3HRXA

Crystal structure of phenylacetic acid degradation protein paag
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
b'MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable enoyl-CoA hydratase
publication title Crystal structure of phenylacetic acid degradation protein PaaG from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3hrxA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3hrxA01
5FIFA 3KTHA 2ZQQA 3V5EA 2HW5A 2F9IA 3ST9A 1EF9A 5INGA 2C8TA 5JBWA 3GMAA 5FUSA 4RYFH 2DEOA 1RJMA 3RSIA 3TRRA 1WZ8A 3H0JA 1XNWA 3T3WA 4FNBA 4RCNA 3TT7A 4EMLA 4OG1A 4ELXA 4I4ZA 1Q51A 3GLMA 1TG6A 3ZW9A 3SLLA 2Q2XA 4Z0MA 1YG6A 1YG8A 4GHNA 3JU1A 4G2RA 3STAA 2CE3A 5DUCA 2FZSA 3PZKA 4EMPA 4NEKA 1SZOA 1UIYA 1TYFA 1K39A 4JOTA 4KWBA 1N6DA 3MYBA 2X24A 4Q0GA 1XNVA 3Q0JA 4B3IA 5IKLB 2ZQRA 5CTBA 3U9TB 3IBBA 5E0SH 1EY3A 1UYRA 3G64A 4FJWD 3R9SA 2PG8A 4ZU2A 5DKPA 3Q1TA 3OC7A 3BF0A 4IZDA 5KJPA 2PBPA 1FC9A 4HC8A 2VSUF 4JCRA 4U0GA 1OD4A 3T8AA 3QREA 2W3PA 1Q52A 3T89A 3R6HA 3MFMA 4Q1IA 5DZKA 4F47A 3V5IA 3N6RB 1RJNA 3NJBA 2CBYA 2GTRA 2ZL4A 3TV5A 5DU6A 4NNQA 3T88A 4YLHA 2J5IA 2VSUA 4KPKA 3R0OA 2UZFA 5CTCA 5E0NX 5C90A 5DTPA 4ASIA 4ELWA 1PJHA 5KDRB 3H0SA 5DL1A 3ZWBA 3GF7A 5C9GA 4WYOB 4I42A 5G1SA 3K8XA 5DTWA 4ELSA 4RYFA 4JVTA 3KTKA 1FCFA 1X0UA 1W2XA 2ZL3A 4K29A 3QYRA 4U18A 3FDUA 3RSTA 3P85A 3Q7HA 2FBMA 3OT6A 3KQFA 3TLFA 5KDRA 4U0HA 3RRVA 3T8BA 2PPYA 4WCZA 4LK5A 1UYVA 2NP9A 1FC7A 2VSSE 3QWDA 3HLN1 3TT6A 3L3SA 3H02A 3WG5A 2J5IB 3PGQA 3ISAA 3MOYA 4JCQA 2QQ3A 1MJ3A 4JCTA 3KTJA 3BPPA 5E0SA 4L8KA 3ZWCA 4B3JA 3H0UA 2ZL2A 2IEXA 4JWVA 4U1AA 1ON3A 2Q35A 2A81A 2FW2A 1SG4A 1HNUA 3QXZA 5MGBA 1ON9A 2VSSF 4OMRA 1FC6A 2A7SA 2X58A 4ZDDA 3LKEA 3HINA 4OLQA 3GKBA 2DUBA 1HNOA 4KNPA 4QIIA 4HNKA 1XO6A 3HRXA 3SWXA 3KTGA 1NZYB 2EJ5A 3VIVA 3TVWA 1DCIA 4U19A 1J7XA 2Q34A 3PE8A 3OMEA 4ZDBA 3P2LA 3M6MA 3QMJA 2A7KA 1XNYA 4MXIA 5G1QA 4FN8A 1XX4A 1N6EA 1UYSA 4JYLA 1VRGA 4JCSA 3K50A 2D3TA 4IZCA 4FZWC 3ZWAA 4GM2A 2VREA 2ZL0A 1EF8A 1NZYA 3IB9A 3ZW8A 1K32A 1WDKA 3HE2A 4IZBA 2VSUC 3DJAA 4I52A 3H0QA 2BZRA 2J5GA 3M6NA 3R9TA 2F9YB 3KTIA 3TVUA 4K3WA 3PEAA 1OD2A 1JXZA 3IAVA 2VSUE 1Y7OA 3FF6A 4JYJA 3NJDA 4ZDCA 2J5II 