3HS0B

Cobra venom factor (cvf) in complex with human factor b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
233
structure length
233
Chain Sequence
DGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobra venom factor
publication title Insights into complement convertase formation based on the structure of the factor B-cobra venom factor complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 233
sequence length 233
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3hs0B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hs0B02
3QP3A 3IFOB 5HI4D 1AHWB 4G8FB 4RGOL 3H42L 5TJWK 3IU3B 5KS9E 1FNLA 2WP3T 3RVXD 3LEXA 4O2FA 2NY2C 1XCTB 3GSOA 4YPGA 4YWGH 2XQYK 4PJGE 4WTZA 3MLRH 5IUSA 2VB5A 3UBXG 2CO6B 1WC7B 5KVEL 4N5UA 3VFGL 4OLVL 5E6YA 3QFDB 4GKZB 3VWKC 1CG9A 1D5XB 4IOSD 5C0JB 2EO1A 5EOTB 3NPZB 2R2EA 4BFEA 3V4UH 3GJFB 3OGOE 3KYNB 1B9ZA 1JP5A 4RQQB 4Y88A 1RAMA 2VR5A 2EYRB 2Q8BL 4P46D 3RAJL 4RWYL 4M8QA 4Z78A 1A14H 3GMMA 4KK5C 2I9LB 4JZNB 3VD3A 3WD5H 3I02A 4DQOL 2QQNH 2X1WL 4RISH 3G6JB 1MREH 3MRIA 5BOZG 4U6YB 5L2JB 2KQMA 2QQLH 1X6LA 4P2OC 4OKVA 2JIXD 4J3OC 3VXTA 3GHEH 3WEXA 4PG2C 2MNUA 4CKVX 5CJOH 4KJPC 4NQVB 3S9DB 1RU9L 1GGBH 3HE6B 3MV9A 5JIHA 1LO3H 1K3ZA 1W72A 1OAQH 4MNHB 4WI8A 3BWUC 2CRZA 4IEFB 3LKOA 3TO4B 5D6DC 4IRSA 1P5UA 3TPUA 1S9XA 3RY6C 2BNUA 4MCYB 2J8HA 3ZE2E 5IHZB 3ARFB 3EFDL 5EZOL 4YGVB 5DEFB 1RIHH 5GGUB 3P73A 3Q0HA 2VH5H 3FFCD 2R1YA 4LCWA 3QUZD 1YEGH 4YHLL 5LGHH 5JR1H 5ILTH 3V9FA 4G8IB 4O5LL 1IKNC 3SDXF 1ZEAH 2YD6A 1MIEL 5HVHC 1FZMA 2QHLA 1T22B 4XCFH 2KDGA 5GS1B 1YQVL 2HWZL 3WLWC 1YPZA 3WJLC 4H1LH 5EU6A 5CD5C 1FV1A 2H3NB 1DQTA 3RX7A 3HB3C 4U1HA 1FZJB 3QNZA 1RIUL 1INEH 3MRDA 4BFIA 4ZFFA 3NZ8B 5C0ND 3UBXA 4MDJA 5D7IA 5EUOF 1YNLH 1KJVB 4XNZB 1ORQA 2YRPA 4MX7A 1IM9D 5F8RC 3WXWH 5EA0H 2IH3B 1DLHA 5DEZA 2W92A 4HMDA 5DFVC 5HDBF 3V5DA 4OIIH 4KHTL 5D7KE 5E6IC 3SJVD 4S1SL 4QRSB 4XNMB 4MXQC 4LCIL 3SKOA 3KLAA 1R5VA 1R3LB 1IAOB 4P5MB 5E00B 4MS8D 4XMKL 4YBLB 5I73C 5E8DL 5F7FA 3R1GH 1IC5H 4TNVF 2IMNA 4LF3A 4KJYB 3E8UH 5IV2B 3L3JB 3SGDH 1MI5E 3P40A 4Y8DC 1XIWD 4IMLB 1P53A 3K74B 4YUEH 3TO2A 4Z77A 3WKMH 1JRHI 3ZZ1A 1NBVL 1NFIA 3PV6B 1NDGB 3MRGB 1X5LA 1NLBL 3VFSB 4JFDB 5DRXA 1T0NB 4LAJH 3LQAH 5GISL 1Z9SA 1UM4L 3BPOC 4NRXB 3DMMB 3JUYA 2D0HA 4BQBA 4NN6B 3MA7B 5FCUH 1NCWL 2R2BB 4QKXB 1FO0L 4ERSL 1F3RB 1AGEA 4M1GL 4WFHD 3EYSH 4LARL 1IGTB 3MRQB 5D1QC 2Z92B 4PB0L 4XBGB 1XGUA 2IC2A 1J1OL 5IJVB 1U8JB 2EE3A 1FDLH 5FEBA 2ILLA 3MGTB 5CJQH 3VXSD 5E8OB 4MJ5B 3UZQA 5CEYB 4K9EL 4PP2B 4XBPB 3UJJL 4PGEA 1XF5A 4U1LB 3BJLA 3OXSA 3LIZL 1QSZA 2DWEB 4WV1C 5K9OA 4O51A 1NFDE 4ODVL 1QG3A 4AEIL 5GGTA 4YHPB 3IDUA 4YZFE 5LKNA 1FJ1A 3B8YA 1S7XA 2ZPKL 1DUYA 5HGDB 5F7UA 4F57L 1GC1L 1OAYL 1Y6MR 2DQEH 5ID1B 2VLRA 3HG1A 4NQCA 4EVNB 4TVPE 1LDSA 1YY9C 3PGCA 4G8EA 1TJHL 3X3GL 4ONFH 3F12A 5F7DB 2JJUA 4PRDA 1WISA 2MPAH 4X9IA 1YEDA 4QNPE 4LSTH 3U30B 4BZ2L 3CSPA 4BA8A 3AREC 2YHGA 1XFPA 4X6DF 4D3CL 4KKAD 5EORL 1HOCB 1QTYT 2ZCKL 2AGJH 1R3KA 1X6NA 4P46B 1FAIL 4C83B 1MJ8H 3N1PC 4HGMA 4WRLA 5ICXA 1FNEA 5A16A 4YHOH 1BOGA 3SDCD 1T1ZA 3IF1B 1EUTA 4R7DB 1EHLH 1ULVA 5MEND 3I3DA 4MJ4A 3SGDI 1ORSA 4U6XB 4L4JA 4OZIE 1FZKA 3R0NA 4WTWA 5D96B 5HGHA 1MCNA 1K2DB 1KT2B 1HCFX 5D7SL 5C7XH 1DR9A 2C5DC 4NDMA 3O6KL 4F33B 3EJYC 4M1DH 1P84J 3L9RA 1BIIA 4C54A 4HCRA 3BRFA 2W9LA 5FUZH 5GGRY 1I8IB 2VABB 2WBJD 4LBEA 5F6IC 1S7RA 2Y1VA 2FBJH 4KI1A 4KI5E 1KIQA 1OAKL 5CCKL 5H94B 2ADFL 2J7LA 5IKCA 5ACMA 1FG2B 2WIMA 3MGAA 5I1GL 3OKLB 3ZL4L 3IVKB 1NAMH 1BQLL 4JY5H 5KN5A 4H20H 4I0PD 4M8VA 4GW5A 1B6DA 3O0RL 5K9KB 5DC9B 4PJIF 5B4MC 1AO7D 5SWSD 1T03H 3FFDA 5C0CD 1T2QH 35C8H 3DUUA 2UY7A 3FCTA 3KXFD 4DAGH 4XP1L 4HW6A 2FATH 3GSUB 3PDOA 3HR5B 3FQXA 1IGCL 4APQA 5D2LE 5DJCB 1CD1A 1MHCB 5KBNC 2GTZA 1IBGH 2XKNA 3QJFA 1DQLL 3ES6B 5FKPA 3VD9A 3ESVF 1K4DB 3MLRL 4N0CC 4K55A 1CGUA 3QEGH 3MMEB 4XP4H 1IM9B 2AJUH 3HRZB 3RUGA 4U31A 2EIZB 5FYJE 4LGSB 2NW2B 4GRMA 8FABA 1EUUA 3L3IB 4R2GB 4K71B 4IOFD 5IGXL 3OHXB 1UFUA 3ECBB 4OF7A 4M62H 4PJDA 3V4UL 3MRJB 1C7SA 1MFDH 3GSRA 1J11A 1NCCH 5JPMA 3D18A 4GG8A 3QAZB 4BZYA 2CDGB 4PJEF 1NDMA 1OAXH 1WLHA 4MLSA 1UJ3B 2KKQA 3VFUB 3SPVA 3ARUA 2C9AA 3WD5L 4X4XB 3RL2B 1U8HB 2QQNL 4HHAA 4ONOA 4RISL 1MREL 3VFRA 2QQLL 5JIKA 1DUZB 1E4JA 3CZFA 4UT9L 4DEPC 5IMOA 4GS7C 4U0RC 3VXPA 3FOLA 1GGBL 3HPJA 1XIWB 4LCUA 3U0TB 3X3FH 1OAQL 2P4AB 1T80A 4P5KB 3NMEA 2H2PD 1A3RH 1G9MC 1BZ9A 2RAMA 4RNRA 1QNZH 1K3IA 3THMH 2XKSA 4OSUL 4MWFB 5DC4B 5AAMA 5JNYB 4NZTH 3TN0C 1D5IH 4LSVH 4X4ME 5T1DL 3ZMRA 2EKSB 4U49A 4XPAH 5FO7B 2ERJB 2NX5E 2MQ3A 4CUCA 2VH5L 4AEHL 1RZGB 3DRTA 3FQUA 4F9LA 5I1AA 4D8PA 1PQZA 1JCKA 2V2TB 1YEGL 1BEYH 4XB7A 5LGHL 3MJ7B 5JR1L 5ILTL 5E7BA 3G04B 1VEPA 2ESVB 4JFOA 2AXHA 1AXSA 3M17A 4PB9H 3NIGE 4YDJB 4QHLA 1NCDH 1ZEAL 4CMMB 5JOEA 4NIKB 4I4WB 1Y0LA 5CEZH 4XCFL 3T3MF 2GI7A 4OAWB 5I1JH 4GXVL 1D6EA 4F7MA 4L8BB 2V5MA 4DUWA 2IGFH 4HUVA 3RY6A 4LKCA 1T1XA 2VDRH 3QNYA 1S7UA 2G5BA 5A2KH 5T5NG 4YDLB 1G9NH 3WXWL 3OPZH 1DVFC 3DVNA 3BP5A 3WN5A 4EDXA 3BMWA 4UOW0 3B9KA 5I76A 4M61A 3DROA 4OIIL 4UNUA 2J5LC 3FRUA 5EBWA 