3HS0B

Cobra venom factor (cvf) in complex with human factor b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
233
structure length
233
Chain Sequence
DGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into complement convertase formation based on the structure of the factor B-cobra venom factor complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Cobra venom factor
total genus 25
structure length 233
sequence length 233
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3hs0B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hs0B02
8FABB 3MBEA 4LSPL 1XR9B 1BQSA 5IHUH 4O02L 3IDGA 5J3HD 4ODTL 1LDPH 1MWAL 3DI3B 4Q9QL 3ARZA 3UJJL 3NN8A 3SGDI 1U8NB 5ITFA 1EX0A 1K3ZA 4LOUD 4XWGH 4FQCH 3JTTA 2KKQA 3VFVA 4JREB 3WXVH 4LBEB 3QCUL 4F7EA 1JTOA 3RQ3A 1NDMB 5TH2B 3ZDZF 4PG9B 1GHFH 3VG0H 2CRIA 3FZUD 1T04A 5DFWH 5BV7L 4QRSB 1QFUL 1GZPB 4JZNA 3GSQB 3VDCA 5B8CC 4OBSA 4KKBC 2FBJH 1NGZA 3AM8A 4PJGA 2FH8A 2D7NA 1CIDA 5JA8B 4H8WL 2CJUL 3HMWH 1S7UB 4PJEB 4PB0H 5TDNB 5EIIA 2KL6A 5C09E 2F54D 1P4IL 3I3DA 5I1IH 1JTPA 4JPIB 1NJ9B 1QOKA 2JJTA 3V0AC 3MZGB 4RFOH 4FQQB 2RBLA 5GS0H 1CDCA 3L3HB 3D48R 3PQYB 4L4VE 3SHSA 3X3FH 5IB5A 5DF0A 3T0BA 1NEZA 2O93L 1AHWA 3PP4H 3ZE1F 2I9TB 4HW6A 3CAFA 4FQLH 1T4KA 2Y6SC 1W8OA 4YHML 4Z9KB 1I8MA 1NQBA 4LASH 1JF1B 3BZ4A 3G04A 4AZ8A 1NGQL 2JJTC 1IC5L 3MRKB 2E27L 3BDXA 4Z7VE 3PV6A 1L4IA 1WIPA 4OFYA 1LP9A 4G9FA 4BJLA 5LWYL 4POUB 4J4PD 4NQDE 4ONHA 5IB2A 4K3DH 4KKBD 3PQYD 1EZVY 2WINA 3PWJA 1J1PH 5JZ7D 2F54B 3O3EB 2X44D 3VH8G 4JANB 3WHE0 1WQVT 1OT2A 5JDSA 1T3FB 5I2IB 2DQFB 2FATH 3S5LA 4U6VH 4RQQA 5JHLL 3RVWD 3DROB 4I1NB 3QSKB 4NO2A 3KLAA 1MNUH 3SKOB 2O61A 2Q7YA 1P7KB 5D5MA 5EBMA 1P7HL 2C3GA 1YEHL 3TA3B 2BNRD 2DAVA 2HMID 4L1DA 4PRHE 3QULA 4Z7WA 5KG9A 2EDRA 1KIRA 1I7RB 3DUSA 1B6UA 2AJXL 1S7TB 2A6KB 3IDNA 5I16B 3RAJL 4GRMB 2KQMA 4FZEH 3I6GA 1T21A 5FO8B 2MCPL 1S8DB 4JZJB 5HGGS 1BX2B 5J13B 1IGYA 1T1YA 1EVTC 2X4SB 1CG9A 3WIHL 1MY5A 4H1LB 2BVEA 1KPVA 5E2WL 4DAGH 1UWXK 1FLRH 3SE9L 2AI0H 5DJZA 1GOHA 4D9QD 2ZG3A 4Y2DA 5C07A 5KSBE 3GSUA 4NJ9L 2L7JA 1J8KA 2E27H 4TNVF 1YUHB 4PRNB 4AEFA 5T3ZE 5C0BB 4FFZH 3B9KA 4Y4HD 4DQOH 4JHBA 1MFCL 2XPGB 5H8DA 4R7NB 2D2OA 3HI5H 4PJCA 2CRZA 3PDOA 2A6KA 2F8XC 5ESVB 2VLLB 3EBAA 5B21A 4LPYA 5C0GA 4Z7OE 1LO0L 3TYGL 3RTQC 4PGJA 4PRHA 2UY6A 1ONQA 5GSRA 2DJ4A 1V05A 2KH2B 5CEXB 1FIGL 3EYUH 1GGTA 2XN9B 4KDVA 2BOCA 4P4RA 4KQ4H 1QRNB 2DB8A 2A38A 2HVKA 3LKNB 2IADA 4AEIL 1KJ2A 1YMMA 4LFHG 1K2DB 2WUBL 2VLRB 2XPGA 4HUXB 5CBAA 2IH3A 3O41A 1NC2A 1YJDL 1U93B 3OWEA 1C5DA 3ILPA 2XN9E 2HRPL 3C08L 3QYCA 5DMIL 4IOFD 1DQDL 5ESQB 5SV3A 4QHLA 3WFHA 4NOBA 3WUZA 3V4VL 2FX7L 4PJIF 1RJZB 1MCKA 2AVGA 1RUKL 3OXRB 4NNYA 4QTIH 3QUMH 5C0FA 3P3YA 5IJVB 1KIPB 1T1ZA 3UC0H 3ZHDA 2VLRD 2HVJA 4FTVB 4DGYL 3KPPB 1F4YH 3K2UH 3GKWH 5MENB 4GG6F 4M1GH 5BZWB 2VDQH 1QRND 4CADB 5F7HA 1R0AH 1SY6L 2J6EA 1JWMB 2V2TB 4EOWL 1BBJB 1JWSA 3K3QA 4OJFL 3AAZA 1X5HA 1SEBA 4WEMB 4HPYL 2NW3A 4X7DC 4HDIB 5T3XH 2NY6C 4KY1H 1I7UB 3M07A 1CFSB 4AM0A 4M5ZL 5ENWA 4RIRB 4APQC 1UM6L 1U41A 1LE5B 4LCUA 4DFIA 5MEND 1QRKA 4IRSC 4LVOB 1DQMH 1FRGL 1QACA 3IJYB 5EC1B 1BP3B 2VQ1A 2VUOA 2OTWA 1L0XA 3UPRB 25C8L 2Z91A 3RUGF 5DDHB 4FHBD 3P73B 1JJUA 4YHLL 4O2EB 1YEGH 3LKQB 2GJZA 4WDIA 3SCMD 2AKRB 1K8DA 5FYJL 2ATPA 3QCUH 5CS7A 2WP3O 4N0YL 4FXKA 3U36A 2NXYC 4MJIE 3BQUD 2I9LB 5I17A 2HKFL 1RULH 5C0AE 1IGCL 5TDOB 3MRFA 4TULH 1VADA 2NXZC 3IJYA 4P2YA 4GSDL 5EC1A 3D39B 1HH9B 1R5VA 4IOIA 1D6EB 3RPIB 3TH3T 3V8OA 3BVNA 4QTHB 3OX8A 1EH9A 3DROA 4NO2B 1T0MB 4BFIA 2EDYA 3WFCL 1GGYA 3RZCD 4MVBC 1P9MA 1Z3GH 4IRJB 3EDKA 3MV7E 1WWAX 3MUJA 3QEQE 4I3GA 1I1FA 2DLFH 5IG7B 3BIAX 3MLRL 1AGEA 4X4ME 5HHNB 5BJTB 4LLQB 4JFDA 1ZANL 4OLZH 1BFOB 4PY7B 4LNRA 5EZJB 1ITCA 3CVHB 3CXDL 4UINL 3U48A 4QRPB 1HHHB 2B4CL 2P5EE 1A7BA 2XQYG 1JPST 4L3ED 1GL4B 1D9KC 5H35A 4X7TA 3IFNH 3UTSD 3MA9L 1HXYB 4R90L 4CVUA 5EFIA 1XF3A 3ARGA 3QO0A 1PG7W 1JNLH 15C8L 1S7XA 4K3EL 4N68A 1F2XK 4O4YH 4HF5H 4F9LA 3QUKB 1BLNB 1LQSR 3OKNB 4JY6A 5DXWA 1SBSH 3I02A 1JZ5A 3QIBA 4R4NC 4OIIH 1FCGA 5JXEA 1I7ZA 5J1AB 4K94L 1NCWL 2OTPA 4F7CB 2IH1A 3BZFB 5CP7A 2ICCA 3GJEA 3MNWB 2H32H 2W65A 2BSED 4M1CD 2IAMD 5AG8A 3VFGL 5EN2B 2NX5B 2P8LB 4FRWA 5GJSL 3QIUA 3U83A 1J0IA 1KNOA 3FB6A 1TZGH 2VH5L 1RZGA 2X7LA 1RD6A 1FPTL 1MH5B 2ZKHH 4LAJH 2YPVH 4APQB 5IHZA 1LK2A 4X6EB 3MLSL 4EI6B 4L8DB 2YXFA 4JEGB 3T3MF 3QUZB 4KKNA 1SBBA 1PAMA 5KZCB 2J4WL 1ZLSH 2GUOA 3B5HA 5F9OL 3RIFK 1QSFD 5AZEL 1CLCA 1JZ2A 3MRHA 4NUJB 4XAWL 2DQUH 4U6XB 4O2CA 5DQ9B 4WEUD 4C54A 2IAMB 3NFNA 3DNKA 2NX5D 2HTLD 1KN2H 3B2UD 1FNSL 3GSNB 3JXAA 5GHWL 1CICC 4N0FA 3IAPA 3SJVE 1IC4L 5C86A 1JGLL 5FAAA 5K93A 4M1GL 3C6LD 2X7LB 3HRPA 1YY8A 5MEPB 3UC0L 5DJ8B 3RWJB 1CZ8H 3KPPA 3WFBH 4HIEB 3JV5A 4HFWB 4UQ3A 2BCKA 4JM2D 1IEHA 1XGQA 5IJKC 2LV4A 3SQBA 1L7TL 2VLKE 3MCKA 4NO0D 3DARA 3MV8D 2CIKB 3VRIB 5JHDE 4OM1L 1YNTA 3MREA 3QUZD 4HWBA 1Y0LA 1FDLH 4EVNB 5D7SH 1NDMA 2J8OA 5TH2A 1QNZH 4XB8A 4JY4B 3DO7B 1E4XL 4YDKH 3PWPE 4HIJA 4A6YB 5IJKA 5MEQB 1RK1A 4CKVX 3JWDL 4OLUH 1WZMA 1K4DB 1UT9A 3PWVB 3HR6A 1BECA 4LU5L 3IFLH 