3HS0B

Cobra venom factor (cvf) in complex with human factor b
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
233
structure length
233
Chain Sequence
DGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobra venom factor
publication title Insights into complement convertase formation based on the structure of the factor B-cobra venom factor complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 233
sequence length 233
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3hs0B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hs0B02
1PG7H 1U8KA 5TE6L 5IKCB 2ZG2A 5B3NA 1KIQB 2DQEL 4K94L 4FFWD 2ENSA 2LU3A 1V7NL 4HAGA 3AS2A 4R4NC 1CZ8H 3MRKA 3SKJL 3AC0A 2OQJA 3ULSA 1S7WA 3RGVA 5CJ8A 2R9HC 2VLRB 3K4AA 4KKCD 1J18A 2Y1VA 4FMKA 4X7DC 1MUJA 3SKUD 1T2JA 1MPAH 3QUZC 2CRIA 3MODH 3HE6A 2ZCKH 3MGTB 3O41A 2BSED 2YA1A 3MR9A 5J4MA 3QJFB 1BVZA 4APQD 3DETD 2VH5H 3K1DA 1WISA 1T7VA 1RUPH 5IVNA 2IQ9H 1BIIB 1BFOB 5HVHC 2ZNXA 4BFIB 1ZMYA 3GMLA 5EWIH 5HDQL 5IJKC 3DRQA 1UWEH 3RVXC 1KLUA 1ED3A 3CU1A 4MA3B 4BH7B 4MGXA 1L7IH 3PHQB 4U1IB 3DMMC 4P57B 2G75B 3MA7B 3MV9A 3IFPA 1YC7A 4H0HB 3MLTB 3FHQA 1OAKH 2NY4C 3BAEH 4MWFA 4X6EA 1P7QD 5SWZB 4ZAKA 1K8IA 4X8JA 5F97E 3MREA 2JB6A 2WWKO 5LCVL 3HG1D 2BNQB 2IBZY 1WVZA 1WZLA 4ELMB 3EHBD 3QO0A 3RWEA 1DTUA 2JK5A 3L5HA 2BOBB 5BQ7A 2ZJSL 4JZOA 1OB1B 1MY7A 5D5ME 1KCKA 1TTUA 3TYFB 4AG4H 5DC0A 2GKIA 4EN3B 4F33A 3MOQA 1KACB 3KPPB 5DD3H 1YNLL 3G04B 4MD5B 4C57C 5D5MF 2UZIL 2OL3B 1E4XI 2P24B 4E41D 3KPOB 3BVNB 1WSST 3U0PA 3CLEL 5IK3B 1NANI 2JKXA 2NY7L 4M3KB 1ZHKB 3SPVA 3EFFA 3FQTB 3RZWA 2F54B 3RNQB 3PV7A 1FZOB 5EO9B 4P2QD 3N9GH 4TNVK 3QHTC 2ZNWA 1H3XA 1YNKH 4X0KB 5C0DB 4YDLB 2OJEA 1KB9J 2A77H 4DGIL 5J89A 5KSAC 3IFOA 3LIZL 3VU2A 4U1MB 2E7CA 4I3GA 4U33A 2BVTA 1F3RB 3VXTA 1X5JA 1KNOB 2FO1A 4JY6A 5A43C 1ORQB 3IXTB 1T6WA 5AYUL 4WI4A 3T0ED 4KUZL 2DLFL 2N56A 2AEWA 5HYEA 4G9DB 4MVBD 3MRGA 4OLWL 3CFEB 4F7CA 1G1YA 5ISZA 1WBXA 5L88L 1X9QA 2DQHH 5LGJA 4OKVA 1Q9KB 1Q94A 1QFHA 1NFDB 2NXYC 3ARFB 4G8GD 5FOJA 2CLZB 2BVYA 1QRNA 3FO1A 4M7ZB 2HA1A 3KLAB 3ZT5A 4MS8D 5C0AE 1N64H 5EORL 43CAB 1CGTA 4PJBE 3SBWC 5B8CB 2F58L 3O4LA 4WI2A 1G0XA 1H3PH 5I76A 1A7BA 1DQQA 1GCFA 3MLVH 1LO5A 2YK1L 5HGAB 1ZT4A 3K7UA 4HWNA 3UYPA 1FFOB 4PJBF 3QUXB 2VDML 2A73B 5T3XD 2C7UA 2AEPH 1SEQH 5EU6A 1ZLWK 4DJMA 2X44D 1OAQH 4I48A 4LASL 5HYQB 1WCBA 2BFVL 1IEAB 3MLZH 1OOAA 5FYKE 4QHMB 3ARVA 4FNLH 3AY4C 5FCUL 3H7LA 1MQKH 3ULUC 5CJOL 5IEKA 1EHXA 4JM2D 5GRJL 5ICXB 3LEXA 5I9QC 3KPNB 3JWDC 4PRIA 5FECB 1FDLH 5KVGH 3M07A 5DK3A 2OZ4A 4LP4A 1XMWA 4PJ7E 3EFDL 1A1MA 3RNKB 3LZFL 2QADC 3FFCA 1CD9B 3KR3H 2VDRH 3V7MA 4WI9A 2XA8H 4OZGE 4EUPA 4P23B 1MCOH 5DJDA 5DVKA 5MERB 4PJ7F 3KPRD 4Z77B 3QQ3B 4LKCA 5D7JB 1NAML 4K8RL 2BSRB 3KJ4C 1T2XA 4OZGF 2NY6D 3OGOE 4RWHA 4U1SB 5CEZH 5FO7B 3KPSB 3IDXH 5F7LB 4LPUA 1YDPA 4LP5A 3VD7A 3TP4A 2VDOL 3RGHA 3MBXH 3VG9B 3ILPB 3GJEB 1NJ9B 5DK2A 3HRZA 4RZCA 1YPZE 3KG5A 3LKOB 1BEYH 1VGEL 4HJ0D 2DL9A 4Y19D 5JW4N 4KRPB 4XWGL 1G9NC 5DVNA 1H15A 3HAEH 3U79A 1YPZF 3O2WH 3VXUA 2ITCB 3RZCB 4N9OB 4PS4L 4JZJC 5F3HB 2BVQA 3QIBC 5HYJD 3C08L 4XPBL 2GJ6E 2JLLA 1NLBL 1XGTA 4Y16C 5A16A 5HYIA 3LPFA 3WNKA 4AT6B 1PX3A 4M1GH 3W5MA 1GH7A 4PRPD 5EUOE 4PGBA 1S7TB 1TZIA 4KRNA 3RTQD 5JIIA 4HS6B 15C8L 4Y1AD 1BVLA 3EO0B 1LWRA 4TOYL 5C0ND 1TXKA 1W72B 1VFUA 4ZTOL 5DQDH 2EXWD 1F2XK 5EUOF 2V5YA 4CW1A 2I9LB 1XIWA 2NW2A 5EU4A 2DTML 1BVKB 3RWGA 3P73B 1Y6MR 4AMKH 4H26B 1OD7A 3OKDB 1A6VL 2DQUH 3IJSB 4WU7B 1BPVA 3PWNB 1OAZH 2PXYC 2V17H 1P53A 3ZDYE 1DBJH 4H88L 2YC1A 5HHVL 3BUTA 5B4MC 4L4TA 3AFLA 5IFAH 3SGKA 1D6EA 1V3LA 4OLZH 5E2TH 1P7KB 3ZDYF 2N7BA 1TNMA 4QRPE 5IVZA 3NZHH 1Z0MA 4YZFE 3PF2A 1DQLH 4WW1B 1J8HE 5T33L 5F1SA 4GRLD 2FL5B 4UMGA 3CFCL 4YFLI 4YZFF 4ODUA 2GITB 1FNEA 1Q38A 2ADGA 5DFWH 3LDBB 4TTGA 4KK9C 4GXVH 1S7QB 1BJMA 4FTVD 4CNIB 4G9FB 3S88H 3ARGA 1MAML 4XCFH 3GI8H 2MPAL 4TUJA 4FQIL 3EOYG 4DCQA 5E6ID 3CU7A 2JJTA 4J4PD 3G9VA 4P5TC 1OD9A 1U93A 3PDDA 1PDKA 2WK2A 4OCXH 1J05A 1OW0A 4O02L 4UT7L 3TBTB 3WD5H 5ICZB 2AEQH 3BP4A 1QSFD 1T21B 2ITDB 3FCTB 1E4KC 1CGSL 5JDSA 1IAIL 3MUZ1 3CAFA 3TVMD 1MHPH 4MNGB 4D9LH 4KXZH 1MCWM 4LLDA 5DHYB 2B20A 2FD6H 5TE7L 4M43L 5KVEL 2P47B 5F7NC 3AREA 3VXMA 3HG1B 3U7WH 1GOHA 3MRRB 4JRXE 2IFFL 3QSKB 2XY1A 4PJDB 1U41A 1H5BC 2OZ4H 1JWMB 2P5WB 5H2BA 3VRIB 1YYML 5TDOA 5B39A 2H26B 4EUPH 1A4KB 3OAYH 3NMEA 4YXLL 3Q1SH 3ZMRA 3H9HA 3HFMH 1EFXA 5DI8B 1VADA 1YA5A 2FYYA 3C60C 4M6ML 1INEL 4P4RB 1IFHH 4WTZA 1NL0L 1M4KA 3L5XH 1B0GB 4XPFH 3IAPA 3RWDA 3KJ6L 4XVTH 3BP5A 3ARBD 1A7QH 1GGBL 4P2QB 1VB9A 5T5NG 5ITFB 5CD3B 4PJAA 5D7SH 2PTTB 1EBPA 1W8OA 1Z0NA 1HKFA 1A9BA 3KXFD 1YY9C 1PKQE 2W60A 1N2RA 2HTLC 4QXWA 1OTUC 2XPGA 2CGRL 1XGPA 1FRGL 3OKMB 5IB2A 4LNVA 2FZ3B 3GHEL 3AAZB 2YN5A 5JW3L 3ULVC 1P2CB 2NYYC 4W81A 3DOSA 3JTSA 2VLMD 4R2GD 3X3FH 4ZFOL 3I6KB 3F7RA 1BBDL 3BWAB 4NM4H 4XNQA 2FIKA 4LAQL 4YHZL 4IDJL 4NFCA 2Q6WB 4FQXA 3MZTA 5F93C 3RUGA 4C59B 3U7YL 1TQCC 3T1WA 1NPUA 3GJFA 4ZUTB 4H20H 3PP4L 2E27L 1N5AB 4NKIH 1UACL 1BJ8A 4G8GB 5JQ6L 5GS1C 5T5NF 2D7MA 1F8TH 2YEZB 2EDLA 3OZ9H 4QTHA 3ZKNC 