3HRSA

Crystal structure of the manganese-activated repressor scar: apo form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
TPNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
molecule keywords Metalloregulator ScaR
total genus 65
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrsA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrsA02
3IRQA 3ABUA 3FMRA 3L09A 4EJVA 1YW7A 4EV0A 4RB2C 1BBYA 1FZPB 1Z7UA 2V1DA 1S7OA 2QVOA 4S05A 1R58A 4MQVA 5LRSA 4FHTA 1WKMA 2JTVA 4I0BA 1FNNA 1MJ9A 4Y15A 3E97A 2F5EA 1RIOH 2ZKZA 4Q5SF 2E1CA 1XB4A 3BROA 1R5HA 4WCGA 3OOPA 3T0YA 2GA2A 5JHUA 3CUQC 4M6XA 2K5FA 3JSOA 3ZMVA 3WTYC 2DPUA 1YQAA 2EA4A 4UHTA 3RKWA 3Q9SA 4LLGF 4M72A 1TQIA 1BC7C 1K78B 2BBYA 2QUFA 2EB7A 4NHJA 4ZYGA 3F3XA 3RIRA 1K7AA 1B4AA 4RGSA 4WWCA 4OMYA 3GFJA 5F1RA 3F8CA 2UXXA 1FYMA 3T8TA 2XROA 2O6GE 3DXJF 3WG9A 5J6XA 4UV9A 2ZJ2A 4HQMA 1YO5C 5HDGA 1J2XA 1I5ZA 2CG4A 2CQKA 4BXUA 5LEJA 2Z9OA 4OIPF 3FHZA 4U7BA 5FGMA 3FM5A 1JXSA 1V4RA 4JK1X 4A5NA 5H6QA 2YSRA 1MZBA 3QAHA 3U9GA 4AWXB 4WXHA 2GWRA 4R8HA 1VTNC 4M9ZA 3PQJA 5DCMA 5CVJA 3BZ6A 2FBHA 5L3CA 5FLXK 1PUEE 5L3GA 1QVPA 1R1TA 2CSOA 2HOEA 1D8KA 1JGSA 1RZ4A 5ILSA 1G3YA 4AIKA 3PFIA 4G6DA 2IT0A 2XHKA 1LDDA 3I0TA 2IRFG 5H20A 1KQ8A 1GXQA 4K2EA 4I09A 1BN5A 2RDPA 2HYFA 5E20A 1YFHA 2EFWA 2D45A 2HR3A 2KRFA 1G3WA 5FD5A 4ESBA 4L5JA 4AVPA 1NHAA 3MZYA 3U1DA 3MZHA 2QYOA 1AWCA 3ZMTA 3ABTA 3LSTA 2ESNA 4MQ9F 4ENKA 4JQFA 5BPIA 1O3TA 2DQRA 1K6OA 3D5LA 5AIQA 2EFOA 4ZYEA 3COAC 2Y48A 1IXSB 3ZMZA 5F6FA 4HW0A 1DPRA 2PLYA 5LLQA 1J75A 1DPUA 4EQQA 3EUHA 3WTTC 2EFPA 4EM0B 1QNTA 4CO8A 3KETA 1J59A 2XAQA 1J9IA 1S6LA 1LJ9A 4NB5A 2UWMA 3PQKA 1O7FA 4Y17A 4ZYHA 3VODA 1Z05A 4Q47A 4P9UA 4KIBA 2DO7A 2QBYB 1I6XA 3GFIA 2WWYA 1P6RA 5HS8A 4ENJA 3KE2A 2P8TA 2DK8A 5LGTA 4G7ZF 5LHIA 1IRFA 4EVIA 1D8JA 3GFLA 2K4BA 2K5IA 4CHUA 2BGCA 3I58A 4IVNA 4LK0F 3SHFA 1QGPA 2DFIA 3IRRA 5CLSA 4L18B 3QU6A 1MJBA 2DT5A 5JR3A 1YS7A 2XKOA 2M45A 1QQIA 3T1BA 3WGHA 1P4AA 3L9FA 2KIMA 2P6SA 1SMYF 4IF4A 2L02A 4UXNA 4MNUA 4F7ZA 3L00A 2ZMEA 3I5UA 2K7LA 1BC8C 3JW4A 3CJNA 1B9NA 3RYPA 3QP5A 3ISPA 3VEPA 3GZ5A 5HS7A 1PP8F 4G7OF 2IA0A 2JPBA 2A6EF 3LAPA 2M8EA 3IKVA 2ZNZA 4L0ZB 3GWZA 1ON1A 1XCBA 2LKPA 2VT3A 2Z99A 2L54A 3WU0A 1P92A 2XIGA 4ESFA 2B0LA 1J7KA 4IHSA 5DUKA 1YIOA 2NAZA 4HV5A 2R7FA 1R7JA 5J8FA 4LJZF 1Z9CA 3JAMK 2EJRA 4L0YB 1T0FA 4IPAA 1FOKA 4RGXA 4BHPA 1I27A 1XGOA 3FXRA 2HYGD 4O6JA 1FPQA 2DBBA 2ZXJA 1Z1DA 3F6OA 3N4MA 1H9GA 3F8FA 3F8MA 3FX3A 1T98A 1RNLA 2VBXA 3GXOA 1IN8A 2WV0A 4B09A 1R36A 1EH8A 3J7AO 2HKOA 4M74A 1XGMA 3REOA 1ZREA 2RQPA 4RGUA 1IN7A 4LB6B 1SFUA 1L0OC 5ICGA 3J80Z 4L5IA 2CW0F 1I1SA 4PGGA 5K5OA 3QPTA 2A5YB 2XRNA 4L9JA 1TQMA 2Z3YA 1MKMA 4CDGA 2F5FA 2RNJA 1BJAA 4AIHA 4Q48A 5IT9Z 3FWEA 3V8KA 2KJBA 1WI9A 2R7DA 3CUQA 3J81K 2MH9A 1CF7A 2HGCA 4HA8A 3M8FA 1IN4A 3EDPA 2HTSA 3E5XA 1WQ2A 2D1VA 4KN7X 4RB0A 2G7HA 3H3UA 1YYVA 3SQNA 3WTSC 3MCZA 4KA4A 3RPUA 4UUVA 1XMAA 5HOOA 5CVUA 4N9HA 2MH2A 5D6EA 2TDXA 1O57A 3HSEA 4BQAA 5DEQA 2DI3A 1ZYRF 5D4RA 5BQTA 4YFKF 2Y75A 2E7WA 3V7CA 2M87A 5ICCA 1ZN2A 3GX4X 2D2WA 5CVRA 5HVQC 3E5QA 3JTGA 2YX4A 4G8XA 1PDNC 1LEAA 4QWQA 5ED4A 3VB2A 2IA1A 2K5LA 2GQQA 5L3FA 3ZP5A 5JFRA 1ZLJA 4XLPF 1IN6A 1BIAA 3DEUA 5TJJA 3LA7A 5EEHA 3KP3A 2FMYA 2DK5A 4RB3C 1E2XA 3ZMUA 4A2UA 2A3SA 2G7UA 3Q9VA 3C7JA 1HBXG 3L2CA 1W7PA 3HSRA 4HLXA 3W6KB 3CUOA 3HYIA 4ESJA 1L3LA 1K78A 2ZNYA 1KYZA 3H3ZA 3M9AA 2J5OA 1JHFA 4HF2A 3TOBA 3FM3A 2EFNA 5LHGA 2P5VA 1YW9A 1Y0UA 3HTSB 2C6YA 2XV4S 3KP2A 5LEKA 2J5PA 3F6VA 3F8NA 2WC2A 4GYGA 4WXDA 4CYDA 1O3SA 5A2QZ 3ZPLA 4PGHA 4KNYA 1LNWA 1OR7A 1Z91A 4LLNA 2XAGA 1LDKB 2L4AA 2X0LA 1ZRCA 4A0YA 5HS9A 2Q0OA 3EYYA 3HHGA 1XN7A 1W7PD 3MWMA 2ETHA 1SD5A 4U0WA 1IXCA 2P7CB 4RB1A 3M7GA 2GCXA 4I7HA 1BI1A 1S8NA 3P9KA 1KQ9A 1J5YA 1ODDA 2PQ8A 3R61A 4YFNF 5LGUA 2EV5A 1QO0D 2VODA 1ZG5A 3GF2A 1TW3A 2VC0A 1LEBA 5E8GA 4MEXF 3ULQB 2CGPA 4E70A 3FXUA 3MQ0A 1WSUA 1P2FA 1WRJA 2XASA 1A04A 1FSEA 5DUIA 2WTEA 1T38A 2OA4A 3R6SA 2OQGA 3KLOA 1XGSA 2DQLA 3TQNA 2KJCA 5CVVA 2PN6A 4N0BA 4HDUA 1IZ1A 2E1NA 3JAMZ 5LGNA 5E1XA 2PI0A 1W7PB 5L3EA 2H94A 2K02A 4MEYF 3N97A 2EV6A 2RKHA 1KQ0A 1E17A 3E6MA 2W24A 3TDUC 2YX7A 4GGGA 4HOBA 1DP7P 4RAZA 1TTYA 3W6JB 2FQ3A 2IA2A 4Y13A 4H0EA 4HF0A 1R23A 3MAJA 4EM2A 4Q4ZF 2QQBA 6PAXA 5IT9K 2FMLA 2MA3A 2QENA 4HLYA 3AAFA 1IAWA 2LNBA 1G6NA 1WWXA 2NYXA 3K2ZA 3HRMA 4XLNF 1U5TB 5HDNA 2VBZA 3KFWX 1R1VA 2FBIA 1JE8A 4ZZDA 2VBWA 4P9FA 2ZCWA 1R1UA 3NQOA 4LLLA 3T8RA 1FX7A 1IUYA 2FNAA 2XAJA 4N9IA 4M9SA 4CICA 3DFGA 1H0MA 2OBPA 2IW5A 2A07F 3GYHX 2R3SA 2RGVA 3G3ZA 1MDMA 1S29A 2NS0A 3O2PE 5DD8A 5L3DA 2HTJA 3D0SA 2HQRA 3HUGA 2HFHA 4KYWA 3EYIA 3HIFA 4OMZA 1X3UA 2XGXA 4IRHA 2FRHA 2O3FA 3ZN1A 4WF2A 2OAZA 4KDPA 1XSDA 2LX9A 4HAMA 1OPCA 5EEGA 2ISYA 5J8CA 5FB2A 2YPRA 3K9TA 1ON2A 3KP4A 3TKYA 3R4KA 1IRGA 1DDNA 2EWNA 2V6CA 3J81Z 1KA8A 2QQ9A 3QRFF 2ZBKA 5ICEA 1FBQA 1FBSA 3IWFA 5AONA 5HLIA 4KFCA 3GZ6A 3ZN0A 3GW2A 5FO5A 3DP7A 5CVIA 3T5XA 3I54A 1XSXA 2M30A 3M1EA 4G6QA 2FE3A 3NRVA 3VOEA 2W85A 4G9YA 1D5VA 1KU7A 3E19A 4TV7A 3BY6A 1G3TA 2PG4A 1LDJA 5DYMA 