3IXAA 5B22A 2YD5A 1C08A 1NCAH 1NBQA 2NY0C 2ITDB 3X12B 3VCLB 1V3LA 2OI9C 3QULB 4Z7WB 1YEIH 3NCBB 1ZGLM 2PN5A 4PGCA 2DRUA 5IW3A 4AK1A 3WBDA 1NFDE 4YNYB 3TJHD 1TNNA 1BAFL 4XHQA 1K8IB 1NBZA 1TVHB 1S7VB 4YHZH 2A73B 3STZB 4DW2H 5A2KH 1KSRA 2IG2H 5D1QA 2HWZH 2YSSA 4ZUTA 5DT1L 5D2NE 4ZDHB 4KAQH 4JZJC 4DUXA 4HXAL 4KK6D 4L8SB 5J12C 3MNZA 2VDOH 4BSWA 3WL9A 1UYWH 3IDYC 4Z0BL 1HXMA 1E4WL 4Y8AA 4KJWC 5DEGA 5FM5O 5IIEB 4NKIH 2A2QT 3SKNB 5L7XH 2P45B 4JQIL 4ISVA 4LCWD 2VLKA 4DFHA 2VRAA 3ALWA 3I3BA 4PRPD 2XZQH 2FATL 3F58L 3PGDB 4ETQA 5FHAH 5IFJB 2VN7A 3MUGA 1Q9OA 5INCA 4NCDA 4HT1L 1CVSC 2IGFH 5L2JB 1QVOB 1RUPH 3QO1A 1A21A 3KXFA 2VKWA 1WZLA 1U6AL 5JA9A 2BVTA 3SJVA 1EHLL 2YC1B 3QXVA 2FWOA 4C83B 1RIVH 2C1OB 3D2UA 3FAXA 3FQRB 4OZFG 4P5KB 5HI4D 5FUZH 2P44B 5FF6A 3EYVB 1FL5A 4OIIL 4O5LH 3QDMA 2HMIC 2X1WL 2LVCA 3IF1B 5E9DA 1XGYL 3CFKA 3HCVB 1DQLH 2XOTA 1ZT4B 2EYTB 3DRQA 2EE2A 3GI9H 3MGOB 1G6RB 3ARQA 3WEXA 4RA0C 4RGMB 1A6ZB 2R9HC 4XVSH 1OTTC 3A6BH 1MH5A 1TQCB 1MJUL 5JW5A 4XGZB 3BKCH 3RI5K 2VLLA 3QWOB 5EIVA 1KF9B 1AJ7H 1YN6A 5FUCC 5I8OH 5AZEH 2AJVH 4WW2A 4LSTH 1QFOA 5HVGB 4EN3D 4O2FA 1NCBH 1V3JA 3CFKB 4X8XA 1M71A 3C5SB 1J1XL 4V1DD 2J8UE 2FJHB 5C9KA 3IDMA 1MEXL 2DTMH 4P5MA 2P5WB 5TFSL 4KK5C 3IJSB 3ALPA 3M45A 2KZ1B 1KJ2B 3KNBA 1ACYL 1D5XB 2DICA 4Y5VC 5L2KA 3B43A 1X6LA 1NAMA 4JZNB 3BZEB 1MWAA 4ZNEA 1I9RH 3OV6A 1TETL 3IB4A 4HLZH 2M8XA 2YHGA 3PGCA 3JTSA 5GZNC 4RWYL 3BPOC 1HQRA 2J8UB 1NSNL 2WQ8A 4YGAB 1ZT1A 1DBML 5EBLA 4RISL 3U46A 2NY0B 2EDWA 3Q5TA 4KJPC 4NN7B 1JN6B 1A6WH 2OXGA 1QBMH 1RJYA 5DUML 5CJQH 5D1QD 3QQ4A 3UCRA 3U2SB 2VR5A 2EIZB 1GXEA 2P5WD 3B9AA 4OSUH 3TF7C 3DECA 3NCFB 4JFYA 1UJ3C 5FGBC 4GO6B 1Q94A 1YYMH 5ILTH 1Q9KB 1D3CA 3OTTA 1BMGA 5D93B 1YEEL 4WHTA 4MA3B 2D7TL 4XP6H 2ID5A 1LP9B 1JUFA 4TTDC 3OAYK 2GK0B 3GHEL 5HYJD 5I76A 2JB6A 1G6VK 3O6FD 3EAKA 2C7UB 4YFLI 3QUXA 5ICYA 3MZTA 4I0PA 1XCTB 1IQWH 2E7CA 4LNRB 4R3SB 1A1MA 4S1QH 5K33A 5I1GH 4JFYB 5ITBL 3LCYA 2OI9B 2OR9H 1ZTXL 5DEFB 1FC1A 5HDQH 2EYSA 5GRWA 4XPFH 4OZHB 4M7JH 1INQB 3FRPG 4Y1AB 2DJSA 1A5FH 5HPOA 2ILLA 4CBPA 1JCKA 2YRPA 3T2OA 1AH1A 3GHBH 1OL0A 3S36L 4JFHD 2DLGA 2HT2D 2ORBL 4JFOA 5I0ZA 2XTJB 1GGBH 2B1AL 1IGIH 3MROA 2R0WH 3V5HA 1FNAA 3MYZA 1NC2B 3D6GA 1OW0C 4WFFE 3T0VA 4NKIL 3SPVA 3WJLA 1MRCH 1I1AD 2FJFB 4D2NA 1IGYB 5I73C 1I8LA 5BO1L 2WUBH 4PV9A 5KVEH 2W65B 4MA8L 5DSCA 1GVIA 2R1WA 4H26B 2FEDD 2V6HA 2DM4A 4K2UH 4M9PA 5F8RC 2NLJA 1F4AA 3CMGA 4LLWB 4LKCB 2VXQH 4ODWB 4MX7B 3BRDA 1OW0A 3NACL 1UH3A 4LDLB 5C09A 1QFWL 5IG7A 3WNMA 4JO1L 5SWSB 2XT1B 2X89D 4XWGL 4HS3B 3ULUE 4Q9BA 4QHNA 4QRUB 4XPGL 4Z0XB 3V6ZA 4Z78A 3C60A 2MQCA 1AC6A 1TENA 4MNQB 3HTLX 1T66C 4LSPH 4M7KL 5F88A 1IC7L 3MGAA 5F9OH 4EUPB 4OCSH 1D5ZA 1F3DH 2XNAA 4F7MB 3F12B 1HCFX 4DUVA 3DSFL 1NBVL 4HGWA 4HUVB 4WCYL 1NUDA 3DYOA 3R0MA 3CU7A 3SKMB 4M8QA 5KVGL 4RAVB 3RDTD 4KK9C 4AIZA 1WUNT 2BJMH 3TJEL 5IFHH 2V7NA 2BSSA 3VXUE 2BP3A 4OD2A 3D0VA 43C9A 3SDAC 4I3RH 4PPTA 3OBAA 4U2YA 4G8FA 4DZ8B 4N0CD 4PLOB 2WK2A 4ZQKA 1D5IH 4YO0A 3UYRL 1A02N 35C8L 3A67H 1BZ9A 1H3GA 4U1IB 4WJ5A 4MD5B 3T4YA 1MFNA 2X70A 5T1KA 3DX8A 1JTTA 4ZAKA 1JWMA 1VACA 3ARGC 5FIEA 5GHWH 1S9KC 4QRQA 4U0RC 4YUEL 4ESKA 5JW4N 1KPRA 4F9PC 1BM3L 4ZQKB 3QFJA 2VZUA 3G5XB 4YDVA 4YLQT 3VD5A 4MCZB 3UROR 1UKQA 2VMFA 3QXUA 4RRPA 2XKUA 2EDKA 1PKQB 1XIWD 4B7IA 4JO3L 2AXFB 4LSTL 2E7HA 2CLRB 4PJEA 2Y72A 4KC3B 2FD6L 2EXWD 5DJDB 4Q2ZB 3WO4C 3M17B 3ZLQC 5KSVB 3CD4A 3G9AB 3KR3L 4DOHE 4N90D 1HSBB 4GAFB 4XVSL 5IMKA 3OAZK 5DEGB 1SY6H 4LVHC 2A9NL 5ETUB 1T21B 3TIEA 2QLVB 3S9DB 3RHWK 2I9TA 3FO1B 1S5HB 5I1GL 4HAGA 1Q9WA 15C8H 4F8QA 2VIRA 4HWBL 4QXGL 4JJ5A 4PR5B 4NZUH 1UQSA 1BFSA 3RPKA 5DJAB 1ZVYA 4ZMAT 4IIQA 4ZXBB 5AD0A 1YEEH 3FB6B 4PY8J 4G6MH 4EI5C 3Q3GA 4PREA 2NY3D 3IFPB 3PABA 5ICZB 2C1OA 1FBIL 2VLMD 2HT4D 3B3IB 4B50A 3TIEB 4MJIB 3LD8B 3BSZH 4XTRC 3REVA 3KYMB 2MPAL 3Q48A 1XR8B 4WNQB 1CE6B 3WIIH 1YEDB 2VTFA 4XZUA 3RNKA 3O4LA 4RZCA 4JG1L 1EGJA 4P3DA 1JHLH 3C8HA 1RVFH 5CEXA 1A1NA 3TCLB 1R0AL 4LLVB 1PKOA 4FQXC 3IDJA 4PGEB 1RULL 5C08E 5E7FA 2B2XH 5MHSD 4K55A 4JRYA 5I1EL 5DJXB 5SWZE 1QSZA 4ZTPL 3WSQH 2AK4A 3LIZH 1YEJH 1NMBL 5I8KL 5GS0D 1JRHI 2NY2D 2HN7B 3CXHK 4E42B 5JO5A 5H37H 4BSVB 5E03A 5FYJH 3ARBB 25C8H 3RY4A 3R0NA 4MDJA 4M48H 3AMKA 2HFFA 2VN4A 4IHOA 3KNBB 1HILA 3DV4A 4G7YL 3GMQA 5D93C 1P6FA 4PJHF 5CJXA 5FM4A 3QXAB 3QUMB 4ZYKA 4JFXA 3I50L 3RJQB 1MWAB 3K4AA 1UJ3B 3L3JA 5CZXC 5TQ0H 4KUCF 4KY1L 4PJXB 3X3FL 1WICA 5F7MC 1WEJH 5CSZB 3B6SB 1GGIL 3LSOB 2EC9U 1ZWIA 2GSIA 3MXVH 4K3JL 3VFPA 4KFZC 4Q74A 5CJ8A 4ZFZB 2UZYB 3IYLW 3QT2A 2BNRA 1T5XB 4ONHB 1YEFL 1I7UA 4D9LH 1MVUB 1S5IH 2BNUA 1TPXB 1CWVA 3SGKA 1KYOK 2J6EH 2ZUQB 2GSGB 3QAZC 3B9KD 1KTRL 3RGHA 3U2SA 2R69H 4XGZA 2FBOJ 4TPRL 3W0WD 1OTTD 2JTDA 4YGVB 4JN1L 3SE9H 1AFVH 3PWPD 3LQZB 4QCIA 1FVEA 3QHFH 3RVTD 4XPAH 2PNDA 3AS2A 4DKFL 1WBXA 5B38A 5B4MC 4N1CA 4EXKA 2FNBA 3DETC 1F4HA 5K9OA 2X10A 2SEBA 4OUOA 5EO0A 5JR1L 3WS6A 5DJ0B 4QYOB 5CGMA 3L95B 5GRJL 2LTQB 3H9HA 4HKBA 5MERB 2QSCL 1KTLA 3QUYC 3W39B 1X5AA 4GQ9H 1FNHA 4AG4H 4WY7H 2I60H 3ARDA 5IFJA 4OUUB 4UILH 1T20B 4ZUSB 3GMPA 4P2RA 