4JB9H 1R24A 1CGVA 3D3VD 2BRQA 1U6AL 3JV6B 1OSPL 5DC9B 2GSIB 3PL6A 4JO2L 4IOIA 1Q1JH 2X89A 1F6LL 3MV7A 3NABH 4F7PB 4QHUB 1EXUB 1G6RB 1G7JB 2DLEA 1AC0A 4EKXA 2VZ1A 5GRYA 1E6OL 1SVZA 5C1MB 1MFEL 5FO9A 1IQWH 1CFTB 5C0RL 1BM3H 5HHME 4JJ5B 3BGFC 2VXVL 2R23B 1YEJL 5J13B 2NY0D 3QPXH 3GUTB 3UBXI 5C8JA 2VL4A 4JM2B 4QRUB 2YR3A 1HH9B 5IHUL 3K8KA 3PP3K 4M7LT 3W0WD 4KKNA 4XNXH 4R6UA 2BC4A 4DUXA 1WGOA 4LKXA 5E5MB 3K2MC 5I8CB 1LQSR 5IBUB 4OCLC 2RGSA 3JWOH 5F7EH 2F19H 3UP1A 2BZDA 5DGQA 4ZSOB 1WJ3A 2ZUUA 3ULVE 1JGLL 5DQJB 1IQDA 3KPRB 3S4SB 2ESVE 4NQVA 2X42A 3RA7L 1U91B 5KSUA 3OXRA 5D93B 4W4OC 4LHUD 1OF2B 2NY6B 1S7RB 1OWWA 3ULVF 1C5DA 4GQPH 1OP3K 2BRRH 4W6WB 3M1BA 3OV6A 4OF3A 1ZGLB 5T3ZD 4YBLC 4S1DD 3CMGA 3CZFB 3SKMA 2ZUYA 4I4WB 4G6JH 4GOSA 4KWUA 5I1KH 4ETYA 1IGYB 1F4XL 4JFXB 3MPCA 1VHPA 4WFEE 2JJUA 2DQJH 3MOAL 1AGEA 1N4XL 4NJ9H 5GSRB 5MENE 3P0YH 2QQNH 1N7ML 4XHJD 3TA3C 3TZVC 1RSFA 1DANU 2AABL 4IOSD 3RL1A 4Z7UB 2DDQH 5HYSB 1XR9A 3FFDB 1IM3B 3MX0A 4YK4B 1MAJA 1QEWA 4J3XA 4X5XA 3BKYL 4WV1B 4ZFFA 3D39A 3JTTA 4PRPB 4P2RA 3F65A 1D5BB 4O2FA 3RTQB 5J0BA 3KHQA 1Y18A 5GIRB 3VXRA 2AV1A 3RVVD 4GQ9H 4HJJH 4AH2A 4OZFB 4EVNB 3HLAA 1J0ZA 1KJVB 2B5IC 5E2UL 4WNQA 2HFGL 4MNQA 3AS0A 5C0JA 3HPLA 1F3JA 4M5ZH 1M05A 4Z5RA 5DHVB 3EGSB 4K71B 4U7KA 4YLQT 1EBAA 4H1LG 2OI9B 5JHDA 3H9YA 4FQHB 1ZTXH 2H9GB 5A1AA 1OTTD 3EJZD 3CVHA 1HHHB 4LCYA 4GKOA 4ZXBD 3FOLB 2IMMA 3L95A 5DFVD 3SDAA 3K4DA 4KJQD 1HHIA 3PG2A 1RIUL 5JXAL 2XWBB 5KJRH 4Y5XB 1M71B 3U4BH 3MJ8B 4XMLL 5A3IC 1DANT 2QQKL 2ZSWA 4LNRA 1ZWIB 5GJSL 5JOEA 4CDHA 3V79C 1MIML 3ISWA 4NOBA 5C0BA 3NTCH 4PB9L 1T0NA 4OGXH 1BX2A 3UTOA 4WFHD 2ARJA 2VE6A 5TE4L 4ZDHB 3GJFH 1Z9SA 2J6EA 4J3WA 3VXNA 3CVIH 5I0DA 5K93A 2FSEA 5I66B 1BZQK 1T2QH 4LOUC 4QHLA 2Q76B 3UYRH 1J1OL 1KIRB 3GSVB 1P69B 1U8MB 4GRWB 3HE7A 3RKDD 5GXBB 3DBXB 1FG9C 5E6IB 2V7NB 4NRYA 2AKRA 4ZUWA 5C0EA 1P1ZA 3QI9A 1XCQB 3BIKB 1ETZB 3V0VA 4NUGH 2WQRA 3LKRA 1QSFB 4OSUL 1BQUA 2WBJC 3G5XB 4MA8H 3CDYA 5L0QC 1JCKA 4K3EH 2FX8H 4FXGB 4K3DH 2WWKT 4MAUH 4QTIH 4CN1A 5DUBB 3I6LD 3QXTA 4M48L 3O6FD 3PWJB 1CF8L 2RCSH 2HT2C 1AGCA 3MRIA 3NPSC 4XNZC 4JKPH 2BNRE 5IHLB 1ZLSH 3OHXA 5E8DH 3M17B 5FV2A 4Q2ZA 5D6DA 1QLFA 3BO8A 1JYNA 3DRTA 1U3HD 3QNYA 3B9KC 5ESVA 5F1OB 4CDGC 3SCMC 3HUJE 2AQ3A 4P5KB 5FK9B 4XTRD 1P4LB 3HR6A 5TDNB 3CC5B 1IKNA 3GIVA 1UZ8A 3QIWA 3QXWA 4NNPL 1WWCA 3T65A 5DYOB 2EH8L 3HUJF 2X40A 1X5AA 1KG0B 3WXVH 4F9PC 4F37F 5GS3A 1EVUA 4U3HA 3ROLB 4HIJB 3T8XB 2ADJA 3QUMA 3GNML 1XF5A 5D70L 4YAQA 4GUPB 5DJ2A 1L0XA 1MNUL 4LLVA 3ARBB 3L7EA 5C0CA 2HJKB 5E2WH 2VLRE 4I77L 1EJ6A 5BV7H 1F58H 4OI9A 3T0VA 1BWWA 5KZCB 4LSRH 1IC7H 3KXFB 3A67L 3F58H 3QDJA 3U36B 3D2UD 4YWGL 4DZBB 3D48R 5KSBA 1IC4L 2VQ1B 2VXTH 1YEFH 2P44B 4M1CD 4XC3L 4RGNC 3S5LG 1XEDA 5EBWB 2Y36H 5DRNA 4K9EC 4R2GB 3TIEB 3MNZA 3UBXB 3FB8A 1Z6JT 4RFEB 2B4CC 3UTSB 4HEME 3MLRH 4JY5L 3QWRA 1KCSL 5EBLB 2ZUVA 4R97B 3SKOB 4NZRL 5CCKL 3SJVD 4XWOC 1REIA 3EUUA 2X4TA 2Y5TB 4NGHL 3H3PL 1JPTL 3V0AC 5JIPA 3RU8H 3WHE0 5J56B 5BMFH 1IAOA 1FGVL 2HLFD 2CUMA 4U1GB 4AIZA 2B2XL 4WWID 3ARFC 4UB0H 3H9SD 3D3VB 1VPOH 4RGMC 4D0DB 1JV5A 4ZUVB 1RIHH 5DD5H 4NHCH 1KJ3L 4TUOA 3CVHH 4L5FL 1DL7L 1T1ZA 1X6NA 3SBWA 3IKKA 4WRLA 2Q87A 4OJFL 3AM8A 3AS1A 4O4YL 1WZMA 3T2NH 3GMMB 4K7FB 3WDHA 1QYGL 2HFTA 2CIIA 2KDGA 4PJ8D 1ZVSA 5JORB 1EO5A 1UCBL 2UWEB 3SDDA 1JVKA 2VL5B 1MWAA 4QXGL 1MEXL 4PUBL 3DUUB 3PWUB 2NY0B 4MNHB 1QSEB 1S7SB 3ZYZA 4TRPL 5FUOL 1FO0H 1I85C 3FRUB 4UI2A 3W0WB 1BD2A 5TJWK 4MAYA 1GIGH 4DEPB 1T22A 3IDIA 4PLNC 2A74B 5SWQB 1IGFL 1UEYA 4ZUSB 5GGUB 3MBEA 5SWSE 1IBGH 4RCAA 2R1YA 4O58H 4RGNE 1U8IB 4WW2C 4XAWL 4OAWA 4KK6D 3LS5H 4KJPC 3NCEB 4R26L 5I16B 5IF0B 4NO2A 4P23C 3UTQB 5KANI 4OV5B 3GB7B 4QOKA 4LHUB 3OSKA 1D6VH 3F8UB 4BJLA 1IKFL 3WNNA 1M7IA 3BESR 4P9HC 3VDBA 4H8WL 1AO7A 4O2CB 4LPYA 3QEGH 1Q72L 3BN9C 4GS7C 3ZE0E 5DJCA 3NBNA 3VMPA 3FQXA 4DUWA 5GRUH 1ZSDB 1R3LA 2OJZH 1GHFH 4NO5A 5MP6L 2D7TL 2R56L 1FV1B 4NCDA 1XGUB 4QNPE 3ZE0F 1KCUH 4YDVA 3ROOA 1BQLL 4NNYA 4OB5L 4KRPC 3QEHB 3NA4A 2VUYA 1JI1A 2IADA 5KAQG 3RZCC 4QNPF 1GGIH 4TYUA 2ORBL 1G7MB 5EFIB 5CHNB 3ZHDA 5FCSH 3ALXA 3T0DA 5I1HH 3Q5YA 5C0GA 4FP8H 3QUMH 1KEML 4PP2B 5C07D 4R90L 2BMKB 1ZLUH 2L7JA 5IG7B 4LCUA 4XX1G 4N1HB 4YE4H 3SQBA 1DBAH 4B7IA 4L3EA 2CUIA 4UINH 4HMDA 3IDYB 3H42L 4PG9B 1B6UA 3SGEI 4AIOA 4JN2B 4F7MB 5ICYA 5E8PB 1UYWH 1RUMH 3EYFA 4ZXBB 2PO6C 4XMPL 3A0OA 4N8VB 3UTZA 5KAQF 3KAAA 4HG4J 5LBSL 4WCYH 3MRNA 1KXQE 1CFNB 3O3EB 5T1KB 2F8VA 1CDJA 4GSDL 4WW2F 1SY6A 2EYRB 3A6BH 4GRMA 1KB9K 4OI8A 4FFWC 4XX1E 5E9DA 2ATKA 4U4BA 3CFIC 3OR7A 4WTXA 5IW1B 2GFBA 4QRQA 4ZS7H 4CVXB 4QXTA 3FKUS 5IESH 1WIUA 4UIMA 4KKCC 4G43A 5GGVL 2YWZA 3VGBA 1B6DA 3BGMB 2GK0A 1MCQA 4OZIA 2PYEB 5FYLL 2XWJB 1H3TA 3OKOB 2D7PA 4YNYA 3NFPB 3WIHL 1AXSA 3FT2A 4APQC 3DETC 4Y2DC 2UZXB 4WU5A 2R1XA 3G08A 5D1QD 5JMRA 4G8FA 4Z7WB 4MSWA 3CX5K 4DFHA 1YYLH 3VFNB 4CVZA 1XF2A 3INUH 2OR9H 4P5TA 1A5FL 3VFGL 1U8JA 3VFMB 3MXWL 4OM0L 4XPAL 3H0TA 3O6FB 4UV7L 3PNWB 2R2BB 1FIEA 2R2HA 5CEXB 3BOVA 5DJAB 1A6AB 2WMPA 4PRBB 1MWAH 3G5YA 3IU3B 2XYCA 1EEZB 1I3UA 3T08A 5C0IA 4OCRL 