2HFEA 3TBSA 2Q8AL 2HT2C 4KI5C 2YXMA 3BQUC 3HZYA 4NO0D 3CU1A 5D7LA 1IKNA 2Z9TA 4JG1L 4J23A 3L5IA 3IFPA 4X8JB 2P44B 2Z31D 3S37X 2R1WB 1AI1H 5DURD 4GG6A 3WFBL 4R9HA 1X5FA 4JRWA 2VDLH 4NM4L 4XPBH 2HH0H 2OL3H 2YD8A 3ARTA 2A77H 3HZKB 2YPKA 4GLRI 4OZ4A 4JM2B 5B8CC 4J8RB 4J3WA 3R1GL 1LEKB 5AG8A 5IHBA 3GIZH 3FHQA 4JFHD 4Z76A 4HF5H 3E8UL 1KPRA 5E8NB 1I7UB 2A74A 1WFNA 4FFWD 2NY6D 5MENB 2LTQB 4LLMB 2Z93A 5KSVB 4QOKD 1SYSB 4YUEL 3WKML 4YHYC 3IDJB 3D87B 4JFXA 4Y4FD 2CR3A 5DRWA 3NA4A 5F96H 4AEEA 1NCTA 5D5ME 4HWEH 5CILH 4ELMF 5E6IA 5TGBB 3CDGA 4I8DA 2YA1A 3LQAL 5DMGD 2NYYC 2D03H 4JO2H 1QQDA 1T0PB 2ZUXA 4WNQB 4PRHB 4MJIA 4Z7UF 5FCUL 5I1LB 1JHTA 5DUBB 1R5WB 5H37H 3TH3T 5LCVH 5E95B 1U58B 1MWAH 1NL0H 5GGVY 3EYSL 4LPUA 5IEKB 1PG7W 3GKWH 4EXKA 2YZ8A 1FDLL 3TA3B 2YRLA 4RIRB 4NBZB 4X5LA 1L6ZA 5CJQL 1TPXB 1C5BH 1NMCC 2DJSA 4LLUA 1FSKB 3D69B 4M02A 3MJ8B 4MHHG 4U1SA 2BDNH 5C0CB 1RJCA 5J1SC 4PJGA 2Q1EA 1W8OA 1NFKA 1KULA 5BJTA 5EH1A 3QDAA 4GQ9H 4OUUA 4RMUA 3FO2A 2YUWA 3B2UC 1BFVH 4AIOA 1CE1H 2OS7A 2X70B 4NKIH 2BXYA 4IJ3C 1P7QD 3L7FA 4TYUA 3E6HA 2YPLD 5F7EH 1QSFD 1QHOA 2PN5A 2ZJSH 3I75B 4TQEH 5EN2B 1UB6A 2FZ3B 2DQEL 3RX8A 3SBWA 3G5YB 4QWWC 1C08A 4NWUH 1MH5B 4KV5F 4ONFL 5FYKD 1PEWA 4OZGF 2MPAL 4Y1AD 1YDPB 3MNVA 3CFKA 4LSTL 3ZE1F 3O8XB 2BNQB 3RY4A 2BP3A 4FXGA 3SKMB 1V8HA 1AXIB 3OZ9H 2B1AL 5SV3A 1E0OB 1MJ7H 4OFVA 4QHNA 5FF6B 1MJ8L 4WV1A 1NBYA 4YHOL 2VQTA 5EIVA 4UV7H 1XH3A 2HT3C 1W72H 1XGTA 3VXUB 3O11A 4XXCA 2X1PA 4LLVA 3QJHB 1EBPA 5FOBB 1QFOA 3WNPA 3QHFH 2WSKA 3BISA 3RVWC 1XR9A 1FLRH 1OSPL 3WHE0 1KPVB 3BT2H 5E2UL 2FHCA 5I8EA 5C7XL 5I66B 5EO9A 5F7YC 3D1MC 4JO3H 3NIDF 4WU7A 4M1DL 5E4EC 3TNMB 1KN2H 4HXAH 1T89A 4ZXBB 4AY0A 3O6FB 4F80A 4OI8A 4L4TD 1B2WL 5FUZL 2CDEA 2W0PA 3TLRA 4B0MM 3AREA 5L2KB 3X13A 2R4RH 3LVEA 5BZDB 2V5YA 3QO0A 3BHBB 5T1MB 5C8JB 4RFNC 1AGDB 3P9MB 2IG2H 4LFHG 3R06A 1OP3H 2NY3C 2HA1A 1NAML 2X4NA 4H20L 4F7TB 2ZG3A 4R0LB 3RWDA 3BDBA 4TSAH 5EU5B 1K8DA 4UAOB 5F1NA 1Z0MA 1T03L 2FBOJ 1T2QL 1ZT7B 35C8L 2OM5A 1RD6A 4PJBB 1JZ8A 4CJ0A 1Z3GH 2FATL 2OK0L 1D7FA 5FAAA 1YEIH 4R4BB 2YD2A 5FFLA 1IT9L 1OCWH 3SDXB 3C8KA 4PGCA 4JQXA 3KR3L 1X7QA 1IBGL 1JN6A 4XVSH 4ODWB 4MA8H 4MA1B 1Q9OB 5DSCB 3QEGL 4Y19A 3U7WH 5DTFB 1A0QL 5HHMD 1WEJL 4U1MA 3D5OF 8CGTA 3O6LH 2VLJE 4RGND 4ETQA 1CGVA 3DV6A 3RWGA 2AJUL 2CKBB 3EOAB 2VDOL 2YKLH 3O45A 4N1HB 3UAJD 4LRIA 2GITA 1UADC 4GFTB 4TVSa 2K3TA 1E4KA 4M62L 1MFDL 1SJHB 5CP7A 2LU7A 1D9KC 1NCCL 2Z31B 3V6OE 5JOPD 4YK4C 1JI1A 2FWOA 3FB7B 3VXRD 5IR1B 1OAXL 1WZLA 4I18B 3E2HB 2UVEA 4BSVA 3WE6A 3EO1B 1K4CA 4FQJH 3RJDA 3OBAA 2BJMH 2XFXB 3O4LE 4Z7WA 3F7YA 1I1YA 3QXUA 5LG1A 1AGFB 3O3DB 1RZIA 4LCWD 3QQ4B 1RZFH 5TF0A 2C1PB 3DSFH 3X3FL 1LNUB 4E41A 1JNLH 4QOKB 4YIQB 2UZIH 1A3RL 4PTTB 5HHVH 2QSCH 1S9KC 1A7QH 4MNGE 2I26N 1R0AH 1QNZL 2FO4B 3THML 4FHBD 3PHQA 2X89A 3RDTB 4Y2OA 1D5IL 1A6VH 4LSVL 4S11A 5IW1A 2ATPB 2XPGA 3GMRB 3W9DA 5EU6D 5FGBA 4MZ2A 5FB8A 5F88B 4OD1H 4Y5XB 5CZKA 5SX4H 3SDAC 1BEYL 1KSRA 1AFVH 5C6PB 4X0KA 3D2UB 3HE7B 5IFHH 3VFNB 1NCDL 2ADJA 2V17H 3QZWB 3KS0H 5CEZL 2YWZA 4YXKH 4OT1L 3BGFB 5GGTH 5I1JL 4NZRH 3I6LE 3K2UH 4WUUB 3QA3B 4OFDA 2IGFL 3UBXI 2XZCH 1RK1B 5I8KH 4WVRA 4HUNB 2P5EE 4TN9A 4HDIA 3QUMB 3SQBA 1E27B 4CNIA 3MRBB 2CGRH 1G1CA 2GSGA 3LPFA 1G9NL 3QDGA 3EO0A 3B3IA 3OPZL 1CYGA 5DR5L 1P7QB 5F9WC 4Q6IB 3UTPD 2YPLB 4PJXA 1BBDH 1FVCB 25C8L 4RMSA 2DLTA 4KPHH 1MJJA 4OD2A 3CLFH 3CZJA 1EEZB 3CH1B 3GSNB 2IWGA 3BEVA 3NFPA 2XWBB 1IL1A 4FQPA 3QISA 3T0XA 4DGVH 1AI1L 2EDFA 1VACA 1U2CA 3WNKA 4JDTH 1N64L 2IADB 4Y1AB 1F11B 2P48B 3GMLB 1TMCB 3NH7H 1BWMA 2HH0L 2OL3L 5GS2D 3AS3A 1MNUL 4ZQKA 2DQTH 2NTSP 4F2MB 4OZIA 3LKSB 2RFXB 3H0TB 3LQZB 2FEEI 3OB8A 4X6BB 5SWZB 4RZCA 1OTTD 3GIZL 3AB0B 2AP2A 1QR1B 5IG7A 1A6TB 3OKNA 2NZ9D 2OR7A 1J05B 3QDHA 4JDZA 4PJCE 4I2XB 3G5XA 3HC4H 5ANME 1ACYH 4XXDB 3BO8B 4NGHH 4QLRA 5F1SA 5F96L 4HH8A 4HWEL 3O3AB 5CILL 5M7QA 3BQUA 2BHZA 3CFEB 3IXAA 2GUOB 4PTUB 5CZXD 1RUAH 3WFHB 2HRLA 4J3VA 1J88A 2D03L 4MA3A 4UDUB 3ARGC 3QB7C 4WU5B 4JY4B 4PJ9B 1FFPB 4OBSA 5IESH 1I85C 3RPKA 4FQ2H 3UPRB 3FN0L 3MROA 5IF0B 5LCVL 3VH8G 2DD8H 1JPGA 4XP6H 1MWAL 3MUY1 1NL0L 5SWQB 5SX4I 4BSWA 1HWHB 5IBTH 3GKWL 2OLDA 4EQ2A 3V6OC 1CQYA 3U6RB 1L7IH 4U0QB 1JIBA 1S9VB 3M8OH 5J1AB 1CI5A 5EZJA 1GOHA 1IEBA 3PL6B 4GRLC 5CSZB 4JQIH 2WP3O 3RQ3A 1C5BL 2VLRD 5E5MB 2BDNL 2CLZB 1A6AA 4KK9D 4Z0BL 5EUOE 3ZSSA 4HKBA 1C5DA 3SDDB 2E5EA 4H5SB 3NCEB 4L4VB 4N0FA 4FN0A 4GQ9L 1D5ZB 1F42A 1OPGH 5HDBE 3N1MC 4DUVA 4NWTH 2VAAA 1BFVL 2CRIA 2YC1B 1DJSA 3MBED 1CE1L 1RMFH 1UZ6E 3D39E 4NKIL 3HZMA 2XNAB 4KKLD 1BOYA 1LE5A 4P3WA 1EEUA 2WK2A 4PRPA 3WIHA 2ZJSL 4TQEL 4BKLA 2O61A 5MEOA 5HHMB 2GCYB 2J4WH 4YAQB 5KSBB 2OR8A 5GRUL 1X5JA 5GS0C 3U82B 4NWUL 3FQRB 4ZFGH 1H9VA 5DK2A 5GJSL 4DGIH 4E42A 4MDIA 3SE4A 2BVYA 2XV6B 1CD9B 2BVOA 2PYEB 1NGYA 1U8QB 2CK0H 4OZFB 4HD9A 4P2RE 1AGBB 4V1DE 1FN4A 1T20A 2BC4B 1NAKH 1IC4H 4KXZH 3CU7A 2Y36H 1MJ7L 1F13A 3VXRB 5I75C 4UV7L 3QXVA 3MLSH 2ARJB 1AKJA 1W72L 3MR9A 5DXWA 4M7ZC 1NSNL 3G6AA 4Z7VE 2VZUA 1OY3B 3KVQA 1I8KB 3QHFL 4M6AA 1M71A 1TZIB 4HT1H 1FLRL 2FRGP 5JXEC 4F7PB 1G7QA 