1ZARA 5ERIA 3RKYA 1MJAA 5HDKA 5D5WB 3LQRA 3FMSA 2FBKA 3DV8A 1BYMA 2IVMA 3F23A 2VE9A 2QLZA 2NNNA 1EH7A 4FX4A 5D5VB 4A0ZA 4KICA 2HEOA 3E3VA 3B02A 1LVAA 1MGTA 3WTWC 3MFKA 2G9WA 5LRRA 1XDUA 4ETSA 4PCQA 4HV6A 1BI2A 3P7NA 1ZG3A 3OV8A 3H92A 2HWVA 1TBXA 1KGSA 1FWZA 5LBQA 1UFMA 3BJ6A 3O3KA 2XKPA 4P96A 5CYVA 5L3BA 5FLXZ 3RJPA 3KLNA 3IL2A 4UVBA 2ZO4A 3RPQA 1GVJA 2BV6A 4GCVA 3TGNA 1O7LA 4Z2YA 2H3JA 3KP7A 2Q8KA 1XCVA 1ZHFA 3HRUA 3K1MA 3R0JA 1U8RA 2DLLA 1O3RA 4IXAA 4LD5A 2ESHA 1U2WA 4KUMA 3V7RA 5TRDA 4A6DA 2QBYA 4GYIA 2IPQX 2XAFA 4HDVA 2GXGA 1LB2A 4RAYA 5D8KB 4KMFA 5FFZA 2AXLA 2RVCA 1Z6TA 2L01A 2KKOA 4A0XA 1CF7B 4KIFA 5E1WA 3SXYA 4YIFA 2V1UA 2EFQA 2XAHA 1RUOA 1U78A 2CFXA 4U7DA 2STTA 2ELHA 1UB9A 2K86A 1EH6A 1XDSA 4LG0A 2XUBA 3LA2A 1OYYA 4I02A 3QPHA 4JBAA 4L9VA 3TO7A 5D5UB 3FMQA 3BDDA 2Y0MA 5JVTA 2UXNA 1SMTA 1FC3A 1OYIA 3I59A 4BYYA 2O61A 3ERED 4IRIA 2V79A 3WGGA 2MBFA 1W4MA 1T6SA 2HQNA 3S2WA 2VBYA 2W84A 3KP5A 4HYEA 1QZYA 2HKXA 5BPDA 2HZTA 4EJUA 2IP2A 1QPMA 1R5GA 2P5KA 1BM9A 3TDZC 2IJLA 1HKQA 2VONA 4IRGA 5KK1A 4XRFA 3WTXC 1H9TA 2BEOA 4IHTA 1U5TC 3JSPA 3CO7C 3F22A 2P4WA 1FP1D 4GO1A 4L9TA 2GZWA 4YIIA 3TOAA 3WU1B 3K1NA 3WODF 4G7HF 1OKRA 1YW8A 2PEXA 2Z5UA 2OQRA 2V9VA 2CWEA 1SD7A 2VC1A 5DD4A 5HLHA 4B8XA 3BPXA 3FZVA 5DDGA 2M5WA 3JTHA 3WGIA 1Z6RA 2K4YA 3CTAA 2PMUA 5JI6A 2H09A 1R22A 5F64A 3SZTA 4ZZLA 2NRAC 2PMHA 1JHHA 3C18A 2CYYA 3P9IA 5DV5A 4HX8A 1S3JA 1S7AA 4XSXF 3RI4A 2MLKA 3V4GA 4U88A 1YTYA 5E8IA 3EQLF 5D8LB 3F72A 4XBFA 3I59B 4BHBA 3F8BA 3R0AA 2VN2A 2Q2EA 1HQCA 1B9MA 1B6AA 3F21A 2EA2A 1B1BA 1W5SA 1DUXC 5BOXA 4BAYA 2OZUA 1TW2A 2P6TA 2H6CA 2GIVA 3GUDA 3C1DA 3ROUA 2QM3A 3KP6A 2GA1A 4UVAA 4OIRF 2DU9A 5DCMB 2V1XA 1YS6A 1FSHA 2JRTA 2VT2A 1ZGJA 4EM1A 5IT3A 1FY7A 2X4HA 3DKWA 4ASNA 4WK8F 2GAUA 2LF7A 4OINF 3ZMSA 4EJOA 1SFEA 1USSA 3ZMDA 1G4DA 3WTUC 4R79A 5E1ZB 4MHGA 4A12A 3HSFA 3WTZA 2EV0A 5HLGA 2FOKA 4FX0A 3J80K 3DQVC 3LAJA 1BIBA 1U3EM 2QZ8A 5DCFA 4XSZF 1TNSA 1F4KA 1IN5A 2RC4A 2DPDA 1GHCA 5K1YA 2M1BA 3DF8A 4P55A 2H27A 2F5DA 2ACJA 1F9NA 1F5TA 2LSOA 4DQ2A 1ZAOA 5K5QA 4MTDA 2QQAA 3RYRA 2F2EA 4EMSA 2MD5A 1AOYA 1SD4A 4KT5C 4OU0A 1U5TA 5D5XB 4O3MA 2VOPA 1USTA 2FA5A 4PDKA 4CXFA 3KEQA 2A69F 3GO5A 1IF1A 5D6FA 4LGWA 4LMYA 1QW1A 1T39A 1R00A 3V7SA 3E6CC 4BNCA 3FXQA 3SFZA 1HKSA 1TQPA 2LF8A 3ML6A 1QBJA 3KZZA 2MLGA 3K69A 4OIOF 3GFMA 3ECOA 1ZH5A 2JZYA 3L7WA 4CZZA 1REPC 2ISZA 3DPLC 3ELKA 1J0RA 2PBIA 2ZFWA 2A61A 2PFBA 4EGYA 4S04A 2FEZA 2UZKA 3QOPA 5BMZA 2JT1A 2EK5A 1U6GA 3C3WA 2OZ6A 2DW4A 3E6DA 2COMA 3QU3A 1YG2A 4M6YA 3G73A 3GEZA 2PJPA 2ZMEB 3I4PA 4L9NA 2KIUA 1ZG1A 1FBUA 5D4SA 2LDUA 4M71A 2K4JA 1RUNA 3IHUA 1STZA 3CO6C 4HF1A 1MD0A 4A6EA 2Z33A 2A68F 3TO6A 1TNTA 4I01A 4EJWA 3RDIA 2A6HF 3BOQA 4RS8A 4M73A 1OMIA 4MGRA 2VOOA 3RTRA 3GVAA 4MTEA 4KN4X 2OD5A 4LB5A 1KU9A 1O3QA 4HX7A 4HZFA 1BI3A 3LWFA 4KMUX 1XMKA 2AS5F 2JPCA 1UCRA 1XD7A 5FFXA 3HHHA 3WE3A 3BJOA 1CGPA 4I98B 3EETA 3M8EA 2BE5F 3O6BB 1GXPA 4BHCA 4YFXF 1ZGAA 1FLIA 4ENMA 2BYVE 4GXOA 2K27A 3NEUA 3I71A 3SZPA 1BI0A 1Q1HA 1G3SA 3WTVC 2D1HA 3LFKA 4ON0A 4A5MA 5FD6A 1B59A 2FSWA 2FXAA 3HOSA 1IXRC 4AD9A 1EV7A 5E17F 4DNCA 4LK1F 5ICFA 2GXBA 4G94A 2W25A 3K1PA 1FYKA 3LQQA 2E7XA 1K79A 1HKTA 1W5TA 3ECHA 3QP6A 2VE8A 2W57A 2DAOA 3BWGA 3HTUA 1C0WA 4UV8A 4AIJA 2VXZA 1SAXA 4EGZA 1ZRDA 1BOAA 1V3FA 4D0PA 1T2KA 1FYLA 5KVRA 3R60A 2O8XA 4NQWA 1PP7U 4ENNA 4M9XA 5E18F 3IKTA 1UHMA 1HSJA 1I1GA 2JSCA 4IJAA 4ZH4F 3MEXA 1IW7F 3CLOA 3KCCA 2P5LC 2O03A 4LFUA 2OU2A 1HSTA 4O5VA 1FT9A 3V8LA 1UHWA 4WX9A 4I0AA 2STWA 4CGZA 3Q5FA 3IWZA 2O0YA 5ILVA 4PZJA 1YLFA 2L3DA 4HQEA 4RGRA 2FF4A 3TO9A 2P7VB 3DPTA 2XVCA 4UVCA 5H6RA 4R1HA 1D3YA 3FF5A 3HOTA 2FNPA 3WE2A 3CDHA 1HXDA 1OYWA 3BP8A 4P5OA 2ADUA 3HRTA 3E5UA 2YR2A 1ONVA 1ULYA 1ZLKA 3IC7A 4OOIA 5ILUA 3MHXA 3I53A 5A2QK 1KYWA 4HX4A 4LG0B 1TLHB 1HW1A 1HW5A 4ZYDA 2MC3A 3K0LA 3RKXA 4YG2F 3BJAA 2YU3A 5CJ9A 4WXCA 1KU2A 2CO5A 3CUQB 1QZZA 1HW2A 3U2RA 2DTRA 3V8JA 2L4MA 3KZYA 1XSVA 1SFXA 2FU4A 2KIFA 2RN7A 2NNYA 3GLXA 5BS6A 2HS5A 1P4WA 2RV8A 1KU3A 1LQ1A 5LHHA 2QWWA 4HBLA 4UNOA 2F5CA 3VFZA 1F1ZA 3KEOA 4U0VA 4BH9A 1XGNA 3LA3A 1SD6A 1ZRFA 2HDCA 4U0YA 3ZQ7A 1RI7A 3BPVA 4OIQF 1P4XA 4I2OA 5K5RA 4KIGA 4EJTA 3HRSA 3E6BA 4QLCU 1FP2A 3I64A 2H6BA 3P9CA 5AIPA 3B73A 1MDMB 4FT8A
chains in the Genus database with same CATH superfamily
