 1WRJA 2CSOA 4RGSA 1Y57A 5F0CA 2HTJA 2CV1A 1UECA 3TVTA 1I4K1 3I55T 2VJ4A 1UDLA 1BKBA 3QIIA 3KLNA 4FX4A 1G59A 3UATA 3A1YA 3RI4A 1K79A 1QVFP 2JT4A 3KEYA 2LQWA 4Y17A 4OB2B 5D6XA 4KNYA 4MFEA 5EC7A 5C4JJ 2QBYB 2X48A 2D5VA 1YWOA 1VQNA 3VOEA 3A8OB 4C8QD 1BJAA 3JCMe 3OSGA 3LLRA 1ETKA 1RKTA 1WJCA 1WPKA 3FM3A 4YFXF 2HQHA 4EVIA 2L3QA 3JRZA 5FKOA 2NUPB 4J9CA 1LNWA 1A6IA 2XD0A 2ISYA 1ZG3A 4RGUA 3AAFA 3EG1A 4A0XA 2DYIA 3TCJA 1WH5A 5HNHA 4ZJZA 1SVOA 1KU7A 3G1MA 2V79A 1F5TA 4I2OA 4J9DA 4XU2A 2EPFA 5HNFA 5J4YA 3PMTA 1J09A 2ME0A 3SWNA 4EPCA 2QA4T 1YIJT 3OYNA 4MZPA 4F17A 1PSEA 2QWWA 2LQ8A 4UV8A 1J7KA 2DAOA 3HUGA 1JE8A 4GFBA 1ZGAA 5B3SH 2BZYA 2M8GX 4CRIA 1YJ9A 1NYFA 3UWNA 3GTGJ 3NQOA 1J2XA 4HQEA 5CPRB 2CQKA 1JXOA 1PD0A 4XAXB 1VQMT 4UUSA 1ABOA 1UHFA 4PSXA 2F5DA 3N05A 4HV5A 4CZCA 1O9SA 3H3UA 1WCMJ 3KZIC 3SQNA 4BEHA 4J19A 2E41A 4FT8A 2W0ZA 1XG1A 2MD0A 5E17F 3EG2A 1YHQA 4FE7A 3KP2A 2CSIA 2VPLA 2R7XA 1Z05A 2CP0A 3JAMK 5D4RA 3CMAQ 2LY2A 1A35A 5CAIA 2RHUA 3BLYA 3OL4A 2PUOB 4L59A 4PCQA 3M0QA 3CCRI 2QYZA 1G2HA 1NLOC 3HOVJ 2O31A 1ON2A 3DLLA 1LE8B 1YW9A 1SHFA 3B73A 3QAHA 4JZ4A 4PL6A 2VKNA 2FMYA 1Z3XA 2Y69H 2PTKA 1IRFA 4W97A 3BDDA 3QYEA 4D0PA 1JUPA 4N0AC 3ISPA 4IRIA 1KQ8A 1AZGB 4OMZA 2KEAA 4M78G 2K7LA 2VE8A 4M77C 1QO0D 2MOXA 3VODA 4HXJA 2EJGA 1XB4A 3IC7A 4OAYA 1T56A 2EQMA 2XSJC 1SVLA 3R6SA 1X19A 3FEOA 2OJED 2YUSA 5F0HA 3DBHB 2XRNA 3WTWC 3I9V2 4XTXA 2ED0A 1U2WA 2JS0A 1VYTA 2OD5A 1IRGA 4PGHA 1OYXA 1IW7F 2E1NA 1JEGA 3DEUA 3K1PA 2O8KA 4PLIA 2BW3B 1VIFA 3O8HA 4HNTA 1AEYA 1QHGA 2F2XA 2O4XB 1M90C 2VC0A 3FKJA 4IUTA 5CK9A 2X4WA 2FQ4A 1EKEA 2FSWA 3I56I 1U1SA 3QXEB 4M75C 2NVQJ 1ONVA 1JKOC 3CC7T 2Q1ZB 2HWVA 1IG7A 2DD4A 4F7UE 3UKGA 4E47A 3KPHA 3Q9SA 4M7AB 2FEZA 1UG0A 2RD1A 4L9TA 2R5MA 2OTJA 4AYBA 3GTLJ 2LVMA 1FC3A 4BHCA 3EH1A 5I11A 1ZSZC 1ZUYA 3QWYA 5BOXA 2OJ2A 3S14J 1S7EA 1R1VA 3CBOA 3LSGA 1K8AC 4UHTA 3MEAA 3S3OA 3CP8A 3RQ4A 1M2VB 2DTRA 2QYOA 3OMYA 3QYBA 2Y31A 2R7UA 3PIPF 4M77A 4WCIA 1TWFJ 1VQ9I 3CCEI 4XN3A 2HDWA 3O6BB 1YIJI 3DKYA 2K4JA 2HOTA 1Z3YA 4BXXJ 4PFZA 1A36A 2K3BA 1RAAB 4QQGA 3D5LA 2K6DA 1BK2A 2RA2A 4IURA 2SRCA 4JJBA 2DA6A 1RIOH 3TU4K 2P8TA 2LNHB 1Z91A 1UCRA 2ZKZA 3OMCA 3OBWA 2IGNA 5F04A 2M4GA 1PRMC 1Z77A 5A2QZ 5GAHJ 1WJRA 4KUIA 3MVPA 4FYXB 2CV0A 4R8HA 4OP0A 2IGKA 2B8AA 5FWBA 3I4NJ 3JCMP 3FKIJ 3CUQA 4B09A 2GA1A 1YRNB 2V1UA 1TSFA 2H8WA 1UE9A 2Z1DA 2YU3A 2D0QB 2H8HA 4AG1C 3G1LA 1XN7A 1LDDA 3HRTA 4W1UA 4BL0B 5K7HA 4DJAA 3HL2A 4L9JA 1EJ9A 2LTPA 1H8AC 2JQ7A 1ACIA 3MPUB 4F91B 2GBYA 3H9GA 