3HRXA

Crystal structure of phenylacetic acid degradation protein paag
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phenylacetic acid degradation protein PaaG from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Probable enoyl-CoA hydratase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3hrxA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3hrxA01
5E0SH 3QMJA 1XO6A 1YG6A 4OMRA 5DTPA 4Q1IA 5DU8A 4GHNA 2VSUE 3TZ3A 1O8UA 3Q7HA 3FDUA 2ZQRA 4I4ZA 4OG1A 3KQFA 1FC6A 4RCNA 5DU6A 2VSSF 1FC9A 3GF7A 3RSIA 3GMAA 3QKAA 2WTBA 4RYFH 3DJAA 4JCTA 4EMMA 5CTBA 4JOTA 3N6RB 2PG8A 1TG6A 3GF3A 2A7KA 3KTJA 3PZKA 3SWXA 4FN8A 1EF9A 3BPPA 4U19A 3VIVA 4NNQA 5JBWA 5KDRA 5INIA 3IBBA 5FUSA 1HZDA 3R9QA 4GM2A 1UIYA 4KPKA 3HLN1 2GTRA 3T8BA 3T3WA 4RYFA 3T88A 3QWDA 4K29A 4LK5A 1XNYA 4HC8A 3HP0A 1OD2A 1HNUA 4JVTA 5DTWA 5DUFA 1NZYA 1VRGA 2UZFA 4WCZA 1N6FA 5C9GA 4QIJA 3KTHA 2F9IB 3MT6A 3H02A 5E0SA 1OD4A 1UYSA 2J5SA 1XNVA 4Q0GA 4FJWD 3PE8A 3RSTA 1SZOA 4FNBA 5DZKA 3R9SA 4U0GA 5JBXA 3M6NA 3BF0A 3TT6A 5CTCA 3PGQA 3R6HA 1FC7A 2DEOA 1UYRA 3QREA 2VSUC 5DL1A 3MOYA 3ZWBA 1K32A 4U1AA 3TRRA 1Q51A 4JCQA 3H0QA 3U9RB 1K39A 4ZU2A 1PIXA 4U0GH 2VSSA 3V5IA 3KTIA 4MXIA 4FB8A 3HINA 4K2NA 1MJ3A 3TT7A 2Q35A 3ZW9A 3H81A 1WDKA 4ZDEA 3ZW8A 2ZQQA 3Q0GA 3HRXA 4KD6A 1ON9A 4MI2A 3P2LA 3U9TB 4JWVA 2DUBA 3NJBA 2W3PA 4JYJA 2VX2A 1XNWA 2BZRA 2PPYA 1X0UA 4I42A 3IB9A 1EY3A 3TLFA 2J5IB 1DCIA 3QXIA 5DU4A 3R0OA 1JXZA 2VSSE 4ZDCA 3H0JA 3TVUA 1WZ8A 4NEKA 2VSUF 2A81A 2J5II 2FBMA 2ZL2A 2J5IA 4ELWA 1DUBA 3STAA 3P5MA 4EMPA 3M6MA 2IEXA 4ZDFA 3G64A 4Z0MA 3MYBA 3LKEA 3TVWA 4QIIA 3T8AA 4F47A 1EF8A 3ZWCA 1YG8A 4MOUA 1J7XA 1FCFA 3GKBA 3P85A 2J5GD 4B3IA 2D3TA 3KTGA 3OMEA 3FF6A 4OLQA 5G1QA 4JCRA 4WYOB 2FW2A 3K50A 3H0SA 3IAVA 5KDRB 1N6DA 4FZWC 1UYTA 5G1RA 1Y7OA 4L8KA 4JJTA 2PBPA 3R9TA 2VSUA 4B3HA 2Q2XA 4DI1A 4B3JA 1XX4A 2F9YB 4KNPA 3OT6A 4JFCA 3DORA 2X58A 3L3SA 4JCSA 1RJMA 1ON3A 1WDLA 4FZWA 2F6IA 3ST9A 2NP9A 4ELSA 2ZL4A 3ISAA 4G2RA 2J5GA 2F6QA 5IKLB 3Q1TA 3TDCA 3I47A 1W2XA 2F9YA 5INFA 1HNOA 2X24A 5G1SA 2HW5A 4IZBA 3RRVA 2QQ3A 2VREA 3ZWAA 3SLLA 1UYVA 3KTKA 4ASIA 5KJPA 2FZSA 4L6WA 4JYLA 5INGA 5DKPA 3QK8A 3LAOA 4FNDA 