3V0WH 1TQCC 1QQDA 1CXEA 4GKOA 3GMMB 1GGIH 3QUYB 4EQ2A 4LSRH 1FZJA 2VAAB 2YOCA 3WDHA 4F8TA 5K9OB 4YXKH 1DLHB 4R26H 3E6HA 3CSYA 1WT5A 1OGTB 4MSWA 4YHIB 4W6XB 1YECL 3U30C 4TSBL 4KRMB 4FFZL 4GW5A 1TZHA 5C0GB 1U42A 4BZ2L 4JRXE 1AKJA 3WFZA 5C6TL 4K7PL 3VJ6A 3KYOB 3PNWB 3D3VD 5ALCH 2DF3A 3T1FB 3R8BB 1MCRA 4YHYC 3PP4L 1FZOA 3I85A 1XGRA 2X5PA 2CUHA 2DTSA 2FHFA 3GBNL 3EO1A 4KVNH 5IQ9A 5EUOE 1JGLH 4QHUA 3V0VA 5H94B 5J06A 1KEGL 1MQKL 2OMNA 4J7RA 1I7TB 1BQUA 2VXQL 4OZIE 1KCKA 3O2VH 5FKPB 3ZDYF 4I18C 5DO2C 1N0LA 3DOSA 4D3CH 2F53B 3EYQD 3PGFH 1U9KA 1K5NB 3WUWA 2QV2A 4P2QE 5GJTL 5INCB 4UT7H 1D5ZB 4R4FL 3MOAL 4XCEB 2ITCA 3KPOB 5CEYA 4WRLA 2UVFA 5I74C 3BAEH 1DDHA 4ZD3H 1NAKH 1J8HE 4PJCB 1JNHB 4YQXL 2GKIA 3ARBC 5A3ID 3BRFA 2QADD 4NPYB 3MV7A 1F4XL 2I26N 4DVBA 1B0GA 3UBXI 1P5UA 1TJHL 3PG2A 1M05B 3TC9A 1XT5A 3LZFH 1HQ4A 4X4ZA 2HG5A 4QNPF 3AM8C 3SGJC 3UTSE 5C6PB 5F9JA 3TO2A 4QWWD 1CCZA 1F90H 4NKOA 1V7ML 3MO1A 4KXZH 4EQ3A 2WBJD 5CBEB 5HSFA 4QF1A 1TJGL 1R24B 5EZIH 4KU1A 3FO0L 4HK3N 2HYMA 4QRUA 1PG7X 4LL9A 1LVEA 2ED8A 3WNKA 1Q9KA 4H0IA 3I6LE 1NGWA 3SDCA 1FRGH 4URTB 4HUKB 1CXLA 3C09B 1W0VB 3TBVB 2E8YA 4CW1B 5BOPA 3BHBA 4KI1A 1ZGLB 3BJ91 3GSVA 1AD9A 1KXVC 2GHWB 3TO2B 1JL8A 4XBGA 5EU6A 4JR9L 2G5RA 5MEOA 4HQQL 4MHHG 4A6YA 4EI6A 1H8NA 4I3SL 3SO5A 1ZA6A 3CU1A 3VGHA 3KJ6H 2YMXL 3GHEH 3GIZL 3P77B 4GS7B 4U4BA 3G6JB 4NQDD 5T1LB 3EJYC 4CNIB 3UPAA 4L3EA 5CGYD 1TZIA 3ZSSA 3BW9B 1QKZH 1OAQL 4PGBB 5E00B 4RFNB 4GBXD 4PRAB 1MAML 3MROB 2YN3A 1L0YA 2GCYA 2Y1VA 1R3KA 2ZOLB 3SPVB 1DVFB 1NBZB 4WJ5B 2HJLB 1JVKA 5D7JC 1FZMA 1G7PA 4LLYB 1ZS8A 1XGTB 4TSCL 3OAUL 4CDGC 1R3JB 3CFJA 4AENA 3WV0A 1NCUA 3BIKB 2HLAA 1MCFA 1DQML 5D6DC 4EBQL 3VXSE 1EXUA 1SJEB 1RJCA 3ZHLA 5I6XB 1UADC 3B2UC 1X3DA 3RIAK 2CXKA 3IAQA 4WW2C 2QL1A 4NRZA 1MCEA 3HZVB 1GIGL 2G5BA 1QSEA 2Q6WA 5ECJE 4V2CB 1DVFD 4ZOBA 3BKYL 1S8DA 4CVXB 1BGXL 1M6OA 3RGVC 5E9DD 1QR4A 2W59A 4FTVE 5I1CL 2AV7B 3MLVL 5EA0H 2C1PA 4G7VH 3BISA 2NX5A 1MHEA 2Q76B 3B9EA 2XI9A 4FS0A 2DQTL 5IBUB 5IESH 1AR1C 3UTPD 2ZUTA 1ULVA 3E1F1 1X4ZA 1I9JH 1ETZB 4N8CL 4BFGA 3PWUB 3BUTA 1XH3B 4ZAKC 4PJDA 1YMHB 4LLUB 5DJYB 1BWWA 2EKJA 5JIHA 2IBZX 2HFGL 2WINB 3TN0C 4L4TE 5B39B 1M7IA 5CKGA 3ZKXC 4OV5A 1G7HB 2UZIH 1NBYB 2XACC 5D4QA 4N8VB 4LP5A 5ID1A 1AO7D 5D5MF 4FA8A 5KVGH 4ONGH 4OLZL 2CH8A 4V1DA 3EDFA 2D7PA 3BD3A 4Y1AE 5IOPB 4XP5L 4M6OH 1WWWX 4PJEF 1LEIB 1Y6NR 2IC2A 4JQIH 2PYFA 4DEPB 4CAGA 1BZ9B 3QUMA 4ZYKB 3VXRD 5I1AA 4JFDD 1EBAA 3BQUB 4O58H 3BO8B 3WKNA 2NXZB 1CDJA 2EDHA 4Z0XA 3V6ZB 3L7EA 4Z78B 3KPRE 3ZYZA 1PDKA 1UA6L 5ANMA 3MCKB 2KZWA 4UI2A 3ZYJA 5E6IB 4XP9L 5LAXB 5JIPA 4P5MB 5GZOD 2VDNH 2ZPKH 1FJ1A 1U3YA 3BGFC 5IW1B 3L3DA 3VFMB 2P43B 4M9OA 5DJCA 4M1DL 2EH8L 2NY1D 3ECBB 4RX4A 5HYSB 3D85B 4I3RL 2EDFA 5BO1H 2XFXA 5CHNA 2N56A 1ZSDA 2VLKD 5FF6B 3RVUC 3G04B 4NSKA 5J7CC 4IRSB 1J0HA 4MAUL 1YJDH 1L6ZA 1MCOH 4G80B 1PG7H 4M6ML 4G8IA 5FECB 4MJ2A 3GSVB 1DQQA 3D69A 1NKOA 1HYRC 1A6PA 3FQWB 3MLTB 4M5ZH 5E8DH 1YMMB 2Y36H 2HJFB 1NUGA 1EFQA 3VXOA 5T1DH 3HZMB 1A6UH 1KTLB 2F8OA 4XVUC 4XX1E 12E8H 3MOBL 2IH3B 4GAYA 4XHJC 2K7QA 4NWTL 3VWKC 1RZIA 3BYYA 1T3FA 5I2IA 4X6BB 3ARDB 3K2UL 3DX8B 2CJUH 3TH2T 2YKLH 1I9EA 5F89A 1OTSC 2UWEB 2LVEA 3N85L 3Q2CA 3UJTL 3VXPA 1U3HB 4WHTB 5CJBA 4DGYH 3FMGH 4LCYA 4TUKL 4D0BB 4LAQL 3F62A 3TZVC 1TETH 4NQXB 5FYJD 1OB1A 1HXMB 4JPVL 4XP6L 4F7PA 2NPLX 4RA3A 2UVEA 5F1NA 1G7MB 1NEZB 4Y5VA 1VKXB 4KH2A 1N7ML 3WS3A 1X5GA 4QLRA 1RK1B 1MCIA 2BMKA 1NAKL 4EBQH 1CG9B 4BSJA 2EO1A 5F89B 1G7IA 1KJ2H 4J1UA 1MRFH 4BQ6A 5FA4A 2P8MB 1M1SA 3LQAH 3KJ4B 2AJZA 1OAKH 1WC7B 2DQDL 2FCBA 3LEVH 4Z76B 3MJ7A 1QSVA 4JG1H 2SEBB 1BQLH 1F4WH 2GTZB 3GO1L 4JGUA 4N90E 4JFFD 2I25N 5MERA 1HEZB 3S4SG 4HIHA 2J5LB 5EZJA 4X98B 3V5DA 3U82B 3GMLB 5D96B 1REIA 4QRPA 1YNLL 1NGYA 4RQQB 3QG6B 4LCWE 4YFLF 4P4RB 3QNZA 4NQEE 3HLAB 3VFRB 3UTZA 4X6DB 1J1OH 3CFCH 4WU5B 1FO0A 4ELKB 3O3DA 3FMGL 3CFBB 3NGBC 2VDML 3WL9B 3GJFB 1RUMH 2VXVH 5B3JE 4O4YL 3RL2B 4GKZA 4JY6B 4UT7L 4M7LT 5I17B 4MZ2A 4ONGL 4XXCA 3ZSTA 4XP1H 2XA8H 2EIEA 5FO7B 4OAWB 1D6EA 1KGCD 3UDWC 2WSKA 3PWPB 5D1ZB 3H7BB 1JPSH 3VFGH 3ZKSD 3UJIH 5C0NC 5IOPA 3MJGX 3UTZB 1WCBA 1QBLL 2YZ8A 5DLML 3MMEA 4IIQC 5ADPL 3QHZL 4P23B 3QEQD 4KHTH 1FFQA 4UV7L 4XXDA 1MLCA 4HJGB 5GRYA 1WSST 1CIUA 3VXRE 3UDWA 4U1HB 4YPGA 3IJHB 3CX2A 3HE7A 4L5FH 5KOVC 3S35L 3QDMB 3EKCA 4Y19E 5L6YH 4PY8I 3ZKND 2AXGB 2Z35B 4IEFB 2XZCL 4APQD 1NFDB 5FYKU 1ADQL 2YPLD 4RGNE 1T1XB 5MENE 4HDIA 2K1MA 4PS4H 4M6NL 3PHQA 2BXYA 5DD5H 3S98A 2ZZUT 5H35B 2HJKB 2R1XB 4ODWA 3T09A 1TTUA 3OKMB 4PJIB 1MLCB 1HH6A 3S5LG 4U1IA 4UOW0 2X09A 3GGWA 5ACLA 5EORL 4HFWA 1NMCC 3P9LB 1Z0NA 1ZSDB 3QDMD 1Q94B 2IPTL 35C8H 3A67L 5GRVK 5JOPD 3RFZC 3CSGA 3EO0B 4I2XA 5HHQB 5GGVH 4U6YB 2HLFC 3BZFA 1OF2A 1AD0B 3V52H 2PCPA 3OKYA 3D3VB 4UV4L 5T1DL 2L7UA 1RJZA 3T0XA 3O11A 5I1JL 5DD6B 2XNAB 2ZJSH 1OCWL 3AC0A 4NDMB 1G6RL 4I5BA 4PTTA 2FJGA 5IVNA 4XNXL 3VXOB 4ZTOL 1N2RA 3NH7H 2E7BA 5JLZB 4RAVA 4YX2H 1DQLL 1VADB 1FORH 1J0ZA 1MOEA 3NABH 4P59L 3RWHB 1JGVL 1H15A 3R4DA 2NQCA 1ROWA 1A3RH 2V2TA 3HAEB 5EPMA 1INQA 4ZS7H 3PWLA 1BJMA 3U46B 3MV9A 1W0WB 