3CMEQ 1IN4A 2XKOC 1SSHA 4XR6A 2BZ8A 2DXTA 3VSLA 5TRDA 1YIJQ 4A69C 2DOAA 1YS6A 3JCMc 2ZJPF 3E6DA 2GBQA 2W7NA 3CF5F 1QA6A 3MEWA 4II1A 3JCMV 1GXQA 2JS2A 2EIJH 2LQKA 5GANj 3CCYA 5GJWB 2VXZA 2FVUA 3K69A 1ETWA 5HVQC 1BU1A 4RB1A 2LOOA 2QDLA 2LX9A 1RAFB 4ZH4F 4FIBA 3D0SA 4NC8A 1WGXA 4IQJA 3H41A 3BZCA 3S32A 3EQLF 2ZMEB 2P5LC 2MLKA 3G73A 3DB3A 3WTTC 2HI3A 3CTAA 5CCAA 2GLOA 5D6EA 3E1SA 5LJ5j 1IRXA 2CO5A 1FYKA 2F69A 2V1DA 4JP0A 3FDRA 3V7SA 4EGZA 4M6VA 3ZMSA 3HSFA 1M27C 1W1FA 4D7NA 2RH2A 4HF0A 1APLC 1TZLA 5E18F 3S15J 4V19K 1ZAOA 1BB9A 4WTOB 5B5EC 2MWPA 3R4KA 3IRRA 2NVYJ 2CS3A 2C6YA 2OTLT 1S5LC 2CT4A 2L9RA 3HHTB 3IP4B 3QYHB 1LVKA 1NK2P 3TEEA 4A4GA 2FNPA 3CMMA 1I07A 3IRQA 3HB9A 1WHKA 4MMLA 5I22A 3QP6A 3BJAA 2ISZA 2FJ1A 2NS8A 4FYVB 4HDVA 1VQPA 1D1CA 2KBTA 1LJ9A 3CPWP 2BZTA 2KRFA 1W36D 1XGNA 4J9GA 3QG1A 3F3XA 2L02A 2P84A 2CP6A 4BEHB 3VUBA 2AK5A 4C92D 1V1CA 4PK4A 4KH1B 2OZ6A 1UGSB 1WHJA 5EG2A 1IUFA 2XAJA 3GPLA 1UGPB 1WVRA 2V9KA 3NTIA 3LX7A 4M4ZA 3U1DA 2FPDA 5KE3A 1KQSA 1R1UA 2M4KA 1TT0A 2B63J 1EF4A 1FTTA 3HYIA 1P6RA 1Y8QB 3K6GA 2QQBA 2V9VA 3TW7A 4PJNA 4S0HB 2HQNA 3KLOA 4M3BA 4KMUX 4M71A 4UV9A 1K6OA 2LKSA 3K4KA 3ZQLA 1H0MA 4KUDK 1KYZA 4H0EA 1AU7A 1GCQC 2EW3A 2HDCA 4M7AE 2PG4A 1GV2A 3OIOA 4RB2C 3CDHA 2A07F 3PVLA 4NDLA 1YI2A 3IH4A 2R57A 2MFZA 2LNBA 4MDXA 2LT4A 4NL3A 2ESNA 5CKTA 2JMCA 1KK7A 3VRYA 2QSGX 2M3AA 4LFUA 3HKSA 1Z7LA 1MNEA 3LSIA 4HNUA 1D3BA 2FRWA 5CLSA 2XAQA 1BW5A 3EG9A 3DLLF 2JPBA 5F27A 2LD5A 3QZ9B 2OCEA 1X2MA 1VUBA 2QDYB 1AWXA 3C1DA 2HOEA 3LNQA 3ASOH 2HQXA 3BR3A 3E7LA 3GW2A 3CUOA 5AIQA 2X6YA 1BL0A 5GAGJ 3NTHA 5FU7C 4KITB 2FZGB 1JU5C 2PJRB 2J06A 1KGSA 2LRQA 3QZ5B 4DBFA 2RQQA 4ATOA 1I1JA 4XRMA 2IRFG 2C06A 1H92A 3ELKA 2K3XA 4C92E 4PUSA 2XGXA 2PVDB 3FBIB 2VBXA 3A1PA 3INZA 5C0MA 1D0YA 3GZ5A 2CQXA 1RLQC 2HFHA 1H3HA 4M78F 1Z0XA 3CLQA 5FU7B 4IO9F 3ECHA 1JQQA 3QWLA 1V4RA 2FBHA 1K78B 1MMNA 3J7AO 1DU6A 3I54A 2YT6A 3X24B 3CCVT 8AT1B 2XF5A 4HYEA 3MHXA 8ATCB 4CC4B 2BZXA 3SDZA 5LJ3e 1WJDA 3VDXA 5F6FA 4ESFA 3HOSA 4GYIA 3G6EA 4ASNA 2X1CA 3DEWA 3CCUI 3CJRB 3DBLB 5DM7F 2KRHA 4BY6B 4QVZA 2E36A 4P9FA 1P4WA 3BR1A 4ITVA 3HTRA 3MEVA 1R4MB 3MKDA 2KDSA 5GMKj 5FFXA 2X6OA 4XLHA 5E1WA 2DO3A 2OX7A 3JCMg 3RYRA 1I5LA 2ZNZA 3W6KB 2VL8A 4A93J 3E0JB 3OYCA 2IS4A 3I53A 3LWFA 2FO0A 2MW8A 1BW6A 3ZMUA 2ZZDA 3GNFB 2H27A 1ZBJA 2GTJA 2P0QA 1ZLJA 3O3KA 4LNPA 3ZN0A 1KU3A 2VASA 4EQQA 3HPGA 1KZHA 1O3SA 4M75E 2RHYA 4XBFA 1GDTA 1HJDA 3F8BA 2R7DA 6PAXA 1OJLA 3PT9A 5GPCA 3OR2C 1DDNA 4BJ5C 1WYXA 3M8FA 2CW7A 2COWA 