3IRQA 5I21A 5KAFC 3ABUA 1BCMA 3FMRA 4JJBA 4V2SA 3HOVJ 2P4RA 3L09A 4ORZA 1NPRA 5GMKl 4B3AA 2F1LA 1TUGB 3JV3A 1S9HA 2KPMA 4EJVA 3GBGA 4KT6A 1F1BB 2L0AA 1YW7A 4EV0A 4EMKA 5KYUB 3M4GA 1RAHB 2VKHA 4FTHA 3QWXX 1WH5A 4RB2C 1Z9QA 2RAEA 3UKGA 2GOXB 4H4KC 1BBYA 3H9GA 1FZPB 4LDXA 1Y0NA 1Z7UA 2HCKA 2V1DA 2JVHA 1S7OA 2QVOA 4KH0B 2ZC2A 4S05A 2X4XA 2YU9J 4XONA 4YTLA 4NS5A 3G6ET 3BZCA 2EIMH 3EAEA 1M5Q1 1N8RC 3CC7A 1R58A 3L1AA 1GBRA 4MQVA 5LRSA 4IUPA 3UWNA 3A1YA 2R93J 2ED0A 4Z88A 2MF2A 2O4XB 3G1JA 4B43A 3DPUA 4FHTA 5IHIA 1WKMA 3I56T 1WHHA 2D9TA 3EG9A 3FIFA 5J1UA 2JTVA 3EUHC 5KYNA 4I0BA 1FNNA 1MJ9A 4RDUA 4Y15A 3E97A 5M5WJ 2F5EA 1VQPI 1AHJB 1SF9A 2C0TA 3MEUA 1OQYA 1RIOH 1TT0A 2ZKZA 4Q5SF 3S3NA 1WXBA 1YFNA 2VQHA 4J9BA 2XGCA 3CCMI 2E1CA 1XB4A 3BROA 3EG3A 1K9MU 5FKNA 1R5HA 2XU8A 4C8QE 4WCGA 3OOPA 2MWOA 4M7DA 3T0YA 2GA2A 3VSKA 3CCJA 1E0EA 3NGPA 2L2PA 5JHUA 1KHIA 4OWRB 3AG1H 2RA2A 1MSEC 1W2BS 1NJIC 1Z7LA 4DW6A 1VNDA 3CUQC 1X58A 5J4VA 2O88A 2AHJB 4M6XA 1ETXA 2K5FA 3QOEA 4BJ5C 3S2DJ 3I9QA 3CCQI 3JSOA 3ZMVA 3W2VA 3WTYC 4C92F 2DPUA 1YHQQ 2VXFA 1YQAA 4BGDA 3OYFA 2MAMA 2EA4A 2CH4A 4UHTA 3SEZA 3HL2A 5GPAA 3RKWA 3Q9SA 4LLGF 1Y39A 1YJNI 2BTTA 2ZCFB 4M72A 2PQWA 2WSEE 3Q1JA 1Q7YR 2KT8A 2QSGX 5C44J 5GAOq 1TQIA 1LOJA 2KRCA 2EQRA 4ZDPA 1K78B 1BC7C 2IS6A 1S5LC 2K9NA 2BBYA 3PNTA 2QUFA 3JRZA 2EB7A 4NHJA 4B6MA 1VQNT 3H36A 1K0SA 4OGEA 4ZYGA 1A5JA 1W1FA 2ROTA 3F3XA 3TP0A 2MK5A 2DFFA 1H3HA 3RIRA 1JEGA 2B7EA 1K7AA 2HSEB 1B4AA 4RGSA 4WWCA 1K73C 4N4NB 4OMYA 3GFJA 1BB9A 3I5SA 5M3MJ 4E7IA 1AZGB 5F1RA 3F8CA 3EG9B 3HKSA 2UXXA 4OMMA 1YI2T 4C8QB 1FYMA 3MP6A 3T8TA 2O9SA 4D7MA 2EQIA 2XROA 2J7IA 2O6GE 2VB6A 4M78G 3ASNH 4HNVA 5EDNA 4RTWA 3U23A 3H0FA 1DGRM 1UGSB 2DJNA 3DXJF 3WG9A 2E10A 5J6XA 1S7EA 4UV9A 3CC2I 3VPRA 2ZJ2A 3LW5E 1Q82C 4M7AF 4M75C 3QHSA 4HQMA 4AYBA 1YO5C 2V26A 3RERA 3CC2A 5HDGA 4BXFA 1Y0MA 3PT9A 3G1OA 3QWYA 1J2XA 1I5ZA 4RUGA 1OPLA 2DDBA 5F27A 2DL4A 1J3TA 2CG4A 3GMEA 1ZR4A 1R8OB 4CYCA 4IHVA 2COZA 2CQKA 4NUBA 2MD0A 4BXUA 5LEJA 2Z9OA 1K61A 4OIPF 1WQWA 2DXBA 3FHZA 1VI0A 2F5VA 4ZYAA 4U7BA 2K3XA 4M7DF 2J6FA 5CQXA 2ATCB 5FGMA 2X51A 2H8WA 3FM5A 3ZXSA 5HNHA 3OS1A 1JXSA 1YI2A 1V4RA 5KCHA 4OB2B 5CR2A 4JK1X 4A5NA 3M8JA 3CMMA 2IGMA 5H6QA 3CCJI 1LFBA 1IZ6A 3M5AA 2YSRA 1MZBA 5IY5H 1T0FC 5FW9A 3SFMA 1VQKT 3QAHA 3U9GA 2E70A 1NK3P 2IS1A 4AWXB 3VS3A 4WXHA 4CCJA 4DBHA 4M7AC 2GWRA 3CLQA 3L2WA 4R8HA 2O4XA 3M0PA 1K83J 3UATA 1KQSA 1VTNC 1MH4A 4BDZA 3A98A 4FT2A 4QW2A 4M9ZA 2L3PA 3QDFA 5M5YJ 4J9CA 4KGZB 2HYJA 3PQJA 2GTOA 5DCMA 5CVJA 5TGTA 3BZ6A 4HVWA 4NL2A 3JAME 1HSQA 3JCMQ 1LE8B 1KFZA 3PIPF 1M8MA 2FBHA 3FXJA 3WU2C 1OCCH 5L3CA 5FLXK 1WJQA 2E3IA 2H3EB 4X6AJ 1K9MR 4PJOD 3AL0C 1PUEE 3Q0WA 3EGDA 5L3GA 2RQUA 4BQNA 5D6YA 1QVPA 1R1TA 2RQWA 3M07A 2CSOA 3ZCOA 1VQ5Q 3HC7A 2HOEA 1PD1A 1PKTA 2COBA 3S3OA 5LFAA 3UR3C 1D8KA 3FBIB 1JGSA 3I35A 1JUMA 3CJTB 3HZJA 1IREB 1RZ4A 8ATCB 3TVTA 3ME9A 3FHNA 2E5NA 5ILSA 2ZPIB 1ETWA 4ZDOA 2A6TA 2LTOA 5I22A 3CCEQ 4DOWA 4BD3A 1G3YA 4QSHA 2DJIA 4AIKA 2QQSA 4ESRA 3PFIA 1BK2A 5C0MA 4G6DA 3ZOBA 1T0HA 1SAUA 3HPHA 2IT0A 2XHKA 1UUEA 1LDDA 3CC4I 1P7IA 2VJIA 3I0TA 3S14J 1WFWA 2OAUA 4FYWB 2IRFG 2LP0A 5H20A 1KQ8A 1GXQA 3CC4A 2VKNA 4HVUA 2DYIA 4M78C 2OCCH 3X26B 4K2EA 3M0UA 1TOVA 4F14A 3QYEA 4I09A 1VQ9T 2JVGA 4D8KA 1VQ7T 1BN5A 3W6VA 1E3PA 2XICA 3D1NI 1U1TA 4ZN3A 2RDPA 4ELZC 4M77C 1JT0A 3PVQA 3BG9A 2HYFA 5E20A 1OPKA 2EJGA 2DPPB 1DGWY 4XN3A 3JCMb 2VGMA 2PX9A 1YFHA 2EFWA 2D45A 5IH2A 2ZGWA 1QCFA 4M75F 3ZFJA 1K73U 2HR3A 2ELKA 2WAFA 1YJWA 2KRFA 2NOGA 3I5RA 3JSCA 3M0RA 3M4YA 1G3WA 3TCJA 5LJ5f 5FD5A 4BEHB 4L5JA 3G1LA 4ESBA 2R5YA 1PWTA 1MBKA 4AVPA 4J9FA 1PJRA 1NHAA 3MZYA 3NWSA 3U1DA 3MZHA 1R4NB 2QTXA 2QYOA 3IH4A 1AWCA 2OAWA 4NOYA 3ABMH 1VQ9A 1E3OC 1CKAA 3ZMTA 1XJWB 2EJFA 3OWTA 4J83A 3ABTA 4LDUA 3BTLA 3BR2A 3CCVT 3LSTA 2ESNA 2EIKH 4MQ9F 4OB3B 4ENKA 3CMEA 4JQFA 5BPIA 1KJWA 2KGTA 1YJNQ 5GAHJ 1B8IA 1O3TA 2D8JA 2V8IA 3C95A 2KRHA 1WNLA 4CZCA 2DQRA 1Q7YC 1K6OA 4LDWA 3D5LA 4DBRA 3RESA 4C0FA 3VS7A 2R7SA 3KZIC 1T56A 3J7YJ 2L2OA 2ZSHB 5AIQA 5FLVA 4LXCA 2EFOA 4ZYEA 3ZQFA 5K7HA 2Y48A 3COAC 1XS9A 1IGQA 5B66C 3H41A 3QO3A 4L6V5 1RAGB 1UJYA 3RMSA 2R0QC 1OV3A 4UB8C 2VGNA 2IEKA 4GLMA 1R6RA 4JUVA 1IXSB 1UGVA 3OS0A 3OS5A 3ZMZA 1Y96B 5F6FA 3CCQA 3QPSA 4HW0A 3PIOF 2K9SA 2JTEA 2RJCA 1Q81C 2Y69H 5LJ3j 1DPRA 2RHYA 2QCOA 2LKSA 3CBPA 5CQYA 5D6XA 1V54H 1M3CA 2PLYA 4HSRA 2K9GA 2DMTA 5LLQA 1J75A 1DPUA 3BQYA 3VKIA 4EQQA 2FHDA 1K73R 2XSDC 3EUHA 3WTTC 4BY7J 4LD9K 2EFPA 1VQ7I 4EM0B 1NK2P 2MSYA 1QNTA 1FMKA 3DEWA 1K4SA 4AFQC 1S72A 2NLUA 1VQOQ 4CC4B 4CO8A 2XRLA 3KETA 3CC7I 1WJAA 1J59A 2DD4A 1WJEA 2XAQA 1J9IA 2ME6A 4IIMA 4FETA 4J9HA 1S6LA 3I55T 2K79A 1LJ9A 2EQKA 5EF6A 2EPDA 3KEYA 3BLYA 3DEEA 4J9IA 3OL4A 5H2FC 4PJMA 1G2BA 2O31A 4NB5A 2UWMA 1N8RU 1V5FA 4B3XA 2CP2A 2E1MB 1ACIA 3PQKA 2WY8Q 1O7FA 3CDLA 3HHTB 1VQ6I 2ABLA 2BE9B 3A8OB 2R5YB 1DU0A 4BACA 2R4GA 4Y17A 4ZYHA 1KC8U 1SRMA 3VODA 1PUFB 1FIAA 3PFYA 4C92C 1Z05A 5KYYA 4Q47A 1NG7A 4P9UA 3MZ8A 3CF5F 2CP6A 3BG7A 4KIBA 4UB6C 4C8QF 1WJ5A 2DO7A 2HBPA 2E5ZA 3E0JB 2JQ7A 2IGNA 1I6XA 4LIVA 2QSFX 5CKTA 3GFIA 2E19A 2WWYA 2QBYB 1B34B 2AK5A 2CH4W 5GMKi 3NAUA 2IG0A 2M0YA 1Q1VA 1VQLA 1ZBXA 4C8QA 1H92A 1FYNA 2CUDA 1P6RA 5GMKm 1YIJQ 5HS8A 3EG1A 5BNGA 2CUJA 2Y31A 3CC4T 4ENJA 3KE2A 5IYCJ 4DZJA 3G6EI 2P8TA 4XRSA 3S1QJ 1D0ZA 2DK8A 4J00A 1N25A 2X6XA 1OCTC 1C0MA 4PK4A 5LGTA 3GCMA 4G7ZF 1SPKA 2LFBA 2JUGA 1ZBJA 1MMNA 1UE9A 5LHIA 4OP0A 3SZGA 1M90C 1IRFA 1JTXA 4EVIA 5F08A 2K5CA 5L8RE 4N4HA 2W4SA 4XRMA 2HL5C 3EG0A 1D8JA 3FBNB 3GFLA 3U21A 3OMCA 2QQ8A 2K4BA 1SFKA 2K5IA 2X1DA 2FYKA 3VS1A 1UJ8A 4GDFA 4LD6A 4C8QC 4CHUA 2BGCA 4GY5A 4C5IA 2CU7A 3I58A 1RAFB 2KI7A 4E6RA 4IVNA 2EVRA 1V1CA 2JN0A 4LK0F 1AVZC 3SHFA 1QGPA 4WCIA 2DFIA 2JM8A 5GANg 2DETA 3IRRA 1W6XA 1Q86R 4A3BJ 5CLSA 3OYAA 4C5EA 1VQPT 2E3HA 2RM4A 