3HRSA

Crystal structure of the manganese-activated repressor scar: apo form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
TPNKEDYLKCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAGYLLTDLGLKLVSDLYRKHRLIEVFLVHHLGYTTEEIHEEAEVLEHTVSDHFVERLDQLLDYPKACPHGGTIPAKGELLVEKHKLTLEEAKEKGDYILARVHDNFDLLTYLERNGLQVGKTIRFLGYDDFSHLYSLEVDGQEIQLAQPIAQQIYVEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloregulator ScaR
publication title Characterization and structure of the manganese-responsive transcriptional regulator ScaR.
pubmed doi rcsb
source organism Streptococcus gordonii
molecule tags Transcription
total genus 65
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrsA01
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hrsA02
1BI2A 4RS8A 2ELHA 3OOPA 5HDKA 4HDVA 4IRGA 4EQQA 4I7HA 2MH2A 2XASA 1D3YA 5ILVA 5L3DA 2E7WA 3E6BA 1WWXA 3LQQA 1YS7A 3ZN0A 2EFNA 1ZG5A 3IWFA 3QP6A 4WXCA 2W57A 4EJTA 4RGRA 2ZNYA 2FNPA 4LFUA 1YQAA 4P5OA 2LNBA 4M9XA 3ML6A 3J80Z 3K9TA 1G6NA 3D5LA 1DP7P 2HKXA 2IA0A 1U2WA 5IT9Z 5D8LB 3R4KA 2DPUA 2L4AA 1ULYA 2FE3A 3D0SA 4R8HA 4OMYA 4R79A 1HSTA 1FP2A 4L0YB 3Q9VA 4ESFA 1TQIA 2HTSA 3FM5A 4NB5A 5D6EA 1KQ9A 2L02A 2XAQA 4HZFA 2FOKA 2Y48A 5EEHA 2LKPA 1XB4A 1GVJA 1FNNA 2CQKA 3KZZA 3JSPA 3E6CC 4U0WA 1JHFA 1QGPA 2XV4S 5CLSA 3GVAA 1YW9A 2XRNA 2AS5F 3LA7A 4UVAA 5E18F 5ED4A 3K0LA 3KP6A 5D4RA 2DK8A 3DFGA 3DKWA 3KEQA 5LRSA 2PJPA 4UNOA 1IXCA 2BE5F 4BNCA 3KLNA 2XKPA 3L2CA 4DQ2A 2OU2A 2XAGA 5CVRA 4GYIA 3PQKA 2VOPA 2GIVA 1HW2A 2EFPA 3HOTA 3QRFF 4ZYHA 2NNYA 3ISPA 1EH8A 1F5TA 2ETHA 3CJNA 4KMFA 1F1ZA 1HBXG 2FF4A 5LGNA 5LLQA 1W5TA 1WKMA 3DXJF 2K4YA 3RPUA 3TDUC 3DEUA 2W24A 4M72A 1W7PD 2XKOA 5A2QZ 4GO1A 4HV5A 4GYGA 1XSXA 1BI3A 4L0ZB 1R23A 1RZ4A 2PEXA 4UHTA 2QQBA 3WTTC 1J7KA 3ZP5A 2Z3YA 3BDDA 2JPCA 3HTUA 4BHCA 3FHZA 4KT5C 4Q4ZF 3R60A 3FMQA 3I71A 2M45A 3N4MA 1EH6A 1NHAA 4XRFA 3ABTA 1BC7C 5LEJA 4XBFA 4A6DA 3BZ6A 4EM1A 2HKOA 3BROA 5E1WA 1Z6TA 2EWNA 2G7UA 2KIFA 2V6CA 4WCGA 4XSXF 5BPIA 1XGNA 2QQ9A 3J80K 2F2EA 2VC0A 2HYFA 4EJUA 1I1SA 1FWZA 1J75A 3GX4X 1ZG1A 2O03A 5IT9K 1TQPA 3F8NA 3HRUA 3V7RA 4ENJA 3HRMA 1TQMA 2PMHA 1YIOA 4IRHA 3TO6A 3BPVA 5BQTA 1R1TA 3B73A 5DCMB 1LQ1A 2A68F 3CUOA 4LD5A 1I5ZA 2WWYA 2DBBA 2IRFG 2V1XA 3I54A 2CGPA 1QQIA 2DPDA 1MD0A 2HR3A 3E5QA 3KP5A 1O57A 3I58A 3V7SA 2Y0MA 1P2FA 4L9VA 2MBFA 4OMZA 4MEXF 4LJZF 1IRFA 2NS0A 2EA2A 3IKVA 4IXAA 3MWMA 4QLCU 2XVCA 3GWZA 4EGZA 5K5OA 3T8TA 2OBPA 2RDPA 3R61A 4HLXA 4MTEA 3CDHA 3M9AA 3C7JA 4IJAA 3O2PE 5LGTA 3HUGA 2M87A 1Z1DA 1R1UA 2W85A 2XROA 2O8XA 2BBYA 5K5RA 1XN7A 2HWVA 2NNNA 1XGSA 2STTA 3M1EA 4ZZDA 1P6RA 3COAC 4M71A 1FPQA 1BM9A 2DAOA 3QAHA 3T5XA 3TGNA 2AXLA 2GQQA 4NHJA 3H92A 1SFEA 1XDUA 3LFKA 2K7LA 1EV7A 4KIBA 3W6KB 2Z5UA 2PQ8A 3T8RA 1TBXA 3CLOA 4MQVA 2DQLA 2EA4A 4ZYEA 3Q5FA 4ENMA 3WTZA 2TDXA 1FBQA 4RGXA 2OZUA 2XGXA 1ZREA 1T0FA 3VEPA 1B9MA 4QWQA 4EGYA 1OR7A 2RKHA 1VTNC 4Q47A 5D5WB 4M9ZA 1FZPB 3MEXA 1R22A 2M30A 4Z2YA 3RI4A 2DFIA 3VFZA 1J9IA 4JBAA 2Q0OA 1H9GA 1KA8A 4AWXB 4EVIA 2LF8A 1XMKA 2IPQX 3ROUA 1XD7A 4U88A 5LBQA 4KIFA 3KCCA 3NEUA 3V7CA 1PUEE 4KDPA 1TTYA 4O6JA 3L9FA 4U7BA 2DT5A 4HX8A 5LHGA 2FNAA 4AIHA 5ICGA 2JT1A 3E5XA 2VOOA 3IRQA 4YFXF 3ZMZA 1JHHA 1FX7A 5H20A 4ON0A 4LB5A 4KIGA 3MCZA 3RTRA 4S04A 4U0YA 4ZZLA 3IKTA 2L3DA 3TO7A 4UV8A 4EV0A 3F6OA 5AIPA 3KP2A 1Y0UA 3DP7A 2RV8A 1K7AA 1GXPA 3ABUA 3F8MA 5D5UB 3LSTA 4M74A 2VE8A 1R1VA 1YFHA 5BS6A 2QM3A 3P7NA 5JHUA 1RNLA 3GLXA 4Y15A 1W5SA 1FSHA 1IN7A 1T38A 4BHPA 2W84A 3SXYA 1C0WA 3WTSC 1XGOA 4ASNA 5D5VB 2ZKZA 2G7HA 4LMYA 4HA8A 4FX0A 1P92A 3SZPA 3J81K 5HVQC 1X3UA 4A6EA 1IN5A 2ZNZA 4DNCA 1I6XA 1IF1A 4P9FA 4MQ9F 4CHUA 2M8EA 3CUQA 1O3SA 2QZ8A 2ESHA 1K78B 1R00A 2A61A 5J6XA 4B09A 1RUNA 3L7WA 4LK1F 2PI0A 4LLGF 2E1NA 1XMAA 1H9TA 2KRFA 4I01A 2Z9OA 4A0XA 1STZA 4EJVA 2PG4A 5F64A 1XSVA 1FP1D 4A0YA 3W6JB 2IW5A 3F8CA 1WSUA 3C3WA 2EFWA 3V8KA 4HYEA 1GXQA 2COMA 5DEQA 4O3MA 2YPRA 1ON1A 2ESNA 1LB2A 3DF8A 4MHGA 3L09A 4OIOF 2A6HF 3P9IA 5BMZA 1YS6A 2OZ6A 3B02A 2YSRA 2KIUA 1IXRC 4HF0A 2HQNA 2VODA 4L9TA 2RVCA 1DPRA 3H3UA 2FMYA 1F4KA 2LX9A 2XHKA 1IZ1A 2DK5A 4ESBA 5J8FA 3I5UA 3O6BB 2GA1A 2RN7A 3WU0A 5L3FA 1ZGAA 4FT8A 3TO9A 2OA4A 3LAJA 4YFNF 4N9IA 1KU9A 1LNWA 4A5MA 2OD5A 2BEOA 1W7PB 2P6SA 3HSEA 3I64A 3V8JA 1WI9A 2P5KA 4L5IA 1LVAA 2EK5A 1U5TA 3LQRA 1OKRA 1XCBA 3GFIA 5H6RA 3SHFA 4D0PA 1T2KA 1KU7A 2E7XA 1B6AA 3JTHA 4G94A 3FM3A 5HS9A 4AIKA 5HDGA 1UB9A 2VT3A 2O0YA 3K69A 1TLHB 2YX4A 5J8CA 1YO5C 3F21A 5E17F 3BWGA 3I4PA 3JSOA 1LDKB 1QPMA 3NQOA 1OPCA 1T39A 4G7OF 3FXRA 2FBKA 2V9VA 3I53A 1S7OA 3U2RA 4I2OA 2DTRA 2IJLA 1U8RA 2HEOA 3G3ZA 5IT3A 4I09A 2R3SA 1XDSA 4WWCA 1IAWA 1OYIA 1ONVA 2K4JA 2RNJA 2OQRA 3REOA 5LHIA 2ISZA 5AONA 2Z33A 1XCVA 4LLNA 1D8KA 3TQNA 1FYLA 4HX4A 2K86A 1BOAA 2QQAA 4PGGA 4ETSA 4GXOA 2O3FA 1J59A 4IF4A 3WGIA 2EB7A 2CO5A 5JR3A 1DDNA 5E8IA 2JSCA 1G3TA 3IWZA 2VT2A 3HRTA 4AIJA 5F1RA 5CVUA 2HYGD 1SD4A 2H6BA 3R6SA 1KYZA 1QZZA 2A3SA 1ZRFA 3EQLF 3F22A 1FYKA 1DPUA 1FOKA 3GFJA 2IT0A 4FHTA 3ZMUA 5FLXK 2V79A 2LSOA 3BJOA 2BV6A 1S6LA 3SFZA 3LWFA 1BC8C 1MJAA 5ICCA 4MGRA 4KFCA 3HSFA 4ZH4F 5CYVA 4HQEA 1MDMA 