1WDMA 2CE3A 3NJDA 4I52A 3BEZA 4K3WA 4QFEA 2EJ5A 3Q0JA 3HE2A 1PJHA 3JU1A 4FN7A 3TV5A 3GLMA 4U0HA 5MGBA 2CBYA 3U9SB 2F9IA 2A7SA 1TYFA 1RJNA 5DUCA 4IZCA 4U18A 1SG4A 2ZL0A 2Q34A 1NZYB 1Q52A 3K8XA 4JSBA 4ZDDA 3PEAA 3T89A 3QXZA 3OC7A 5C90A 3WG5A 4IZDA 4HNKA 2C8TA 4EMLA 1N6EA 3MFMA 4ZDBA 3H0UA 4ELXA 4WZ8B 4KWBA 5DZKH 2ZL3A 3QYRA 5E0NX 4YLHA 3V5EA 5FIFA
chains in the Genus database with same CATH superfamily
5E0SH 3QMJA 1XO6A 1YG6A 4OMRA 5DTPA 4Q1IA 1UX5A 5DU8A 4GHNA 2VSUE 3TZ3A 1O8UA 3Q7HA 3FDUA 2ZQRA 4I4ZA 4OG1A 3KQFA 1FC6A 4RCNA 5DU6A 2VSSF 1FC9A 3GF7A 3RSIA 3GMAA 3QKAA 2WTBA 4RYFH 3DJAA 4JCTA 3W8HB 4EMMA 5CTBA 3A4MA 4JOTA 3N6RB 2PG8A 1TG6A 3GF3A 2A7KA 3KTJA 3PZKA 3RQFA 3SWXA 4FN8A 1EF9A 3BPPA 4U19A 3VIVA 4NNQA 3A4LA 5JBWA 5KDRA 5INIA 3IBBA 5FUSA 1HZDA 3R9QA 4GM2A 1UIYA 4KPKA 3HLN1 2GTRA 3T8BA 3ADCA 3T3WA 3ADBA 4RYFA 3T88A 3QWDA 4K29A 4LK5A 1XNYA 4HC8A 3HP0A 1OD2A 1HNUA 4JVTA 5DTWA 5DUFA 1Y64B 1NZYA 1VRGA 2UZFA 4WCZA 1N6FA 5C9GA 4QIJA 3KTHA 3ADDA 2F9IB 3MT6A 3H02A 5E0SA 1OD4A 1UYSA 2J5SA 1XNVA 4Q0GA 4FJWD 3PE8A 3RSTA 1SZOA 4FNBA 5DZKA 3R9SA 3AM1A 4J2UA 4U0GA 5JBXA 3M6NA 3BF0A 3TT6A 3AJMA 5CTCA 3PGQA 3R6HA 1FC7A 2DEOA 1UYRA 3QREA 3IRBA 2VSUC 3L8IA 5DL1A 3MOYA 3ZWBA 3L8JA 1K32A 4U1AA 3TRRA 1Q51A 4JCQA 3H0QA 3U9RB 2YJGA 1K39A 4ZU2A 1PIXA 4U0GH 2VSSA 3V5IA 3KTIA 4MXIA 4FB8A 3HINA 3W8IB 4K2NA 1MJ3A 3TT7A 2Q35A 3ZW9A 3H81A 4ZDEA 1WDKA 3ZW8A 2ZQQA 3Q0GA 3HRXA 4KD6A 1ON9A 4MI2A 3P2LA 3U9TB 4JWVA 2DUBA 3NJBA 2W3PA 4JYJA 2VX2A 1XNWA 2BZRA 2PPYA 1X0UA 4I42A 3IB9A 1EY3A 3TLFA 2J5IB 1DCIA 3QXIA 5DU4A 3R0OA 3BPTA 1JXZA 2VSSE 4ZDCA 3H0JA 3TVUA 1WZ8A 4NEKA 2VSUF 2A81A 4NARA 2J5II 2FBMA 2ZL2A 2J5IA 4ELWA 1DUBA 3STAA 3P5MA 4EMPA 3M6MA 2IEXA 4ZDFA 3G64A 4Z0MA 3MYBA 3LKEA 3TVWA 4QIIA 3T8AA 4F47A 1EF8A 3ZWCA 1YG8A 4MOUA 1J7XA 5HUQA 1FCFA 3GKBA 3O4XE 3P85A 2J5GD 4B3IA 2D3TA 3KTGA 1UX4A 3OMEA 3RQEA 3FF6A 4OLQA 5G1QA 4JCRA 4WYOB 2FW2A 3K50A 3H0SA 3IAVA 1N6DA 5KDRB 3RQGA 4FZWC 1UYTA 5G1RA 1Y7OA 4L8KA 4JJTA 2PBPA 3R9TA 2VSUA 4B3HA 2Q2XA 4DI1A 4B3JA 1XX4A 2F9YB 4KNPA 3OT6A 4JFCA 3DORA 4HDTA 2X58A 3L3SA 4JCSA 1RJMA 1ON3A 1WDLA 4FZWA 2F6IA 3ST9A 2NP9A 4ELSA 2ZL4A 3ISAA 4G2RA 