2AJ3B 1LNUB 4LVHB 2Z92B 1U3HB 3UJTL 3O8XC 1C5CH 3O3DA 1XF4B 4Q9RL 2AGJH 4M1DL 4QY8B 4X6DA 3DSFH 3ULUH 3EHBC 3RDTA 4A6YL 5LWYH 2CKBA 1DN2A 3GSNA 4XHQA 3GGWA 5CBAA 5IHZB 4MCZA 5INCB 2CDGB 5KN5A 3IRZA 2VIRA 4WUKL 3WMSA 1NEZB 1QFWH 1ZS8A 2X4NB 2EDXA 1SJHA 4K3JL 1NGYB 2HG5B 1S9YB 2ENYA 3UC0L 1JF1A 4P99A 3REVB 1QLRA 1CTNA 3ABZA 3FB5B 1NFIB 5D72L 4O51A 3KLDA 2ZP0T 1DEEA 3EIFA 1JNHA 4XRCB 2R8SL 1CU4L 4M61B 3QA3A 3D2UB 1T5XB 3O2VH 5J6HA 3LKPA 4ODSH 5EDXA 2VABA 5I1DB 1SMOA 2QBWA 4ODVL 3BQUD 1U8LB 2UVFA 1LDPL 4U3CA 3CDGA 5TF0A 1CK0L 3L3JA 5DXWA 5GRZA 3EYUL 3C9NA 1R0AL 5EPMA 3T0EC 1UQSA 1XGQB 2ZOLB 1KYOJ 3N06B 4KZDH 2R1WA 3BKCL 4L8DB 4NQDE 5CBEA 2OTUB 1NBZB 3D5OF 3SJVB 3WN5B 5HGDB 5CP7B 4MVBC 5DEFA 1KC5H 4FZ8L 2YD4A 3DXAA 3KDMB 1CE6A 3BPLB 2OS7A 4X4MA 5CIPB 5C6TL 1FZKB 1YEKH 5FGBC 1C7TA 3CFDA 1OPGL 3L3IB 3MCG1 2YD2A 3H9SB 5IW3A 1MRFH 2IAMB 5LVEA 3HG1E 4GH7B 1M7DB 4J3VA 5GS1A 4NPYB 5BS0A 4MS8C 4PR5A 4UDTA 3BN3B 4PB0L 1QPPA 3U2SB 5CMAB 5TQ2H 2NNAB 1OGTB 1G9MH 2X9WA 2F9BT 4JO3L 3T0BA 1CTOA 2DJSA 3EO9H 4X99B 2WP3O 2IPKA 3MCLL 1RU9L 4EI5D 2VUOA 3QEQA 1SY6H 1PG7L 4YXHH 4PJ8B 4E41E 5HHNA 1DBMH 2P8MA 1JRHH 3AUVA 4HKBB 4U0RB 4LBEB 4YHPA 3QDGA 2Z8WC 1UVQA 4BH8A 1CZ8L 1I7RA 4HS8H 3LN9A 1K9TA 3DGCR 4PRDA 1RVFH 3S35X 1KPUA 2YKLH 1T1YA 1NGWB 2AXJA 2AXGA 4QGYA 1MLBA 1MPAL 2K9UA 1JGDA 3MODL 2ZCKL 4UTBH 2C1OB 1AIFB 3BW9A 5F9DC 4Y88A 3HZYB 2RFXA 1A9EA 2MOVA 1ORSB 1K85A 4HUWB 2CLRB 2VH5L 2X1OA 1YMHB 2CRMA 2ADIB 1KULA 5TQ0H 1RUPL 2IQ9L 5F7MC 2DRUA 3TJEH 3T0EE 2J8UA 5EWIL 3MRDB 5D2NC 3P9MB 1UWEL 3ESUF 2X4OA 5J1AB 1R5WB 2WW8A 4IIQC 5DR5H 5DRZA 3DV4A 2G9HA 3GSUB 5FUZH 2ZOKB 1EZVX 3I6GA 1L7IL 1O0VA 1G7HB 4MMZC 1BBJA 3HI1B 4EBQH 4X4XA 4GKSB 1IAKB 1OL0A 1NUGA 3NCYP 1OAKL 3BAEL 1CICA 3BUYB 3TBSB 4JFQA 4DKAA 3QXAA 1P4IH 4O2EA 4HFUH 4X6FA 4GXUN 3BHBA 2CKBH 25C8H 3GSNH 3FQWA 1DZBA 2PETA 2VQTA 4AG4L 2JELH 2P46B 5IBUG 5T3XE 4UT9H 1HN1A 3IDNB 4G42A 3ARDA 2R2CA 1OQXA 3LH2H 1T5WA 5DD3L 5C07B 1Y6KR 1UB6B 5HGHA 1ZANH 1R5IA 3D0LB 4WEBH 1FFQA 1FLTX 5C09A 5C0NC 1YZZA 3Q5OA 1IM9D 1KPRB 1GGUA 2EXWC 4Z78A 3N9GL 4PJ5B 1NDGA 4IRSD 3QAZC 1YNKL 4NCC1 3CUPB 4R96B 4C56A 5I74B 4YHYC 2A77L 2OI9C 4JEGB 2Z31C 2CDFB 5ESQA 3MUGB 1FVCB 3TO4A 3ZHLA 4ZSOE 4NQCB 3I3BA 4BYHA 3MFFB 2CDEB 2VERN 3KPRE 3RVTC 4TVPE 5C08D 4RAHA 1KV3A 2BHZA 1VGKB 2BXYA 5D2NE 4LRIA 1IVLA 4HUKB 2X4SA 2YUXA 1T1XB 1MFDH 1W8NA 5HYSG 4LRNH 3IKCB 3WSQH 3QXVA 2JJVA 2BNUB 4GRLC 2R15A 2AQ1A 2DQHL 1OWRM 4LFHG 5I8OH 3PWPD 4Z95H 4KK8D 1U95B 2GTWB 2VLRA 4Y19E 2FATH 2Z93B 5ALCH 1OM3H 3WIFB 1N64L 1JMZA 1SMAA 1VERA 5E6IC 3QDHA 3D69A 4J4PC 5KVFH 5KS9E 5I8EB 1H3PL 3FRPA 5HYJE 3QJFA 1RJLB 1HINH 3MLVL 3P9LB 3JZ7A 2WUBH 1A21A 2R69H 1BIIA 1N59B 1BFOA 1GSMA 2AEPL 5KS9F 4BFIA 3QEUA 3CXDH 1SEQL 1NUDA 1OAQL 3TVMC 4HXBH 3LD8C 4Y1AE 4BH7A 2ZSVB 3L9RB 4WDIB 3VGFA 4F57H 3MLZL 3PHQA 5F9JA 2QSCH 4PGCB 4PREB 4P57A 1NBVH 1PEWA 2G75A 4FNLL 3MA7A 1MIEH 5H37G 1MQKL 1JF6A 3IGAB 5SWZA 3VA6A 1FDLL 4Y8AA 1HSAB 1S3KH 5KVGL 4OLXH 2BNQA 4WWKD 1PSKH 2BHYA 4KGLA 1NCNA 4ELMA 3KR3L 2VDRL 4PIRF 1C16B 2XA8L 4Y5YB 2DQFB 2BOBA 1OB1A 3S36X 1MCOL 1MFBH 5E8OB 4YC2C 1UXSB 4NBYB 3B4NA 1X5LA 1Z9LA 4EN3A 5GGSB 3KPPA 3EDJA 3MROB 3G04A 5DEGB 2BSSB 5CEZL 1LE5B 4DOHE 1K5NB 2OL3A 3ARBC 3IDXL 4HJGB 1QA9B 2P24A 3KPOA 4I3RH 4OF7A 3BVNA 3O3AB 4FN0A 3V5HB 3MBXL 2HMIC 5IK3A 1CIDA 1ZHKA 1RUAH 3PGDB 4FTVE 4KTYA 4Y4HB 1BEYL 5GS2D 3FQTA 2F54A 3RNQA 3BQUB 5EO9A 5FIEA 1I1FB 4GW1B 3U30B 4RX4A 2E8YA 4JQXC 5C0DA 2H3NB 4X0KA 2OR7A 3O2WL 4R4FH 1T80A 4I5BB 2W9DH 3RWHB 1B3JA 1T4KB 2WWMD 4U1MA 3GSQB 5DJXB 1K4DA 4R2GC 1X5YA 5GRVL 1B4JH 3U82B 1QSFE 1KNOA 3QHZH 3KPQB 3MLYH 2EE6A 5CFHA 1ORQA 1TFHA 3IXTA 4NNXB 1Z9MA 4FFVC 4R97C 2ZUTA 3FB6B 5MEQB 1MCDA 4M1GL 5J12C 2VLKA 3EYOA 3KYAA 3IDGB 1DN0A 4G9DA 3KPLB 1X44A 1RZIB 2FCBA 1K4CB 4HDIB 4Z7NE 5DQDL 1Q9KA 2O61A 1NFDA 4AMKL 4R7DA 1FL6B 1ZVHA 2CLZA 2A9MH 1NC2D 2DQUL 4NWUH 1A14H 3KLAA 4Z7NF 4PRHD 1OAZL 3GSRB 3PXJA 3QCUH 2V17L 4KXZI 1DBJL 5B8CA 4WI3A 2DWDB 4KTEH 4EI5B 2R39A 3FQUB 3DUHA 4UV4H 4J3OC 5DZNA 2ED8A 3TNMB 5IFAL 2BXZA 3KGRA 5HGAA 3VDCA 4OLZL 1FFOA 5E2TL 3GBMH 3NZHL 3QUXA 2A73A 1DQLL 4YH6A 1EV2E 3ZTJG 2DLTA 3FO2B 2NY0C 3G9AB 1RZKH 3C2AH 4P2YA 5J57B 4DAGH 2I27N 1CYGA 4QHMA 1I85A 2QHRH 4MQXD 2EO9A 1OHQA 4DEPC 4GXVL 1JPGB 4NQXB 5I1CH 1TITA 5ICXA 3S88L 4Y4KC 2DKMA 3TFKD 1ROWA 4JGMA 4XCFL 3KPNA 1H3GA 4ODHH 3GI8L 5K9KB 5FECA 4PJ9D 4TTDC 1QKZH 3LN4A 1CFQA 3V4VH 3RNKA 3UTTD 1FBIH 2VLME 3NFNB 4OCXL 3WD5L 4P23A 4BKLB 2AEQL 3CX2A 3FZUD 4LMQE 2LU7A 1UGNA 4XXDB 5MERA 3OWEA 4Z77A 5D7JA 4BUGA 4BUHA 1OLZA 2XN9D 4S1DC 1PX4A 4Y5VC 2E7LC 3K8MA 1MHPL 3PQYD 4D9LL 4U1SA 3KPSA 2FD6L 2XZQH 4PJEB 1WAAE 2ZG3A 3U7WL 2NR6D 3GJEA 3ILPA 1NJ9A 2C4XA 4U05A 1D9KD 2YUWA 3LKOA 3WNMA 3PWVB 1GZQB 1ZHLB 4XHJC 2OZ4L 1YMMD 3QNXA 1IGJB 5ITBH 4I0PB 1WAAF 3F12B 2YHGA 3L3HA 4NRZB 2FO4B 2ITCA 3RZCA 3CFKB 5I73B 3F7VA 4Y2OA 2YD3A 4XCEB 3Q1SL 4MZ3A 5F3HA 5JQHC 3HFML 3VJ6B 3K74B 2HYMA 2FBJH 4Z7VE 1IFHL 3L5WB 4LQ1A 4JCMA 3RVVC 3L5XL 4AT6A 4UOW0 4XPFL 4LHUG 4KZEH 4XAKD 3RIAF 2OL3H 1IM9B 1Q0XH 4XVTL 4LAJH 