2HQRA 3JW4A 2FQ3A 3ZQ7A 2FSWA 2K5LA 1SFXA 4AVPA 1WRJA 3HHGA 4KYWA 1FBSA 1R58A 4HF2A 4HAMA 5D5XB 3U1DA 5L3CA 4IHSA 3U9GA 4MTDA 2P5LC 1Z91A 2RQPA 2XUBA 3RIRA 5CVVA 4KUMA 1EH7A 2LDUA 4N0BA 3CUQC 1TNTA 3F8FA 2DLLA 1BI0A 1O7LA 4K2EA 1O3RA 2Q2EA 2HGCA 2EV6A 3HYIA 2XAJA 3F8BA 1MKMA 3KEOA 1SMYF 2FEZA 3C1DA 2VBWA 3LA2A 5E1XA 3HTSB 1USTA 3GFLA 1KQ8A 2VBZA 4UUVA 2VBYA 1O3TA 3BJAA 2GXBA 2W25A 3I59B 1B9NA 1BN5A 4G8XA 2QVOA 2QBYA 4XLPF 4RB3C 3J81Z 4LLLA 1SD6A 5CJ9A 3K1MA 2ZMEA 1IUYA 1ZG3A 4KICA 5LEKA 4A5NA 1HW1A 2GAUA 3ELKA 2FBHA 1FSEA 3GF2A 2KJCA 3CO7C 5LRRA 4GGGA 2FU4A 2L01A 5DCMA 1IN4A 2VXZA 1MZBA 3KP3A 4OIRF 3WODF 1ZN2A 2H09A 4M6YA 2QLZA 2M1BA 2EJRA 5E1ZB 1TNSA 4HW0A 4N9HA 4OIPF 4EM0B 5L3EA 1RUOA 2Z99A 1E2XA 5KK1A 5D8KB 3DPLC 1KU2A 3RYPA 2XAFA 2V1DA 4I02A 3IRRA 4MEYF 1TW3A 2FA5A 5FFZA 4IRIA 3RDIA 1IN8A 1D5VA 2MD5A 5FD5A 1ZLKA 3GFMA 4A0ZA 4PCQA 1U5TC 1PP8F 3T0YA 5ERIA 1MJ9A 2DQRA 3IHUA 3RPQA 4YIFA 3J7AO 1I27A 2L54A 2UWMA 2Y75A 2P8TA 2ZFWA 2GXGA 1AWCA 1LJ9A 1BBYA 2H94A 3DPTA 1KU3A 4Y17A 3ZMVA 5ICEA 3WTXC 1LEAA 5DUIA 2C6YA 2RGVA 4M73A 1YYVA 4R1HA 1G3WA 1L0OC 5DV5A 1Z9CA 1ZHFA 4AD9A 5FO5A 1CF7A 4P55A 4U7DA 3G73A 1WQ2A 4G6QA 3WTYC 5FD6A 2DI3A 4S05A 2D1HA 2KIMA 1BI1A 5E8GA 2XIGA 1O7FA 2PBIA 1W4MA 1U78A 3MHXA 2JRTA 4JQFA 1AOYA 4OOIA 3V4GA 1Z05A 3AAFA 4OINF 3LAPA 3PQJA 2NYXA 1LDDA 3EYIA 3RJPA 2EV0A 1FBUA 3KE2A 2RC4A 2NAZA 1XSDA 2J5PA 4CDGA 1R36A 4IHTA 1REPC 3ECHA 5L3GA 3H3ZA 3L00A 4RB2C 4KN4X 3KETA 3GO5A 3E5UA 2VE9A 3GEZA 4EM2A 3F3XA 2YU3A 2P6TA 4M9SA 4LG0A 1FC3A 3M8EA 1ZRDA 4ENNA 3BPXA 3RKXA 1S29A 2DU9A 2FXAA 3WE3A 2CW0F 4LK0F 3M8FA 3K2ZA 2DW4A 3E6DA 2V1UA 6PAXA 1S3JA 2OQGA 3ECOA 1USSA 3QP5A 5HS8A 5BPDA 3RKWA 1KGSA 3ZMDA 5TJJA 2D2WA 2M5WA 3MQ0A 4F7ZA 5TRDA 5ILSA 1FYMA 2O61A 4WXHA 1TW2A 3EUHA 1QW1A 3ZPLA 1Q1HA 2H6CA 2R7DA 3SQNA 1JXSA 4PDKA 2F5CA 1IW7F 5HLIA 2CSOA 3MAJA 5FLXZ 2VN2A 2GWRA 2PN6A 4XLNF 3RYRA 2ZXJA 4XSZF 5DD8A 3P9CA 2P7VB 3WGHA 5DCFA 2WC2A 3OV8A 2HOEA 3JAMZ 4G9YA 4JK1X 3QPHA 3MZHA 5FGMA 3HIFA 3GZ5A 2GCXA 2B0LA 2X4HA 3PFIA 2ZBKA 2QENA 2F5DA 4WXDA 4HQMA 5DDGA 4IPAA 3P9KA 1U5TB 1HKSA 3BOQA 2WTEA 3FMRA 4YIIA 1K78A 2BYVE 2JTVA 2K5IA 1J5YA 4P96A 1ZRCA 4RB0A 2IVMA 5FB2A 3ZN1A 3DV8A 4HV6A 3RKYA 2VBXA 2GZWA 5DUKA 4PGHA 3QU3A 4OU0A 5ILUA 1OMIA 2R7FA 1QZYA 5JI6A 1YW7A 1UHMA 2VC1A 1V4RA 3TDZC 5LGUA 4NQWA 3FXUA 2P4WA 1ZARA 2MA3A 4A2UA 3QPTA 2CYYA 1T6SA 3EETA 3WE2A 3KLOA 1OYWA 4OIQF 1KQ0A 1YLFA 1P4AA 1OYYA 1FT9A 2EFQA 2A07F 2ZCWA 1R5HA 1I1GA 5CVIA 4KNYA 3EDPA 2CWEA 4O5VA 5CVJA 1K79A 4CGZA 3DQVC 3E19A 2OAZA 1W7PA 3QOPA 3HOSA 1HQCA 1HW5A 4RAZA 2IA2A 5JFRA 3TOAA 4BQAA 2HFHA 4HLYA 1GHCA 1ZLJA 1LDJA 2DO7A 1YTYA 2QWWA 5HLHA 1RI7A 2XAHA 1SD5A 1MDMB 2K02A 2UXXA 4H0EA 2EV5A 2FRHA 2NRAC 2YX7A 1RIOH 5AIQA 3ERED 1QVPA 3ULQB 1R7JA 2F5EA 3WG9A 1HKTA 5D6FA 5HDNA 2H3JA 1B59A 3E97A 4EJOA 3IL2A 3LA3A 2HZTA 3IC7A 4M6XA 4ZYDA 1XGMA 2QUFA 5HLGA 4I0AA 5F6FA 1O3QA 1ZAOA 1J0RA 4BHBA 1R5GA 3JAMK 4B8XA 2MLGA 1YG2A 3C18A 3CTAA 1DUXC 1T98A 3CO6C 1F9NA 4ENKA 4CZZA 4L5JA 4LGWA 4GCVA 3GUDA 3BY6A 3FX3A 4ZYGA 2IA1A 3EYYA 2VONA 2K27A 5KVRA 2Q8KA 1G3YA 1U6GA 1G4DA 4A12A 2QBYB 4HDUA 3WU1B 2KJBA 4Q48A 1K6OA 1P4WA 4P9UA 1P4XA 2ZMEB 4UVBA 1QBJA 4UV9A 1MGTA 2KKOA 3BP8A 1IRGA 2ACJA 1FLIA 3S2WA 1YW8A 1QO0D 5HS7A 2QYOA 3GYHX 1BJAA 1U3EM 2O6GE 2ISYA 3F72A 4FX4A 2UZKA 4YFKF 4KN7X 1BYMA 5FFXA 2PFBA 2P7CB 3VB2A 1ODDA 4CYDA 1JGSA 4BH9A 3ZMSA 4RB1A 3KFWX 2F5FA 3VOEA 2UXNA 2D1VA 4L18B 4BAYA 2ZJ2A 4UVCA 2K5FA 3FZVA 1E17A 4IVNA 2HTJA 3GXOA 4WF2A 4TV7A 2GA2A 4I98B 4CXFA 2P5VA 2MH9A 3HRSA 3HSRA 2E1CA 1ZYRF 2A5YB 1Z7UA 4CO8A 4PZJA 2JZYA 4E70A 5H6QA 2A6EF 1BIAA 1CF7B 3GW2A 1ON2A 3I59A 3SZTA 1IXSB 1V3FA 4CICA 5K5QA 4WX9A 3Q9SA 1Z6RA 3WTUC 3K1NA 3HHHA 1ZGJA 2X0LA 4G7ZF 1L3LA 4UXNA 2IP2A 3F6VA 3V8LA 5A2QK 2G9WA 3FF5A 4HX7A 5E20A 1UHWA 5BOXA 2ZO4A 1UCRA 1UFMA 3R0AA 1JE8A 5ICFA 4HF1A 1BIBA 2HS5A 4Y13A 2A69F 2J5OA 1SMTA 5JVTA 4RGUA 1MJBA 1G3SA 3O3KA 2YR2A 3TKYA 3I0TA 3FXQA 1KYWA 3R0JA 1B4AA 4RGSA 2LF7A 4LG0B 1S8NA 4WK8F 3N97A 3WTWC 3MZYA 3M7GA 1A04A 2EFOA 5L3BA 4KMUX 5DD4A 4KA4A 4Q5SF 3TOBA 4RAYA 3F23A 3NRVA 5EEGA 3K1PA 3ZMTA 2L4MA 4BXUA 4YG2F 2CG4A 3FMSA 1CGPA 4EMSA 3VODA 1QNTA 4I0BA 3JTGA 4G7HF 1SAXA 5D4SA 2BGCA 3FWEA 4BYYA 4U0VA 1ZH5A 4HOBA 1LEBA 2CFXA 3CUQB 2WV0A 2D45A 5K1YA 3KZYA 3E3VA 5HOOA 1B1BA 1SD7A 3KP4A 3WGGA 1HSJA 3BJ6A 2MLKA 4ESJA 2H27A 3MFKA 3T1BA 4L9NA 2HDCA 1J2XA 2PMUA 4G6DA 1D8JA 5DYMA 3KP7A 4EJWA 1H0MA 1SFUA 2FMLA 2STWA 3WTVC 1PP7U 3GZ6A 1S7AA 3QU6A 3E6MA 4MNUA 4LB6B 5LHHA 4L9JA 4HBLA 2PLYA 2K4BA 1FY7A 2FBIA 1IN6A 1HXDA 2ADUA 2JPBA 1PDNC 2MC3A 1HKQA
chains in the Genus database with same CATH superfamily