4RUGA 3J81K 2GQIA 1D0XA 3JAME 3IH3A 4C0GA 5KCOA 3L2ZA 2DLPA 5GAN3 3EGUA 1TC3C 4CZZA 2OPTA 2DQLA 2LCCA 2CSQA 3TP3A 4MTDA 3VKIA 5DDGA 1TQIA 3K1NA 2ZFUA 3CC4A 2KISA 1WJAA 2DXIA 2X3WD 1D1AA 1ZARA 4OU0A 1MD0A 1R6RA 3M3YJ 5M3MJ 3DLMA 1KQ1A 2PN6A 2VN2A 3UA6A 2DA7A 2ACJA 1MDMB 3B6CA 1ZH5A 1YRNA 4J9BA 4OMFB 1TWBA 3BDLA 1YN8A 4C5GA 3CC4Q 4ENMA 3K4MA 4C3JJ 1KSWA 2OAUA 3KXTA 1Y6IA 1V5EA 2L9VA 2XIGA 5ILUA 4F52A 5GMKl 1HW1A 4BQQA 3CESA 2WA0A 3UF4A 2VGMA 2VXEA 1K0SA 3ABMH 4JZ3A 2BHZA 2RJFA 5KAIC 3MO8A 2PMHA 2XAUA 4ZYEA 1Q82U 5J40A 1AHDP 2KIFA 2OAZA 2NVXJ 5DTDA 2H94A 2DBMA 4J6WA 4C5IA 4N4HA 3S1QJ 5IOZA 1SG5A 2LLKA 3HP9A 4M3GA 4X9DA 1T38A 5IP6A 4XSZF 1VQPT 3AG2H 2KZVA 5LJ3h 2YPRA 3GX4X 1X2QA 2P81A 5IOYA 3KX2A 1AOJA 1G3YA 2Y2ZA 2HGCA 2G7HA 3GTOJ 3FK7A 4X6AJ 1B72A 1XMAA 3C12A 4KJZA 4MGRA 2WY7Q 2NVUB 2YWWA 2LCSA 3UA7A 3ZMVA 4A3BJ 3HEFA 1JJ8C 1T0JA 2BKDN 5GANg 1F43A 3WHCA 2UXNA 1VQKA 5FLVA 4BH9A 1ZGJA 4UXNA 3OSFA 5DYMA 2JZ2A 3M56A 3OS5A 1YX3A 3IUOA 1JHFA 2OUMA 3V8LA 3RZDJ 1YIOA 2A3SA 4LG0A 3KFVA 2EQUA 4B3XA 2A08A 2E3IA 1LFBA 4R1HA 4ZGDB 2EIMH 2XB0X 4JJDA 5LRRA 4IF4A 2QUFA 4F7UB 2DZCA 4U87A 4FW1A 2ZGWA 5LJ3g 1N5ZA 4ZYGA 4OB1B 1QHHD 2J7IA 1R23A 1RRJA 1UZCA 3ABLH 5M5YJ 2GQVA 3MJXA 2HZYA 4CCJA 2AZSA 1JJ2A 5GAN8 2W85A 4MQVA 5ILSA 2ZJQF 3I55I 1FBQA 1FEXA 1Y0NA 1V5GA 2MWOA 2Y75A 1ZR4A 4RTWA 5GAN4 1T98A 1O4XA 4M73A 3QU6A 1IDZA 3L2CA 2ETHA 2X6WA 1QNTA 2STWA 1OV3A 1TG0A 1VQ4Q 3QPHA 1NM7A 2LJ3A 1KIKA 2OTJQ 3S16J 3CBMA 5K5OA 5HY6A 5CVRA 4WCGA 2O61A 3I4PA 2QGGA 2DYRH 4E7SA 2XF6A 2R0QC 1HC8A 4M78C 2AZVA 9ATCB 4ME7A 2CUBA 3FXKA 1W0UA 3VYTB 2J5OA 1PKSA 2M0OA 1RUOA 2XPUA 3V42A 4DOZA 2VT2A 2DCEA 2C0OA 5LHHA 1X6GA 2CWEA 2DERA 1O7LA 3W2VA 3N97A 1D8JA 1ZUKA 4P1WA 5KYUB 1FZPB 2K4YA 5E3MA 2M30A 4MNUA 1CGPA 2ATCB 3EGXA 2B0LA 3MAJA 3OW2S 1M1KU 3TO7A 1B7TA 2MF2A 5LL6S 4ESRA 3JCMf 1YQAA 2R7FA 4KISA 4KN7X 2DEQA 4OMYA 4ENNA 1ZX6A 3HFNA 1RABB 3QKJA 2KK4A 5HCKA 2QEXQ 3NMZC 4A0ZA 2MIOA 4BE0A 4AFUC 5C6SA 1H88C 1P92A 4FCYA 3J7YJ 1YCSB 2E6ZA 2FHDA 1GXIE 2KIQA 3I5UA 2M5WA 3NARA 3Q0VA 4KUMA 2QXFA 5ERIA 2LJ0A 4XU0A 1J9IA 2ZO4A 3L2VA 1MW7A 1YBYA 5GMKi 1LUJB 3T8RA 5ICCA 2ECZA 4YEJA 1X1BA 4QLCU 1PJRA 5IY5H 1K61A 1MMGA 5HKCA 1E2XA 2LY9A 3OL3A 1ETYA 3F70A 3FWEA 1K78A 3H3ZA 2RF0A 1Y39A 1JHHA 1HKSA 4HAMA 2IGOA 1FBSA 3HKZN 4MZTA 2FBIA 3DB4A 2M2EA 1GFCA 4DBHA 3WHBA 3LW5E 4A6EA 1WIEA 4M77B 1PD1A 2A05A 3RESA 2H6BA 3TREA 2L7FP 2WSEE 4LDVA 2P7VB 2AS5F 1M4ZA 1O7FA 1Q1HA 1N8RC 1P7JA 2DTOA 2DU9A 3V8JA 5CIUA 4UNOA 1RUWA 3S8PA 