3HRXA

Crystal structure of phenylacetic acid degradation protein paag
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phenylacetic acid degradation protein PaaG from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Probable enoyl-CoA hydratase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3hrxA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3hrxA01
3T88A 4RYFH 3RSIA 4QIJA 3R0OA 2EJ5A 2J5GA 2NP9A 1NZYA 4NEKA 3IAVA 3PE8A 3TT7A 4JCTA 3H0JA 4GHNA 4K3WA 4JFCA 4MI2A 2DUBA 1FCFA 2CE3A 3H81A 3QKAA 2VSUE 4ZDDA 3SWXA 2J5IB 3HINA 5DUFA 3KTGA 4DI1A 2Q35A 5DU8A 3OC7A 3GLMA 4I4ZA 4KWBA 3KTHA 4FNBA 5DZKA 4HNKA 2PG8A 3HP0A 3P85A 4L8KA 3BF0A 3P2LA 1XX4A 4KNPA 1HNUA 2VX2A 2FBMA 4U19A 1XNYA 4JOTA 3PZKA 5DZKH 5JBWA 1UYVA 3TV5A 1SG4A 3KTKA 4WCZA 1EF8A 2VSSA 4LK5A 2Q2XA 2QQ3A 1JXZA 4JWVA 2BZRA 4KPKA 5DKPA 3ZWCA 5CTCA 1YG6A 3MOYA 5KDRB 3HE2A 4QIIA 3T8AA 2GTRA 1DCIA 3T89A 4WYOB 5G1RA 3BPPA 4I52A 4B3HA 4Z0MA 1OD4A 2W3PA 3TLFA 3TT6A 4IZDA 1UYRA 4FN8A 1RJNA 2J5SA 5CTBA 3Q0JA 4RCNA 4EMLA 1DUBA 3ZW8A 3QMJA 1EY3A 3BEZA 4JCQA 2FW2A 3H0QA 3QK8A 4IZCA 4FZWC 4KD6A 1SZOA 3PEAA 3QXZA 3JU1A 5INFA 3KTIA 3QWDA 1WDKA 3MT6A 2DEOA 3R9SA 3NJBA 1N6EA 5MGBA 3P5MA 4GM2A 2VSSF 2ZQQA 3GF7A 2D3TA 3T8BA 2C8TA 3V5EA 1EF9A 4JCRA 2F9YA 1UYTA 4ELWA 4U1AA 3QYRA 3RRVA 2ZL4A 3DORA 2J5GD 5C9GA 5FIFA 2X24A 3VIVA 4F47A 3G64A 2F9IA 2FZSA 3ZWBA 3M6NA 4JYJA 4JVTA 4I42A 3KQFA 2UZFA 2ZL3A 4EMPA 4L6WA 3IBBA 4ELXA 2ZQRA 4OLQA 4JYLA 2CBYA 4MOUA 1NZYB 1Q51A 3RSTA 1ON3A 5DU6A 4ASIA 4JCSA 2WTBA 5INGA 5E0SA 4U18A 4U0GA 1FC6A 3SLLA 2J5IA 3ST9A 1XO6A 4FNDA 2X58A 4OG1A 4ZDFA 4JJTA 3ZW9A 1K39A 5E0NX 3OT6A 4RYFA 2VSSE 4HC8A 4OMRA 4MXIA 2VSUA 1YG8A 2Q34A 2ZL0A 1O8UA 5FUSA 3Q0GA 5IKLB 1Q52A 3K50A 3N6RB 1N6DA 4B3JA 3STAA 3Q7HA 4ELSA 4Q1IA 2A81A 3GKBA 3M6MA 2VSUF 4K29A 5DU4A 3FF6A 4U0GH 3QREA 4NNQA 3HRXA 3R9QA 3QXIA 5DTWA 5DL1A 1TYFA 3H02A 1PIXA 2A7SA 2A7KA 2F6IA 1XNVA 4YLHA 3I47A 4QFEA 3IB9A 3V5IA 1N6FA 3HLN1 3MFMA 3LKEA 1XNWA 4IZBA 3OMEA 3TVUA 3KTJA 2F9IB 3H0UA 2PPYA 5KDRA 3TRRA 3ZWAA 5DTPA 5C90A 3DJAA 4JSBA 1VRGA 3FDUA 3U9SB 4FZWA 1WDLA 4ZU2A 3TVWA 4ZDEA 2J5II 2HW5A 1X0UA 1TG6A 2VSUC 2ZL2A 1ON9A 3T3WA 