1BI2A 3BR1A 3NWTA 2RB6A 4BI8B 4RS8A 2ELHA 3OOPA 2RNAA 5HDKA 2B63J 4XQ3A 4D9JA 3OWTA 4IRGA 4EQQA 4HDVA 5IH2A 4I7HA 1ZK8A 4YIRX 4CYCB 2A6TA 5KNLA 5LJ5f 4II1A 2MH2A 1H92A 3LSIA 2E34A 2XASA 1E6GA 2E65A 2LG4A 3WU2C 4LDWA 2E10A 1ACMB 2YRVA 5GAN6 1D3YA 2B7EA 1FMWA 4M3GA 4UY8I 4LDXA 5ECAA 1S5LC 1HDPA 5ILVA 3I55Q 5L3DA 3TP3A 2E7WA 3E6BA 1WWXA 3U23A 4E47A 1GL5A 1X1DA 1S72T 3AG1H 3B6CA 5FWBA 3LQQA 1YS7A 2R7ZJ 3ZN0A 2EFNA 1ZG5A 3HFNA 2R5YA 3QO3A 3IWFA 3QP6A 1QVFP 4A3EJ 5IYBJ 5GAN3 1I39A 3FKIJ 4WXCA 3GTJJ 2DA4A 2W57A 4EJTA 3QKJA 3SHWA 4M78A 5M9OA 4RGRA 1YJNQ 4F3QA 2QQSA 2DA5A 2R7XA 2ZNYA 2FNPA 4LFUA 2E2JJ 1W1WE 1YQAA 1TWHJ 4P5OA 3CPFA 2DFEA 2LNBA 4C30A 4OWRB 4M9XA 4YEJA 1WQ7A 4KUIA 2M0CA 3ML6A 8AT1B 3J80Z 2Z0WA 1JT6A 4JRKA 3EFRA 3K9TA 3MEUA 1G6NA 2F5VA 1Z77A 1YWPA 2EPDA 3D5LA 5IY5H 2CDTA 1DP7P 1OPLA 2HKXA 3C94A 2IA0A 1U2WA 4A3KJ 2CUFA 3AL0C 3HPGA 1IREB 5IT9Z 5GAN4 4LOCA 2EW3A 3CCVT 3PMTA 1VQ4Q 2JUGA 5D8LB 3R4KA 1PD0A 3G6EA 2V26A 4Z02A 4F92B 1G2BA 3A02A 4PFOA 1XOVA 1R4MB 3P5JA 2DPUA 4XRSG 1QHHD 2L4AA 1BL0A 4PJOB 3LFUA 2CUBA 1ULYA 3CCSI 2FE3A 1TP4A 1KONA 1W0UA 1M2VB 1PC0A 2XU8A 3D0SA 2COZA 4E6RA 5EZGA 4R8HA 4OMYA 2PUKB 2KQRA 4R79A 2IS1A 1HSTA 1VQMA 1FP2A 1VQOT 4L0YB 3A98A 2VL8A 1MUZA 4J9GA 3KZIC 3OYJA 3Q9VA 3CCUI 1T0HA 2AT1B 2HDAA 4ESFA 1TQIA 1TT5B 3J81E 2HTSA 3EFSA 3FM5A 2E3HA 4NB5A 1LUJB 5D6EA 3J7AY 2R7UA 3PSIA 3ZGKA 4LDYA 1RR7A 3S3OA 3I56A 1KQ9A 2L02A 2XAQA 4YRVA 4F16A 4IZZA 1B34B 4HZFA 2DNUA 1WCMJ 4F14A 3JREA 3QJ6A 1T08B 2FOKA 2BZTA 4RM2A 2Y48A 5J1UA 1Y71A 1TH7A 2CUEA 1KQSP 5EEHA 2LKPA 1JKPC 1XB4A 1U9OA 4F55A 5KYYA 1S72A 1ETOA 3ASNH 3OYMA 3OYLA 1GVJA 1VI0A 1FNNA 1VYUA 2CQKA 1AEYA 3DB4A 4C92E 2EPFA 3KZZA 4BJ5C 3I5RA 3JSPA 2E70A 1YI2I 2VV5A 3NHNA 3VS7A 3G71T 3E6CC 3CCJA 3AKZA 1UG0A 1ERDA 2COYA 3ASOH 4U0WA 5FKMA 2QEXI 1MSFC 1QHGA 2JUFA 3BDUA 4IUQA 1EX4A 2PTKA 2ZJQF 5CIUA 1JHFA 3ZL7C 4ZGDB 1QGPA 2XV4S 5CLSA 3OIOA 3GVAA 4DYQA 3JR9A 3S3NA 3CC2I 1YW9A 4PSXA 1HD3A 2XRNA 2AS5F 2BZ8A 3LA7A 2EAYA 1KC8U 1MBKA 4B1RA 4UVAA 1AWOA 4AC0A 2RM4A 2K85A 1X2KA 5GAOp 5E18F 2MMPA 3N5BB 4P5NA 1H3HA 2LCLA 2LC4A 5ED4A 3PNYA 3HOUJ 2WY8Q 2FOWA 2K40A 2JN6A 3IP4B 2X85A 3EH2A 3LSGA 4C8QC 4BEHA 3K0LA 3KP6A 5D4RA 1GCQA 2WSCE 2DK8A 3VJPA 3DFGA 3DKWA 3KEQA 4Z8AA 2JT4A 2RI3A 2HOSA 4BUGA 3CC7A 3KBGA 2L9NA 5LRSA 2PJPA 1YHQI 4RMOA 1SAUA 2W1OA 4UNOA 3S1NJ 3VYTB 3CCRQ 1IXCA 2KL4A 2BE5F 4BNCA 5GAMg 3KLNA 2LBFA 2XKPA 3L2CA 4DQ2A 3QWXX 5CQYA 3TREA 1JJ2A 1BR2A 2OU2A 1NZ9A 2XAGA 5CVRA 1Z3XA 1X1CA 3LYIA 4GYIA 4DJAA 4KH1B 3PQKA 2E3IA 2LD5A 2VOPA 4PJOD 2GIVA 2EIKH 5GMKj 4OF1A 2KYMA 4JOMA 5F04A 3DTEA 1OQYA 1HW2A 1IB8A 2O2OA 3K4KA 2XK0A 2EFPA 3G4ST 1K4US 1OCTC 2K9QA 2QDYB 3HOTA 3NWSA 4AFQC 2E6ZA 2Y69H 1VQOA 2B8AA 3QRFF 4ZYHA 2NNYA 5EGOA 1K61A 3ZEHA 3H1CA 5CKFA 3ISPA 5KCOA 1U06A 1EH8A 1F5TA 3HP9A 2ETHA 4B4CA 3CJNA 4KMFA 4Q5WA 1F1ZA 1HBXG 4B9XA 2FF4A 4CCOA 1YRNA 2JMCA 1K73C 5LGNA 2DXIA 2EYQA 2OI3A 4J83A 4M77F 3UDCA 1ZSZC 1MV3A 4X34A 3FIFA 4ZDPA 4BDYA 5LLQA 1W5TA 4C5HA 2AK5A 1WKMA 1LNXA 3DXJF 2K4YA 1TZLA 3RPUA 3TDUC 2K3XA 3DEUA 2PQWA 3CMEI 1NTCA 2NVQJ 1QVGA 1YITT 2W24A 2ZXHA 4M72A 1W7PD 2XKOA 2Y0SA 1FOXA 2ZSIB 1UG1A 4LUEA 3G71A 2KRMA 4OMLA 1N8RU 2DA2A 4AIDA 5A2QZ 4I6ZA 2KT1A 4XU0A 4GO1A 4M78G 5EEAA 4NL3A 1HJDA 4HV5A 4X9DA 2Z2SB 5D7UA 3ZFJA 4LDUA 4BJTA 3ZQCA 2DL4A 1WPKA 3BCBA 1RESA 3E1SA 1YN8A 2MF2A 5GANh 1A0NB 3QPSA 1KZHA 1IGUA 5J39A 2FD5A 4BE2A 1OCOH 4GYGA 2DX1A 4UUSB 1XSXA 1UDLA 1FEXA 1BI3A 2JNGA 4L0ZB 1R23A 1RZ4A 4AYBN 5B66C 1SEUA 2PEXA 1M27C 5GAMf 2QSHX 5GANf 1RI0A 4N4IA 3CMAQ 2DOFA 3PFSA 1I5OB 3QYHB 4UHTA 2QQBA 2DBKA 3WTTC 4C3JJ 1J7KA 3ZP5A 3NFCA 4C8QF 2Z3YA 4A54A 3BDDA 3K4LA 1H89C 2JPCA 3HTUA 4BHCA 3FHZA 5M3FJ 1V1CA 3PL8A 3SDGA 4M7AC 2H8WA 4KT5C 4Q4ZF 2NUTA 2E6NA 3R6OA 2ZFUA 3R60A 2F4MB 1GVDA 1H8KA 2ZPFB 3A5ZB 3FMQA 3I71A 4BI3A 4DOVA 1PCXA 1PG5B 2Y90A 3DCFA 5IHIA 5DLOA 3C0CA 2Q2EB 2MAMA 2IAIA 3CBPA 1Y8QB 5J1RA 2ATCB 2M45A 3JV3A 3MEAA 1GXIE 3N4MA 2W00A 1VQ6I 2HSEB 1EH6A 1NHAA 4XRFA 5GAOl 3ABTA 2OTLT 1BC7C 2LCSA 5LEJA 1ABOA 4BY7J 4FM4B 2A3LA 2YT6A 1Q82C 4XBFA 5FKLA 4A6DA 3GF5A 2LQWA 5EJCA 2C0TA 2RHYA 2RMOA 2J6KA 3BZ6A 4EM1A 2HKOA 2EFIA 2JN0A 3BROA 5E1WA 1Z6TA 2EWNA 2G7UA 2XPUA 1SKUB 4IKFA 2M16A 2O9LA 2COBA 3LH5A 3KUFA 1KHIA 4E6KG 4A3CJ 2KIFA 2IIMA 2V6CA 3SB2A 3P8HA 1TXQA 2M9UA 4WCGA 4XSXF 5BPIA 3C2GA 2DA6A 1XGNA 2QQ9A 3AG4H 4OMOA 5LL6S 4BE1A 3J80K 2M8GX 1IRZA 2F2EA 2VC0A 2EGEA 2HYFA 4EJUA 2NVXJ 3OIPA 1I1SA 1QKWA 3FXKA 3UPUA 1FWZA 2DTHA 1J75A 4LUDA 4HSTA 1VUBA 3GX4X 2DAQA 4PKCC 3OR1C 4LIVA 1ZG1A 3DEWA 2OV7A 1JXOA 2X6YA 1UMQA 3OL4A 2Y4YA 4BL0B 3SWNC 4ME7A 2ZXIA 4C92B 2O03A 5IT9K 2GFAA 1TQPA 2JS0A 3HSBA 2RHXA 2XF5A 3F8NA 4LDVA 1N9SA 3HRUA 3V7RA 4FE7A 2RA2A 4OVAA 5F27A 4ENJA 2XPWA 2CP7A 1QQJA 3HRMA 4I99C 2R4GA 3EAEA 4B9WA 1X58A 3OMCA 2KRNA 1TQMA 4M75F 3R6NA 1JQQA 2PMHA 1TUDA 4DEXA 1OV3A 1YIOA 2D0QB 2LY9A 2FHDA 4IRHA 3TO6A 1EA3A 3BPVA 2DK3A 5BQTA 1OPKA 2HOAA 1R1TA 2ZSHB 1OISA 2E2IJ 3B73A 4QSHA 5DCMB 2BTTA 2H8HA 2BY0A 1LQ1A 4OMNA 3DTKA 4Y3OA 1GUUA 4NL2A 2A68F 3CUOA 1T56A 1I5ZA 3CCYA 4LD5A 4UUTA 2WWYA 2CKKA 5GMKi 1X19A 2DBBA 3VRYA 3FXMA 2IRFG 2BY3A 2V1XA 5HK3A 3I54A 1YJWQ 2CGPA 3MZ8A 4XORA 4M7AF 5JLWA 1QQIA 3T9NA 3OMGA 4FT4A 4D5CA 2DPDA 3GMEA 5DLQE 3JCMW 2LVSA 1MD0A 1E3PA 2HR3A 3E5QA 1O57A 3I58A 3KP5A 3V7SA 2KK4A 4J5YA 2FRWA 3JCMg 1B07A 2HZDA 1M3AA 1HA8A 3H8ZA 2OUMA 2R7QA 1RETA 3HC7A 5E3MA 3H0FA 3HFOA 2Y0MA 3CCLT 1P2FA 2OTLA 4R0KA 2DM1A 2VKDA 4L9VA 4F7UF 2MBFA 1I4K1 4OMZA 4MEXF 3H5AA 4XKBA 5IOYA 4EMKB 4LJZF 1IRFA 2X6XA 3VS6A 4PFZA 1HLVA 