2COBA 2EFOA 4IX7A 4HT8A 1VNDA 1K9AA 4B1RA 3O8GA 3OY9A 2KRMA 2W82A 4BXFA 2B7EA 1QZEA 2MCNA 2J6OA 1BC8C 3FC3A 4Q5WA 2WAQA 5DM7R 1VQ8T 3G1JA 1OFCX 4Q48A 1Z6RA 3PIOF 1QPIA 2HL3A 5IYDJ 1TT5B 1B9MA 2PMZN 3T8TA 4LIVA 3CO6C 1M3BA 4DBQA 2FG0A 3QJYA 1VQPQ 2Y30A 4HKEA 1P7IA 3KUFA 5KH6A 1MV3A 1U5TC 2L54A 1M3CA 4ETSA 4OMPA 2B86A 5HLIA 3KIOA 3CCJA 4WX9A 3HXLA 2E5QA 3F8NA 3CCRA 1I3AA 2GZWA 2F5TX 2HS5A 3DU5A 4D1QA 4J7FA 3VV0A 2M87A 1HA8A 1Q82C 1SFKA 3FJPA 2KDZA 4G7OF 2CGHA 5K1YA 2XC7A 2QLZA 4F7UA 5F1JA 3GIBA 3BTIA 5DM6F 1M3AA 2BVLA 3P9CA 3AL0B 5K7FA 1WH7A 1BCMA 2E12A 3OR1C 2Q2EA 1GXPA 1B6AA 3V7CA 2O6GE 2M0CA 5LRSA 2NYSA 4QVDA 3T1BA 4M7DF 1IXCA 3KP7A 3NWSA 2MH2A 3HG9A 3PIOA 2K86A 1IV8A 1VQKT 4WF2A 1GLNA 3CC2Q 1UJ8A 2QGUA 4KGXB 1X01A 3I5RA 3HTSB 3FXRA 1ENHA 2FX0A 4EJTA 4JBAA 2L9NA 3M8EA 5L3FA 4EDUA 3PGGA 3T9NA 4C3HJ 3H0FA 4R0KA 3R61A 3ZQIA 4RTUA 1MH3A 1BJZA 5EGOA 1LQ1A 2HZTA 2BY0A 1G5VA 1A31A 5FROA 2Q0OA 2CV2A 3RUXA 3EYYA 2IA2A 4O6JA 1MDMA 1C0WA 4XU1A 1WI3A 3OYJA 3OYLA 2PUKB 5LGTA 4UVAA 3HGYA 1LPLA 2FU4A 3J7AF 3A03A 3CCVA 2DTHA 5LGUA 5GMKh 2KY9A 2V1RA 2DE0X 1A5JA 5M3FJ 1U8BA 5DUIA 4UY8I 2MMPA 3SWNC 4C8QG 5HDKA 1TNTA 2GXBA 4NHJA 1FMWA 2HBPA 4E7ZA 1VQ6T 4L6V5 1ZQ1A 4XKBA 1VQ6A 3K10A 2VE9A 2KT8A 3ZN1A 2R5AA 2RV8A 4RGXA 5D6WA 2F6CA 4CC7A 2KP6A 4F92B 1P4AA 3LAJA 2LSOA 3VU3C 5AONA 4ZC3A 1PCXA 4Y4RA 5IP9J 3GOXA 2FE3A 1YJNT 5GJVB 5GAN7 5LFAA 4CXFA 1MBEA 2DA2A 3TO9A 5CO7A 2IXSA 2JMAA 5C44J 2VKEA 2VONA 1UTIA 2M02A 1NJIC 1YITI 1BI2A 4G8XA 2QG9B 5K7ZA 3H5AA 1RESA 3MWMA 1TL8A 1EFNA 2E70A 2MABA 3DU6A 4DA4A 1U5TB 3CCLT 1IN7A 3HPWA 2SEMA 4LG0B 3A02A 2GF7A 4OMOA 1KQ2A 1FLIA 1XX5A 5EZGA 4C9YA 3JSPA 2CP7A 2DMPA 4NC6A 2VB6A 2W57A 1JTYA 2JVGA 2V9PA 5IYBJ 4NQWB 1HSTA 2EYZA 3EFSA 4JRKA 1S7AA 2E1CA 2D1XA 4C92F 5E8GA 4Z02A 1N9RA 2O9LA 1LOJA 2DXCA 1D1BA 5M5WJ 3MKLA 2NS0A 2DN0A 2CS7A 2IPOB 1VQOQ 4LITA 4GXOA 4BDYA 2YU9J 1MKMA 1LE8A 3H9QA 3I56T 1N6AA 3IAM2 4B8XA 4GLKA 4C0FA 4XLNF 1OLTA 4HPQA 2E5NA 2BY1A 3TW6A 5JHUA 3GZ6A 2E34A 1D09B 1OPKA 3P8HA 3TQ7P 4B9XA 4QVCA 2DA3A 2FOKA 3W2WA 5LJ3f 2JA2A 4IOAF 1T6SA 4IRHA 3GXOA 4AD9A 5HLGA 1K1ZA 1ZA1B 3META 3ZFJA 2EK5A 2X85A 1VQ5T 4OIRF 2OTLQ 1OZ2A 4M7AD 1KQSS 5EG0A 1OISA 2BXZA 2KT0A 2DILA 2DNUA 3SZGA 5TISC 1STZA 5KYXB 2ICWG 2CFOA 1ZHFA 3OYGA 4E7JA 1SFEA 3OIPA 3G71Q 4HBLA 1SFOJ 3KP4A 2DYBA 2O01E 3C94A 4L5GA 2NUTA 3PQJA 3SHWA 1JUMA 3F9KA 1POGA 4MTEA 5BNGA 3DP7A 3EHQA 2K3PA 3M8JA 3F8MA 3PMIA 1BA5A 2EA4A 2JTEA 4PJ0C 4X0GA 5E8IA 5GAOm 2LP0A 2RKHA 2BW3A 3EDPA 