2J5GA 2F6QA 5IKLB 3Q1TA 3TDCA 3I47A 1W2XA 2F9YA 5INFA 1HNOA 2X24A 5G1SA 2HW5A 4IZBA 3RRVA 2QQ3A 2VREA 3ZWAA 3SLLA 1UYVA 3KTKA 4ASIA 4GEHB 5KJPA 2FZSA 4L6WA 4JYLA 5INGA 5DKPA 3QK8A 3LAOA 4FNDA 1WDMA 2CE3A 3NJDA 4I52A 3BEZA 4K3WA 4QFEA 2EJ5A 3Q0JA 3HE2A 1PJHA 3JU1A 4FN7A 3TV5A 3GLMA 4U0HA 5MGBA 2CBYA 3U9SB 2F9IA 2A7SA 1TYFA 1RJNA 5DUCA 4IZCA 3A4NA 4U18A 1SG4A 2ZL0A 2Q34A 2P63A 1NZYB 1Q52A 3K8XA 4JSBA 4ZDDA 3PEAA 3T89A 3QXZA 3OC7A 5C90A 3WG5A 4IZDA 4HNKA 2C8TA 4EMLA 1N6EA 3MFMA 4ZDBA 3H0UA 4ELXA 4WZ8B 4KWBA 5DZKH 2ZL3A 3QYRA 5E0NX 4YLHA 3V5EA 5FIFA
chains in the Genus database with same CATH topology
5E0SH 3QMJA 1XO6A 1YG6A 4OMRA 5DTPA 4Q1IA 5DU8A 4GHNA 2VSUE 3TZ3A 1O8UA 3Q7HA 3FDUA 2ZQRA 4I4ZA 4OG1A 3KQFA 1FC6A 4RCNA 5DU6A 2VSSF 1FC9A 3GF7A 3RSIA 3GMAA 3QKAA 2WTBA 4RYFH 3DJAA 4JCTA 4EMMA 5CTBA 4JOTA 3N6RB 2PG8A 1TG6A 3GF3A 2A7KA 3KTJA 3PZKA 3SWXA 4FN8A 1EF9A 3BPPA 4U19A 3VIVA 4NNQA 5JBWA 5KDRA 5INIA 3IBBA 5FUSA 1HZDA 3R9QA 4GM2A 1UIYA 4KPKA 3HLN1 2GTRA 3T8BA 3T3WA 4RYFA 3T88A 3QWDA 4K29A 4LK5A 1XNYA 4HC8A 3HP0A 1OD2A 1HNUA 4JVTA 5DTWA 5DUFA 1NZYA 1VRGA 2UZFA 4WCZA 1N6FA 5C9GA 4QIJA 3KTHA 2F9IB 3MT6A 3H02A 5E0SA 1OD4A 1UYSA 2J5SA 1XNVA 4Q0GA 4FJWD 3PE8A 3RSTA 1SZOA 4FNBA 5DZKA 3R9SA 4J2UA 4U0GA 5JBXA 3M6NA 3BF0A 3TT6A 5CTCA 3PGQA 3R6HA 1FC7A 2DEOA 1UYRA 3QREA 2VSUC 5DL1A 3MOYA 3ZWBA 1K32A 4U1AA 3TRRA 1Q51A 4JCQA 3H0QA 3U9RB 2YJGA 1K39A 4ZU2A 1PIXA 4U0GH 2VSSA 3V5IA 3KTIA 4MXIA 4FB8A 3HINA 4K2NA 1MJ3A 3TT7A 2Q35A 3ZW9A 3H81A 1WDKA 4ZDEA 3ZW8A 2ZQQA 3Q0GA 3HRXA 4KD6A 1ON9A 4MI2A 3P2LA 3U9TB 4JWVA 2DUBA 3NJBA 2W3PA 4JYJA 2VX2A 1XNWA 2BZRA 2PPYA 1X0UA 4I42A 3IB9A 1EY3A 3TLFA 2J5IB 1DCIA 3QXIA 5DU4A 3R0OA 3BPTA 1JXZA 2VSSE 4ZDCA 3H0JA 3TVUA 1WZ8A 4NEKA 2VSUF 2A81A 4NARA 2J5II 2FBMA 2ZL2A 2J5IA 4ELWA 1DUBA 3STAA 3P5MA 4EMPA 3M6MA 2IEXA 4ZDFA 3G64A 4Z0MA 3MYBA 3LKEA 3TVWA 4QIIA 3T8AA 4F47A 1EF8A 3ZWCA 1YG8A 4MOUA 1J7XA 5HUQA 1FCFA 3GKBA 3P85A 2J5GD 4B3IA 2D3TA 3KTGA 3OMEA 3FF6A 4OLQA 5G1QA 4JCRA 4WYOB 2FW2A 3K50A 3H0SA 3IAVA 1N6DA 5KDRB 4FZWC 1UYTA 5G1RA 1Y7OA 4L8KA 4JJTA 2PBPA 3R9TA 2VSUA 4B3HA 2Q2XA 4DI1A 4B3JA 1XX4A 2F9YB 4KNPA 3OT6A 4JFCA 3DORA 4HDTA 