1QVGP 4M78C 2NS0A 2RHUA 2X1DA 2EA2A 1U8BA 3IKVA 4IXAA 4J9FA 1IO6A 5KYUB 3MWMA 2QDLA 3CCSQ 1RR8C 3QWLA 4QLCU 2XVCA 2NUPB 2EYZA 3GWZA 4EGZA 1WX6A 5K5OA 1DP3A 3T8TA 5GJWB 2OBPA 1SRLA 3M54A 2RDPA 3CCMA 1HOMA 2GGRA 2WADA 4HEA2 3R61A 2KY9A 2EJFA 3CCUQ 4HLXA 1VQPQ 4M7DA 5B1AH 3GTPJ 4MTEA 3CDHA 3S17J 3M9AA 1Z9QA 4JUVA 3C7JA 4IJAA 4FYVB 4Z89A 4XN3A 3O2PE 5LGTA 3X26B 5BNGA 1B7TA 3JCMP 1IJWC 1RLPC 3HUGA 3HTRA 2M87A 2NOJB 3SEQA 3BG5A 3QXEB 3BZKA 1Z1DA 1R1UA 2M2EA 2R93J 4LG3A 1OX8A 3LWHA 2W85A 4BQNA 1M2OA 2XROA 2O8XA 2BBYA 5K5RA 2EVRA 3M57A 3TEEA 2H8RA 4MDWA 1XN7A 5HNFA 5JVGF 2HWVA 4Y52J 1H3ZA 2NNNA 2DMQA 1XGSA 2STTA 4RG2A 3JRAA 2RQQA 3M1EA 4ZZDA 1P6RA 3COAC 4BB7A 4M71A 2AXTC 4D5FA 1FPQA 1JJ2P 1X43A 4YTLA 1RLQC 3OYFA 2DCEA 3QHSA 2QEXQ 4LD6A 2DPPB 4IURA 4QPQA 4XR6A 1N9RA 1BM9A 1WI3A 2DAOA 2KZVA 3QAHA 4FISA 3T5XA 3TGNA 5GTHC 5IP9J 2DZCA 5LJ3e 2AXLA 3CC2Q 4EEFG 2GQQA 4NHJA 3S15J 3H92A 3D1NI 4OMFB 1SFEA 2MPXC 1XDUA 4ZDOA 4CI0C 1VQNQ 3P8BB 3LFKA 2K7LA 2XF7A 1EV7A 2JMWA 3BG3A 5FROA 4EMHA 1QWEA 2F4IA 4KIBA 4FCYA 1LVKA 3W6KB 4HVVA 2Z5UA 1WZ2A 5C4JJ 2PQ8A 3NGPA 1W5CC 4HSRA 3T8RA 4M78E 1VQ5Q 1TBXA 3CCET 3HZJA 2DMNA 3CLOA 4MQVA 2DQLA 2CRGA 2EA4A 5EZHA 3GTOJ 4ZYEA 1GV2A 3Q5FA 3CCLA 4ENMA 3WTZA 3GTMJ 1BR4A 1M1KR 1SHGA 1YHQQ 3G4SI 3S32A 1ZGWA 1N77A 2RNGA 2TDXA 1TL8A 1AKHB 2HDWA 4E7LA 2P4TA 1FBQA 2K5CA 3L1AA 3H0DA 2LK2A 3CLQA 2G0EA 2OZUA 2XGXA 4IEJA 4RGXA 4DYRA 1ZREA 1WHMA 2QAZA 3EG9A 2F48A 1T0FA 5FJ8J 3VEPA 1PUFA 3VWBA 2LMJA 5GAOr 2F5KA 2GNCA 4LN2A 1K83J 1G5VA 1B9MA 3I5SA 3RMSA 1D0YA 1M1EB 1ZA2B 1V5EA 2FUG2 4XLAA 4C5EA 3NAUA 3ME9A 3CBMA 4QWQA 1KD1C 3K4MA 4EGYA 1WXTA 2C06A 3AT1B 1OR7A 1BR1A 3ZXSA 2RKHA 1VTNC 3OYYA 3EUKL 3JRIA 3IH4A 4FE4A 4Q47A 1GCQC 5D5WB 2EKHA 1VQ9T 3LL7A 4M9ZA 1IO2A 1YITI 1K4SA 2CQQA 1FZPB 3MEXA 4XLFA 2IGMA 1R22A 2M30A 5LJ3d 1TWBA 4Z2YA 4E7SA 3RI4A 3HKZN 3PVQA 1BK2A 5IHNA 2DFIA 3VFZA 1O4XA 4JBAA 1ACIA 3ZRGA 2Q0OA 1J9IA 1D09B 2HI3A 4II3A 2DODA 3GP8A 1H9GA 1I3QJ 1KA8A 4AWXB 4EVIA 4OMMA 1YX5A 2D1XA 2J06A 1ETKA 2LF8A 3CMEQ 1MIJA 1UTIA 1XMKA 2IPQX 2JK3A 3OYEA 4XQFA 3A1YA 2DTIA 3ROUA 3PJRA 1XD7A 1ZTRA 2RJCA 4ELYC 1N78A 3HG9A 3HOWJ 4U88A 5CK9A 1CSKA 3JRGA 1Y0NA 5LBQA 4X1EA 1Y96A 4A3MJ 1UAAA 2LMDA 2R7VA 4KIFA 3MKDA 3WXMB 1BKBA 2LC2A 3KCCA 4XKVA 3OW2S 1VQ8T 3NEUA 3V7CA 5GP9A 2KRCA 1PUEE 2DFUA 2KI7A 3DB3A 4ZC3A 4KDPA 1MBJA 2CMPA 3LW5E 4JJNK 1TTYA 4O6JA 3L9FA 3CQZJ 1K73U 2FPEA 2ENMA 3BQYA 4HKEA 5D6YA 2KDOA 2E60A 3ZBDA 2DRKA 4U7BA 1BBZA 5J3LA 2XDBA 2DT5A 3A01B 4OAZA 4HX8A 4W97A 5LHGA 1NK3P 3GTGJ 2R7SA 2QA4A 3RKQA 2FNAA 4AIHA 2R5ZA 1Q86C 4AU7A 3REAB 5J4YA 5ICGA 2JT1A 3E5XA 2VOOA 4BBSJ 3IRQA 1ITYA 2XKOC 3RESA 4YFXF 3ZMZA 1JHHA 4M75A 3JB9F 1FX7A 1PRMC 1DU6A 4NC7A 1B72A 2K9MA 4HCBA 5H20A 3M5AA 3DLAA 2B86A 4BJ6C 2LY1A 4E2FB 3G6EQ 4Y33A 4ON0A 1NG2A 3F0CA 4V19K 2DT6A 4KIGA 2KPMA 4LB5A 4JRPA 1WHUA 3MCZA 3RTRA 4S04A 1AHJB 4ORZA 2KXCA 1EIFA 2YHTA 3DBRB 3JCUC 4U0YA 3L1PA 3A8HB 3SEMA 4ZZLA 4F93B 3IKTA 1QP3A 2L3DA 3TO7A 1X1AA 4UV8A 4EV0A 4J00A 2L3RA 3EG3A 1NJIR 2XAUA 1M30A 3F6OA 2ZPEB 2DJIA 5AIPA 3JRZA 3JB9H 1KG1A 3KP2A 3A0BC 3MD2A 3WHBA 3I4NJ 1OX9A 2CT3A 1Y0UA 3DP7A 1CQTA 1A36A 1GCPA 2RV8A 2L2OA 1K7AA 2G6FX 1GXPA 2M0OA 3ABUA 3F8MA 2VKHA 5D5UB 1FIPA 2LYCA 2FZKB 2MW8A 4XIDA 3FJPA 4KH0B 3LSTA 2O4XA 4M74A 2VE8A 1M90R 2V8IA 3ESWB 1R1VA 1NBEB 2RJDA 5FU6C 3H6ZA 4CC4B 3OSFA 3M0RA 1JUSA 3TP0A 1KHCA 1WGXA 2H1LA 4B3XA 3BTIA 5BS6A 2QM3A 1YFHA 2QSGX 1Z9ZA 2FZGB 1U1SA 3P7NA 5JHUA 4M77G 1RNLA 1DU0A 3GLXA 2F2WA 2CS7A 4PLLA 4Y15A 2DA3A 4MFDA 4Y4RA 5DM7R 2LJ3A 2HXIA 3CESA 2QCOA 1W5SA 3PNWC 4JPBW 4A3LJ 4M7AD 1V5FA 1FSHA 2CP6A 2JTFA 4J6WA 5HCKA 1IN7A 1K9MC 1U1TA 1T38A 2KEAA 4BHPA 3CPWP 2JM9A 2W84A 4J9HA 3SXYA 1C0WA 5GMKe 3WTSC 2M3AA 2JA5J 2AQEA 1S1NA 1HK9A 1S7EA 1XGOA 4N4OB 4UC4A 3LSJA 2PMZA 3KXTA 1Q82U 2ED1A 2EYXA 2R7RA 1LFBA 3VSLA 5KE2A 1GBRA 5J4VA 4ASNA 3FK7A 4QIWN 4M7AG 5D5VB 4CC3A 3ZQFA 1IGNA 2CUJA 4B44A 2KVQG 2ZKZA 4GDFA 2G7HA 2W0ZA 1RKTA 4LMYA 4CH7A 4DOZA 1LCKA 2YRCA 1O9SA 1M1KC 3Q3SA 2MWOA 4KT6A 3VS0A 4HA8A 1Q81R 4FX0A 4M78B 4OB3B 1P92A 3VSKA 3SZPA 3J81K 1VQKA 2PJRA 4HXJA 2XGEA 5HVQC 1X3UA 3RZOJ 1JO8A 4ZN3A 4A6EA 1IN5A 2ZNZA 4DNCA 1I6XA 1IF1A 4P9FA 2LJ0A 4MQ9F 1BB9A 1PSFA 1OU8A 2DF6A 3CCVQ 4CHUA 3S14J 1BW5A 2FG0A 4C8QG 1VQMT 3MKLA 2M8EA 3CUQA 1O3SA 1WHLA 2OJED 1I5LA 3W2AA 2QZ8A 2ESHA 1K78B 1R00A 2A61A 3CD6T 5J6XA 2BHZA 2PVGB 3S6WA 4B09A 1RUNA 3L7WA 4LK1F 2KDSA 2PI0A 4J9CA 4F04B 3IAM2 1XC5A 4LLGF 4J19A 1T0JA 5I11A 3I56T 1VQOQ 4JJDA 4EPCA 2E1NA 1XMAA 2CW7A 2RN8A 3OW2A 1H9TA 2BE7D 2KRFA 4I01A 5B5EC 4AG2C 3CPWS 4N4NB 2Z9OA 4TVRA 4A0XA 4DOWA 2DMOA 2DYBA 2RAEA 1SG5A 1STZA 1WFXA 2EZHA 2P84A 1RC9A 2E5QA 5LJ3h 4EJVA 3VS4A 2PG4A 1VOMA 5F64A 2QG9B 3EG0A 2QTXA 1XSVA 2DFHA 4OB2B 4KGZB 2GOMA 1FP1D 2X51A 4BI4A 3CCJT 1SFKA 4A0YA 3W6JB 3GOXA 2PU9B 4C0DB 5LJ3f 1Z7LA 2M4GA 1NH3A 5GAMd 2IW5A 2LFBA 2WAFA 1YJ9T 3F8CA 5GANd 1WSUA 1G8XA 1MMSA 3C3WA 3G1MA 1B8IB 1YJWI 4AM3A 3VV0A 2EFWA 5CR2A 3ERMA 5GAN5 2VB6A 1RAGB 2AO9A 5CQEA 3LSPA 1OU9A 4BACA 2L8DA 2ECBA 4NQWB 4HYEA 2CQXA 3V8KA 5HNHA 1C6VX 1GXQA 1X1BA 2O9VA 2RI2A 3EHQA 