4EMMA 5JBXA 4JSBA 1O8UA 2J5SA 3QK8A 3Q0GA 4FB8A 3TDCA 3R9QA 4ZDEA 2F6IA 3BEZA 5INFA 1PIXA 5DU4A 5DUFA 5DU8A 2F6QA 3H81A 2F9YA 1N6FA 3QKAA 4MI2A 2F9IB 3HP0A 4U0GH 4QFEA 3U9RB 4MOUA 3TZ3A 4FZWA 5DZKH 3GF3A 4B3HA 3QXIA 4FN7A 2WTBA 2VSSA 4ZDFA 1HZDA 4WZ8B 1WDMA 4QIJA 1UYTA 4L6WA 4KD6A 3DORA 1DUBA 2J5GD 5INIA 4JJTA 4DI1A 3U9SB 3LAOA 2VX2A 4JFCA 5G1RA 4FNDA 1WDLA 3I47A 3P5MA 4K2NA 3MT6A
chains in the Genus database with same CATH superfamily
5FIFA 3KTHA 2ZQQA 3V5EA 2HW5A 2F9IA 3ST9A 1EF9A 5INGA 2C8TA 4J2UA 5JBWA 3GMAA 5FUSA 4RYFH 2DEOA 1RJMA 3RSIA 3TRRA 1WZ8A 3H0JA 1XNWA 3T3WA 4FNBA 4RCNA 3TT7A 4EMLA 4OG1A 3AM1A 4ELXA 4I4ZA 1UX5A 1Q51A 3RQGA 3GLMA 1TG6A 3ZW9A 3SLLA 2Q2XA 4Z0MA 1YG6A 1YG8A 4GHNA 3JU1A 4G2RA 3STAA 2CE3A 5DUCA 2FZSA 3PZKA 4EMPA 4NEKA 1SZOA 1UIYA 1TYFA 1K39A 4JOTA 4KWBA 1N6DA 3MYBA 2X24A 4Q0GA 1XNVA 3Q0JA 4B3IA 5IKLB 3A4MA 2ZQRA 5CTBA 3U9TB 3IBBA 5E0SH 1EY3A 1UYRA 3G64A 4FJWD 3R9SA 2PG8A 4ZU2A 5DKPA 3Q1TA 3OC7A 3BF0A 4IZDA 5KJPA 2PBPA 1FC9A 4HC8A 2VSUF 4JCRA 4U0GA 1OD4A 3T8AA 3QREA 2W3PA 1Q52A 3T89A 3R6HA 3MFMA 4Q1IA 5DZKA 4F47A 3V5IA 3N6RB 1RJNA 3NJBA 2CBYA 2GTRA 2ZL4A 3TV5A 5DU6A 4NNQA 3T88A 4YLHA 2J5IA 2VSUA 4KPKA 3R0OA 2UZFA 5CTCA 5E0NX 5C90A 5DTPA 4ASIA 4ELWA 1PJHA 5KDRB 3H0SA 5DL1A 3ZWBA 2P63A 3W8HB 3GF7A 5C9GA 4WYOB 4I42A 5G1SA 3K8XA 5DTWA 4ELSA 4RYFA 4JVTA 3KTKA 1FCFA 1X0UA 1W2XA 2ZL3A 3L8IA 4K29A 3QYRA 4U18A 3FDUA 3RSTA 3P85A 3Q7HA 2FBMA 3OT6A 3KQFA 3TLFA 5KDRA 4U0HA 3RRVA 3T8BA 2PPYA 3W8IB 4WCZA 4LK5A 1UYVA 2NP9A 1FC7A 2VSSE 3QWDA 3HLN1 3TT6A 3L3SA 3H02A 3WG5A 2J5IB 3PGQA 3ISAA 3MOYA 4JCQA 2QQ3A 1MJ3A 4JCTA 3ADCA 3KTJA 3BPPA 5E0SA 4L8KA 3ZWCA 4B3JA 3H0UA 2ZL2A 2IEXA 3AJMA 4JWVA 4U1AA 1ON3A 2Q35A 2A81A 2FW2A 3L8JA 1UX4A 1SG4A 1HNUA 3QXZA 5MGBA 1ON9A 2VSSF 4OMRA 1FC6A 3A4NA 2A7SA 2X58A 4ZDDA 3LKEA 3HINA 4OLQA 3GKBA 2DUBA 1HNOA 4KNPA 4QIIA 4HNKA 1XO6A 3HRXA 3SWXA 3KTGA 1NZYB 2EJ5A 3VIVA 3TVWA 1DCIA 4U19A 1J7XA 2Q34A 3PE8A 3OMEA 4ZDBA 3P2LA 3M6MA 3QMJA 2A7KA 1XNYA 4MXIA 5G1QA 4FN8A 1XX4A 1N6EA 1UYSA 4JYLA 1VRGA 4JCSA 3K50A 2D3TA 4IZCA 4FZWC 3ZWAA 4GM2A 2VREA 2ZL0A 1EF8A 1NZYA 3IRBA 3IB9A 3ADBA 3ZW8A 1K32A 3ADDA 1WDKA 3HE2A 4IZBA 2VSUC 