1XSXA 3LGFA 2M1HA 1U5SA 2KR3A 3EGDB 4XKVA 1HXDA 2I10A 5CKBA 4EMSA 1HYOA 2RK2A 1XCBA 4G12A 5KAFC 1IXSB 3QODA 1O57A 4CICA 3UPUA 4N4OB 3M0PA 1KONA 1MJAA 4F04B 1QWEA 2JA7J 1VQKQ 3M4YA 5E1ZB 1FBUA 1L0OC 4LE9A 3JB9G 1W4SA 1HQCA 2HVQA 3JRBA 4XK8E 3IAS2 5F0FA 3LOCA 1H8KA 1Q81R 4ZYAA 3RYPA 1WFXA 4MLOA 1QCOA 1T3LA 4M78B 3PFSA 2A61A 3HIFA 3OYKA 2DA9A 3M0SA 1CKBA 4D8KA 2ZPIB 2ESHA 1SANA 4BKXA 3X28B 3REBB 3HSBA 2DTIA 3MP1A 2K40A 2EVRA 5KHDA 4I02A 2X35A 2BE9B 5DD8A 3CXCP 2VC1A 4KMFA 4N9HA 3E6BA 3H8ZA 2VQHA 3LSHA 1IHWA 5EEHA 5JLWA 3KFWX 1Y8RB 3JW4A 5FLXZ 3AKZA 3QDRB 1RAIB 2RMOA 5CQEA 4GCVA 2R3SA 2YLBA 4C92C 2DF6A 3AT1B 3C18A 3ULQB 4CCLA 2OF7A 3E2UA 2AHQA 1Z9CA 3CCEQ 4CC2A 3RERA 3I59A 1IAWA 3KEOA 3COAC 3PO2J 3RPUA 2XGEA 2X9HA 3WE2A 5H20A 2PU9B 3ZMTA 5LJ3j 3CD6I 1VQNQ 3I58A 4E2FB 1Z21A 3CCUT 3IL2A 3AG1H 4RS8A 3X2QH 3CUQB 2VGNA 4A0YA 4B44A 1ZR2A 1RR7A 5CKHA 3VS0A 3X20B 2HOSA 2EQJA 1LFUP 1XCVA 2XI9A 5JLXA 3L09A 1UJ0A 4HF1A 1WI7A 2DL7A 2HKNA 3WTXC 1Z7UA 2V4JC 4ZGJB 2DMNA 4LJZF 3KE2A 2DQRA 4IHYA 1ZK8A 2ZC2A 1BCOA 3H5RA 2AXLA 1RI9A 3GFMA 4KFCA 1YJ9T 2VJ5A 3Q5FA 2O7OA 4A4KA 2RQUA 3CCLQ 4ZDPA 4BI3A 4OIQF 2XDVA 3I4MJ 1WGSA 2DXBA 4AIJA 1BOBA 4LUEA 2D2WA 2RNAA 1WJSA 1I50J 5EZHA 4ZDOA 2ZNYA 4M7DG 5IT9K 1DGWY 1X4OA 4I76A 4BY6C 1K9MR 3S6WA 3JRHA 1WJQA 1OPCA 5EGOB 3M54A 1OCRH 1XGOA 4CC3A 2R5ZB 1R00A 3EUHA 4VUBA 1QVUA 2EB7A 1Z6TA 1VQMA 1MBJA 2GCXA 2P5VA 5D8KB 2LFBA 1N9SA 1FIPA 3ER0A 4C3IJ 3OSSC 3B6AA 3DEEA 2V6CA 3FZVA 4IEJA 2DEUA 3IQLA 4AVZA 1E6HA 1Z67A 1X75C 4JUVA 5BPDA 2L2PA 3CZ6A 3VYHB 4UVBA 3CCMQ 4JRQA 5ECAA 2KQRA 4F7UF 1BR1A 1ARKA 2HQEA 3SB2A 4XM3A 1VQLQ 2XKPA 4XIDA 4PJOG 3QOPA 2BOLA 4P5OA 5EG0B 1VQ4T 4ZZLA 2DVEA 1FWZA 2Y4YA 3BWGA 3K9TA 2Z3YA 1E3PA 3OYDA 2HEOA 4ORZA 2HEQA 2FNAA 1YO5C 3RKXA 4G9YA 4DNCA 4BY1J 4BS9A 2JJ7A 3M1CA 2H09A 1NLPC 1U1TA 3QUIA 1M90U 3CO7C 2IA0A 1ZRCA 4RA2A 1SFXA 4L18B 5L8RE 1BYMA 4EJWA 3EG9B 2CQQA 2K9LA 3GF2A 5KYYB 4QKUA 3A8HB 3BY6A 1U78A 1WQ2A 3DPTA 3KZYA 3VPRA 4B47A 4XTUA 4EIKA 2ROLA 2PFBA 1T0FC 3LMMA 2ZPEB 5GAMh 5K5QA 1W2BS 1QVFA 3CCJT 3CMAT 3MN2A 3QJ6A 3KYCB 3MEXA 1T3SA 1OPLA 3LSJA 4MEXF 1QCNA 3W6JB 1WJFA 4E6RA 3F21A 1PYVA 4G7ZF 4CYDA 2A0FB 2QGFB 4KGVB 3HRSA 4JX6A 4B43A 1KQ0A 1QVPA 2HNIA 2RHXA 1R5ID 1YCYA 2RJDA 3OQ5A 5L23A 4NQWA 4LOCA 1G4DA 5HODA 1OU9A 3K4JA 2QF7A 4AIHA 4UB8C 2ME6A 3H5NA 2ADUA 1VOMA 4A4EA 4XTVA 2VJJA 4HW0A 1PP8F 2HVRA 3WGHA 3L2QA 4A3CJ 4JK1X 1MBKA 3HKZA 3GP8A 1QVGS 1HCRA 3BG3A 3CMYA 2O4XA 3A8GB 4MO7A 5C3EJ 1NEGA 4M3FA 1YW8A 2EYWA 4J01A 