2YDLA 1UGPB 4BD3A 1NE8A 2COMA 5DEQA 2FPFA 4EMGA 3JB9J 2CW8A 5L8RE 3OA6A 2YS9A 4O3MA 3CC4A 5FKNA 2DOAA 1K8AR 1PM3A 3CC7T 3CCQT 2YPRA 1ON1A 2ESNA 1LB2A 2WAEA 1UB4A 2K3YA 3VUBA 3DF8A 4MHGA 3L09A 3H3VK 4OIOF 1UGRB 3JCMX 3M0UA 5IAYA 2A6HF 1IXDA 3P9IA 2KE9A 4M78D 5BMZA 1YS6A 1WPYA 4M7DC 4DEYA 2OZ6A 1QPIA 3B02A 1PHTA 1W2BS 1FYNA 2YSRA 2KIUA 1WJSA 1IXRC 4HF0A 2HQNA 1VQ7A 2VODA 3JCMJ 4L9TA 2DTOA 4FSSA 2RVCA 4CYCA 1DPRA 3I3LA 2IS6A 1JKRC 3L2VA 1QU3A 2P81A 3H3UA 2FMYA 1F4KA 3LWIA 2HPIA 3I9V2 2LX9A 1BCMA 2XHKA 3LSHA 1UFFA 3SYTA 3IQLA 2CP5A 3FBIB 2HMAA 1ETQA 2MWPA 1VQPI 1JI8A 1IZ1A 2JW4A 1P9QC 2DK5A 1J09A 2OCCH 4ESBA 4RMNA 3I5UA 5J8FA 2K9GA 3LMMA 3CD6A 2QQ8A 3O6BB 4MO7A 3L2WA 1LE8B 2GA1A 2RN7A 4M77C 3G4SQ 5KCMA 3WU0A 2KNBB 5L3FA 2EGAA 4ESRA 1ZGAA 4FT8A 1NYFA 4RA2A 3TO9A 2OA4A 1OEBA 1ZSGA 3A8LB 3LAJA 2H1KA 4QW2A 4YFNF 2VUBA 4XTWA 3GCMA 3DBHB 2ROLA 4N9IA 4BXFA 3VUZA 4PK4A 1KU9A 1VQ9I 1LNWA 3DLMA 2V6EA 4A5MA 1CKBA 2NYSA 1PKTA 1JU5C 1PJRA 2OD5A 4RTVA 4F7UG 3JCMc 5A0GA 3GPLA 1ZUKA 3UT1A 5KYXA 2BEOA 2L0KA 3BLYA 2ROTA 1UGSB 1TUGB 1WXBA 1XQHA 1W7PB 2BZYA 2P6SA 3Q0UA 5FRMA 4LXCA 3HSEA 3I64A 3V8JA 1WI9A 2EZLA 2P5KA 1LVAA 1WJAA 2EK5A 4L5IA 4PJMA 2HVRA 5IXFA 2CS3A 1IC8A 1U5TA 1X3WB 2MIOA 1X3ZB 1WJBA 3CXCS 3NPFA 3RR6A 1TT0A 3LQRA 3W6VA 2DLPA 1OKRA 1XCBA 3UA6A 3GFIA 7AT1B 5H6RA 3SHFA 1YITQ 3OSGA 2DXBA 3UF4A 2CGHA 4D0PA 1U5SA 3QYEA 1T2KA 1KU7A 4NDLA 1VQNI 3TU4K 2E7XA 1B6AA 3JTHA 2GOXB 4G94A 1H641 1WVRA 3FM3A 2J05A 4XNFA 4A93J 5HS9A 4AIKA 1RAAB 5HDGA 5HK0A 1AWJA 2F2XA 3QZ9B 1VQ5I 2FEIA 1UB9A 3CEYA 4J7FA 3DWLE 1T0FC 5EG2A 1AZEA 4XKCA 1QVFS 2VT3A 2O0YA 1VQ8I 3BFMA 3K4NA 2KQWA 2W48A 3HL8A 4IUUA 3K69A 1PVEA 1TLHB 2BVMA 2YX4A 3D7SB 5J8CA 2YUOA 4C0FA 3CCQA 1YO5C 2LLKA 4QVDA 2HVQA 2LT4A 4BS9A 4PJOA 3F21A 5HODA 2GLOA 5E17F 1D0XA 3BWGA 1OR7C 1M2VA 1Q81C 2OTJA 4X6AJ 3I4PA 3JSOA 2HVSA 1KD1U 1X4OA 2M34A 1LDKB 4G6TB 2MK5A 4RTTA 4NBQA 3JCMe 1VQ4T 4H4KC 1P7IA 4M7DF 2IG0A 5EG0B 1I8FA 4ATOA 2M4KA 3QBYA 2HSPA 4M77E 1QPMA 1KJWA 3ZQLA 2ZPGB 2ZPHB 1JXMA 3NQOA 1OPCA 4FW2A 4GLKA 4RCCA 1T39A 3RNJA 2X9DA 4G7OF 3FXRA 2FBKA 2V9VA 1MNMC 1Y7XA 3I53A 3MN2A 2BY1A 1B34A 1S7OA 2X1CA 1GLNA 2XDVA 3U2RA 1S9HA 2DTRA 2IJLA 4I2OA 1U8RA 4ABZA 2HEOA 3G3ZA 2DEQA 2X4WA 1OCRH 5IT3A 4I09A 2YLBA 2R3SA 2EQJA 3QJYA 2HOTA 2OTLQ 1XDSA 3CF2A 4WWCA 3E7LA 1IAWA 4NOYA 2ICWG 1OYIA 2M51A 5FU6B 1ONVA 3X28B 2K4JA 2KFDA 2RNJA 2LOOA 3FXLA 2HKQB 3M8JA 5GMKh 3RERA 2OQRA 3REOA 1XPXA 3H5NA 3I55A 4C2UA 1TC3C 1WH5A 2LVMA 5LHIA 3M59A 4JZ3A 1Q7YC 2XPVA 4M6VA 2ISZA 1UJYA 1D1BA 5AONA 2Z33A 4XN0A 1XCVA 5DM7F 4LLNA 4C8QE 5GAMh 1X69A 5GAN8 1D8KA 2BZXA 3TQNA 1OZ2A 1U9NA 1FYLA 2J6FA 4HX4A 1HC8A 1YJNA 3CDIA 3JCMd 4M75C 3GBQA 2K86A 1Q86U 1BOAA 2QQAA 2LNHB 1PKSA 3TSZA 4PGGA 2DL3A 4C0GA 2KT0A 4GXOA 4ETSA 4KGVB 4QPOA 4C3IJ 2O3FA 1J59A 4IF4A 3EFOB 3PIOA 4XONA 3QYFA 2EB7A 2CO5A 3GZNB 3RPUD 4BUPA 5JR3A 3WGIA 1DDNA 3S2HJ 5GMKl 5E8IA 2RO0A 3EGDB 2JSCA 2AHJB 3CZ6A 3OYHA 1JUMA 3ABKH 1G3TA 1AVZC 2V8KA 2A05A 2YUQA 3IWZA 2VT2A 3HRTA 1VFCA 4AIJA 2HCKA 2LKSA 1UUEA 5F1RA 5CVUA 1RUWA 4X9CA 4U87A 2HYGD 1SD4A 2E64A 2H6BA 3R6SA 4MDXA 2WA0A 2HEQA 1KYZA 1QZZA 2A3SA 4C9YA 1ZRFA 3A03A 3EQLF 3JRHA 4J9IA 3F22A 1FYKA 3CCRT 1VQ4A 3G6EI 1DPUA 2OAWA 2HZYA 4J9EA 3K6GA 2QYZA 3Q0VA 2VIXA 3WVDB 3PFYA 4A69C 1FOKA 2E1HA 3IAS2 5E3NA 3GFJA 2IT0A 2QGUA 3M07A 4FHTA 3ZMUA 3K4CA 5FLXK 2DO3A 2VPRA 2V79A 4FETA 3EGXB 1VQMQ 3BJOA 1BJZA 2WB1A 2LSOA 2BV6A 1S6LA 3SFZA 3TL4X 3M4OJ 2WV1A 3OW2P 3LWFA 2K7AA 5FWCA 5TGTA 2ZCFB 4MZPA 4RKUE 2R5AA 3ULRB 1BC8C 3HM5A 2L9VA 3RQ4A 2CUDA 5L23A 4ZTJA 1R77A 1MJAA 2CZ6B 2K3FA 2CV1A 4JJBA 2L3PA 5ICCA 3JRBA 3DEEA 2DKGA 1ENHA 4MGRA 4KFCA 3CCLQ 3HSFA 2VGMA 4NS5A 2PX9A 4ZH4F 5CYVA 4HQEA 4RLFA 4B43A 2ME0A 1Y0MA 4G12A 2CZ7B 4RTWA 3I56I 1MDMA 3S1RJ 1K9MU 1IGQA 2HQRA 3JW4A 2VJJA 1I81A 2FQ3A 2JS2A 3CCMT 3DKYA 3ZQ7A 4XU3A 3IUOA 2X35A 2FSWA 2ZZDA 4RCBA 4L5EA 2GQIA 1TSFA 2KRSA 2Y0SN 2COWA 2K5LA 4BU2A 2G3RA 2LQ8A 1SFXA 2W4SA 1WRJA 3D5RC 3HHGA 4AVPA 1S72I 4KYWA 1ZBXA 5IXBA 4UUSA 3TW6A 1C0MA 3X20B 2WACA 1FBSA 3O5ZA 3O8HA 1YIJT 3VYHB 2VXEA 3HGYA 3CCJI 1R58A 4HF2A 4MMKA 4EATA 4HAMA 5D5XB 2DILA 3VYSB 3U1DA 1ORKA 1R9TJ 2DTZA 2KMTA 5L3CA 4IHSA 3L2QA 2MC4A 1YJ9I 3P8DA 1TWCJ 1M1KU 1AHDP 3U9GA 4MTDA 4IL6C 2M1HA 4XTXA 4M7AE 1TWFJ 1RABB 3C4SA 4D7MA 2P5LC 3I9QA 3QIIA 3AL0B 1Z91A 1NG6A 2RQPA 2XUBA 3RIRA 4AFUC 5CVVA 2X4YA 4KUMA 1EH7A 2LDUA 2RJEA 4N0BA 4ZGJB 2LY2A 3CUQC 3K2AA 2V1NA 1TNTA 3F8FA 1VQ5A 2VXFA 2QF7A 5FRNA 2DLLA 1BI0A 1O7LA 2IGOA 4K2EA 5B3SH 2Q2EA 2HGCA 1O3RA 2EV6A 1MSEC 2CZ1B 4RG8A 4F7UE 1VQLT 4RLQA 3HYIA 2XAJA 3F8BA 3CCVI 4CCLA 2VQGA 2FYKA 2LTPA 3CCRA 1ETVA 1KIKA 1LKXA 4E4HA 1MKMA 3KEOA 1RRJA 1B3QA 3CPWA 1TS9A 5A0LA 1Z67A 1SMYF 2I2LA 2FEZA 4B47A 2NVYJ 3C1DA 2VBWA 2Y31A 2ZJRF 2EBPA 2JJ9A 2NOGA 3LA2A 1KQ1A 5AT1B 1G59A 2IVWA 5E1XA 4IUPA 2ID3A 4M77B 4YELA 3HTSB 1USTA 2QGGA 4CCKA 2O31A 3UNGC 3GFLA 1VQOI 4BE0A 1KQ8A 2VBZA 2DA1A 1RI9A 2L0AA 3G1LA 4UUVA 2VBYA 3CCEQ 1O3TA 3BJAA 2GXBA 3HOZJ 3CMMA 2HBPA 2W25A 3OY9A 3I59B 5FLXE 1B9NA 1BN5A 3N05A 4G8XA 2DRMA 4IIOA 1WH7A 1WLPB 2QVOA 5HY6A 3BR5A 2QBYA 