4L18B 1JXMA 4CCMA 1Y1VJ 3HKZN 3QU6A 1RLQC 1MJBA 3QUIA 1WXTA 4PJOE 2MW8A 3GF5A 4A4HA 2DT5A 5JR3A 3CC2T 1YS7A 2LCLA 3PL8A 2XKOA 1MUZA 1X75C 4LNPA 1O75A 4HT9A 2W0ZA 5EG2A 2M45A 2R7UA 3CMYA 1QQIA 3T1BA 3WGHA 2VKEA 1P4AA 3L9FA 2JVVA 2KIMA 2P6SA 4II2A 4IHYA 4N4GA 1SMYF 1GRIA 4IF4A 1VQKI 3IV5A 2L02A 4UXNA 2DBMA 3DB3A 1M1FA 2CS3A 4MNUA 2L9NA 2OC6A 4F7ZA 4PJOA 3TBIA 1QZEA 2KZGA 3FK7A 1RAEB 5J39A 3L00A 2AZVA 2ZMEA 3I5UA 2KR3A 2K7LA 4FQGA 4OGCA 1BC8C 4CCNA 4M3GA 2X4WA 3JW4A 3CJNA 5KAIC 1B9NA 1YCSB 3RYPA 3QP5A 3H35A 1RR8C 3ISPA 3VEPA 3GZ5A 4RMNA 5HS7A 1PP8F 4G7OF 2CKKA 4M7AB 3R6OA 1ZSGA 1JJ2A 1TWHJ 5LJ3d 4FU6A 2IA0A 3A8LB 2DEQA 2JPBA 4IOAF 2A6EF 5GAMh 3LAPA 1FIPA 1M2VA 1LPLA 4R56A 2M8EA 1ETKA 1IRXA 1U3OA 3TSWA 4C8QG 3IKVA 2ZNZA 4NBQA 4CCLA 1ZK8A 4L0ZB 1VYUA 2K3BA 3GWZA 2Z0WA 1ON1A 4JOMA 3QDRB 1XCBA 2AIRB 3CC2Q 2LKPA 2VT3A 2Z99A 2CV2A 2L54A 3CCLA 3FKIJ 3WU0A 1P92A 2XIGA 2W1OA 4B1RA 3HTRA 4ESFA 1MBFA 5EG0B 2QXFA 2B0LA 1J7KA 1DU6A 4IHSA 1X01A 5DUKA 1R9TJ 2JW4A 2JS2A 2KT1A 1YIOA 1H88C 4EMKC 2NAZA 1N75A 1HC8A 1WGSA 3X28B 4HV5A 3G1MA 4BJ6C 2R7FA 1R7JA 5J8FA 4LJZF 1Z9CA 4BI3A 3JCMd 3CCSA 1XMXA 1YI2Q 1ZQ3P 2Y0SN 1IDYA 3JAMK 5E3LA 2EJRA 4L0YB 2VIXA 1UAAA 2NVTJ 2XI9A 3OMGA 1YJ9T 3PIOA 2KSSA 4DGWB 1UECA 2O2OA 1QHHD 4CA0A 1T0FA 4IPAA 5IYBJ 3MKYB 1FOKA 4RGXA 4BHPA 3PMIA 4A3CJ 3T9NA 2LRDA 5I2MA 1I27A 2EYWA 1XGOA 1M2OA 3FXRA 2HYGD 2DE0X 5GTHC 2CJJA 4HCZA 3CXCP 2HQHA 2ZPBB 4O6JA 2HQAA 2WADA 2EQJA 1FPQA 3MCAB 3JCMc 2MYSA 1D0XA 1MMDA 2DBBA 2ZXJA 1Z1DA 3OR1C 3F6OA 3N4MA 1EF4A 1RPWA 1NTCA 2RF0A 3F8FA 1H9GA 3F8MA 1LCKA 1D1AA 5C4XJ 2NUZA 3FX3A 5KHDA 3GBQA 1UG0A 1T98A 3LNQA 2EBPA 1RNLA 2RQRA 2VBXA 3GXOA 3MEVA 1IN8A 2WV0A 4B09A 4GRIA 4FYXB 3RR6A 4DEYA 1R36A 4F7UA 1EH8A 2BVLA 3J7AO 1EX4A 2HKOA 3CMET 4M74A 1VQKA 1R71A 1XGMA 4MDXA 4RMOA 3REOA 1Y56A 1ZREA 2ID6A 2RQPA 1DQUA 3MMYB 4I6ZA 4RGUA 4BQQA 2O8KA 1R77A 1IHWA 1IN7A 4LB6B 1KD1C 1JRIA 1SFUA 3M3YJ 1X6OA 2NUPA 1ITYA 1L0OC 3CCRI 3EUAA 4EEFG 4E7ZA 5ICGA 1D1CA 3J80Z 1YI2I 3RKQA 4L5IA 2CW0F 2LTPA 2R7VA 1GCQC 4QKUA 1KG1A 4PL6A 5GAN8 4QQDA 2E35A 4HCBA 4E47A 1I1SA 4PGGA 5K5OA 2VASA 2L7FP 2FPEA 3QPTA 2A5YB 2GQIA 1W5CC 2G3RA 2XRNA 4L9JA 1VQ9I 2CV0A 3A2KA 1GV2A 1X1PA 2FRYA 4E7KA 1TQMA 2Z3YA 2CT3A 3GTMJ 1MKMA 1RC9A 4CDGA 2F5FA 1PC0A 2KRMA 1QCOA 2RNJA 1SVOA 4A3MJ 2PTKA 1YE9A 1AKHB 1BJAA 1RRJA 4KULA 1IB8A 4FE7A 3UDCA 4AIHA 2GTJA 4XKBA 2CZ1B 2K2MA 3TU4K 2P0WA 5FU6C 1EKEA 2GFAA 3S15J 4Q48A 1RETA 3DTIA 1WI7A 4PLIA 5IT9Z 1YX5A 2VQCA 3FWEA 2QDLA 1N9RA 2DYRH 3V8KA 2HD0A 3FIWA 2R7XA 2KJBA 1WI9A 3S93A 2AO9A 5M3FJ 1W36C 3ZGKA 2R7DA 2DA5A 1VQNI 1OYXA 2KFDA 5LJ5g 3CUQA 5FKLA 2MH9A 3J81K 1CF7A 3PNVA 2GBQA 1MHNA 2HGCA 5DM7F 5GAMg 3DU6A 5B5EC 4HA8A 1WHKA 2DXTA 2R92J 4RTXA 1YJNA 4CSWA 2XIDA 1HYOA 4RBOA 3M8FA 1YITI 1IN4A 2FD5A 3EDPA 2DK3A 3KFVA 3CCRQ 2HTSA 1IO6A 2X6WA 3E5XA 1WQ2A 4ZGJB 2D1VA 4KN7X 4RB0A 4C2UA 2X1EA 2G7HA 3A0BC 3H3UA 2PNIA 2COYA 2SEMA 1YYVA 3EFSA 2R7RA 2JMCA 3A0HC 4XLAA 3SQNA 2XD0A 1W4SA 2EYZA 3WTSC 3VS0A 4PJLA 1W2BP 3CD6Q 3MCZA 4RAGA 4KA4A 3RPUA 4A69C 4UUVA 5FKKA 2VPLA 2IPOB 4MZTA 1OI1A 2LQWA 1XMAA 3HOZJ 2FQ4A 2XGEA 3CP8A 5IP6A 1YHQI 2A08A 2LJ3A 2NYSA 1X3ZB 5HOOA 3GTLJ 4ABZA 5CVUA 4N9HA 3EUKL 4AIDA 2MH2A 5D6EA 3MKWB 2TDXA 4BXXJ 1O57A 2EBIA 3HSEA 2OTLA 4XKWA 2X1CA 4BQAA 2RI5A 4BDYA 5DEQA 2EYQA 2DI3A 1WZ2A 1S72Q 1ZYRF 4Z6YA 5D4RA 4BB7A 5BQTA 4YFKF 3LOCA 3BCAA 4F7UB 2E36A 2IS2A 1QQJA 3H9JA 2DIGA 5HY6A 2ZZDA 2Y75A 2E7WA 3V7CA 2DKGA 3JCMJ 2M87A 3DLMA 1SEUA 4M77B 2LLKA 5ICCA 4XORA 1ZN2A 2CUFA 3GX4X 1ZUUA 2D2WA 5CVRA 4XTWA 4M77E 5HVQC 3K4CA 2EZHA 5K7ZA 2IS4A 3NFCA 1ZELA 4XLHA 3E5QA 3JTGA 2RQQA 3CXCS 1YIJT 1KD1R 2YX4A 2VI6A 4G8XA 4GFBA 4D5FA 1D3BB 2CUBA 1PDNC 1LEAA 4QWQA 1OULA 3A8HB 3CC7T 2EIJH 2A37A 1UDLA 3L1PA 5ED4A 1KQ1A 2JJ7A 3OOUA 4PSWA 4E7LA 4A3JJ 1YWPA 1Z3XA 2K6DA 3MKZA 2DXIA 3VB2A 2CGHA 3Q0VA 2ECZA 3I55Q 2IA1A 1VQ4Q 3OSGA 1NJIR 4V2FA 1JKRC 4IO9F 2K5LA 3EHQA 3M0TA 4ZTJA 1KQSS 1ERDA 3ER0A 3Q3SA 1EZZB 4M78F 1JO8A 2OCEA 2G0EA 2GQQA 4FM4B 2DNUA 3QQAA 1N5ZA 3GPLA 5L3FA 3ZP5A 4RM3A 4BL0B 1PRMC 2LNVA 5GAOp 3K4LA 5KYXA 5JFRA 3RDVA 2VPRA 1NZ9A 1ZLJA 4XLPF 1IN6A 3OYJA 1BIAA 1VZ0A 4M7DB 2NOJB 3DEUA 5TJJA 2LDMA 2PMZA 3KYCB 3TQ7P 4OAZA 4IZZA 3K4MA 1QVTA 2XMFA 3LA7A 1H8KA 2HSPA 2YUOA 4QQGA 5DLOA 3HPGA 5EEHA 4FCYA 2FB7A 2BUDA 2FPFA 2WB1N 2HMAA 4KRTA 2L5QA 3KP3A 3SWNB 2YRCA 2LC2A 3M56A 3E9FA 2FMYA 3VJPA 4XOPA 1QVUA 3RZOJ 2DK5A 4MLOA 4RB3C 2WACA 3CCUQ 1E2XA 4M78B 3ZMUA 2KDSA 4A2UA 2A3SA 2G7UA 5FWBA 3Q9VA 5LL6S 3GOXA 1A6IA 3C7JA 3I56A 1HBXG 3FISA 3L2CA 1W7PA 3CCVI 3HSRA 2LBFA 5IPAA 1K8AU 3E9GA 3LSRA 1VQ4A 1ZSZB 4HLXA 2VV5A 3JCMh 3W6KB 3CUOA 4XLEA 4PFZA 2F2WA 4XLCA 3HYIA 3A8GB 1IO2A 4M7AA 2EAYA 4ESJA 1L3LA 1K78A 4J5YA 5IP9J 2ZNYA 1HK9A 1KYZA 4HXJA 1BJZA 4D5CA 2JJ9A 4DYRA 3H3ZA 1TXQA 1YJ9A 3S6WA 3W2AA 4BU2A 5D7UA 2EFIA 2WA0A 4FW2A 5GJVB 3M9AA 2J5OA 2OTJI 3TSZA 1JHFA 4XLFA 4HF2A 2E5QA 2L89A 3TOBA 3FM3A 1KZHA 4DYQA 1OZ2A 2XG8D 4A3LJ 4JS4A 2EFNA 3HG9A 4ZDLA 1JB0E 1XTDA 3P8HA 1HF0A 4RTTA 5LHGA 2G6FX 4LE9A 2DL3A 2P5VA 4HEA2 1MMGA 