5KJPA 4Q0GA 2IEXA 1FC9A 1UYSA 3GF3A 4FB8A 4ZDBA 1RJMA 3TDCA 5G1QA 1K32A 4K2NA 2PBPA 3ISAA 1OD2A 4WZ8B 1FC7A 4FN7A 5DUCA 2F6QA 4ZDCA 3U9RB 3WG5A 1Y7OA 1J7XA 4EMMA 5G1SA 3Q1TA 5E0SH 3NJDA 1W2XA 3R6HA 5INIA 4G2RA 1PJHA 2VREA 3U9TB 2F9YB 1WDMA 3L3SA 4B3IA 1WZ8A 1UIYA 3LAOA 3MYBA 1MJ3A 3PGQA 3R9TA 3K8XA 3TZ3A 1HNOA 4U0HA 4FJWD 3H0SA 5JBXA 3GMAA 1HZDA
chains in the Genus database with same CATH superfamily
3T88A 4RYFH 3RSIA 4QIJA 3R0OA 2EJ5A 2J5GA 2NP9A 1NZYA 4NEKA 3IAVA 3PE8A 3TT7A 4JCTA 3H0JA 4GHNA 4K3WA 4JFCA 4MI2A 2DUBA 1FCFA 2CE3A 3H81A 3QKAA 2VSUE 4ZDDA 3SWXA 2J5IB 3HINA 5DUFA 3KTGA 4DI1A 2Q35A 5DU8A 3OC7A 3GLMA 4I4ZA 4KWBA 3KTHA 4FNBA 5DZKA 4HNKA 2PG8A 3HP0A 3ADBA 3P85A 3L8IA 4L8KA 4GEHB 3BF0A 3A4MA 3P2LA 1XX4A 4KNPA 1HNUA 2VX2A 2FBMA 4U19A 1XNYA 4JOTA 3PZKA 5DZKH 5JBWA 1UYVA 3TV5A 1SG4A 3KTKA 4WCZA 1EF8A 2VSSA 4LK5A 2Q2XA 2QQ3A 1JXZA 4JWVA 2BZRA 4KPKA 5DKPA 3ZWCA 5CTCA 1YG6A 3MOYA 5KDRB 3HE2A 4QIIA 3T8AA 2GTRA 1DCIA 3T89A 4WYOB 5G1RA 3BPPA 4I52A 3RQGA 3AJMA 4B3HA 4Z0MA 1OD4A 2W3PA 3TLFA 3TT6A 4IZDA 1UYRA 4FN8A 1RJNA 3RQEA 3IRBA 2J5SA 5CTBA 3Q0JA 4RCNA 4EMLA 3O4XE 4NARA 1DUBA 3RQFA 3ZW8A 3QMJA 1EY3A 3BEZA 4JCQA 2FW2A 3H0QA 3QK8A 4IZCA 4FZWC 4KD6A 1SZOA 3PEAA 3QXZA 3JU1A 5INFA 3KTIA 3QWDA 1WDKA 3MT6A 2DEOA 3R9SA 3NJBA 1N6EA 5MGBA 3P5MA 4GM2A 2VSSF 2ZQQA 3W8HB 3GF7A 2D3TA 3T8BA 2C8TA 3V5EA 1EF9A 4JCRA 2F9YA 1UYTA 4ELWA 4U1AA 3QYRA 3RRVA 2ZL4A 3DORA 2J5GD 5C9GA 5FIFA 2X24A 3VIVA 3A4NA 4F47A 3G64A 2F9IA 2FZSA 3ZWBA 3M6NA 4JYJA 4JVTA 4I42A 3KQFA 1Y64B 2UZFA 2ZL3A 4EMPA 4L6WA 3IBBA 4ELXA 2ZQRA 4OLQA 4JYLA 2CBYA 4MOUA 1NZYB 1Q51A 3RSTA 1ON3A 5DU6A 4ASIA 1UX5A 4JCSA 2WTBA 5INGA 5E0SA 4U18A 4U0GA 1FC6A 4J2UA 3SLLA 2J5IA 3ST9A 1XO6A 4FNDA 2X58A 4OG1A 4ZDFA 4JJTA 3ZW9A 1K39A 5E0NX 3OT6A 4RYFA 2VSSE 4HC8A 4OMRA 4MXIA 2VSUA 1YG8A 2Q34A 2ZL0A 1O8UA 5FUSA 3Q0GA 5IKLB 1Q52A 3AM1A 1UX4A 3K50A 2YJGA 3N6RB 1N6DA 4B3JA 3STAA 3Q7HA 4ELSA 3W8IB 4Q1IA 2A81A 3GKBA 3M6MA 2P63A 2VSUF 4K29A 3L8JA 5HUQA 5DU4A 3FF6A 4U0GH 3QREA 4NNQA 3HRXA 3R9QA 3QXIA 5DTWA 5DL1A 1TYFA 3H02A 1PIXA 2A7SA 2A7KA 2F6IA 1XNVA 4YLHA 3I47A 4QFEA 3IB9A 3V5IA 1N6FA 3HLN1 3MFMA 3LKEA 1XNWA 4IZBA 