4XLPF 3VDXA 2L9SA 4RB3C 2V4JC 2LRQA 3DTIA 1RAEB 2OPTA 1XX5A 2NLUA 5GAEJ 3J81Z 1OCPA 2E1MC 4LITA 4C2TA 1OLTA 4C92A 4XOPA 4LLLA 1SD6A 4JRIA 4IIMA 5CJ9A 1VZ0A 2EINH 1I50J 2HNHA 4CZCA 2JTMA 5KYWB 3K1MA 2ZMEA 3CP2A 4KRTA 1RKWA 1IUYA 1ZG3A 4KICA 5LEKA 4JX4A 1X27A 3JAME 1YIJA 2ZAEA 3G71I 4A5NA 1HW1A 5IPAA 1A6QA 1YWOA 1T3LA 2GAUA 2EZKA 1ZKGA 2LR8A 1F36A 2FBHA 3ELKA 3KX2A 1FSEA 2HKNA 1ARKA 4A4GA 5C3EJ 3GF2A 3UA7A 2KJCA 3QODA 1W0TA 3CO7C 4IHYA 1MMNA 4GLMA 2EJ9A 5LRRA 2KBTA 4GGGA 4C8QB 1VQ9Q 2FU4A 2L01A 5DCMA 1IN4A 3JCMh 2KZGA 2VXZA 1K1ZA 1MZBA 3KP3A 4OIRF 1WJFA 2VXDA 4I76A 1I1JA 2CV0A 4E7JA 3WODF 1ZN2A 2H09A 4M6YA 5A0DA 2QLZA 2X48A 1TOVA 4Y91A 2DERA 2M1BA 3JCMf 2EJRA 2E36A 4PFPA 5E1ZB 1TNSA 3JCMV 1I07A 4HW0A 2P0KA 4N9HA 3J7YJ 4OIPF 4KJZA 4EM0B 5L3EA 3FBNB 1ZLMA 4FYWB 3CMAA 4KBMB 1RUOA 2Z99A 1VQLA 4J6XA 5EC7A 1E2XA 3FIWA 1F1BB 5KK1A 3MMYB 3HB9A 1LPQA 5D8KB 3DPLC 1KU2A 1VIFA 3SFIA 1MMAA 3RYPA 1A5JA 1W2BA 2XAFA 2V1DA 2ZC2A 4IHWA 4I02A 4IQ4A 3IRRA 2ZGWA 4MEYF 1TW3A 2VQCA 3ZQHA 3IH3A 1MV0B 2K2MA 2FA5A 3VRZA 2CU7A 2D0NA 1LPLA 2HQEA 2QA4T 5FFZA 4EMKA 2M9HA 4IRIA 2DN0A 3RDIA 2EIFA 4OGEA 1IN8A 2ZB9A 1VQ8Q 1D5VA 2MD5A 4K11A 3H0IA 4M77D 2VKEA 2DOEA 2QXFA 5FD5A 4DW6A 3MEVA 3CJTB 2KRHA 1ZLKA 4ZGEB 4C2MJ 4RBOA 3HHTB 2DXCA 3HPWA 3GFMA 4A0ZA 1ZSZB 4OMPA 4AFSC 1NLOC 2NUPA 4PCQA 3TQ7P 4A3IJ 1MNDA 1U5TC 4P1WA 1PP8F 3BZCA 4CC2A 3T0YA 2ECCA 2FJ1A 5ERIA 1MJ9A 2DQRA 3L42A 2NXNB 3IHUA 3RPQA 4R55A 4YIFA 2VI6A 3J7AO 2DXUA 2CT4A 1I27A 2L54A 4XL9A 2DL5A 2UWMA 2BW3B 1MGQA 2Y75A 2P8TA 2ZFWA 3VKIA 2GXGA 1E7OA 1WFWA 1AWCA 3CCST 4HVWA 1LJ9A 1BBYA 2GM4A 5CKTA 2H94A 4V2GA 2DIGA 2E5KA 4AFZC 2E5NA 4HT9A 3DPTA 1KU3A 1IHWA 4Y17A 3ZMVA 3M1CA 5ICEA 3WTXC 3OYAA 2LDMA 4PJOC 1LEAA 2HQ5A 5DUIA 3NTKA 5FLVA 4LNPA 2C6YA 2E19A 2RGVA 4M73A 1YYVA 4R1HA 1B72B 1G3WA 2FB7A 2P0WA 1AU7A 4F91B 1D3BB 3X2QH 1QWFA 2C0IA 2V8JA 1L0OC 3JRDA 4C8QD 1Q81U 2O88A 3FDYA 4D8DA 1ZUUA 3RBBB 5DV5A 1Z9CA 1ZHFA 4AD9A 5FO5A 2X4JA 1CF7A 3G1JA 4P55A 4PJLA 4U7DA 1NYGA 3G73A 1WQ2A 4ZDLA 4A63B 4G6QA 5KHDA 3WTYC 4VUBA 4M7AB 5FD6A 2MYSA 1T33A 4FW1A 2DI3A 3VU3C 4S05A 1WQWA 2I0NA 3A8OB 3LGFA 4FIBA 9ATCB 3J7ZI 2D1HA 2KIMA 1BI1A 2ID6A 4LIUA 5E8GA 4J6YA 1YI2T 2XIGA 3O8GA 4AVZA 2QQRA 3TSWA 2FL7A 4M3EA 2GTJA 2JVVA 3OYIA 1SC7A 1O7FA 1Y07A 3EG2A 2PBIA 2O9SA 1OI1A 1W4MA 3S93A 1U78A 3MHXA 3CC2T 2JRTA 5DS9A 2VQHA 1QMCA 2QASA 3SDZA 4F7UB 1KFZA 4JQFA 2JXBA 1Q7YR 2F69A 1AOYA 2IXSA 3S3MA 4XLHA 3ZOBA 1LFUP 2VQLA 2DJZA 2FX0A 1AKHA 1WHGA 1NEGA 5M5WJ 4OOIA 1HSQA 3V4GA 1Z05A 1XG1A 3AAFA 1SVMA 1JTXA 2X6WA 4OINF 3LAPA 3BG6A 3PQJA 1VQKT 2NYXA 2JWTA 3QOEA 1UGVA 1MH3A 1IV6A 2C0OA 1LDDA 4BQOA 2OTLI 1RACB 3NTHA 2OF7A 2VJ4A 2DE0X 3EYIA 1X2MA 4F52A 1Q7YU 1XS9A 5FKOA 3RCOA 3RJPA 3SDBA 2KXDA 2EV0A 1FBUA 3KE2A 2RC4A 4CSWA 2NAZA 2R7WA 1XSDA 4XTUA 4B48A 1UHSA 2J5PA 4IUVA 4AMCA 5GAOm 2LQNA 2KP6A 4CDGA 3C2BA 3BR6A 3Q1JA 1R36A 3CCSA 4IHTA 1REPC 3ECHA 2W7NA 2A5WA 1PYVA 1OJLA 3PT9A 4M7DG 5L3GA 3H3ZA 2EQUA 2O7OA 3L00A 5F0HA 4XRSA 2K3BA 3MEWA 4RB2C 4KN4X 5DY9A 3SWNB 3KETA 3GBGA 3GO5A 1AT1B 3E5UA 2VE9A 4L5GA 3OBWA 3CCUA 1K8AU 4OAYA 1VQPA 4M75D 2OC6A 3I55T 2DMPA 5J47A 2VWFA 4PJOF 1PRLC 4MLOA 1ABQA 3GEZA 1BW6A 3ZQQA 2V9PA 4EM2A 1YNZA 2YUNA 3I56Q 3F3XA 1VNDA 1KQ2A 2YU3A 4UB6C 3A8GB 1X6GA 5GAGJ 1WI7A 2RK2A 2P6TA 1SSHA 4M9SA 3HEFA 2XIDA 2E2HJ 4QQGA 2I8DA 1FXXA 1WA7A 2R5MA 4JLGA 4KT0E 4LG0A 9ANTA 4BY1J 1WHKA 1W70A 4HVUA 1FC3A 3BC8A 1XMXA 4QKUA 1Y57A 1LOJA 1BOBA 3PO2J 5IN1A 5A2QE 1V76A 2V1QA 2RQWA 1Z0XA 1S72Q 3M8EA 2DA7A 2O8KA 3CQTA 1ZRDA 4ENNA 4MMLA 3DKMA 4XTVA 3BPXA 4M4ZA 3RUXA 5LJ5g 3UKGA 3RKXA 4A3JJ 1S29A 5GAOn 2JSPA 2MI6A 3A4CA 2RH2A 2DU9A 3GTKJ 2EKOA 2FXAA 3WE3A 3CCJQ 1YI2A 2CW0F 2CSQA 4LK0F 1VYTA 2QEXA 3FKJA 1N25A 3M8FA 4W1UA 5D6XA 5CQXA 1YJ9Q 1TWGJ 1NPRA 1YX3A 1FJLA 3K2ZA 3CC4T 3CC2A 1WJCA 2DW4A 3DU6A 1AWXA 1UJ8A 3VYRB 4DGWB 4IQJA 3E6DA 2V1UA 6PAXA 1PD1A 3PUFA 2DZ9A 1VQNA 1S3JA 2R58A 2OQGA 2R5YB 3HPHA 2DL7A 3JCMQ 2IGNA 4A3FJ 2P0QA 3ECOA 1USSA 1WGSA 2DA9A 3QP5A 5HS8A 1MHNA 2Y2ZA 5BPDA 2K6DA 5LJ5j 3RKWA 1Y1WJ 1KGSA 3ZMDA 3G1OA 5KAIC 5TJJA 2D2WA 2M5WA 1M8MA 2ZPBB 1IG7A 3QUIA 4WCIA 1EJ9A 2HL5C 3CCLI 3HKSA 1VQ7T 3RDVA 3MQ0A 4NC6A 3CCQQ 3CC7Q 4F7ZA 1R4NB 4JLIA 3H36A 3ZQIA 5TRDA 5ILSA 1FYMA 2GXAA 3IH2A 1TW2A 4WXHA 2O61A 3EUHA 3EG1A 5GJVB 1QW1A 1YHQA 3ZPLA 1Q1HA 2H6CA 2XG8D 1M8VA 4JZ4A 3META 2D6FA 2R7DA 4HG2A 3PE0A 3SQNA 3BQZA 1JXSA 4PDKA 3BG9A 3OYCA 4DBFA 1AWWA 3PIPA 1K0XA 2F5CA 1IW7F 5HLIA 5FKKA 2H3EB 2M0YA 5J40A 2F1LA 4ITVA 1VQ6T 2WAQA 2CSOA 3K4BA 1T3SA 3PIOF 1WHHA 2Y30A 3H9QA 3MAJA 5M5XJ 3VS3A 5FLXZ 2LT1A 4XU2A 4RUGA 2JOYA 2UUZA 1POGA 1QA6A 3FISA 2KAFA 4QQDA 2HNIA 2DYSH 2VN2A 2CP2A 2GWRA 2MOXA 2PN6A 3PO3J 1EF4A 4XLNF 1QCNA 5F08A 4A3BJ 3RYRA 3OYDA 3H5RA 5CO7A 3FXOA 4N4HA 2I10A 3SFMA 2ZXJA 2MG4A 4XSZF 3MP1A 2RK1A 5KCHA 1KK7A 3K7AJ 4PSWA 5DD8A 1X2QA 3U21A 5IP7J 3P9CA 3L2UA 1ZX6A 2DD4A 3X25B 1K73R 2JA2A 1Y6IA 2P7VB 3WGHA 3TVTA 5DCFA 2WC2A 2CP3A 3OV8A 3UR3C 3CMEA 2L7FP 2HOEA 1W2BP 3JAMZ 4G9YA 4IUTA 4JK1X 2RF0A 1GFDA 1FOWA 3QPHA 2DJNA 1JJ6C 2K9SA 5FGMA 3MZHA 3HIFA 3G71Q 1OFCX 1I0CA 3GZ5A 2JVGA 1Q95G 