2JPCA 5F64A 1MBFA 1W36C 3BT9A 3CMEA 2PLYA 1X43A 2DYSH 4AFZC 2BYVE 3DTIA 2LX7A 1N75A 3F23A 2IS6A 2EKHA 4XLCA 4QSHA 5CQYA 3ZEHA 3TQNA 4C2TA 2K2MA 3M07A 1Y1WJ 1JBMA 2IVMA 4Y52J 2CUZA 3FXLA 4BI8B 2HTSA 3RR6A 1M1GA 5LJ5h 4Y33A 4J8OA 4X9CA 2XB5A 3JCMb 3ZPLA 1NTCA 1P2FA 2M45A 3F8FA 4NOYA 5JFRA 2CT3A 4RG8A 3QBYA 3CC7Q 2EYXA 2ZSHB 3WTYC 2XPWA 1VQPI 3R60A 4FYWB 1BI0A 4LG3A 5KYNA 4LN2A 1VQNT 3PE0A 5LGNA 4BU2A 4Q47A 2KVQG 1IC8A 3RSNA 2VOPA 3FB9A 5GMKe 1OMIA 3JCMX 3UR3C 4J7IA 3K4NA 5J4VA 2DLLA 1N77A 1ON1A 1USSA 2STTA 4JX5A 3REAB 2DK5A 2FZKB 4I0AA 3J80E 1WWXA 5GANf 2C0TA 2N8GA 3P7NA 4CCMA 3GMEA 2WWYA 3C2HA 2DW4A 3M5AA 2HYJA 3KYLA 4RAFA 4OAZA 5J6XA 2M9UA 1JUSA 4Y3OA 4KIBA 1QU3A 2OAWA 1ZLKA 4HCZA 2FL7A 1LFPA 5CVUA 4EM0B 5CJ9A 4J9EA 4M78A 4ZGEB 3FX3A 5FKKA 3DPLC 4LB5A 3S3NA 4R55A 2LDMA 1IGUA 4FETA 4L5EA 1YS7A 2K5FA 2L9SA 2EFWA 1GRIA 4XRSA 2HCKA 1WDXA 2XU8A 4CSWA 3BC8A 2X0LA 1DUXC 1LCKA 1DU0A 1WHHA 2DK3A 4U0VA 1RC9A 2MC4A 1IREB 5J1RA 3KP5A 4M9XA 3QOEA 4RTZA 1YJWT 3I55A 3AG3H 1OYYA 5HS7A 3E97A 4IZZA 3X25B 4QIWN 4P96A 2EZLA 4C8QE 2M0MA 2DI3A 2RVCA 2K5CA 1K83J 3GCMA 1WPYA 2CZ6B 1FY7A 1KJWA 1H9GA 2QENA 2RAEA 3L42A 2LBFA 3MQ0A 1JJ2P 1VQ5Q 1KU2A 3U1KA 1X1CA 1FYLA 3RDIA 2TDXA 2GFUA 2RHZA 1YJWI 5GTIC 4FW2A 3LSRA 4CA0A 2F5EA 3G4ST 2F4OB 3HTUA 3ZQFA 4ESJA 4HDUA 2LG4A 2BBYA 3ABKH 4IXAA 1D5VA 4RDUA 3G6ET 1S7OA 3OA6A 4XRSG 2VBYA 2RC4A 1R58A 1NPRA 2OQGA 3BPVA 1RAGB 3OYBA 4RTVA 5GAOr 1EH7A 1Z1DA 2V1NA 4LDXA 4OIOF 2CH0A 4XICA 1ZN2A 5FLMJ 2IS2A 4AMCA 3V7RA 1LJOA 2JK3A 3SWNB 1ETXA 2P0WA 2QTVA 1S3JA 2IP2A 5CYVA 2Y9ZA 2M7BA 4YFKF 4XQFA 2AT1B 5E1XA 1VF9A 2YX7A 3FXUA 4A3JJ 3ZCOA 2P4RA 3L9FA 2FXAA 1U06A 4KIFA 4OMMA 2CUDA 3HHHA 3HSEA 1NYGA 4ABZA 2OI3A 5GAEJ 2QA4I 1H3ZA 3CF2A 3GBQA 2YXYA 1TP4A 4RAZA 5JR3A 1YFHA 1YI2I 2FOWA 3ECOA 5DCMA 4ZTFA 2EINH 4M7AC 4EJOA 5GAOq 3I56Q 2M34A 3SZPA 1OCOH 2V6EA 2JT1A 3BCAA 2NYXA 4S04A 4NL2A 5I2SA 1RI7A 2ED1A 5KYWB 2K27A 1Y96A 3GTMJ 1PUFB 2K9GA 2W00A 1U0JA 2XAFA 1X3ZB 2I8DA 4NUBA 3C2BA 4MFDA 4FYYB 2XMFA 4OINF 2DM1A 3R0JA 1U5TA 2HYGD 4PKCC 3FXQA 2NLUA 1QQIA 4U7DA 1SAXA 2EQIA 2XAHA 3JCMW 4HVUA 2KJBA 1XGSA 1VQ4A 4F3QA 2LZ6B 2CUEA 3HHGA 3MFKA 1GV5A 1OCZH 5GADJ 2UZKA 1XS9A 1K4TA 2E1OA 2CZ1B 2EJFA 5GAN2 2AIRB 4JS4A 3D5SC 1YI2T 3EAEA 4BE1A 2ELKA 4M6XA 3I56A 1I39A 3BW1A 2X1DA 2EBIA 1IN5A 1C0MA 1T0FA 3CUQC 5FLXK 2K5LA 3CBPA 1VQ6I 2HYFA 3C7JA 2H8RA 2E1HA 3HFOA 1S8NA 2QQ9A 4NBQA 2HVSA 3OYAA 2EIKH 2HPIA 1SAUA 1EH8A 1SVMA 4A5MA 5L3BA 1S29A 3SJMA 1FYMA 1OU8A 1SF9A 4M75F 