3DJAA 4I52A 3H0QA 2BZRA 2J5GA 3M6NA 3RQEA 3R9TA 2F9YB 3KTIA 3TVUA 4K3WA 3PEAA 1OD2A 1JXZA 3BPTA 3IAVA 2VSUE 1Y7OA 3FF6A 4JYJA 3NJDA 3O4XE 4ZDCA 2J5II 4EMMA 5JBXA 4JSBA 1O8UA 2J5SA 3QK8A 3Q0GA 4FB8A 4NARA 3TDCA 3R9QA 4ZDEA 2F6IA 3BEZA 5INFA 1PIXA 5DU4A 5DUFA 5DU8A 2F6QA 3H81A 2F9YA 1N6FA 3QKAA 4MI2A 2F9IB 3HP0A 4U0GH 4QFEA 3U9RB 4MOUA 4HDTA 3TZ3A 4FZWA 5DZKH 3GF3A 4B3HA 3QXIA 4FN7A 2WTBA 2VSSA 4ZDFA 1HZDA 4WZ8B 1WDMA 4QIJA 3A4LA 1UYTA 4L6WA 4KD6A 3RQFA 5HUQA 3DORA 1DUBA 2J5GD 4GEHB 5INIA 4JJTA 4DI1A 3U9SB 3LAOA 2VX2A 4JFCA 5G1RA 4FNDA 1Y64B 1WDLA 3I47A 3P5MA 4K2NA 2YJGA 3MT6A
chains in the Genus database with same CATH topology
5FIFA 3KTHA 2ZQQA 3V5EA 2HW5A 2F9IA 3ST9A 1EF9A 5INGA 2C8TA 4J2UA 5JBWA 3GMAA 5FUSA 4RYFH 2DEOA 1RJMA 3RSIA 3TRRA 1WZ8A 3H0JA 1XNWA 3T3WA 4FNBA 4RCNA 3TT7A 4EMLA 4OG1A 4ELXA 4I4ZA 1Q51A 3GLMA 1TG6A 3ZW9A 3SLLA 2Q2XA 4Z0MA 1YG6A 1YG8A 4GHNA 3JU1A 4G2RA 3STAA 2CE3A 5DUCA 2FZSA 3PZKA 4EMPA 4NEKA 1SZOA 1UIYA 1TYFA 1K39A 4JOTA 4KWBA 1N6DA 3MYBA 2X24A 4Q0GA 1XNVA 3Q0JA 4B3IA 5IKLB 2ZQRA 5CTBA 3U9TB 3IBBA 5E0SH 1EY3A 1UYRA 3G64A 4FJWD 3R9SA 2PG8A 4ZU2A 5DKPA 3Q1TA 3OC7A 3BF0A 4IZDA 5KJPA 2PBPA 1FC9A 4HC8A 2VSUF 4JCRA 4U0GA 1OD4A 3T8AA 3QREA 2W3PA 1Q52A 3T89A 3R6HA 3MFMA 4Q1IA 5DZKA 4F47A 3V5IA 3N6RB 1RJNA 3NJBA 2CBYA 2GTRA 2ZL4A 3TV5A 5DU6A 4NNQA 3T88A 4YLHA 2J5IA 2VSUA 4KPKA 3R0OA 2UZFA 5CTCA 5E0NX 5C90A 5DTPA 4ASIA 4ELWA 1PJHA 5KDRB 3H0SA 5DL1A 3ZWBA 3GF7A 5C9GA 4WYOB 4I42A 5G1SA 3K8XA 5DTWA 4ELSA 4RYFA 4JVTA 3KTKA 1FCFA 1X0UA 1W2XA 2ZL3A 4K29A 3QYRA 4U18A 3FDUA 3RSTA 3P85A 3Q7HA 2FBMA 3OT6A 3KQFA 3TLFA 5KDRA 4U0HA 3RRVA 3T8BA 2PPYA 4WCZA 4LK5A 1UYVA 2NP9A 1FC7A 2VSSE 3QWDA 3HLN1 3TT6A 3L3SA 3H02A 3WG5A 2J5IB 3PGQA 3ISAA 3MOYA 4JCQA 2QQ3A 1MJ3A 4JCTA 3KTJA 3BPPA 5E0SA 4L8KA 3ZWCA 4B3JA 3H0UA 2ZL2A 2IEXA 4JWVA 4U1AA 1ON3A 2Q35A 2A81A 2FW2A 1SG4A 1HNUA 3QXZA 5MGBA 1ON9A 2VSSF 4OMRA 1FC6A 2A7SA 2X58A 4ZDDA 3LKEA 3HINA 4OLQA 3GKBA 2DUBA 1HNOA 4KNPA 4QIIA 4HNKA 1XO6A 3HRXA 3SWXA 3KTGA 1NZYB 2EJ5A 3VIVA 3TVWA 1DCIA 4U19A 1J7XA 2Q34A 3PE8A 3OMEA 4ZDBA 3P2LA 3M6MA 3QMJA 2A7KA 1XNYA 4MXIA 5G1QA 4FN8A 1XX4A 1N6EA 1UYSA 4JYLA 1VRGA 4JCSA 