3OMEA 3ADDA 3TVUA 3KTJA 2F9IB 3H0UA 2PPYA 5KDRA 3A4LA 3TRRA 3ZWAA 5DTPA 5C90A 3DJAA 4JSBA 1VRGA 3FDUA 3U9SB 4FZWA 1WDLA 4ZU2A 3TVWA 4ZDEA 2J5II 2HW5A 1X0UA 1TG6A 2VSUC 2ZL2A 1ON9A 3T3WA 5KJPA 4Q0GA 2IEXA 1FC9A 1UYSA 3GF3A 4FB8A 4ZDBA 1RJMA 3TDCA 5G1QA 1K32A 4K2NA 2PBPA 3ISAA 3BPTA 3ADCA 1OD2A 4WZ8B 1FC7A 4FN7A 5DUCA 2F6QA 4ZDCA 3U9RB 3WG5A 1Y7OA 1J7XA 4EMMA 5G1SA 3Q1TA 5E0SH 3NJDA 1W2XA 3R6HA 5INIA 4G2RA 1PJHA 2VREA 3U9TB 2F9YB 1WDMA 3L3SA 4B3IA 1WZ8A 1UIYA 3LAOA 3MYBA 1MJ3A 3PGQA 3R9TA 3K8XA 3TZ3A 1HNOA 4HDTA 4U0HA 4FJWD 3H0SA 5JBXA 3GMAA 1HZDA
chains in the Genus database with same CATH topology
3T88A 4RYFH 3RSIA 4QIJA 3R0OA 2EJ5A 2J5GA 2NP9A 1NZYA 4NEKA 3IAVA 3PE8A 3TT7A 4JCTA 3H0JA 4GHNA 4K3WA 4JFCA 4MI2A 2DUBA 1FCFA 2CE3A 3H81A 3QKAA 2VSUE 4ZDDA 3SWXA 2J5IB 3HINA 5DUFA 3KTGA 4DI1A 2Q35A 5DU8A 3OC7A 3GLMA 4I4ZA 4KWBA 3KTHA 4FNBA 5DZKA 4HNKA 2PG8A 3HP0A 3P85A 4L8KA 3BF0A 3P2LA 1XX4A 4KNPA 1HNUA 2VX2A 2FBMA 4U19A 1XNYA 4JOTA 3PZKA 5DZKH 5JBWA 1UYVA 3TV5A 1SG4A 3KTKA 4WCZA 1EF8A 2VSSA 4LK5A 2Q2XA 2QQ3A 1JXZA 4JWVA 2BZRA 4KPKA 5DKPA 3ZWCA 5CTCA 1YG6A 3MOYA 5KDRB 3HE2A 4QIIA 3T8AA 2GTRA 1DCIA 3T89A 4WYOB 5G1RA 3BPPA 4I52A 4B3HA 4Z0MA 1OD4A 2W3PA 3TLFA 3TT6A 4IZDA 1UYRA 4FN8A 1RJNA 2J5SA 5CTBA 3Q0JA 4RCNA 4EMLA 4NARA 1DUBA 3ZW8A 3QMJA 1EY3A 3BEZA 4JCQA 2FW2A 3H0QA 3QK8A 4IZCA 4FZWC 4KD6A 1SZOA 3PEAA 3QXZA 3JU1A 5INFA 3KTIA 3QWDA 1WDKA 3MT6A 2DEOA 3R9SA 3NJBA 1N6EA 5MGBA 3P5MA 4GM2A 2VSSF 2ZQQA 3GF7A 2D3TA 3T8BA 2C8TA 3V5EA 1EF9A 4JCRA 2F9YA 1UYTA 4ELWA 4U1AA 3QYRA 3RRVA 2ZL4A 3DORA 2J5GD 5C9GA 5FIFA 2X24A 3VIVA 4F47A 3G64A 2F9IA 2FZSA 3ZWBA 3M6NA 4JYJA 4JVTA 4I42A 3KQFA 2UZFA 2ZL3A 4EMPA 4L6WA 3IBBA 4ELXA 2ZQRA 4OLQA 4JYLA 2CBYA 4MOUA 1NZYB 1Q51A 3RSTA 1ON3A 5DU6A 4ASIA 4JCSA 2WTBA 5INGA 5E0SA 4U18A 4U0GA 1FC6A 4J2UA 3SLLA 2J5IA 3ST9A 1XO6A 4FNDA 2X58A 4OG1A 4ZDFA 4JJTA 3ZW9A 1K39A 5E0NX 3OT6A 4RYFA 2VSSE 4HC8A 4OMRA 4MXIA 2VSUA 1YG8A 2Q34A 2ZL0A 1O8UA 5FUSA 3Q0GA 5IKLB 1Q52A 3K50A 2YJGA 3N6RB 1N6DA 4B3JA 3STAA 3Q7HA 4ELSA 4Q1IA 2A81A 3GKBA 3M6MA 2VSUF 4K29A 5HUQA 5DU4A 3FF6A 4U0GH 3QREA 4NNQA 3HRXA 3R9QA 3QXIA 5DTWA 5DL1A 1TYFA 3H02A 1PIXA 2A7SA 