2VWFA 1T95A 2ECBA 3BG9A 2KMUA 5BQTA 1AVZC 1XJWB 3GF5A 1UG2A 3PSFA 1WHUA 2G9WA 1C1AA 1OI1A 3IKTA 2X4YA 1M9SA 3HDDA 1R8OB 3JB9J 4Y7NJ 5FKMA 4E7IA 2ZPBB 5I2MA 3WTUC 2A7YA 1YFNA 2HZDA 2HBWA 3G6EI 1TQPA 2E35A 3BCBA 2IA1A 2K9NA 3D5RC 2RQTA 3CCSQ 1HSJA 1JO8A 1VQ4I 1W5CC 2OTJI 4ZNXA 4DYQA 3CCMA 1L3LA 3FIWA 1QVFS 3O5ZA 1E7OA 4I7HA 4XQ3A 3CD6A 2E5KA 3JRGA 4J9HA 4M7DA 2RN7A 4HOBA 5LJ3d 4PJOD 4U0WA 2RQWA 2O9SA 1QVTA 2FRHA 3VS5A 1OCPA 2JN0A 4QTRA 4P9UA 1R7JA 2F4IA 2JMWA 2A5WA 1IRZA 3OB9A 4RG2A 1IF1A 4I09A 3R0AA 4J5YA 3SEZA 1KYWA 5JVTA 2KHMA 2O9VA 1FPQA 5CVIA 2ELJA 2DDAA 1YP5A 2LNVA 3QPTA 3L2WA 1Z9ZA 1D8KA 1R5HA 4J83A 1KD1C 2MPXC 3IHUA 5DCFA 1TWGJ 3I9QA 1U3OA 4OOIA 2YR2A 3ZOBA 1HOMA 2E3HA 3FIFA 3QHSA 2KL4A 5A2QK 4M75B 1S72A 5HS9A 4M7DD 2BVMA 4H4KC 2FQ3A 3TDUC 5HLTA 2JSCA 1R71A 4IUUA 2CGPA 4PJOF 3VS6A 1UB4A 3E9FA 2DPDA 2GIVA 3RNJA 3GBGA 2A28A 3FXMA 2WAEA 3WGIA 1AKHA 1AWJA 1MJBA 4BXUA 4HG2A 3QPLA 3VS4A 3G4SQ 1GT0C 2HXOA 3TKYA 2QK0A 5J8FA 1AHJB 2QQ8A 2R7WA 2A69F 2F4MB 2LKPA 2OQRA 3H92A 3CPWA 1UAAA 1TWCJ 2DFFA 2HOAA 3V4GA 3GTKJ 1Q95G 3CPFA 5GANd 5J1UA 5D5UB 3SHFA 3C2GA 2OC6A 4AC0A 2KRSA 2D1HA 3HSRA 2M0YA 2XDPA 5EJCA 4RB0A 2ZAEA 2VKVA 3Q0UA 1Y71A 1K7AA 2DRMA 1I6HJ 4M77D 1M1KR 1ODDA 2EQRA 3I5SA 3I59B 3WTSC 4FE4A 2PX9A 3VYUB 3OS1A 2E6NA 2KI7A 4ZN3A 4HVVA 1TTHB 2CW8A 3WU0A 2KJCA 1JI8A 2GGRA 3M0TA 5GANh 1KC8R 1QPMA 2HKQB 4HT9A 4MQ9F 4CYCA 1XDSA 4LLLA 1A04A 3DFGA 1FYNA 1NG2A 4KDPA 2K3YA 3P8BB 4RKUE 1F1BB 1B34B 2EH3A 2E64A 3ZL7C 1O3TA 2P4WA 3JV3A 1KHCA 4NNJA 3VB2A 1WQ7A 2XDBA 2ABLA 4DW6A 3CJQB 2VYTA 3CCMT 1R1TA 1WA7A 2HQRA 1ZG1A 2R7TA 3RKQA 1UB9A 3K4LA 3EYIA 1T08B 2GQQA 5FB2A 4MHGA 2PBIA 1LB2A 2FPFA 1WQWA 3JSOA 4LDYA 4M75D 1JTXA 1BI3A 3O2PE 1CSKA 2DETA 3LGLA 1NHAA 4FASD 1ZREA 2W48A 2D1VA 5FFZA 4B48A 4DZJA 5FRNA 3ZR8X 2VBWA 2K85A 5J47A 3TBIA 1M2VA 2DBBA 4EJUA 3CCQQ 3J80Z 4DEXA 4D9JA 4O3MA 3QSUA 1QKWA 4BE2A 1X69A 5JVGF 2YS9A 2JM8A 1M1FA 2VLAA 3DXJF 4BJ6C 4PJOB 1KA8A 3MZHA 1IXRC 1V5FA 3PNYA 4G6QA 3HC7A 4O5VA 3P9IA 4BBRJ 4AVPA 4JJCA 3DV8A 4XONA 2IPQX 1E3HA 2OTLI 1QZZA 1VQLI 3OV8A 4L0ZB 2DJNA 2AKKA 4Y15A 5GAN5 3JCMh 4IJAA 1XMKA 3TO6A 3LQQA 3T5XA 2MH9A 4KIGA 3ZMZA 3HOWJ 2WACA 1B1BA 3ESWB 2P7CB 2BE7D 3QYGB 3G71I 3M57A 2W25A 1I6XA 3RIRA 2E2IJ 3WVDB 2KRCA 5E3LA 2ZCWA 2GTOA 2J6KA 1ZBXA 4PJMA 3SEQA 2RQPA 4A5NA 4EM1A 4XMYA 2DMOA 3D1NI 4HV6A 2R58A 4R56A 1M1KC 1YITT 2COMA 2F5FA 2WV1A 1TUGB 1ACMB 1UGVA 2E1MB 3W2AA 2DK8A 1HSQA 1OYWA 2VPRA 2K9SA 2M8EA 2IVWA 2YRVA 3M55A 3ULRB 4M7AG 4BQOA 1VYVA 