1S7TA 4LLUB 2DBJA 1KIPB 4PJCE 3TESA 4Z7VF 3AXLB 1A7QL 1A8JH 7FABH 4HS6A 5H35B 1FN4B 4MB5A 5D7SL 3IDYC 1A02N 3G6DH 1W72A 2KH2B 3HZMB 3MV8D 4IRSB 5E2VH 3ZL4H 2XZCH 2FGWH 1YEGH 4U1HB 1OTTC 1UH2A 3EJZC 4PJCF 3W81A 3T0WA 1BVKA 5FF6B 3P73A 5DFVC 1IARB 3OKDA 8FABB 4KJQC 4PG2C 4OUUA 4WU7A 1NKRA 3PWNA 5C08B 1ZGLP 5JUEH 3BH9B 3SE4A 3W9DA 3X3FL 4K9EH 4NM4L 2B4CH 4JKMA 5JNYA 5AYQA 5T3ZE 1P7KA 1JWSB 4PGEB 4H20L 1WZ1L 2EEAA 3RVWD 4WW1A 4NKIL 3BP7B 1YECH 3PWPB 4KJWC 1A6TB 4KTDH 1LE9B 4G80B 3EW3B 2FL5A 3V7AG 1F8TL 3OZ9L 2GITA 5D7IB 4HV8A 3FOMB 4JB9L 4GW4A 2GK2A 1DQDH 1S7QA 3LSOB 3QDAA 1KB5B 4CNIA 4G9FA 3BE1H 1YUHB 3PP3H 1Q1JL 1UJ3B 1KOAA 3NABL 2XXMB 3F62A 5GGQH 1I1AD 1BQHA 1R3KA 4PJHB 1RIVH 5IBTH 4P4KC 1CFBA 3TBTA 2K7PA 3O6FC 1IQWL 1T21A 1BM3L 5DS8B 4ZFZB 3V7AE 5BZWB 1J86A 4NT6B 4Z18A 3FCTA 2VDPH 2V2TB 3KVQA 2JCCB 4GKZA 4YDJB 4XI5D 3QPXL 3HC0B 4MNGA 4CVUA 4LVHC 4OBSA 5DHYA 1U3HC 1ZT1B 3EDFA 1OP3H 4TNWK 4UQ2B 4XNXL 1S5HB 4GAFB 2HVJB 1J87A 4XTRC 1JHLH 3MRRA 3JWOL 1GXEA 5F7EL 2GJZB 5F96H 2F19L 4PJDA 2B0SH 3VI3E 1NCTA 5IVXB 1FG2A 2P5WA 3GKWH 2I07B 2PYFB 3VXSB 3CGTA 5CUSH 2H26A 1A4KA 4EIZC 3B9DA 4RMSA 3VI3F 1NH6A 4WFHE 3V8CA 5DI8A 5B38B 2VDKH 2BRRL 2DLIA 3HZVA 4P4RA 4QGTA 4P9HH 3N1GC 4W68A 1VFAA 5IEHB 5F6IC 1B0GA 4OFYD 1FPTH 4GG6B 4G6JL 3WKMH 6FABH 4PV9B 1RZ8B 5I1KL 4PJXB 2VLLB 4P3DA 4OF5A 5FUCC 3A6CH 4P2QA 5AZ2H 1VSCA 2DQJL 5ITFA 5CD3A 4NJ9L 2PTTA 4CRPA 4M1CC 2MCPL 3P0YL 2QQNL 4HAFA 4Z7WE 5FYJU 3QG7H 3GK8H 2DDQL 3OKMA 2WLZA 2FZ3A 4OZ4B 4DKFH 3AAZA 4DN3H 2DS4A 3G6JB 3BH8B 1P2CA 4Z7WF 1EAPB 3I6LE 3I6KA 1S7XB 2FJHB 3BWAA 3WN5C 2IAND 1NMBH 4L4VA 2Q6WA 4Z76A 4XXCA 5L2KD 3BPLC 4GQ9L 4HJJL 5HTSA 4NKQB 5CILH 1N5AA 5B21A 5I18H 2WP3T 4X5LA 4G8GA 1HQRB 1W72H 2NY5H 4Q6IB 1D5ZB 4M5ZL 1NC2B 2YEZA 5EOTB 4PRHB 4UBDD 3WS6C 2VISB 1Z9OA 3MMEA 1XF1A 1ZTXL 4X6CE 1HILB 2IH3A 5K9QG 3STZB 1J88A 2C1PB 2GSIA 5KJRL 3U4BL 2FECL 3RQ3A 4F7PA 4X6CF 2P48B 3O9WD 4PJ8C 1G6RA 1G7JA 4M4PA 3NTCL 5I30H 4OGXL 5T1LD 2Z8VC 1IGIH 1A6PA 3DROA 1G7PB 1CFTA 4OLUH 1H8SA 4JJ5A 3TH4T 2RAMA 3CVIL 3J7HA 4IMKA 1PD6A 4AEEA 4RAUB 5JPMB 3GUTA 1RHHA 3BSZH 5FUCE 3ZDZF 4JM2A 2X4PB 3UYRL 4HXAH 5L8KB 1PZUB 3HR5B 4CADB 5E5MA 4PJ9B 4NKMB 4ZPTA 3KNBA 4KK6C 1WT5A 4DVBB 1ERNA 1JPST 4OF8A 3UTTB 3IXAB 3RPKA 1E4XH 4XBGB 4BFBD 3PUCA 4XZUB 4F8QA 2PW2A 1CLOH 3N50A 3VMOA 1LEKB 4NUGL 1NANH 2YRZA 4MA8L 5DQJA 3KPRA 4M7JH 3S4SA 2IPTH 3WFBH 5FKPB 4K3EL 2FX8L 4K3DL 5D4QA 3SJVE 4RRPA 4QTIL 1OF2A 3LRGA 3X3GH 3PQYB 1S7RA 4ZOBA 4F7EB 2RCSL 1ZGLA 4JKPL 3WO4C 1ZLSL 1F4WL 5E8DL 3WFDH 3CZFA 4CVWA 1D9KB 2C3VB 2R9HD 4NYLB 1IGYA 4JFXA 5E4IA 1YMMB 4RMQA 4HH9B 4ODTH 5GSRA 2GIYA 3BIAX 5DMKB 3ZKQD 4L29A 2EIDA 3NCCB 4RFNB 3NCFB 5JDJA 1GC1H 5LG1A 3WXVL 8CGTA 4Z7UA 2AV7B 3D85B 3FFDA 1IM3A 4LLMB 1BFTA 2Z0BA 4WV1A 2OP4H 4PRPA 1JMXA 1KIUA 1D5BA 1MCEA 3RTQA 1EERB 1AGBB 5E2WL 3UZEA 2IC2A 2HT4D 4OZFA 4X80H 3MV8B 3DMMD 3GMRB 4EVNA 5BV7L 1F58L 1O7SA 2D2OA 4LSRL 1IC7L 5DJ6B 3F58L 3LCYA 3P9WB 4M02A 5IIEB 1SJEB 4PP1D 2E6QA 2QKIB 2VXTL 1YEFL 1CDHA 3EGSA 1P4BH 1V8HA 2BY3A 3OR6A 4FQHA 5BW7A 4Q7DA 3QZWA 2Y36L 2FGZA 1HHHA 5C0AD 1I3VA 3FOLA 1TNNA 4JPKH 4L8BB 3MLRL 5LGKA 4Y5XA 1ND0B 3MJ8A 5ANME 4OT1H 5ESAA 3O3UN 5ILTH 1ZWIA 5E8NB 3P40A 3QFDB 3WDJA 3MXVH 5CSZB 4ZDHA 3RU8L 1KYOK 5BMFL 3O45B 3DGGB 1N6UA 4PJFB 5JOFB 3UX9B 3SOBH 4UB0L 4ERSH 1VPOL 4QT5B 2PNDA 4QRRA 5I66A 5FYKD 2MQCA 1RIHL 3P4NB 3Q0HA 5DD5L 2Q76A 1HE7A 5D1QC 5FYLD 1KIRA 4NHCL 4JY4A 1U8MA 3CVHL 3PDGA 1FL3B 4LIQH 5EBMB 2AK4B 1QQDB 4LCWA 2V7NA 1GAFH 5MEPB 1CL7I 1XCQA 3BIKA 5EZLB 5IROC 4P5MB 3MYZA 4OGYH 3T2NL 2CK0H 3S34H 2JJWA 4LLYB 1U36A 4WUUB 1D3CA 5C07E 1QSFA 5T3XH 3G5XA 1G6RH 3ZKXB 2VAJA 1UWXK 4FXGA 5DUBA 3FB7B 2J6EL 4XNMB 3UJJH 3PWJA 1EHLH 4NDMB 4RBPK 4X9FA 4R4BB 1FO0L 3JVGC 4YJZL 2CJUH 1J1XH 5IB5B 5HHOD 3M17A 1GIGL 2ZCLH 2V5SA 1IBGL 3NVQA 5LGHH 4OI7A 3B6SB 4FQPA 4IDLA 4O58L 5DTFB 3MCKB 1KPVB 4P5KA 3LS5L 3VXPB 5TDNA 1CCZA 4M9OA 3CC5A 4GAYA 4WTWA 4PYHA 2COQA 5JHLH 2O93L 2OX5A 4GAJH 5DYOA 1MY5A 3CFBB 5FFLA 1D6VL 4B0MM 1QP1A 3TN0B 4JO1H 1NC4B 1Q9LB 1XF3A 4HIJA 5AEAA 3T8XA 2GJ6D 1CGUA 3RIFK 4H25A 3EO1B 4HPOH 4OCYH 3QEGL 5BJTA 3MRPA 3EYVB 3Q3GB 1NCCH 5GRUL 2HJKA 2OJZL 4K7PX 1GHFL 1WC7B 1PJ9A 4EDXB 5D1ZA 2Q3AA 3KXFA 1KCUL 3BQUC 4NWTH 3KS0J 4DZBA 1HKLH 12E8H 1JUFB 2R0ZH 2VQ1A 3MC0A 4LSDA 3NAAH 3ESVF 1GGIL 5A2LH 5F6HJ 3QBTB 4YR6A 3SY0B 5EBWA 1RZ7H 3TIEA 5CSBA 3UBXA 5I1HL 2C5DC 4RFEA 5F3BB 3UTSA 2IANB 4BA8A 4FP8L 3QUML 1HNGA 4W4NA 2X10A 5L2KB 5EBLA 2N1KA 1UM4L 3CIQA 4NFDA 1H0DB 3SKOA 2XKNB 1Y0LB 4YBHA 2CIKB 2Y5TA 1P6AB 4YE4L 1DBAL 1T0MB 3QRGH 2KPNA 4OZFH 1P9MA 4JFED 4UINL 4XBEH 4XP5H 1TMCB 4YPJA 1UYWL 1RUML 3D3VA 4YDIH 4YQXH 4D0DA 5DHVH 4ZUVA 1FSKC 2Y07H 4WCYL 2V9TA 1A6ZB 4EI5C 3JV5A 1JHKH 1M1SA 1YN7B 1ZV5A 3NIDE 3R06B 4UILH 4D8PB 2P5ED 3OKKB 3A6BL 3GMMA 5T1LB 3IETB 4K7FA 3ARQA 1A2YB 1KTDB 2R2EB 2XZAH 3N1PC 3SE3A 3EJJX 4AJ0A 4Y16D 4ZS7L 3NIDF 1VFBB 3EZ8A 5IESL 4YEFA 2UWEA 2VL5A 4N0UB 3PWUA 4POZD 5F9WB 4MNHA 2X1WL 1QSEA 1S7SA 1MJ8H 2F74B 3LQAH 4PJGA 1X5KA 2BY0A 3FRUA 3W0WA 2ID5A 3GDBA 4LCIH 5SWQA 2FRGP 