4PJAA 3PL6A 4OGAD 2YK1L 4OZGA 4DCQA 1WBZB 1HHIB 2V5RA 4KHXL 3QZWB 3GSWA 3EO1B 5L2KD 4HWUA 4XNQA 3QB7C 3PL6D 3WIFA 1N2RB 2JCCB 5EG6C 1DUYB 1S7SA 1NPUA 2FJFA 2IANA 3DWTA 3MRMA 3RA7H 5FEBA 2PYED 1A6VL 4L9LA 4EDXA 2WAHA 4PG2A 4O9HH 5BVPL 3OPZH 3K4ZA 3EJZD 2P4AB 1XF4B 5FGRA 5EC2B 4BA8A 3PWNB 4G7YH 4KI5D 1I7RA 4PJDB 3I84A 2DQEH 1C12A 1S7RA 1ORSB 4S1DC 4ZFGH 1MCWW 5FV1L 5J89A 4NRYB 5ALCL 4JFHE 5FV2A 4MJIA 3X11B 4GW5B 5BV7H 3OJDB 2NY5H 5HPMA 3MRMB 4DKFH 3H3BC 1F3JB 1J1OL 2X4SA 1N7MH 5JXAL 4L9DA 5EOTB 4YR6B 1FL3B 2Q8AH 1CDGA 5E8OB 3T8XA 4D8PB 2NY0D 4PJ7E 3GMOA 5CEZD 3VI4F 3IETA 2A0LD 5GGTA 4PRID 4UOW1 3WLBB 2VDKH 3UJJH 3HFML 2W60A 1LMKA 3D2UB 3FQRA 1BF2A 2R69L 4JKPH 5D8JL 5I15H 1CICB 4WIQA 3KVQA 3K2MC 4OTXL 1Q9LA 4FQXB 3KLHD 2NYYC 3NN8B 4PJ7B 1W72H 1F6AB 1B2WH 3KLSA 4RSVA 2AV7A 3QHZH 5C0AD 4IMKC 4XRCB 5ICXB 1U8JB 3ROLA 4OCXH 3MMEB 2HTKD 2P46B 4JG0L 4ONFL 1UB5A 5T1LD 3RWGB 2BNRE 4RCAA 3O6FB 5I30L 3QI9C 4P5TD 2HFGH 4C58B 3HNSL 3CFDA 4JHWL 4G6AD 3W0WA 1JGDA 3BPNB 1FL6A 2HKHH 3CCHB 4FMKA 3TFKD 4BH8A 1G7JA 3IDIB 2EH8H 1H3XA 3C5SA 1FYTB 1QO3A 3HG1A 1YYLL 1QYGH 2AXHA 2DWDB 2XY1A 2BNRB 5FK9A 4Z7NF 3RDTB 2EYRA 1MCLA 3IJSA 1ZV5A 3QJHA 1U8IB 1CGYA 3U6RA 4DN3H 4LVHB 1MIML 1U0QA 5K9JL 5DFVD 1RPQA 4QRRA 5K59E 4JKLA 4KJPD 3ISWA 5DJXA 3BN9C 3OZ9L 3RZWA 1ZHLA 2AV1B 1JI1A 3WO4B 4X80L 1P6AB 2WWKT 1VGEL 1ED3A 1GSMA 1PEZA 1ORQA 4POYA 1JHTA 5JPNA 1HQRB 4LDEB 3CCHA 5FDWA 4S11A 5EOCL 3SDCB 2DQUL 5ISZA 3FRUB 2XICA 3V52L 4RMUA 1KBGH 1ZT4A 4JRYE 2R8SH 5LGJB 1KCUH 5EUOB 1INEH 5FK9B 3LEYH 3OKLA 1X5LA 5FHBH 1WAAE 3QPQD 5EU5A 1WIUA 3CX5J 3QHTC 5E7BA 4OZIB 5ISZD 3HS0A 3BSZL 3VXNA 1YY8B 5T33L 3VFOB 3VFMA 5CWSA 2HT3C 2NTFA 1ZK9A 5DD0L 1EEZB 3O2WL 1JV5A 3B8SA 4LGPB 2A73A 3STZA 3VW3H 4OZFB 1BQHA 3GMNA 4L3CA 4PJBA 2AAVA 2GEEA 1S7UA 3ARSA 2XN9D 3S34H 1MHEB 5KSBA 3KYKL 3UYPA 4FG6D 5LKNA 2B0SL 4QHMB 3BEVA 3MRQA 4QOKD 1YYLH 4N1EA 3DUSB 3IDNB 4XI5C 3KPNA 2PO6B 3BPLB 4AIXA 1RZ8A 3S3SA 3RGVB 2FX9H 4TN9A 2DM3A 4DKEL 5DHYA 4PUBL 2BVOB 1EA9C 3MA9H 1ODAA 3I3EA 2R0LL 3I6KA 5CUSL 3JWDH 1BVLB 3O3UN 2P47B 3GRWA 2I07B 3LQZA 4QCIB 4DVRL 5FCUH 1UG9A 1T0MA 4BFIB 1YYML 2PKDA 5IF0A 3H9SA 1KCSH 3SBWC 4JDVB 1EJ6A 3CDCA 3DMMB 2VZTA 4JO3H 4RRPG 4H20L 3UO1L 1KCUL 5GS1B 3G6AA 4KK8D 5DJ0A 1RZ8B 5LBSL 1AE6H 4PJFA 2X4NA 3O3EA 3NTCL 3L3IB 3JVGA 4P46B 5I1LA 4IRZH 3LMJL 4F58H 2NY3B 1AGBB 2C1PB 2WIIA 1LNUB 3WEXB 3BFOA 1JPGB 4MDJB 3MPCA 4OZFH 3IFNL 4P3CL 1I85C 3Q0HA 1FZJB 4JDVA 4O00A 2WBWB 5I9QB 2P8PB 4EN3C 3MJ8B 5DVMA 3O9WA 1KIRB 1ZTXH 3PABB 3CH1B 5C3TA 2RFXB 2UYLB 3GO1H 4HXBL 1FFNB 4QHNB 4YPGB 3B3IA 4R3SA 3N1GC 3RVWC 4LEXH 3UYOD 2JJSC 2ADFH 1KJMB 3BPNC 2DWEA 3ARDD 3PGDA 4LVNB 4C56E 1YMMD 5IWLA 3OQ3B 1PYWB 1FH5L 4MQXD 3AB0C 1ADQA 2VR9A 3V7AE 4C55A 1X5FA 4NP4L 1CK0H 2CLZA 4GRWB 4I48B 2H2SC 5EH1A 1LEIA 3UTTE 3K7UA 3C5ZD 4Z7UB 4WCYH 5L8LB 1N8ZA 2ADIB 2A74A 4RFOL 1AGDA 2EH7L 1XF5B 4HFUL 4P48A 4E0RB 1N5AA 2EECA 1K6QH 4NQDA 3S8WA 3RTQB 4X7FC 1E6OH 2HN7A 2AJUL 5JO5B 1S78C 4E42A 3NFNB 4IRJD 4KJYB 2G60H 2ICWI 1QSFE 4XC3H 5HHPB 3QIBD 4LBEA 3P4OA 4WO4D 3MLWH 4XBGB 2DS4A 2ZNXA 4AYFA 5BXFB 1MFBH 1OAZH 4F7PB 3HFMH 1S9VB 3QP3A 5AAMA 2FGWH 3ULUL 2ICES 4XAKE 4JDZA 4KUZL 1BEYL 2Q20A 1CFQA 5AAWA 1N5AB 4J4PA 1NANI 2J88H 4NGHH 1ND0B 2VZ1A 3FFCA 4CVZA 4ZPTB 1NC4B 1ZA3B 5C0IB 4YXHH 1UVQA 5IMMA 3IDMB 2HFEB 5IM7A 3TN0A 1ZLUH 2X05A 4OFKA 4PV8A 4G6KH 5A2IH 2Z8WC 4GMSL 4JY4A 3IVKA 1EJOL 4KQ4L 1KIPA 1T1ZB 2YD4A 3S88L 3WFCH 1OAYL 3DPBA 3SGEH 4M8VA 1HEZA 1JZ6A 3CPLB 1RFDH 3KHQA 4LIQE 4PLJC 3D39A 5CD5D 3B83A 2HT3D 3U0PB 5IVZA 4MD0A 4ERSL 4U6YA 2Y6SD 5E4EB 4PRPE 3OG6B 4GG8A 5DYOA 4LCYB 4N0CC 4U1NA 1K85A 1V5JA 2GAZB 4Y4KD 2JJUA 3LDBC 1DE4B 3MRRB 4JM2A 2R0LH 3KPRB 1FVDA 1QA9A 1C12B 1S7RB 1WFUA 3C2SA 4U2ZA 1FFPA 1QSEB 2Q6WB 4LCUB 1NL0L 4Y5VB 3FB5A 5KZCD 4YE4L 5FYLE 5CLWA 1VKXA 4Y0GA 3PJSA 3EFFA 1EFXD 5TQ2L 1DLFL 1X44A 5B38G 1WFTA 1EDQA 4NQVA 1U6AH 4PG2C 4NRXA 4EI5D 4BFBD 2A83B 5D7IE 4YBLC 3VI3E 3WUWB 3QDJB 1IAMA 3P73A 4OGYL 4UTBL 2ARWA 4JQXC 3C6LC 4Y16C 1DBKL 43CAA 3BESR 3DMMA 3JV6B 1W0YT 2DJUA 4P9HL 5EU6D 1T66D 1SY6A 3BGMA 2JB6B 4QHKJ 5GGSB 6CGTA 4WW1B 4KPHH 2CK0H 3BN3B 3TT3L 2OZ4L 5BW7A 1FZKA 1YEHH 3J7HA 4HC1A 2W9DL 3CZFB 4QGTA 4D0DB 2VXSL 4G6FD 3U0WL 1U95B 4WWKD 1HHKB 1U8MA 4ZUWB 4FFWD 1L7TH 5IT2H 4D94A 3MA7A 3LZFL 3L3KB 4KTDH 4NNPL 5IGXL 1LD9A 4G9DA 1CF8H 2XV6B 2LAAA 4M6NH 1CN4A 3WKMH 4PIRF 1VCAA 2H2PC 3LIZL 5F1IA 4OD1H 5DURD 3JWOL 3UBXA 1R3HB 4J3UA 1J1XH 3VRLE 3QAZB 3NZHL 1S7WA 3KWWA 5TFSH 1PYWA 1TPXC 1IARB 1KJVA 4JPWH 4KKCC 5TE4L 5JW4R 1HHKA 3ZKQD 5DK0B 3ZE2E 1CFTA 4IIQB 4XH2A 3IFLL 2ITCB 4I48A 4HX1A 4QY8B 2FZ3B 4J8RA 3MC0A 3VXUB 3MUY1 5B39A 1WTLA 1H15B 4H1LG 5KVFH 4CMHC 3JVGC 2ZCLH 1JYNA 1UM6H 3P77A 5EWIL 1MIMH 2O5XL 5KSUB 3QWRA 1HQ4B 4DQOL 3DUHA 4IMLB 1ZLUK 4GG6B 5EZOH 5DMGC 3MXWL 1BM3H 3QNXA 2IANE 3QEHB 4TVPE 5CJ5A 1CD1B 5DJ2B 4YHKH 2FGWL 3BT2H 2A9ML 4TNVK 3ZE2F 1A7PL 3AREB 1DVFA 4FQ2L 2BX5A 4GAJH 4I77H 4TOYH 5HYJE 3IDGB 1KACB 3VD3A 5DWUH 4M62L 1A6UL 3QDME 1MJJA 2N4IA 1A22B 3RKDD 1EEQA 1F5WA 1K6QL 4CGTA 2DM2A 3BX7C 1MJ7L 