3K50A 2D3TA 4IZCA 4FZWC 3ZWAA 4GM2A 2VREA 2ZL0A 1EF8A 1NZYA 3IB9A 3ZW8A 1K32A 1WDKA 3HE2A 4IZBA 2VSUC 3DJAA 4I52A 3H0QA 2BZRA 2J5GA 3M6NA 3R9TA 2F9YB 3KTIA 3TVUA 4K3WA 3PEAA 1OD2A 1JXZA 3BPTA 3IAVA 2VSUE 1Y7OA 3FF6A 4JYJA 3NJDA 4ZDCA 2J5II 4EMMA 5JBXA 4JSBA 1O8UA 2J5SA 3QK8A 3Q0GA 4FB8A 4NARA 3TDCA 3R9QA 4ZDEA 2F6IA 3BEZA 5INFA 1PIXA 5DU4A 5DUFA 5DU8A 2F6QA 3H81A 2F9YA 1N6FA 3QKAA 4MI2A 2F9IB 3HP0A 4U0GH 4QFEA 3U9RB 4MOUA 4HDTA 3TZ3A 4FZWA 5DZKH 3GF3A 4B3HA 3QXIA 4FN7A 2WTBA 2VSSA 4ZDFA 1HZDA 4WZ8B 1WDMA 4QIJA 1UYTA 4L6WA 4KD6A 5HUQA 3DORA 1DUBA 2J5GD 5INIA 4JJTA 4DI1A 3U9SB 3LAOA 2VX2A 4JFCA 5G1RA 4FNDA 1WDLA 3I47A 3P5MA 4K2NA 2YJGA 3MT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FIF A;  3KTH A;  2ZQQ A;  3V5E A;  2HW5 A;  2F9I A;  3ST9 A;  1EF9 A;  5ING A;  2C8T A;  5JBW A;  3GMA A;  5FUS A;  4RYF H;  2DEO A;  1RJM A;  3RSI A;  3TRR A;  1WZ8 A;  3H0J A;  1XNW A;  3T3W A;  4FNB A;  4RCN A;  3TT7 A;  4EML A;  4OG1 A;  4ELX A;  4I4Z A;  1Q51 A;  3GLM A;  1TG6 A;  3ZW9 A;  3SLL A;  2Q2X A;  4Z0M A;  1YG6 A;  1YG8 A;  4GHN A;  3JU1 A;  4G2R A;  3STA A;  2CE3 A;  5DUC A;  2FZS A;  3PZK A;  4EMP A;  4NEK A;  1SZO A;  1UIY A;  1TYF A;  1K39 A;  4JOT A;  4KWB A;  1N6D A;  3MYB A;  2X24 A;  4Q0G A;  1XNV A;  3Q0J A;  4B3I A;  5IKL B;  2ZQR A;  5CTB A;  3U9T B;  3IBB A;  5E0S H;  1EY3 A;  1UYR A;  3G64 A;  4FJW D;  3R9S A;  2PG8 A;  4ZU2 A;  5DKP A;  3Q1T A;  3OC7 A;  3BF0 A;  4IZD A;  5KJP A;  2PBP A;  1FC9 A;  4HC8 A;  2VSU F;  4JCR A;  4U0G A;  1OD4 A;  3T8A A;  3QRE A;  2W3P A;  1Q52 A;  3T89 A;  3R6H A;  3MFM A;  4Q1I A;  5DZK A;  4F47 A;  3V5I A;  3N6R B;  1RJN A;  3NJB A;  2CBY A;  2GTR A;  2ZL4 A;  3TV5 A;  5DU6 A;  4NNQ A;  3T88 A;  4YLH A;  2J5I A;  2VSU A;  4KPK A;  3R0O A;  2UZF A;  5CTC A;  5E0N X;  5C90 A;  5DTP A;  4ASI A;  4ELW A;  1PJH A;  5KDR B;  3H0S A;  5DL1 A;  3ZWB A;  3GF7 A;  5C9G A;  4WYO B;  4I42 A;  5G1S A;  3K8X A;  5DTW A;  4ELS A;  4RYF A;  4JVT A;  3KTK A;  1FCF A;  1X0U A;  1W2X A;  2ZL3 A;  4K29 A;  3QYR A;  4U18 A;  3FDU A;  3RST A;  3P85 A;  3Q7H A;  2FBM A;  3OT6 A;  3KQF A;  3TLF A;  5KDR A;  4U0H A;  3RRV A;  3T8B