2X58A 3L3SA 4JCSA 1RJMA 1ON3A 1WDLA 4FZWA 2F6IA 3ST9A 2NP9A 4ELSA 2ZL4A 3ISAA 4G2RA 2J5GA 2F6QA 5IKLB 3Q1TA 3TDCA 3I47A 1W2XA 2F9YA 5INFA 1HNOA 2X24A 5G1SA 2HW5A 4IZBA 3RRVA 2QQ3A 2VREA 3ZWAA 3SLLA 1UYVA 3KTKA 4ASIA 5KJPA 2FZSA 4L6WA 4JYLA 5INGA 5DKPA 3QK8A 3LAOA 4FNDA 1WDMA 2CE3A 3NJDA 4I52A 3BEZA 4K3WA 4QFEA 2EJ5A 3Q0JA 3HE2A 1PJHA 3JU1A 4FN7A 3TV5A 3GLMA 4U0HA 5MGBA 2CBYA 3U9SB 2F9IA 2A7SA 1TYFA 1RJNA 5DUCA 4IZCA 4U18A 1SG4A 2ZL0A 2Q34A 1NZYB 1Q52A 3K8XA 4JSBA 4ZDDA 3PEAA 3T89A 3QXZA 3OC7A 5C90A 3WG5A 4IZDA 4HNKA 2C8TA 4EMLA 1N6EA 3MFMA 4ZDBA 3H0UA 4ELXA 4WZ8B 4KWBA 5DZKH 2ZL3A 3QYRA 5E0NX 4YLHA 3V5EA 5FIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E0S H;  3QMJ A;  1XO6 A;  1YG6 A;  4OMR A;  5DTP A;  4Q1I A;  5DU8 A;  4GHN A;  2VSU E;  3TZ3 A;  1O8U A;  3Q7H A;  3FDU A;  2ZQR A;  4I4Z A;  4OG1 A;  3KQF A;  1FC6 A;  4RCN A;  5DU6 A;  2VSS F;  1FC9 A;  3GF7 A;  3RSI A;  3GMA A;  3QKA A;  2WTB A;  4RYF H;  3DJA A;  4JCT A;  4EMM A;  5CTB A;  4JOT A;  3N6R B;  2PG8 A;  1TG6 A;  3GF3 A;  2A7K A;  3KTJ A;  3PZK A;  3SWX A;  4FN8 A;  1EF9 A;  3BPP A;  4U19 A;  3VIV A;  4NNQ A;  5JBW A;  5KDR A;  5INI A;  3IBB A;  5FUS A;  1HZD A;  3R9Q A;  4GM2 A;  1UIY A;  4KPK A;  3HLN 1;  2GTR A;  3T8B A;  3T3W A;  4RYF A;  3T88 A;  3QWD A;  4K29 A;  4LK5 A;  1XNY A;  4HC8 A;  3HP0 A;  1OD2 A;  1HNU A;  4JVT A;  5DTW A;  5DUF A;  1NZY A;  1VRG A;  2UZF A;  4WCZ A;  1N6F A;  5C9G A;  4QIJ A;  3KTH A;  2F9I B;  3MT6 A;  3H02 A;  5E0S A;  1OD4 A;  1UYS A;  2J5S A;  1XNV A;  4Q0G A;  4FJW D;  3PE8 A;  3RST A;  1SZO A;  4FNB A;  5DZK A;  3R9S A;  4U0G A;  5JBX A;  3M6N A;  3BF0 A;  3TT6 A;  5CTC A;  3PGQ A;  3R6H A;  1FC7 A;  2DEO A;  1UYR A;  3QRE A;  2VSU C;  5DL1 A;  3MOY A;  3ZWB A;  1K32 A;  4U1A A;  3TRR A;  1Q51 A;  4JCQ A;  3H0Q A;  3U9R B;  1K39 A;  4ZU2 A;  1PIX A;  4U0G H;  2VSS A;  3V5I A;  3KTI A;  4MXI A;  4FB8 A;  3HIN A;  4K2N A;  1MJ3 A;  3TT7 A;  2Q35 A;  3ZW9 A;  3H81 A;  1WDK A;  4ZDE A;  3ZW8 A;  2ZQQ A;  3Q0G A;  3HRX A;  4KD6 A;  1ON9 A;  4MI2 A;  3P2L A;  3U9T B;  4JWV A;  2DUB A;  3NJB A;  2W3P A;  4JYJ A;  2VX2 A;  1XNW A;  2BZR