3BT2L 3GB7B 3IETB 1LEIA 4JO3L 1YMMA 5JPNA 4HXAL 3TFKD 1IGFL 1PKOA 2Z35A 3KPNA 3HC3H 4BFBD 3L3GA 2IBZX 1RK0A 4GAYB 3BRDA 2R4RL 4NO3A 2NW3B 3VH8A 1QFWM 1EO8H 3BYTA 3RWFB 4MXVF 2IG2L 1OP3K 2HRPH 1J8HB 1UQSA 3V0WL 1VPOH 3SGJA 4LIQH 3BP7B 3M1BA 1KCRH 4TSAL 2HTLD 4PJ7F 2F19H 1U3HB 5ACLA 1BMGA 4NQED 1TQBB 5HPOA 4JHBA 1FC2D 4M7LT 4ZOEA 1HH6A 2VXQH 4OM0H 1H3PL 3TIDA 3T77B 1Z3GL 2FSEB 3TV3H 1YEIL 4ZUSB 4PREA 4KC3B 1HHIA 3DI3B 1DN0A 1OCWL 5LAXB 2AK4A 2HKHH 1JV5B 4XVSL 1CDUA 4MA8L 2OTUA 1A4KB 1WCBB 5HDOA 3U7WL 1QYGL 2OSLB 1EFQA 4K3GA 4OKDA 4HAFA 2BZDA 3U7AA 3SQOH 2LABA 1FBIH 1S7SA 1MPAL 4X6DE 5ERWA 5E9DA 3O6MH 4W4NA 3ULUD 3VW3H 4K3EH 2YKLL 3WJJC 1SJEB 4P5TB 5C0IA 1MCKA 3ZKND 3S8WA 3L1OH 3C5JB 3OSKA 5DHXB 1WBYB 2O5ZH 3VDCA 3B8SA 5BCAA 5IHUH 1BD2D 4HJ0D 1A3LL 4A2MA 2H1PH 1HCVA 1A7OH 1JWSB 1RIVL 2R2CA 2Z91A 3UDWC 5IQ7H 5FM4A 3BZDA 1CD0A 3DO7B 3PWLB 4AM0B 2EIBA 1RV6X 5KG9A 2FEEL 1H5BB 4FQJL 5LGKA 4ZUWB 5T3XD 2BJML 2J3SA 1KYOK 4RAVA 4NKOB 1IGMH 4L3CB 4JAMA 2W60B 5D72L 3T8XB 5I1DB 2FR4A 4AH2B 5F3HA 4UBDD 3RZCC 1CFSB 1UH4A 1RZFL 2X9XA 3RGVB 2Q76A 2NLJA 4HV8B 1JNLL 2GJ6E 1GGIH 3QNXB 4J7RA 4M00A 2UZIL 5HHVL 1NGQL 2QSCL 1A7QL 1UWXH 1R0AL 3T2PA 2VXTH 1INDH 2K1MA 2BHYA 1DQJA 1TLKA 3CFJA 3I6KA 2IPKA 5E1HB 5I30L 5K93A 1A6VL 1XF3A 3KLDA 5ENWA 3DHMA 1AJ7H 1AGCA 4PJ8B 3VJ6A 4OD1L 4PJIE 2CDFB 4JFEE 1MAJA 1WCQA 4AIXA 4NT6A 4ODUB 1KB5A 1BVLA 4X5XA 2CPCA 4AIZB 5FKAA 5IVXA 2QL1A 1QD0A 1AFVL 4WWKD 2F53E 1WBZB 4U6HB 3RWCA 3QG6A 4DGYH 5IFHL 1T21A 4Z7UB 1PG7X 5J8OA 3GSQB 5HTSA 2Y06H 3B9KD 5AAWA 1A9BA 4YXKL 1C1EL 2ZG1A 3CC5A 2OMNA 3OJDA 5GGTL 1TIUA 4JM4H 4NZRL 3K2UL 4DKEH 4HS6B 3V8OA 2R0WH 4E0RB 1K8IB 5GRJH 3LHPH 4YEEA 5I8KL 4UOW1 1LO5A 4HUXB 1WBXB 4JN2A 4MD0B 5JO5B 2ICWI 3TVMB 3LSOB 3QO1B 3MBEB 5GSVB 43CAA 3KPRE 4N0UE 3O3BB 4N8VG 3WO4B 2R2HA 1AP2B 1BBDL 4LKXA 4PD4K 5DRZA 4KPHL 4PJEE 4W70A 5D1ZB 5JOFA 4R97B 1H15B 3OKDA 2RHEA 3WSQH 2A6DA 1ZLUK 2A73A 4G8GD 2DF3A 5C2BL 1HN1A 4FTVE 4Y4HD 2FGZA 2XWJA 3L3HB 4K23L 4P48A 3RNKA 2J8UF 1F02I 1W0VB 4L8DB 5MEPB 1DDHA 2FL5B 5CBAA 1IAIH 5L6YL 3VU2A 2W65B 2DQTL 1P7KB 1MFNA 3T0DA 5C3LD 5EZIL 1T7XA 2YD7A 4OZGB 1BVKB 2EECA 3TZVD 1SJXA 2WBWB 5F9DC 2APFA 3HC4L 4HCRL 1ACYL 3O9WC 3OX8B 4NGHL 3AAZA 4DK6A 2X4PB 3KNBB 3MFFA 2IH1B 4X7TA 2BMKB 1T5WA 4JRXA 2B39A 1RUAL 4M03A 5K59F 3C09C 2YRZA 4WCYL 1VSCA 2P8MB 4XP5H 1U8IA 5ETUB 4N0RA 5IESL 1NGZA 4FQ2L 3MREA 2IQAB 3QPQD 3B6SA 4O02H 2XKUA 2DD8L 4KHXH 4X7FC 3T3ME 2OR9H 4XP6L 5A43C 4Y5VA 4JGUA 4U1GC 2NXZD 5IBTL 1TETH 1N4XH 1JGEB 3M8OL 2NY7H 4KWUA 2BSSB 3K4ZA 3CH8A 1V05A 4I3SH 4JQIL 1SYVA 1UA6H 2DL9A 5CZVH 2FJFB 1LWRA 4NQEB 4CN4A 5I2IB 4KFZC 4HJGB 3LD8B 2LAAA 3V6ZB 2OYPA 3H7BB 3ZYIA 1A21A 3JTSB 5IOPA 3PWPA 5ITBH 1OPGL 5FA4B 3QUYC 3REWA 1HYSD 3ARGA 3HNSH 1UH3A 2D7PA 1I85A 1RMFL 4S1DD 2P8PB 1T3FA 5BXFB 1D6VH 4N8VA 3MRCA 4LEOB 3TCXA 5C1MB 2HT4D 4Z8FH 3ZDZF 2J4WL 3QDMB 1NGWB 1N2RA 2ZSWB 4JVPA 2VOTA 3D3VB 2E6PA 1AR2A 4ZFGL 4DGIL 5EBLA 2R1XB 1MEXH 3STZB 3D0VB 1DTUA 5F7NC 3X12B 3RVUD 2FO1A 2GAZB 1I3GH 2DLGA 4ENEC 2HLAA 4X6CA 3H2WA 3VXQB 3O4LA 1NAKL 5IMLB 1IC4L 2NNAA 5J11C 1FL5A 4WFED 5C71A 3ULUL 2Y36L 4D9RE 1HDMA 3WHE1 4OQ1A 1MFEH 3QCVH 4NPYA 1QBMH 3MLSL 3AU1B 2B5IC 3L7EA 4ELME 1TCMA 4WEBH 4G7VH 4PLKC 1JNNH 4Q9QH 3MA9H 5A3IC 4HT1L 2NQCA 4DKDC 2A2QT 3G5VB 1F3DH 5DJ2A 1EJ6A 3E3QE 3BEWB 4HUKB 5CGYD 1H3WM 2Z0BA 4CMHC 1MIMH 1NQBA 4JJ5B 5IW6B 3VFOB 5F93C 5C92A 3EYFB 4Z7QF 5IK3A 4G80B 3GJEB 3HC3L 3IDYC 1SVCP 3IJHA 5F1KC 4F7CB 1Z2KA 2X4SA 2V7NB 1FZOA 1NCAH 1YMHA 4MHHI 3FMGH 3AM8C 3FT2B 3SCMC 3U4EA 3H7LA 1G9MH 4Y19D 3FT3A 2PXYC 4POUB 4LIQL 4JKWA 4WWKB 1KCRL 4YFLF 2JCCE 4PGBA 2AJ3B 1VKXA 1IE5A 4JO4H 2ZKHH 2F19L 4JFFD 4EDWH 4HKJA 3ZT7A 2BSRA 4IRJC 4D9QD 4I1NB 2P5EA 2UWEF 3S37H 2R4SH 2VXQL 2NXYC 3NCYS 1SBBA 4OM0L 1KPUB 3SE9H 3GI8H 1CLOH 2ICWB 3TV3L 4QRTB 3MX0A 3BESR 2FX7H 1A5FH 2IALB 4QTIL 1FPTL 5HY9A 1A9EA 2KL6A 4NM8H 2HKHL 3QFJE 1QA9A 4KJQC 5EUKA 4WW2A 3X11A 1QLFB 1BZ7A 3QUKA 2I9TB 2J1KA 4EI6A 2IQ9H 1FE8H 3DETC 3Q3GA 4QCIA 5HJ3A 3U48A 1FFQA 3SQOL 4S0SD 4FABH 1FBIL 3MV7E 4AENA 3D0LB 4G9FD 4YBQD 5ID0B 3U79A 5D7JA 3QIWA 3O2WH 3VFVB 1J12A 1FHGA 3L6FB 1FVDA 2DAVA 4GBXA 3L1OL 2IMMA 4LMQE 5A2FA 2O5ZL 2EZ0D 4ZPTB 1EZVX 2NPLX 5FHAL 5IHUL 3GSVA 3WDHA 4E41D 4G8GB 2H1PL 1A7OL 3FZUC 4Y4HB 5EC2B 5IQ7L 4TRPH 1F3JB 3L3KB 1EPFA 1SEBA 3NCJH 2Y6SC 5DT1L 4K7FB 2G75B 2X89D 3EDFA 3MCKA 5ANMA 3KAAA 4IRZH 2VRAA 4UINH 4QRPE 1DLFL 2I27N 4PJHA 4PV9A 1PKQB 1BZQK 1IGML 4UTBL 3MV01 1YYMH 2WQRA 4AJ0A 3CVHB 5I1HL 4LFHD 4LNRA 1U6AH 3TZVB 4Y4KB 1S3KL 2K7PA 2IANB 1F90H 2VITB 2EXYC 3MRHA 4ODBD 4PGDA 3SY0A 1W0YT 3WS3B 3ALPA 3GMPB 3K80A 3FOMB 3UCRA 1I9EA 2HLFC 3WJJA 1UWXK 2CIKA 3WNLA 1J0JA 5GRZA 2VXTL 2WWMC 1INDL 3MTRA 1P4LB 2DIBA 3BZFA 3JV5A 3ROOB 1XGPB 3MLWH 3C6LA 3UDWA 4HKZA 2H2SD 4NQXA 4RA3A 5ISZB 4XNUL 1JTPA 1FFNB 4HWBA 3OTTA 5FO8A 2PTTB 1DEDA 4N90E 4C56A 5IB3A 1DBKH 2ICWJ 1C16B 1AIFB 1MELA 4DGYL 1T66C 3QDGD 3NCYP 4NQSA 3B5TA 1YPZF 4JR9H 1YUHA 1JYWA 4JZJA 2BX5A 4UZGA 4MVBD 2X4UB 1S7TB 1PY4A 4JM4L 4ODXB 3V5HA 1LK3H 1A1NB 5GRJL 3LHPL 5E5UB 