A;  2PPY A;  4WCZ A;  4LK5 A;  1UYV A;  2NP9 A;  1FC7 A;  2VSS E;  3QWD A;  3HLN 1;  3TT6 A;  3L3S A;  3H02 A;  3WG5 A;  2J5I B;  3PGQ A;  3ISA A;  3MOY A;  4JCQ A;  2QQ3 A;  1MJ3 A;  4JCT A;  3KTJ A;  3BPP A;  5E0S A;  4L8K A;  3ZWC A;  4B3J A;  3H0U A;  2ZL2 A;  2IEX A;  4JWV A;  4U1A A;  1ON3 A;  2Q35 A;  2A81 A;  2FW2 A;  1SG4 A;  1HNU A;  3QXZ A;  5MGB A;  1ON9 A;  2VSS F;  4OMR A;  1FC6 A;  2A7S A;  2X58 A;  4ZDD A;  3LKE A;  3HIN A;  4OLQ A;  3GKB A;  2DUB A;  1HNO A;  4KNP A;  4QII A;  4HNK A;  1XO6 A;  3HRX A;  3SWX A;  3KTG A;  1NZY B;  2EJ5 A;  3VIV A;  3TVW A;  1DCI A;  4U19 A;  1J7X A;  2Q34 A;  3PE8 A;  3OME A;  4ZDB A;  3P2L A;  3M6M A;  3QMJ A;  2A7K A;  1XNY A;  4MXI A;  5G1Q A;  4FN8 A;  1XX4 A;  1N6E A;  1UYS A;  4JYL A;  1VRG A;  4JCS A;  3K50 A;  2D3T A;  4IZC A;  4FZW C;  3ZWA A;  4GM2 A;  2VRE A;  2ZL0 A;  1EF8 A;  1NZY A;  3IB9 A;  3ZW8 A;  1K32 A;  1WDK A;  3HE2 A;  4IZB A;  2VSU C;  3DJA A;  4I52 A;  3H0Q A;  2BZR A;  2J5G A;  3M6N A;  3R9T A;  2F9Y B;  3KTI A;  3TVU A;  4K3W A;  3PEA A;  1OD2 A;  1JXZ A;  3IAV A;  2VSU E;  1Y7O A;  3FF6 A;  4JYJ A;  3NJD A;  4ZDC A;  2J5I I;  4EMM A;  5JBX A;  4JSB A;  1O8U A;  2J5S A;  3QK8 A;  3Q0G A;  4FB8 A;  3TDC A;  3R9Q A;  4ZDE A;  2F6I A;  3BEZ A;  5INF A;  1PIX A;  5DU4 A;  5DUF A;  5DU8 A;  2F6Q A;  3H81 A;  2F9Y A;  1N6F A;  3QKA A;  4MI2 A;  2F9I B;  3HP0 A;  4U0G H;  4QFE A;  3U9R B;  4MOU A;  3TZ3 A;  4FZW A;  5DZK H;  3GF3 A;  4B3H A;  3QXI A;  4FN7 A;  2WTB A;  2VSS A;  4ZDF A;  1HZD A;  4WZ8 B;  1WDM A;  4QIJ A;  1UYT A;  4L6W A;  4KD6 A;  3DOR A;  1DUB A;  2J5G D;  5INI A;  4JJT A;  4DI1 A;  3U9S B;  3LAO A;  2VX2 A;  4JFC A;  5G1R A;  4FND A;  1WDL A;  3I47 A;  3P5M A;  4K2N A;  3MT6 A; 
#chains in the Genus database with same CATH topology
 5FIF A;  3KTH A;  2ZQQ A;  3V5E A;  2HW5 A;  2F9I A;  3ST9 A;  1EF9 A;  5ING A;  2C8T A;  4J2U A;  5JBW A;  3GMA A;  5FUS A;  4RYF H;  2DEO A;  1RJM A;  3RSI A;  3TRR A;  1WZ8 A;  3H0J A;  1XNW A;  3T3W A;  4FNB A;  4RCN A;  3TT7 A;  4EML A;  4OG1 A;  3AM1 A;  4ELX A;  4I4Z A;  1UX5 A;  1Q51 A;  3RQG A;  3GLM A;  1TG6 A;  3ZW9 A;  