2J6OA 3PNYA 2CW8A 3JR9A 2DILA 2LX7A 3FDYA 1YW9A 3RCOA 1VYTA 3G7ZA 3QYBA 1Y0UA 3KX2A 3HTSB 2MWPA 1SVLA 4MFEA 3SJMA 3BR1A 2C6YA 2M3AA 2J05A 4XQ3A 2KDOA 1VQ5A 2YUNA 2XV4S 3KP2A 1M1EB 2V7FA 3OBYA 5GAGJ 5LEKA 1RL2A 5D6WA 2R7QA 2D1XA 2J5PA 3F6VA 1QKXA 2P84A 3AG2H 3F8NA 2WC2A 1X43A 3AG4H 4GYGA 4J9DA 4WXDA 4CYDA 1O3SA 5A2QZ 5IOYA 4FSXA 4JRQA 4M78E 3JRHA 1OFCX 3ZPLA 2LREA 2GFUA 2VQGA 1ZSZC 4LITA 4OB1B 3CCJQ 4PGHA 3U1KA 1JT6A 4KNYA 1WCMJ 2JK3A 4X9DA 2BZYA 2MOXA 2K9MA 1RKTA 2ZPHB 3DKMA 1LNWA 3LSIA 2DXUA 3CCLQ 2M8GX 1OR7A 3WXMB 1Z91A 4LLNA 4OB0B 2ZB9A 2XAGA 1M90U 4PFPA 1JJ6C 1SSFA 1LDKB 4KGVB 4BE1A 1Z9ZA 2L4AA 2X85A 3QIIA 1BR2A 2X0LA 4YELA 4KITB 3AFHA 4C3HJ 3OYDA 1ZRCA 2VYTA 3A5ZB 2XGDA 4PJOB 3EFOA 1BU1A 4A0YA 5HS9A 2HAXA 2CW7A 2Q0OA 3EYYA 3HHGA 4V2GA 1XN7A 2R58A 1W7PD 4A3FJ 1V5GA 4NNJA 4A3GJ 3J7AY 2P81A 2VL8A 2ETHA 3MWMA 1W0UA 1XQHA 1Y71A 2WSFE 1SD5A 4J9EA 1I50J 4U0WA 4F17A 3BDUA 4QIWN 1TUCA 4MIMA 4J6XA 3BR3A 4NC7A 1IXCA 3H5RA 2P7CB 4XK8E 4RB1A 1WPYA 2X3WD 5I11A 3JB9F 1ABQA 1B3QA 3M7GA 4FYVB 2GCXA 2KE9A 3SEQA 4I7HA 1BI1A 4RM2A 1S8NA 3P9KA 1HCRA 1KQ9A 1UGPB 1SHGA 2LNHB 1J5YA 3BE3A 1ODDA 2PQ8A 4BUPA 1FOWA 3M59A 4M7AE 2DL8A 3CMEQ 1K76A 3PFSA 2CZ7B 4XU3A 2EQUA 3R61A 3JREA 2E5KA 2EKHA 2GBYA 4YFNF 5K7FA 2LY9A 5LGUA 3CQZJ 2EV5A 3FJPA 2F2XA 1QO0D 1VQ7A 5GMKj 2VODA 1ZG5A 3GF2A 4XRSG 1TW3A 3JRIA 2VC0A 2DZCA 3C0CA 2NXNB 4D9JA 1LEBA 3CPWS 2BXZA 5E8GA 4Y3OA 2NVXJ 1Z3YA 2DTZA 3OYGA 4MEXF 3ULQB 1YP5A 2LP5A 2XK0A 2CGPA 3H9NA 4E70A 3FXUA 3FXOA 3MQ0A 1NYGA 4NDLA 1WSUA 1P2FA 3PGGA 1WRJA 1VQ8Q 2VJ5A 1TU0B 2DIQA 5CQGA 4EIKA 4W1UA 2XASA 1TC3C 4QPOA 3GLLA 2RB6A 2XKOC 1A04A 3FXKA 4PJNA 3CCMA 1FSEA 5DUIA 3C2BA 5GAMf 2WTEA 2E71A 1FTTA 1Q81U 4OMPA 3DBLB 1T38A 3CPFA 3CCQT 1LFUP 3CQTA 2OA4A 3R6SA 2WAEA 1SKUB 2JA5J 1A0NB 2OQGA 5KE3A 3KLOA 2RJEA 5GAOl 1XGSA 2DQLA 3TQNA 1M1GA 5GAMe 5CKHA 4IUTA 3J7AF 2M0MA 3HEFA 2KJCA 5CVVA 4CCKA 2QA4Q 2D6FA 5GP9A 4IUUA 5LJ5e 3CF2A 1HLVA 4A54A 2IGOA 2PN6A 4N0BA 3EH1A 3ZQHA 2FZCB 3CPWA 1GCPA 2A7YA 4HDUA 1OOTA 1IZ1A 2GQVA 2E1NA 3JAMZ 5LGNA 5E1XA 4G12A 3NHNA 2VJJA 2QGUA 2PI0A 1W7PB 2C0IA 3DB4A 5L3EA 2BY1A 3GTOJ 2AZSA 3CCUI 5JLWA 2H94A 2K02A 1KC8C 2GIZA 4MEYF 3N97A 5F0CA 5GPCA 4RLFA 1PCXA 4OMQA 2EYYA 5F0HA 2FEIA 2ELJA 4RA2A 1MGQA 2J6KA 2EV6A 1JU5C 1VQMA 3L2QA 2HDAA 1U1SA 3OIQA 4C0DB 1A6QA 4XICA 1Y8QB 1TL8A 2JM9A 1QMCA 1BR4A 1IC8A 1NG2A 3MO8A 2XF7A 4AFZC 2ZAEA 1NG6A 2RKHA 3G4SQ 1KQ0A 1E17A 3E6MA 3DLAA 2EINH 2CQXA 3HGGA 2HQ5A 1SHFA 4R55A 5KYWA 4DA4A 2W24A 3TDUC 4E4HA 2DTIA 4FT4A 4C92A 4ZN1A 2DL7A 1UG1A 1I39A 3CCEA 2YX7A 4GGGA 4HOBA 1DP7P 3H5NA 4RAZA 4J6WA 1TTYA 1VQ5T 3W6JB 4JX6A 2ZJRF 1D3BA 2YWWA 2FQ3A 2VUBA 3AT1B 3GNFB 5KE2A 2C06A 2IA2A 2DA4A 1AWXA 4Y13A 4H0EA 3SDBA 4HF0A 2KEAA 2FUG2 2BXYA 3CCVA 1WYXA 1R23A 2L3SA 3MAJA 4M3FA 4EM2A 4Q4ZF 2F2VA 2QQBA 1LE8A 6PAXA 3E2UA 4RKUE 5IT9K 4AMCA 2FMLA 3JCMP 3A01B 2MA3A 1AOJA 1NYFA 2QENA 4HLYA 3AAFA 3BR6A 1IAWA 2LNBA 2RK2A 3VSLA 2EKOA 2OJ2A 2CUZA 1G6NA 2QKMB 5HODA 5A2QE 1WWXA 2HVRA 2FOWA 1WJFA 1U9OA 1AA7A 2NYXA 2WAQN 3K2ZA 3HRMA 2DVJA 2MIOA 4A4KA 4ELYC 2LY2A 1U5TB 2JN6A 2HOAA 4XLNF 5HDNA 2CQNA 2VBZA 1B72B 2JS0A 4F91B 3KFWX 3LSKA 5M5XJ 1W0TA 1R1VA 1OCOH 2FBIA 3TP3A 3JCMW 1JE8A 4ZZDA 1M1KR 5F0FA 1YJWQ 1RAIB 2LOOA 2VBWA 4P9FA 3MKDA 2LQKA 2ZCWA 2FRWA 4KBMB 2KAFA 2XDPA 1R1UA 3FKJA 2QG9B 3NQOA 1X2MA 5FU6B 4LLLA 2Z16A 2XC7A 3BDLA 4PNOA 3T8RA 1G2HA 1FX7A 1IUYA 1NLOC 2RQVA 1YOVB 2RI3A 1BCOA 2FNAA 3OR2C 2XAJA 4N9IA 2HPMA 2CSQA 1Q81R 4ATOA 4M7DD 4M9SA 4DYCA 5J47A 4CICA 3DFGA 5DM7R 1H0MA 3K70C 2OBPA 4RAFA 4IHWA 2KYBA 3I55A 4F04B 3CCSI 2IW5A 3BZKA 3Q0UA 1U06A 2ZXHA 3DTKA 3GZNB 4W97A 2A07F 3GYHX 4M75E 4MMKA 2R3SA 4HNTA 2W48A 2LMDA 5EGOA 2RGVA 4FIBA 3G3ZA 4NL3A 2V1NA 1MIJA 2AQFA 1MDMA 1S29A 2NS0A 1G59A 1XOVA 4J7FA 3LSPA 4M75B 3O2PE 2W82A 1UZCA 2R5ZB 1X19A 4ZGEB 5J3LA 5DD8A 2HNHA 5L3DA 2RK1A 3H0IA 1FMVA 2LCCA 4BE2A 3HOYJ 2HTJA 1SG5A 3D0SA 1X6GA 1TWCJ 4EMGA 5LJ5h 3ZQIA 1G5VA 2A5WA 5KYUA 3EGDB 2BIVA 4CI0C 2HQRA 4KISA 2RJFA 1DP3A 3HUGA 2DA3A 5FROA 1RLPC 1WX6A 2E1HA 3CMEI 1JI8A 2HFHA 1OISA 4KYWA 2WV1A 4BBRJ 3OQ5A 4Y91A 3ZEHA 3EYIA 4F52A 2H1LA 3HIFA 1MSFC 4OMZA 3NARA 1X3UA 2XGXA 2DMOA 4IRHA 2FRHA 2O3FA 2LJ1A 2XF6A 3I56Q 1JJ8C 3ZN1A 1I8FA 2RHXA 4JRIA 2PUKB 1MBHA 4A93J 2PMZN 3P5JA 4WF2A 1FTZA 2OAZA 4N0AA 3PTAA 4KDPA 1XSDA 2I0NA 1IV8A 2LX9A 1QWFA 3QZ9B 4HAMA 2IGKA 1OPCA 3AHUA 1X3WB 5EEGA 1H8AC 2ISYA 2JA7J 1TZLA 4M4ZA 5J8CA 5GAMd 3ESWB 5FB2A 5LJ3h 2GXAA 3VWBA 2YPRA 4Y28E 1VOMA 2E4HA 1WHUA 1QKWA 2KYMA 1TWAJ 2FL7A 3K9TA 1ON2A 3K4NA 5EC7A 5CAIA 3KP4A 3TKYA 1MNDA 1ZTRA 3L42A 3THKA 2YS9A 3R4KA 1IRGA 1DDNA 2F48A 2LC4A 4BY1J 3X25B 4DOZA 4Z02A 2EWNA 4HKEA 2V6CA 5CKEA 2LRQA 3J81Z 3D5RC 2NS8A 2IBDA 1JKOC 3MD2A 4CYCB 4PSXA 3TW7A 4AU7A 2L7ZA 2VLAA 2B9SA 1KA8A 3R6NA 2BKDN 2QQ9A 6AT1B 3QRFF 4M75G 4PLLA 2M16A 3SWNA 1TSFA 2IVWA 2CP5A 1NBEB 3HM5A 5IOZA 4X34A 2ZBKA 2E1MC 5ICEA 1FBQA 1QCNA 1FBSA 2BY0A 2HEQA 3NTIA 1YIJA 5B1AH 9ANTA 4A4GA 1ZQ1A 1JUSA 3IWFA 5AONA 5HLIA 4IL6C 4KFCA 3GZ6A 3ZN0A 2H8HA 4XTYA 2I10A 3GW2A 5FO5A 1MMSA 1PM3A 