4PY7B 3MV8D 3HE6C 3WIHH 5D7IF 1MAMH 4X9HA 32C2A 4XT1C 4J1UA 1FRGH 1ZHKA 4EN3B 3GSXA 2FECI 5DJDB 1BJ1J 5INDA 1I8LC 3TO4C 4H0IA 3CD4A 4JJHA 5GJTL 1YY8B 5T33H 4P2RA 5JLZA 3WFCH 5BS0D 1ZVSB 1FH5H 5GGRB 3WSQL 5IT2H 4TULH 3KWWA 3MLTB 5CJ5A 2FDBP 4YPJA 3DV4B 2ZUTA 4XCNB 3HC0B 1YEKH 2GT9B 5BRZB 3AXLA 3MNZA 4MLIA 3H3PH 3QRGL 1A1MA 5MERB 3CLEH 3V0VB 2MFNA 4ZG1A 3KPOB 4Z5RA 1Q0YH 5AYQA 5C08B 5EPMB 2ZCLH 1BHGA 3LS5L 4HH9B 1YNTB 5HI3D 2H26B 5HGGS 3ZKSD 1EXUB 3RY5A 4HIHA 5FGCE 4K8RD 2DLFH 3PIQA 5JZ7C 1QEWB 3ARPA 3CDCA 4MQSB 2Y7QB 3PP3H 3Q6GL 5CMAB 4OQTH 3BUYA 3ZDYF 2E7CA 4LLYB 3MXVH 2GQHA 4KHXL 2OR9L 3GBMH 2FD6H 3N0PB 2Z4QA 3FFCE 3TJEH 1EEYB 1NMBH 1TETL 3PDGA 4OZHA 3KYOA 4M6NH 1JWUA 1N4XL 3VMNA 1ZMYA 2NY7L 3OKMA 4PRPD 2JK5B 1H0DB 5IHLB 5F72S 4J3UA 4I3SL 4P57B 3N1QC 4NZUH 4JO1H 3EW3B 3QHZH 1UA6L 5JHDA 4JFFB 1ZS8A 5CZVL 1RZ7H 2W59A 3BKMH 4OUOA 5KSAD 1JF5A 4NYLB 2VC2L 1EBAA 2RB8A 2WUBH 4UDTB 2VERN 4N68A 1KLUA 5ITBL 5J6HB 3EJZC 4PBXA 5D2NB 3FTGA 3IDMB 1HSBB 2IAMB 4J3TA 3HNSL 1MCSA 1RJLB 2VWEE 3Q5TA 1BJ8A 1IGJA 1YJDL 2H9GB 1D6VL 5IB2A 1I1FA 2IBBA 2NY0C 1MCWM 2IPUG 2HFGH 4Z8FL 4JRYA 1AKJD 3ILPA 4QTHA 3I6GB 1LP9E 1EK3A 1S5IH 2QADD 4G9FB 2HVKA 4P3DA 1MEXL 3BFOA 3EYQD 2G9HB 4RFEA 3SJVE 1OOAA 2BSTA 2N7AA 1M7DB 1I3GL 1YQ2A 5IBLC 1YMMD 4LHUB 1OSZA 2ARJQ 4WEUD 1MFEL 3QCVL 2W38A 4MNQD 4QHMA 4WEBL 4G7VL 2F5BL 4M9PA 1JNNL 3MZTA 4Q9QL 1X5IA 1IJ9A 5GGQH 2HFFB 4DOHE 5JW5A 2AJYL 2XICA 5ITFB 1WUNT 1MCPH 4GKSA 3STLB 3RZWA 2C3VA 4ISVB 1GC1C 1Q9KB 2YBRB 1S9WB 2BY3A 3GMQA 3FL7A 4H25B 2X10A 1JBJA 3L5WA 3TM6A 3RVXC 3BGAA 4AEFA 1ZWIB 1T6WA 5CSGA 2F54E 1U3ZA 1KB5H 3PWJB 1I3RA 2HJFB 1JHKH 2OI9B 5MEQA 2OX5A 3G08A 4IBLT 5F7KC 4QGYA 1NCAL 2XG5A 2AK4D 3SGEI 5EBMB 5LVEA 3FMGL 3S5LG 1FNSH 4XTRD 3KJ4C 4WFHE 3ZLQC 3O41A 5F44A 3CGTA 3L3OA 1G9ML 1MRFH 1I8MB 2D7NA 5IB1A 1WZ1H 4P46C 1FVEA 4QXTA 4JO4L 2ZKHL 4EDWL 1KJ2B 1OD9A 2P5WB 4X99B 2WLYA 4MMXC 1ZHBA 3S37L 3B9EA 5C0GA 3VXSE 3WNOA 4HG4J 2ITCB 3GI8L 4L3AA 5IBUB 1CLOL 2IF7A 1PLGL 1AQDA 2FX7L 1A5FL 2V9QA 3KPQA 1KCSH 3N1FC 4QF1B 1N7ML 1ZGLA 2VYRE 3OF6A 1MCHA 4NM8L 5L8KB 1NC4A 3IJSB 4NRZA 1OP5H 4OI9A 1O7VA 5D93B 4L29A 4TUKH 1CE6A 1SJVA 5B22A 3ARVA 3RUGF 2IQ9L 1FE8L 1RVFL 2WANA 3PXJA 3LN4A 3OWEA 1H8SA 4FABL 4PJDF 1MHHA 3SCMA 3O2WL 4LPWA 1H8NA 5HHPB 4FQQA 5DGQA 4KQ3H 5BS0B 3TBVA 3DXAB 1DBBH 4XHJD 5J13B 5DJAA 1I7TA 1DE4A 5HYFA 4Y2DD 1S9YA 2AABL 3QUZC 1QO3B 5IMMB 3NCJL 4WO4B 1B0RB 3INUH 3N9GH 1RULH 3DURA 4KK8D 5J89A 1IC7L 4NSKA 2LU3A 4P4RA 1OGAA 1QLEH 3P9LB 1YYML 1U6AL 5MENE 5HPMB 4DVBA 4NO2A 3C9NA 2VDKH 5E70A 3M45A 4DTGL 5J6GA 3WUWB 5TDOA 4JPIB 2VWEC 3CSBA 4XZUA 5EFIB 4JFYA 4GMSH 4MXVE 3OKEA 5C0NC 3OKKB 1JNHB 1RZ8A 3MRNA 3MLWL 2KPNA 5D8JL 1G6VK 4IS6B 4NNYB 3IFLH 2P46B 1WIUA 4NRYA 1JPFB 1EDQA 1KTLB 3CCHB 3IAQA 1XF2A 4LRNH 3S5LA 2HMID 4YC2B 4EI5B 1W2KT 1SY6A 2VDNL 1CLZL 4K8RL 5C0FB 2J88H 4PJFB 1DBKL 3ORJA 5E2TH 2BNRA 2VL5B 4HC1H 4I3RL 1TITA 3QAZC 4TTDD 2GKIA 3IFOA 1AHWA 1EFXB 1GGCH 4G8FA 3QUXD 3IU3A 4MS8C 1AO7E 5SWSE 1KG0B 1TZGH 5C0CE 1XCTA 5DD3L 4FXLA 3KXFE 3DUSB 5KSAB 3T0EE 4AG4H 2EXWD 3WIHL 1XIWC 1WC7A 1ZHLB 3PGDB 1MAML 3ZHLA 4XX1E 5AYUL 5EO0B 2J8OA 1FRGL 3QFDA 4GKZA 1PX4A 1D5XA 4AQOA 1KUMA 5C0JA 2BVUA 4G6KH 5EOTA 4DKFH 2A6IB 1FYTB 2AK1H 3KYNA 4RQQA 2R0ZH 3TBWB 4KRPD 1HI6B 2YK1L 1WITA 5EC1B 5T33L 3H3KA 3AS1A 2V2XB 2AEWA 2EYRA 3CVIH 1FH5L 2APVA 2QBWA 4CVWA 4GG6F 2ERJC 5IT2L 2I9LA 3OJMB 4JZNA 2QADB 3KYKH 4CJ1A 2HTKD 1KV3A 1SQ2N 3GKZA 5L2JA 3G6JA 1CFQB 1KTRL 4U6YA 5L88H 1CL7I 4JRXD 43C9B 3CK0L 4R3SB 3H3PL 4HJJH 5CLWA 4NQVA 5I6XB 4YO0B 3HE6A 3T08A 1UCTA 4MNHA 5TDNB 4MNQB 1CCZA 2RJMA 2SEBA 4KROB 2CLVB 4Z7OF 1Q0YL 3TO4A 1AQKH 3RJQB 1TZHB 4MCYA 4GQPH 5IHZA 3ARFA 4ZS6D 3K2MC 1X5YA 3O4OC 1N8ZB 3AY4A 4YGVA 5DEFA 3T1FB 4MXWH 5GGUA 4XVUD 2XACC 4YDLC 1CK0H 4M93B 2C26A 4PRIB 1YYLH 3DGGB 1IC1A 4GAJL 3ZTNH 2DLFL 5L8LB 3IKKA 3PP3K 5D9SB 1U8KB 1OD7A 3D25B 3EFFB 2JJWA 4G8IA 3PWPD 4GSDH 4ONGL 3MXVL 1WICA 1ES0B 3MRFB 2X1XR 2FD6L 4ALAH 1T22A 1NMBL 5GS1A 1M05B 4M6NL 4M43H 4L8SC 7FABH 4LVNC 3AMLA 2H3NA 1ZOXA 4K07A 1YEFH 4KKAC 4NNXB 4PJGF 3EGSB 1FZJA 4NZUL 3A6CH 4JO1L 4HUMB 4FP8H 2E9WA 3QHZL 1UKSA 1UKTA 2EDXA 1LDPH 4PJBE 1RZ7L 3WL9B 2GY5A 3BKML 3NZ8A 3SDCC 3TWCL 4OFYA 2WUBL 5DYOB 1I1AD 3IDGB 1KJVA 2FGWH 5EO1B 2V9TA 1VA9A 4WDIB 1UENA 2AW2A 4MAYB 1CFNB 2IH3A 3LQAC 1KJMB 4Q6YA 3TT3H 3NPSC 1BFOB 2UWEB 1V3MA 3PQYB 1JGDB 5ACZB 3JWOC 2EDNA 3OAUL 5H2BB 4QRSA 5B38B 4XNMA 5IROC 2CQVA 2HFGL 1S5HB 2MCG1 2FX9H 4O2FB 4Q2ZB 4HGWB 4PS4H 4DJMA 3RIAK 2J8UE 2LU4A 1QSED 1WT5A 1R3JB 1R3LA 3MRMB 3LS4H 1I3UA 2WBJC 1PEZA 1IAOA 1S5IL 4TSBH 4P5MA 5E00A 5LQBH 5HYQB 4ZOBA 4NCDA 5HHNB 4KJYA 5IV2A 2AJSH 3L3JA 3BKCH 2NMSA 1UYWH 4Y2DB 2IJ0C 4WY7H 4IMLA 1F2XK 4I0PC 3QDJD 3TNNB 2BOCB 3H9SB 2FHFA 1NDGA 3MRGA 4JFHE 1TTFA 3JTTB 1CXFA 3BW9B 4ZAKD 1MCIA 4JFDA 3VFSA 1T0NA 1U2HA 4P2QB 1S7QB 3HI1B 4C59B 3FO0H 3T0EC 1PG7H 3ZSTA 4NRXA 3DMMA 5I74B 4HUWB 5T3ZH 2N1KA 4HX1B 5I18L 3QEHB 1MVUB 2R2BA 3QIBD 5ADOH 4HWBH 4WI5A 1KB5L 4KKBD 1D3CA 1IGTA 2DQDH 2R56L 3GRWH 3MRQA 1JHKL 2Z92A 5HXMA 4XBGA 5IJVA 2ZG2A 