3QPXL 3S3PA 3T4AA 1PKQE 5D9SA 1MHPL 1FSKB 1O0VA 2WANA 3VXTA 1EAJA 4UUJA 1UXSB 2WNGA 1E27B 3MLRH 1ZLVK 2VXVL 2DQHL 4JRWA 4XBEH 3TBTB 2WWMD 1GC1H 1H3TA 1G7IB 3OKEA 4ELMA 3A0OA 3KPSE 2P5ED 3T8XB 4D8PA 3PDDA 3CJJA 4GFTB 3ULVL 1YNTB 2ORBH 4A6YL 3P0VH 1H0DB 3TBYB 4G8GA 5FB8A 3VMNA 3ARFD 4DGVL 3GIVB 2NR6D 1Q0XH 3E8UH 5FA3B 4PJFB 4HT1H 5T3ZD 1UFUA 2VDRL 3UJTH 1NCDH 1PGRB 4OV5B 1A0QL 3D39E 1KENL 3KPSB 1BFTA 3PXJA 1CE6A 5A1AA 5D7IF 5ITBH 1NCAL 3EYSL 4OZFA 3T2PA 3V95A 5KANI 2FLBT 4PP1C 5F1SA 2XYCA 1FYTD 1EMTH 1W2KT 4ZSOE 1QVOA 4JO1H 5H2BA 1DN0B 1C5BL 1I1RA 4JO4H 5C0BA 3MRDA 1FE8L 1N64H 4JHAH 4KQ3H 2WV3A 5C0CE 3P4MA 2PW2A 3GK8H 1I75A 1UWEL 4EDWH 4WFED 2APTA 4JAMB 1UKTA 4OT1H 1SYVB 3MRIA 3DSFH 2JCCE 5LQBH 1BVLA 1H3UA 1D9KD 1HHHA 2WMPA 1WBYB 4ZSOB 5FCUL 2R1WB 5D1ZA 4JJ5B 4PR5A 1PY4A 3ARBA 4DKDC 1RURH 3NPSC 1P7KA 1LO2H 4J6RH 4H0HB 1A6ZA 4LGSB 3FHAA 4ZPVA 3VGBA 3FQUA 4OGXH 1KCRH 4PRPA 2PF6A 2QSVA 2QQQA 1P7QD 5EU3A 3L3DB 2APBA 3BPLC 3MLVH 1XH3A 5EA0L 2C3XA 2R0ZH 4L4VD 1KTDB 1LO5A 5C08A 3V7AG 3X14B 5IB4B 1LILA 5GSVB 3SKNA 1M7IB 3TYFB 4XPGH 2C3VA 1Q9LB 1Q0XL 3E8UL 1S3KH 4FQ1H 1VEOA 1D9KB 4N9GB 1CD9B 1S7WB 1I8IB 4LDOB 2ZOKB 2MHAB 4NNXB 1FVCB 1JPFA 4X9GA 4X6DA 4QRPE 4M7LL 4PGEA 4QOKB 2PYFB 4HJJH 5AWNL 4NO0A 3NOIA 2GT9B 3SKMA 2R8SL 2BSRB 2R2HB 4P49A 1OAUL 4QF1B 5H94A 2Z9TA 4OLXH 1KLFA 3JBG7 4X6BA 5IFHL 3PP3K 1WFNA 1NCCH 4UT6L 2E5EA 3UXFA 2CR6A 4RWHA 5IB3B 4HBCL 1EO8L 5T3XE 1AO7A 4M5YL 4U6XA 3SOBL 1J0KA 2EDXA 4H88L 4BK4A 4RNRB 5F1KC 4OCWL 4BELD 1JPFB 3KPQB 2YD7A 4I77L 2YUXA 3MFFA 2OL3H 3VRJB 2CQVA 2BY2A 5F7UA 3HC3L 3V4UL 1JNLL 5L6YL 1T03L 1UH4A 1JNHA 2RCSH 2GJ6B 3WD5H 1XGPA 4FP8H 4X7EC 2OXHA 2YWZA 4DAGL 1NLBH 4DVBB 2RJMA 1A6AA 1IAIH 2DQIL 5A43C 4ZFZA 2W0KA 2GJZB 4WDIB 2KQNA 1Y0LB 1YPZE 1Y18B 4GRLA 5DI8A 1EAPB 5D7JA 1HHIA 5C07E 3W9DA 5J1TC 4LSQH 1UXWB 4LMQI 4JFEB 4XPBL 3KPRA 4CN4A 4H25A 4PJ9C 4X9FA 3I6GB 1BQLL 1E27A 1F4WL 2JJVA 3P9LA 1XGPB 4ODHH 5DR5H 5BVJA 2GQHA 2DIBA 1CD0A 2XTJC 1A6WL 1DVFC 2UWEA 5AZ2L 4KWUA 1OD7A 1PW3A 4Y1AA 3IS1X 4UIKL 3FQXA 2DL2A 2DYPD 2Y7QA 1AQDA 4PRIA 3BHBB 5IMMB 1ZGLA 3LQAC 1CZ8L 1PY9A 2X9YA 2B4CC 3IGAB 1FZOB 3MJ8A 5T1MA 3MLZH 5EO0B 5HHNA 3B5TA 4DGVH 5IMOB 5JUEL 3HI1B 1A7QH 2YRLA 1YQVH 2IG2L 4HSQA 3FB8B 2HP4A 1F3RB 3G9VA 1FAIH 1ZHKA 2EICA 3FQTB 1O7VA 2EXYD 2B5IC 3U0PA 5FUZL 1L9NA 3H7BA 4TNWF 3ALXA 2BSTA 1OVZA 3LS4H 4TRPH 4Y89A 4O2EA 4GG8B 4WI8A 1DN0A 4G9FE 4JKMA 4ZUVA 1MCDA 4WI2A 1YMHA 5DJYA 3VG9B 3U36B 2CKBL 3GK8L 5ALBH 5K9KB 4GKNB 1UM4H 4JE4B 3QIBB 3ZL4L 4E0RA 1IM3B 5ADPH 5FO8A 1FSKC 4X98A 3MUHL 4KMLB 1CFBA 1Z5LA 1YDPB 1MI5B 2OJEA 1BJ1J 1GH7A 4UDTA 2BSTB 2MQ0A 4XRCA 1AP2A 2CDGB 1W72L 1Q1JH 3OXSB 1UKSA 4LMQE 1XF1A 3TT1H 3IXTA 1J05A 4HUWA 4RMQA 4PJ7F 1G9MC 4XNZC 2YN5A 1CLYH 3GKWL 5BZWA 3BDYH 1R24A 3KS0H 4LPCA 2AK4B 4MHHI 2HWZL 4P9ML 3NCJH 2PW1A 1TNMA 1AHWC 1Q72L 4HPOL 4OB5H 5BS0E 4YHZL 3S6CA 3MACL 4QRPD 4BH8B 2X9WA 2B20A 5B3NA 2OJEB 4UDTB 4XCYB 4GG6A 4LFHD 3MODL 3MOAH 4M93C 4XP4L 4MX7A 4XMKL 4KRNA 4W4NA 2Y5TB 1AY1H 3DLQR 4HJJL 1IGTB 4WFHE 5DJ8A 3O6LL 3RWJA 1U58A 2MKLC 2R2HA 1KB5H 3VGAB 1T7XA 1A14H 2F19L 2B1AH 4UQ3B 2BY0A 2FR4A 3SDXA 1CDUA 1EJOH 4PTUA 5D2LB 5GRJH 5C0CD 1G9MH 2NY1B 1MJUH 1B3JA 4R9HA 1K8DB 1TVBB 3ZYOA 3F12A 3TESA 5IBUG 2ICEA 3PXHA 4HZAA 3X13A 3HS0B 1CQYA 3VXNB 2FZ3A 4J8RB 4HMEA 1IT9H 3LKPB 3HZMA 3UTTB 3KLDA 1RV6X 1JBJA 3VD9A 4MJID 5CIPH 1A4JA 1A2YA 2V2WB 2WM0A 3HE7D 1ITBB 2P24B 3P9MA 5BV7B 1QEWA 4PTUB 3SDDA 1X9QA 2AW2A 3CFJB 3HZYA 3LDBB 4LQFH 3O0RH 3VH8A 1RJLB 2I27N 2AI0L 3T77B 4L3EE 4UV7H 2BOBB 4DWHA 5FO9B 1QSFB 1V3MA 2E7LC 1UXWA 4I8DA 3LN4B 4FZEL 4OKVB 4HD9A 4LU5H 4NBZB 2DBLH 4HWNA 5MEPA 1SMAA 4XCFL 3HC4H 5MEOB 4TNWK 3ZKMC 4BZYA 2PXYC 5ETUA 2K7PA 3KPSA 2A1WH 4WY7L 1B9ZA 5D7LB 3VMOA 3NCMA 3O8XC 4OCYH 2F19H 4NO3B 4K8RD 5LBSH 3FQXB 3W11D 5DJAA 3IETB 4EIGB 3BOVA 4Y2DD 5C07D 5H2BB 3MA7B 5DURB 2Y4SA 3T4AB 4JFQA 4WHYH 2E9BA 5EORH 2AS5M 3QZWA 4OZIA 4YXLL 4M00A 2ZCHL 1YN7A 5DD3L 2DKMA 2EKSB 1H3VA 4TTDD 5CILH 2NNAA 1N4XL 2V17L 4X6CE 3MLYL 4Y7MA 5TF1H 3QEGH 3GMLA 5DFTA 5HYSG 5HYQB 1A4KB 4K3GA 4ZD3L 1NLBL 5E8NA 1IC4H 2DI8A 5LGHH 5CINL 4WHCA 1N0XL 1AGCB 2HAZA 3UP1A 1N59B 3ZE0F 4XH2B 4UIKH 3ARRA 3EDEA 32C2A 3VFNB 3M17A 5KSVA 4Q7DA 2VXSH 5JW4M 1AGEB 3AVEA 5BRZE 1Z9LA 3BYTA 3GKZA 3W0WB 3DX6A 5D70H 1M6OB 4ZOAA 1MCCA 1G7JB 5I1HL 5FDYA 1I8IA 3Q6FA 4JRYD 2ZUUA 4R0LA 1GOGA 5J11B 2F5AL 3D87B 3O81A 1WAAA 4GW4A 4JO4L 1N3NA 5JTWA 5IHBA 4OFPA 5IK3A 3GMQB 5DC0A 1C16A 5F21B 3IFPA 1NFIB 2E6QA 3JV0A 5GS1A 2BSRA 1T7YA 4YC2C 4M7ZC 4HKXB 1L6XA 2AV1A 2VDMH 1HNFA 3LH2L 3V6FA 2JB5L 3O2DA 4JR9H 4YHPB 4EN3B 3O4OC 2EEAA 2Z4QB 4ENED 2PTTA 3VFPB 5IW6B 3SGKC 4PJGF 2P5EB 1NJ9A 5E24E 1CFTB 1H3WM 4OI7A 3MRNA 3TIDA 1KNOB 5EU4A 3QO1B 1JYXA 4HS8H 1S9VA 5DMJB 1BZQK 1C16B 4LKXB 5GRUL 1LO5B 1QHOA 3HG1E 3QDJE 3BKJH 4U1SA 3SDYL 1K4CB 3HR5B 5CP3A 2NTSP 2V7NB 1VESA 5KSBB 3FTGA 3JWOC 2UZXB 1Z3GL 5C0AA 4LRIC 1DN2A 3H0TA 2J88L 4P99A 2FECL 3TBYA 4HKZB 1P1ZA 2AJYL 1MY7A 3X13B 4R7DB 5EDXA 5HHMD 3R06A 3EHBC 1QTYT 3E0GA 3C2AL 3RL1A 4CN1A 3MBED 1J12A 3HNTH 3WS3B 3F7RA 