A;  2PPY A;  1X0U A;  4I42 A;  3IB9 A;  1EY3 A;  3TLF A;  2J5I B;  1DCI A;  3QXI A;  5DU4 A;  3R0O A;  1JXZ A;  2VSS E;  4ZDC A;  3H0J A;  3TVU A;  1WZ8 A;  4NEK A;  2VSU F;  2A81 A;  2J5I I;  2FBM A;  2ZL2 A;  2J5I A;  4ELW A;  1DUB A;  3STA A;  3P5M A;  4EMP A;  3M6M A;  2IEX A;  4ZDF A;  3G64 A;  4Z0M A;  3MYB A;  3LKE A;  3TVW A;  4QII A;  3T8A A;  4F47 A;  1EF8 A;  3ZWC A;  1YG8 A;  4MOU A;  1J7X A;  1FCF A;  3GKB A;  3P85 A;  2J5G D;  4B3I A;  2D3T A;  3KTG A;  3OME A;  3FF6 A;  4OLQ A;  5G1Q A;  4JCR A;  4WYO B;  2FW2 A;  3K50 A;  3H0S A;  3IAV A;  5KDR B;  1N6D A;  4FZW C;  1UYT A;  5G1R A;  1Y7O A;  4L8K A;  4JJT A;  2PBP A;  3R9T A;  2VSU A;  4B3H A;  2Q2X A;  4DI1 A;  4B3J A;  1XX4 A;  2F9Y B;  4KNP A;  3OT6 A;  4JFC A;  3DOR A;  2X58 A;  3L3S A;  4JCS A;  1RJM A;  1ON3 A;  1WDL A;  4FZW A;  2F6I A;  3ST9 A;  2NP9 A;  4ELS A;  2ZL4 A;  3ISA A;  4G2R A;  2J5G A;  2F6Q A;  5IKL B;  3Q1T A;  3TDC A;  3I47 A;  1W2X A;  2F9Y A;  5INF A;  1HNO A;  2X24 A;  5G1S A;  2HW5 A;  4IZB A;  3RRV A;  2QQ3 A;  2VRE A;  3ZWA A;  3SLL A;  1UYV A;  3KTK A;  4ASI A;  5KJP A;  2FZS A;  4L6W A;  4JYL A;  5ING A;  5DKP A;  3QK8 A;  3LAO A;  4FND A;  1WDM A;  2CE3 A;  3NJD A;  4I52 A;  3BEZ A;  4K3W A;  4QFE A;  2EJ5 A;  3Q0J A;  3HE2 A;  1PJH A;  3JU1 A;  4FN7 A;  3TV5 A;  3GLM A;  4U0H A;  5MGB A;  2CBY A;  3U9S B;  2F9I A;  2A7S A;  1TYF A;  1RJN A;  5DUC A;  4IZC A;  4U18 A;  1SG4 A;  2ZL0 A;  2Q34 A;  1NZY B;  1Q52 A;  3K8X A;  4JSB A;  4ZDD A;  3PEA A;  3T89 A;  3QXZ A;  3OC7 A;  5C90 A;  3WG5 A;  4IZD A;  4HNK A;  2C8T A;  4EML A;  1N6E A;  3MFM A;  4ZDB A;  3H0U A;  4ELX A;  4WZ8 B;  4KWB A;  5DZK H;  2ZL3 A;  3QYR A;  5E0N X;  4YLH A;  3V5E A;  5FIF A; 
#chains in the Genus database with same CATH topology
 5E0S H;  3QMJ A;  1XO6 A;  1YG6 A;  4OMR A;  5DTP A;  4Q1I A;  1UX5 A;  5DU8 A;  4GHN A;  2VSU E;  3TZ3 A;  1O8U A;  3Q7H A;  3FDU A;  2ZQR A;  4I4Z A;  4OG1 A;  3KQF A;  1FC6 A;  4RCN A;  5DU6 A;  2VSS F;  1FC9 A;  3GF7 A;  3RSI A;  3GMA A;  3QKA A;  2WTB A;  4RYF H;  3DJA A;  4JCT A;  3W8H B;  4EMM A;  5CTB A;  3A4M A;  4JOT A;  3N6R B;  2PG8 