1U8JA 5FECB 4L1HA 4NO5B 3MGTA 5TE7H 5E8OA 4MJ5A 4IOFC 4V2BA 4XGZB 5CEYA 4PP2A 1KJ3H 3P73B 4XBPA 1L7TH 1MRFL 5M95B 2B1HH 4KMLB 4U1LA 4U1NB 1FGVH 4JFQB 2X09A 5FO9B 3QUXB 5D7JD 3QIWD 4YHPA 3B5GA 4GBXD 1C8PA 2QLVB 3DTXB 1HEZB 2JF1A 2VL4A 1VADB 1K6QL 4XMLH 3ZDZE 1ZHNB 1KCSL 1WWBX 4U6VH 5HGDA 3FO1B 4YJZL 1JZ4A 3IB4A 1LVEA 4DVRL 5ID1A 4QYOB 4G43B 4TUKL 4EVNA 2H2PC 4IIQC 5F7DA 3QNZB 2PO6B 3MRDB 2YPLE 5DA0B 1QSFE 2BRRH 3QWRD 4LOUD 4K7PY 1DZBA 1FCGA 3MJ6A 5C07D 5JHLH 1HOCA 2LAGB 3I50L 1DBBL 4P46A 4PGZA 3F65A 4C83A 3BAEH 4QRRD 1QPPA 5KVFH 3ESUF 1JGLL 4B5EA 3ARBB 3IF1A 4XBEH 4RAUB 1B0WA 1F5WA 4FS0A 4R7DA 1CL7L 3VMOA 4LVHB 3BP4B 4L3ED 3INUL 4R0LC 4U6XA 4Z7WF 1RULL 3T4AB 5DZNA 5T3ZD 1K2DA 1KT2A 3C6LD 2G2RB 4HZLB 1QLEL 3WXVL 4F33A 1DFBH 4LSUH 4Y16D 4NKDB 4YLQT 5HHQB 4P9HL 4NQDB 1BBJB 4C56D 4NBXB 1I8IA 2VABA 4HK3N 3T2NH 2R9HD 1YN7B 5H94A 3IU4H 4GMSL 1WVZA 2CJUL 1FG2A 4GRWH 4L4TE 4RX4D 5CBEB 3OKLA 2DM3A 3IFLL 3IVKA 1F4WL 5CIPB 5E0QA 4UU9B 5K9KA 4NOBA 2YD4A 4OLUH 1DSFH 5LJYH 4LSSH 5IQ9B 3OXRB 1WAAA 1QRNB 2ZNWA 2J88L 2Z31C 3MLZH 2AJXH 1RUPH 2V6HA 4PJAB 1J0ZA 5GGSY 4HPOH 3GSUA 1FFRA 3EYOB 3HR5A 3VG0H 1GGCL 4FXKB 4D9LH 3E2HC 5DJCA 1J9CT 1MHCA 3ARDB 4KMTH 1TZGL 1RPQA 3ES6A 1JK8B 4HLJA 4OTXH 1K4DA 5ESQB 4AG4L 1I1AB 2X1OA 4FFWC 2NY6C 1IM9A 5L0QB 2AQ1A 4LQ1A 3HRZA 2EIZA 2NW2A 1ZLWH 4DCQB 1XZ0B 5IIEB 1WTGT 3B9VA 4Y4FC 5EOCH 3L3IA 2LV4A 4U7SA 4DKFL 3OHXA 4QNPF 3ECBA 3MRJA 2R0ZL 1WK0A 1X4ZA 5HHME 5DHYB 3MSPA 4RGNE 5DMGC 1LILA 1X5KA 4X7EC 2Y9RT 3CVIL 3KLHD 2A83B 1QSEB 4QGTA 2XN9D 2CDGA 3NCFB 4Y5XC 3BN9D 1HQRB 1UJ3A 4LGPB 3KYKL 4ZUUB 3VFUA 2ADIB 3QIUB 4X4XA 4WI2A 1U8HA 3MV9E 3CX2A 2YMXH 3IKCB 2IPTH 4OZIF 3IRPX 5L88L 1DUZA 1VFBB 3S3PA 5JOPE 2VLKD 1EAJA 1JTOA 4PIRF 1UACH 3VXRE 4LU5H 3OKYA 4HJJL 3BI9X 3X14B 1XIWA 2NY4B 3U0TA 3W0WD 1CDHA 4UNTA 3HB3D 4N8CH 4P5KA 1M6OB 2EDLA 3MUZ1 3BGFC 3QDJB 1TFHA 4OCYH 4PY8I 1B4JH 4PBWD 4HS8L 4XPFH 2H8PB 4KI5F 4ZAKB 4MWFA 5J0BA 5LWYH 4NOFA 4LCWE 5JNYA 5ABDE 1F58L 2EKSA 3IDIB 1QACA 1UVQB 1LEGB 5FO7A 4MXWL 3WS6C 1CK0L 1RZGA 3ZTNL 1RI8A 2ADGB 1G0DA 3I84A 3QIBB 2V2TA 1YECH 1WWAX 3H8NA 3MJ7A 3G04A 4OLXL 2ESVA 1YPZE 4GSDL 4YDJA 2FH6A 5EU6E 2ZCHL 3H9YA 4CMMA 2BOBB 4I4WA 4ALAL 4OAWA 5I0ZA 1ZA3B 4M43L 3ET9F 7FABL 4NKQB 5D2LF 3FB5B 4L8BA 2MJWA 1T04B 3JSSA 4PR5B 5FGRA 2VN7A 1YEFL 5D7IE 3UTSD 5I9QC 3RWEB 4U1JB 2PR4H 3TT1L 3A6CL 3OR6B 5F97E 4OGYH 1LDPL 4JB9H 1KIRB 2FGWL 5J4MA 1G7IB 4FFVD 1N5AB 2X42A 1FC1A 2VUYA 3RBSA 3U2SB 1EA9C 3K4AA 3VGDA 3DO3A 4NN7C 3NFNB 2WW8A 1SEQH 3RWHB 4LK4A 4X8JA 3MC0A 2FX9L 2R1WA 4PS4L 2VR9A 3RU8H 2JELH 5KOVC 5C0EB 4JQVA 4XVJH 3UTPE 3LS4L 4TSBL 3BVNB 1A4JB 5LQBL 3HZKA 4S0TD 5C07B 4JM2A 3BDXA 1QLRB 4J8RA 4DFIA 4BYHA 4UQ3B 5LGJB 2NTFB 3QI9D 1LEKA 4QRRB 1PGRB 2AJSL 5E8NA 1UYWL 2APTA 2EDKA 3RWIB 1CT8B 4OD3H 2HFTA 4WY7L 5JW3H 5TDPB 5MENA 4YDKH 2A6JB 4LLMA 3H9HB 1SYSA 5A2LH 4L3EB 3ZYOA 3IDJA 1BLNB 2WNGA 4GW1B 4P3CH 1LMKA 2X5PA 3DNKA 1FNGB 2FLRT 1PFCA 3VFWB 3NABH 5TGBA 1A6ZB 5IROA 3SKUD 4Y16B 2NY2B 2FIKB 3LCYA 1CDYA 5T3ZL 2EDTA 4K3JL 3CSYB 3DGCR 1V7MH 1XF1A 4PRHA 4WNQA 3W2DH 5HHXL 5I1LA 5DUBA 1R5WA 3LB6D 5ADOL 2DJUA 5C3TA 1F4AA 4HWBL 4LDLB 4EBQH 3VWKB 4N5ED 1U58A 5BW7A 5ECJE 3U9UB 5IEKA 2DQDL 4RGNC 2CRMA 4M5ZH 3TA3A 4JGJA 4RIRA 5TE7L 3UAJC 1VEOA 4YDVB 1J0YA 2V5RA 2OP4L 1NC4D 3D69A 3SKJH 1J1XL 3LDBC 1KJ3L 3MJ8A 5KVEH 1HK6A 1I9IL 3RPIB 5C0CA 3N50A 1L9MA 1I7ZB 1L7TL 2B1HL 3AGVA 1IAIM 15C8H 5DFWH 1IEAB 5J1TC 1FGVL 2RCSH 1FG9C 5DO2D 3QEQD 4P2OB 5CINL 5F9OH 4UNVA 5IJKA 3H3BC 4UIMB 5C6TL 3GSWB 2VLRE 3HG1E 4NQCE 4Z6AT 1DBJH 2X70A 4XMLL 1Y0LB 1Q8MA 1XGYL 2VISB 5TE6H 1ODAA 2L0DA 3I75A 5EN2A 1MAKA 2XQBH 2DBLH 3QR2A 2FZ3A 3G5YA 4HUVB 2EH7L 1MH5A 4S1RH 4G6JL 5FXCH 4M3KB 1S7UB 1YDPA 2YR3A 4G9DB 2BRRL 1OGAD 5DUML 2OQJB 3O8XA 2BNQA 1R3HB 3RIAF 3SKMA 4RWHA 4ZS7H 4CN1A 5FF6A 3BAEL 2XN9B 4L9LB 5KVFL 1I9RL 3S3JA 3HUJB 1A6UH 2M1KA 4BELD 2BRQA 3VXUA 4MJ2A 3IGAB 4JHAH 3QJHA 2C3HA 5FOBA 4JY6B 4FQLL 1U92B 5BMFH 1CU4L 3FT4B 5KJRH 1UWGL 2VLKB 1RJYB 3LOWA 3GO1H 1KPVA 5K9JH 3BOVA 1A1OB 5I66A 3T04D 3W0WB 5DHVB 4WENB 4YHLH 1DFBL 4LSUL 3TNMA 4EOWH 5HSFA 4ZXBA 3O6FA 1BX2B 2KQNA 4O5LH 3WUZA 3L3DB 1EZVY 4U7MA 2BNRD 3T2NL 3UTTD 3T1WA 4H26A 5L2KA 3BSZH 5BZDA 3IU4L 3KJ6H 4PRAB 1L0XA 3BIBX 4RMWA 3BHBA 5T1MA 3EZ8A 5C8JA 1AGDA 3P9MA 4LSQH 2AAVA 5KOMC 12E8H 2Q6WB 2ICEB 4M3JA 4F7TA 3CDFA 4J3XA 4R0LA 5GZND 2AXGB 5EU5A 4D0DB 3GM8A 4IM8A 2LQRA 1DSFL 1A6WH 1ZT7A 5BVJB 2PYFB 3QZWG 5F71A 2AJXL 4PJBA 3GDBA 3VCLB 5I73B 5MHSD 4C57C 4HPOL 1HYRC 4NN5C 4KHTH 4R4BA 3VG0L 1BJMA 1MCDA 1SHMA 3C08H 3SDXA 1ZT1B 4KMTL 3UTSB 4ODWA 4ETYA 1A7NL 3RUGE 4OTXL 3RFZC 1OTTC 1Q9OA 3S6CA 5DSCA 1P2CB 5DTFA 4N1CA 5KS9B 4PJDE 2NZ9C 1ZLWK 2CKBA 3EOAA 4J4PA 1HH9B 5EOCL 4KRNA 3O81A 5H35B 3BPOB 5IWLA 3VE0B 5CZXC 1SJHA 1U95B 3SE3A 2F9BT 2Z31A 4PY8J 4JDVB 3PWNB 5DMYA 3FB7A 1A47A 5IR1A 3ULUE 2VLLB 3ISWA 3EKCA 2N4IA 5D1QB 4I18A 1RZJC 3ARFD 1KN4H 3EO1A 3LKQB 5GISH 2P24B 2YMXL 2XFXA 1UM4H 2DKUA 2IPTL 4HIIB 5DDHB 4ZSOB 1BD2E 3QI9B 4YXLH 1AGFA 4LU5L 3HCVB 3DRQB 3QQ4A 3OG4B 3VRLE 2DQFB 2C1PA 4ERSH 1LNUA 