2A7KA 2F6IA 1XNVA 4YLHA 3I47A 4QFEA 3IB9A 3V5IA 1N6FA 3HLN1 3MFMA 3LKEA 1XNWA 4IZBA 3OMEA 3TVUA 3KTJA 2F9IB 3H0UA 2PPYA 5KDRA 3TRRA 3ZWAA 5DTPA 5C90A 3DJAA 4JSBA 1VRGA 3FDUA 3U9SB 4FZWA 1WDLA 4ZU2A 3TVWA 4ZDEA 2J5II 2HW5A 1X0UA 1TG6A 2VSUC 2ZL2A 1ON9A 3T3WA 5KJPA 4Q0GA 2IEXA 1FC9A 1UYSA 3GF3A 4FB8A 4ZDBA 1RJMA 3TDCA 5G1QA 1K32A 4K2NA 2PBPA 3ISAA 3BPTA 1OD2A 4WZ8B 1FC7A 4FN7A 5DUCA 2F6QA 4ZDCA 3U9RB 3WG5A 1Y7OA 1J7XA 4EMMA 5G1SA 3Q1TA 5E0SH 3NJDA 1W2XA 3R6HA 5INIA 4G2RA 1PJHA 2VREA 3U9TB 2F9YB 1WDMA 3L3SA 4B3IA 1WZ8A 1UIYA 3LAOA 3MYBA 1MJ3A 3PGQA 3R9TA 3K8XA 3TZ3A 1HNOA 4HDTA 4U0HA 4FJWD 3H0SA 5JBXA 3GMAA 1HZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T88 A;  4RYF H;  3RSI A;  4QIJ A;  3R0O A;  2EJ5 A;  2J5G A;  2NP9 A;  1NZY A;  4NEK A;  3IAV A;  3PE8 A;  3TT7 A;  4JCT A;  3H0J A;  4GHN A;  4K3W A;  4JFC A;  4MI2 A;  2DUB A;  1FCF A;  2CE3 A;  3H81 A;  3QKA A;  2VSU E;  4ZDD A;  3SWX A;  2J5I B;  3HIN A;  5DUF A;  3KTG A;  4DI1 A;  2Q35 A;  5DU8 A;  3OC7 A;  3GLM A;  4I4Z A;  4KWB A;  3KTH A;  4FNB A;  5DZK A;  4HNK A;  2PG8 A;  3HP0 A;  3P85 A;  4L8K A;  3BF0 A;  3P2L A;  1XX4 A;  4KNP A;  1HNU A;  2VX2 A;  2FBM A;  4U19 A;  1XNY A;  4JOT A;  3PZK A;  5DZK H;  5JBW A;  1UYV A;  3TV5 A;  1SG4 A;  3KTK A;  4WCZ A;  1EF8 A;  2VSS A;  4LK5 A;  2Q2X A;  2QQ3 A;  1JXZ A;  4JWV A;  2BZR A;  4KPK A;  5DKP A;  3ZWC A;  5CTC A;  1YG6 A;  3MOY A;  5KDR B;  3HE2 A;  4QII A;  3T8A A;  2GTR A;  1DCI A;  3T89 A;  4WYO B;  5G1R A;  3BPP A;  4I52 A;  4B3H A;  4Z0M A;  1OD4 A;  2W3P A;  3TLF A;  3TT6 A;  4IZD A;  1UYR A;  4FN8 A;  1RJN A;  2J5S A;  5CTB A;  3Q0J A;  4RCN A;  4EML A;  1DUB A;  3ZW8 A;  3QMJ A;  1EY3 A;  3BEZ A;  4JCQ A;  2FW2 A;  3H0Q A;  3QK8 A;  4IZC A;  4FZW C;  4KD6 A;  1SZO A;  3PEA A;  3QXZ A;  3JU1 A;  5INF A;  3KTI A;  3QWD A;  1WDK A;  3MT6 A;  2DEO A;  3R9S A;  3NJB A;  1N6E A;  5MGB A;  3P5M A;  4GM2 A;  2VSS F;  2ZQQ A;  3GF7 A;  2D3T A;  3T8B A;  2C8T A;  3V5E A;  1EF9 A;  4JCR A;  2F9Y A;  1UYT A;  4ELW A;  4U1A A;  3QYR A;  3RRV A;  2ZL4 A;  3DOR A;  2J5G D;  5C9G A;  5FIF A;  2X24 A;  3VIV A;  4F47 A;  3G64 A;  2F9I