4ZUSA 2E9JA 4GRWH 1J0JA 5IOPB 1YYLL 2L7UA 3GMQA 4NKOA 1U8IA 4FHBD 1CWVA 1CDYA 3INUL 2OR9L 2X1QA 3WJLA 2PXYD 2ZUWA 2VXQH 1I1RA 5D5MB 5I16A 5IF0A 1W0WB 3UTQA 4OV5A 3GB7A 5IQ9A 3RWIB 4KKAD 1MWAL 1X5IA 2G60H 4TSBH 2R29H 3RHWK 1F6AB 4OFVA 2CR3A 3MNVB 2G5BB 1C5CL 1ZSDA 4PJIE 2VZUA 3P4OB 5I1LB 2AGJL 3DSFL 2A6DB 3D25B 4FFZH 4PGJA 1FV1A 1HHGB 1XGUA 5EN2B 3ULUL 3FT4B 3DVGB 3QUZB 5JXEC 5LWYL 2K1MA 1GGYA 4PJIF 3B9EA 3TO2B 3VWKD 3QEHA 2WUCH 5HY9B 1UA6H 5F7WC 2QHLA 3O81A 1QFWL 5I73C 4HC1A 2QEJA 4LLAA 1G7MA 5HVHB 3HB3D 2PW1B 3QB7C 5CHNA 3WJJA 5EZJA 3RBSA 4JQIH 3UPRB 1WCQA 4PP2A 4KVCH 3DMMB 2BMKA 4BQ8A 5IG7A 1JYVA 1IC1A 3O2VL 3LRHA 3G6AA 1HXYB 4IRSC 2NY4B 4UTAH 3IJHB 4Y89A 3MTRA 4D9RD 3LN5B 5DDHB 1LILA 4XT1C 1AD9B 4JN2A 5IMKA 5C0AB 4ZXBA 2WM0A 4PJBB 3EKCA 3GHBH 4N8VA 2W0LA 4U7SA 3L1OH 3UTPD 4HBCL 2VZ3A 4GBXA 1CFNA 1RZFH 4KZDL 3O3EA 2HP4A 2I9TB 5T1KA 3SDCA 2HVKB 2B7DT 3ZTJH 2EYRA 3VD4A 1KC5L 4DW2H 1AH1A 1ADQA 3MGOB 1YEKL 4CVXA 1MRFL 2XRAH 2GCYB 1HYRC 1RULH 3AU1B 3ZTNH 3RL2B 2PYEA 3B5TA 4OLEA 4JDZB 4KROD 5E1AB 5TQ2L 2KBGA 1G9ML 1JPFB 1LO2H 2XWJA 2OBGA 3OKOA 3NFPA 5KSAB 3U48A 1YN6B 1OTUD 4PJ7B 2D31A 2ATPB 3EO9L 3IDJB 1KELH 1N3NB 3VFNA 5F6HI 4NQEE 4OZGB 1SY6L 4YXHL 1QFUH 2NYYD 1DBML 1UKSA 1JRHL 2F8OA 5D96C 3U1SH 1I7TB 3VFMA 1EMTH 3O6FA 4HS8L 3PNWA 2R2BA 2EDKA 1RVFL 5DJAA 4Z0XB 4PRBA 4ZO9A 4G5ZH 2PR4H 2YKLL 3IU3A 1EEZA 5HI4D 5HHOB 5F89B 4RAVB 4S2SB 2AJ3A 1LNUA 2Z92A 3TCLB 4UTBL 1BHGA 2M8XA 1YPZB 1XF4A 3MRJA 4WWKC 1IE5A 4QY8A 3V6OC 3LS4H 3WUWB 1T6VN 3HE6D 3HNVH 4WO4C 1MFCH 3QT2A 2J12B 5C08E 5IHZA 5TQ0L 4X7TB 4X7CC 2YMXH 3K46A 5GZND 5INCA 2CDGA 5MEND 4B5EA 3TJEL 4DTGH 1NEZA 4N8PA 5KW9H 2X4NA 3RWCB 5DR5L 1NGYA 2GJ6B 5J11C 5FUZL 4M62H 2HG5A 2XQYK 1S9YA 4S1QH 5FGCE 1LO4H 1S8DB 2H45A 5CP3A 1TJIH 3REVA 4KKLD 3KPMB 3DI2B 2FBOJ 3FB5A 1NFIA 4WHYH 3O6MH 4EBQL 4MA7H 3ZE1F 5CEZD 1MSPA 1UT9A 1V05A 1I8IB 3B5HA 4XRCA 5D7IE 1P4IL 4M61A 1W0VB 3BDYH 4OTXH 4HFUL 4IOFC 3HNTH 4HKZB 4G8IB 4HZAA 2NTFB 1S7UA 2CKBL 25C8L 3GSNL 4FQLH 5I1DA 1MFAH 1K8DA 1UJTA 5D7IF 5JW4R 2DQGH 1JNLH 1A3LH 1U8LA 2NX5E 1Q0YH 2JELL 4JHBA 1RJZB 3E2HC 4KDTA 5BOZG 4UT9L 3BI9X 4HC1H 3DVIA 1HQ4B 2VLJA 2DD8L 5KG9B 4PTTB 3LH2L 3TT1H 1XGQA 2ZOLA 4P2OC 4B53A 2OTUA 1NBZA 1ZANL 2C9AA 3CSBA 2UYLA 3KJ4B 4QRPB 3WN5A 2EDQA 2DIBA 4WEBL 5CP7A 5HGDA 1D5IH 3BZEB 2JCCE 4L4JA 1J8HB 3KDMA 4NHUB 4JFEB 2NY2D 5CIPA 1NMAH 1FZKA 3L3IA 3H9SA 3GMPB 4Q6IC 2IAMA 1DR9A 1V7MH 2JCCF 4NPYA 1JN6B 3V6OE 3PV6B 3RIFF 1YEDB 3MV01 2F53A 3U2SA 5CMAA 5IT2H 2NNAA 1OGTA 2X9YA 3W11C 5INDB 2P5EB 3TZVD 2FEEL 4JZJB 4JRYA 4X99A 3QIBB 3AGVA 2VDLH 1RUQH 1I8MA 4R0LB 1MFDL 3KHOA 4Y16B 4PJ8A 3JV0A 4HKBA 1ADQH 4LRNL 3OTTA 4LBEA 3WSQL 3U6RA 1BGXH 4GG6E 1FNLA 1DE4B 3AB0C 5I8OL 1KLGB 4Z95L 2P45B 5ISZD 4GAGH 2EE9A 1NGWA 2FB4H 2FATL 3DX6B 4UNTA 1RUKH 5ALCL 3TFKC 1OM3L 2GTZB 1MF2H 1ITBB 4JRXB 1WFOA 4KJYB 3WIHA 1QRND 3CD4A 4JFFE 1AIFA 5KVFL 3HZYA 5ACZB 1GGTA 2PXYB 1ORSA 1TZHA 5MEOB 3O0RH 4HUWA 2CLRA 1HINL 2IBBA 1YMHA 3IFNH 2ADIA 3FZUC 4OD2A 2WUBL 3T09A 1Q9OB 2R69L 2Y6SD 4ODBD 3BPNC 3CXDL 4IM8A 3MRDA 3EDDA 2IGFH 3FONB 4P3WA 1I75A 5J1AA 4HXBL 3GSUA 3MRLA 1U8OB 3TCXA 5EU6D 5KOMC 4F57L 5FAAA 2P8LA 1I4FB 1MHHA 1BQSA 1G7HA 2QSCL 4HK3N 3HI1A 4LPCA 1NBVL 3C87A 1FYHB 1DVFD 1MIEL 2NR6C 3SGJA 2NMSA 4LLQB 2FHCA 2XNAB 3LKNB 4GKSA 1IAKA 3BUYA 4ZTPH 3TBSA 4PRHE 1B0WA 5DK0B 4LOUD 1S3KL 4OLXL 1NFKA 1PSKL 1PKQB 3VWKB 4HKXB 2H32B 4PRID 2Y72A 3C8DA 5DMIH 1HDMB 4TUKH 3BZ4B 3FFCD 1MFBL 4XPTH 3LRSB 5GS0H 1EUUA 2VSCA 3IDNA 5E5UB 2CH8A 4AZ8A 2WBJD 5DMYA 4HIXH 1UB6A 4L9LC 43C9B 3ES6A 5CP3H 5JW5B 3D0LA 4I3RL 4RMTA 5FKAB 4MXVE 3DX8B 4CMMB 1X5FA 4UAOC 1NCDH 2HT2D 4I2XE 1KPRA 4AQOA 1RUAL 5ERWA 2NPLX 4LDEB 5DD6B 4HLJA 4KK5D 5EO1B 1RZGA 4PJ5A 5DZOA 4MXVF 4L3AA 4ODWB 3CUPA 5AAMA 4R96A 3ZO0A 3UTTE 1H5BB 4R4FL 3UPCA 4JM4H 2CDFA 2W9DL 3MUGA 3OPZH 1FVCA 1T04A 1F4HA 2X09A 2J88H 5FYJH 1WTGT 1B4JL 4NQCA 3MFFA 1NCWH 1RZJC 3QHZL 2WINA 5IMMB 1DBKH 1FLRH 1E4WH 2XN9E 1VGKA 1MRCH 3PQYE 1H3VA 1JHTB 3C60B 1T1XA 1IRAY 2GHWB 3R0NA 3RVWC 3UYOD 3QQ9C 3N1QC 3L3DB 3SKNA 3IKCA 3GEWB 2BNUA 2I26N 5CIPH 1R5VA 1HEZA 4XBPA 1U95A 2QSTA 4P3CH 2GTWA 3T4AB 2A9ML 1F3DJ 2Z93A 4NWUL 1XIWD 1A14L 1JPSH 2JE8A 1UADC 3WIFA 4ZYKB 3QCUL 4KTEL 2AP2A 1FVEB 1I1AC 1WBYB 5I8EA 4I18C 3VGAB 4UV4L 1RJLA 4J6RH 1NBYB 2ESVB 3GBML 4L4TD 1EH9A 3Q6GH 5HBBA 4RMWA 1MCPH 3ZKXC 2F15A 3ARYA 5JLZB 2SEBB 2BOCA 2OSLB 5GJTH 4XI5C 1RZKL 3MRKB 3MLSH 2ZSVA 2DQDH 3L9RA 4XWOD 1S7WB 3DUSB 4WDIA 4DAGL 2X5PA 4JN1H 4PGCA 4PREA 1ZT7A 3LPGA 1WITA 2QHRL 3RPIB 4AL8L 3MRFB 5I2IB 3HE6B 1E6JH 5I1CL 1J0HA 5K59E 3ZYJA 1RMFH 4ODHL 3MR9B 1HSAA 3BKJH 4JFOB 1QKZL 5MENB 2C26A 3V4VL 5J9PB 1FBIL 2VWEC 1I9RH 2H8PB 5K59F 1C16A 4Y5YA 2DQFA 3VE0B 3WFZA 2W59A 5E8OA 4FA8A 3UROR 4LLWA 1ED3B 1U8PB 2WIMA 5GGSA 4EJ1C 3MROA 5DEGA 2BSSA 1LE5A 3BGFB 1K5NA 3O4OC 4HJGA 1QA9A 2XZQL 3O3AA 3V5HA 1MCFA 4L8SC 4X6EB 4MWFB 1C1EH 1FFNA 2KUTA 1INDH 4U6XA 4LSTH 3MREB 4Y4HA 5EB9A 3VXMD 1KF9B 3BQUA 1I1FA 4GW1A 2YD1A 4HWUA 1JZ8A 4JZOB 5DD0H 4I5BA 3RWHA 1T4KA 3GSQA 5DJXA 3TGXA 4OFDA 4F33B 2FBJL 1IILE 