A;  1TG6 A;  3GF3 A;  2A7K A;  3KTJ A;  3PZK A;  3RQF A;  3SWX A;  4FN8 A;  1EF9 A;  3BPP A;  4U19 A;  3VIV A;  4NNQ A;  3A4L A;  5JBW A;  5KDR A;  5INI A;  3IBB A;  5FUS A;  1HZD A;  3R9Q A;  4GM2 A;  1UIY A;  4KPK A;  3HLN 1;  2GTR A;  3T8B A;  3ADC A;  3T3W A;  3ADB A;  4RYF A;  3T88 A;  3QWD A;  4K29 A;  4LK5 A;  1XNY A;  4HC8 A;  3HP0 A;  1OD2 A;  1HNU A;  4JVT A;  5DTW A;  5DUF A;  1Y64 B;  1NZY A;  1VRG A;  2UZF A;  4WCZ A;  1N6F A;  5C9G A;  4QIJ A;  3KTH A;  3ADD A;  2F9I B;  3MT6 A;  3H02 A;  5E0S A;  1OD4 A;  1UYS A;  2J5S A;  1XNV A;  4Q0G A;  4FJW D;  3PE8 A;  3RST A;  1SZO A;  4FNB A;  5DZK A;  3R9S A;  3AM1 A;  4J2U A;  4U0G A;  5JBX A;  3M6N A;  3BF0 A;  3TT6 A;  3AJM A;  5CTC A;  3PGQ A;  3R6H A;  1FC7 A;  2DEO A;  1UYR A;  3QRE A;  3IRB A;  2VSU C;  3L8I A;  5DL1 A;  3MOY A;  3ZWB A;  3L8J A;  1K32 A;  4U1A A;  3TRR A;  1Q51 A;  4JCQ A;  3H0Q A;  3U9R B;  2YJG A;  1K39 A;  4ZU2 A;  1PIX A;  4U0G H;  2VSS A;  3V5I A;  3KTI A;  4MXI A;  4FB8 A;  3HIN A;  3W8I B;  4K2N A;  1MJ3 A;  3TT7 A;  2Q35 A;  3ZW9 A;  3H81 A;  4ZDE A;  1WDK A;  3ZW8 A;  2ZQQ A;  3Q0G A;  3HRX A;  4KD6 A;  1ON9 A;  4MI2 A;  3P2L A;  3U9T B;  4JWV A;  2DUB A;  3NJB A;  2W3P A;  4JYJ A;  2VX2 A;  1XNW A;  2BZR A;  2PPY A;  1X0U A;  4I42 A;  3IB9 A;  1EY3 A;  3TLF A;  2J5I B;  1DCI A;  3QXI A;  5DU4 A;  3R0O A;  3BPT A;  1JXZ A;  2VSS E;  4ZDC A;  3H0J A;  3TVU A;  1WZ8 A;  4NEK A;  2VSU F;  2A81 A;  4NAR A;  2J5I I;  2FBM A;  2ZL2 A;  2J5I A;  4ELW A;  1DUB A;  3STA A;  3P5M A;  4EMP A;  3M6M A;  2IEX A;  4ZDF A;  3G64 A;  4Z0M A;  3MYB A;  3LKE A;  3TVW A;  4QII A;  3T8A A;  4F47 A;  1EF8 A;  3ZWC A;  1YG8 A;  4MOU A;  1J7X A;  5HUQ A;  1FCF A;  3GKB A;  3O4X E;  3P85 A;  2J5G D;  4B3I A;  2D3T A;  3KTG A;  1UX4 A;  3OME A;  3RQE A;  3FF6 A;  4OLQ A;  5G1Q A;  4JCR A;  4WYO B;  2FW2 A;  3K50 A;  3H0S A;  3IAV A;  1N6D A;  5KDR B;  3RQG A;  4FZW C;  1UYT A;  5G1R A;  1Y7O A;  4L8K A;  4JJT A;  2PBP A;  3R9T A;  2VSU A;  4B3H A;  2Q2X A;  4DI1 A;  4B3J A;  1XX4 A;  2F9Y B;  4KNP A;  3OT6 A;  4JFC A;  3DOR A;  4HDT A;  2X58 A;  3L3S A;  4JCS A;  1RJM A;  1ON3 