A;  2FZS A;  3ZWB A;  3M6N A;  4JYJ A;  4JVT A;  4I42 A;  3KQF A;  2UZF A;  2ZL3 A;  4EMP A;  4L6W A;  3IBB A;  4ELX A;  2ZQR A;  4OLQ A;  4JYL A;  2CBY A;  4MOU A;  1NZY B;  1Q51 A;  3RST A;  1ON3 A;  5DU6 A;  4ASI A;  4JCS A;  2WTB A;  5ING A;  5E0S A;  4U18 A;  4U0G A;  1FC6 A;  3SLL A;  2J5I A;  3ST9 A;  1XO6 A;  4FND A;  2X58 A;  4OG1 A;  4ZDF A;  4JJT A;  3ZW9 A;  1K39 A;  5E0N X;  3OT6 A;  4RYF A;  2VSS E;  4HC8 A;  4OMR A;  4MXI A;  2VSU A;  1YG8 A;  2Q34 A;  2ZL0 A;  1O8U A;  5FUS A;  3Q0G A;  5IKL B;  1Q52 A;  3K50 A;  3N6R B;  1N6D A;  4B3J A;  3STA A;  3Q7H A;  4ELS A;  4Q1I A;  2A81 A;  3GKB A;  3M6M A;  2VSU F;  4K29 A;  5DU4 A;  3FF6 A;  4U0G H;  3QRE A;  4NNQ A;  3HRX A;  3R9Q A;  3QXI A;  5DTW A;  5DL1 A;  1TYF A;  3H02 A;  1PIX A;  2A7S A;  2A7K A;  2F6I A;  1XNV A;  4YLH A;  3I47 A;  4QFE A;  3IB9 A;  3V5I A;  1N6F A;  3HLN 1;  3MFM A;  3LKE A;  1XNW A;  4IZB A;  3OME A;  3TVU A;  3KTJ A;  2F9I B;  3H0U A;  2PPY A;  5KDR A;  3TRR A;  3ZWA A;  5DTP A;  5C90 A;  3DJA A;  4JSB A;  1VRG A;  3FDU A;  3U9S B;  4FZW A;  1WDL A;  4ZU2 A;  3TVW A;  4ZDE A;  2J5I I;  2HW5 A;  1X0U A;  1TG6 A;  2VSU C;  2ZL2 A;  1ON9 A;  3T3W A;  5KJP A;  4Q0G A;  2IEX A;  1FC9 A;  1UYS A;  3GF3 A;  4FB8 A;  4ZDB A;  1RJM A;  3TDC A;  5G1Q A;  1K32 A;  4K2N A;  2PBP A;  3ISA A;  1OD2 A;  4WZ8 B;  1FC7 A;  4FN7 A;  5DUC A;  2F6Q A;  4ZDC A;  3U9R B;  3WG5 A;  1Y7O A;  1J7X A;  4EMM A;  5G1S A;  3Q1T A;  5E0S H;  3NJD A;  1W2X A;  3R6H A;  5INI A;  4G2R A;  1PJH A;  2VRE A;  3U9T B;  2F9Y B;  1WDM A;  3L3S A;  4B3I A;  1WZ8 A;  1UIY A;  3LAO A;  3MYB A;  1MJ3 A;  3PGQ A;  3R9T A;  3K8X A;  3TZ3 A;  1HNO A;  4U0H A;  4FJW D;  3H0S A;  5JBX A;  3GMA A;  1HZD A; 
#chains in the Genus database with same CATH topology
 3T88 A;  4RYF H;  3RSI A;  4QIJ A;  3R0O A;  2EJ5 A;  2J5G A;  2NP9 A;  1NZY A;  4NEK A;  3IAV A;  3PE8 A;  3TT7 A;  4JCT A;  3H0J A;  4GHN A;  4K3W A;  4JFC A;  4MI2 A;  2DUB A;  1FCF A;  2CE3 A;  3H81 A;  3QKA A;  2VSU E;  4ZDD A;  3SWX A;  2J5I B;  3HIN A;  5DUF A;  3KTG A;  4DI1 A;  2Q35 A;  5DU8 A;  3OC7 A;  3GLM A;  4I4Z A;  4KWB A;  3KTH