3K70C 2GCXA 2PMZN 2LKXA 2BXZA 3EUAA 2B0LA 2X4HA 3PFIA 1WJQA 2ELKA 2ABLA 2ZBKA 4XKWA 2DDAA 4CA0A 1BA5A 2QENA 4A53A 1R49A 4C5GA 2F5DA 5CKHA 3VS5A 3C2HA 5KYYB 5KYXB 4WXDA 4N0AA 2Z1DA 4HQMA 1TU0B 2M7AA 3CXCP 5DDGA 4F17A 3M0TA 1UJ0A 2OTJT 2FVUA 3EPZA 4IPAA 1AD5A 2YXYA 3KPHA 3CCEI 2A0FB 2M7BA 3P9KA 4C92C 2QA4I 2FPDA 1U5TB 1HKSA 4M75G 4AT1B 1ZA1B 2KLOA 2WTEA 3BOQA 4RTZA 3FMRA 3PUBA 1ETWA 2OCEA 4GFBA 2ZMEC 4YIIA 4XRMA 4D7NA 1K78A 2BYVE 2JTVA 2OAUA 2P0PA 2K5IA 3MO8A 4XTYA 5J26A 1J5YA 2JVHA 3CF5F 4JS4A 2F4OB 4P96A 3CJRB 2XB5A 2IBDA 1H8AC 5HKCA 3BR2A 1FIAA 1ZRCA 2VASA 2AIRB 1Y1VJ 4BEHB 1NJIC 4CCNA 4RB0A 2K2VA 2IVMA 2E4HA 3OR2C 5FB2A 3REBB 3ZN1A 3DV8A 4JDSA 2CH4A 1VQ6A 2WAQN 3QQAA 4HV6A 3BDLA 4XK4A 3BTJA 3RKYA 2VBXA 2LBFB 3O8VA 2GZWA 5DUKA 3E2UA 4PGHA 4IOAF 2VGNA 3QU3A 4OU0A 5GAHJ 5DTDA 2VJ5A 2CV2A 5ILUA 2P4RA 2KISA 2EJGA 2EGCA 1M90C 1OMIA 3OS1A 4KULA 4XLCA 1A6IA 1FOYA 1F43A 2HQXA 3PVLA 1E6HA 1E3HA 2R7FA 1QZYA 1XNIA 5JI6A 1YW7A 3NARA 1UHMA 2VC1A 3ZQGA 1B8IA 3TCJA 1Q82R 1X01A 1V4RA 3TDZC 1QLYA 1D1AA 2K57A 5EGOB 2X1EA 5LGUA 4NQWA 4J01A 2JA8J 4EMKC 3FXUA 2EH3A 2KIQA 5C0MA 2P4WA 2Q1ZB 4PJNA 3L2RA 2WBMA 1ZARA 2MA3A 4IHXA 3FLGA 1YJNT 1YRNB 4A2UA 1R6RA 3QPTA 2X9HA 3ZCOA 3QWYA 1G83A 4UB8C 3PGGA 4ZJZA 3QYBA 1EKEA 2IGKA 4II2A 2TCTA 2CYYA 1T6SA 3EETA 1FTTA 2XI9A 4M7DE 3WE2A 3KLOA 2IS2A 1UHCA 4HPQA 4XM3A 3JB9D 4D6WA 3DBLB 1AZGB 2AQFA 1O75A 2DFFA 4MZTA 2MABA 3QSUA 1R0BG 2XF6A 3UATA 1OYWA 1TWAJ 2GF7A 3AG3H 3U1KA 2E35A 3PM1A 2N8GA 4HNVA 2PVOB 2YUPA 4OIQF 4CRIA 1ZUYA 1KQ0A 1V29B 2YSQA 3M9QA 2LTOA 4OGCA 2A28A 1OCCH 2LQKA 1MW7A 3KYLA 4AYBA 1QVTA 1N75A 4C92F 1YLFA 1P4AA 1DGRM 1FT9A 1OYYA 2JMAA 5GTIC 2EFQA 3W2WA 2O01E 1UZCA 2A07F 1VQKI 1M3BA 2NS7A 3VS2A 3WVEB 4EDUA 1M1FA 3FEOA 5M3MJ 1LE8A 2ZCWA 4JX5A 1R0CB 3LNQA 1R71A 4LE9A 4Y7NJ 1R5HA 1I1GA 1WDXA 2JRMA 5CVIA 4JP0A 4KNYA 2JUCA 2WSFE 4OP0A 5KE3A 3CCVA 1SRMA 4J8OA 3BY7A 2XRLA 4WTOB 3EDPA 2CWEA 4O5VA 2RD1A 3H41A 5CVJA 3GIBA 1R8OB 5GANg 3H9NA 1K79A 3HJEA 4JX6A 1ETYA 4CGZA 3MKWB 1KSWA 2KSSA 3DQVC 1N27A 2FRYA 2JM8A 3E19A 3E9GA 3FK6A 2CQNA 2IS4A 5KYNA 2NUTB 2OAZA 1W7PA 3QOPA 1KQSS 1UGQB 1YCSB 1PWTA 3HOSA 2OJ2A 3I35A 1HQCA 1HW5A 1JKQC 3RSNA 1HYOA 1M5Q1 4RAZA 3HBLA 1JBMA 2IA2A 5JFRA 1JTYA 5I2SA 5KAFC 5GAMj 3TEDA 3JRFA 3TOAA 3A0HC 3S16J 5GANj 4BQAA 1ZQ1A 5F0CA 5K7HA 2HFHA 4NUBA 4RAFA 2LJ1A 1D1CA 5EYRA 3OOUA 2LP5A 1Y39A 1WYXA 4HLYA 1LFPA 1JRIA 2LNVA 3BE3A 3LSMA 3NTIA 3CCMQ 4E7IA 3LGLA 3WHCA 3JRCA 2X3XD 1GHCA 1NEBA 1ZLJA 2GFUA 2DETA 1W6XA 1LDJA 2DO7A 2DVEA 2KGTA 1YTYA 4RTXA 1W36C 1TG0A 5FU7C 3BR3A 2QWWA 5HLHA 4KUDK 3FXJA 1X75C 2ECZA 2PUOB 1DQUA 2YUSA 1YIJQ 3PNVA 1OULA 1RI7A 2XAHA 4C92D 1SD5A 1MDMB 2K02A 2UXXA 4H0EA 2EV5A 4PNOA 2FRHA 4B3AA 2NRAC 2KHMA 2DBMA 3FB9A 2YX7A 1TTHB 5C6SA 4JRQA 1RIOH 2WSEE 3Q0WA 5AIQA 5EG0A 1NK2P 3CC4I 3QZ5B 3ERED 2L7MP 2AHQA 6AT1B 1IZ6A 1VIEA 3KYCB 2L2PA 1QVPA 2LCCA 1WJ5A 1GFCA 2A08A 2O5RA 3BTCA 3ULQB 4GY5A 2Z16A 4QVZA 1R7JA 1WNLA 1U0JA 2BHYA 2EQRA 2BXYA 2XSDC 2LP0A 2F5EA 1APLC 1HDDC 3WG9A 3RMQA 4M3FA 2CYZB 3A8MB 2HU9A 1HKTA 1YFNA 4MIMA 2R92J 2V9KA 5D6FA 1A35A 4FQGA 2X3WD 1P7JA 4M3DA 4NC8A 5HDNA 2CUZA 4CUGA 5IYCJ 4XAXB 2H3JA 1X6OA 1VQ7I 1VQLQ 1B59A 3E97A 4QVCA 5I21A 4EJOA 3IL2A 2VPLA 2B9SA 2MGQA 3LA3A 1JEGA 3TW7A 3OS2A 1HCRA 2RJFA 2HZTA 3BW1A 2HD0A 3IC7A 1VQMI 3OS5A 3BTLA 4BY6C 4M6XA 4ZYDA 4PJJA 3SZGA 2EYYA 5JHFA 1ZHIA 1XGMA 3M53A 1NLPC 2VKNA 2QUFA 3KYDB 3S2DJ 5HLGA 4C5IA 5GAN7 4I0AA 3M55A 2RPNA 2JQ7A 3OL3A 3CD6I 2EZIA 5F6FA 1O3QA 1OYXA 1ZAOA 1J0RA 2NWMA 3OS0A 5CAIA 4BHBA 1OQKA 1R5GA 2KMUA 2NS8A 1JKOC 2F2VA 3G4SA 2F5TX 3JAMK 4B8XA 1KC8R 2MLGA 1PSEA 4HRIA 4JS5A 5F1JA 4PLIA 5FW9A 3JB9G 3G2BA 4Y92A 1YG2A 3C18A 2RQUA 3G7ZA 3DU5A 1N5ZA 3CTAA 1M9SA 4D8KA 2D8JA 3A1PA 4M75E 1WIEA 3PNTA 1DUXC 1X4PA 1T98A 2LX7A 3JB9I 2D9TA 3CO6C 1VA7A 2L3QA 1F9NA 1VF9A 3SJMA 1D5YA 4ENKA 2JTEA 2QGFB 2CH4W 4CZZA 2BVLA 4L5JA 4LGWA 3TMOA 2J6OA 3EFOA 4GCVA 1SSFA 3GUDA 2ZXWH 1RPWA 3GTQJ 1N6AA 3BY6A 3FX3A 2DYIA 4ZYGA 2IA1A 3EGDA 3EYYA 2VONA 1KD1R 2K27A 3DLLF 5CKDA 5KVRA 2Q8KA 3BG7A 3PTAA 1YITA 1G3YA 4DA4A 1U6GA 4HCKA 3TBIA 1G4DA 3OSSC 4A12A 2QBYB 2DIQA 3OYKA 5D6WA 4GRIA 4HDUA 3EUHC 2JA7J 1OOTA 2ZPIB 3PMIA 3UWNA 2E12A 3WU1B 3WG7H 1IUFA 2KJBA 4S0HB 1W4SA 4Q48A 2D5VA 1FTZA 1K6OA 4BDZA 1SF9A 1NPPA 1YP5A 4PJOG 4M7DB 3CMAT 1P4WA 3LSKA 3SEZA 3AHUA 1UG2A 3GLLA 4FSXA 3VYUB 4P9UA 3CCQI 3CC7I 1P4XA 2QI2A 2ZMEB 4UVBA 1GBQA 1QBJA 1TUCA 3M3YJ 1GRIA 4AG1C 2J7IA 3HUGB 3LLRA 4A4EA 4PUSA 3EGXA 5GAOq 2YRDA 2FZCB 4UV9A 2OTJI 1SANA 1MGTA 2KKOA 2WY7Q 3BP8A 2EQKA 2XDPA 8ATCB 1T95A 5DM6F 1DJ7B 3W3CA 1IRGA 2XHCA 2EIJH 4IX7A 5C4XJ 2EILH 2VVKA 2YLCA 2ACJA 1FLIA 3LH0A 5IOZA 3KIOA 2AKLA 3S2WA 2RI5A 2WB1N 2MSYA 1YW8A 1K0SA 1QO0D 3MKZA 3EGUA 2LH9A 1IV8A 1YOVB 1NM7A 5HS7A 4GBQA 2RHIA 2QYOA 5K7FA 2RQVA 2PVDB 2VC8A 3GYHX 3GNFB 2R0QC 3HDDA 1ZR2A 3M0QA 1BJAA 5AYFA 2BY2A 5J3BA 1K76A 2W82A 2QA4Q 5CQGA 1U3EM 2O6GE 1N8RR 4R56A 5EF6A 2ISYA 4MZMA 3F72A 4DYCA 2HXOA 4FX4A 1RAHB 2UZKA 2L3SA 4YFKF 1MBGA 1RAIB 2M0MA 3C95A 3D5SC 4KN7X 4HNUA 2CZ0B 5FFXA 1BYMA 2PFBA 1AA7A 2P7CB 3VB2A 2RREA 1ODDA 4ANJA 