3SLL A;  2Q2X A;  4Z0M A;  1YG6 A;  1YG8 A;  4GHN A;  3JU1 A;  4G2R A;  3STA A;  2CE3 A;  5DUC A;  2FZS A;  3PZK A;  4EMP A;  4NEK A;  1SZO A;  1UIY A;  1TYF A;  1K39 A;  4JOT A;  4KWB A;  1N6D A;  3MYB A;  2X24 A;  4Q0G A;  1XNV A;  3Q0J A;  4B3I A;  5IKL B;  3A4M A;  2ZQR A;  5CTB A;  3U9T B;  3IBB A;  5E0S H;  1EY3 A;  1UYR A;  3G64 A;  4FJW D;  3R9S A;  2PG8 A;  4ZU2 A;  5DKP A;  3Q1T A;  3OC7 A;  3BF0 A;  4IZD A;  5KJP A;  2PBP A;  1FC9 A;  4HC8 A;  2VSU F;  4JCR A;  4U0G A;  1OD4 A;  3T8A A;  3QRE A;  2W3P A;  1Q52 A;  3T89 A;  3R6H A;  3MFM A;  4Q1I A;  5DZK A;  4F47 A;  3V5I A;  3N6R B;  1RJN A;  3NJB A;  2CBY A;  2GTR A;  2ZL4 A;  3TV5 A;  5DU6 A;  4NNQ A;  3T88 A;  4YLH A;  2J5I A;  2VSU A;  4KPK A;  3R0O A;  2UZF A;  5CTC A;  5E0N X;  5C90 A;  5DTP A;  4ASI A;  4ELW A;  1PJH A;  5KDR B;  3H0S A;  5DL1 A;  3ZWB A;  2P63 A;  3W8H B;  3GF7 A;  5C9G A;  4WYO B;  4I42 A;  5G1S A;  3K8X A;  5DTW A;  4ELS A;  4RYF A;  4JVT A;  3KTK A;  1FCF A;  1X0U A;  1W2X A;  2ZL3 A;  3L8I A;  4K29 A;  3QYR A;  4U18 A;  3FDU A;  3RST A;  3P85 A;  3Q7H A;  2FBM A;  3OT6 A;  3KQF A;  3TLF A;  5KDR A;  4U0H A;  3RRV A;  3T8B A;  2PPY A;  3W8I B;  4WCZ A;  4LK5 A;  1UYV A;  2NP9 A;  1FC7 A;  2VSS E;  3QWD A;  3HLN 1;  3TT6 A;  3L3S A;  3H02 A;  3WG5 A;  2J5I B;  3PGQ A;  3ISA A;  3MOY A;  4JCQ A;  2QQ3 A;  1MJ3 A;  4JCT A;  3ADC A;  3KTJ A;  3BPP A;  5E0S A;  4L8K A;  3ZWC A;  4B3J A;  3H0U A;  2ZL2 A;  2IEX A;  3AJM A;  4JWV A;  4U1A A;  1ON3 A;  2Q35 A;  2A81 A;  2FW2 A;  3L8J A;  1UX4 A;  1SG4 A;  1HNU A;  3QXZ A;  5MGB A;  1ON9 A;  2VSS F;  4OMR A;  1FC6 A;  3A4N A;  2A7S A;  2X58 A;  4ZDD A;  3LKE A;  3HIN A;  4OLQ A;  3GKB A;  2DUB A;  1HNO A;  4KNP A;  4QII A;  4HNK A;  1XO6 A;  3HRX A;  3SWX A;  3KTG A;  1NZY B;  2EJ5 A;  3VIV A;  3TVW A;  1DCI A;  4U19 A;  1J7X A;  2Q34 A;  3PE8 A;  3OME A;  4ZDB A;  3P2L A;  3M6M A;  3QMJ A;  2A7K A;  1XNY A;  4MXI A;  5G1Q A;  4FN8 A;  1XX4 A;  1N6E A;  1UYS A;  4JYL A;  1VRG A;  4JCS A;  3K50 A;  2D3T A;  4IZC A;  4FZW C;  3ZWA A;  4GM2 A;  2VRE A;  2ZL0 A;  1EF8 A;  1NZY A;  3IRB A;  3IB9 A;  3ADB A;  3ZW8 A;  1K32 