A;  4FNB A;  5DZK A;  4HNK A;  2PG8 A;  3HP0 A;  3ADB A;  3P85 A;  3L8I A;  4L8K A;  4GEH B;  3BF0 A;  3A4M A;  3P2L A;  1XX4 A;  4KNP A;  1HNU A;  2VX2 A;  2FBM A;  4U19 A;  1XNY A;  4JOT A;  3PZK A;  5DZK H;  5JBW A;  1UYV A;  3TV5 A;  1SG4 A;  3KTK A;  4WCZ A;  1EF8 A;  2VSS A;  4LK5 A;  2Q2X A;  2QQ3 A;  1JXZ A;  4JWV A;  2BZR A;  4KPK A;  5DKP A;  3ZWC A;  5CTC A;  1YG6 A;  3MOY A;  5KDR B;  3HE2 A;  4QII A;  3T8A A;  2GTR A;  1DCI A;  3T89 A;  4WYO B;  5G1R A;  3BPP A;  4I52 A;  3RQG A;  3AJM A;  4B3H A;  4Z0M A;  1OD4 A;  2W3P A;  3TLF A;  3TT6 A;  4IZD A;  1UYR A;  4FN8 A;  1RJN A;  3RQE A;  3IRB A;  2J5S A;  5CTB A;  3Q0J A;  4RCN A;  4EML A;  3O4X E;  4NAR A;  1DUB A;  3RQF A;  3ZW8 A;  3QMJ A;  1EY3 A;  3BEZ A;  4JCQ A;  2FW2 A;  3H0Q A;  3QK8 A;  4IZC A;  4FZW C;  4KD6 A;  1SZO A;  3PEA A;  3QXZ A;  3JU1 A;  5INF A;  3KTI A;  3QWD A;  1WDK A;  3MT6 A;  2DEO A;  3R9S A;  3NJB A;  1N6E A;  5MGB A;  3P5M A;  4GM2 A;  2VSS F;  2ZQQ A;  3W8H B;  3GF7 A;  2D3T A;  3T8B A;  2C8T A;  3V5E A;  1EF9 A;  4JCR A;  2F9Y A;  1UYT A;  4ELW A;  4U1A A;  3QYR A;  3RRV A;  2ZL4 A;  3DOR A;  2J5G D;  5C9G A;  5FIF A;  2X24 A;  3VIV A;  3A4N A;  4F47 A;  3G64 A;  2F9I A;  2FZS A;  3ZWB A;  3M6N A;  4JYJ A;  4JVT A;  4I42 A;  3KQF A;  1Y64 B;  2UZF A;  2ZL3 A;  4EMP A;  4L6W A;  3IBB A;  4ELX A;  2ZQR A;  4OLQ A;  4JYL A;  2CBY A;  4MOU A;  1NZY B;  1Q51 A;  3RST A;  1ON3 A;  5DU6 A;  4ASI A;  1UX5 A;  4JCS A;  2WTB A;  5ING A;  5E0S A;  4U18 A;  4U0G A;  1FC6 A;  4J2U A;  3SLL A;  2J5I A;  3ST9 A;  1XO6 A;  4FND A;  2X58 A;  4OG1 A;  4ZDF A;  4JJT A;  3ZW9 A;  1K39 A;  5E0N X;  3OT6 A;  4RYF A;  2VSS E;  4HC8 A;  4OMR A;  4MXI A;  2VSU A;  1YG8 A;  2Q34 A;  2ZL0 A;  1O8U A;  5FUS A;  3Q0G A;  5IKL B;  1Q52 A;  3AM1 A;  1UX4 A;  3K50 A;  2YJG A;  3N6R B;  1N6D A;  4B3J A;  3STA A;  3Q7H A;  4ELS A;  3W8I B;  4Q1I A;  2A81 A;  3GKB A;  3M6M A;  2P63 A;  2VSU F;  4K29 A;  3L8J A;  5HUQ A;  5DU4 A;  3FF6 A;  4U0G H;  3QRE A;  4NNQ A;  3HRX A;  3R9Q A;  3QXI A;  5DTW A;  5DL1 A;  1TYF A;  3H02 A;  1PIX A;  2A7S A;  2A7K A;  2F6I A;  1XNV A;  4YLH A;  3I47 