A;  1WDL A;  4FZW A;  2F6I A;  3ST9 A;  2NP9 A;  4ELS A;  2ZL4 A;  3ISA A;  4G2R A;  2J5G A;  2F6Q A;  5IKL B;  3Q1T A;  3TDC A;  3I47 A;  1W2X A;  2F9Y A;  5INF A;  1HNO A;  2X24 A;  5G1S A;  2HW5 A;  4IZB A;  3RRV A;  2QQ3 A;  2VRE A;  3ZWA A;  3SLL A;  1UYV A;  3KTK A;  4ASI A;  4GEH B;  5KJP A;  2FZS A;  4L6W A;  4JYL A;  5ING A;  5DKP A;  3QK8 A;  3LAO A;  4FND A;  1WDM A;  2CE3 A;  3NJD A;  4I52 A;  3BEZ A;  4K3W A;  4QFE A;  2EJ5 A;  3Q0J A;  3HE2 A;  1PJH A;  3JU1 A;  4FN7 A;  3TV5 A;  3GLM A;  4U0H A;  5MGB A;  2CBY A;  3U9S B;  2F9I A;  2A7S A;  1TYF A;  1RJN A;  5DUC A;  4IZC A;  3A4N A;  4U18 A;  1SG4 A;  2ZL0 A;  2Q34 A;  2P63 A;  1NZY B;  1Q52 A;  3K8X A;  4JSB A;  4ZDD A;  3PEA A;  3T89 A;  3QXZ A;  3OC7 A;  5C90 A;  3WG5 A;  4IZD A;  4HNK A;  2C8T A;  4EML A;  1N6E A;  3MFM A;  4ZDB A;  3H0U A;  4ELX A;  4WZ8 B;  4KWB A;  5DZK H;  2ZL3 A;  3QYR A;  5E0N X;  4YLH A;  3V5E A;  5FIF A; 
#chains in the Genus database with same CATH homology
 5E0S H;  3QMJ A;  1XO6 A;  1YG6 A;  4OMR A;  5DTP A;  4Q1I A;  5DU8 A;  4GHN A;  2VSU E;  3TZ3 A;  1O8U A;  3Q7H A;  3FDU A;  2ZQR A;  4I4Z A;  4OG1 A;  3KQF A;  1FC6 A;  4RCN A;  5DU6 A;  2VSS F;  1FC9 A;  3GF7 A;  3RSI A;  3GMA A;  3QKA A;  2WTB A;  4RYF H;  3DJA A;  4JCT A;  4EMM A;  5CTB A;  4JOT A;  3N6R B;  2PG8 A;  1TG6 A;  3GF3 A;  2A7K A;  3KTJ A;  3PZK A;  3SWX A;  4FN8 A;  1EF9 A;  3BPP A;  4U19 A;  3VIV A;  4NNQ A;  5JBW A;  5KDR A;  5INI A;  3IBB A;  5FUS A;  1HZD A;  3R9Q A;  4GM2 A;  1UIY A;  4KPK A;  3HLN 1;  2GTR A;  3T8B A;  3T3W A;  4RYF A;  3T88 A;  3QWD A;  4K29 A;  4LK5 A;  1XNY A;  4HC8 A;  3HP0 A;  1OD2 A;  1HNU A;  4JVT A;  5DTW A;  5DUF A;  1NZY A;  1VRG A;  2UZF A;  4WCZ A;  1N6F A;  5C9G A;  4QIJ A;  3KTH A;  2F9I B;  3MT6 A;  3H02 A;  5E0S A;  1OD4 A;  1UYS A;  2J5S A;  1XNV A;  4Q0G A;  4FJW D;  3PE8 A;  3RST A;  1SZO A;  4FNB A;  5DZK A;  3R9S A;  4J2U A;  4U0G A;  5JBX A;  3M6N A;  3BF0 A;  3TT6 A;  5CTC A;  3PGQ A;  3R6H A;  1FC7 A;  2DEO A;  1UYR A;  3QRE A;  2VSU C;  5DL1 A;  3MOY A;  3ZWB A;  1K32 A;  4U1A A;  3TRR A;  1Q51 A;  4JCQ A;  3H0Q A;  3U9R B;  2YJG