2C4FT 4U1SB 3I6KB 2PO6C 4WWID 1KG0A 2FO4B 2GY5A 1WLHA 2YPKB 5HYFA 4MB3A 3NIDF 1VB9A 4P2RB 4Y5XB 1DSFH 2AEPL 4M61A 3EOYG 5ISZB 2NY4B 2PR4H 3GSXB 4G80A 2CDFB 4M3JA 3VU2A 1A9EA 4F33B 3BKMH 1ERNA 3BP4A 4KRPC 5E00A 1DE4A 4P46C 4U3CA 3F65A 4BSWB 2FIKB 3IU4L 1KB9J 4Y4FD 4LEOB 5TPWH 3NACH 2R39A 1EO5A 3OMZA 3MGTB 3NH7L 1G7PB 2E9JA 4JHAL 4KQ3L 4YIQB 2QKIA 5KAQG 1T7WA 3H3PH 3T3PF 3U1SH 2X40A 43CAB 3BP5A 4WO4A 5GGQL 1RIUL 5D7KE 4NDMA 2MNUA 4F37K 1NC2D 5KTEH 2ZWLT 1CLZL 1JMZA 3TO4B 1V7MH 3GHBL 4PB9L 5A40E 4U6HA 3FCTB 2W0FB 2ZUSA 4X6FB 3WHE1 2EDTA 5E8NB 2XN9A 1UB6B 4Y4FB 2GFBB 3SKOA 3UAJC 1KIQB 4IOSD 5DZOA 5ABDE 4NFBA 1CL7L 4YEEA 3LS5H 1YY9D 3QHFL 3JUZA 1DUZB 5F7EL 2WZPD 4QOKA 1CU4H 3ULVC 3IXTB 1CVRA 3GM0A 4F7TA 2IQAB 3SEPA 5ICZA 4PJIE 5KS9A 1CK0L 4K2UL 3QI9B 3KS0J 5C0RH 1R3HA 3X3GH 4B7LA 5I66A 1NCBL 3M1BB 2YS4A 4L9LB 4MQTB 4J4PC 3KYOA 3PNWA 1DBAL 5EUKA 4Q9RH 1KIQA 4JN2A 4RDQG 2VDLH 1IEBB 2FSEA 3P11H 4LHQB 3ROLB 2CLVB 4NCC2 1QHPA 5JOPE 1MQKH 3D18A 4HGWB 3SGEI 1IGTA 3MSPA 2Z31A 2IEPA 4X4YA 2VOTA 4IJ3B 5EO1A 4F2MA 1VPOL 2FEEL 1KPUB 3G5YB 3MRJA 5KTEL 5HI3D 2E6JA 5ANMB 5LGHL 3MGOA 1PVHA 3SCMA 1E6JL 1IGFL 3FN3A 3P0VL 5D2NC 4I18A 4BUGA 2EYRB 4Z7WF 2VQTA 2GTWB 5D1XA 1MCPL 1MRDH 1VSCA 3TPUA 5J9PB 2GI7A 3OKKB 8CGTA 3DMMD 1JNJA 1FLRL 3KPOA 5CEYB 1WEJL 1LE5A 4GOSA 4A6YH 1EEYA 5CBAB 4JFXB 4GUPA 4Y5YB 1A4JB 2ZSWB 4PJXE 4U1HA 4FFVD 5E1HB 3OB0K 1KPUA 2Z35A 3MBXL 5CSGA 5SWSD 2YUZA 1Q8MA 3ES6B 3VXRA 2IFFH 4MAYD 1TZIB 2DLFL 4B0MM 4HWEL 1RI8A 4UILL 4YHOL 3TJHC 2B39A 4LOUC 1HOCB 2ADJA 1UYWL 4Z0BH 1CDIA 3HRZA 4HK0A 3FT3B 3UZEA 5IESL 1UB5B 5CWSB 3BE1H 3G6JF 4ZTPH 5C0DA 2OJZL 1EHXA 1BD2E 3BRGC 2HA1A 4GQPH 3VWJC 3RJDA 1CT8A 3NIGE 4UB0L 3UYRH 1QFHA 1P53A 2Y23A 2DMKA 2IAMA 4JO2H 1ZA3A 5AUMB 4P2OB 4D9RD 3BT2L 5F7NC 4WFHD 1DBJL 2R4RH 4RAHA 1HOCA 4GW1B 3VXSB 3EYFA 3RGVA 1YN7B 4LEOA 1YNLH 4YDJA 3MRCA 1FORL 3SN6N 3T4YB 1IAKB 3KR3H 2ZG1A 3RVXD 1RZKH 1T83C 3RNQA 2AQ2A 4J1UB 1C8PA 1HZHL 1UQSB 5E2VH 1B0WA 1UM5L 1QSED 1JUFB 4P2OD 2W0LA 3MREB 5BZDA 1U8LB 5I1IL 4LIQL 3LEVL 3RWIB 5JW3L 4WO4B 3OKLB 2QQNL 2NX5E 4FN0A 4QXGH 1OT1A 4PRAA 3TP4A 1IBGH 2DKSA 1NMCB 1JFQH 5L9DH 1EGJL 4G6JL 3FB5B 5HXMA 1IEAA 2X4OA 2VLKB 1EEZA 1BIIB 4PJDF 4M3KB 5CP7B 1WBYA 1A3LH 1INDL 2WIIB 3HNVL 4Z7QF 3WFDL 4N9OB 1VA9A 3BIKA 4UB0H 1Q72H 4HPOH 4OB5L 4WGWB 4HX1B 5HHXH 2OSLB 4G8GB 3ZDZE 5FB8B 3SJVB 3GJFA 5KVEL 4KDTC 3F7YB 4NWUL 3O6KH 1MAKA 1K8IA 5D1XD 1EFXA 1F13A 3QJFB 3DVGA 4XXCC 3FO1A 2VL4A 3CSPA 1FNFA 4L8BB 5KSUA 12E8L 3MOBH 4KKLC 4DGIL 3CDGB 5DQJB 3UTTD 5E8OA 5GRXG 2EDBA 5EUOF 2CK0L 5KAQF 1I8KA 1WCBB 4G8EB 4HC1L 4L8CA 4ZXBA 3O2VL 1RQ5A 3C6LB 3RHWF 1BJ8A 2VSCA 1J8HB 4NZJA 4G8GD 4PJCE 1VFAA 4NOFA 4NO0B 4JVWA 2ADIA 1FYTE 1S78D 3LV3B 5EO1B 4F2MB 3DXAE 1IFHH 4ZXBD 1IGFH 4ZS6C 4FQXA 2A9MH 4OLVH 3VH8B 3BEWA 3I6LD 2E7MA 5IP4A 2E6PA 5E2WH 5HHPA 1MEXH 3FKUS 3DHMA 1R3LB 2DLEA 1LO3L 1D5MA 3PHQB 3G08A 1I1YA 4JREC 3WD5L 4XNZB 1CE1H 4UU9A 1H8SA 3N1MC 2F74B 4G43B 3RTQD 3ARGD 1J8HD 5DTFB 5I0DA 4OGZA 4R90H 3RL1B 1H3PL 8FABA 4M8QB 3QFDA 4Y2OA 1EHAA 1PKQA 4U31A 3RIAF 4HFUH 1HYSD 1CGUA 5KS9E 3PQYE 4XI5D 4YAQB 1SEBB 5GGRY 4Q9RL 1NDGA 3I50H 2UWEE 3AXLB 5DS8B 4PG9A 1WZ1H 2HVKB 1U8IA 5B39G 3IFOA 3WCYA 4LQFL 4YDIL 3K74B 3NFSL 4I0PD 1CU4L 3GBMH 3MFGB 4JO2L 4R0LC 4ZO9A 1OAXL 3FONB 2VERN 3LKSA 3ZTNL 1A3RL 1MUJA 1HKLL 3GDBA 3RVUD 4L3AA 1IFHL 4LPUA 1UENA 3DX7B 4FQIH 2G75B 1PBYA 4HCRH 4KJYA 4U6TA 2NY5L 1T83A 3VWJB 3BW9A 1A47A 5D96C 4FXLA 4BYHA 4LK4A 1FVDB 2DQTH 3OF6D 5CJXC 3HI1A 4AQ1B 3VFOA 5JZ7C 1G7QA 2WUCH 4N5UA 3MRIB 4H5SA 1DUYA 2EDLA 1BX2A 1YEDA 4LCCC 4XZUB 3KPMA 1XF2B 2W0FA 1MHCB 4X6FA 1JF1A 2X9XA 3KYNA 1T89A 2OS7A 3QISA 5JW3H 3FQNA 3VXPB 4ELMB 1FGVL 4PJHB 4LP4A 4TUJB 5JQ6L 5F9AC 3WJJA 4OIAA 1CGVA 2NW3B 5BZDB 5EC2A 4QRRE 4M6MH 3BIBX 1GOFA 2VLJE 5E2JA 2YC1A 2AXJA 4WUUD 4NN5B 1IKNC 1FFNA 2I24N 4LRIA 4MLIA 5C9JA 4YHPA 4EN3A 3TA3D 5C0BE 4LHUG 1GPOH 5KSAD 2CIIB 1WZKA 4KROD 5IR1A 1KFAH 3RU8L 1NLDL 2J6EL 3GMMA 4FQ1L 3QDGD 4LCIH 1RUAL 5DYOB 4NKMB 1NGPH 4XVTH 3D18B 4ZFOL 4JLRB 5I8CA 2AQ1A 2IBBA 4LLUA 4WV1A 4FZ8H 3RAJH 3ILQC 4GRMA 4W6YB 2VL5B 3QUYD 1ZEAL 1D5BB 1F58H 3C60B 1K4CA 4MXWL 1JGUL 3ULSA 3RTQA 5GS0C 1U2HA 4RX4D 2V5MA 3SDYH 4RMRA 3KPQA 5KJRL 1P84J 3VFWA 4JKKA 4KAQL 1N3NB 4ODXB 3L5XH 2DLTA 1KC5H 1NAMB 1ZGLP 3O6FA 3PHSA 1CGSH 5FYJU 4ALAH 1BEYH 1CF8L 4NUGL 3ZTJG 4XWOD 2DBLL 1AFVL 3WIHA 1U8NA 4I9WD 4Y5XA 1QLFB 3L7FA 3UEZA 4TULL 2GK2A 4KI5C 1NCWH 2DYPA 3HE6B 1IM9D 2XTJE 3W9EA 2PETA 1YPZA 2EIDA 2FX8L 1CE1L 1OQOA 5CEZE 5EU4B 5HGHB 4MWFA 1E4XI 4YHKL 4Z95H 1CS6A 3BQUC 4JFFE 4NM8L 1CTOA 4UNVA 5C0DB 1BLNA 2X4RA 1EHLH 3S34L 2BCKB 2PW1B 1IT9L 3QIWB 3B6SA 1MF2H 3ESVF 4NQDB 4Z7OF 2JE8A 3TNNA 1RZJC 1OAUH 2XA8L 3O3BB 5C0EB 2XWTA 3TO4D 2VAAA 1TTGA 5D71L 4OLXL 4P3WA 5DK0A 2F54E 5DUBB 3NBNA 5T1MB 2NW2B 3FO0H 3LN4A 3SQOH 1UZ8A 2H3NB 2HJKA 3DV6B 4JCMA 4GW1A 1L9MA 3GM8A 1S9XB 2C9AA 1NL0H 3TO4A 2CO7B 3BP6A 5A3IC 2ZSWA 1I1AA 1RZIB 3QNYB 4KRPB 5DEFA 1BQHB 4K7PY 3EZ8A 3OX8B 1FHGA 2H9GA 4AENB 1OWWA 3MRHB 4NUJA 4X7CC 4XP9H 4ZFOB 3IRPX 4HZLB 5FYKE 43C9B 5I71B 