A;  4QFE A;  3IB9 A;  3V5I A;  1N6F A;  3HLN 1;  3MFM A;  3LKE A;  1XNW A;  4IZB A;  3OME A;  3ADD A;  3TVU A;  3KTJ A;  2F9I B;  3H0U A;  2PPY A;  5KDR A;  3A4L A;  3TRR A;  3ZWA A;  5DTP A;  5C90 A;  3DJA A;  4JSB A;  1VRG A;  3FDU A;  3U9S B;  4FZW A;  1WDL A;  4ZU2 A;  3TVW A;  4ZDE A;  2J5I I;  2HW5 A;  1X0U A;  1TG6 A;  2VSU C;  2ZL2 A;  1ON9 A;  3T3W A;  5KJP A;  4Q0G A;  2IEX A;  1FC9 A;  1UYS A;  3GF3 A;  4FB8 A;  4ZDB A;  1RJM A;  3TDC A;  5G1Q A;  1K32 A;  4K2N A;  2PBP A;  3ISA A;  3BPT A;  3ADC A;  1OD2 A;  4WZ8 B;  1FC7 A;  4FN7 A;  5DUC A;  2F6Q A;  4ZDC A;  3U9R B;  3WG5 A;  1Y7O A;  1J7X A;  4EMM A;  5G1S A;  3Q1T A;  5E0S H;  3NJD A;  1W2X A;  3R6H A;  5INI A;  4G2R A;  1PJH A;  2VRE A;  3U9T B;  2F9Y B;  1WDM A;  3L3S A;  4B3I A;  1WZ8 A;  1UIY A;  3LAO A;  3MYB A;  1MJ3 A;  3PGQ A;  3R9T A;  3K8X A;  3TZ3 A;  1HNO A;  4HDT A;  4U0H A;  4FJW D;  3H0S A;  5JBX A;  3GMA A;  1HZD A; 
#chains in the Genus database with same CATH homology
 3T88 A;  4RYF H;  3RSI A;  4QIJ A;  3R0O A;  2EJ5 A;  2J5G A;  2NP9 A;  1NZY A;  4NEK A;  3IAV A;  3PE8 A;  3TT7 A;  4JCT A;  3H0J A;  4GHN A;  4K3W A;  4JFC A;  4MI2 A;  2DUB A;  1FCF A;  2CE3 A;  3H81 A;  3QKA A;  2VSU E;  4ZDD A;  3SWX A;  2J5I B;  3HIN A;  5DUF A;  3KTG A;  4DI1 A;  2Q35 A;  5DU8 A;  3OC7 A;  3GLM A;  4I4Z A;  4KWB A;  3KTH A;  4FNB A;  5DZK A;  4HNK A;  2PG8 A;  3HP0 A;  3P85 A;  4L8K A;  3BF0 A;  3P2L A;  1XX4 A;  4KNP A;  1HNU A;  2VX2 A;  2FBM A;  4U19 A;  1XNY A;  4JOT A;  3PZK A;  5DZK H;  5JBW A;  1UYV A;  3TV5 A;  1SG4 A;  3KTK A;  4WCZ A;  1EF8 A;  2VSS A;  4LK5 A;  2Q2X A;  2QQ3 A;  1JXZ A;  4JWV A;  2BZR A;  4KPK A;  5DKP A;  3ZWC A;  5CTC A;  1YG6 A;  3MOY A;  5KDR B;  3HE2 A;  4QII A;  3T8A A;  2GTR A;  1DCI A;  3T89 A;  4WYO B;  5G1R A;  3BPP A;  4I52 A;  4B3H A;  4Z0M A;  1OD4 A;  2W3P A;  3TLF A;  3TT6 A;  4IZD A;  1UYR A;  4FN8 A;  1RJN A;  2J5S A;  5CTB A;  3Q0J A;  4RCN A;  4EML A;  4NAR A;  1DUB A;  3ZW8 A;  3QMJ A;  1EY3 A;  3BEZ A;  4JCQ A;  2FW2 A;  3H0Q A;  3QK8 A;  4IZC A;  4FZW C;  4KD6 A;  1SZO A;  3PEA A;  3QXZ A;  3JU1 A;  5INF A;  3KTI A;  3QWD