3V8CA 4N8CL 4QOKA 4YIQA 5T3XE 4OCYL 4PTTA 1YA5A 1T1WB 5EZLB 1J1OH 1B4JL 2X1QA 4KK9C 2FO4A 4CN6A 4FNLH 1T0MB 4XPFL 2VN4A 5LWYL 3RDTA 1CLCA 2ATPA 3GMRA 3UYOD 4TOYH 2WUCL 5F88A 1KLGB 1CIUA 4Y5XA 3MBEC 4NP4H 3LIZH 4JANB 3TBTB 4KKLC 1YECL 5MI0C 1PDKA 2D3VA 4EQ3A 4ODVH 5HGBB 3D2UA 4OFYD 4R97C 3HE7A 3VFNA 4HUUB 1QRKA 3WFDH 3HA0A 2ZPKH 3QZWA 3WHXA 4X6EB 1A7PH 2GK0B 2E6QA 4YR6B 4WUUA 3QA3A 2XTJD 4RGMB 3FB6B 1RK1A 1Z6JT 4F8TA 2PR4L 3V52L 2DKSA 4OGYL 3QUMA 1GOFA 3V2AR 1E27A 3P4OB 3MRBA 4JB9L 2IPUK 4BZ2H 2UYLB 4D3CH 5EORH 3VFTB 2P42B 4R26H 5B21A 1P7QA 4Q6IA 4MJ6B 2YPLA 2E27H 4GG6E 2X9WA 1FVCA 5I71C 3K0WA 4CU6A 1EEZA 3CH1A 3GSNA 5HHOD 1SEQL 5F6IB 5FYJD 3ARZA 1VB9A 4X98B 5JIPA 2XWBA 5EU3B 2G5RA 3BWAB 3RU8L 3TFKC 2JELL 2IADA 5HD8D 4Y1AA 1F11A 1YEHL 3GMLA 3FQNB 4OZFG 4X7CC 4UQ2B 3DECA 1NCNA 4XHQA 4JFDD 2BK8A 4X6CF 4ZTOH 4F2MA 2W1NA 2WAHA 1RSFA 4XPHH 3LKSA 2RFXA 3DMMD 3H0TA 3LQZA 4G8GE 4X6BA 5SWZA 4JHZA 4M9OA 4APQC 1QR1A 1UZ8B 1VGEL 1A6TA 4JKPL 1OGTB 1J05A 4OD3L 5GPRA 4I2XA 5JW3L 3UP1A 4YDKL 3PWVB 2ADFH 2CIIB 1QHPA 1DQQB 4XXDA 1O7SA 3BO8A 3EHBC 4IOIB 2HTLC 5DD6B 4OCLC 1IZJA 3O3AA 1MI5B 4MJIE 1KIPB 1M7XA 4D0CB 3CFEA 4PTUA 2GUOA 4FQ1H 4QRQB 1YC7A 2Q7YB 1RHHB 1HNGA 3WFHA 4X83A 1Y18B 3MJ9A 5HI5D 4UDUA 1Z9MA 2FB4H 4WU5A 1U91B 3BIKB 4JY4A 4PJ9A 1FFPA 1V7ML 4R96B 3W2DL 4L1DA 3UTTB 3UPRA 3S4SB 4FQXD 4XP1H 5IF0A 4JPVL 3WDIA 2AV1B 4EBQL 3P2TA 1IGCH 5SWQA 3BZEB 1SY6L 1QZ1A 4JZOB 4NJAH 3U6RA 1T83C 1F4HA 3N1GC 1DQLH 1MCLA 1S9VA 4M5ZL 5J1AA 1TVBB 3ULUC 3C60D 1FFOB 2VXVH 2VMFA 3U7YL 3PL6A 3ZKNC 5CSZA 2X9YA 3SKJL 2LVCA 4Q9BA 4YHNB 2J12B 5E5MA 4YEFA 2CLZA 3QCUH 1PJ9A 4HJ0C 3GI9H 1UB5B 3QWQB 3SDDA 4H5SA 4L4VA 2D0GA 15C8L 3CNKA 1D5ZA 3AVEA 5IGXH 2RCSL 1DQML 3JV6A 5F9OL 4WGVB 4DEPB 1ZK9A 2YC1A 2YWYA 3T0VA 3D85D 1FNFA 4PYGA 1X5GA 1DBJL 4F3FB 3MXWL 2XNAA 4PG9B 1NFDB 5TE6L 4KKCD 1MCBA 2GCYA 2XQBL 2DBLL 4F9LC 4YAQA 3IXTB 5KSBA 1NGXB 3PJSB 4WW1B 4P4KD 3UMTA 4UT9H 3TN0B 3BMVA 4BK5A 4S1RL 3MUGB 1N59B 4CNIB 2PYEA 4OZFA 1U8QA 4C58B 3TGXA 1JRHH 1AGBA 5HVWA 4MA7L 4M6MH 2BC4A 5J3HD 3G6DH 1I3VA 4ZS7L 1BWWA 2CK2A 2CH8A 3VXRA 3MLYL 5A40E 4OSUH 4JCLA 1A6UL 2ARJA 4EUPH 4PJCF 5DJZB 1NCBH 4JHAL 3EYUH 1XR8B 5T1DH 1XGRB 1IL1B 4PJHF 1I8KA 4GAFB 5BMFL 3OQ3B 4WWKC 1TZIA 5KJRL 3RRQA 3QH3B 3GO1L 4F7PA 3BP6B 4ZUVA 3RVTD 4AEHH 5JXAH 1RFDH 3GB7A 2ZUVA 3IETA 4KTEH 5K9JL 4WWID 3WN5C 4TUOB 2AV7B 2DQJH 3B9KC 5DK0B 2W9DH 4X5WB 4EOWL 1Q38A 3ETBF 2Q20A 1C12B 2AEPH 3VXNB 4JKMA 4ZO6A 2OXGA 2X4OB 4GAYA 4HPYL 1DVFB 2NW3A 3BSZL 4GXVH 2LVEA 3KJ6L 4OGAD 4JFPA 1OTSD 1OWRM 3QT2A 4UTAL 3RWFA 3QRFM 2J5LB 1G7PB 4LSQL 1U36A 1J8HA 3ZYJA 12E8L 1Q9LB 2E9JA 5JMRA 3NN8B 3RKDD 1P6FA 3BP7A 1NUDA 1A6WL 1U3HA 2H6PB 2F58H 4Y4HC 3L5HA 3V4PH 3T77A 2FSEA 4R2GD 3S97C 5B8CB 1JPGB 3GFUA 4ZUSA 2Q8AH 2E6JA 3HFMH 4Y19E 3QQ9D 2XZAL 4JG1H 3C08L 4QHUB 3KYMB 2IFFH 1UZ6F 4DZBB 2XTJB 2HP4A 5LAXA 1JV5A 4JFFE 4D9QE 3WFBH 1NJ9B 1H3UA 1A4KA 1WCBA 2EICA 4R90H 4YHYB 4NM4H 3S34H 4H8WC 5D2LB 3TZVC 1EV2E 4QY8B 2OSLA 1HXMB 4N9GB 5IEHB 5L7XH 3A6OA 1ZAGA 3MFGB 2H32B 1SJEA 4P5TA 2VXSL 2A0LD 3C5JA 3MGOB 2PCPB 3SGKA 5DUPH 1WBYA 5HHOB 1I9JH 1RY7B 3UROR 3UC0L 5F1IB 3W39B 3DX7B 1B90A 1JWSA 2VLMD 1INQB 1HNFA 2DLHA 1IM3B 2VQ1B 4Z7WE 1CFTB 1Z9LA 3SDAD 4G9FE 2OTWB 2QR0B 3DO7A 3PWLA 2XA8H 4AM0A 2X4TB 3ULVH 3QPQC 1AD9B 1C5CL 1H5BA 1KN4L 4QT5B 4Z7VF 3RVVD 4ZUWA 4TNWK 4E41E 4NKOA 1G6RB 4L3CA 4YXLL 3JWOH 2W60A 2NXZC 3T8XA 5I1DA 4AH2A 4P9MH 4P23D 1CFSA 2Q3AA 5JUEH 5IFJB 3RGVA 4HV8A 1DN2A 3QNXA 2ESVD 3FQWB 4J12A 5E7FA 3SBWC 4WFGD 1QUNA 2WM0A 1P84K 4FG6D 4FNLL 3VI3E 3ME0A 4WHDA 4MMZC 3RTQD 2RGSA 3IS1X 4NHCH 1CGXA 4IJ3B 3K4DA 5D1XD 2FJHB 4TOYL 1HYSC 4PJ8A 3QHTC 5ESAB 2CDFA 4S1DC 2QSVA 4NP4L 4ODUA 4FQXB 3HPLB 4GRWF 5EWIH 4OFKA 3KPTA 4AIZA 5AG9A 2NX5B 4M48L 3MOBH 1CXKA 1WBZA 3C5ZD 3OJVC 4U6HA 4XXCC 3RGHA 4POYA 5IVZB 3BPLB 3DLQR 4OZHF 4Z7UA 2VIRB 3WFDL 3QXTA 3ALXA 3GSQA 1E4WH 2EIEA 3C60B 5C70A 1A7PL 3RVUC 1CFBA 5TQ0L 4RSVA 5I1CL 4HS6A 4E0RA 1K8IA 2XT1B 3QDGE 1T89C 1PYWB 4OFPA 4HUXA 1WBXA 4R4ND 5IMKB 4MD0A 4PJXE 1U8MB 5FYKU 5JO5A 2BVQB 3AMKA 4MD4B 3TVMA 3LSOA 3QO1A 3MBEA 3WBDA 3D85B 4JM2D 5GSVA 1MJUH 4R26L 2B1AH 3O3BA 1OW0C 4DKAA 2E27L 5E4EB 3MV8E 1AP2A 4YQXH 3VFMB 5BV7B 2VLJD 5D1ZA 1H15A 4ZFOB 3FN3A 3PP4H 4K2UH 5CGYC 3ULVD 1SBSH 4A6YA 4P4KB 1OSPH 3L3HA 5EOQH 1AXTH 2WINB 5E2UH 5BO1H 3V6FB 5MEPA 1W0VA 4L8DA 2FL5A 2VDMH 4RFNB 4ZTOL 4KRMB 2W65A 4ZYKB 1P7KA 4ODHH 2NY3B 4XPHL 3NZHH 1B2WH 4OZGA 3DOSA 3GM0A 4PRHD 1BVKA 4JQXC 5IM7B 1V3KA 3BXNB 3PHOB 4XCYB 3OX8A 3GGWB 4OCRH 4ESKA 2X4PA 3KNBA 1VFAA 2ZUWA 4GW4B 2IH1A 2BMKA 2YZ1A 5E1AB 3TA3D 4FQHB 4YNYB 4X4YB 4FQ1L 4LRIC 1YJDC 2MSPA 1HE7A 4B7LA 5CLTA 1E4KC 5D5MB 3ILQD 2FB4L 2AQ2A 2P8MA 5JDSB 5ETUA 1TJIH 2IQAA 4KY1H 3GZKA 3FB8B 3WNNA 4F58L 3L5XH 5GS0D 2X6MA 2OK0H 1CDBA 3PNWB 1IT9H 2WMPA 4NJAL 3KR3H 4YHZL 3P9WB 4LVOC 3ARRA 1JGEA 4YBQC 2BSSA 1T7VA 2VXVL 1D9KB 1KTDB 2Q86B 1A0QH 2NR6D 4YK4B 1WEJH 2EZ0C 5DJ8B 4PJFE 2I5YH 3BH8B 2FJFA 1JE6A 3QCUL 4NQEA 5I2IA 3GI9L 4HJGA 3V6ZA 1MRCH 2VDOH 3H7BA 3JTSA 2EDWA 5FA4A 4W4OA 4PRPE 3LEVL 3S98A 