A;  3ADD A;  1WDK A;  3HE2 A;  4IZB A;  2VSU C;  3DJA A;  4I52 A;  3H0Q A;  2BZR A;  2J5G A;  3M6N A;  3RQE A;  3R9T A;  2F9Y B;  3KTI A;  3TVU A;  4K3W A;  3PEA A;  1OD2 A;  1JXZ A;  3BPT A;  3IAV A;  2VSU E;  1Y7O A;  3FF6 A;  4JYJ A;  3NJD A;  3O4X E;  4ZDC A;  2J5I I;  4EMM A;  5JBX A;  4JSB A;  1O8U A;  2J5S A;  3QK8 A;  3Q0G A;  4FB8 A;  4NAR A;  3TDC A;  3R9Q A;  4ZDE A;  2F6I A;  3BEZ A;  5INF A;  1PIX A;  5DU4 A;  5DUF A;  5DU8 A;  2F6Q A;  3H81 A;  2F9Y A;  1N6F A;  3QKA A;  4MI2 A;  2F9I B;  3HP0 A;  4U0G H;  4QFE A;  3U9R B;  4MOU A;  4HDT A;  3TZ3 A;  4FZW A;  5DZK H;  3GF3 A;  4B3H A;  3QXI A;  4FN7 A;  2WTB A;  2VSS A;  4ZDF A;  1HZD A;  4WZ8 B;  1WDM A;  4QIJ A;  3A4L A;  1UYT A;  4L6W A;  4KD6 A;  3RQF A;  5HUQ A;  3DOR A;  1DUB A;  2J5G D;  4GEH B;  5INI A;  4JJT A;  4DI1 A;  3U9S B;  3LAO A;  2VX2 A;  4JFC A;  5G1R A;  4FND A;  1Y64 B;  1WDL A;  3I47 A;  3P5M A;  4K2N A;  2YJG A;  3MT6 A; 
#chains in the Genus database with same CATH homology
 5FIF A;  3KTH A;  2ZQQ A;  3V5E A;  2HW5 A;  2F9I A;  3ST9 A;  1EF9 A;  5ING A;  2C8T A;  4J2U A;  5JBW A;  3GMA A;  5FUS A;  4RYF H;  2DEO A;  1RJM A;  3RSI A;  3TRR A;  1WZ8 A;  3H0J A;  1XNW A;  3T3W A;  4FNB A;  4RCN A;  3TT7 A;  4EML A;  4OG1 A;  4ELX A;  4I4Z A;  1Q51 A;  3GLM A;  1TG6 A;  3ZW9 A;  3SLL A;  2Q2X A;  4Z0M A;  1YG6 A;  1YG8 A;  4GHN A;  3JU1 A;  4G2R A;  3STA A;  2CE3 A;  5DUC A;  2FZS A;  3PZK A;  4EMP A;  4NEK A;  1SZO A;  1UIY A;  1TYF A;  1K39 A;  4JOT A;  4KWB A;  1N6D A;  3MYB A;  2X24 A;  4Q0G A;  1XNV A;  3Q0J A;  4B3I A;  5IKL B;  2ZQR A;  5CTB A;  3U9T B;  3IBB A;  5E0S H;  1EY3 A;  1UYR A;  3G64 A;  4FJW D;  3R9S A;  2PG8 A;  4ZU2 A;  5DKP A;  3Q1T A;  3OC7 A;  3BF0 A;  4IZD A;  5KJP A;  2PBP A;  1FC9 A;  4HC8 A;  2VSU F;  4JCR A;  4U0G A;  1OD4 A;  3T8A A;  3QRE A;  2W3P A;  1Q52 A;  3T89 A;  3R6H A;  3MFM A;  4Q1I A;  5DZK A;  4F47 A;  3V5I A;  3N6R B;  1RJN A;  3NJB A;  2CBY A;  2GTR A;  2ZL4 A;  3TV5 A;  5DU6 A;  4NNQ A;  3T88 A;  4YLH A;  2J5I A;  2VSU A;  4KPK A;  3R0O A;  2UZF A;  5CTC A;  5E0N X;  5C90 A;  5DTP A;  4ASI A;  4ELW A;  1PJH A;  5KDR B;  