1RZ4A 4HLYA 2ID6A 2VQGA 5IHNA 5GPAA 5L3DA 2TRTA 3CEYA 4G94A 3GFLA 1BIBA 5DV5A 5DLOA 1T2KA 3IV5A 2R92J 3JTGA 3FK6A 2KSSA 2FMLA 4HCCA 4CH7A 3C95A 1FJLA 2L4AA 2L3DA 3L2RA 5A0LA 1HLVA 4FX0A 1JKQC 1IXDA 1MNMC 1ZQ3P 1WZ2A 1XPXA 2H3JA 2RI3A 4MIMA 1D3BB 1XQHA 2A37A 1IV6A 5JI6A 4E7LA 4GRIA 2DJZA 4M75A 5IAYA 5IH2A 1VQ7Q 2JUGA 2O5RA 4QQ6A 3K70C 1TQMA 4AYBN 4U0YA 2R7ZJ 1Y7XA 4XOPA 1S6LA 3I35A 4EMKC 4C0ZA 5A0GA 2RDPA 1X2NA 4JX4A 3AL0C 4LLNA 3DKMA 3BQZA 4YELA 1DPRA 2LY1A 3UNGC 3L1PA 1SEUA 5J1YA 2JTVA 3LFKA 4GLMA 3HM5A 3G1OA 4KICA 1HD3A 5CQXA 4FHTA 1YHQI 3S1MJ 3R6NA 5IN1A 2CUFA 2WAQN 2DT6A 3LSKA 1WX6A 2FRYA 1YW7A 3PUFA 4UUTA 2OU2A 1FOWA 4RAGA 3CCVQ 2VKHA 4C30A 1T33A 3Q3SA 4FSSA 4UVCA 2CFXA 5CVVA 1RL2A 2LP5A 3RMQA 1UGQB 4B9WA 1Q7YR 3JTHA 3EHRA 3CC7I 2X4JA 1O3QA 1K73U 4J9IA 4LD6A 2FZCB 4A63B 2KGTA 1J75A 1IGQA 4LB6B 2LR8A 2I0NA 3VEPA 4D7MA 1PRLC 3M0RA 1YJNI 4D5FA 2DIQA 2QEXT 1PSFA 2VVKA 2LQNA 3OMGA 1J3TA 3FISA 4GO1A 4LIUA 1VQ5A 2E19A 4HSRA 3OW2A 3VYRB 3J80K 2MG4A 4KN4X 2KE9A 3GTJJ 4GBQA 3LAPA 1PP7U 2CKKA 4RTTA 5AYFA 1VQ9Q 3GVAA 3K1MA 1LVAA 3CC2A 2QQRA 3GEZA 3B02A 1G2BA 2QZ8A 4HLXA 1NBEB 3CPWS 2AO9A 5CKEA 2L7KA 2COZA 1DP7P 2K3FA 3HBLA 2XGCA 1BR2A 2GWRA 2ZJ2A 2VIXA 2BY3A 3KP6A 4A6DA 1GUUA 2A36A 4ZTJA 2WAFA 1HKQA 2L01A 2PQWA 2JN6A 2EWNA 1TUDA 1KC8U 4M7DB 3S2DJ 2ZXJA 5B1BH 4N9IA 3CCMI 1D3YA 2BY2A 1B59A 2HMAA 4PJOA 2OZUA 2WSCE 2CP5A 4M7AA 3TMOA 3HOUJ 1XTDA 3SDGA 3GYHX 4E7HA 1AA7A 1W70A 2LTOA 2AXTC 4ELZC 5CKFA 2M1BA 2K4BA 3HZJA 1PWTA 2CZ0B 3FMSA 3I3LA 2YX4A 2JTMA 1JXMA 5BMZA 2ZXHA 1Y0UA 2QQSA 2ZPHB 4JOMA 4TVRA 1GL5A 1W4MA 2Z9OA 4X1VA 2OV7A 1I5OB 2DT5A 3M59A 2WADA 3I55Q 1LEAA 4IHTA 2F1LA 4A3DJ 2XIDA 1X4PA 1FSHA 2V1XA 5FU6B 1K6YA 4RCBA 1AKHB 3WGGA 1TU0B 5LBQA 3PJRA 1K8AU 2JUFA 1MGQA 5LJ5f 1T39A 3CQTA 2B9SA 3H35A 2Z33A 1YJ9I 1EIFA 1FSEA 2E7XA 3BZKA 3ZQQA 2R7QA 4B4CA 3G71T 2OCCH 3L2UA 4MMKA 3LFUA 4M6YA 2KLOA 2DD5A 4EMGA 5J8CA 3ONQA 3PO3J 3EFRA 1D0ZA 3LQRA 1UHWA 1VQLT 3FMRA 3GZNB 3NAUA 3F6VA 2VUMJ 2E4HA 4B6MA 4B3AA 3TGNA 2LH9A 3GNGA 2LK2A 2V8JA
chains in the Genus database with same CATH topology
2XUBA 3RJPA 1BIAA 5M9OA 5ICEA 1SFUA 1K73C 1QZYA 2EFPA 5KCHA 4E70A 5DCMB 1FX7A 1Q86C 5DUKA 5BS6A 3MZYA 1EV7A 4U88A 1SMYF 3H6ZA 2FBKA 4J6YA 4KA4A 3SXYA 3HL8A 1DPUA 1W5SA 5LLQA 3CC7A 4CO8A 5FD5A 4RB3C 3Q1JA 4WXHA 4LGWA 2JOYA 4I0BA 4C5EA 3BOQA 2A5YB 2BUDA 2QTXA 3CCEA 1OR7A 4LD9K 1E17A 1W7PB 3CCRT 4QQDA 3PQKA 2XHKA 1TH7A 5KK1A 4RMOA 2MBFA 4HZFA 1UHMA 3CCLA 1ULYA 3L7WA 1WKMA 1NPPA 4A53A 2Q8KA