A;  1WDK A;  3MT6 A;  2DEO A;  3R9S A;  3NJB A;  1N6E A;  5MGB A;  3P5M A;  4GM2 A;  2VSS F;  2ZQQ A;  3GF7 A;  2D3T A;  3T8B A;  2C8T A;  3V5E A;  1EF9 A;  4JCR A;  2F9Y A;  1UYT A;  4ELW A;  4U1A A;  3QYR A;  3RRV A;  2ZL4 A;  3DOR A;  2J5G D;  5C9G A;  5FIF A;  2X24 A;  3VIV A;  4F47 A;  3G64 A;  2F9I A;  2FZS A;  3ZWB A;  3M6N A;  4JYJ A;  4JVT A;  4I42 A;  3KQF A;  2UZF A;  2ZL3 A;  4EMP A;  4L6W A;  3IBB A;  4ELX A;  2ZQR A;  4OLQ A;  4JYL A;  2CBY A;  4MOU A;  1NZY B;  1Q51 A;  3RST A;  1ON3 A;  5DU6 A;  4ASI A;  4JCS A;  2WTB A;  5ING A;  5E0S A;  4U18 A;  4U0G A;  1FC6 A;  4J2U A;  3SLL A;  2J5I A;  3ST9 A;  1XO6 A;  4FND A;  2X58 A;  4OG1 A;  4ZDF A;  4JJT A;  3ZW9 A;  1K39 A;  5E0N X;  3OT6 A;  4RYF A;  2VSS E;  4HC8 A;  4OMR A;  4MXI A;  2VSU A;  1YG8 A;  2Q34 A;  2ZL0 A;  1O8U A;  5FUS A;  3Q0G A;  5IKL B;  1Q52 A;  3K50 A;  2YJG A;  3N6R B;  1N6D A;  4B3J A;  3STA A;  3Q7H A;  4ELS A;  4Q1I A;  2A81 A;  3GKB A;  3M6M A;  2VSU F;  4K29 A;  5HUQ A;  5DU4 A;  3FF6 A;  4U0G H;  3QRE A;  4NNQ A;  3HRX A;  3R9Q A;  3QXI A;  5DTW A;  5DL1 A;  1TYF A;  3H02 A;  1PIX A;  2A7S A;  2A7K A;  2F6I A;  1XNV A;  4YLH A;  3I47 A;  4QFE A;  3IB9 A;  3V5I A;  1N6F A;  3HLN 1;  3MFM A;  3LKE A;  1XNW A;  4IZB A;  3OME A;  3TVU A;  3KTJ A;  2F9I B;  3H0U A;  2PPY A;  5KDR A;  3TRR A;  3ZWA A;  5DTP A;  5C90 A;  3DJA A;  4JSB A;  1VRG A;  3FDU A;  3U9S B;  4FZW A;  1WDL A;  4ZU2 A;  3TVW A;  4ZDE A;  2J5I I;  2HW5 A;  1X0U A;  1TG6 A;  2VSU C;  2ZL2 A;  1ON9 A;  3T3W A;  5KJP A;  4Q0G A;  2IEX A;  1FC9 A;  1UYS A;  3GF3 A;  4FB8 A;  4ZDB A;  1RJM A;  3TDC A;  5G1Q A;  1K32 A;  4K2N A;  2PBP A;  3ISA A;  3BPT A;  1OD2 A;  4WZ8 B;  1FC7 A;  4FN7 A;  5DUC A;  2F6Q A;  4ZDC A;  3U9R B;  3WG5 A;  1Y7O A;  1J7X A;  4EMM A;  5G1S A;  3Q1T A;  5E0S H;  3NJD A;  1W2X A;  3R6H A;  5INI A;  4G2R A;  1PJH A;  2VRE A;  3U9T B;  2F9Y B;  1WDM A;  3L3S A;  4B3I A;  1WZ8 A;  1UIY A;  3LAO A;  3MYB A;  1MJ3 A;  3PGQ A;  3R9T A;  3K8X A;  3TZ3 A;  1HNO A;  4HDT A;  4U0H A;  4FJW D;  3H0S A;  5JBX A;  3GMA A;  1HZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...