3IP4B 4C3JJ 2O5RA 2HDWA 3DP7A 5CVIA 2TRTA 3I56I 2DA7A 3A03A 4AFUC 3T5XA 3BTIA 3I54A 4C0GA 3WVEB 3HUGB 1N27A 3L2RA 1XSXA 4CH7A 2M30A 2NUPB 3EPZA 5FU7C 4X1EA 4B48A 1N77A 1MW7A 1M4ZA 4BBSJ 1UGRB 3A1PA 4F93B 3M1EA 2DLPA 4G6QA 2ZPGB 3PSIA 3JB9H 5GAN7 3ERMA 2AKLA 2FE3A 3BT9A 3NRVA 3VOEA 2W85A 3IAS2 2ESWA 4G9YA 1JBMA 4GLKA 1D5VA 1KU7A 3E19A 4TV7A 5KYXB 1PKSA 3BY6A 1G3TA 2PG4A 1JKPC 5HK0A 2CDTA 4U87A 4AUXA 5CPRB 1SC7A 3EFRA 1LDJA 5C3EJ 4A3EJ 5DYMA 5AYFA 1ZARA 4JS5A 5ERIA 3PNWC 3UA7A 3RKYA 1I6HJ 1MJAA 2Y9YA 5GAN2 1X27A 1S1NA 2V6EA 5HDKA 4EMKB 2CP3A 2K40A 5D5WB 3F70A 4J6YA 4B44A 3AL0B 3EH2A 3S16J 2BY2A 3LQRA 3FMSA 2FBKA 2BOLA 3DV8A 3MKLA 1BYMA 2IVMA 3F23A 2VE9A 3H0HA 4PJOF 2BHZA 4NC6A 2VWFA 1W1WE 3CP2A 3KYLA 4HCKA 1K4US 3LFUA 1VQ8T 2VQLA 2DT6A 2QLZA 1BW6A 1M2VB 4M77A 5CCAA 2NNNA 1I5OB 1X6BA 2YSQA 1FMWA 1EH7A 4OVAA 1YITQ 1QHGA 5D5VB 4FX4A 4A0ZA 3PM1A 2L9VA 4KICA 1XPXA 2HEOA 1WHMA 3CCRA 3DKXA 4F92B 4UUSB 3VRZA 3E3VA 3B02A 1LVAA 1MGTA 2F4OB 3WTWC 2R7WA 1SVMA 2X35A 3EG2A 3DLLA 3MFKA 2G9WA 4M7AD 2DOFA 5LRRA 1XDUA 4ETSA 4DOVA 5CO7A 3S32A 4RTUA 5GANd 4PCQA 3CD6T 5B3SH 3CD6I 4HV6A 1BI2A 1VYVA 1PNJA 3P7NA 4X1VA 1PD0A 3ONQA 4LUEA 2OX7A 1ZG3A 2Y4YA 2KP6A 2FX0A 3CD6A 3OV8A 4ZGDB 4M3EA 1VIFA 3H92A 2HWVA 5J1YA 2R5AA 1TBXA 1TS9A 1KGSA 3CCUA 1FWZA 2YRVA 4BUGA 5LBQA 1UFMA 4I99C 3BJ6A 4D7NA 4Y92A 3O3KA 2XKPA 1GFCA 3MEAA 1UJ0A 2OTLQ 2K7AA 4JX4A 4P96A 5CYVA 3LL7A 2M2EA 5L3BA 2XPVA 5FLXZ 2UUZA 3RJPA 1Y07A 4IUQA 5GAOr 3KLNA 3IL2A 3D7SB 2P4TA 4UVBA 2KNBB 2ZO4A 4LIUA 3RPQA 1GVJA 2BV6A 4GCVA 2R7ZJ 1RACB 1M1KU 3TGNA 1LVKA 4XKCA 3BG5A 3DCFA 2K57A 2K9LA 1QPIA 2YLBA 1O7LA 2M0CA 2QA4I 4LDVA 1Z21A 4C92E 1OCPA 4Z2YA 2H3JA 2KL4A 3KP7A 4F7UF 3S3MA 2RHZA 2Q8KA 4BI8B 3PO3J 2M7BA 2BY3A 1V55H 2MCNA 1XCVA 1Y57A 1ZHFA 3HRUA 1R5ID 3K1MA 5DM6F 1X69A 4UUTA 3M58A 3R0JA 2CQQA 3BR0A 1TWBA 3IQLA 5J1RA 2HBWA 1IDZA 3I55I 4QT7A 5KCMA 1U8RA 3G2BA 2VXEA 2DLLA 2M7AA 1OU9A 1SRLA 2JTMA 1O3RA 4IXAA 4LD5A 2ESHA 4C2TA 4UY8I 2RI2A 2DOEA 4C3IJ 1ZLMA 5FJ8J 1U2WA 2JRMA 3LX7A 1VQMQ 2CP7A 3OYNA 4A3KJ 4KUMA 1YX3A 3HKZA 3V7RA 5TRDA 4A6DA 2QBYA 4GYIA 2IPQX 3A8MB 2XAFA 1GV5A 2GXGA 3HXLA 4HDVA 4MMLA 4A4EA 1LB2A 3G71A 3GP8A 4RAYA 1M1KC 2Y30A 5D8KB 1QVGS 2Y0SA 1WHLA 3VU3C 4KMFA 4J8OA 2VC8A 4JRPA 2PJRB 2EIFA 5FFZA 1Z0XA 2AXLA 2RVCA 2Z2SB 1X2NA 2K9QA 1Z6TA 2L01A 4E7JA 4C92G 2L8DA 4XTZA 2L0KA 4JX5A 2KKOA 1S72I 4A0XA 2OTLI 2A3LA 2MPXC 2HI3A 2M4KA 3H0DA 3X2QH 4F3QA 1CF7B 1E7OA 4KIFA 1MBJA 5E1WA 2NUTA 5C6SA 3CMAI 3SXYA 4YIFA 3VS6A 3KUFA 3CCVQ 3QG1A 1AHDP 3CMAA 4HT8A 1LJOA 3TEDA 1WZOA 3CCLT 1AT1B 4FASD 4JLGA 1W2BA 2Z1DA 4XM3A 1YRNA 3CDIA 2V1UA 2EFQA 4N0AC 2QEXT 4PJOC 2XAHA 1RUOA 5CKBA 5C4JJ 3IH2A 2VKDA 2OTLT 1U78A 1VQ6A 1JGGA 2QQRA 4QVZA 2CFXA 3DBHB 4U7DA 2STTA 2ELHA 2KHMA 3NPFA 3JCUC 1JKQC 2LYCA 1UB9A 2K86A 2WY7Q 1WJBA 1EH6A 2DM1A 3PE0A 3BFMA 4XU2A 4XTXA 3JRDA 2KK4A 4KUIA 1XDSA 2LZ6B 4LG0A 1YRNB 2VXDA 1D0YA 1HD3A 4JZ3A 4D6WA 2XUBA 1M30A 5CQEA 1IJWC 3LA2A 1OYYA 2UV1A 2LQ8A 2YT6A 5GANh 3C2HA 3JCMg 2E2HJ 4I02A 1R0BG 3ASOH 3QPHA 1OLTA 3JB9I 4JBAA 2E12A 2L7MP 4L9VA 3S8PA 3JCMX 1GBQA 4Z8AA 3H3VK 3X20B 3TO7A 4B47A 4MFDA 3KYDB 3FMQA 3BDDA 2Y0MA 5D5UB 3HOWJ 5JVTA 2UXNA 2PZ1A 3CBMA 1O9SA 3ABLH 3OB9A 3VDXA 3SB2A 1SMTA 2OTJQ 1GFDA 1FC3A 1ETYA 1UFFA 2WSCE 4FL6A 1OYIA 3I59A 2BE7D 4TVRA 2KIQA 3DBRB 4AC0A 4BYYA 5FKOA 3OYHA 2D5VA 2QKLB 2O61A 2DRKA 3EHRA 4PKCC 4Q5WA 1VQ7Q 1I0CA 3ERED 2LD5A 4IRIA 2DF6A 2COWA 2E64A 2OJED 2V79A 3WGGA 1HJDA 3LYIA 2YUSA 2MBFA 3ABKH 3SDZA 1W4MA 1T6SA 2M51A 1EFNA 3REAB 2HQNA 4OMFB 2E1OA 2KMTA 4J19A 3S2WA 2VBYA 2M34A 2W84A 3KP5A 2CT4A 4HYEA 3W2WA 1VQ4T 1QZYA 2HKXA 5BPDA 2HZTA 4EJUA 2NVYJ 2Q2EB 1X1CA 4MZMA 4M7AG 3BG3A 2VVKA 1MNMC 2L3RA 2PUOB 2IP2A 1QPMA 3I3LA 3J81E 2QGGA 1YCYA 1R5GA 4RTYA 2A05A 2P5KA 1BM9A 5L23A 2RJDA 4M77G 3TDZC 2IJLA 1HKQA 3HSBA 2DYBA 2VONA 4DEXA 2VJ4A 4ANJA 3E1SA 3EFOB 4HCCA 2QK0A 4IRGA 5KK1A 1WH7A 4XRFA 1U5SA 4BY6B 3ZL7C 3WTXC 1H9TA 3TL4X 2BEOA 4IHTA 4FISA 4D8DA 1U5TC 2HOSA 2PVOB 3JSPA 3CO7C 1H3ZA 2HQEA 3F22A 1S72T 5B1BH 3OYLA 1JXOA 3G6EQ 2P4WA 1VIEA 4PJOG 4DJAA 4C5GA 1FP1D 4GO1A 3DWLE 4L9TA 4S0HB 2GZWA 2QASA 2CZ0B 3E7LA 4YIIA 1V29B 2QI2A 3TOAA 1UELB 3WU1B 3K1NA 3FJ5A 2NUTB 5IXFA 2R7OA 3WODF 4X9CA 4G7HF 1NEGA 1M90R 2ZPEB 2PJRA 1K6YA 4RG8A 3I9V2 1ZUYA 3OIOA 1X1AA 2AQEA 1PVEA 3FC3A 4XU1A 1OKRA 1Y7XA 1YW8A 3CC7Q 2PEXA 1B8IB 3VYUB 3J80E 5GMKh 2XDDA 4IQ4A 3FEOA 2Z5UA 4M77F 2OQRA 2W7NA 4A4FA 1AWWA 1HA8A 3TREA 3OMYA 1X4OA 1HOMA 2RNAA 2V9VA 3IUOA 5DY9A 2CWEA 2V1RA 1Q86C 1WVRA 1SD7A 2VC1A 5DD4A 3OBWA 5HLHA 2ZXIA 1D09B 4B8XA 4B9WA 3BPXA 3FZVA 4N4OB 1PRLC 5DDGA 2Y4XA 3HPWA 1MH3A 2M5WA 5LJ5j 1B34A 3JTHA 4QTRA 3JRBA 1WHJA 3CJQB 2HXOA 2L3QA 3OSVA 1IXDA 1Y96A 2OPTA 3JRFA 3WGIA 1Z6RA 3BR5A 2K4YA 2CQ7A 3CTAA 2YRDA 4JZ4A 2PMUA 2RO0A 5JI6A 2DX1A 1Q82U 2H09A 2GM4A 1R22A 2F4IA 5F64A 2BVMA 5HNFA 1Y8RB 3MVPA 2LK2A 3SZTA 4ZZLA 4M78D 3HGYA 2NRAC 5HCKA 2PMHA 1Y1WJ 3PIPA 1NE8A 1JHHA 3C18A 3RBBB 2CYYA 4IKFA 3P9IA 5DV5A 4E2FB 2AXTC 3CCUT 2QA4A 3OY9A 1QWEA 4HX8A 1S3JA 3OYIA 2F69A 1JJ2P 1S7AA 