3QI9D 4WTXA 4YPJA 4PJ8B 5T5FL 2ARJA 4BM7A 5IM7B 3HPJA 4JFQB 5C09D 1AC0A 3L1OL 4TOYL 3LPWA 4E9LA 2FD6H 4HK0B 5DD5L 3RRQA 1EUTA 4N5ED 3QIUC 1SEQH 1T1WB 3CZFA 1JHLL 3S36X 1BIIA 1PG7L 4XBPA 1ZMYA 1SJVA 3F5WA 4NN5C 1U91A 5CLTA 4J3WA 3BH9B 1JMXA 4MAUH 2Z91B 4ZUSA 4UTAL 1U36A 2Y06L 5A2LH 1ZHNB 2BZDA 2I5YL 2D7TH 4HZLA 3LRHA 1KCSL 1U8MB 2A77H 2FSEB 3QUYA 2Z92A 4KRPD 1KT2A 4ONOA 2WIMA 1MCQA 3T0ED 4F3FA 2A1WL 3FO9B 1F45A 2VDNL 5E08L 4MA1C 1CICA 2Z8RA 4G9FD 4IDJL 4WEBL 3WIFB 1DL7H 3S97C 3PJSB 1JNNL 2PXYA 3P30L 1RUQL 3ARVA 1RUAH 4OF7A 4D0CB 3I9GL 4L1HA 3QEQA 1XGTA 4XPFL 3N85H 4JPWL 3EYSH 4OF8A 5JR1H 1JPGA 1T2JA 5IV2B 2BHYA 4LRNH 3VFUB 4ZS7L 4U7KA 1EXUB 1SJEA 1EHNA 1J1PL 5SWQA 2FL5B 1UCBL 4MB5A 5F7DB 1FLTX 4EEEA 3V4VH 1XIWC 4YC2B 3H2WA 3QEGL 2C5DC 4HXBH 2CGRL 3O9WC 1PX3A 3NMEA 1RUKH 2VSDA 3EYOA 5DGQA 4P57B 3H9SD 5K9KA 1YEJL 5I74B 1E4XH 4YDKL 2XG4A 2O5YL 3V9FA 4WI7A 1J5OL 1A7NL 1ZLWH 4OCRL 3VA6A 5KJRH 5E6ID 3QFJE 4CMHB 5C1MB 3UAJD 1FGVH 5IMLB 4KZDH 4U05A 3B9VA 3B9KC 2AJXH 4UZGA 1G9NL 3UPCA 2OYPA 3S4SB 1RU9H 1CXFA 5C8JB 32C2B 2FL5A 5F7DA 1P5VA 2QSCH 2IALB 5BQ7A 4HJGA 4GQ9L 1FNGB 4X4XA 3JWOH 4PLKC 4GH7B 1P4BH 3GJEB 3MNWA 4YAQA 3BPOB 3RIFF 3ETBF 4LF3A 2CUIA 3DRTB 1LEGB 3NCJL 5F9JB 3W5MA 2HT4C 4LCIL 5DD3H 3B2VL 1CDYA 3MLTA 5LXGL 2OQJA 5E8PA 5HYIA 4DZBA 3G5ZB 4Z77B 4YDVB 1OTUD 3U7YH 1IC5H 4POZD 2HKHL 4WFGE 5EOCJ 3TGXA 3MV01 5JIIA 3FOLA 1WZ1L 4CADA 5BMFH 3FN0H 5D2LA 3C5ZA 1Q1JL 4S1RL 3TNMB 3AAZB 3DX9B 5DLMH 3VXRB 4OCMC 4R26L 2PTVA 1P9MC 3ROOA 4ODUB 2HFEA 4E41D 4F57H 1HWHB 2EDJA 5FKAB 1RZKL 3SCMC 3UTSB 4JFEA 2VLME 3A6BL 4QWWC 1OP3K 1HSBA 2R1YB 4GBXC 2FIKA 4KVNL 1HILB 3CMOH 5F1NB 1OAYH 2X1XR 5DJCB 4O51A 4CVXA 1OP3H 3FOLB 4RGMC 3ABZA 2ICWA 3L3OB 1AKJD 2R4RL 4IRSD 3SE3C 2D4DA 1U8HB 5DDHA 3RY6C 2ED9A 2R4SL 1KLGB 5EBMB 4YK4C 3TVMC 5E56A 3RBSA 3AS3A 3C2AH 4WFFD 1H5BC 3LOWA 3Q3GB 3FFCD 5D7LD 2GITA 4YK4B 5IBLC 3F7YA 2GCYB 1NMBH 5HBBA 4LNVA 2E9IA 1YQVL 3NFSH 1XCTA 1NGQH 1DR9A 4HIHB 4DN3L 4P3CH 3GBML 3DBXA 4PRBA 2J1KA 2HT2C 5CJOH 5BCAA 3G6JE 4M61B 1AQKH 5CAYB 3GBLA 4IM8A 2R9HD 4F33A 5GRUH 4XMPH 4Y4HC 2RGSA 3E6FA 2OX5A 5D1ZC 4R7NA 2NY2B 1A6TB 4XNYH 4HKJA 4N0UB 3RZCB 2DQCH 1V7NL 1BQHG 4P5KA 4NO5A 2V7HA 3ZL4H 3OKOB 3DURA 5FGCB 5GIRA 1VHPA 2W07A 1MHCA 3NZ8A 1I9RL 2PTTB 3KDMB 5IUSA 4YR6A 5DVNA 2CKBA 4NN6B 3H9YA 5C70A 4LSSL 4P2OC 1MCNA 4WW2F 5IF0B 3QCTL 2P5WE 3JV4B 5E99H 4K94H 2D31A 4KI5E 4HV8A 4F15B 3BDBA 3VXQB 3QQ3A 3ECBA 4HKJB 1IAOA 1AO7E 5KN5B 3RZCA 4GRWE 4NKQB 2C7UA 3GSRB 2VDKL 2GYSA 1U8QA 3R8QA 1NBYA 1I3GH 2J5LC 4XB7A 5DVKA 1U8PB 3O9WD 2AJ3B 3BE1L 1EK3A 1HN1A 1M05A 1KJVB 5DA4A 5I1KL 4QRRD 4Z7VA 3FB7B 4Y2DB 5C07B 1EEUA 3MFFB 1RZGB 5HGHA 1NKRA 3QIBC 3ZDXE 1MFAH 2CR3A 2GSGA 4ZUVB 3R06B 3B9KB 2D9CA 5B4MD 3MLPA 1XAUA 5CBEA 3X14A 4HHAB 3G6DH 1QNZL 3UO1H 1PZUB 3U1SL 2ZSVB 1MRFL 2A6DA 1N0XH 2BJML 2AK1L 1B4JH 2Q86B 3BD4A 1A6AB 4I2XB 3V5KA 5J57B 1NCTA 2APVA 2WQRA 1AXSA 2VZOA 1OM3H 3SE8H 3VD7A 2Q7NA 2NY6D 2XWTB 5F93C 5LGKA 2HH0L 1JWUB 5F70A 5EU6B 1A5FL 1QBAA 4OQTH 4P23D 4KGLA 4PBWD 1AXTL 4ERSH 1WITA 3C08H 3B4NA 1MFDH 4N8VG 4UQ2B 3MJ9A 4OFYD 3NCEB 4BQ9A 3ARDC 1A2YB 1E6OL 2F53E 2V2WA 2VQ1B 1YEIL 2NY3C 3G5YA 4JFEE 2NZIA 2VC2H 3LY6A 1K3IA 3BGAA 3NA9L 2Y36L 4RMWA 5KSAB 4C57C 2HLFD 2CIKA 1SYSB 3OGCA 5DHVH 4LQ1A 1I1CA 4OCWH 4NHUB 2IMNA 1KLUB 3H3PL 2FHCA 4JM2B 4JHWH 5GS1C 1IAII 5SX5K 1JK8A 1IC1A 3GSWB 4AJ0A 5EIQA 3OKMA 1D5XA 5L2KB 1NCNA 1KB5A 4YHIA 3BMVA 5JDJA 1NANH 1R3KB 2ZOLA 4XP1L 1ZT7B 2OP4H 2Y9RT 4XCCL 3BZEA 2NR6C 5MEQA 1BD2D 2VITA 1WVZA 1FE8H 1YA5A 1FG2A 2OMBA 3OAUH 5HJ3B 3A6CH 3NFPB 1FIEA 2OTUA 3MRGB 5GXBB 1SEQL 3BP7A 2WUCL 1XF4A 6FABH 5D7IB 4LARH 1GGCH 2XXMB 3MR9B 4F3FB 4J23A 1RJYB 5SWSE 4C56A 3L95A 3R1GH 1S5IL 3ZT7A 2VDRH 4ORGA 4OQTL 4U1MB 3L3GA 3UZQA 2V17H 1GIGH 3V6OC 2CUMA 5CCKL 1NMAH 2QSTA 1IZJA 1DEDA 3PWPA 4PV9B 2J2ZA 1ACZA 1FL3A 1YDPA 2X1QA 1VACB 3HAEA 2XQBH 4MJ5A 4PRIB 3UTQB 1IM9B 3H6JA 3LEYL 4EUPH 5L8JB 3MNZB 5D2NA 5JPMA 4LSVH 3SDAA 4QNPE 3V6OA 2I9LA 3OKDB 1VFBB 1OP5K 2BXZA 1BBDL 4FQXD 4JZJA 4NQEA 1NFDA 3OZ9H 3QG6A 1F11A 4K8RC 4P2RD 2Y07H 3UTOA 1VGEH 2NY4D 3QDJA 5J6HB 3BXNB 4HH9B 1II4E 4LHJB 4S1RH 3GSUB 3IDJB 1SVZA 4NQED 1UWGH 2FRGP 5DEZA 5BS0B 1J8HA 2XZZA 3D0LB 4XC3L 4PJIA 2ZCKL 2IALA 3HE6C 3VGEA 1IAIM 1NUNB 4AT6A 4AMKL 4WVRA 4X8JB 3BWUC 3SY0B 1C7TA 3O6ML 5FKPA 1YEGL 4H88H 4OAWA 5FO7A 5I30H 1K5NA 4H20H 1FO0H 5HHVH 3MV9E 1IVLA 1PJ9A 4NQCB 4OZHF 2DD8L 4ALAL 5IB1A 5AD0B 3WLBA 2IADB 4KK5D 4MNGA 1LK3H 3HUJA 1KCVL 5SWZD 2A74B 3F58H 3OHXA 3EOAB 3GUTA 1DBBH 3TV3L 2D9QB 4Q0XH 3S88H 5TE4H 3KYMA 3MRJB 4AEIH 5CJQL 2PYEE 4O2FB 1Z9OA 3L7FB 3QH3A 5ID1B 3CFCL 4X99B 3D2UD 2XZAH 4KZDL 1NDGB 3FOMA 4P2OA 5C0ND 4NQCD 4E5XB 4OZGB 4U1JA 3HPJB 5E6ZA 3D25A 5BXFA 4XAKD 3DO7A 4OZ4B 3O4OB 1AXTH 5FYKL 1NAMH 1H8OA 3MJ6A 4UQ2A 4P5TB 4AY0A 1XGYH 2X1PA 5JXAH 2GJ6A 1IL1A 3O3AB 2ENYA 4M7ZB 3DTXA 1ZS8B 3V6FB 4YDIH 4OZGE 5T33H 4DK3A 4NO3A 5D6DA 5CD3A 2DQDH 1J10A 4Y16D 1CFVL 5IW6A 3MLSH 1W0VA 3TBVA 5LQBL 4JB9L 3QRFM 3FOMB 2Z92B 2YKLL 3O11B 3V8CA 4GRLC 1X5XA 2HFFB 1OB1B 1XZ0B 1GZQA 2ENSA 1FJ1B 