3H0S A;  5DL1 A;  3ZWB A;  3GF7 A;  5C9G A;  4WYO B;  4I42 A;  5G1S A;  3K8X A;  5DTW A;  4ELS A;  4RYF A;  4JVT A;  3KTK A;  1FCF A;  1X0U A;  1W2X A;  2ZL3 A;  4K29 A;  3QYR A;  4U18 A;  3FDU A;  3RST A;  3P85 A;  3Q7H A;  2FBM A;  3OT6 A;  3KQF A;  3TLF A;  5KDR A;  4U0H A;  3RRV A;  3T8B A;  2PPY A;  4WCZ A;  4LK5 A;  1UYV A;  2NP9 A;  1FC7 A;  2VSS E;  3QWD A;  3HLN 1;  3TT6 A;  3L3S A;  3H02 A;  3WG5 A;  2J5I B;  3PGQ A;  3ISA A;  3MOY A;  4JCQ A;  2QQ3 A;  1MJ3 A;  4JCT A;  3KTJ A;  3BPP A;  5E0S A;  4L8K A;  3ZWC A;  4B3J A;  3H0U A;  2ZL2 A;  2IEX A;  4JWV A;  4U1A A;  1ON3 A;  2Q35 A;  2A81 A;  2FW2 A;  1SG4 A;  1HNU A;  3QXZ A;  5MGB A;  1ON9 A;  2VSS F;  4OMR A;  1FC6 A;  2A7S A;  2X58 A;  4ZDD A;  3LKE A;  3HIN A;  4OLQ A;  3GKB A;  2DUB A;  1HNO A;  4KNP A;  4QII A;  4HNK A;  1XO6 A;  3HRX A;  3SWX A;  3KTG A;  1NZY B;  2EJ5 A;  3VIV A;  3TVW A;  1DCI A;  4U19 A;  1J7X A;  2Q34 A;  3PE8 A;  3OME A;  4ZDB A;  3P2L A;  3M6M A;  3QMJ A;  2A7K A;  1XNY A;  4MXI A;  5G1Q A;  4FN8 A;  1XX4 A;  1N6E A;  1UYS A;  4JYL A;  1VRG A;  4JCS A;  3K50 A;  2D3T A;  4IZC A;  4FZW C;  3ZWA A;  4GM2 A;  2VRE A;  2ZL0 A;  1EF8 A;  1NZY A;  3IB9 A;  3ZW8 A;  1K32 A;  1WDK A;  3HE2 A;  4IZB A;  2VSU C;  3DJA A;  4I52 A;  3H0Q A;  2BZR A;  2J5G A;  3M6N A;  3R9T A;  2F9Y B;  3KTI A;  3TVU A;  4K3W A;  3PEA A;  1OD2 A;  1JXZ A;  3BPT A;  3IAV A;  2VSU E;  1Y7O A;  3FF6 A;  4JYJ A;  3NJD A;  4ZDC A;  2J5I I;  4EMM A;  5JBX A;  4JSB A;  1O8U A;  2J5S A;  3QK8 A;  3Q0G A;  4FB8 A;  4NAR A;  3TDC A;  3R9Q A;  4ZDE A;  2F6I A;  3BEZ A;  5INF A;  1PIX A;  5DU4 A;  5DUF A;  5DU8 A;  2F6Q A;  3H81 A;  2F9Y A;  1N6F A;  3QKA A;  4MI2 A;  2F9I B;  3HP0 A;  4U0G H;  4QFE A;  3U9R B;  4MOU A;  4HDT A;  3TZ3 A;  4FZW A;  5DZK H;  3GF3 A;  4B3H A;  3QXI A;  4FN7 A;  2WTB A;  2VSS A;  4ZDF A;  1HZD A;  4WZ8 B;  1WDM A;  4QIJ A;  1UYT A;  4L6W A;  4KD6 A;  5HUQ A;  3DOR A;  1DUB A;  2J5G D;  5INI A;  4JJT A;  4DI1 A;  3U9S B;  3LAO A;  2VX2 A;  4JFC A;  5G1R A;  4FND A;  1WDL A;  3I47 A;  3P5M A;  4K2N A;  2YJG A;  3MT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...