A;  1K39 A;  4ZU2 A;  1PIX A;  4U0G H;  2VSS A;  3V5I A;  3KTI A;  4MXI A;  4FB8 A;  3HIN A;  4K2N A;  1MJ3 A;  3TT7 A;  2Q35 A;  3ZW9 A;  3H81 A;  1WDK A;  4ZDE A;  3ZW8 A;  2ZQQ A;  3Q0G A;  3HRX A;  4KD6 A;  1ON9 A;  4MI2 A;  3P2L A;  3U9T B;  4JWV A;  2DUB A;  3NJB A;  2W3P A;  4JYJ A;  2VX2 A;  1XNW A;  2BZR A;  2PPY A;  1X0U A;  4I42 A;  3IB9 A;  1EY3 A;  3TLF A;  2J5I B;  1DCI A;  3QXI A;  5DU4 A;  3R0O A;  3BPT A;  1JXZ A;  2VSS E;  4ZDC A;  3H0J A;  3TVU A;  1WZ8 A;  4NEK A;  2VSU F;  2A81 A;  4NAR A;  2J5I I;  2FBM A;  2ZL2 A;  2J5I A;  4ELW A;  1DUB A;  3STA A;  3P5M A;  4EMP A;  3M6M A;  2IEX A;  4ZDF A;  3G64 A;  4Z0M A;  3MYB A;  3LKE A;  3TVW A;  4QII A;  3T8A A;  4F47 A;  1EF8 A;  3ZWC A;  1YG8 A;  4MOU A;  1J7X A;  5HUQ A;  1FCF A;  3GKB A;  3P85 A;  2J5G D;  4B3I A;  2D3T A;  3KTG A;  3OME A;  3FF6 A;  4OLQ A;  5G1Q A;  4JCR A;  4WYO B;  2FW2 A;  3K50 A;  3H0S A;  3IAV A;  1N6D A;  5KDR B;  4FZW C;  1UYT A;  5G1R A;  1Y7O A;  4L8K A;  4JJT A;  2PBP A;  3R9T A;  2VSU A;  4B3H A;  2Q2X A;  4DI1 A;  4B3J A;  1XX4 A;  2F9Y B;  4KNP A;  3OT6 A;  4JFC A;  3DOR A;  4HDT A;  2X58 A;  3L3S A;  4JCS A;  1RJM A;  1ON3 A;  1WDL A;  4FZW A;  2F6I A;  3ST9 A;  2NP9 A;  4ELS A;  2ZL4 A;  3ISA A;  4G2R A;  2J5G A;  2F6Q A;  5IKL B;  3Q1T A;  3TDC A;  3I47 A;  1W2X A;  2F9Y A;  5INF A;  1HNO A;  2X24 A;  5G1S A;  2HW5 A;  4IZB A;  3RRV A;  2QQ3 A;  2VRE A;  3ZWA A;  3SLL A;  1UYV A;  3KTK A;  4ASI A;  5KJP A;  2FZS A;  4L6W A;  4JYL A;  5ING A;  5DKP A;  3QK8 A;  3LAO A;  4FND A;  1WDM A;  2CE3 A;  3NJD A;  4I52 A;  3BEZ A;  4K3W A;  4QFE A;  2EJ5 A;  3Q0J A;  3HE2 A;  1PJH A;  3JU1 A;  4FN7 A;  3TV5 A;  3GLM A;  4U0H A;  5MGB A;  2CBY A;  3U9S B;  2F9I A;  2A7S A;  1TYF A;  1RJN A;  5DUC A;  4IZC A;  4U18 A;  1SG4 A;  2ZL0 A;  2Q34 A;  1NZY B;  1Q52 A;  3K8X A;  4JSB A;  4ZDD A;  3PEA A;  3T89 A;  3QXZ A;  3OC7 A;  5C90 A;  3WG5 A;  4IZD A;  4HNK A;  2C8T A;  4EML A;  1N6E A;  3MFM A;  4ZDB A;  3H0U A;  4ELX A;  4WZ8 B;  4KWB A;  5DZK H;  2ZL3 A;  3QYR A;  5E0N X;  4YLH A;  3V5E A;  5FIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...