3OMYA 4CYDA 1JGSA 3LX7A 4Z6YA 1UHFA 1Q86R 2HYJA 5B1BH 1UE9A 2K9LA 3E0JB 4BH9A 3M0PA 2MFZA 1H88C 2RQRA 3ZMSA 1BCOA 2TRTA 4CC7A 2OX7A 2DXTA 2ME6A 5HLTA 4AUXA 4RB1A 3I55I 4FYYB 1G2HA 2EQIA 4N0AC 4HCZA 4C0ZA 4DBHA 3M0SA 4RAGA 4C3HJ 3KFWX 2DDBA 2F5FA 3K70D 3HOVJ 2L89A 2JZ2A 3VOEA 2XDDA 5I22A 1WHJA 5M5YJ 3EG9B 1Q1VA 2UXNA 2D1VA 4BKXA 1PUFB 2IEKA 4BAYA 4L18B 4J7IA 5CKEA 2ZJ2A 1YJNI 3QYGB 4PL6A 4UVCA 1X6BA 1K8AC 2K5FA 3F70A 3FZVA 3AG2H 5LJ5e 1E17A 4A4FA 3H9GA 4IVNA 1QKXA 2HTJA 3GXOA 2L5QA 3PSFA 2PZ1A 2ESWA 2HDDA 2XMFA 4M7DD 4WF2A 4TV7A 3HGGA 2GA2A 1WJRA 1RL2A 3B6AA 3FC3A 1Z21A 3HKZA 4I98B 3M56A 3J80E 4XU1A 4OB0B 3VPRA 1RADB 5IYDJ 1I3AA 3CP8A 4CXFA 3QDFA 1NJIU 3EH1A 2P5VA 1ZR4A 1XJWB 2MH9A 3HRSA 3PIPF 4DBQA 3HSRA 5E3LA 2E1CA 2Y9YA 1ZYRF 4M77A 4DZPA 2A5YB 1YJWT 2VKVA 3RQIA 4OB1B 2JJ7A 2X6OA 3GNGA 5TISC 1VQ4I 5LD2C 3JCMb 1Z7UA 2I5UA 4HNTA 4CO8A 5IT9E 1YI2Q 4PZJA 2JZYA 4RM3A 4DZJA 4E70A 4RTUA 3VYGA 5H6QA 2HBWA 2A6EF 4C0DC 1K9MR 1BIAA 1QVFA 1FMVA 1CF7B 5CKBA 3GW2A 1Z3YA 1ON2A 4XLEA 1D0ZA 3I59A 3CMYA 3M4GA 5KYUA 1M90U 2KR3A 2BIVA 4Z88A 4B6MA 1NG7A 5F0FA 2HL3A 3SZTA 1IXSB 2V1RA 3K4JA 3CXCA 4XOTA 1M4ZA 3THKA 1V3FA 5EDNA 1Y96B 2XD0A 4JYKA 4CICA 1UECA 3ASKA 3HOXJ 5K5QA 2F6CA 3QG1A 1MBEA 1ETXA 2NUZA 1GT0C 1VQKQ 4WX9A 1KC8C 5GPAA 4A3GJ 3Q9SA 4E7HA 2KDZA 4KGXB 5KYWA 2Y9ZA 1Z6RA 1IRXA 1WZOA 2BOLA 1SVLA 3WTUC 2DYRH 3K1NA 2GQVA 2PNIA 2AZSA 3URGA 3H0GJ 3E9FA 2A7YA 3OYNA 3AFHA 4FTHA 2R7TA 3HHHA 1ZGJA 2X0LA 4G7ZF 1L3LA 5IP6A 2IPOB 5LJ5d 1QP2A 3SD4A 2R5ZB 4V2FA 4UXNA 2IP2A 3CCUT 5CPRB 3F6VA 3V8LA 5A2QK 4M78F 4C8QA 1VQPT 4E7ZA 4M75B 2G9WA 2D8HA 1PNJA 5FU7B 3FF5A 4HX7A 4XICA 4RTYA 5E20A 4ZTFA 1QRYA 5KH6A 1YBYA 2GBYA 4A3DJ 1YCYA 1UHWA 3GTLJ 5BOXA 2LREA 2ZO4A 3CBOA 1UCRA 4IOCF 4BXXJ 1UFMA 1JJ2S 2EQMA 3OQ5A 2E1OA 2DMUA 3R0AA 1Y56A 1JE8A 2E41A 3JSCA 3EHRA 5ICFA 4HF1A 1E0EA 1BIBA 2HS5A 3OSVA 3W2VA 4Y13A 5GAN2 1HF0A 2V7FA 5FLMJ 5E3OA 4FU6A 2YWWA 1OZ3A 2A69F 3ONQA 4FASD 2J5OA 2RHZA 3HL2A 2SEMA 1SMTA 2K3PA 5IHKA 5JVTA 2QEXT 1R5ID 3J7AF 4RGUA 1MJBA 2BUDA 3BR0A 1JT0A 1J3TA 1G3SA 2FQ4A 2FO0A 3O3KA 2YR2A 2CH0A 3TKYA 3I0TA 2EYWA 3FXQA 2L9RA 2XGDA 3ABLH 1X1PA 2YU9J 1JB0E 2GIZA 2A37A 2O4XB 1YJWA 1KQSA 1VQNT 1QZEA 2DMTA 2K9NA 1KYWA 3OIQA 3R0JA 4L6V5 3CCRI 1UEBA 2VJIA 1K9AA 1ZSZA 2DVJA 1B4AA 1WJEA 4QT7A 5GMKm 4BY6B 2AZVA 4RGSA 3HXLA 3OYGA 1M1GA 3RZDJ 3L2ZA 2LF7A 3F9KA 2HPMA 4LG0B 2EBIA 3FJ5A 3DLLA 1VQ5T 1S8NA 4KITB 4WK8F 3N97A 3WTWC 3CC4Q 1MMDA 3MZYA 1GDTA 2LZ6B 4HCCA 3M7GA 2MCNA 3X24B 2CJJA 3HOYJ 2CREA 1A04A 2EFOA 5L3BA 4RDUA 4IO9F 1QVGS 4KMUX 5DD4A 4KA4A 1N8RC 2BW3A 4Q5SF 4KISA 3A2KA 1YHQT 3QDRB 2QK0A 5C44J 2ED0A 5LFAA 3TOBA 4QTRA 4BBRJ 1XTAA 3ABMH 4NNJA 4RAYA 5K7ZA 1LJOA 3M58A 4V2SA 3F23A 3MJXA 1MH4A 3NRVA 3CCEA 1UELB 2QKLB 4OMQA 2XICA 5EEGA 1ZBJA 4PJOE 2KYBA 5I2MA 3K1PA 1MMGA 3ZMTA 2CSIA 1VQ7Q 3KFVA 3C12A 3CJQB 4DBRA 3VS1A 3BT9A 2DL8A 2QSFX 1QVUA 1IDYA 2ELJA 2BE9B 2L4MA 3BCAA 4BXUA 2CQ7A 5H2FC 2HQHA 4YG2F 4C92G 2CG4A 3DKXA 2E5ZA 1DGWY 2R57A 1YE9A 1AOJA 3I4MJ 3CCMI 1V55H 1EFNA 3FMSA 1CGPA 1D3BA 3ER0A 4XK8E 4X1VA 4ZN1A 1V54H 4EMSA 2XB0X 1IHVA 3VODA 3LSRA 1QNTA 4I0BA 1T8IA 3MP6A 4ZYAA 1W36D 3CD6Q 2UV1A 1V5GA 2PJRB 2GBQA 4FT2A 1WJDA 3OYBA 3JTGA 4ELZC 1ZELA 4G7HF 2VLAA 1Y8RB 1SAXA 1YIJI 5D4SA 1VQ6Q 2BGCA 1SFOJ 3FWEA 1JJ8C 4M7AA 3K10A 4U0VA 4BYYA 1CKAA 3IV5A 1ZH5A 4CCJA 2DD5A 4HOBA 3S1QJ 3OBYA 1LEBA 4QQ6A 2CFXA 3CUQB 4BGDA 2VUMJ 4ZNXA 2WV0A 1JUPA 3CDLA 5GADJ 2D45A 5J1YA 1A31A 4DIQA 1VQ9A 3LOCA 5K1YA 4BQQA 3KZYA 3CMET 1I6HJ 4XTZA 3E3VA 5HOOA 4X0GA 4J9BA 4N4GA 3MPUB 4D1QA 4EIKA 4M3BA 3ZR8X 1W1FA 3OB9A 2EIMH 1B1BA 5JLXA 1VYVA 1K4TA 2HAXA 2ZJPF 1SD7A 3KP4A 3MVPA 3WGGA 3MKYB 2CP0A 2X4XA 4Y28E 4F7UA 1YJ9A 1HSJA 4A4KA 1E3OC 3A01A 4FL6A 2DEUA 5GPCA 3BJ6A 3FHNA 3S8PA 4CCMA 2R7OA 3INZA 3CMAI 2LRDA 1ZQ3P 1BU1A 2MLKA 4ESJA 2XC7A 3MFKA 3T1BA 4L9NA 1VQLI 2H27A 1WXUA 3S1MJ 2HDCA 1J2XA 4LD9K 1IDZA 2CFOA 4PJ0C 3KEYA 3QPLA 4XMYA 2RQTA 2PMUA 2DT7B 4G6DA 1MBHA 5CCAA 1D8JA 3MCAB 2L7ZA 2A36A 5DYMA 4JJCA 1K6YA 3KP7A 1C1AA 4EJWA 2SRCA 1U3OA 1H0MA 1SEMA 2GTOA 2M02A 1SFUA 3M4YA 2FMLA 3MP8A 2STWA 2MD0A 2XGCA 2BKDN 2NVTJ 2XSJC 2K79A 1VQ8A 1X2NA 3H9JA 1MBFA 5LJ3g 3WTVC 1PP7U 3GZ6A 3DPUA 1M3CA 2QTVA 1S7AA 3QU6A 4A4HA 4HT8A 2AKKA 1QCFA 2OTJQ 5E79C 1MNEA 3E6MA 5GAMe 2QKMB 2DJQA 3SWNA 4MNUA 1FMKA 2JA6J 2E1MB 2Y4XA 5GANe 1SHFA 4LB6B 1OCZH 3H35A 5LHHA 1EZZB 2KROA 3NMZC 4L9JA 4HBLA 2PLYA 4L59A 3G6ET 2K4BA 3H0HA 1FY7A 2FBIA 1IN6A 1HXDA 2ADUA 1RAFB 2VYTA 1XTDA 2JPBA 2W10A 4J9DA 2KT8A 1QCOA 2L7KA 4E7KA 3V42A 1PDNC 1SPKA 5LJ3j 2MC3A 1GV5A 4FYXB 1HKQA 1JGGA 4IHVA 2E71A 3FDRA 3FRNA 1SVOA 5LJ5h 4MFEA 2HQAA 2NVUB
chains in the Genus database with same CATH topology
1BI2A 2RB6A 4BI8B 4RS8A 2ELHA 3OOPA 5HDKA 4XQ3A 4HDVA 4IRGA 4EQQA 4I7HA 5LJ5f 4II1A 2MH2A 2XASA 2E65A 4LDWA 2E10A 2YRVA 5GAN6 1D3YA 4LDXA 5ILVA 5L3DA 2E7WA 3E6BA 1WWXA 4E47A 1S72T 3LQQA 1YS7A 3HFNA 3ZN0A 2EFNA 1ZG5A 3QO3A 3IWFA 3QP6A 5GAN3 3QKJA 4WXCA 2W57A 4EJTA 5M9OA 4M78A 4RGRA 2QQSA 2ZNYA 2FNPA 4LFUA 1YQAA 4P5OA 3CPFA 2LNBA 4KUIA 4M9XA 1WQ7A 3ML6A 3J80Z 4JRKA 3EFRA 3K9TA 3MEUA 1G6NA