1OQOA 3O8XD 2BNQD 1IQDB 4KTDH 1QFPA 1WFOA 2P8PA 5FGBC 5BXFA 3PE9A 4GLRH 4LEOA 1ND0B 2W0FB 3AUVA 3QDMA 1NGWA 3VXUD 2ZSWA 1DEEB 5KVMC 1T83A 3MRKB 3D3VA 4YE4L 1PSKH 3H9ZA 2R1XA 2QSTA 3STZA 3X12A 3DHJA 3TC9A 3FJTA 2APXA 3T0BA 2R39A 1FQ9C 2GAZA 4XC3H 1JRHL 4N9OB 3VXQA 3PV7A 2EEBA 1BD2A 2A6KB 4M6ML 5IMLA 4NHUB 3G6DL 1JUFB 4ZXBD 2P8LB 3O6FD 1JYVA 4XPGL 2H2SC 3IRZA 3P0GB 3UO1L 4HULB 3SDAB 3HAEB 5B39B 2DLEA 3AU1A 2D9CA 3MCLH 4OLWH 2EYTB 2EIDA 2G60H 1NCBL 1U8NB 4PRBB 5L2KD 3EYUL 2YS4A 1E4XH 1YMME 3CMGA 2HJLB 2ICES 4ZD3L 1JMXA 2OCFD 4XAWH 5DS8B 3MRLB 3G5VA 5JXAL 1RFDL 4KTEL 5FYLD 4P23B 3BEWA 5JORB 4G6MH 2DQJL 4MNQE 2XIDA 1I7RB 4JVUA 2W9DL 2XXMB 3F7PC 2R15A 4MVBC 3GNML 4JJ5A 5IW6A 2GW5A 3VFOA 3EYFA 1AE6L 3BZ4B 2AEPL 4G80A 3GJEA 1ZT4B 1CDCA 2YOCA 1DCLA 1EH9A 4OT1H 4OCWH 3RTQB 4UUJB 1EERB 5I1IH 1S7WB 4F7CA 5FV2A 5D1XB 2V7NA 4LASL 2APWA 2QKIB 3FT2A 3MRPB 4XWOD 2ZNXA 4C4KT 4WWKA 3CFDB 2YD9A 3C5ZB 1H3GA 2AJ3A 3ROLB 5J13C 2AI0H 2I25N 2F58L 5DR5H 2YSSB 4J4PD 4HIJB 2AK4E 1KPUA 3QUMH 3V4PL 25C8H 4LL9A 2ICWA 1LE9B 4QRTA 3HFML 5HYIA 2IALA 2IFFL 1N64H 5E9DE 1QLFA 1HHJB 2I9TA 1KCUL 3T0WA 4R90L 1E28B 3S34L 1MNUH 1BM3H 3LRSB 5L7XL 3D39D 1Q72H 3ARXA 5EB9A 3D0LA 5FYKH 5ID0A 2AJZB 3VFVA 3DX6B 5HI3C 3L6FA 4PP1D 2AEIT 3UTOA 1ONQB 2VLJB 2GSIB 5DUPL 4ZPTA 5ICZB 1I9JL 1CXLA 3ZKMD 3TIEB 4QRUB 4OJFH 4G8GA 3S88H 1MUJB 4GT7A 4Y4HA 4K8RC 5EC2A 1F3JA 3L3KA 3VFPB 1NC2D 2XA8L 4V1DD 1G7MB 4K7FA 3ULVL 4WHYH 2G75A 3RDTD 4YC2C 3C6SB 4I48B 1PKQA 3GEWB 1EEQA 1OP9A 1KNOB 4X6FA 3JWOL 1E4XI 4HIXH 4GRLB 4ZO8A 3CVHA 5J9PB 4P9ML 2DWDB 3TZVA 4Y4KA 3FN0H 1RJZB 3JV4B 5JUEL 1OM3L 5DQ9B 2IANA 2VITA 2E9BA 3WS3A 1PY9A 3GMPA 5DJXB 3FOMA 3K81A 3EIFA 3D2UD 4ORGB 3HE7D 3QQ3B 4JVWA 3SN6N 5KSAC 1P4LA 4WTXA 3ROOA 3SE4C 3UTQB 1XGPA 4NHCL 5IFAH 3DJ9A 1OF2B 3EOYG 4MNGB 5IVXE 5ISZA 4WUUD 1MHEB 2FHBA 4Z0BH 1FFNA 2XYCA 2MHAB 3MCG1 3DX8B 4F8QA 5EULV 3ZKXC 2P45B 5DI8B 2PTTA 3REVB 5JIIA 5EWIL 3QXAB 3FRPG 2JCCF 3MOBL 1WQVT 1C16A 1K9TA 1AIFA 5HGAB 3F7VB 5FA3B 2UVFA 5J56B 1E4WL 5IB4B 1D5MB 3IJHB 3EYQC 5C0RL 2X4UA 1S7TA 4ODXA 5GSRB 1R5IB 5GRUH 5I75B 1A1NA 1NKRA 5GJSH 4PY7A 2HKFH 1M7IB 4OI7A 3E6FB 1GGYA 1F4YH 4P2CG 1F6LL 4EN3A 3MYZA 5DJDA 1G7JB 5CGTA 2YEZB 1MJUL 2DTSA 5SWZD 2ORBH 5LXGL 1YY8A 4OZFH 4YQXL 4LLAA 4HSQA 3VD5A 1NBZB 1ZVSA 1NSNH 1MCEA 5FK9B 3PP4L 4K2UL 5GGRA 3SGJC 5CGMA 1SBSL 1F45A 4M93C 3JBG7 2BVPB 3MLTA 5EOQL 1AXTL 3NAAH 5BO1L 4MD5B 4ZNEA 1B4RA 2KUTA 3DV4A 1T2XA 5E2WH 2VDML 4XCNA 3HC0A 2GT9A 4LHUG 3NFSL 1UEMA 1J86A 5CWSB 4ODHL 1GVIA 3NZHL 3B43A 5MERA 4PJ9D 1IGFH 3V0VA 3DYOA 2I60L 2EDHA 1PBYA 3KPOA 1ZGLP 3F6LA 4XTRC 5DD0H 2C7UB 2ZUUA 4JRXE 1G7HB 5C08A 4Q0XH 5EPMA 3F58H 4HH9A 1YNTA 3CPLA 1OW0A 4OCRL 5GGSB 2H26A 4PFEA 3NBNA 4OFIA 1EXUA 1T1YB 3JVGA 4PJCB 3V0WH 3LPWA 3VGEA 2R8SH 1P69B 3PL6D 1HXYB 5J06A 1GCFA 1QEWA 4GUPB 4HZAA 3RHWK 4LSDA 4LDOB 2Y7QA 3SDDD 1TJIL 5CMAA 4PGJA 5GRYA 4L4VD 4KY1L 1H3PH 4LLYA 3L5XL 2FIRT 1JMZA 3FRPA 2ZUQB 1LK2B 2C4XA 2HN7B 4LPVA 1V7NL 2H45A 4CVXB 2Z8WC 3LN5B 1MLBB 1EEYA 4JFED 2D31B 5HYSB 4NNPL 5HDLA 3OR7B 1XF4B 3LKPB 4ZO7A 2JK5A 1H0DA 3PWPE 4ELKB 1CTNA 1QYGH 4ONHA 4P57A 3U46B 4XHJC 2I5YL 4LAQH 5FCSH 4JFFA 4KZEL 1MPAH 4FFYH 4I5BB 4NYLA 1KFAH 1MRCL 2ATKB 4UDTA 4Y2DC 5IBUG 1VERA 3D9AH 5IB3B 5J6HA 1ITCA 2PYED 5DVOA 5D2NA 3IDMA 4HIEB 1HSBA 2IAMA 5EUOB 4JEGB 4MZ3A 2F8OA 1A3LH 1RJLA 4KK8C 3RZCB 1F8TL 1RIVH 3JWNC 4Q9CA 4KTDL 1JWMB 2H9GA 2N56A 2ZZUT 1N6QH 4H0HB 4WI9A 5F6HI 4I77H 3D39B 3I6GA 4X6CE 4BZ1H 4KJWD 1PSKL 2XRAL 4G9FA 3N85H 5D72H 3W11D 2A38A 3ZT6A 2G9HA 5GS2H 4OCNC 2HVJB 1LO4H 1M7DA 4XC3L 1PVHA 3V7AE 4KVNH 4LHUA 4NC0B 4QXUH 1NGQH 1VENA 2PXYD 3HMWL 1EJOH 4P2RB 1NC2B 4V1DB 3GUTB 3UTZB 4OLWL 3MCLL 3IDXH 2HMIC 2G60L 2DN7A 5I30H 1TVHB 1E4XL 5GS3A 2HFFA 4XAWL 4AT6B 5J12C 5ITFA 4TTDC 1X5HA 3I2CH 3STLA 1J8HD 4ISVA 1Q9KA 2YBRA 4G6ML 1S9WA 4KQ4H 4Z7VB 4H25A 4YX2H 3WUWG 3ZYZA 1OB1B 4L5FH 3IS0X 4UMGA 1J8KA 1ZWIA 1U3HD 3TCLB 1RZJH 3PWJA 4KAQH 3DETD 5DQJB 2HJFA 1C1EH 2EXWC 2Y5TB 4OCWL 2YA0A 2R23B 5I8OH 5D6CB 5I1IL 1IRAY 5GQBA 1OAUH 3NCCB 2YN3A 3ULSB 2PTVA 5EBMA 5CAYB 3G5ZB 3S96B 3QULB 3BGMB 1BF8A 1DANU 3V79C 4XRCB 4KRPC 3QYCA 1WAAF 4BH7B 1I8MA 4W6YB 4R6UA 2AI0L 1R6VA 2DQCH 1KJ2A 5EDXA 2Y6SD 4WFFD 2P5WA 4X99A 2HTKC 3QUML 2ITCA 4P5TD 3B9DA 4QF1A 5CS7A 1CXHA 4P9HC 1ZLUH 5C2BH 1OT2A 3MV8A 3IJSA 4K23H 5IVOA 3IDNB 4PYHA 3O9WB 3GSNL 5L6YH 4DZ8B 1LP9F 1BM3L 4A6YH 2X4RB 1Q72L 2MMXA 3P4NB 5E4IA 3LKNB 3K8LA 1T5XB 5EZIH 5FYKL 4Y5VC 4IHOB 5C0DB 2X7LB 1IKFL 4ZS6C 4BUHA 3C09B 5HHPA 3DX9B 2D7MA 5BS0A 3DXAA 5T1LD 4TTGA 2QQQA 1D5BB 4X6DB 3RGVD 4OJFL 4XVUC 1EHXA 4HCRH 4NUJB 1EIBA 3S88L 1QFWH 3JZ7A 4PJHE 5TFSH 2NZIA 1MSPA 4U1KB 1QO3A 5E99H 4WO4A 5IMMA 1B0RA 3ILPB 3NGBB 4XP9H 5F7HA 2VZSA 4UILL 2VZOA 3EDJA 4WCYH 1X5XA 2VUOA 4PJ8D 3VG9C 4AL8H 3P9LA 2B20A 3CJJA 4HIXL 4NBYB 1UXWB 4ODTL 2EE2A 3RNQB 5HPMA 4GH7B 1MQKH 4L3EE 3I3BA 1ZTXL 3MJ9L 2CUHA 2Z8RA 5T3ZE 3WUWA 3MUHL 2HG5B 1C7TA 4JPIA 4DN4L 1T4KB 3QUYB 3DYMA 3VGBA 3AS0A 5EFIA 4ZDHB 3OKKA 1JNHA 2GJ6B 1MRDH 1I1AC 3RI5K 1P1ZB 1N3NB 4JHWH 5IFAL 4IS6A 4C56E 