4XSXF 4Z89A 3RI4A 1UG2A 1YJ9Q 2CV1A 3ZR8X 2FZKB 2EJ9A 3SEMA 2MLKA 3V4GA 4U88A 4C5HA 2DA1A 2JWTA 1YTYA 5E8IA 5J26A 3EQLF 1ARKA 5D8LB 2QEXA 3F72A 3MEWA 4KGXB 4KT0E 4R0KA 2XB0X 4XBFA 2QEXI 2CZ6B 1E3HA 3I59B 1I5LA 4BHBA 1XG1A 3F8BA 1WI3A 4LOCA 3R0AA 4EDUA 2JUFA 3QJ6A 3M0SA 1YITT 1F36A 1ORKA 3LWIA 4OMNA 5LJ3f 2VN2A 2JA6J 2LQNA 2Q2EA 1HQCA 1PHTA 3BTJA 2ED1A 2YLCA 4M78A 1B9MA 1B6AA 3M0QA 3F21A 1IRZA 1RUWA 1AWOA 3JCMf 2EA2A 3PMTA 3S2HJ 1JUPA 1EA3A 2I5UA 3IAM2 5CKDA 2B63J 2DAQA 1V76A 2K3FA 4DZPA 1B1BA 2W00A 1IV6A 1OU8A 3OSFA 5LJ3e 4HPQA 1W5SA 3SFIA 1WDXA 5BOXA 1DUXC 4BAYA 2KBTA 1KQ2A 2OZUA 4Y7NJ 1TW2A 1HDPA 2P6TA 2ZFUA 5DS9A 2DO3A 2DTOA 2XPUA 2H6CA 3LSHA 3RSNA 2GIVA 1WIEA 3M57A 2ID3A 3GUDA 1NH3A 2GGRA 3VV0A 1LFPA 1GVDA 2MFZA 3C1DA 3OS2A 3VUZA 1ETVA 3ROUA 3INZA 2QM3A 3KP6A 2GA1A 3CCMT 3AKZA 3OW2A 3M4OJ 1C1AA 5FLMJ 2CRGA 2M02A 3SWNC 4BI4A 4UVAA 4BQOA 1JTYA 3CJRB 4OIRF 1YIJI 2M0OA 2RH2A 2DU9A 2NVUB 5DCMB 4MDWA 2O01E 1WPKA 1YS6A 2V1XA 1FSHA 2JRTA 1T3SA 3NTKA 1KIKA 2VT2A 1YWOA 2EGEA 3L2VA 1ZGJA 2R5ZA 2KY9A 4EM1A 2Q1ZB 5ECAA 2CSIA 2DFHA 1TWFJ 3RMQA 1MBGA 4B9XA 5IT3A 4M3BA 1FY7A 2X4HA 2Y90A 3P8DA 5CKFA 2ZSIB 3DKWA 3JCMV 1ZUKA 1WJSA 1N8RR 4FYYB 4ASNA 4WK8F 2K2VA 2GAUA 2LF7A 4OINF 3ZMSA 4EJOA 2X9HA 3UPUA 1VQ4I 1SFEA 2C0OA 2DT7B 1VQLT 3JB9J 2F5KA 1USSA 1RI0A 3ZMDA 1OR7C 2V8JA 1G4DA 2RN8A 3G71I 1K8AR 2DL5A 1N9SA 3WTUC 4R79A 5GANe 1VA7A 5GTIC 5E1ZB 2CH0A 2EZIA 3WVDB 5HKCA 2NVQJ 4IHXA 2YHTA 1E6GA 3VYSB 3WHBA 3C2GA 4IEJA 1ZSZA 2DERA 4MHGA 4A12A 1FOXA 3HSFA 3WTZA 2QYZA 1BBZA 3NWTA 2EV0A 5HLGA 3BTCA 1VQPQ 2FOKA 4NC8A 4JLIA 2DYSH 4C30A 4F7UG 4JJCA 4FX0A 3J80K 1GT0C 3DQVC 3LAJA 2XDVA 1BIBA 5IYDJ 2D0NA 2WB1A 4M7DC 1U3EM 1VF9A 2QZ8A 2CFOA 4Y33A 5DCFA 2HVQA 2R5MA 1QLYA 1SEMA 2OF7A 3K4KA 4XSZF 2QSHX 3BY7A 2DA6A 1TNSA 1TP4A 1F4KA 2BW3B 3UT1A 3V42A 3LSGA 1IG7A 2HPIA 3VUBA 1IN5A 2RC4A 2D8HA 2DPDA 2K3YA 1K0XA 1GHCA 2A36A 3QBYA 5K1YA 5HLTA 1BOBA 1BR1A 1GUUA 2JNGA 2KLOA 1NLPC 2KDZA 2M1BA 3IH3A 3PJRA 1ABOA 4QVDA 1NJIU 1GL5A 3QKJA 2JA8J 1ZA1B 1VQ8A 3C12A 2JMAA 5IP7J 2IXSA 2JZ2A 3K4BA 2M1HA 2JSPA 3DF8A 3CCMQ 3LSMA 4P55A 2F5DA 2H27A 2MI6A 1ETQA 1T8IA 1OCRH 1ETOA 2ACJA 1F9NA 5EYRA 1F5TA 1B07A 4YIRX 2DVEA 2W10A 2LSOA 4DQ2A 2YDLA 3MPUB 2QDYB 4N4IA 3CMAQ 1ZAOA 5K5QA 4MTDA 3MJXA 4KUDK 2QQAA 1T0JA 3RYRA 2F2EA 4EMSA 2MD5A 1R4MB 5J40A 3M9QA 5GANj 4C8QD 5IHKA 1AOYA 3ZRGA 3CCET 5JVGF 1SD4A 4KT5C 4ZNXA 4OU0A 3WHCA 1N6AA 3REBB 4PJJA 4XTUA 1U5TA 5D5XB 4O3MA 3CCJT 2DCEA 2VOPA 1USTA 2FA5A 3G4ST 1TT5B 2OTJT 4PJ0C 1Q82R 1QVGP 2E65A 1Z77A 2DMQA 1A35A 1PYVA 1EIFA 4PDKA 2EZKA 4CXFA 3PO2J 2CREA 3KEQA 3ZQLA 2A69F 2H8RA 2OV7A 3GO5A 1IF1A 5D6FA 1M8VA 4XR6A 4LGWA 2QAZA 2ZMEC 2KMUA 4LMYA 1QW1A 3OYYA 2FG0A 4KH1B 4CC2A 1T39A 2JUCA 2DMUA 1R00A 4P1WA 2KRSA 3BW1A 3V7SA 2IAIA 2LCSA 3E6CC 4BNCA 3JB9D 4II1A 3M54A 3FXQA 4M6VA 2KT0A 4EATA 3SFZA 1A36A 1WJDA 1WLPB 1HKSA 1PG5B 1WHGA 1VQ9Q 1TQPA 3A02A 2FZGB 2HXIA 2LF8A 3URGA 1QVFP 3ML6A 1QBJA 3KZZA 5EGOB 2MLGA 1LNXA 1RR7A 3K69A 4ME7A 4OIOF 3GFMA 5E3OA 3ECOA 1VFCA 2OTJA 1YITA 1U0JA 1ZH5A 5FRMA 3HJEA 3LH0A 4HNUA 3G4SA 2JZYA 2BW3A 1RI9A 2BZTA 3HB9A 3L7WA 4CZZA 4JYKA 1LKXA 1REPC 1KONA 2ISZA 3VYRB 3DPLC 3ELKA 1TG0A 1J0RA 2PBIA 4C9YA 3H6ZA 2ZFWA 3EGUA 2A61A 2PFBA 3K10A 4ZC3A 4E7HA 3JCMe 4EGYA 2XDBA 3FXLA 4C0ZA 3CZ6A 2FEZA 1OCZH 2LVSA 4S04A 3DU5A 3QOPA 2UZKA 4AFSC 5A0GA 5BMZA 4BJTA 2JT1A 1YJNT 2EK5A 4YRVA 1U6GA 4ZTFA 5J3BA 1XC5A 1C6VX 1QVFA 3C3WA 2OZ6A 1W70A 2X3XD 2ZPFB 3MP8A 2EGCA 2DW4A 1YHQA 2M9HA 2COMA 1IUFA 3E6DA 3QU3A 1YG2A 4M6YA 3G73A 2BZXA 2EW3A 3LH5A 2KQWA 3GEZA 2DODA 4XIDA 2PJPA 2ZMEB 2A28A 3FLGA 3GIBA 4JPBW 3VS5A 1VQOA 3I4PA 4L9NA 2E6NA 2KIUA 2XSJC 1ZG1A 2JTFA 2KVQG 3CMAT 4OMOA 1FBUA 2X4JA 1A31A 1VQLI 2P0QA 3SD4A 2L9RA 3NTHA 3VS4A 1B7TA 2DFUA 2M4GA 3GTKJ 5D4SA 2AT1B 2O7OA 4J01A 5FWCA 1VQ5I 2O9LA 2NS7A 2EQMA 2LDUA 3SYTA 4M71A 2K4JA 1RUNA 3IHUA 1QP3A 4V19K 3WG7H 1STZA 5E3NA 3GTJJ 3CO6C 3JB9G 3KPHA 1WFXA 1MD0A 4HF1A 2HU9A 3HL8A 3PVLA 2MABA 4Y52J 4MZPA 1YJWT 3UNGC 4A6EA 2Z33A 3QSUA 3A4CA 2I8DA 2A68F 2O9VA 3MN2A 3TO6A 1TNTA 4I01A 4EJWA 5GANf 3KXTA 3BQZA 2X4YA 3O5ZA 3RDIA 5DTDA 1VQMT 2Y2ZA 2KZVA 2EH3A 4G6TB 1KK7A 2A6HF 2ZJQF 3BOQA 1Q95G 1I81A 1UHFA 5KCOA 5IAYA 1VQNQ 3G71Q 4RS8A 5EG0A 2DRMA 3X24B 1KSWA 4M73A 1OMIA 3LGLA 4AM3A 3O8HA 4FE4A 2RREA 3W3CA 1MV0B 5DLQE 5KYYB 1K8AC 4II3A 4MGRA 1OZ3A 2B8AA 2LR8A 2VOOA 1BW5A 2RQTA 2B86A 4XTVA 3RTRA 3O8VA 3QXEB 5M9OA 4OAYA 3GVAA 4MTEA 4XKVA 4XL9A 3RQIA 4XQFA 1HDDC 3ZQGA 2V1QA 4RCCA 4LUDA 4WTOB 3OYMA 4KN4X 1X1DA 3K2AA 1UTIA 3CCEI 1XNIA 1E6HA 5FKMA 4OF1A 2OD5A 1ZR2A 2DEUA 4LB5A 4L59A 3RZDJ 1KU9A 3OYEA 1ENHA 4HX7A 4HZFA 1UHSA 1O3QA 1BI3A 3S17J 1CKBA 2M9UA 3CC4Q 2KQRA 2KROA 2DA9A 3LWFA 4KMUX 1ZX6A 4QVCA 1XMKA 2AS5F 2JPCA 1RESA 1FEXA 1D1BA 4IOCF 1UCRA 2WAQA 1XD7A 5FFXA 1FOYA 2XB5A 2F6CA 5GAEJ 3QZ5B 3HHHA 3DLLF 3K4JA 4C92B 3WE3A 4JJNK 3BJOA 1Q7YU 1T08B 1APLC 1T33A 1YJ9I 2DMPA 1CGPA 2DDAA 4J7IA 4I98B 4XOTA 1LUJB 3EETA 2KISA 3M8EA 3VYGA 3OA6A 4DBQA 1VQOI 5E79C 2FPDA 3N5BB 7AT1B 2BE5F 3O6BB 1GXPA 4LDYA 1X2QA 