5JIKA 5EOCH 2AJVL 4LLDB 5HD8D 4GXUM 3EO9L 3QXAA 3SKJH 2Y25A 4TUOA 1RMFH 3WMSA 3S36H 1IKFL 1E4KC 4G5ZL 3DBXB 1ZLVH 1R5IA 2QEJA 3T1WA 4X0KB 3CLFH 5D1QB 1YJDC 3IDUA 4KGJA 1X5YA 4MJ4A 4Y4KC 5ALBL 3SDCD 2LFGA 1CL7I 1QQDB 4KKAD 5AUMA 1AQDB 1UH2A 1F4YL 1DQQB 1BF8A 3E6FB 1E4KA 3DXAA 5SX4H 1KEML 3ULVF 4OFDA 5KVDL 2PUQT 4NBYB 4ELMF 4L29A 4MA7L 4TSBH 4U1MA 2JELL 2V9QA 1S7SB 3HB3D 1E28A 4HK3J 3HMXA 4BZ2H 3F5WB 4JFDE 1OPGL 3BZ4B 4JDTL 1I1AC 4K3DL 4C59B 4X4MA 4MCYB 5F3HA 5K59F 4FFVC 4ZOCA 2QQLL 2OR8A 1HINH 3HLAA 3ZDXF 3QG7H 1RFDL 1P4LB 4JZOB 1F00I 4WI9A 4Y1AD 1S9YA 3VWKA 1CDHA 4JFDB 1MHPH 4OCSL 3OJ2C 2C3VB 1D5BA 2IPTH 3KPTA 4NM4H 2PXYB 5C0BD 4I4WA 4AG4L 4KMQA 3MGTA 5HYJA 2Z31C 3OG4B 4GRWF 3SJVD 4GLRH 1CXKA 4H26A 4R4BB 1IE5A 5J8OA 4RWYH 1FNEA 2BRRL 2QR0B 1I3GL 4UNTA 1ZOXA 4PB9H 3IDXH 1YEKH 2QHRH 3EHBD 3E6HB 5DJ6A 5BV7C 3BDYL 1QR1A 2BFVH 5IVXB 1ORQB 2HRPH 2VLJA 3HR5A 1XR8A 4WNQA 2YUWA 4XX1G 5HTSA 3MJ9L 3RKDC 2IH1B 3WFBL 1Z6JT 2BHZA 4MDIA 1T03H 2B0SH 1A1NB 5D72L 4UBDD 4PJ5E 4HULB 3HUJE 3K81A 1Z9SA 3U9UB 4MNGE 4WU5A 2UV3A 2L0DA 5L0QC 1PZ5A 5HGDA 2P8PA 5T5NF 4GT7A 2ZCLL 1CLOL 4NZDA 4P4KB 3IRZA 3VI4E 3EYUL 3PHOB 3QUZA 3FFDB 1SJXA 3MCLH 1QBML 3QIWA 4Z95L 1FVEB 4ZUUB 1ND0A 3FFCB 4CVZB 5DVOA 3FT4B 5EBWB 4BZ1L 1OF2B 4IOFC 3PV6B 4M93B 3MV9D 5HVHB 4J3TA 3VFVB 2BOCB 5HDLA 1NSNH 5J3HC 5DI8B 3W9DB 5J6GA 4PYGA 5B8CB 1SMOA 2H1PH 3NGBB 1F97A 4XPAL 4OD1L 1CXIA 3E3QE 4P4KD 4Z5RB 2YA2A 4KTDL 4NNPH 4RBPK 5IGXH 3LKOA 4WFEE 2R2BB 3IDXL 3O41B 4FOMA 4I9WE 2QKIB 3F7PC 4ZTOH 1MI5D 2ZCHH 3CFIC 1MFBL 3ARFA 2OM5A 4U7MA 2KUTA 3UBXG 1UA6H 3ZTJH 3U4BL 3IS0X 5ACZB 2FEEI 4Y4KB 4KZEL 4FG6C 5I8OL 3WN5B 1FFRA 4M1CC 2VXUH 4FXKB 5C0FB 2GY7B 3ESUF 3RVTC 3MBXH 5E95B 5ID0A 4LHUD 4H0GA 3DURB 1MJ7H 3T65A 3FHQA 1DBBL 1SVCP 3IDYB 5EU7C 2FYYB 4D9QE 1HWGB 4XBPB 2XA3A 3VI3F 4FNLH 3PGCB 3OGOE 3WXWH 4OCRH 3KDMA 3GMNB 2JIXD 2CDEB 1BFVL 2CKBH 3TNNB 5DD1L 1SYSA 3OGCB 3T08A 3MACH 4U1KA 1DLFH 4MA7H 5T1KD 3BEVB 3MRQB 4NYLA 1G9NC 2HTKC 3O9WB 2EXWC 4HWBH 2Z8SA 5ENWB 2D7OA 4WHDA 5ESAA 3TZVB 2XQBL 1DBJH 5D1ZD 4MLSA 4MVBD 3AS1A 2FO1A 3CPLA 3HC3H 1U8PA 5EZLA 2DQJL 5TDPB 2JIXB 3FQNB 5I1CH 2CDEA 1CTNA 1AGCA 3CLFL 3LPGA 5IEKB 5D5MB 4ZUWA 4OM0H 3LKQA 3TBSA 2DBJA 1HYSC 3HKFA 3KYAA 4GMTL 2XZAL 1V8HA 4O02H 4LLMA 3NCYP 5IBLD 2GTZA 1HHJB 3W81A 5IMOA 1A1OA 1HIML 4YH6A 1QG3A 2V7HB 3ILPB 1FAKT 2Y06H 3MV7B 5F1IB 1EFXB 3QJFA 3GI8H 1G9NH 2AXGA 5JOFA 4L4JA 3NIDE 4RGOL 4PJ9B 4MYWB 2MJWA 5LCVH 1AXSB 1FC2D 2RR3A 3ULUF 3QCVH 4LVNC 2R0WL 2HLAB 3QIUB 5E5MA 5DRXB 2XWBB 3CX5K 1KT2B 3C60D 5IK3B 5D2NB 1DANT 3ULUH 2EDEA 3DIFA 4KJWD 4F9LC 2YD3A 2F53D 4M03A 4X6DF 1HH6B 4JRXD 4LCCA 4RAUB 4HKXA 4NRYA 2WLYA 5GS3A 4R97B 5IVXA 3QXWA 5IKCA 3SDXB 4KUCD 5E9DE 2FH6A 1I3UA 5LVEA 1JPTL 1MFDL 1F11B 2V2XA 4G7VL 1QYGL 5GJTH 4NHUA 2IAMC 4LF3B 4BQCA 1AD9B 5DC9B 1AI1L 2LABA 5FM5M 3HPLA 5IROA 4DEPC 3G5ZA 2P1YA 4Z77A 2VDPH 4G6FB 5D71H 1QPPA 4M6OL 2YD1A 3SE8L 5JW5B 1UWEH 3QWQB 4EDWL 5IVXF 4PJGE 1IL1B 2LAGB 3DI2B 2XTLA 1MJ8H 5F71A 3BI9X 3THML 4DVRH 3LSOA 3EUUA 1C5CH 3V5KB 4HBQA 3ZKXB 3PL6B 5AEAA 1F2QA 1RHFA 4KV5E 2AEQL 2P7TA 2Z8VC 5J6GB 2CD0A 5FGCE 2G9HB 3PQYA 3SDDD 2IBGA 5E2UH 4TSAL 1VFAB 3OAYH 3G5VA 5CD5C 2ZPKL 2VZSA 2R2BA 4Y4FC 5F7FA 2VDQL 3CLEL 4Q97A 1T5WA 4DK6A 2FX8H 4NWTH 2Z93B 4RFEB 2AXFA 2H32B 1A7QL 4PJBB 4UMGA 1UC6A 5EU7E 3U0TA 1KGCE 1PD6A 2MMXA 4NKDA 5E6IA 4AIOA 3JTTB 3E3QC 1IM9A 4OLYL 4R8WL 4JGMA 1I1YB 1GC1L 2I60L 2R4SH 3SDAB 1HHGB 1KB5B 3A6CL 4XVJH 3QRGH 3L5WB 3V2AR 4G6JH 5JHDB 4K07A 5D2LF 1DQJB 3GSQA 1K9TA 1CGXA 1TVHA 2VABB 3X17A 3DTXB 3EOTH 5HYQA 4X6CF 5F3HB 2ZG2A 2YZ1A 1B0RA 4NJAL 2DQCL 4MA3A 2P8MA 3RX5A 2L4OA 3TFKC 4KJQC 4U1NB 4YHNB 3OR7B 5D70L 2E3VA 1CGWA 2P48B 3N50A 2XRAH 3IGAA 2W60B 2Y5EA 3C9NA 4KKLD 3G5XA 4RFNC 1JIBA 4HF5L 3CUPA 2VC2L 4X5WA 1DJSA 1D6VH 2NTFB 4O51B 1GAFL 5E2UL 5TDOA 2HJLA 4QRTB 4ETQB 3RDTC 2ZCKH 4HIIA 4PJ5A 1JP5A 2A83A 5HD8C 4WUKL 2YR3A 4V1DB 5JHDD 3ILQD 3KHOA 4LLVA 1FGNL 3EDDA 4G9FB 4M5YH 1HE7A 4PRPB 3VCLA 3ET9F 3MV11 3F7QA 2OP4L 4XCCH 1XMWA 3C9NB 3HZVA 1LP9E 2X2YA 3GIVA 4GKZB 3QXDA 1Y6MR 3C09C 4HCRA 2H2PD 4V2BA 1S7VA 4RGOH 2ED7A 1IGIL 4MXVF 2I07A 5C2BL 5DC4B 1RAMA 4EJ1C 1J0YA 1DEEB 1LEGA 3T0WA 3H9SB 3OPZL 1RZ7L 2PR4L 3D9AH 5HYEA 3O4LD 5C09B 5I1KH 4QRSA 4MNHB 4HUUA 1LD9B 1NGPL 5HYSA 5HHOE 2C26A 2FB4L 3EYOB 1NGZB 1NH6A 5EULV 4Y19A 2A6DB 1OARL 3SY0A 1U92A 2YEZA 3RI5F 3ULVH 2XXCB 2YD9A 4NHCL 5T3ZH 5I1LB 3P4LA 4I3SH 4JFPB 4NC0B 3U9PL 4GAGL 5IR1B 1XEDA 3ROOB 2VNCA 4R0LB 5C6WH 1I8LC 1U3JA 1T2QH 4G8EA 1CXHA 2AEWA 3OKKA 4L8CB 5GGTL 4MQ7A 3L3HA 4ELKA 5C8JA 5IJVA 1MRCL 2G60L 2YPVL 3DSNA 2X4PB 4HIJB 4HGMA 2FWOB 4TUOB 5I1AB 1DQTA 1HIMH 4RGNC 3RZCC 4C4KO 1LDPL 3BD5A 3L7EB 1KN4H 5HHQA 3QFJD 5E8EB 4JM4L 4KTEL 2PO6D 3MRKA 1YY9C 1CYGA 4ELME 1NC4A 4ZNCD 1RMFL 3GSOA 4XPHH 4ACPA 2VKXA 1G6RA 5HHME 4P2RE 5DRWA 1JI2A 3BP4B 4R2GD 3DV6A 4HEME 5EBGA 3UMTA 2G9HA 4JQVC 4CRPA 1PZ5B 1T04B 2AGJH 4YO0B 5HGDB 5IFAH 4Y4HA 1QLRA 4YNYA 4Z7UA 4C4KT 3QFDB 4P5TA 1B6DA 1MCWM 3O0RL 3CIQA 4UIMB 1ZHLB 4S2SB 4E41B 3B2VH 3HMXH 3LB6D 4X7SL 4OQTA 2H9GB 5CILL