4NNYA 3VD7A 1JPFA 2DQHH 3U9PH 5F3BB 1KTLA 3U1SH 3CCHA 4XCCH 1NKOA 3SO3C 1S8DB 2KBGA 4EI5A 2GFBB 1FIGL 5C0FA 4PJFA 4PJIB 3HLAB 3QEUB 4JFEB 2VL5A 3TVMD 3DI2B 3HS0B 1F4XH 4ZOCA 3CXHJ 3KDMB 1EFXA 1SMOA 2B2XH 4U3XA 3BE1L 4LHJB 2F53B 5J11B 1KG0A 5D1ZD 1H3VA 1PD6A 3PDDA 5H37G 3M07A 4LLDB 3DUSA 3RA7H 3FQTB 3R8BB 5KSAA 4PLNC 2HKFL 4P0DA 1ZHLA 2VJXA 3PGDA 1JYXA 5EO0A 4YDIH 1F4YL 5SV4A 3KLSA 2P1YA 3ULUH 2A6IA 4Y89A 5F9JB 1FYTA 3EZJB 4XH2B 2ORBL 4G6AD 5B38G 3WCYA 3TBWA 4CMHB 1HI6A 4PUBH 5EC1A 3LV3B 3T3PF 3MLUH 5C0BD 3KPRB 4N0UB 5DEGB 2OJZL 4NCC1 3ARQA 4PJEB 3GMOB 3NAAL 2IEPA 1CFQA 1QFWI 4JM2F 5I17B 3HNTH 2JB6B 5E2WL 4KKBC 5T3XH 1EO5A 43C9A 4FTVB 4R3SA 2XN9E 4LPTA 3DIFB 4GMTH 4YO0A 2NY5C 3SCMB 1GHFL 1QVOA 3L95B 2PXYB 3ULVF 5TDNA 1TTUA 2WIIB 2ZUSA 4MNQA 2CLVA 5DD0L 4IRJB 4WW2C 4Q0XL 2NXYB 1TZHA 3F58L 2AXJA 3BPNC 4XPTH 3EJZD 1N8ZA 1QR4A 3WIFB 5I1KH 3VXMD 3T1FA 5KSUB 5D7JC 2BY0A 2R8SL 3QIWC 1O0VA 4GBXC 4GRWE 4PRIA 1G1YA 3UJIL 3DGGA 1A64A 4P4RB 2V7HB 4WIQA 5HYJD 5D9SA 1W0WB 5DMIH 1WIPA 1U8KA 1JF1B 4OZHE 5TQ2H 1WIOA 2VO5A 3D25A 3EFFA 5KZCB 1JZ7A 2CO7B 1ES0A 3MRFA 1JI2A 3P30H 4QTIH 1FPTH 1MCJA 2NY1C 4ZMAT 1M05A 2BSED 5JHDE 3Q6FB 3K8KA 4HFWB 4LOUC 2VE6B 3U36B 4NNXA 5F6HJ 4U2YA 3QDMD 3EGSA 3LRGA 1HINH 1CIDA 4LAQL 3D3VD 3WL9A 3HZVA 1MFAH 4FFYL 1KFAL 1CGTA 5DYOA 1NUNB 3IDGA 5EO1A 3D9AL 4WDIA 4MAYA 5C09D 1CFNA 2GJZB 1KJMA 4RMQA 5FHAH 4JRYE 3UTSE 5DMJB 1JVKA 3EO9H 1BFOA 3L5JA 1A2YB 5DLMH 2UWEA 5ACZA 3PQYA 1JGDA 3C6LC 1KB9K 4HK0B 3V0AC 5H2BA 4O00A 1AR1D 5B38A 3BIAX 1BJ1H 3OV6A 2E7HA 1S5HA 1N6QL 2OTPA 3MJGX 2UZYB 2VDQH 4HGWA 4Q2ZA 3CMOH 4Y16C 5DT1H 1S7VB 4ACPA 4I77L 1NEZB 1R3JA 4G5ZH 5B3JE 1DLFH 3MRMA 4BZ1L 4Y8AA 4UTBH 2R9HC 3N85L 2F74B 1U42A 5HYQA 2XWTB 5I1HH 3QWOB 1LO4L 1S3KH 5T1LB 5CSBA 3VMPA 5E94B 3T4YB 5ALCL 3SKNB 4KVNL 5HHNA 4JZJC 4N0YH 3P4MB 1LD9B 4QXUL 4Y2DA 5FUOL 3CVHH 4H8WH 1EJOL 3RWJB 3OB0H 3TNNA 1VGKB 4ZSOE 3IDXL 2BOCA 3H9SA 4D94A 1GZQB 4HAGA 2BVEA 2JB5H 4HXBH 3JTTA 3BW9A 4RMTA 3TYFB 5D71H 1U8LB 3WYRA 5C9JB 4XNUH 1P5VA 4P2QA 3HR6A 1S7QA 3HI1A 3OG6B 4ELMB 1A02N 5JTWA 3I2CL 1KENH 4HUWA 2J6EA 4ZTPH 1TJGH 4HX1A 4KQ4L 4J3SA 5K33A 4YX2L 2JTDA 4BH8B 2COQA 1ZA6B 4L5FL 3QEHA 1MVUA 4FMKA 3Q48A 3G9VA 4PJ5D 5DJ0B 1RZJL 4RDQF 4KAQL 2SEBB 5JW4R 3DVFA 5I8OL 1NMAH 3NACH 5FECA 4MQXD 2JJTC 3RHWF 4NO5A 5AZEH 1OAUL 3DSNA 5E8EB 4XGZA 1N5YH 1HWGB 4U05A 4NC1E 1UCBL 3BD4A 3ZKQD 5FHBL 1KB9J 2DTMH 4PJBF 3KLHC 3VGAC 2FYYB 2DQCL 4L9LC 4U1NA 4JFQA 4TUJB 3BN9C 5FO9A 3QUXA 5GJTH 2W0KA 3DTXA 1HEZA 1KOAA 1B88A 2JCCB 1VADA 5EU7E 3H6JA 3WDJA 1ZHNA 1OTUD 3FO9B 3FO1A 5CUSH 1MHPH 2GHWB 4HEME 3QEQE 3BH9B 4QYOA 2O5YH 4G43A 3F5WA 2GJJA 4LPYA 1FL6B 1CN4A 2YN5A 2YD5A 2PO6A 3QFJB 4A6YL 4O2CB 4O4YH 3QRGH 1TVDA 1EVUA 3DUHA 2VSDA 2ZOLB 2FEDD 3V7AG 5HBBA 4Y4KD 5C0BB 3ZTJG 5KANG 2IAND 3MV7B 1F6AB 1MFCH 2AJVH 1UC6A 1QFWL 3ARBA 3LS5H 3TESA 4RAUA 5TFSL 1N6UA 1OGAE 1RQ5A 4OGZA 5E99L 5AZ2H 1UG9A 5T1KB 3BP4A 1YN6B 2UZXB 3GMNB 5CHNB 3T4AA 4XP9L 2G2RA 4P99A 5D4QA 2V2WB 5ISZD 4HZLA 4AL8L 3Q6GH 4OIAA 4QRPB 4NKDA 1MQKL 5HHQA 4NQDA 1BBJA 2DYPB 3KPMB 1YN7A 4U1IB 2E8ZA 3T0AA 3VXMB 2J2ZA 4HS3B 1MRDL 4J6RH 1KCLA 4HKXB 3GBLA 4JHWL 2P49B 5CBEA 4FZEL 5BQ7B 1J18A 5I0DA 2JJSA 3PGFL 1UXSB 4FFVC 2F54D 2BNRE 3UTTE 2NY0B 5HYJB 1FGNH 5CIPA 1FO0B 5EIIB 2DQHL 3U9PL 3U1SL 4XCCL 4UU9A 2VC2H 4HWZB 1IAKB 3C2AL 4I0KA 5IQ9A 3OXRA 1QRNA 2VNCA 3HN3A 4EN3D 3VRIB 4PJAA 3F8UB 1LO2L 2D9QB 5A2JH 2EE6A 4LLWB 3EYOA 1F4XL 1YJDH 2EDDA 2X4QB 4UB0L 4FXKA 2B2XL 3RIFK 1CWVA 3CSGA 4LDEB 4DFHA 1GGUA 3ARDA 1JK8A 1JPSH 3QI9C 1IGYB 3DPBA 1JZ5A 1GPOH 3RA7L 5MHSE 5ESQA 1I1AA 3SO5A 1XGQB 4YDIL 5C09B 4DCQA 1XZ0A 5IIEA 5BRZD 1HHGB 4JGMA 5DHYA 2C3WA 1GZPB 4PUBL 3V5KB 4DUXA 5HVFB 3G6JE 1MVFA 3MLUL 4HQQL 2A83A 1QSEA 2F5BH 2VZVA 1EX0A 2A9MH 5C08D 3HNVH 1HQRA 1UM6H 4ZUUA 2AJYH 2ADIA 3QIUA 2L7JA 3LB6C 3IKCA 3HNTL 4N5EC 1VFBA 4NC1C 5T3XL 3RX5A 4KGLA 4HEPG 3KJ4B 4GMTL 3X14A 3KG5A 4CVZB 1M6OA 1K5NB 3QDJA 4MB3A 1UWEH 1MLCB 1Q9WB 1OQXA 5EU7C 4P49A 2H8PA 4RGMC 4ZAKA 1TQCB 1UT9A 1NGPH 1X44A 1N0XH 4XPTL 4YBHA 5I8CB 2Y4SA 1V3LA 4NFCA 5DO2C 4KH2A 3IDIA 5I1KL 1MF2H 2ICCA 1UVQA 1LEGA 2JIXB 5DJYB 9CGTA 3FKUS 3O3UN 4G7YH 2ADGA 3QIBA 4PJ5B 5DMIL 5ESVB 4KUCD 4C4KO 5TQ2L 2YUVA 3RI5F 3CFIC 5FGCB 2FJGB 3SOBH 2BOBA 5E8PB 1PLGH 1B0GB 2IAMD 3P30L 1N7MH 1KJ2H 2EDEA 3VDBA 1ZA3A 2OXHA 1P4BH 4LCYB 3FB5A 1T04A 4PR5A 4Z9KB 3VWJD 3IJYB 3FFCB 3RWEA 4U1JA 1RVFH 3T2QA 1HINL 3QUZB 3OR6A 1I1CA 1BAFH 5TH2B 1MFAL 1AD0B 1IILE 4R7NB 5TE4H 1KIRA 4KVCL 3W9EB 4U3CA 3QXWA 1HHHB 5J57B 5GHWL 3HRPA 1OARH 2XTJE 1G7IA 2CLRB 1N5AA 2M8XA 3U2SA 4LHUD 3EO9L 4YHIB 3T0ED 5DLML 5I19H 4LPXA 4DN3H 3BRGC 3NFNA 2HJKB 4X8XA 2GTWB 1FL3B 2AABH 2Z8SA 5KSBF 3RWHA 2Y23A 1CICD 2VDQL 5L8JB 3CMOL 4YWGL 5C0EA 1IC7H 4G5ZL 1JZ2A 2AXFB 4FQIH 3BVNA 1A4JA 3QWRA 5HHOE 5GGVH 5C07A 3O3EB 1QLRA 4MQ7B 4UQ3A 1AHWC 5LGJA 2NTFA 1LP9B 4QRRA 1F2QA 4N0YL 4DTGH 5ALBH 1Z9OA 2D0FA 4CGTA 1UGNA 3SJVB 3CVHL 5EBGA 1CT8A 3RWIA 4H8WL 5TDPA 3IAGC 2A6JA 3H9HA 4JFDE 3D48R 3OB0K 4EEEA 4L3EA 5GZNC 1BLNA 4GW1A 1A14L 1FNGA 5D8JH 1PZ5B 4A2LA 2JB5L</