5J4YA 5GAMj 1QVGA 1FXXA 5KYWB 2AHQA 1QVFS 4BHCA 3M1CA 3TW6A 2LKXA 4YFXF 3OSSC 3VYHB 3CCLI 1X1BA 5JHFA 3O8GA 3PUFA 4L5GA 4XNFA 1GCQA 4RLQA 3QWLA 1ZGAA 2CUEA 4JDSA 2BHYA 4B4CA 1FLIA 4ENMA 4ZJZA 2BYVE 2JMWA 2X6YA 4GXOA 2K27A 4YEJA 3HOXJ 1NEBA 4J9GA 1B72A 5IT9E 3NEUA 3OYBA 2J06A 2QTVA 3I71A 3SZPA 1BI0A 1ZGWA 1JJ2S 2VUMJ 4E6KG 3G71T 3GTQJ 2ENMA 1QP2A 1Q1HA 3A01A 4MO7A 2NWMA 3BCBA 2OI3A 1G3SA 2QGFB 1I4K1 3WTVC 4HG2A 4XK4A 1VQMI 2HNIA 3RUXA 5IXBA 2D1HA 3LFKA 4ON0A 4A5MA 5FD6A 2E2IJ 1R49A 5LD2C 1ZHIA 2FO0A 2FVUA 3VRYA 1B59A 2FSWA 3QPLA 2EZLA 2FXAA 1BA5A 1JQQA 2R57A 3HOSA 3JRGA 4D1QA 1IXRC 2E41A 4ITVA 3SDGA 3CCQQ 3SHWA 2E60A 1TUDA 4CRIA 4AD9A 4AVZA 3LLRA 5GAOm 3H9QA 2HL3A 4I76A 5I2SA 5A0LA 2D0QB 1EV7A 3HOUJ 2RPNA 5E17F 3QYGB 1U9NA 2CS7A 2DA2A 1V5EA 4EMHA 3RPUD 1VQ6Q 4JRKA 3ZQCA 2CP0A 4DNCA 1SANA 3CESA 2A0FB 4LK1F 1RAAB 8AT1B 4IQJA 4A63B 2MGQA 5ICFA 2GXBA 3H5AA 4G94A 4BY6C 1OJLA 3OYCA 2ROLA 3L2ZA 4NQWB 4EPCA 2ZXWH 2W25A 2YXYA 3CPWP 3QODA 2ICWG 3K1PA 4FW1A 1YHQT 4M7DG 4XN0A 5A0DA 1FYKA 3LQQA 2MC4A 1SSHA 2V9PA 2PU9B 2E7XA 1K79A 3S1MJ 1HKTA 2LT1A 1W5TA 1EJ9A 3ECHA 4L5EA 4M75D 3QP6A 1K1ZA 2VE8A 4XU0A 1PUFA 2F4MB 2ECBA 1TWGJ 2DAOA 2W57A 4HVVA 3BWGA 4A3DJ 3HFOA 2X48A 5AT1B 3PSFA 4P5NA 3HTUA 2EYXA 3H8ZA 4F16A 1C0WA 1CSKA 1X2KA 4E7SA 4HSTA 3QJYA 4UV8A 4AIJA 1ZA2B 1D5YA 2VXZA 2H1KA 1SAXA 1MV3A 4EGZA 1ZRDA 2YUPA 3EGXA 2RHIA 1WA7A 4M77D 2N8GA 1BOAA 1AWJA 1K9AA 1QU3A 1V3FA 5JLXA 4D0PA 3LSJA 1T2KA 3OL3A 1BL0A 1H641 1IHVA 1OEBA 2KXCA 3AG3H 5GADJ 3VS2A 5EZHA 3JRCA 1WJRA 2ZJPF 1FYLA 3NMZC 1VQLQ 5KVRA 2HDDA 1KHCA 3R60A 2O8XA 4NQWA 4AG2C 3FB9A 4M7DE 1VQKQ 1M9SA 5KH6A 1AU7A 1PP7U 4ENNA 4RCBA 4M9XA 3QYHB 5LJ5d 3FRNA 1G83A 3LMMA 5F04A 5E18F 4BEHA 3IKTA 3GTGJ 1UHMA 1HSJA 1I1GA 2JSCA 3B6CA 4OMLA 1IGNA 1O4XA 1GLNA 5FU7B 1KD1U 4IJAA 4IUVA 2FJ1A 4ZH4F 2K85A 4F7UE 2XF5A 5FRNA 1UEBA 3HP9A 2DN0A 4BE0A 4JP0A 3MEXA 3S1RJ 3JRAA 1IW7F 3CLOA 1N78A 1UHCA 3RNJA 3KCCA 2P5LC 5HK3A 2O03A 2LMJA 4LFUA 5CIUA 2OU2A 2DBKA 1HSTA 4O5VA 4DIQA 1FT9A 5GAOn 2RNGA 1VQ6T 2HKNA 1Q86U 1G8XA 1X4PA 3B6AA 3V8LA 1NPPA 1OQKA 1OX8A 1RADB 2V8KA 2RMOA 1QA6A 3GTPJ 1UHWA 4WX9A 4I0AA 2DXCA 4LN2A 4CC7A 3G4SI 2STWA 3KBGA 3GNGA 1P7JA 2LBFB 4CGZA 1QRYA 3I4NJ 1WXUA 3G6EA 3UF4A 4IIOA 4C2MJ 1XTAA 1ZKGA 3Q5FA 3IWZA 2O0YA 3CCRT 3H1CA 5ILVA 4PZJA 1J09A 5KNLA 1YLFA 3N05A 2L3DA 3C4SA 4HQEA 4CCOA 4CC3A 2KXDA 3ULRB 4JJDA 4XMYA 4RGRA 2HZYA 1UMQA 3HDDA 2E2JJ 5FLXE 2FF4A 3TO9A 1UGQB 2P7VB 1XX5A 2V9KA 5F1JA 2LG4A 1P9QC 3DPTA 2V4JC 2DZ9A 2XVCA 4UVCA 1W36D 5H6RA 2YUQA 2EGAA 3CCST 3DTEA 3K7AJ 4X0GA 1K4TA 1T95A 4R1HA 1OX9A 2E6ZA 3DKYA 2Y9ZA 1D3YA 5E3MA 3FF5A 2GF7A 3HOTA 2P0KA 2BZ8A 3FDRA 5IN1A 1TH7A 3ASKA 2R7TA 2FNPA 3WE2A 3CDHA 1RKWA 3C94A 4PFOA 1R0CB 1GXIE 1HXDA 4DBFA 3OYKA 2E34A 3QYFA 2XAUA 1OYWA 1VUBA 3LWHA 2GNCA 1TTHB 3BP8A 4P5OA 2ADUA 3HRTA 1M3BA 2GLOA 1WJCA 2PVDB 3E5UA 5GAN5 2YR2A 1ONVA 3EGXB 3OW2S 1ULYA 1ZLKA 3IC7A 1BKBA 3M53A 1KC8R 4A53A 5CK9A 4OOIA 2XPWA 4AYBN 5ILUA 3MHXA 4KJZA 2HQXA 3LGFA 4VUBA 3I53A 2OUMA 2EPFA 1MNEA 4IURA 5A2QK 1KYWA 3F0CA 4CUGA 4HX4A 4F55A 3PUBA 1FJLA 2DMNA 1ACMB 1RABB 4LG0B 2LT4A 2LH9A 4M3DA 1TLHB 1HW1A 2EILH 1F43A 2JT4A 1VQ8I 1AZEA 2RHUA 3RQ4A 1MMAA 1HW5A 2CMPA 2DFEA 2MC3A 3K0LA 3OIPA 3RKXA 4YG2F 3BJAA 4ZYDA 2YU3A 2JOYA 2PVGB 5CJ9A 3S1NJ 1Z67A 2QF7A 4WXCA 1PSEA 1KU2A 4RG2A 4QQ6A 3CCSQ 2CO5A 3CCYA 1AD5A 3CUQB 4FSSA 5EJCA 3FK6A 4GBQA 2QA4T 5IHNA 3UA6A 1QZZA 1HW2A 3META 3U2RA 2QEXQ 2HOTA 4RTVA 2DTRA 1U8BA 5GMKe 2LJ0A 3CXCA 3V8JA 2L4MA 3KZYA 1MBEA 1I3AA 3CEYA 1LPQA 1XSVA 2JA2A 3OW2P 1SFXA 2FU4A 5EZGA 1H89C 2KIFA 1DJ7B 2JXBA 2RN7A 2MMPA 3GLXA 5BS6A 2NNYA 2HS5A 3J7ZI 1P4WA 2RV8A 1VQPA 3I4MJ 4K11A 9ATCB 1PSFA 2X6OA 1KU3A 2L9SA 2X9DA 1LQ1A 2VKVA 3KIOA 4QPQA 5LHHA 4IX7A 2DJQA 2QWWA 4HBLA 3ZQQA 4UNOA 2RD1A 3MP1A 5GJWB 2WBMA 3VYTB 3M55A 2KRNA 4PUSA 2F5CA 3CBOA 3K6GA 4Y4RA 5EEAA 2MG4A 1SFOJ 3P8BB 1WQ7A 3VFZA 1F1ZA 1IGUA 1NM7A 2I2LA 5TISC 1AEYA 2L7KA 2HVSA 1VQOT 3KEOA 4U0VA 2ME0A 1I07A 2P0PA 4BH9A 4C0DC 2ECCA 1YJWI 1VQNA 4A3IJ 1M3AA 1XGNA 3LA3A 1SD6A 4RTZA 2HZDA 3BC8A 4UUSA 2XHCA 3HBLA 1T3LA 1YNZA 1ZRFA 4U0YA 2HDCA 1I3QJ 3ZQ7A 1RI7A 1GDTA 2DJZA 3FXMA 3D5SC 2GOMA 2AKKA 4AG1C 3BPVA 4OIQF 1I1JA 3BG6A 1P4XA 2DOAA 1UB4A 1YBYA 5GAN6 4AT1B 4LG3A 4I2OA 3TEEA 3ZBDA 5K5RA 4C92D 2SRCA 1Y6IA 4KIGA 4EJTA 3HRSA 3HFNA 3E6BA 4QLCU 3F9KA 1M27C 4UC4A 2DD5A 1CQTA 3K70D 5LJ3g 1FP2A 2IIMA 1YN8A 3I64A 2DTHA 3TMOA 2F5TX 2H6BA 1WGXA 2LY1A 4HRIA 2HKQB 1POGA 3L2UA 1AKHA 3P9CA 4BKXA 5GAN3 5AIPA 1KQSP 2TCTA 3B73A 1K9MC 1MDMB 4M75A 2CYZB 2LVMA 4XAXB 5GAN4 2K3PA 4BS9A 4FT8A 3H0GJ
chains in the Genus database with same CATH topology
3IRQA 5I21A 3ABUA 3FMRA 4V2SA 3L09A 5GMKl 1NPRA 4EJVA 4EMKA 1YW7A 4EV0A 3M4GA 4RB2C 1BBYA 1FZPB 4LDXA 1Z7UA 2V1DA 1S7OA 2QVOA 4S05A 2X4XA 4YTLA 3G6ET 4NS5A 3EAEA 1M5Q1 1N8RC 3CC7A 1R58A 3L1AA 4MQVA 5LRSA 4IUPA 3UWNA 2MF2A 2O4XB 4FHTA 3I56T 1WKMA 2D9TA 3FIFA 2JTVA 4I0BA 1FNNA 1MJ9A 4Y15A 3E97A 2F5EA 1AHJB 3MEUA 1RIOH 2ZKZA 4Q5SF 3S3NA 2E1CA 1XB4A 3BROA 1K9MU 1R5HA 2XU8A 4C8QE 4WCGA 3OOPA