1DFBH 3KPQA 4NNXA 1F11B 4U1JB 1EFXD 1UXWB 3K8LA 1WZKA 1A7NH 2DQCH 2O5ZH 3FB6A 4KZEL 2OL3L 1Q0XL 5CLTA 2NY2B 5AAWA 1BF8A 3U7AA 3IDGA 7FABL 3KPLA 3C6LA 3SPVB 3X11B 4RA0C 1RZIA 3G6DL 1K4CA 5E2VL 2O5YH 3ZL4L 4UBDC 2XZCL 4YBQC 2FGWL 1YEGL 1NGXB 3SDXE 5DWUH 2HTKC 1SVCP 3IFOB 4ZNEA 5JUEL 2VWEE 3GSRA 3TZVB 3WFHB 2R0LH 2DWDA 4XPGH 4MJ6B 3SDXF 4JY6B 4EI5A 3O9WC 5AG8A 4K9EL 3FQUA 3A6OA 1NCBH 2B4CL 2AXFB 1CS6A 4FQJH 3GIZH 4EDWH 3TNMA 2W65B 4OGAD 5FXCH 3SQOH 2QQLH 3THMH 4LARH 3VFSB 3HPJB 7CGTA 1EEYB 2CUHA 1YECL 4JFPB 4F7CB 4HLZH 4KTDL 5ISZB 3FO2A 5A2FA 2Q7NA 2BNRB 2AJVH 2MKWA 1Q94B 3ZZ1A 4KUCD 1QRNB 2EDRA 1DQDL 1JPGA 2HRPH 1PG7X 2YPLA 3HUJB 4NQXA 3WL9B 1VFMA 3BE1L 5K9KA 2PO6D 4P48A 4ONHA 1EZVY 3WHXB 5GGQL 1DQQB 5C9KA 4RQQB 1RIVL 3NFNA 4Z6AT 1A64A 2DOCA 5IBTL 1TPXC 3S3JA 4BKLA 3TPUB 4F8TA 4P2CG 5L2KE 4XXDA 1D5MB 4Q97A 4IRJC 4HSQA 1MRDH 4RWYH 4H8WC 2OXGA 2PTUA 2VDPL 1HHKA 1JK8A 3SDYH 1DVFB 2LFGA 1G7QB 5IFJB 1UEMA 4WI7A 3QP3A 1FYTE 3AS3A 1SM3H 2WQ8A 4PJEA 4M7KH 3LEXB 5F8QC 1C5BH 4NRXB 5F96L 2B0SL 1GZQA 1ZHLA 5FB8A 1I8LA 3GKWL 1IGJA 4I0PA 3F12A 4Y2DD 3IS1X 5CUSL 2FO4A 4MJ2A 5DJDB 3CFKA 3E6FA 4OIBA 3RY6A 4XCEA 2WBJB 3V52H 5DGRA 5L0QB 3QUYA 3VJ6A 2VDKL 4OZHE 4TSCH 3OKNA 4NQDD 5BRZA 3WKNA 4POUB 4HFWA 4P9HL 3GRWA 3L5WA 3L3OB 1BMGA 4FG6D 2HT4C 4N0UE 1FPTL 2B1HH 4NZJA 5IR1A 3WKML 3QIUD 3BYTA 5TDPB 3NPSB 4XNZB 6FABL 1C08B 4LVOC 5ACLA 4HMEA 1KIPA 3WFEH 5BVJB 4OZHF 2XKUA 3AXLA 4PP1C 3A6CL 5AZ2L 5GPRA 1JJUA 5H35A 5D1XD 5TPWH 4CBPA 2BVOA 1CDGA 2P7TB 3VWJD 3O8XD 2CR6A 3B9KB 3S5LB 3SCMB 4U1HA 3QG7L 5FF6A 3HAEA 3GK8L 4JFDA 1MAKA 5IW6B 4D3CH 1F13A 4DKFL 2X1PA 2BVQB 3BH9A 5FO8B 4DN3L 4D94A 4XPHH 5KOVC 3V6BR 4KDWA 4Y0GA 2VMFA 2FIRT 5L6YH 1NMBL 4PGZA 2NY3D 4NN6C 5C71A 2DMCA 4WY7H 4P2RD 4PGBB 1JWSA 4PGEA 5HI3D 1LK3H 4J23A 2APBA 3VXRD 1RPQA 5CILL 3TWCH 4I0KA 3BP7A 5I18L 3PWPA 1A6TA 1LE9A 4G80A 1QSZA 5CZVH 1RQ5A 5FYKU 5EA0H 1W72L 2NY5L 1PGRB 2D9CA 1XIWB 1MHEB 3U0WH 1IZJA 3FOMA 3QO1B 5SWSB 4G6FD 3RP1A 4P9MH 3LSOA 5JHDD 4RGNB 2FHBA 2YC1B 3WNOA 3O2DH 1YUHA 2H2PD 5JO5A 1ZAGA 1EX0A 1UJ3A 1UH3A 3ARTA 3SDAD 1KENH 1CLCA 2CRZA 2K7QA 4PJHA 5JMOC 1A0QH 5I30L 1ZHNB 4OKDA 1IGIL 2DIAA 3B83A 1FE8H 1FGNH 4OLUL 1DQMH 3O3BA 4PRAB 5C0BD 5DS8A 3F6IA 4ZFZA 5BZWA 4WHDA 3WS3B 4NT6A 4POYA 5KVDH 1Z3GH 2V2TA 1T83C 4YDJA 4D0BB 4XP6H 3V6ZB 3BSZL 3CX5J 4LDOB 1HNFA 1ZT1A 4HXAL 4BQBA 4RGMB 1S5HA 4Y8DC 2NY1D 1E4XL 2GJZA 3IDUA 4YHLH 5D2LE 5EULV 1CLOL 5IVXA 2RQ8A 5JOPD 3QI9D 3MJGX 3C5JB 2I07A 2PYFA 3VXSA 1S7VB 2VXSH 4M7JL 1OTSD 2IPTL 3WFBL 2MJWA 4NZDA 2ZG1A 4QHNB 5D2LF 3UMTA 3QULB 3X3GL 3FQRB 4M8VA 1UG9A 5B38A 5JDSB 4LSPH 5E6ZA 4LLDB 3WFDL 4C4KO 5IEHA 4MZ2A 3S9DB 1CDIA 3AROA 1I3RB 4PV9A 1RZ8A 2JJSA 3FAWA 1R3HB 2VLLA 2VO5A 4PJXA 5FYLE 3VXMB 3B43A 4HULB 2A6KB 4KQ3H 4ODTL 4DK3A 4U6HB 4WW2B 4F7TA 1Y6NR 5IWLC 1GC1L 3QIWD 5DRXB 3WUWG 1QFOA 3JV4B 1H3UA 4CJ0A 2ZCHH 5C7XH 5FGRA 4O00A 4OZ4A 1CI5A 2EE3A 3G6JA 3BH8A 3H9HB 3PABB 2OTPA 4TVPD 1YC8A 4XVUC 1EAPA 4QWWC 2X4UB 2BSTB 4N9GB 1S7XA 2OP4L 2FJHA 3GRWH 1WF5A 2QSQA 1EJOH 3BP5B 4GS7B 5HHOE 4X80L 5C0CD 2X70B 1MI5A 1GZPB 3BKMH 1SEBB 2HJFB 1U42A 1B88A 1V3MA 2W0FB 4LHQB 5K9OB 4CN4A 1AFVH 1HQRA 3LOWA 2X4RB 4Q6IA 1D5ZA 3QDJD 2I24N 5GHWH 1NC2A 1P4BL 5D6CB 2KKQA 2VISA 2I5YH 4DGYH 3EOAB 5IHBA 1HILA 4JPKL 4OUOA 3STZA 1JL8A 3OX8B 4DQOH 5HHQB 3TJHC 3JTSB 4OT1L 2WANA 1OCWH 4FFYH 4R0LC 5ILTL 3REWB 4E9LA 1MJUH 1AHWC 4NBZB 4P46A 3MXVL 4LFHD 4POZC 3NN8A 1G7PA 3OJDB 4LEXH 3WE6B 1TDQA 2RHEA 2XKSA 3ORJA 4LGSB 5CJXC 2VZVA 3SOBL 1UWXH 1G84A 4ERSL 4RAUA 1KJMB 5JPMA 2CXKA 3MO1B 3QXUA 4HBQA 1R24B 4P0DA 1ES0B 2ZPKH 4RBPH 1ACYH 4M6OH 1YQ2A 3HR5A 4HUUB 2PO6B 4CADA 4PJ9A 3RAJH 4NKMA 4LIQL 3HCVB 4BK5A 4DVBA 1KB5H 1GAFL 1T7WA 2Z31D 4LCCA 1Q9WB 3UTTA 3IXAA 3K81A 1KXVC 5CJQH 4AIXA 4XBGA 4CGTA 3EYSH 1MCHA 4OGYL 2CK0L 3S34L 3MJ7B 4OFPA 5T3XL 3RVTD 1CDBA 3E8UH 1G6RL 5FKPA 4KKAC 3QDMD 5FO9B 2APTA 3PQYA 1OAXH 3UJJL 4F7EA 4JFEE 5ABDE 3OAUH 1EHLL 3SDDD 2YRPA 4ZG1A 1TTFA 2CJUL 3V5DB 1J1XL 1CGWA 3HI5H 4F9LC 1KBGH 2ZCLL 1CGXA 1D9KA 1BD2D 1IAMA 2BC4B 4F37K 1NMCC 5LGHL 3L7FB 5J1TC 2C3VA 3QYCA 4NYLA 2EE2A 2VYRE 1G7IA 1YMMA 3LPWA 3VWKC 3MBED 3OJMB 4APQB 3I9GH 4Y2DB 3MFGB 4MX7B 1MFNA 1XCTA 3BPOC 3E3QC 4ETQB 3B2UD 4K7PH 2P5EE 5JHLL 5DMKA 4GAJL 4E42B 3HB3C 2W07A 3UDWA 2HLAB 4JO1L 2AV7A 3D85A 4MYWB 2DJUA 4NQDB 3B9VA 4ZO8A 5D7LE 1JZ5A 3M1BB 4HPOL 4OCYL 3QIUB 3LAFA 4KMLB 1W0YT 1IC5H 1NCCL 1AO7D 2O5XH 4CL7A 1P7QB 5D1XB 3TBVB 2Y9RT 4JHWH 3MV8A 2X41A 3GMRA 3VWJB 3O8XB 3OQ3B 5DJ6A 3GZKA 1EA9C 4NWTL 1HKLL 5CJBA 5IIEA 1SJEA 5M94B 12E8L 2R0ZL 3ZT7A 1HI6B 2YD8A 2CK2A 1T89A 3S96B 3NAAL 2YZ1A 2EYTA 3L3GB 5HJ3B 1XR9B 4C83B 1RZ7L 2E7HA 4GLRI 1MCKA 4I1NB 4L8BA 5E99H 2X2YA 5BO1H 2NY3B 2ZUSA 3MRBB 1ZGLM 4P2RB 4OF0A 4E41B 1XR8B 4O2FB 1XZ0A 4IDJH 5E8NA 5D9SB 4GG8B 3VXRB 3T2OA 1KT2B 3QFDA 3QRGL 5CSZA 1KJ2B 1ZVYA 4XBEL 2XG4A 3O45A 1ONQB 2VQUA 4L3ED 4PJFA 4WNQB 4KROC 5JOFA 4NN7B 3U9UB 2HMID 4XP5L 4KPHH 4YDIL 4G6FB 4YQXL 2Y07L 5JHDB 3P4NA 1EGJA 4RIRB 4HIHB 3TT3H 4LCYB 4LSSH 2EH7H 3E3QE 3SDAB 4QLRA 1JHKL 1FL3A 5EBMA 2AK4A 1QQDA 3VGAC 1JFQH 5MEPA 5GRXG 4UILL 3DURB 5SV3A 4P5MA 3T0EB 1ODAA 5DA4A 4WUUA 3C6SA 5C0BB 2LE9A 1KN4H 1U2CA 5CKGA 4FFVD 5DJYB 5HI4C 5DLMH 3TH2T 3FB7A 3VXNB 5T5FH 3NGBC 2MHAB 3RGVC 4XNMA 3LQAL 5E4EC 1MJ8L 5C92A 4D9RE 3JSSA 2RBLA 1HSBB 1TCRB 5IB5A 1L4IA 4LCIL 4UUJA 3MUY1 3HE6C 4XP4H 4YHIB 1KLFA 2NY1B 1A3RH 2DB8A 3B6SA 5GZNC 3UTPE 4ZUWB 5DTFA 3MCKA 1KPVA 4TVSa 4W6XB 2DMBA 3VXPA 2VXQL 5MHSD 3V0VB 3DPBA 5E2JA 1E28B 2D3VA 4YUEH 3DX7B 3CFBA 4MJ5B 3TN0A 1NC4A 2NW3B 4DKEH 4KKLC 1Q9LA 3GMOB 1A4JB 3GSOB 3WDIA 2G60L 3SE8H 1LP9E 4TSBL 4N68A 2R29L 4BELD 1CFSA 1FZJB 5EOCJ 2C3GA 3EYVA 3Q3GA 3U83A 4HKJB 5GGSY 1JYXA 3DRTB 4FFZL 4MDJB 4ZAKC 1LP9F 3C2SA 5EZOH 4XNUH 4LMQI 5ESVB 2N4IA 3X17A 1F4XH 5EIVA 4JR9H 3RDTD 1VKXA 3QUKB 1B90A 2WUCL 1JUFA 1UA6L 4Y4KD 3RFZC 1N7MH 3T65B 1AJ7H 1FFPA 4TTDD 3LVEA 5F7DB 3W9EB 3F5WA 5D71H 4ORGB 1NUFA 5F88A 3OL2A 1K2DA 4JQIL 2ADJB 5D2NB 5F3BA 2IANA 3BZDA 4IIQB 4Q0XH 1P7HL 4NCC2 4YGVB 4JKLA 4KVCL 3ZKMD 4B7LA 1VACA 2QR0B 2NY2C 1H0DA 4KHTH 1JP5A 2XKNA 5F9OH 1MCJA 1Y0LA 1A6WH 3QCVH 4ESKA 1K6QH 5E7FA 2CIKA 4A2LA 1RK1A 1T0MA 4YEEA 3T4YB 4UTAL 3QDJB 4KVNH 3VFTB 2Q8BH 4U6TA 1FJ1A 4Y19B 3B8SA 3CH1B 4HGWA 4GW5B 5KSBB 1HWHB 5GSVB 2V2XA 5HVWA 1LEIB 3RWFA 1OT2A 1DQTA 3GHBL 1HIMH 3L1OL 5KS9B 1PLGH 3SE9H 2N7AA 3VFVB 5HYJB 4X83A 1HXMA 1RZFL 1A6ZA 1RD6A 1QBMH 3FB8B 3P4MB 5FDWB 5K9JH 5E24E 1YN7A 1O7VA 4JZNB 3SO3C 4WGWB 2WBWB 1RZJH 4JO4H 4D8PA 3OKKA 1LEGB 4DW2L 2DN7A 3FQNB 3IETA 3ILQD 1PG7W 1A2YA 1KTDA 5CEZE 2R2EA 5EC2B 3U9PH 4OQ1A 3TLRA 5M95B 3DXAD 4Y1AB 3MV9E 1VFBA 3NCBB 2AJSH 2XRAL 2XI9A 1EFQA 1RULL 3LQZB 3I3EA 3BXNB 3HZKB 5LKNA 2A2QT 1LO2L 2RJMA 3QAZB 4GO6B 5EU5A 4YHYB 5I71B 1EGJH 2Z31B 2Z9TA 5DD1H 4R7NB 1TENA 5IOPA 3NFSH 1KELL 2GUOA 3F7YB 4L3CA 1IJ9A 1ITCA 2Y6SC 2CMRH 1BJ1J 4J3SA 1PVHA 1QFUL 2AJXH 3QDMB 5D5MA 3U1SL 1W0WA 3QEQD 4GMSH 2YUVA 4NZTH 3VDAA 1EMTL 4HWBA 1OARH 1INQA 4G3YH 2J5LC 2VC2H 3WEXB 2A1WH 2IH1B 3RWIA 1QR1B 4G5ZL 2PR4L 3QDGD 4DOHB 4GRLB 1DVFC 1I1YB 2ZUQC 1UCTA 1Z5LB 1SBSH 2JTDA 5C0FB 1F6AA 3KWWB 3ARZA 1ZXQA 1FO0A 5JPNB 4KJWD 3B3IA 3F7PC 3MNVA 2G5BA 1MVUB 4MD4B 3P4OA 5I1LA 1QUNA 4FTVB 3EYQC 3Q5TA 2A6DA 2E6PA 1U58B 3D25A 1J1PH 3MBEB 3HNVL 3LS4L 5EN2A 3FT4A 3DVGA 3QUZA 1MFCL 3AVEA 3PGCB 3TNNA 1RI8A 2R1YB 3OKEA 4NFBA 4X5WB 3FHAA 4XMKH 4N0FB 2YMXL 1BZ9B 5IB3A 3HC4H 3TO2A 5HY9A 4DTGL 4LPXA 2A83B 3UJIH 2E9WA 5KW9L 4I0CC 5HHPB 3W82A 2R0KH 4PBVC 1F4YH 4M62L 1BP3B 2PW1A 4S1QL 1LO4L 5IJKA 3STBA 1TJIL 4P4KD 2AI0H 4U1KB 3TVMB 3OBAA 3UPRA 3LD8B 3O6ML 5ISZE 4MA7L 1WICA 2WIIB 3PGFH 3DMMA 1R3LB 3D18B 4NO5B 4KK5C 4YIQB 3HMXA 1G1CA 3BDYL 3BISA 4OLVH 1CICD 4OTXL 1HXYA 5F7YC 1QRNE 3HNTL 1BOGB 2OTWB 4YDVB 4UIKH 4V1DD 4FQLL 1MFAL 3LN5A 2JIXA 5DDHA 2DQGL 3N1MC 3O4LE 3I2CH 3R1GH 1JNLL 1A3LL 3DVNB 5C0AA 3RJDA 1Q0YL 1QNZH 3D9AH 4PJBA 5SX4I 3P11H 5IB1B 4HC1L 2HN7B 4OFIA 1UKQA 1S9VB 1ZA3B 3TT1L 4YC2B 5IP4A 3IT8D 2I9TA 1JNNH 3NIFE 5EU6E 4EUPG 2HVKA 1D5IL 5F1IB 1A7PH 4M93B 1RFDH 3MGOA 1NMAL 5C09D 4DN4H 4DUVA 3SO5A 3NIFF 2D9QB 2GW5A 4WENB 4KMTH 3TM6A 3S37H 2GCYA 1XIWC 1NGZB 3FAXA 3AU1A 1WFNA 4PRIE 2Q86B 4HWZB 3EYFB 1CD1B 3LB6C 4JDZA 2EO1A 5E1AA 5IT2L 4C56D 2EDTA 2Y25A 3FFCE 3UTZB 3QCTH 4WI8A 5KSAA 1BFVH 1YN6A 4PJ7A 5EZIH 4LVNC 4PBXA 2ATPA 3IDJA 3GM0A 4MQSB 4LU5H 1N3NA 3MJ6A 2VDLL 4F3FB 4V2BA 1RUQL 3SGKC 3WYRA 4OZGA 5EC1B 4GRMB 2AK1H 1ADQL 1I7TA 1F6FB 1BGXL 5J12B 2YBRB 1II4E 2MQ3A 4UNVA 4Z0XA 4GAGL 1T83A 2FB4L 5EG6C 5F89A 1WTLA 4RAVA 2YWYA 5CWSB 4S2SA 5F9AC 1PKOA 1RUKL 4HS3B 2YSSB 3FN9A 1MF2L 5E00B 3TCLA 2EYSB 1YPZA 3JWOC 3ARGC 5E6YA 3D87B 5DSCB 3SHSA 4WU5B 2R1XB 1MCLA 3G08B 5L7XH 4G8FB 4MSWB 3O0RL 3OF6D 3IFNL 1HOCB 2JJTC 4C4KT 1XF2B 1RAMA 3OXSA 4X7TA 2VKXA 2EDWA 3KYMB 4JDTH 1OW0C 1UH4A 2IEPA 4AK1A 1U3YA 1LK2B 4K7PY 5K9QI 2IGFL 4MXWH 3RWCA 4HWBH 2GJ6A 1PY9A 2V5MA 4Z7VB 3RVUD 1U3JA 1HHJB 2EIZB 5H94A 2NZ9D 1S8DA 3MYJA 2FJFB 2H1PH 3KPMA 4RDQG 3FN0H 5EUOA 2LABA 4PJCB 5F8RC 1I8IA 3AREC 3O3DB 4ZTPL 1U92B 3AY4A 4W6YB 3L5JA 4HKZA 4Z7QE 4G8IA 2NTFA 1KTKE 4Y4KB 5CBAB 1A7OH 2HJLB 5DMIL 1SJXA 4TUKL 4XPTL 4L4TE 2AQ2A 4Z7QF 5GS0L 1SJHB 5C2BH 5LJYH 1AP2A 1HQ4A 5KG9A 2C3HA 1HZHH 4PTTA 2Z35B 4Q9BA 4HIXL 4XB8A 4EN3D 1FORH 3VD5A 5D8JH 3SEPA 4QRPA 4Y5VB 3PHSA 1QBLH 3BZEA 1A1NB 4RDQF 4HUXB 1J8HA 4NHUA 4U6YB 1NCDL 1N6VA 4JFEA 2VNCA 1ZK9A 1CL7H 1UC6A 4Q6YA 3GKZA 3HMXH 2ICES 3DHMA 3LKPB 5DJ8B 2VABB 2F54D 1JN6A 3PV6A 1KCVH 4JM4L 5IMOB 3OPZL 1YEDA 2J88L 3CDGB 5FYJL 4ELKB 1MLCA 4GMTH 1NCWL 4J12A 3FTGB 5INDA 1DBKL 1FLRL 1E4WL 4OGAC 4BSVB 3WO3B 4JZJA 2LU4A 1LGVA 3QIBA 5FEBA 1MRCL 1JE6A 3FMGH 1IMHC 1HCFX 3TV3H 2E9BA 4M5YH 5DF0A 2XXCB 5J6GB 4Y16A 3RI5F 3GSXB 4OLYH 4KRLB 4AENB 3TYGL 4X98B 1MHCA 3R0MA 2VLKD 3UPAA 3EOTH 1YNTB 1DE4A 4HX1B 4WTZG 5E5RB 1AKJD 1KLGA 2MSPA 4U2ZA 3VXME 4P3CL 2XFXB 3BZFB 5EU3B 5FYKH 1DDHB 3DX6A 1TZGH 4NM8H 1C12B 1JPSL 3GBLA 2GTZA 3FJTA 4MD0B 1HCVA 4JRXA 4KJYA 3PL6C 4UT6H 4GKNB 5ACZA 5TFSH 2PXYA 5MEOA 1ZLVK 4J6RL 4JPIB 2CKNA 4NKDB 1Q9OA 3Q6GL 1JGEB 1MCPL 4HT1H 2CLVB 1D5XA 5GJTL 3FONA 3QDGB 4M00A 4BH8B 1SHMA 3MLSL 2DQDL 1U8OA 3DHJA 4RGOH 1I4FA 4JN1L 4JPVH 4JQVC 2L0DA 1U8NB 1G0DA 4PJAE 1MLBB 4LLQA 2NXZD 2XNAA 3LKNA 2DWEB 1E6JL 2DL2A 1JZ4A 5E56A 2AJYH 1MQ8A 1RMFL 1O5DT 2GSGB 5DK0A 4BSWB 1A9EB 1EK3A 3BKJL 4PJAF 5HXMA 1PKQA 2VITB 3MNWA 2H32A 1GJIA 5BVPH 4Z0BH 1AY1H 1I9RL 1HDMA 1U8QB 3BZ4A 4JREB 1IEBB 4S10A 3LRSA 2V6HA 2X4OB 1FL5B 4P4KB 4JG0H 4FG6C 1CXFA 3RUGE 1ULVA 3GSWA 5D7JD 5HPMB 2D0GA 3QIUC 2FH8A 1BBJB 1J7VR 43C9A 4PPTA 5JW5A 1FC1A 1E4KA 1SBBA 5FKAA 3KPSD 3DX8A 5D1XC 3RUGF 1C1EL 4CMMA 3V5KB 3VWJC 4NO3B 5CGYD 1INDL 4LSTL 3LKSA 4V1DB 4O2EB 2ERJC 3BHBB 5EO1A 2RB8A 3IU4H 1DLHB 4ODWA 4KUCF 2D03H 4NC0B 3JWDH 1H5BA 4X6CB 5DD0L 4Q9QH 4DWHA 1UKTA 3MV7E 5MI0C 3TIDB 1CBVH 4ODXB 4ZUUB 1CLZH 4N0YH 2BX5A 4P49A 5IMMA 4F80A 3VFOB 2NY3C 1DFBL 4OFKA 1T5WB 3BEWB 1QBAA 5HGHB 2W9EH 4HUVB 4BFGA 3R8BB 2DQCL 1A7NL 2O5ZL 1S9WB 2ICCA 5HI3C 5ECJE 1CLYH 3C60A 4HCRH 2XACC 5C09B 5F6IB 3L3DA 2X7LA 4Z78B 2O5YL 3HHRB 4NN7C 4ENED 3QJHB 1QHOA 3R4DA 4IEFB 5DWUL 5E8EB 2BHUA 3K80A 2H2PC 1AXTH 1G9NH 2FWOB 3SDAC 2R0LL 4XPGL 4JKKA 1FVEA 1NCBL 4FQJL 4EDWL 3GIZL 1PQZA 3SQOL 1N8ZB 1NBYA 2ESVA 2EXYD 2H41A 2QQLL 3BYYA 3CLFH 3THML 4LARL 4PY7B 1R3IH 1T03H 3HMWH 1T20B 5JLZA 1AGFA 1QG3A 2SEBA 1NSNH 2OSLA 1QO3B 5EOQH 5FA4B 1CXKA 3DUSA 5K33A 2AJVL 2QL1A 4ONGH 1U0QA 5GZOC 3RPIA 3MRFA 5I2IA 2HRPL 2NY1C 3I3DA 1T3FB 1FFRA 5F7FA 1AGDB 3HE7C 4PRNB 4EQ3A 3D69B 4B41A 4YXKL 3QI9C 4LL9A 4JFOA 4G9FD 3IDMB 3U4EB 5MENA 5J9PA 2IWGA 1OTSC 3ZE2E 4DVRH 2BJMH 2H8PA 4HPYH 3UO1H 3NA9H 3VE0A 3D39E 3QEUB 3BMVA 2QTEA 4P2RE 1EO8H 1MRDL 5FHAH 2EDDA 3ZE2F 4RWYL 1X5ZA 3G5ZB 3VXRE 3L6FA 1U8PA 2OK0H 3SDYL 4KHXH 5F1NA 1BOYA 2HKFH 5F9JB 3ECBA 4PFEA 1F45A 3TC9A 2Q8AH 3VXQB 1VFOA 1SM3L 2AJUH 4WHTB 5D6DC 4MNQE 3O6LH 1H9VA 4M7KL 4XGZB 1B0RA 3V9FA 4F2MB 1C5BL 5JHDE 2DQIH 3IAQA 2XTJC 1SYVB 1IKNC 3QIWC 2H32H 2YN3A 3RIAK 5B3JE 5FOBB 1FAIH 4I13B 2F8XC 2P5WD 1MELA 3F6LA 1A6UH 3BMWA 3V52L 5A2IH 2DM7A 2G2RB 5B3JF 4I3SH 5C0BE 3NZ8A 5ANMB 3S3SA 4TSCL 5AWNH 3WIIH 4ZO7A 4W4OA 1F11A 4K8RD 4U1JA 1UXWA 1DUZB 4EEEA 2B1HL 4HZLB 1N6QH 1AD0B 3KS0H 4M03A 5E03A 3VGDA 3WO4B 3K3QA 3WFEL 4XCCH 3CFJA 3X11A 4H1LA 5TPWL 5F21B 5CS7A 1YEEH 4AEIH 1OSZB 1NGXA 5JXED 3KYOB 5JOPE 3OJ2C 5FHBH 1L9NA 2EEBA 1U2HA 4D3CL 3TA3A 3WFHA 2H2SC 3TZVA 1K4DB 4MA1C 2AVGA 3NIGE 4FQQB 4XPHL 4F15B 4MJ6A 3WNLA 3ALPA 2F5BH 5L6YL 2AXFA 4NQED 3FN3A 1PEZA 2DI9A 2W65A 4WY7L 3NIGF 4NQSB 4P59H 3P0VH 3LHPH 2VLKB 3EYOB 2NQCA 1DN0B 1LK3L 4L4VD 5DUMH 3VFSA 3BRGC 4WI5A 5HVFB 3HPJA 1LO3H 4JLRB 1EEYA 5DUPH 2YA0A 3TWCL 1AKJB 4JFPA 2ZUXA 3HTLX 5CZVL 2W91A 5EA0L 3BEVB 2J7LA 3OKLB 2BNRA 3ZHKA 1BF2A 2O61B 3U0WL 4M6NH 4R7DB 1T1WB 3ELAT 2XTJE 5I71C 4P9ML 3WL9A 3HUJA 2GYSA 4K2UH 3O2DL 4RMUA 3CPLA 2X9XA 1UM6H 3AM8C 1K3ZA 1RHFA 1KENL 3WHXA 3W39B 4RQQA 1A0QL 3VFPB 3ULVH 4Y4FD 1QOKA 5EUKB 3PHOB 1FE8L 1FGNL 3TPUA 1DQML 3SDDC 1D5MA 1EDQA 5IKCA 5C0CE 1KIQA 1TJHH 5KVDL 1Z3GL 1RJYB 4KMQA 1FHGA 2IBGA 2Y06H 4XP6L 3JUZA 1DVFA 1G7QA 2YD6A 2NXZB 5DMJB 5IFJA 2QLVB 3QDJE 1ZLWH 3MLWH 4V2CB 3GO1H 4MAYC 3MACH 5A40E 5KSBE 3MBEC 2HFFB 3DSNA 5D1QB 2P42B 3MGTA 3NPZB 3B2UC 4NRXA 4YHLL 3LN4B 1CFQB 5KSBF 3C09B 2D0HA 2A9NH 2VXSL 4YHOH 2NX5D 1ZA6B 5CD5D 4JFYB 1IL1B 2WBJA 3NH7H 5TGBB 4LSPL 4MA3A 2EEDA 3L3OA 1HYSD 4U1IA 5TDPA 1C08A 1QHPA 3EOBB 5BVJA 3OMZA 3MLTA 4NN5B 4KQ3L 5DZLA 2P7TA 5GGRY 1PW3A 2EECA 2VAAB 3B9KA 3S5LA 1C8PA 3SCMA 3QNXB 4X7EC 2EDBA 4WO4D 3L3HB 4UDUB 2QQQA 2VRAA 3P30H 5C7XL 2ZCHL 3F7VB 5IW6A 3QDME 1WK0A 5FO8A 3TYFA 4KQ4H 4F9PA 4EQ2A 3U4AA 1YQVH 4EXKA 3GRWL 4M93C 3CCHB 4MD5A 1DSFH 2VR5A 3I84A 1J0KA 4QXUH 5DVLA 1EJOL 4ZPVB 1QLEH 3BKML 5CLWA 3H2WA 1BD2E 2FHFA 3VGGA 4XP1H 1AFVL 4H1LH 1OP5K 3ULUE 5GHWL 1MHEA 1FZOA 3H3BC 3VI4E 1YEHH 1G9MC 5GGVY 2I5YL 3QO1A 4IOFD 5SWSA 4OUUB 1IZKA 4DGYL 1IAII 4YDKH 3ULUF 2CPCA 4JFFD 3W9DB 4DQOL 3VI4F 4QOKE 4QEGA 1F02I 1J5OH 3H9ZA 3DLQR 5HD8D 1OCWL 4FFYL 2LVCA 5JNYB 4JAMB 1MJUL 2W38A 3CDFA 1ZHNA 4CU8A 4P2OD 1AO7E 5CAYB 4UNUA 1S9XB 3PDOB 4PRAA 4LEXL 2YPKB 4D0CB 1TIUA 3CFEA 3WS3A 3L3KB 4QKXB 4D0BA 3V6ZA 1RY7B 4HV8B 1JGVH 1J11A 5DQ9B 4PJIB 1NEUA 4BQ6A 2ZPKL 3ARFA 4GW4B 1ACYL 4M6OL 3O11B 4QRRD 4PLJC 1WUNT 4WFFD 3BT2H 1KTRL 2GQHA 3RAJL 1FSKB 5IUSA 1KB5L 3EJYC 1XAUA 2VN4A 43CAA 1QFPA 1UZ6E 2NLJB 5CJQL 4LGRB 3EYSL 3P0GB 4LCWD 5AG9A 3QHFH 1BQHB 1R3KB 3W11D 3C5JA 3E8UL 3DX9B 1S7VA 2LV4A 1UZ6F 4QHNA 1OY3B 3GMNB 4U2YA 3QULA 3FQRA 1OAXL 1EEUA 2XTLA 3OAUL 4FMFA 3MA9H 5ADOH 4GKZB 4OGZA 4L3EE 3UZQA 5HYQA 3HI5L 5AUMB 1IEAA 4PY8J 3IFLH 1KBGL 1I3RA 3KYKH 1R3HA 2DYPD 2DM3A 3RDTC 3EBAA 5H8DA 1LD9B 2P8PB 3I9GL 2A6KA 1MJ7H 5HDLA 2EDNA 1FG2B 1JIBA 1Q8MA 4U6HA 4K7PL 3QG6B 4MJID 4WW2A 5ADPH 1R3JB 4JFHD 5DRXA 3KYNB 3JV4A 9CGTA 5E9DE 4OIIH 4CU7A 2CD0A 3FO9B 1NAMB 3PABA 3ZKMC 3QQ3A 4N8CH 1IAIM 4HD9A 4ZOEA 2X4UA 2BSTA 2BSRA 3HZVB 4N9GA 2MFNA 1IC5L 1VFAB 4JANB 2O5XL 3T0XA 3N0PB 3TH3T 4LSQH 5HVGB 5FO7A 3LMJH 4JHWL 4JFZH 4OZIE 2X70A 4P3DB 1GZPA 4NOFA 5J3HD 1YEIH 4KC3B 1SEBA 2HJFA 2W0FA 4HK0B 5D1ZD 3DARA 5K9OA 5KZCD 1CG9B 2X4RA 4N0RA 4NUJB 4PV8B 4OZIF 5IMLB 1S78D 3EAKA 5D6CA 2VZOA 5MHSE 5FDYA 1JZ2A 5ETUB 3EOAA 2VZSA 1TVHB 4X7FC 3N85H 5E99L 3OX8A 5BO1L</